data_6P5C
# 
_entry.id   6P5C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6P5C         
WWPDB D_1000241561 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6P5C 
_pdbx_database_status.recvd_initial_deposition_date   2019-05-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Wu, E.Y.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0002-5189-7036 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'DNA Repair (Amst.)' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1568-7856 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            89 
_citation.language                  ? 
_citation.page_first                102826 
_citation.page_last                 102826 
_citation.title                     
;The importance of Ile716 toward the mutagenicity of 8-Oxo-2'-deoxyguanosine with Bacillus fragment DNA polymerase.
;
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.dnarep.2020.102826 
_citation.pdbx_database_id_PubMed   32113909 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hamm, M.L.'          1 ? 
primary 'Garcia, A.A.'        2 ? 
primary 'Gilbert, R.'         3 ? 
primary 'Johri, M.'           4 ? 
primary 'Ricart, M.'          5 ? 
primary 'Sholes, S.L.'        6 ? 
primary 'Murray-Nerger, L.A.' 7 ? 
primary 'Wu, E.Y.'            8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6P5C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     88.217 
_cell.length_a_esd                 ? 
_cell.length_b                     93.521 
_cell.length_b_esd                 ? 
_cell.length_c                     105.279 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6P5C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*CP*GP*AP*TP*CP*AP*CP*GP*C)-3')
;
2700.788  1   ?       ?     ? ? 
2 polymer     syn 
;DNA (5'-D(P*GP*CP*GP*TP*GP*AP*TP*CP*G)-3')
;
2771.822  1   ?       ?     ? ? 
3 polymer     man 'DNA polymerase I'                           66322.086 1   2.7.7.7 I716M ? ? 
4 non-polymer syn 'SULFATE ION'                                96.063    4   ?       ?     ? ? 
5 water       nat water                                        18.015    144 ?       ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DG)(DA)(DT)(DC)(DA)(DC)(DG)(DC)' CGATCACGC B ? 
2 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DT)(DG)(DA)(DT)(DC)(DG)' GCGTGATCG C ? 
3 'polypeptide(L)'        no no 
;MAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKR
AAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIW
ELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLG
VILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGR
LSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSED
EVTPNMRRQAKAVNFGIVYGMSDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPD
ITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQA
VTLRVPLKVDYHYGSTWYDAK
;
;MAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKR
AAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIW
ELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLG
VILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGR
LSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSED
EVTPNMRRQAKAVNFGIVYGMSDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPD
ITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQA
VTLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DT  n 
1 5   DC  n 
1 6   DA  n 
1 7   DC  n 
1 8   DG  n 
1 9   DC  n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DT  n 
2 5   DG  n 
2 6   DA  n 
2 7   DT  n 
2 8   DC  n 
2 9   DG  n 
3 1   MET n 
3 2   ALA n 
3 3   LYS n 
3 4   MET n 
3 5   ALA n 
3 6   PHE n 
3 7   THR n 
3 8   LEU n 
3 9   ALA n 
3 10  ASP n 
3 11  ARG n 
3 12  VAL n 
3 13  THR n 
3 14  GLU n 
3 15  GLU n 
3 16  MET n 
3 17  LEU n 
3 18  ALA n 
3 19  ASP n 
3 20  LYS n 
3 21  ALA n 
3 22  ALA n 
3 23  LEU n 
3 24  VAL n 
3 25  VAL n 
3 26  GLU n 
3 27  VAL n 
3 28  VAL n 
3 29  GLU n 
3 30  GLU n 
3 31  ASN n 
3 32  TYR n 
3 33  HIS n 
3 34  ASP n 
3 35  ALA n 
3 36  PRO n 
3 37  ILE n 
3 38  VAL n 
3 39  GLY n 
3 40  ILE n 
3 41  ALA n 
3 42  VAL n 
3 43  VAL n 
3 44  ASN n 
3 45  GLU n 
3 46  HIS n 
3 47  GLY n 
3 48  ARG n 
3 49  PHE n 
3 50  PHE n 
3 51  LEU n 
3 52  ARG n 
3 53  PRO n 
3 54  GLU n 
3 55  THR n 
3 56  ALA n 
3 57  LEU n 
3 58  ALA n 
3 59  ASP n 
3 60  PRO n 
3 61  GLN n 
3 62  PHE n 
3 63  VAL n 
3 64  ALA n 
3 65  TRP n 
3 66  LEU n 
3 67  GLY n 
3 68  ASP n 
3 69  GLU n 
3 70  THR n 
3 71  LYS n 
3 72  LYS n 
3 73  LYS n 
3 74  SER n 
3 75  MET n 
3 76  PHE n 
3 77  ASP n 
3 78  SER n 
3 79  LYS n 
3 80  ARG n 
3 81  ALA n 
3 82  ALA n 
3 83  VAL n 
3 84  ALA n 
3 85  LEU n 
3 86  LYS n 
3 87  TRP n 
3 88  LYS n 
3 89  GLY n 
3 90  ILE n 
3 91  GLU n 
3 92  LEU n 
3 93  CYS n 
3 94  GLY n 
3 95  VAL n 
3 96  SER n 
3 97  PHE n 
3 98  ASP n 
3 99  LEU n 
3 100 LEU n 
3 101 LEU n 
3 102 ALA n 
3 103 ALA n 
3 104 TYR n 
3 105 LEU n 
3 106 LEU n 
3 107 ASP n 
3 108 PRO n 
3 109 ALA n 
3 110 GLN n 
3 111 GLY n 
3 112 VAL n 
3 113 ASP n 
3 114 ASP n 
3 115 VAL n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 ALA n 
3 120 LYS n 
3 121 MET n 
3 122 LYS n 
3 123 GLN n 
3 124 TYR n 
3 125 GLU n 
3 126 ALA n 
3 127 VAL n 
3 128 ARG n 
3 129 PRO n 
3 130 ASP n 
3 131 GLU n 
3 132 ALA n 
3 133 VAL n 
3 134 TYR n 
3 135 GLY n 
3 136 LYS n 
3 137 GLY n 
3 138 ALA n 
3 139 LYS n 
3 140 ARG n 
3 141 ALA n 
3 142 VAL n 
3 143 PRO n 
3 144 ASP n 
3 145 GLU n 
3 146 PRO n 
3 147 VAL n 
3 148 LEU n 
3 149 ALA n 
3 150 GLU n 
3 151 HIS n 
3 152 LEU n 
3 153 VAL n 
3 154 ARG n 
3 155 LYS n 
3 156 ALA n 
3 157 ALA n 
3 158 ALA n 
3 159 ILE n 
3 160 TRP n 
3 161 GLU n 
3 162 LEU n 
3 163 GLU n 
3 164 ARG n 
3 165 PRO n 
3 166 PHE n 
3 167 LEU n 
3 168 ASP n 
3 169 GLU n 
3 170 LEU n 
3 171 ARG n 
3 172 ARG n 
3 173 ASN n 
3 174 GLU n 
3 175 GLN n 
3 176 ASP n 
3 177 ARG n 
3 178 LEU n 
3 179 LEU n 
3 180 VAL n 
3 181 GLU n 
3 182 LEU n 
3 183 GLU n 
3 184 GLN n 
3 185 PRO n 
3 186 LEU n 
3 187 SER n 
3 188 SER n 
3 189 ILE n 
3 190 LEU n 
3 191 ALA n 
3 192 GLU n 
3 193 MET n 
3 194 GLU n 
3 195 PHE n 
3 196 ALA n 
3 197 GLY n 
3 198 VAL n 
3 199 LYS n 
3 200 VAL n 
3 201 ASP n 
3 202 THR n 
3 203 LYS n 
3 204 ARG n 
3 205 LEU n 
3 206 GLU n 
3 207 GLN n 
3 208 MET n 
3 209 GLY n 
3 210 LYS n 
3 211 GLU n 
3 212 LEU n 
3 213 ALA n 
3 214 GLU n 
3 215 GLN n 
3 216 LEU n 
3 217 GLY n 
3 218 THR n 
3 219 VAL n 
3 220 GLU n 
3 221 GLN n 
3 222 ARG n 
3 223 ILE n 
3 224 TYR n 
3 225 GLU n 
3 226 LEU n 
3 227 ALA n 
3 228 GLY n 
3 229 GLN n 
3 230 GLU n 
3 231 PHE n 
3 232 ASN n 
3 233 ILE n 
3 234 ASN n 
3 235 SER n 
3 236 PRO n 
3 237 LYS n 
3 238 GLN n 
3 239 LEU n 
3 240 GLY n 
3 241 VAL n 
3 242 ILE n 
3 243 LEU n 
3 244 PHE n 
3 245 GLU n 
3 246 LYS n 
3 247 LEU n 
3 248 GLN n 
3 249 LEU n 
3 250 PRO n 
3 251 VAL n 
3 252 LEU n 
3 253 LYS n 
3 254 LYS n 
3 255 THR n 
3 256 LYS n 
3 257 THR n 
3 258 GLY n 
3 259 TYR n 
3 260 SER n 
3 261 THR n 
3 262 SER n 
3 263 ALA n 
3 264 ASP n 
3 265 VAL n 
3 266 LEU n 
3 267 GLU n 
3 268 LYS n 
3 269 LEU n 
3 270 ALA n 
3 271 PRO n 
3 272 TYR n 
3 273 HIS n 
3 274 GLU n 
3 275 ILE n 
3 276 VAL n 
3 277 GLU n 
3 278 ASN n 
3 279 ILE n 
3 280 LEU n 
3 281 HIS n 
3 282 TYR n 
3 283 ARG n 
3 284 GLN n 
3 285 LEU n 
3 286 GLY n 
3 287 LYS n 
3 288 LEU n 
3 289 GLN n 
3 290 SER n 
3 291 THR n 
3 292 TYR n 
3 293 ILE n 
3 294 GLU n 
3 295 GLY n 
3 296 LEU n 
3 297 LEU n 
3 298 LYS n 
3 299 VAL n 
3 300 VAL n 
3 301 ARG n 
3 302 PRO n 
3 303 ASP n 
3 304 THR n 
3 305 LYS n 
3 306 LYS n 
3 307 VAL n 
3 308 HIS n 
3 309 THR n 
3 310 ILE n 
3 311 PHE n 
3 312 ASN n 
3 313 GLN n 
3 314 ALA n 
3 315 LEU n 
3 316 THR n 
3 317 GLN n 
3 318 THR n 
3 319 GLY n 
3 320 ARG n 
3 321 LEU n 
3 322 SER n 
3 323 SER n 
3 324 THR n 
3 325 GLU n 
3 326 PRO n 
3 327 ASN n 
3 328 LEU n 
3 329 GLN n 
3 330 ASN n 
3 331 ILE n 
3 332 PRO n 
3 333 ILE n 
3 334 ARG n 
3 335 LEU n 
3 336 GLU n 
3 337 GLU n 
3 338 GLY n 
3 339 ARG n 
3 340 LYS n 
3 341 ILE n 
3 342 ARG n 
3 343 GLN n 
3 344 ALA n 
3 345 PHE n 
3 346 VAL n 
3 347 PRO n 
3 348 SER n 
3 349 GLU n 
3 350 SER n 
3 351 ASP n 
3 352 TRP n 
3 353 LEU n 
3 354 ILE n 
3 355 PHE n 
3 356 ALA n 
3 357 ALA n 
3 358 ASP n 
3 359 TYR n 
3 360 SER n 
3 361 GLN n 
3 362 ILE n 
3 363 GLU n 
3 364 LEU n 
3 365 ARG n 
3 366 VAL n 
3 367 LEU n 
3 368 ALA n 
3 369 HIS n 
3 370 ILE n 
3 371 ALA n 
3 372 GLU n 
3 373 ASP n 
3 374 ASP n 
3 375 ASN n 
3 376 LEU n 
3 377 MET n 
3 378 GLU n 
3 379 ALA n 
3 380 PHE n 
3 381 ARG n 
3 382 ARG n 
3 383 ASP n 
3 384 LEU n 
3 385 ASP n 
3 386 ILE n 
3 387 HIS n 
3 388 THR n 
3 389 LYS n 
3 390 THR n 
3 391 ALA n 
3 392 MET n 
3 393 ASP n 
3 394 ILE n 
3 395 PHE n 
3 396 GLN n 
3 397 VAL n 
3 398 SER n 
3 399 GLU n 
3 400 ASP n 
3 401 GLU n 
3 402 VAL n 
3 403 THR n 
3 404 PRO n 
3 405 ASN n 
3 406 MET n 
3 407 ARG n 
3 408 ARG n 
3 409 GLN n 
3 410 ALA n 
3 411 LYS n 
3 412 ALA n 
3 413 VAL n 
3 414 ASN n 
3 415 PHE n 
3 416 GLY n 
3 417 ILE n 
3 418 VAL n 
3 419 TYR n 
3 420 GLY n 
3 421 MET n 
3 422 SER n 
3 423 ASP n 
3 424 TYR n 
3 425 GLY n 
3 426 LEU n 
3 427 ALA n 
3 428 GLN n 
3 429 ASN n 
3 430 LEU n 
3 431 ASN n 
3 432 ILE n 
3 433 SER n 
3 434 ARG n 
3 435 LYS n 
3 436 GLU n 
3 437 ALA n 
3 438 ALA n 
3 439 GLU n 
3 440 PHE n 
3 441 ILE n 
3 442 GLU n 
3 443 ARG n 
3 444 TYR n 
3 445 PHE n 
3 446 GLU n 
3 447 SER n 
3 448 PHE n 
3 449 PRO n 
3 450 GLY n 
3 451 VAL n 
3 452 LYS n 
3 453 ARG n 
3 454 TYR n 
3 455 MET n 
3 456 GLU n 
3 457 ASN n 
3 458 ILE n 
3 459 VAL n 
3 460 GLN n 
3 461 GLU n 
3 462 ALA n 
3 463 LYS n 
3 464 GLN n 
3 465 LYS n 
3 466 GLY n 
3 467 TYR n 
3 468 VAL n 
3 469 THR n 
3 470 THR n 
3 471 LEU n 
3 472 LEU n 
3 473 HIS n 
3 474 ARG n 
3 475 ARG n 
3 476 ARG n 
3 477 TYR n 
3 478 LEU n 
3 479 PRO n 
3 480 ASP n 
3 481 ILE n 
3 482 THR n 
3 483 SER n 
3 484 ARG n 
3 485 ASN n 
3 486 PHE n 
3 487 ASN n 
3 488 VAL n 
3 489 ARG n 
3 490 SER n 
3 491 PHE n 
3 492 ALA n 
3 493 GLU n 
3 494 ARG n 
3 495 MET n 
3 496 ALA n 
3 497 MET n 
3 498 ASN n 
3 499 THR n 
3 500 PRO n 
3 501 ILE n 
3 502 GLN n 
3 503 GLY n 
3 504 SER n 
3 505 ALA n 
3 506 ALA n 
3 507 ASP n 
3 508 ILE n 
3 509 ILE n 
3 510 LYS n 
3 511 LYS n 
3 512 ALA n 
3 513 MET n 
3 514 ILE n 
3 515 ASP n 
3 516 LEU n 
3 517 ASN n 
3 518 ALA n 
3 519 ARG n 
3 520 LEU n 
3 521 LYS n 
3 522 GLU n 
3 523 GLU n 
3 524 ARG n 
3 525 LEU n 
3 526 GLN n 
3 527 ALA n 
3 528 HIS n 
3 529 LEU n 
3 530 LEU n 
3 531 LEU n 
3 532 GLN n 
3 533 VAL n 
3 534 HIS n 
3 535 ASP n 
3 536 GLU n 
3 537 LEU n 
3 538 ILE n 
3 539 LEU n 
3 540 GLU n 
3 541 ALA n 
3 542 PRO n 
3 543 LYS n 
3 544 GLU n 
3 545 GLU n 
3 546 MET n 
3 547 GLU n 
3 548 ARG n 
3 549 LEU n 
3 550 CYS n 
3 551 ARG n 
3 552 LEU n 
3 553 VAL n 
3 554 PRO n 
3 555 GLU n 
3 556 VAL n 
3 557 MET n 
3 558 GLU n 
3 559 GLN n 
3 560 ALA n 
3 561 VAL n 
3 562 THR n 
3 563 LEU n 
3 564 ARG n 
3 565 VAL n 
3 566 PRO n 
3 567 LEU n 
3 568 LYS n 
3 569 VAL n 
3 570 ASP n 
3 571 TYR n 
3 572 HIS n 
3 573 TYR n 
3 574 GLY n 
3 575 SER n 
3 576 THR n 
3 577 TRP n 
3 578 TYR n 
3 579 ASP n 
3 580 ALA n 
3 581 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   581 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DPO1, polA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              pLysS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 9 'synthetic construct' ? 32630 ? 
2 1 sample 1 9 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6P5C         6P5C   ? 1 ? 1 
2 PDB 6P5C         6P5C   ? 2 ? 1 
3 UNP D9N168_GEOSE D9N168 ? 3 
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWEL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6P5C B 1 ? 9   ? 6P5C   21 ? 29  ? 21  29  
2 2 6P5C C 1 ? 9   ? 6P5C   6  ? 14  ? 6   14  
3 3 6P5C A 3 ? 581 ? D9N168 1  ? 579 ? 298 876 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 6P5C MET A 1   ? UNP D9N168 ?   ?   'initiating methionine' 296 1 
3 6P5C ALA A 2   ? UNP D9N168 ?   ?   'expression tag'        297 2 
3 6P5C ASP A 303 ? UNP D9N168 ALA 301 conflict                598 3 
3 6P5C VAL A 418 ? UNP D9N168 PRO 416 conflict                713 4 
3 6P5C MET A 421 ? UNP D9N168 ILE 419 'engineered mutation'   716 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6P5C 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.02 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.33 
_exptl_crystal.description                 '~0.1x0.1x0.4 mm rod' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50% saturated ammonium sulfate, 100 mM MES, 2% methylpentanediol, 10 mM magnesium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER R 4M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-03-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6P5C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 70 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       44306 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.62 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.29 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         6.36 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4436 
_reflns_shell.percent_possible_all        92.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.pdbx_Rsym_value             0.314 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -0.0100 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.0100 
_refine.B_iso_max                                130.520 
_refine.B_iso_mean                               29.5600 
_refine.B_iso_min                                9.960 
_refine.correlation_coeff_Fo_to_Fc               0.9080 
_refine.correlation_coeff_Fo_to_Fc_free          0.8600 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6P5C 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2000 
_refine.ls_d_res_low                             28.3400 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     41136 
_refine.ls_number_reflns_R_free                  2134 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.3600 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2299 
_refine.ls_R_factor_R_free                       0.2726 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2277 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1L3S 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.2600 
_refine.pdbx_overall_ESU_R_Free                  0.2190 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             5.9100 
_refine.overall_SU_ML                            0.1450 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.2000 
_refine_hist.d_res_low                        28.3400 
_refine_hist.number_atoms_solvent             144 
_refine_hist.number_atoms_total               5188 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       599 
_refine_hist.pdbx_B_iso_mean_ligand           76.48 
_refine_hist.pdbx_B_iso_mean_solvent          22.32 
_refine_hist.pdbx_number_atoms_protein        4658 
_refine_hist.pdbx_number_atoms_nucleic_acid   366 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.013  5167  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  4740  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.524  1.601  7060  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.342  1.637  10986 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 7.021  5.000  580   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 33.269 22.201 268   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 16.798 15.000 876   ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 18.854 15.000 38    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.076  0.200  664   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.020  5499  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1078  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2000 
_refine_ls_shell.d_res_low                        2.2570 
_refine_ls_shell.number_reflns_all                2620 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             133 
_refine_ls_shell.number_reflns_R_work             2487 
_refine_ls_shell.percent_reflns_obs               80.1200 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.6740 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.6630 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6P5C 
_struct.title                        'Bacillus Fragment DNA polymerase mutant I716M' 
_struct.pdbx_descriptor              'DNA polymerase I/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6P5C 
_struct_keywords.text            'Polymerase, REPLICATION, TRANSFERASE, REPLICATION-DNA complex' 
_struct_keywords.pdbx_keywords   REPLICATION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR C 13  ? ALA C 18  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  AA2 ARG C 52  ? LEU C 57  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  AA3 ASP C 59  ? ASP C 68  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  AA4 ASP C 77  ? TRP C 87  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  AA5 LEU C 99  ? ASP C 107 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  AA6 PRO C 108 ? GLY C 111 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  AA7 ASP C 114 ? MET C 121 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  AA8 PRO C 129 ? GLY C 135 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  AA9 ASP C 144 ? ASN C 173 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P10 AB1 GLN C 175 ? LEU C 182 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P11 AB2 LEU C 182 ? GLY C 197 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P12 AB3 ASP C 201 ? ALA C 227 ? ASP A 496 ALA A 522 1 ? 27 
HELX_P HELX_P13 AB4 SER C 235 ? GLU C 245 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P14 AB5 SER C 262 ? ALA C 270 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P15 AB6 PRO C 271 ? HIS C 273 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P16 AB7 GLU C 274 ? TYR C 292 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P17 AB8 TYR C 292 ? VAL C 300 ? TYR A 587 VAL A 595 1 ? 9  
HELX_P HELX_P18 AB9 LEU C 335 ? LYS C 340 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P19 AC1 ILE C 341 ? GLN C 343 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P20 AC2 GLN C 361 ? GLU C 372 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P21 AC3 ASP C 373 ? ARG C 382 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P22 AC4 ASP C 385 ? GLN C 396 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P23 AC5 SER C 398 ? VAL C 402 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P24 AC6 THR C 403 ? TYR C 419 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P25 AC7 SER C 422 ? ASN C 431 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P26 AC8 SER C 433 ? PHE C 448 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P27 AC9 PHE C 448 ? GLY C 466 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P28 AD1 PRO C 479 ? SER C 483 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P29 AD2 ASN C 485 ? GLU C 523 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P30 AD3 GLU C 545 ? ALA C 560 ? GLU A 840 ALA A 855 1 ? 16 
HELX_P HELX_P31 AD4 THR C 576 ? ALA C 580 ? THR A 871 ALA A 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 1 N3 ? ? ? 1_555 B DG 9 N1 ? ? B DC 21 C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DC 1 N4 ? ? ? 1_555 B DG 9 O6 ? ? B DC 21 C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 1 O2 ? ? ? 1_555 B DG 9 N2 ? ? B DC 21 C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 2 N1 ? ? ? 1_555 B DC 8 N3 ? ? B DG 22 C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 2 N2 ? ? ? 1_555 B DC 8 O2 ? ? B DG 22 C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 2 O6 ? ? ? 1_555 B DC 8 N4 ? ? B DG 22 C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 3 N1 ? ? ? 1_555 B DT 7 N3 ? ? B DA 23 C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 3 N6 ? ? ? 1_555 B DT 7 O4 ? ? B DA 23 C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 4 N3 ? ? ? 1_555 B DA 6 N1 ? ? B DT 24 C DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 4 O4 ? ? ? 1_555 B DA 6 N6 ? ? B DT 24 C DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5 N3 ? ? ? 1_555 B DG 5 N1 ? ? B DC 25 C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DC 5 N4 ? ? ? 1_555 B DG 5 O6 ? ? B DC 25 C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 5 O2 ? ? ? 1_555 B DG 5 N2 ? ? B DC 25 C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 6 N1 ? ? ? 1_555 B DT 4 N3 ? ? B DA 26 C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 6 N6 ? ? ? 1_555 B DT 4 O4 ? ? B DA 26 C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 7 N3 ? ? ? 1_555 B DG 3 N1 ? ? B DC 27 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 7 N4 ? ? ? 1_555 B DG 3 O6 ? ? B DC 27 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 7 O2 ? ? ? 1_555 B DG 3 N2 ? ? B DC 27 C DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 8 N1 ? ? ? 1_555 B DC 2 N3 ? ? B DG 28 C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 8 N2 ? ? ? 1_555 B DC 2 O2 ? ? B DG 28 C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 8 O6 ? ? ? 1_555 B DC 2 N4 ? ? B DG 28 C DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 9 N3 ? ? ? 1_555 B DG 1 N1 ? ? B DC 29 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 9 N4 ? ? ? 1_555 B DG 1 O6 ? ? B DC 29 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 9 O2 ? ? ? 1_555 B DG 1 N2 ? ? B DC 29 C DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           325 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    326 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR C 7   ? ALA C 9   ? THR A 302 ALA A 304 
AA1 2 GLY C 47  ? LEU C 51  ? GLY A 342 LEU A 346 
AA1 3 GLY C 39  ? ASN C 44  ? GLY A 334 ASN A 339 
AA1 4 LYS C 20  ? GLU C 26  ? LYS A 315 GLU A 321 
AA1 5 LYS C 72  ? MET C 75  ? LYS A 367 MET A 370 
AA1 6 VAL C 95  ? ASP C 98  ? VAL A 390 ASP A 393 
AA2 1 LYS C 306 ? VAL C 307 ? LYS A 601 VAL A 602 
AA2 2 VAL C 198 ? VAL C 200 ? VAL A 493 VAL A 495 
AA2 3 PHE C 345 ? VAL C 346 ? PHE A 640 VAL A 641 
AA3 1 ILE C 310 ? ASN C 312 ? ILE A 605 ASN A 607 
AA3 2 SER C 322 ? THR C 324 ? SER A 617 THR A 619 
AA4 1 HIS C 528 ? GLN C 532 ? HIS A 823 GLN A 827 
AA4 2 GLU C 536 ? PRO C 542 ? GLU A 831 PRO A 837 
AA4 3 TRP C 352 ? TYR C 359 ? TRP A 647 TYR A 654 
AA4 4 VAL C 569 ? GLY C 574 ? VAL A 864 GLY A 869 
AA5 1 TYR C 467 ? THR C 469 ? TYR A 762 THR A 764 
AA5 2 ARG C 475 ? TYR C 477 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR C 7   ? N THR A 302 O ARG C 48  ? O ARG A 343 
AA1 2 3 O PHE C 49  ? O PHE A 344 N VAL C 42  ? N VAL A 337 
AA1 3 4 O VAL C 43  ? O VAL A 338 N ALA C 22  ? N ALA A 317 
AA1 4 5 N LEU C 23  ? N LEU A 318 O SER C 74  ? O SER A 369 
AA1 5 6 N MET C 75  ? N MET A 370 O PHE C 97  ? O PHE A 392 
AA2 1 2 O VAL C 307 ? O VAL A 602 N VAL C 198 ? N VAL A 493 
AA2 2 3 N LYS C 199 ? N LYS A 494 O VAL C 346 ? O VAL A 641 
AA3 1 2 N ILE C 310 ? N ILE A 605 O THR C 324 ? O THR A 619 
AA4 1 2 N LEU C 530 ? N LEU A 825 O ILE C 538 ? O ILE A 833 
AA4 2 3 O LEU C 537 ? O LEU A 832 N ALA C 357 ? N ALA A 652 
AA4 3 4 N ALA C 356 ? N ALA A 651 O HIS C 572 ? O HIS A 867 
AA5 1 2 N VAL C 468 ? N VAL A 763 O ARG C 476 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 901 ? 3 'binding site for residue SO4 A 901' 
AC2 Software A SO4 902 ? 3 'binding site for residue SO4 A 902' 
AC3 Software A SO4 903 ? 5 'binding site for residue SO4 A 903' 
AC4 Software A SO4 904 ? 3 'binding site for residue SO4 A 904' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 GLN C 361 ? GLN A 656 . ? 1_555 ? 
2  AC1 3 ARG C 407 ? ARG A 702 . ? 1_555 ? 
3  AC1 3 LYS C 411 ? LYS A 706 . ? 1_555 ? 
4  AC2 3 HIS C 273 ? HIS A 568 . ? 2_564 ? 
5  AC2 3 ARG C 484 ? ARG A 779 . ? 3_555 ? 
6  AC2 3 ARG C 524 ? ARG A 819 . ? 1_555 ? 
7  AC3 5 MET C 1   ? MET A 296 . ? 1_555 ? 
8  AC3 5 MET C 4   ? MET A 299 . ? 1_555 ? 
9  AC3 5 ALA C 5   ? ALA A 300 . ? 1_555 ? 
10 AC3 5 ARG C 48  ? ARG A 343 . ? 1_555 ? 
11 AC3 5 ARG C 382 ? ARG A 677 . ? 3_545 ? 
12 AC4 3 SER C 350 ? SER A 645 . ? 2_565 ? 
13 AC4 3 SER C 433 ? SER A 728 . ? 1_555 ? 
14 AC4 3 ARG C 434 ? ARG A 729 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6P5C 
_atom_sites.fract_transf_matrix[1][1]   0.011336 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010693 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009499 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 27.996  19.105 24.996  1.00 93.25  ? 21   DC  B "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 27.176  19.552 26.092  1.00 96.76  ? 21   DC  B "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 27.530  18.810 27.362  1.00 97.09  ? 21   DC  B "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 28.960  18.863 27.599  1.00 95.83  ? 21   DC  B "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 26.872  19.373 28.622  1.00 90.17  ? 21   DC  B "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 26.432  18.324 29.497  1.00 80.64  ? 21   DC  B "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 27.956  20.251 29.223  1.00 90.36  ? 21   DC  B "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 29.252  19.583 28.791  1.00 90.22  ? 21   DC  B "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 30.352  20.517 28.494  1.00 87.44  ? 21   DC  B N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 31.367  20.710 29.443  1.00 83.37  ? 21   DC  B C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 31.305  20.105 30.524  1.00 76.23  ? 21   DC  B O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 32.386  21.552 29.158  1.00 79.58  ? 21   DC  B N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 32.417  22.186 27.982  1.00 85.25  ? 21   DC  B C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 33.440  23.010 27.742  1.00 82.02  ? 21   DC  B N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 31.398  22.007 27.000  1.00 84.88  ? 21   DC  B C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 30.395  21.173 27.295  1.00 84.78  ? 21   DC  B C6    1 
ATOM   17   P P     . DG  A 1 2   ? 25.390  18.641 30.702  1.00 87.59  ? 22   DG  B P     1 
ATOM   18   O OP1   . DG  A 1 2   ? 24.620  17.401 30.995  1.00 74.34  ? 22   DG  B OP1   1 
ATOM   19   O OP2   . DG  A 1 2   ? 24.648  19.891 30.370  1.00 72.14  ? 22   DG  B OP2   1 
ATOM   20   O "O5'" . DG  A 1 2   ? 26.360  18.932 31.937  1.00 84.82  ? 22   DG  B "O5'" 1 
ATOM   21   C "C5'" . DG  A 1 2   ? 26.139  18.385 33.262  1.00 79.11  ? 22   DG  B "C5'" 1 
ATOM   22   C "C4'" . DG  A 1 2   ? 26.607  19.363 34.318  1.00 72.90  ? 22   DG  B "C4'" 1 
ATOM   23   O "O4'" . DG  A 1 2   ? 27.799  20.046 33.836  1.00 71.43  ? 22   DG  B "O4'" 1 
ATOM   24   C "C3'" . DG  A 1 2   ? 25.585  20.467 34.625  1.00 69.90  ? 22   DG  B "C3'" 1 
ATOM   25   O "O3'" . DG  A 1 2   ? 25.602  21.064 35.929  1.00 66.78  ? 22   DG  B "O3'" 1 
ATOM   26   C "C2'" . DG  A 1 2   ? 26.065  21.601 33.744  1.00 66.90  ? 22   DG  B "C2'" 1 
ATOM   27   C "C1'" . DG  A 1 2   ? 27.569  21.440 33.904  1.00 64.11  ? 22   DG  B "C1'" 1 
ATOM   28   N N9    . DG  A 1 2   ? 28.387  22.109 32.895  1.00 59.22  ? 22   DG  B N9    1 
ATOM   29   C C8    . DG  A 1 2   ? 28.012  22.459 31.617  1.00 55.47  ? 22   DG  B C8    1 
ATOM   30   N N7    . DG  A 1 2   ? 28.932  23.131 30.980  1.00 52.89  ? 22   DG  B N7    1 
ATOM   31   C C5    . DG  A 1 2   ? 29.955  23.276 31.907  1.00 56.37  ? 22   DG  B C5    1 
ATOM   32   C C6    . DG  A 1 2   ? 31.213  23.920 31.792  1.00 63.46  ? 22   DG  B C6    1 
ATOM   33   O O6    . DG  A 1 2   ? 31.686  24.516 30.817  1.00 68.11  ? 22   DG  B O6    1 
ATOM   34   N N1    . DG  A 1 2   ? 31.943  23.834 32.973  1.00 61.31  ? 22   DG  B N1    1 
ATOM   35   C C2    . DG  A 1 2   ? 31.519  23.207 34.119  1.00 59.45  ? 22   DG  B C2    1 
ATOM   36   N N2    . DG  A 1 2   ? 32.370  23.236 35.153  1.00 60.27  ? 22   DG  B N2    1 
ATOM   37   N N3    . DG  A 1 2   ? 30.355  22.587 34.235  1.00 58.14  ? 22   DG  B N3    1 
ATOM   38   C C4    . DG  A 1 2   ? 29.630  22.659 33.098  1.00 56.91  ? 22   DG  B C4    1 
ATOM   39   P P     . DA  A 1 3   ? 25.361  20.226 37.281  1.00 69.38  ? 23   DA  B P     1 
ATOM   40   O OP1   . DA  A 1 3   ? 25.836  18.836 37.076  1.00 63.04  ? 23   DA  B OP1   1 
ATOM   41   O OP2   . DA  A 1 3   ? 23.971  20.480 37.752  1.00 56.80  ? 23   DA  B OP2   1 
ATOM   42   O "O5'" . DA  A 1 3   ? 26.397  20.921 38.279  1.00 68.06  ? 23   DA  B "O5'" 1 
ATOM   43   C "C5'" . DA  A 1 3   ? 27.821  20.849 38.033  1.00 60.73  ? 23   DA  B "C5'" 1 
ATOM   44   C "C4'" . DA  A 1 3   ? 28.570  21.978 38.707  1.00 63.34  ? 23   DA  B "C4'" 1 
ATOM   45   O "O4'" . DA  A 1 3   ? 29.220  22.802 37.705  1.00 58.41  ? 23   DA  B "O4'" 1 
ATOM   46   C "C3'" . DA  A 1 3   ? 27.755  22.937 39.590  1.00 61.42  ? 23   DA  B "C3'" 1 
ATOM   47   O "O3'" . DA  A 1 3   ? 28.542  23.251 40.755  1.00 61.62  ? 23   DA  B "O3'" 1 
ATOM   48   C "C2'" . DA  A 1 3   ? 27.503  24.121 38.674  1.00 56.01  ? 23   DA  B "C2'" 1 
ATOM   49   C "C1'" . DA  A 1 3   ? 28.740  24.141 37.772  1.00 55.69  ? 23   DA  B "C1'" 1 
ATOM   50   N N9    . DA  A 1 3   ? 28.496  24.600 36.400  1.00 52.90  ? 23   DA  B N9    1 
ATOM   51   C C8    . DA  A 1 3   ? 27.405  24.322 35.610  1.00 48.74  ? 23   DA  B C8    1 
ATOM   52   N N7    . DA  A 1 3   ? 27.461  24.868 34.420  1.00 47.06  ? 23   DA  B N7    1 
ATOM   53   C C5    . DA  A 1 3   ? 28.675  25.543 34.420  1.00 47.35  ? 23   DA  B C5    1 
ATOM   54   C C6    . DA  A 1 3   ? 29.315  26.329 33.450  1.00 46.53  ? 23   DA  B C6    1 
ATOM   55   N N6    . DA  A 1 3   ? 28.804  26.566 32.239  1.00 45.38  ? 23   DA  B N6    1 
ATOM   56   N N1    . DA  A 1 3   ? 30.515  26.871 33.768  1.00 49.73  ? 23   DA  B N1    1 
ATOM   57   C C2    . DA  A 1 3   ? 31.019  26.641 34.990  1.00 49.44  ? 23   DA  B C2    1 
ATOM   58   N N3    . DA  A 1 3   ? 30.506  25.924 35.990  1.00 50.36  ? 23   DA  B N3    1 
ATOM   59   C C4    . DA  A 1 3   ? 29.321  25.392 35.635  1.00 50.32  ? 23   DA  B C4    1 
ATOM   60   P P     . DT  A 1 4   ? 28.013  24.243 41.929  1.00 60.82  ? 24   DT  B P     1 
ATOM   61   O OP1   . DT  A 1 4   ? 28.700  23.830 43.185  1.00 62.10  ? 24   DT  B OP1   1 
ATOM   62   O OP2   . DT  A 1 4   ? 26.533  24.335 41.868  1.00 50.54  ? 24   DT  B OP2   1 
ATOM   63   O "O5'" . DT  A 1 4   ? 28.603  25.658 41.499  1.00 54.60  ? 24   DT  B "O5'" 1 
ATOM   64   C "C5'" . DT  A 1 4   ? 30.031  25.836 41.341  1.00 55.58  ? 24   DT  B "C5'" 1 
ATOM   65   C "C4'" . DT  A 1 4   ? 30.350  27.247 40.900  1.00 53.39  ? 24   DT  B "C4'" 1 
ATOM   66   O "O4'" . DT  A 1 4   ? 30.055  27.405 39.490  1.00 50.17  ? 24   DT  B "O4'" 1 
ATOM   67   C "C3'" . DT  A 1 4   ? 29.576  28.350 41.635  1.00 51.40  ? 24   DT  B "C3'" 1 
ATOM   68   O "O3'" . DT  A 1 4   ? 30.525  29.174 42.333  1.00 52.75  ? 24   DT  B "O3'" 1 
ATOM   69   C "C2'" . DT  A 1 4   ? 28.775  29.047 40.539  1.00 47.74  ? 24   DT  B "C2'" 1 
ATOM   70   C "C1'" . DT  A 1 4   ? 29.547  28.708 39.269  1.00 48.03  ? 24   DT  B "C1'" 1 
ATOM   71   N N1    . DT  A 1 4   ? 28.781  28.684 37.997  1.00 43.43  ? 24   DT  B N1    1 
ATOM   72   C C2    . DT  A 1 4   ? 29.376  29.208 36.872  1.00 40.22  ? 24   DT  B C2    1 
ATOM   73   O O2    . DT  A 1 4   ? 30.483  29.725 36.880  1.00 39.21  ? 24   DT  B O2    1 
ATOM   74   N N3    . DT  A 1 4   ? 28.618  29.117 35.728  1.00 40.65  ? 24   DT  B N3    1 
ATOM   75   C C4    . DT  A 1 4   ? 27.357  28.563 35.602  1.00 40.59  ? 24   DT  B C4    1 
ATOM   76   O O4    . DT  A 1 4   ? 26.804  28.546 34.506  1.00 43.75  ? 24   DT  B O4    1 
ATOM   77   C C5    . DT  A 1 4   ? 26.797  28.021 36.822  1.00 43.59  ? 24   DT  B C5    1 
ATOM   78   C C7    . DT  A 1 4   ? 25.434  27.397 36.785  1.00 42.51  ? 24   DT  B C7    1 
ATOM   79   C C6    . DT  A 1 4   ? 27.532  28.099 37.940  1.00 45.07  ? 24   DT  B C6    1 
ATOM   80   P P     . DC  A 1 5   ? 30.040  30.328 43.363  1.00 51.13  ? 25   DC  B P     1 
ATOM   81   O OP1   . DC  A 1 5   ? 31.007  30.342 44.490  1.00 58.06  ? 25   DC  B OP1   1 
ATOM   82   O OP2   . DC  A 1 5   ? 28.598  30.120 43.702  1.00 51.31  ? 25   DC  B OP2   1 
ATOM   83   O "O5'" . DC  A 1 5   ? 30.185  31.649 42.467  1.00 47.90  ? 25   DC  B "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 5   ? 31.266  31.846 41.509  1.00 50.59  ? 25   DC  B "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 5   ? 30.970  32.974 40.536  1.00 50.43  ? 25   DC  B "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 5   ? 30.231  32.473 39.392  1.00 47.70  ? 25   DC  B "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 5   ? 30.166  34.168 41.091  1.00 48.73  ? 25   DC  B "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 5   ? 30.899  35.409 41.054  1.00 40.86  ? 25   DC  B "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 5   ? 28.900  34.218 40.246  1.00 46.08  ? 25   DC  B "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 5   ? 29.262  33.432 38.990  1.00 49.24  ? 25   DC  B "C1'" 1 
ATOM   91   N N1    . DC  A 1 5   ? 28.128  32.708 38.378  1.00 44.05  ? 25   DC  B N1    1 
ATOM   92   C C2    . DC  A 1 5   ? 27.988  32.702 36.981  1.00 44.38  ? 25   DC  B C2    1 
ATOM   93   O O2    . DC  A 1 5   ? 28.835  33.298 36.289  1.00 37.47  ? 25   DC  B O2    1 
ATOM   94   N N3    . DC  A 1 5   ? 26.939  32.038 36.425  1.00 38.98  ? 25   DC  B N3    1 
ATOM   95   C C4    . DC  A 1 5   ? 26.047  31.424 37.209  1.00 41.46  ? 25   DC  B C4    1 
ATOM   96   N N4    . DC  A 1 5   ? 25.034  30.775 36.628  1.00 43.72  ? 25   DC  B N4    1 
ATOM   97   C C5    . DC  A 1 5   ? 26.168  31.420 38.628  1.00 44.36  ? 25   DC  B C5    1 
ATOM   98   C C6    . DC  A 1 5   ? 27.201  32.083 39.166  1.00 42.60  ? 25   DC  B C6    1 
ATOM   99   P P     . DA  A 1 6   ? 30.198  36.798 41.522  1.00 37.78  ? 26   DA  B P     1 
ATOM   100  O OP1   . DA  A 1 6   ? 31.267  37.694 42.081  1.00 37.64  ? 26   DA  B OP1   1 
ATOM   101  O OP2   . DA  A 1 6   ? 28.981  36.483 42.310  1.00 36.55  ? 26   DA  B OP2   1 
ATOM   102  O "O5'" . DA  A 1 6   ? 29.752  37.463 40.139  1.00 38.25  ? 26   DA  B "O5'" 1 
ATOM   103  C "C5'" . DA  A 1 6   ? 30.691  37.612 39.046  1.00 36.49  ? 26   DA  B "C5'" 1 
ATOM   104  C "C4'" . DA  A 1 6   ? 30.008  38.350 37.923  1.00 38.54  ? 26   DA  B "C4'" 1 
ATOM   105  O "O4'" . DA  A 1 6   ? 29.195  37.404 37.173  1.00 37.01  ? 26   DA  B "O4'" 1 
ATOM   106  C "C3'" . DA  A 1 6   ? 29.048  39.425 38.453  1.00 37.48  ? 26   DA  B "C3'" 1 
ATOM   107  O "O3'" . DA  A 1 6   ? 29.047  40.596 37.642  1.00 38.32  ? 26   DA  B "O3'" 1 
ATOM   108  C "C2'" . DA  A 1 6   ? 27.699  38.750 38.388  1.00 39.41  ? 26   DA  B "C2'" 1 
ATOM   109  C "C1'" . DA  A 1 6   ? 27.864  37.883 37.147  1.00 39.92  ? 26   DA  B "C1'" 1 
ATOM   110  N N9    . DA  A 1 6   ? 26.935  36.749 37.078  1.00 40.06  ? 26   DA  B N9    1 
ATOM   111  C C8    . DA  A 1 6   ? 26.389  36.026 38.113  1.00 40.65  ? 26   DA  B C8    1 
ATOM   112  N N7    . DA  A 1 6   ? 25.482  35.160 37.730  1.00 39.00  ? 26   DA  B N7    1 
ATOM   113  C C5    . DA  A 1 6   ? 25.395  35.356 36.357  1.00 37.06  ? 26   DA  B C5    1 
ATOM   114  C C6    . DA  A 1 6   ? 24.597  34.761 35.367  1.00 34.44  ? 26   DA  B C6    1 
ATOM   115  N N6    . DA  A 1 6   ? 23.722  33.784 35.611  1.00 32.49  ? 26   DA  B N6    1 
ATOM   116  N N1    . DA  A 1 6   ? 24.735  35.206 34.098  1.00 34.84  ? 26   DA  B N1    1 
ATOM   117  C C2    . DA  A 1 6   ? 25.618  36.179 33.851  1.00 34.41  ? 26   DA  B C2    1 
ATOM   118  N N3    . DA  A 1 6   ? 26.419  36.819 34.698  1.00 34.79  ? 26   DA  B N3    1 
ATOM   119  C C4    . DA  A 1 6   ? 26.259  36.353 35.949  1.00 36.50  ? 26   DA  B C4    1 
ATOM   120  P P     . DC  A 1 7   ? 28.432  41.981 38.201  1.00 37.76  ? 27   DC  B P     1 
ATOM   121  O OP1   . DC  A 1 7   ? 29.511  42.995 38.148  1.00 40.39  ? 27   DC  B OP1   1 
ATOM   122  O OP2   . DC  A 1 7   ? 27.703  41.698 39.453  1.00 42.99  ? 27   DC  B OP2   1 
ATOM   123  O "O5'" . DC  A 1 7   ? 27.201  42.282 37.221  1.00 37.91  ? 27   DC  B "O5'" 1 
ATOM   124  C "C5'" . DC  A 1 7   ? 27.471  42.849 35.941  1.00 37.01  ? 27   DC  B "C5'" 1 
ATOM   125  C "C4'" . DC  A 1 7   ? 26.343  42.577 34.979  1.00 35.14  ? 27   DC  B "C4'" 1 
ATOM   126  O "O4'" . DC  A 1 7   ? 26.194  41.167 34.764  1.00 35.97  ? 27   DC  B "O4'" 1 
ATOM   127  C "C3'" . DC  A 1 7   ? 24.954  43.013 35.406  1.00 31.76  ? 27   DC  B "C3'" 1 
ATOM   128  O "O3'" . DC  A 1 7   ? 24.748  44.417 35.284  1.00 26.14  ? 27   DC  B "O3'" 1 
ATOM   129  C "C2'" . DC  A 1 7   ? 24.104  42.236 34.423  1.00 30.51  ? 27   DC  B "C2'" 1 
ATOM   130  C "C1'" . DC  A 1 7   ? 24.875  40.926 34.282  1.00 31.21  ? 27   DC  B "C1'" 1 
ATOM   131  N N1    . DC  A 1 7   ? 24.286  39.832 35.073  1.00 27.96  ? 27   DC  B N1    1 
ATOM   132  C C2    . DC  A 1 7   ? 23.414  38.948 34.434  1.00 27.46  ? 27   DC  B C2    1 
ATOM   133  O O2    . DC  A 1 7   ? 23.227  39.066 33.209  1.00 28.05  ? 27   DC  B O2    1 
ATOM   134  N N3    . DC  A 1 7   ? 22.825  37.962 35.155  1.00 26.55  ? 27   DC  B N3    1 
ATOM   135  C C4    . DC  A 1 7   ? 23.038  37.878 36.470  1.00 25.65  ? 27   DC  B C4    1 
ATOM   136  N N4    . DC  A 1 7   ? 22.454  36.881 37.129  1.00 25.52  ? 27   DC  B N4    1 
ATOM   137  C C5    . DC  A 1 7   ? 23.890  38.794 37.158  1.00 26.76  ? 27   DC  B C5    1 
ATOM   138  C C6    . DC  A 1 7   ? 24.478  39.756 36.428  1.00 27.97  ? 27   DC  B C6    1 
ATOM   139  P P     . DG  A 1 8   ? 23.517  45.076 36.021  1.00 28.58  ? 28   DG  B P     1 
ATOM   140  O OP1   . DG  A 1 8   ? 23.610  46.559 35.853  1.00 30.80  ? 28   DG  B OP1   1 
ATOM   141  O OP2   . DG  A 1 8   ? 23.417  44.494 37.359  1.00 30.46  ? 28   DG  B OP2   1 
ATOM   142  O "O5'" . DG  A 1 8   ? 22.245  44.632 35.162  1.00 26.75  ? 28   DG  B "O5'" 1 
ATOM   143  C "C5'" . DG  A 1 8   ? 22.120  45.096 33.806  1.00 25.23  ? 28   DG  B "C5'" 1 
ATOM   144  C "C4'" . DG  A 1 8   ? 20.925  44.454 33.145  1.00 26.72  ? 28   DG  B "C4'" 1 
ATOM   145  O "O4'" . DG  A 1 8   ? 21.082  43.016 33.169  1.00 26.37  ? 28   DG  B "O4'" 1 
ATOM   146  C "C3'" . DG  A 1 8   ? 19.575  44.710 33.815  1.00 25.56  ? 28   DG  B "C3'" 1 
ATOM   147  O "O3'" . DG  A 1 8   ? 19.055  45.969 33.397  1.00 24.34  ? 28   DG  B "O3'" 1 
ATOM   148  C "C2'" . DG  A 1 8   ? 18.751  43.531 33.321  1.00 25.13  ? 28   DG  B "C2'" 1 
ATOM   149  C "C1'" . DG  A 1 8   ? 19.797  42.410 33.240  1.00 27.47  ? 28   DG  B "C1'" 1 
ATOM   150  N N9    . DG  A 1 8   ? 19.811  41.457 34.346  1.00 28.74  ? 28   DG  B N9    1 
ATOM   151  C C8    . DG  A 1 8   ? 20.627  41.448 35.455  1.00 30.84  ? 28   DG  B C8    1 
ATOM   152  N N7    . DG  A 1 8   ? 20.391  40.443 36.256  1.00 29.56  ? 28   DG  B N7    1 
ATOM   153  C C5    . DG  A 1 8   ? 19.365  39.746 35.636  1.00 30.63  ? 28   DG  B C5    1 
ATOM   154  C C6    . DG  A 1 8   ? 18.705  38.561 36.023  1.00 36.03  ? 28   DG  B C6    1 
ATOM   155  O O6    . DG  A 1 8   ? 18.895  37.875 37.034  1.00 41.68  ? 28   DG  B O6    1 
ATOM   156  N N1    . DG  A 1 8   ? 17.719  38.195 35.103  1.00 34.58  ? 28   DG  B N1    1 
ATOM   157  C C2    . DG  A 1 8   ? 17.407  38.894 33.962  1.00 33.81  ? 28   DG  B C2    1 
ATOM   158  N N2    . DG  A 1 8   ? 16.418  38.384 33.202  1.00 29.65  ? 28   DG  B N2    1 
ATOM   159  N N3    . DG  A 1 8   ? 18.054  39.983 33.566  1.00 29.41  ? 28   DG  B N3    1 
ATOM   160  C C4    . DG  A 1 8   ? 19.016  40.343 34.441  1.00 28.83  ? 28   DG  B C4    1 
ATOM   161  P P     . DC  A 1 9   ? 17.899  46.691 34.244  1.00 25.34  ? 29   DC  B P     1 
ATOM   162  O OP1   . DC  A 1 9   ? 17.656  48.003 33.630  1.00 24.54  ? 29   DC  B OP1   1 
ATOM   163  O OP2   . DC  A 1 9   ? 18.227  46.501 35.668  1.00 23.43  ? 29   DC  B OP2   1 
ATOM   164  O "O5'" . DC  A 1 9   ? 16.563  45.831 34.002  1.00 23.47  ? 29   DC  B "O5'" 1 
ATOM   165  C "C5'" . DC  A 1 9   ? 15.996  45.640 32.697  1.00 21.63  ? 29   DC  B "C5'" 1 
ATOM   166  C "C4'" . DC  A 1 9   ? 14.816  44.699 32.771  1.00 20.89  ? 29   DC  B "C4'" 1 
ATOM   167  O "O4'" . DC  A 1 9   ? 15.256  43.410 33.239  1.00 20.81  ? 29   DC  B "O4'" 1 
ATOM   168  C "C3'" . DC  A 1 9   ? 13.678  45.144 33.704  1.00 22.48  ? 29   DC  B "C3'" 1 
ATOM   169  O "O3'" . DC  A 1 9   ? 12.464  44.976 32.990  1.00 24.95  ? 29   DC  B "O3'" 1 
ATOM   170  C "C2'" . DC  A 1 9   ? 13.665  44.129 34.834  1.00 22.37  ? 29   DC  B "C2'" 1 
ATOM   171  C "C1'" . DC  A 1 9   ? 14.357  42.910 34.210  1.00 23.01  ? 29   DC  B "C1'" 1 
ATOM   172  N N1    . DC  A 1 9   ? 15.124  42.147 35.195  1.00 24.17  ? 29   DC  B N1    1 
ATOM   173  C C2    . DC  A 1 9   ? 14.700  40.864 35.530  1.00 25.03  ? 29   DC  B C2    1 
ATOM   174  O O2    . DC  A 1 9   ? 13.741  40.381 34.934  1.00 26.60  ? 29   DC  B O2    1 
ATOM   175  N N3    . DC  A 1 9   ? 15.361  40.174 36.482  1.00 28.24  ? 29   DC  B N3    1 
ATOM   176  C C4    . DC  A 1 9   ? 16.377  40.743 37.131  1.00 26.07  ? 29   DC  B C4    1 
ATOM   177  N N4    . DC  A 1 9   ? 16.999  40.027 38.073  1.00 30.42  ? 29   DC  B N4    1 
ATOM   178  C C5    . DC  A 1 9   ? 16.824  42.057 36.820  1.00 25.55  ? 29   DC  B C5    1 
ATOM   179  C C6    . DC  A 1 9   ? 16.168  42.723 35.862  1.00 25.49  ? 29   DC  B C6    1 
ATOM   180  P P     . DG  B 2 1   ? 12.713  31.041 42.519  1.00 67.95  ? 6    DG  C P     1 
ATOM   181  O OP1   . DG  B 2 1   ? 12.622  29.549 42.595  1.00 62.61  ? 6    DG  C OP1   1 
ATOM   182  O OP2   . DG  B 2 1   ? 14.051  31.705 42.539  1.00 65.61  ? 6    DG  C OP2   1 
ATOM   183  O "O5'" . DG  B 2 1   ? 11.915  31.556 41.237  1.00 42.82  ? 6    DG  C "O5'" 1 
ATOM   184  C "C5'" . DG  B 2 1   ? 10.476  31.637 41.228  1.00 33.56  ? 6    DG  C "C5'" 1 
ATOM   185  C "C4'" . DG  B 2 1   ? 10.009  32.509 40.085  1.00 31.24  ? 6    DG  C "C4'" 1 
ATOM   186  O "O4'" . DG  B 2 1   ? 10.253  33.900 40.407  1.00 30.06  ? 6    DG  C "O4'" 1 
ATOM   187  C "C3'" . DG  B 2 1   ? 10.721  32.278 38.753  1.00 28.13  ? 6    DG  C "C3'" 1 
ATOM   188  O "O3'" . DG  B 2 1   ? 10.121  31.239 37.965  1.00 25.66  ? 6    DG  C "O3'" 1 
ATOM   189  C "C2'" . DG  B 2 1   ? 10.629  33.633 38.083  1.00 27.69  ? 6    DG  C "C2'" 1 
ATOM   190  C "C1'" . DG  B 2 1   ? 10.662  34.609 39.249  1.00 28.69  ? 6    DG  C "C1'" 1 
ATOM   191  N N9    . DG  B 2 1   ? 11.992  35.145 39.495  1.00 28.98  ? 6    DG  C N9    1 
ATOM   192  C C8    . DG  B 2 1   ? 12.891  34.765 40.466  1.00 28.26  ? 6    DG  C C8    1 
ATOM   193  N N7    . DG  B 2 1   ? 14.008  35.442 40.422  1.00 30.90  ? 6    DG  C N7    1 
ATOM   194  C C5    . DG  B 2 1   ? 13.848  36.300 39.339  1.00 32.72  ? 6    DG  C C5    1 
ATOM   195  C C6    . DG  B 2 1   ? 14.729  37.277 38.800  1.00 36.29  ? 6    DG  C C6    1 
ATOM   196  O O6    . DG  B 2 1   ? 15.865  37.594 39.191  1.00 33.87  ? 6    DG  C O6    1 
ATOM   197  N N1    . DG  B 2 1   ? 14.164  37.924 37.698  1.00 36.84  ? 6    DG  C N1    1 
ATOM   198  C C2    . DG  B 2 1   ? 12.909  37.671 37.188  1.00 34.80  ? 6    DG  C C2    1 
ATOM   199  N N2    . DG  B 2 1   ? 12.536  38.417 36.127  1.00 29.28  ? 6    DG  C N2    1 
ATOM   200  N N3    . DG  B 2 1   ? 12.066  36.786 37.707  1.00 29.06  ? 6    DG  C N3    1 
ATOM   201  C C4    . DG  B 2 1   ? 12.602  36.135 38.763  1.00 30.13  ? 6    DG  C C4    1 
ATOM   202  P P     . DC  B 2 2   ? 11.039  30.423 36.917  1.00 23.71  ? 7    DC  C P     1 
ATOM   203  O OP1   . DC  B 2 2   ? 10.159  29.434 36.242  1.00 23.74  ? 7    DC  C OP1   1 
ATOM   204  O OP2   . DC  B 2 2   ? 12.257  29.994 37.612  1.00 24.52  ? 7    DC  C OP2   1 
ATOM   205  O "O5'" . DC  B 2 2   ? 11.474  31.538 35.863  1.00 25.83  ? 7    DC  C "O5'" 1 
ATOM   206  C "C5'" . DC  B 2 2   ? 10.484  32.170 35.042  1.00 23.86  ? 7    DC  C "C5'" 1 
ATOM   207  C "C4'" . DC  B 2 2   ? 11.151  33.129 34.086  1.00 24.08  ? 7    DC  C "C4'" 1 
ATOM   208  O "O4'" . DC  B 2 2   ? 11.701  34.246 34.813  1.00 26.40  ? 7    DC  C "O4'" 1 
ATOM   209  C "C3'" . DC  B 2 2   ? 12.337  32.583 33.295  1.00 22.96  ? 7    DC  C "C3'" 1 
ATOM   210  O "O3'" . DC  B 2 2   ? 11.964  31.882 32.120  1.00 20.34  ? 7    DC  C "O3'" 1 
ATOM   211  C "C2'" . DC  B 2 2   ? 13.002  33.866 32.849  1.00 24.85  ? 7    DC  C "C2'" 1 
ATOM   212  C "C1'" . DC  B 2 2   ? 12.773  34.784 34.036  1.00 27.59  ? 7    DC  C "C1'" 1 
ATOM   213  N N1    . DC  B 2 2   ? 13.956  34.940 34.903  1.00 28.13  ? 7    DC  C N1    1 
ATOM   214  C C2    . DC  B 2 2   ? 14.862  35.951 34.576  1.00 24.78  ? 7    DC  C C2    1 
ATOM   215  O O2    . DC  B 2 2   ? 14.632  36.664 33.592  1.00 24.15  ? 7    DC  C O2    1 
ATOM   216  N N3    . DC  B 2 2   ? 15.962  36.127 35.338  1.00 25.64  ? 7    DC  C N3    1 
ATOM   217  C C4    . DC  B 2 2   ? 16.157  35.365 36.414  1.00 25.59  ? 7    DC  C C4    1 
ATOM   218  N N4    . DC  B 2 2   ? 17.243  35.606 37.154  1.00 26.37  ? 7    DC  C N4    1 
ATOM   219  C C5    . DC  B 2 2   ? 15.264  34.309 36.763  1.00 27.34  ? 7    DC  C C5    1 
ATOM   220  C C6    . DC  B 2 2   ? 14.182  34.132 35.985  1.00 28.47  ? 7    DC  C C6    1 
ATOM   221  P P     . DG  B 2 3   ? 13.045  31.050 31.304  1.00 19.23  ? 8    DG  C P     1 
ATOM   222  O OP1   . DG  B 2 3   ? 12.280  30.193 30.355  1.00 18.90  ? 8    DG  C OP1   1 
ATOM   223  O OP2   . DG  B 2 3   ? 13.989  30.462 32.228  1.00 20.01  ? 8    DG  C OP2   1 
ATOM   224  O "O5'" . DG  B 2 3   ? 13.859  32.185 30.556  1.00 20.49  ? 8    DG  C "O5'" 1 
ATOM   225  C "C5'" . DG  B 2 3   ? 15.188  32.015 30.112  1.00 19.97  ? 8    DG  C "C5'" 1 
ATOM   226  C "C4'" . DG  B 2 3   ? 15.704  33.391 29.777  1.00 21.19  ? 8    DG  C "C4'" 1 
ATOM   227  O "O4'" . DG  B 2 3   ? 15.718  34.195 30.985  1.00 20.77  ? 8    DG  C "O4'" 1 
ATOM   228  C "C3'" . DG  B 2 3   ? 17.130  33.409 29.246  1.00 20.19  ? 8    DG  C "C3'" 1 
ATOM   229  O "O3'" . DG  B 2 3   ? 17.102  33.320 27.826  1.00 18.86  ? 8    DG  C "O3'" 1 
ATOM   230  C "C2'" . DG  B 2 3   ? 17.661  34.747 29.719  1.00 20.17  ? 8    DG  C "C2'" 1 
ATOM   231  C "C1'" . DG  B 2 3   ? 16.879  35.028 30.993  1.00 20.65  ? 8    DG  C "C1'" 1 
ATOM   232  N N9    . DG  B 2 3   ? 17.631  34.765 32.219  1.00 21.87  ? 8    DG  C N9    1 
ATOM   233  C C8    . DG  B 2 3   ? 17.388  33.824 33.193  1.00 21.82  ? 8    DG  C C8    1 
ATOM   234  N N7    . DG  B 2 3   ? 18.219  33.900 34.195  1.00 21.45  ? 8    DG  C N7    1 
ATOM   235  C C5    . DG  B 2 3   ? 19.049  34.965 33.871  1.00 21.75  ? 8    DG  C C5    1 
ATOM   236  C C6    . DG  B 2 3   ? 20.155  35.522 34.570  1.00 21.25  ? 8    DG  C C6    1 
ATOM   237  O O6    . DG  B 2 3   ? 20.619  35.194 35.663  1.00 21.58  ? 8    DG  C O6    1 
ATOM   238  N N1    . DG  B 2 3   ? 20.703  36.603 33.882  1.00 22.22  ? 8    DG  C N1    1 
ATOM   239  C C2    . DG  B 2 3   ? 20.256  37.074 32.672  1.00 22.31  ? 8    DG  C C2    1 
ATOM   240  N N2    . DG  B 2 3   ? 20.923  38.108 32.150  1.00 26.70  ? 8    DG  C N2    1 
ATOM   241  N N3    . DG  B 2 3   ? 19.258  36.539 31.997  1.00 22.65  ? 8    DG  C N3    1 
ATOM   242  C C4    . DG  B 2 3   ? 18.704  35.499 32.649  1.00 21.16  ? 8    DG  C C4    1 
ATOM   243  P P     . DT  B 2 4   ? 18.321  32.594 27.050  1.00 19.43  ? 9    DT  C P     1 
ATOM   244  O OP1   . DT  B 2 4   ? 17.997  32.584 25.590  1.00 19.93  ? 9    DT  C OP1   1 
ATOM   245  O OP2   . DT  B 2 4   ? 18.553  31.298 27.749  1.00 20.31  ? 9    DT  C OP2   1 
ATOM   246  O "O5'" . DT  B 2 4   ? 19.566  33.558 27.343  1.00 19.56  ? 9    DT  C "O5'" 1 
ATOM   247  C "C5'" . DT  B 2 4   ? 19.637  34.859 26.761  1.00 19.89  ? 9    DT  C "C5'" 1 
ATOM   248  C "C4'" . DT  B 2 4   ? 21.065  35.349 26.699  1.00 21.92  ? 9    DT  C "C4'" 1 
ATOM   249  O "O4'" . DT  B 2 4   ? 21.555  35.627 28.031  1.00 21.76  ? 9    DT  C "O4'" 1 
ATOM   250  C "C3'" . DT  B 2 4   ? 22.073  34.396 26.058  1.00 21.82  ? 9    DT  C "C3'" 1 
ATOM   251  O "O3'" . DT  B 2 4   ? 22.985  35.230 25.339  1.00 21.32  ? 9    DT  C "O3'" 1 
ATOM   252  C "C2'" . DT  B 2 4   ? 22.717  33.712 27.250  1.00 21.99  ? 9    DT  C "C2'" 1 
ATOM   253  C "C1'" . DT  B 2 4   ? 22.669  34.801 28.328  1.00 21.90  ? 9    DT  C "C1'" 1 
ATOM   254  N N1    . DT  B 2 4   ? 22.491  34.319 29.712  1.00 22.42  ? 9    DT  C N1    1 
ATOM   255  C C2    . DT  B 2 4   ? 23.286  34.878 30.691  1.00 20.06  ? 9    DT  C C2    1 
ATOM   256  O O2    . DT  B 2 4   ? 24.156  35.703 30.448  1.00 18.47  ? 9    DT  C O2    1 
ATOM   257  N N3    . DT  B 2 4   ? 23.038  34.419 31.961  1.00 18.58  ? 9    DT  C N3    1 
ATOM   258  C C4    . DT  B 2 4   ? 22.110  33.458 32.332  1.00 21.47  ? 9    DT  C C4    1 
ATOM   259  O O4    . DT  B 2 4   ? 22.018  33.114 33.508  1.00 20.97  ? 9    DT  C O4    1 
ATOM   260  C C5    . DT  B 2 4   ? 21.281  32.951 31.259  1.00 20.60  ? 9    DT  C C5    1 
ATOM   261  C C7    . DT  B 2 4   ? 20.265  31.897 31.567  1.00 20.07  ? 9    DT  C C7    1 
ATOM   262  C C6    . DT  B 2 4   ? 21.508  33.402 30.020  1.00 20.45  ? 9    DT  C C6    1 
ATOM   263  P P     . DG  B 2 5   ? 24.173  34.570 24.433  1.00 21.76  ? 10   DG  C P     1 
ATOM   264  O OP1   . DG  B 2 5   ? 24.502  35.558 23.372  1.00 23.89  ? 10   DG  C OP1   1 
ATOM   265  O OP2   . DG  B 2 5   ? 23.775  33.216 24.055  1.00 19.99  ? 10   DG  C OP2   1 
ATOM   266  O "O5'" . DG  B 2 5   ? 25.400  34.557 25.446  1.00 22.94  ? 10   DG  C "O5'" 1 
ATOM   267  C "C5'" . DG  B 2 5   ? 25.869  35.790 26.029  1.00 26.67  ? 10   DG  C "C5'" 1 
ATOM   268  C "C4'" . DG  B 2 5   ? 26.981  35.493 27.005  1.00 32.20  ? 10   DG  C "C4'" 1 
ATOM   269  O "O4'" . DG  B 2 5   ? 26.445  34.987 28.257  1.00 30.88  ? 10   DG  C "O4'" 1 
ATOM   270  C "C3'" . DG  B 2 5   ? 27.966  34.420 26.516  1.00 38.75  ? 10   DG  C "C3'" 1 
ATOM   271  O "O3'" . DG  B 2 5   ? 29.269  34.877 26.881  1.00 46.35  ? 10   DG  C "O3'" 1 
ATOM   272  C "C2'" . DG  B 2 5   ? 27.576  33.184 27.315  1.00 36.27  ? 10   DG  C "C2'" 1 
ATOM   273  C "C1'" . DG  B 2 5   ? 27.200  33.852 28.624  1.00 34.89  ? 10   DG  C "C1'" 1 
ATOM   274  N N9    . DG  B 2 5   ? 26.426  33.066 29.570  1.00 34.34  ? 10   DG  C N9    1 
ATOM   275  C C8    . DG  B 2 5   ? 25.431  32.154 29.305  1.00 37.74  ? 10   DG  C C8    1 
ATOM   276  N N7    . DG  B 2 5   ? 24.967  31.575 30.383  1.00 38.09  ? 10   DG  C N7    1 
ATOM   277  C C5    . DG  B 2 5   ? 25.710  32.128 31.419  1.00 38.66  ? 10   DG  C C5    1 
ATOM   278  C C6    . DG  B 2 5   ? 25.666  31.885 32.829  1.00 42.51  ? 10   DG  C C6    1 
ATOM   279  O O6    . DG  B 2 5   ? 24.926  31.112 33.462  1.00 38.08  ? 10   DG  C O6    1 
ATOM   280  N N1    . DG  B 2 5   ? 26.603  32.659 33.510  1.00 39.24  ? 10   DG  C N1    1 
ATOM   281  C C2    . DG  B 2 5   ? 27.469  33.548 32.923  1.00 38.16  ? 10   DG  C C2    1 
ATOM   282  N N2    . DG  B 2 5   ? 28.302  34.189 33.756  1.00 34.74  ? 10   DG  C N2    1 
ATOM   283  N N3    . DG  B 2 5   ? 27.522  33.784 31.615  1.00 37.68  ? 10   DG  C N3    1 
ATOM   284  C C4    . DG  B 2 5   ? 26.624  33.041 30.931  1.00 36.77  ? 10   DG  C C4    1 
ATOM   285  P P     . DA  B 2 6   ? 30.514  34.709 25.897  1.00 45.70  ? 11   DA  C P     1 
ATOM   286  O OP1   . DA  B 2 6   ? 30.449  35.770 24.861  1.00 34.26  ? 11   DA  C OP1   1 
ATOM   287  O OP2   . DA  B 2 6   ? 30.610  33.260 25.554  1.00 40.05  ? 11   DA  C OP2   1 
ATOM   288  O "O5'" . DA  B 2 6   ? 31.741  35.106 26.833  1.00 44.81  ? 11   DA  C "O5'" 1 
ATOM   289  C "C5'" . DA  B 2 6   ? 31.600  36.039 27.911  1.00 43.07  ? 11   DA  C "C5'" 1 
ATOM   290  C "C4'" . DA  B 2 6   ? 32.518  35.644 29.044  1.00 47.24  ? 11   DA  C "C4'" 1 
ATOM   291  O "O4'" . DA  B 2 6   ? 31.805  34.901 30.072  1.00 43.99  ? 11   DA  C "O4'" 1 
ATOM   292  C "C3'" . DA  B 2 6   ? 33.703  34.773 28.622  1.00 44.94  ? 11   DA  C "C3'" 1 
ATOM   293  O "O3'" . DA  B 2 6   ? 34.870  35.255 29.294  1.00 50.58  ? 11   DA  C "O3'" 1 
ATOM   294  C "C2'" . DA  B 2 6   ? 33.262  33.368 29.003  1.00 45.48  ? 11   DA  C "C2'" 1 
ATOM   295  C "C1'" . DA  B 2 6   ? 32.362  33.595 30.220  1.00 42.71  ? 11   DA  C "C1'" 1 
ATOM   296  N N9    . DA  B 2 6   ? 31.250  32.650 30.341  1.00 39.19  ? 11   DA  C N9    1 
ATOM   297  C C8    . DA  B 2 6   ? 30.430  32.177 29.344  1.00 37.12  ? 11   DA  C C8    1 
ATOM   298  N N7    . DA  B 2 6   ? 29.493  31.364 29.772  1.00 38.21  ? 11   DA  C N7    1 
ATOM   299  C C5    . DA  B 2 6   ? 29.732  31.266 31.136  1.00 34.15  ? 11   DA  C C5    1 
ATOM   300  C C6    . DA  B 2 6   ? 29.082  30.559 32.164  1.00 34.82  ? 11   DA  C C6    1 
ATOM   301  N N6    . DA  B 2 6   ? 28.029  29.761 31.968  1.00 33.29  ? 11   DA  C N6    1 
ATOM   302  N N1    . DA  B 2 6   ? 29.559  30.698 33.421  1.00 36.43  ? 11   DA  C N1    1 
ATOM   303  C C2    . DA  B 2 6   ? 30.609  31.504 33.621  1.00 38.75  ? 11   DA  C C2    1 
ATOM   304  N N3    . DA  B 2 6   ? 31.300  32.226 32.738  1.00 35.31  ? 11   DA  C N3    1 
ATOM   305  C C4    . DA  B 2 6   ? 30.806  32.060 31.501  1.00 37.24  ? 11   DA  C C4    1 
ATOM   306  P P     . DT  B 2 7   ? 36.313  34.580 29.036  1.00 46.32  ? 12   DT  C P     1 
ATOM   307  O OP1   . DT  B 2 7   ? 37.342  35.601 29.338  1.00 49.30  ? 12   DT  C OP1   1 
ATOM   308  O OP2   . DT  B 2 7   ? 36.268  33.906 27.724  1.00 46.69  ? 12   DT  C OP2   1 
ATOM   309  O "O5'" . DT  B 2 7   ? 36.351  33.416 30.117  1.00 43.31  ? 12   DT  C "O5'" 1 
ATOM   310  C "C5'" . DT  B 2 7   ? 36.323  33.713 31.524  1.00 44.58  ? 12   DT  C "C5'" 1 
ATOM   311  C "C4'" . DT  B 2 7   ? 36.190  32.421 32.294  1.00 47.18  ? 12   DT  C "C4'" 1 
ATOM   312  O "O4'" . DT  B 2 7   ? 34.871  31.890 32.087  1.00 45.39  ? 12   DT  C "O4'" 1 
ATOM   313  C "C3'" . DT  B 2 7   ? 37.142  31.287 31.875  1.00 48.24  ? 12   DT  C "C3'" 1 
ATOM   314  O "O3'" . DT  B 2 7   ? 38.283  31.345 32.739  1.00 51.73  ? 12   DT  C "O3'" 1 
ATOM   315  C "C2'" . DT  B 2 7   ? 36.304  30.024 32.029  1.00 46.39  ? 12   DT  C "C2'" 1 
ATOM   316  C "C1'" . DT  B 2 7   ? 34.921  30.529 32.455  1.00 47.84  ? 12   DT  C "C1'" 1 
ATOM   317  N N1    . DT  B 2 7   ? 33.794  29.854 31.801  1.00 46.68  ? 12   DT  C N1    1 
ATOM   318  C C2    . DT  B 2 7   ? 32.956  29.094 32.582  1.00 49.77  ? 12   DT  C C2    1 
ATOM   319  O O2    . DT  B 2 7   ? 33.107  28.959 33.786  1.00 53.75  ? 12   DT  C O2    1 
ATOM   320  N N3    . DT  B 2 7   ? 31.932  28.488 31.899  1.00 45.53  ? 12   DT  C N3    1 
ATOM   321  C C4    . DT  B 2 7   ? 31.678  28.558 30.542  1.00 45.60  ? 12   DT  C C4    1 
ATOM   322  O O4    . DT  B 2 7   ? 30.720  27.953 30.068  1.00 49.43  ? 12   DT  C O4    1 
ATOM   323  C C5    . DT  B 2 7   ? 32.609  29.358 29.781  1.00 48.90  ? 12   DT  C C5    1 
ATOM   324  C C7    . DT  B 2 7   ? 32.420  29.485 28.301  1.00 50.58  ? 12   DT  C C7    1 
ATOM   325  C C6    . DT  B 2 7   ? 33.606  29.961 30.441  1.00 46.93  ? 12   DT  C C6    1 
ATOM   326  P P     . DC  B 2 8   ? 39.504  30.281 32.664  1.00 45.47  ? 13   DC  C P     1 
ATOM   327  O OP1   . DC  B 2 8   ? 40.647  30.931 33.341  1.00 39.92  ? 13   DC  C OP1   1 
ATOM   328  O OP2   . DC  B 2 8   ? 39.662  29.804 31.259  1.00 44.92  ? 13   DC  C OP2   1 
ATOM   329  O "O5'" . DC  B 2 8   ? 38.942  29.053 33.507  1.00 43.32  ? 13   DC  C "O5'" 1 
ATOM   330  C "C5'" . DC  B 2 8   ? 38.404  29.308 34.807  1.00 48.99  ? 13   DC  C "C5'" 1 
ATOM   331  C "C4'" . DC  B 2 8   ? 38.100  28.013 35.513  1.00 52.81  ? 13   DC  C "C4'" 1 
ATOM   332  O "O4'" . DC  B 2 8   ? 36.849  27.486 35.026  1.00 51.10  ? 13   DC  C "O4'" 1 
ATOM   333  C "C3'" . DC  B 2 8   ? 39.128  26.902 35.305  1.00 52.81  ? 13   DC  C "C3'" 1 
ATOM   334  O "O3'" . DC  B 2 8   ? 39.095  26.057 36.459  1.00 52.50  ? 13   DC  C "O3'" 1 
ATOM   335  C "C2'" . DC  B 2 8   ? 38.566  26.139 34.125  1.00 51.79  ? 13   DC  C "C2'" 1 
ATOM   336  C "C1'" . DC  B 2 8   ? 37.071  26.207 34.437  1.00 53.66  ? 13   DC  C "C1'" 1 
ATOM   337  N N1    . DC  B 2 8   ? 36.165  26.093 33.287  1.00 49.77  ? 13   DC  C N1    1 
ATOM   338  C C2    . DC  B 2 8   ? 34.891  25.540 33.475  1.00 48.60  ? 13   DC  C C2    1 
ATOM   339  O O2    . DC  B 2 8   ? 34.580  25.103 34.593  1.00 48.56  ? 13   DC  C O2    1 
ATOM   340  N N3    . DC  B 2 8   ? 34.042  25.471 32.428  1.00 48.59  ? 13   DC  C N3    1 
ATOM   341  C C4    . DC  B 2 8   ? 34.409  25.956 31.240  1.00 46.73  ? 13   DC  C C4    1 
ATOM   342  N N4    . DC  B 2 8   ? 33.535  25.872 30.235  1.00 50.54  ? 13   DC  C N4    1 
ATOM   343  C C5    . DC  B 2 8   ? 35.692  26.538 31.025  1.00 47.91  ? 13   DC  C C5    1 
ATOM   344  C C6    . DC  B 2 8   ? 36.527  26.596 32.068  1.00 47.74  ? 13   DC  C C6    1 
ATOM   345  P P     . DG  B 2 9   ? 40.367  25.172 36.853  1.00 47.59  ? 14   DG  C P     1 
ATOM   346  O OP1   . DG  B 2 9   ? 40.537  25.256 38.327  1.00 52.77  ? 14   DG  C OP1   1 
ATOM   347  O OP2   . DG  B 2 9   ? 41.489  25.552 35.944  1.00 38.28  ? 14   DG  C OP2   1 
ATOM   348  O "O5'" . DG  B 2 9   ? 39.828  23.705 36.597  1.00 45.87  ? 14   DG  C "O5'" 1 
ATOM   349  C "C5'" . DG  B 2 9   ? 38.677  23.275 37.328  1.00 57.45  ? 14   DG  C "C5'" 1 
ATOM   350  C "C4'" . DG  B 2 9   ? 38.252  21.918 36.831  1.00 61.01  ? 14   DG  C "C4'" 1 
ATOM   351  O "O4'" . DG  B 2 9   ? 37.531  22.096 35.589  1.00 63.58  ? 14   DG  C "O4'" 1 
ATOM   352  C "C3'" . DG  B 2 9   ? 39.421  20.990 36.506  1.00 63.52  ? 14   DG  C "C3'" 1 
ATOM   353  O "O3'" . DG  B 2 9   ? 39.016  19.654 36.819  1.00 62.90  ? 14   DG  C "O3'" 1 
ATOM   354  C "C2'" . DG  B 2 9   ? 39.643  21.229 35.022  1.00 65.31  ? 14   DG  C "C2'" 1 
ATOM   355  C "C1'" . DG  B 2 9   ? 38.207  21.404 34.548  1.00 64.97  ? 14   DG  C "C1'" 1 
ATOM   356  N N9    . DG  B 2 9   ? 37.973  22.120 33.296  1.00 61.67  ? 14   DG  C N9    1 
ATOM   357  C C8    . DG  B 2 9   ? 38.855  22.879 32.560  1.00 63.54  ? 14   DG  C C8    1 
ATOM   358  N N7    . DG  B 2 9   ? 38.323  23.368 31.471  1.00 53.51  ? 14   DG  C N7    1 
ATOM   359  C C5    . DG  B 2 9   ? 37.018  22.897 31.484  1.00 52.13  ? 14   DG  C C5    1 
ATOM   360  C C6    . DG  B 2 9   ? 35.963  23.087 30.555  1.00 54.07  ? 14   DG  C C6    1 
ATOM   361  O O6    . DG  B 2 9   ? 35.971  23.742 29.504  1.00 57.17  ? 14   DG  C O6    1 
ATOM   362  N N1    . DG  B 2 9   ? 34.801  22.427 30.956  1.00 54.58  ? 14   DG  C N1    1 
ATOM   363  C C2    . DG  B 2 9   ? 34.673  21.674 32.101  1.00 52.26  ? 14   DG  C C2    1 
ATOM   364  N N2    . DG  B 2 9   ? 33.474  21.109 32.312  1.00 49.86  ? 14   DG  C N2    1 
ATOM   365  N N3    . DG  B 2 9   ? 35.648  21.495 32.978  1.00 50.16  ? 14   DG  C N3    1 
ATOM   366  C C4    . DG  B 2 9   ? 36.787  22.120 32.602  1.00 56.28  ? 14   DG  C C4    1 
ATOM   367  N N     . MET C 3 1   ? 7.872   4.936  -1.468  1.00 57.00  ? 296  MET A N     1 
ATOM   368  C CA    . MET C 3 1   ? 6.632   5.198  -0.690  1.00 57.68  ? 296  MET A CA    1 
ATOM   369  C C     . MET C 3 1   ? 6.880   5.192  0.834   1.00 53.74  ? 296  MET A C     1 
ATOM   370  O O     . MET C 3 1   ? 5.879   5.377  1.603   1.00 40.01  ? 296  MET A O     1 
ATOM   371  C CB    . MET C 3 1   ? 5.568   4.167  -1.071  1.00 65.45  ? 296  MET A CB    1 
ATOM   372  C CG    . MET C 3 1   ? 4.546   4.713  -2.044  1.00 68.37  ? 296  MET A CG    1 
ATOM   373  S SD    . MET C 3 1   ? 3.808   6.289  -1.498  1.00 78.81  ? 296  MET A SD    1 
ATOM   374  C CE    . MET C 3 1   ? 3.686   6.120  0.282   1.00 72.46  ? 296  MET A CE    1 
ATOM   375  N N     . ALA C 3 2   ? 8.143   4.991  1.249   1.00 55.85  ? 297  ALA A N     1 
ATOM   376  C CA    . ALA C 3 2   ? 8.740   5.430  2.542   1.00 54.09  ? 297  ALA A CA    1 
ATOM   377  C C     . ALA C 3 2   ? 9.575   6.694  2.299   1.00 50.23  ? 297  ALA A C     1 
ATOM   378  O O     . ALA C 3 2   ? 9.578   7.547  3.194   1.00 51.16  ? 297  ALA A O     1 
ATOM   379  C CB    . ALA C 3 2   ? 9.570   4.336  3.180   1.00 49.95  ? 297  ALA A CB    1 
ATOM   380  N N     . LYS C 3 3   ? 10.252  6.797  1.144   1.00 45.58  ? 298  LYS A N     1 
ATOM   381  C CA    . LYS C 3 3   ? 10.785  8.077  0.594   1.00 44.27  ? 298  LYS A CA    1 
ATOM   382  C C     . LYS C 3 3   ? 9.581   8.996  0.347   1.00 41.68  ? 298  LYS A C     1 
ATOM   383  O O     . LYS C 3 3   ? 8.474   8.462  0.141   1.00 39.13  ? 298  LYS A O     1 
ATOM   384  C CB    . LYS C 3 3   ? 11.594  7.881  -0.696  1.00 40.52  ? 298  LYS A CB    1 
ATOM   385  N N     . MET C 3 4   ? 9.769   10.317 0.448   1.00 34.67  ? 299  MET A N     1 
ATOM   386  C CA    . MET C 3 4   ? 8.712   11.296 0.113   1.00 31.68  ? 299  MET A CA    1 
ATOM   387  C C     . MET C 3 4   ? 8.974   11.844 -1.296  1.00 30.21  ? 299  MET A C     1 
ATOM   388  O O     . MET C 3 4   ? 10.116  12.277 -1.588  1.00 33.05  ? 299  MET A O     1 
ATOM   389  C CB    . MET C 3 4   ? 8.621   12.433 1.137   1.00 29.87  ? 299  MET A CB    1 
ATOM   390  C CG    . MET C 3 4   ? 7.500   13.402 0.837   1.00 27.37  ? 299  MET A CG    1 
ATOM   391  S SD    . MET C 3 4   ? 7.130   14.521 2.193   1.00 29.54  ? 299  MET A SD    1 
ATOM   392  C CE    . MET C 3 4   ? 6.371   13.377 3.360   1.00 26.25  ? 299  MET A CE    1 
ATOM   393  N N     . ALA C 3 5   ? 7.934   11.831 -2.124  1.00 27.17  ? 300  ALA A N     1 
ATOM   394  C CA    . ALA C 3 5   ? 7.967   12.257 -3.537  1.00 29.71  ? 300  ALA A CA    1 
ATOM   395  C C     . ALA C 3 5   ? 7.927   13.794 -3.637  1.00 27.95  ? 300  ALA A C     1 
ATOM   396  O O     . ALA C 3 5   ? 7.139   14.446 -2.935  1.00 27.22  ? 300  ALA A O     1 
ATOM   397  C CB    . ALA C 3 5   ? 6.814   11.641 -4.299  1.00 27.77  ? 300  ALA A CB    1 
ATOM   398  N N     . PHE C 3 6   ? 8.711   14.340 -4.556  1.00 26.65  ? 301  PHE A N     1 
ATOM   399  C CA    . PHE C 3 6   ? 8.730   15.777 -4.894  1.00 26.88  ? 301  PHE A CA    1 
ATOM   400  C C     . PHE C 3 6   ? 9.444   15.961 -6.232  1.00 26.64  ? 301  PHE A C     1 
ATOM   401  O O     . PHE C 3 6   ? 10.272  15.115 -6.636  1.00 23.75  ? 301  PHE A O     1 
ATOM   402  C CB    . PHE C 3 6   ? 9.437   16.582 -3.794  1.00 25.74  ? 301  PHE A CB    1 
ATOM   403  C CG    . PHE C 3 6   ? 10.882  16.221 -3.565  1.00 24.42  ? 301  PHE A CG    1 
ATOM   404  C CD1   . PHE C 3 6   ? 11.234  15.180 -2.727  1.00 23.89  ? 301  PHE A CD1   1 
ATOM   405  C CD2   . PHE C 3 6   ? 11.897  16.929 -4.186  1.00 24.26  ? 301  PHE A CD2   1 
ATOM   406  C CE1   . PHE C 3 6   ? 12.563  14.827 -2.529  1.00 23.73  ? 301  PHE A CE1   1 
ATOM   407  C CE2   . PHE C 3 6   ? 13.227  16.586 -3.978  1.00 23.51  ? 301  PHE A CE2   1 
ATOM   408  C CZ    . PHE C 3 6   ? 13.559  15.546 -3.141  1.00 24.75  ? 301  PHE A CZ    1 
ATOM   409  N N     . THR C 3 7   ? 9.164   17.098 -6.845  1.00 25.67  ? 302  THR A N     1 
ATOM   410  C CA    . THR C 3 7   ? 9.891   17.634 -8.010  1.00 27.74  ? 302  THR A CA    1 
ATOM   411  C C     . THR C 3 7   ? 11.104  18.413 -7.510  1.00 27.38  ? 302  THR A C     1 
ATOM   412  O O     . THR C 3 7   ? 10.920  19.439 -6.818  1.00 25.57  ? 302  THR A O     1 
ATOM   413  C CB    . THR C 3 7   ? 8.953   18.527 -8.818  1.00 28.71  ? 302  THR A CB    1 
ATOM   414  O OG1   . THR C 3 7   ? 7.727   17.790 -8.896  1.00 28.16  ? 302  THR A OG1   1 
ATOM   415  C CG2   . THR C 3 7   ? 9.526   18.895 -10.168 1.00 29.67  ? 302  THR A CG2   1 
ATOM   416  N N     . LEU C 3 8   ? 12.291  17.952 -7.873  1.00 29.45  ? 303  LEU A N     1 
ATOM   417  C CA    . LEU C 3 8   ? 13.548  18.719 -7.728  1.00 33.43  ? 303  LEU A CA    1 
ATOM   418  C C     . LEU C 3 8   ? 13.630  19.658 -8.932  1.00 33.27  ? 303  LEU A C     1 
ATOM   419  O O     . LEU C 3 8   ? 14.085  19.213 -9.988  1.00 32.69  ? 303  LEU A O     1 
ATOM   420  C CB    . LEU C 3 8   ? 14.723  17.741 -7.610  1.00 37.06  ? 303  LEU A CB    1 
ATOM   421  C CG    . LEU C 3 8   ? 15.819  18.212 -6.660  1.00 42.28  ? 303  LEU A CG    1 
ATOM   422  C CD1   . LEU C 3 8   ? 16.744  17.073 -6.262  1.00 44.77  ? 303  LEU A CD1   1 
ATOM   423  C CD2   . LEU C 3 8   ? 16.594  19.363 -7.291  1.00 45.33  ? 303  LEU A CD2   1 
ATOM   424  N N     . ALA C 3 9   ? 13.100  20.879 -8.789  1.00 34.30  ? 304  ALA A N     1 
ATOM   425  C CA    . ALA C 3 9   ? 12.783  21.794 -9.913  1.00 36.45  ? 304  ALA A CA    1 
ATOM   426  C C     . ALA C 3 9   ? 14.030  22.575 -10.344 1.00 39.03  ? 304  ALA A C     1 
ATOM   427  O O     . ALA C 3 9   ? 14.796  23.057 -9.474  1.00 42.43  ? 304  ALA A O     1 
ATOM   428  C CB    . ALA C 3 9   ? 11.651  22.720 -9.545  1.00 34.64  ? 304  ALA A CB    1 
ATOM   429  N N     . ASP C 3 10  ? 14.206  22.706 -11.661 1.00 44.36  ? 305  ASP A N     1 
ATOM   430  C CA    . ASP C 3 10  ? 15.315  23.460 -12.302 1.00 46.46  ? 305  ASP A CA    1 
ATOM   431  C C     . ASP C 3 10  ? 14.934  24.932 -12.382 1.00 41.90  ? 305  ASP A C     1 
ATOM   432  O O     . ASP C 3 10  ? 15.817  25.776 -12.152 1.00 47.93  ? 305  ASP A O     1 
ATOM   433  C CB    . ASP C 3 10  ? 15.615  22.927 -13.705 1.00 50.90  ? 305  ASP A CB    1 
ATOM   434  C CG    . ASP C 3 10  ? 16.458  21.666 -13.711 1.00 56.46  ? 305  ASP A CG    1 
ATOM   435  O OD1   . ASP C 3 10  ? 17.123  21.376 -12.684 1.00 58.17  ? 305  ASP A OD1   1 
ATOM   436  O OD2   . ASP C 3 10  ? 16.443  20.982 -14.747 1.00 67.54  ? 305  ASP A OD2   1 
ATOM   437  N N     . ARG C 3 11  ? 13.681  25.206 -12.740 1.00 40.10  ? 306  ARG A N     1 
ATOM   438  C CA    . ARG C 3 11  ? 13.110  26.575 -12.817 1.00 44.75  ? 306  ARG A CA    1 
ATOM   439  C C     . ARG C 3 11  ? 11.809  26.615 -12.015 1.00 39.94  ? 306  ARG A C     1 
ATOM   440  O O     . ARG C 3 11  ? 11.287  25.538 -11.667 1.00 39.81  ? 306  ARG A O     1 
ATOM   441  C CB    . ARG C 3 11  ? 12.832  26.959 -14.271 1.00 52.37  ? 306  ARG A CB    1 
ATOM   442  C CG    . ARG C 3 11  ? 11.645  26.219 -14.875 1.00 63.87  ? 306  ARG A CG    1 
ATOM   443  C CD    . ARG C 3 11  ? 11.541  26.334 -16.390 1.00 75.46  ? 306  ARG A CD    1 
ATOM   444  N NE    . ARG C 3 11  ? 11.057  25.106 -17.025 1.00 83.26  ? 306  ARG A NE    1 
ATOM   445  C CZ    . ARG C 3 11  ? 11.767  23.978 -17.185 1.00 87.06  ? 306  ARG A CZ    1 
ATOM   446  N NH1   . ARG C 3 11  ? 13.013  23.879 -16.743 1.00 87.75  ? 306  ARG A NH1   1 
ATOM   447  N NH2   . ARG C 3 11  ? 11.217  22.939 -17.789 1.00 88.61  ? 306  ARG A NH2   1 
ATOM   448  N N     . VAL C 3 12  ? 11.290  27.821 -11.795 1.00 34.83  ? 307  VAL A N     1 
ATOM   449  C CA    . VAL C 3 12  ? 10.037  28.109 -11.046 1.00 34.20  ? 307  VAL A CA    1 
ATOM   450  C C     . VAL C 3 12  ? 8.859   28.044 -12.013 1.00 34.20  ? 307  VAL A C     1 
ATOM   451  O O     . VAL C 3 12  ? 8.965   28.665 -13.056 1.00 30.74  ? 307  VAL A O     1 
ATOM   452  C CB    . VAL C 3 12  ? 10.102  29.502 -10.395 1.00 34.47  ? 307  VAL A CB    1 
ATOM   453  C CG1   . VAL C 3 12  ? 8.778   29.872 -9.755  1.00 32.78  ? 307  VAL A CG1   1 
ATOM   454  C CG2   . VAL C 3 12  ? 11.249  29.606 -9.399  1.00 37.01  ? 307  VAL A CG2   1 
ATOM   455  N N     . THR C 3 13  ? 7.758   27.391 -11.638 1.00 32.05  ? 308  THR A N     1 
ATOM   456  C CA    . THR C 3 13  ? 6.537   27.293 -12.470 1.00 34.04  ? 308  THR A CA    1 
ATOM   457  C C     . THR C 3 13  ? 5.383   27.937 -11.706 1.00 34.68  ? 308  THR A C     1 
ATOM   458  O O     . THR C 3 13  ? 5.517   28.092 -10.476 1.00 35.33  ? 308  THR A O     1 
ATOM   459  C CB    . THR C 3 13  ? 6.249   25.838 -12.845 1.00 36.89  ? 308  THR A CB    1 
ATOM   460  O OG1   . THR C 3 13  ? 5.755   25.215 -11.653 1.00 38.98  ? 308  THR A OG1   1 
ATOM   461  C CG2   . THR C 3 13  ? 7.463   25.107 -13.389 1.00 35.14  ? 308  THR A CG2   1 
ATOM   462  N N     . GLU C 3 14  ? 4.316   28.303 -12.421 1.00 35.32  ? 309  GLU A N     1 
ATOM   463  C CA    . GLU C 3 14  ? 3.073   28.886 -11.848 1.00 41.69  ? 309  GLU A CA    1 
ATOM   464  C C     . GLU C 3 14  ? 2.511   27.987 -10.735 1.00 37.79  ? 309  GLU A C     1 
ATOM   465  O O     . GLU C 3 14  ? 1.951   28.534 -9.790  1.00 42.39  ? 309  GLU A O     1 
ATOM   466  C CB    . GLU C 3 14  ? 2.007   29.111 -12.926 1.00 45.30  ? 309  GLU A CB    1 
ATOM   467  C CG    . GLU C 3 14  ? 1.799   30.573 -13.279 1.00 54.28  ? 309  GLU A CG    1 
ATOM   468  C CD    . GLU C 3 14  ? 0.926   31.340 -12.297 1.00 62.52  ? 309  GLU A CD    1 
ATOM   469  O OE1   . GLU C 3 14  ? 1.451   32.264 -11.633 1.00 60.54  ? 309  GLU A OE1   1 
ATOM   470  O OE2   . GLU C 3 14  ? -0.286  31.020 -12.205 1.00 68.93  ? 309  GLU A OE2   1 
ATOM   471  N N     . GLU C 3 15  ? 2.598   26.666 -10.880 1.00 37.72  ? 310  GLU A N     1 
ATOM   472  C CA    . GLU C 3 15  ? 2.093   25.668 -9.891  1.00 39.08  ? 310  GLU A CA    1 
ATOM   473  C C     . GLU C 3 15  ? 2.680   25.944 -8.493  1.00 34.60  ? 310  GLU A C     1 
ATOM   474  O O     . GLU C 3 15  ? 1.967   25.823 -7.507  1.00 33.20  ? 310  GLU A O     1 
ATOM   475  C CB    . GLU C 3 15  ? 2.486   24.265 -10.341 1.00 39.92  ? 310  GLU A CB    1 
ATOM   476  C CG    . GLU C 3 15  ? 1.355   23.494 -10.973 1.00 44.26  ? 310  GLU A CG    1 
ATOM   477  C CD    . GLU C 3 15  ? 1.714   22.035 -11.165 1.00 47.23  ? 310  GLU A CD    1 
ATOM   478  O OE1   . GLU C 3 15  ? 0.793   21.252 -11.516 1.00 55.80  ? 310  GLU A OE1   1 
ATOM   479  O OE2   . GLU C 3 15  ? 2.916   21.690 -10.952 1.00 39.53  ? 310  GLU A OE2   1 
ATOM   480  N N     . MET C 3 16  ? 3.950   26.323 -8.443  1.00 31.86  ? 311  MET A N     1 
ATOM   481  C CA    . MET C 3 16  ? 4.694   26.657 -7.207  1.00 31.60  ? 311  MET A CA    1 
ATOM   482  C C     . MET C 3 16  ? 4.197   27.984 -6.634  1.00 28.24  ? 311  MET A C     1 
ATOM   483  O O     . MET C 3 16  ? 4.536   28.254 -5.493  1.00 28.57  ? 311  MET A O     1 
ATOM   484  C CB    . MET C 3 16  ? 6.191   26.779 -7.501  1.00 33.32  ? 311  MET A CB    1 
ATOM   485  C CG    . MET C 3 16  ? 6.689   25.677 -8.387  1.00 33.21  ? 311  MET A CG    1 
ATOM   486  S SD    . MET C 3 16  ? 8.454   25.672 -8.539  1.00 31.01  ? 311  MET A SD    1 
ATOM   487  C CE    . MET C 3 16  ? 8.687   24.214 -9.556  1.00 34.03  ? 311  MET A CE    1 
ATOM   488  N N     . LEU C 3 17  ? 3.396   28.759 -7.364  1.00 26.64  ? 312  LEU A N     1 
ATOM   489  C CA    . LEU C 3 17  ? 2.969   30.103 -6.902  1.00 27.97  ? 312  LEU A CA    1 
ATOM   490  C C     . LEU C 3 17  ? 1.470   30.160 -6.590  1.00 25.47  ? 312  LEU A C     1 
ATOM   491  O O     . LEU C 3 17  ? 0.902   31.256 -6.706  1.00 26.28  ? 312  LEU A O     1 
ATOM   492  C CB    . LEU C 3 17  ? 3.372   31.128 -7.960  1.00 28.75  ? 312  LEU A CB    1 
ATOM   493  C CG    . LEU C 3 17  ? 4.787   30.943 -8.490  1.00 28.76  ? 312  LEU A CG    1 
ATOM   494  C CD1   . LEU C 3 17  ? 5.060   31.932 -9.604  1.00 30.69  ? 312  LEU A CD1   1 
ATOM   495  C CD2   . LEU C 3 17  ? 5.799   31.103 -7.372  1.00 29.02  ? 312  LEU A CD2   1 
ATOM   496  N N     . ALA C 3 18  ? 0.900   29.077 -6.060  1.00 27.85  ? 313  ALA A N     1 
ATOM   497  C CA    . ALA C 3 18  ? -0.492  29.014 -5.543  1.00 28.49  ? 313  ALA A CA    1 
ATOM   498  C C     . ALA C 3 18  ? -0.619  29.954 -4.346  1.00 29.75  ? 313  ALA A C     1 
ATOM   499  O O     . ALA C 3 18  ? 0.418   30.305 -3.759  1.00 33.88  ? 313  ALA A O     1 
ATOM   500  C CB    . ALA C 3 18  ? -0.867  27.609 -5.154  1.00 29.38  ? 313  ALA A CB    1 
ATOM   501  N N     . ASP C 3 19  ? -1.846  30.318 -3.992  1.00 27.29  ? 314  ASP A N     1 
ATOM   502  C CA    . ASP C 3 19  ? -2.132  31.385 -3.009  1.00 30.90  ? 314  ASP A CA    1 
ATOM   503  C C     . ASP C 3 19  ? -2.247  30.811 -1.580  1.00 27.05  ? 314  ASP A C     1 
ATOM   504  O O     . ASP C 3 19  ? -2.551  31.600 -0.647  1.00 23.68  ? 314  ASP A O     1 
ATOM   505  C CB    . ASP C 3 19  ? -3.363  32.166 -3.470  1.00 36.32  ? 314  ASP A CB    1 
ATOM   506  C CG    . ASP C 3 19  ? -4.627  31.328 -3.468  1.00 42.27  ? 314  ASP A CG    1 
ATOM   507  O OD1   . ASP C 3 19  ? -4.536  30.157 -3.026  1.00 40.48  ? 314  ASP A OD1   1 
ATOM   508  O OD2   . ASP C 3 19  ? -5.682  31.853 -3.919  1.00 47.42  ? 314  ASP A OD2   1 
ATOM   509  N N     . LYS C 3 20  ? -1.995  29.511 -1.397  1.00 26.11  ? 315  LYS A N     1 
ATOM   510  C CA    . LYS C 3 20  ? -1.711  28.910 -0.061  1.00 27.52  ? 315  LYS A CA    1 
ATOM   511  C C     . LYS C 3 20  ? -0.611  27.863 -0.212  1.00 23.25  ? 315  LYS A C     1 
ATOM   512  O O     . LYS C 3 20  ? -0.708  27.022 -1.118  1.00 23.38  ? 315  LYS A O     1 
ATOM   513  C CB    . LYS C 3 20  ? -2.939  28.275 0.616   1.00 28.99  ? 315  LYS A CB    1 
ATOM   514  C CG    . LYS C 3 20  ? -2.808  28.188 2.141   1.00 29.79  ? 315  LYS A CG    1 
ATOM   515  C CD    . LYS C 3 20  ? -3.884  27.380 2.829   1.00 31.19  ? 315  LYS A CD    1 
ATOM   516  C CE    . LYS C 3 20  ? -3.548  26.994 4.259   1.00 28.84  ? 315  LYS A CE    1 
ATOM   517  N NZ    . LYS C 3 20  ? -3.232  28.188 5.086   1.00 28.96  ? 315  LYS A NZ    1 
ATOM   518  N N     . ALA C 3 21  ? 0.379   27.907 0.678   1.00 20.15  ? 316  ALA A N     1 
ATOM   519  C CA    . ALA C 3 21  ? 1.566   27.036 0.613   1.00 18.50  ? 316  ALA A CA    1 
ATOM   520  C C     . ALA C 3 21  ? 2.202   26.904 1.989   1.00 17.80  ? 316  ALA A C     1 
ATOM   521  O O     . ALA C 3 21  ? 2.168   27.857 2.767   1.00 16.85  ? 316  ALA A O     1 
ATOM   522  C CB    . ALA C 3 21  ? 2.552   27.602 -0.365  1.00 17.08  ? 316  ALA A CB    1 
ATOM   523  N N     . ALA C 3 22  ? 2.759   25.737 2.258   1.00 17.55  ? 317  ALA A N     1 
ATOM   524  C CA    . ALA C 3 22  ? 3.813   25.568 3.254   1.00 17.49  ? 317  ALA A CA    1 
ATOM   525  C C     . ALA C 3 22  ? 5.112   25.904 2.530   1.00 18.76  ? 317  ALA A C     1 
ATOM   526  O O     . ALA C 3 22  ? 5.370   25.316 1.453   1.00 19.19  ? 317  ALA A O     1 
ATOM   527  C CB    . ALA C 3 22  ? 3.805   24.186 3.814   1.00 17.79  ? 317  ALA A CB    1 
ATOM   528  N N     . LEU C 3 23  ? 5.873   26.837 3.102   1.00 17.24  ? 318  LEU A N     1 
ATOM   529  C CA    . LEU C 3 23  ? 7.155   27.313 2.568   1.00 16.46  ? 318  LEU A CA    1 
ATOM   530  C C     . LEU C 3 23  ? 8.263   27.111 3.609   1.00 17.46  ? 318  LEU A C     1 
ATOM   531  O O     . LEU C 3 23  ? 8.100   27.502 4.802   1.00 20.41  ? 318  LEU A O     1 
ATOM   532  C CB    . LEU C 3 23  ? 6.981   28.786 2.200   1.00 16.83  ? 318  LEU A CB    1 
ATOM   533  C CG    . LEU C 3 23  ? 8.264   29.558 1.921   1.00 17.86  ? 318  LEU A CG    1 
ATOM   534  C CD1   . LEU C 3 23  ? 8.873   29.105 0.600   1.00 19.25  ? 318  LEU A CD1   1 
ATOM   535  C CD2   . LEU C 3 23  ? 7.972   31.046 1.884   1.00 18.94  ? 318  LEU A CD2   1 
ATOM   536  N N     . VAL C 3 24  ? 9.384   26.580 3.142   1.00 18.03  ? 319  VAL A N     1 
ATOM   537  C CA    . VAL C 3 24  ? 10.660  26.472 3.878   1.00 18.49  ? 319  VAL A CA    1 
ATOM   538  C C     . VAL C 3 24  ? 11.704  27.254 3.081   1.00 19.42  ? 319  VAL A C     1 
ATOM   539  O O     . VAL C 3 24  ? 11.911  26.982 1.870   1.00 20.36  ? 319  VAL A O     1 
ATOM   540  C CB    . VAL C 3 24  ? 11.062  25.001 4.074   1.00 19.21  ? 319  VAL A CB    1 
ATOM   541  C CG1   . VAL C 3 24  ? 12.443  24.866 4.668   1.00 18.99  ? 319  VAL A CG1   1 
ATOM   542  C CG2   . VAL C 3 24  ? 10.051  24.277 4.953   1.00 20.86  ? 319  VAL A CG2   1 
ATOM   543  N N     . VAL C 3 25  ? 12.280  28.238 3.749   1.00 18.37  ? 320  VAL A N     1 
ATOM   544  C CA    . VAL C 3 25  ? 13.462  28.999 3.299   1.00 17.88  ? 320  VAL A CA    1 
ATOM   545  C C     . VAL C 3 25  ? 14.519  28.739 4.340   1.00 18.46  ? 320  VAL A C     1 
ATOM   546  O O     . VAL C 3 25  ? 14.472  29.379 5.386   1.00 20.61  ? 320  VAL A O     1 
ATOM   547  C CB    . VAL C 3 25  ? 13.155  30.496 3.170   1.00 18.12  ? 320  VAL A CB    1 
ATOM   548  C CG1   . VAL C 3 25  ? 14.391  31.265 2.717   1.00 19.58  ? 320  VAL A CG1   1 
ATOM   549  C CG2   . VAL C 3 25  ? 11.984  30.746 2.235   1.00 17.04  ? 320  VAL A CG2   1 
ATOM   550  N N     . GLU C 3 26  ? 15.380  27.773 4.072   1.00 19.24  ? 321  GLU A N     1 
ATOM   551  C CA    . GLU C 3 26  ? 16.239  27.130 5.088   1.00 18.68  ? 321  GLU A CA    1 
ATOM   552  C C     . GLU C 3 26  ? 17.516  27.959 5.257   1.00 18.11  ? 321  GLU A C     1 
ATOM   553  O O     . GLU C 3 26  ? 18.259  28.153 4.283   1.00 17.37  ? 321  GLU A O     1 
ATOM   554  C CB    . GLU C 3 26  ? 16.567  25.699 4.647   1.00 19.63  ? 321  GLU A CB    1 
ATOM   555  C CG    . GLU C 3 26  ? 17.278  24.871 5.711   1.00 20.04  ? 321  GLU A CG    1 
ATOM   556  C CD    . GLU C 3 26  ? 16.366  24.389 6.831   1.00 20.84  ? 321  GLU A CD    1 
ATOM   557  O OE1   . GLU C 3 26  ? 15.266  24.933 6.951   1.00 22.82  ? 321  GLU A OE1   1 
ATOM   558  O OE2   . GLU C 3 26  ? 16.731  23.423 7.533   1.00 21.26  ? 321  GLU A OE2   1 
ATOM   559  N N     . VAL C 3 27  ? 17.756  28.413 6.470   1.00 17.46  ? 322  VAL A N     1 
ATOM   560  C CA    . VAL C 3 27  ? 19.018  29.067 6.889   1.00 18.07  ? 322  VAL A CA    1 
ATOM   561  C C     . VAL C 3 27  ? 19.576  28.198 8.007   1.00 20.38  ? 322  VAL A C     1 
ATOM   562  O O     . VAL C 3 27  ? 18.914  28.093 9.051   1.00 18.68  ? 322  VAL A O     1 
ATOM   563  C CB    . VAL C 3 27  ? 18.796  30.499 7.406   1.00 18.14  ? 322  VAL A CB    1 
ATOM   564  C CG1   . VAL C 3 27  ? 20.122  31.078 7.890   1.00 18.01  ? 322  VAL A CG1   1 
ATOM   565  C CG2   . VAL C 3 27  ? 18.096  31.414 6.402   1.00 17.43  ? 322  VAL A CG2   1 
ATOM   566  N N     . VAL C 3 28  ? 20.753  27.623 7.793   1.00 22.13  ? 323  VAL A N     1 
ATOM   567  C CA    . VAL C 3 28  ? 21.288  26.550 8.659   1.00 21.62  ? 323  VAL A CA    1 
ATOM   568  C C     . VAL C 3 28  ? 22.176  27.189 9.713   1.00 22.40  ? 323  VAL A C     1 
ATOM   569  O O     . VAL C 3 28  ? 22.180  26.681 10.813  1.00 20.11  ? 323  VAL A O     1 
ATOM   570  C CB    . VAL C 3 28  ? 22.002  25.502 7.790   1.00 22.11  ? 323  VAL A CB    1 
ATOM   571  C CG1   . VAL C 3 28  ? 22.844  24.554 8.617   1.00 23.99  ? 323  VAL A CG1   1 
ATOM   572  C CG2   . VAL C 3 28  ? 20.981  24.730 6.965   1.00 21.93  ? 323  VAL A CG2   1 
ATOM   573  N N     . GLU C 3 29  ? 22.892  28.270 9.386   1.00 25.61  ? 324  GLU A N     1 
ATOM   574  C CA    . GLU C 3 29  ? 23.700  29.031 10.383  1.00 27.09  ? 324  GLU A CA    1 
ATOM   575  C C     . GLU C 3 29  ? 22.794  29.447 11.551  1.00 24.40  ? 324  GLU A C     1 
ATOM   576  O O     . GLU C 3 29  ? 21.728  30.004 11.255  1.00 22.22  ? 324  GLU A O     1 
ATOM   577  C CB    . GLU C 3 29  ? 24.310  30.268 9.722   1.00 31.09  ? 324  GLU A CB    1 
ATOM   578  C CG    . GLU C 3 29  ? 25.426  29.948 8.755   1.00 38.40  ? 324  GLU A CG    1 
ATOM   579  C CD    . GLU C 3 29  ? 26.669  29.402 9.445   1.00 45.52  ? 324  GLU A CD    1 
ATOM   580  O OE1   . GLU C 3 29  ? 26.850  29.643 10.671  1.00 49.80  ? 324  GLU A OE1   1 
ATOM   581  O OE2   . GLU C 3 29  ? 27.440  28.718 8.770   1.00 49.96  ? 324  GLU A OE2   1 
ATOM   582  N N     . GLU C 3 30  ? 23.190  29.231 12.810  1.00 24.23  ? 325  GLU A N     1 
ATOM   583  C CA    . GLU C 3 30  ? 22.322  29.598 13.970  1.00 27.95  ? 325  GLU A CA    1 
ATOM   584  C C     . GLU C 3 30  ? 22.056  31.102 13.910  1.00 23.88  ? 325  GLU A C     1 
ATOM   585  O O     . GLU C 3 30  ? 20.921  31.498 14.145  1.00 21.82  ? 325  GLU A O     1 
ATOM   586  C CB    . GLU C 3 30  ? 22.887  29.178 15.334  1.00 35.33  ? 325  GLU A CB    1 
ATOM   587  C CG    . GLU C 3 30  ? 21.894  28.297 16.111  1.00 45.68  ? 325  GLU A CG    1 
ATOM   588  C CD    . GLU C 3 30  ? 22.336  27.742 17.463  1.00 53.72  ? 325  GLU A CD    1 
ATOM   589  O OE1   . GLU C 3 30  ? 22.858  28.521 18.307  1.00 54.65  ? 325  GLU A OE1   1 
ATOM   590  O OE2   . GLU C 3 30  ? 22.171  26.518 17.668  1.00 59.74  ? 325  GLU A OE2   1 
ATOM   591  N N     . ASN C 3 31  ? 23.069  31.883 13.540  1.00 21.22  ? 326  ASN A N     1 
ATOM   592  C CA    . ASN C 3 31  ? 22.980  33.354 13.410  1.00 20.28  ? 326  ASN A CA    1 
ATOM   593  C C     . ASN C 3 31  ? 22.604  33.670 11.957  1.00 18.43  ? 326  ASN A C     1 
ATOM   594  O O     . ASN C 3 31  ? 23.485  33.537 11.076  1.00 18.37  ? 326  ASN A O     1 
ATOM   595  C CB    . ASN C 3 31  ? 24.282  34.044 13.823  1.00 19.55  ? 326  ASN A CB    1 
ATOM   596  C CG    . ASN C 3 31  ? 24.070  35.544 13.867  1.00 21.79  ? 326  ASN A CG    1 
ATOM   597  O OD1   . ASN C 3 31  ? 23.290  36.066 13.063  1.00 22.22  ? 326  ASN A OD1   1 
ATOM   598  N ND2   . ASN C 3 31  ? 24.695  36.224 14.816  1.00 18.24  ? 326  ASN A ND2   1 
ATOM   599  N N     . TYR C 3 32  ? 21.343  34.004 11.701  1.00 14.94  ? 327  TYR A N     1 
ATOM   600  C CA    . TYR C 3 32  ? 20.819  34.106 10.322  1.00 14.90  ? 327  TYR A CA    1 
ATOM   601  C C     . TYR C 3 32  ? 21.117  35.466 9.653   1.00 14.58  ? 327  TYR A C     1 
ATOM   602  O O     . TYR C 3 32  ? 20.761  35.610 8.488   1.00 14.59  ? 327  TYR A O     1 
ATOM   603  C CB    . TYR C 3 32  ? 19.332  33.781 10.333  1.00 15.05  ? 327  TYR A CB    1 
ATOM   604  C CG    . TYR C 3 32  ? 18.498  34.482 11.369  1.00 14.29  ? 327  TYR A CG    1 
ATOM   605  C CD1   . TYR C 3 32  ? 18.311  35.856 11.359  1.00 14.46  ? 327  TYR A CD1   1 
ATOM   606  C CD2   . TYR C 3 32  ? 17.858  33.754 12.360  1.00 14.11  ? 327  TYR A CD2   1 
ATOM   607  C CE1   . TYR C 3 32  ? 17.475  36.482 12.279  1.00 14.06  ? 327  TYR A CE1   1 
ATOM   608  C CE2   . TYR C 3 32  ? 17.033  34.368 13.288  1.00 14.16  ? 327  TYR A CE2   1 
ATOM   609  C CZ    . TYR C 3 32  ? 16.833  35.732 13.245  1.00 13.80  ? 327  TYR A CZ    1 
ATOM   610  O OH    . TYR C 3 32  ? 16.006  36.297 14.173  1.00 15.80  ? 327  TYR A OH    1 
ATOM   611  N N     . HIS C 3 33  ? 21.741  36.417 10.350  1.00 14.00  ? 328  HIS A N     1 
ATOM   612  C CA    . HIS C 3 33  ? 22.027  37.782 9.847   1.00 15.10  ? 328  HIS A CA    1 
ATOM   613  C C     . HIS C 3 33  ? 23.008  37.675 8.672   1.00 15.61  ? 328  HIS A C     1 
ATOM   614  O O     . HIS C 3 33  ? 24.124  37.196 8.886   1.00 15.24  ? 328  HIS A O     1 
ATOM   615  C CB    . HIS C 3 33  ? 22.517  38.686 10.994  1.00 14.72  ? 328  HIS A CB    1 
ATOM   616  C CG    . HIS C 3 33  ? 21.409  39.142 11.895  1.00 15.60  ? 328  HIS A CG    1 
ATOM   617  N ND1   . HIS C 3 33  ? 20.358  39.922 11.426  1.00 14.26  ? 328  HIS A ND1   1 
ATOM   618  C CD2   . HIS C 3 33  ? 21.174  38.920 13.219  1.00 14.44  ? 328  HIS A CD2   1 
ATOM   619  C CE1   . HIS C 3 33  ? 19.549  40.183 12.428  1.00 14.71  ? 328  HIS A CE1   1 
ATOM   620  N NE2   . HIS C 3 33  ? 20.021  39.570 13.531  1.00 15.35  ? 328  HIS A NE2   1 
ATOM   621  N N     . ASP C 3 34  ? 22.549  37.996 7.461   1.00 16.62  ? 329  ASP A N     1 
ATOM   622  C CA    . ASP C 3 34  ? 23.391  38.030 6.225   1.00 18.65  ? 329  ASP A CA    1 
ATOM   623  C C     . ASP C 3 34  ? 23.925  36.625 5.941   1.00 18.64  ? 329  ASP A C     1 
ATOM   624  O O     . ASP C 3 34  ? 25.038  36.518 5.443   1.00 21.12  ? 329  ASP A O     1 
ATOM   625  C CB    . ASP C 3 34  ? 24.560  39.021 6.368   1.00 18.65  ? 329  ASP A CB    1 
ATOM   626  C CG    . ASP C 3 34  ? 24.983  39.743 5.080   1.00 18.64  ? 329  ASP A CG    1 
ATOM   627  O OD1   . ASP C 3 34  ? 24.250  39.649 4.062   1.00 18.45  ? 329  ASP A OD1   1 
ATOM   628  O OD2   . ASP C 3 34  ? 26.005  40.464 5.140   1.00 16.47  ? 329  ASP A OD2   1 
ATOM   629  N N     . ALA C 3 35  ? 23.164  35.601 6.312   1.00 19.76  ? 330  ALA A N     1 
ATOM   630  C CA    . ALA C 3 35  ? 23.545  34.176 6.224   1.00 19.21  ? 330  ALA A CA    1 
ATOM   631  C C     . ALA C 3 35  ? 22.953  33.614 4.947   1.00 18.76  ? 330  ALA A C     1 
ATOM   632  O O     . ALA C 3 35  ? 21.961  34.144 4.459   1.00 17.34  ? 330  ALA A O     1 
ATOM   633  C CB    . ALA C 3 35  ? 23.028  33.410 7.426   1.00 19.50  ? 330  ALA A CB    1 
ATOM   634  N N     . PRO C 3 36  ? 23.534  32.516 4.431   1.00 18.96  ? 331  PRO A N     1 
ATOM   635  C CA    . PRO C 3 36  ? 23.067  31.895 3.207   1.00 18.46  ? 331  PRO A CA    1 
ATOM   636  C C     . PRO C 3 36  ? 21.724  31.196 3.421   1.00 18.70  ? 331  PRO A C     1 
ATOM   637  O O     . PRO C 3 36  ? 21.464  30.679 4.498   1.00 17.80  ? 331  PRO A O     1 
ATOM   638  C CB    . PRO C 3 36  ? 24.138  30.831 2.878   1.00 19.36  ? 331  PRO A CB    1 
ATOM   639  C CG    . PRO C 3 36  ? 25.309  31.134 3.805   1.00 19.47  ? 331  PRO A CG    1 
ATOM   640  C CD    . PRO C 3 36  ? 24.690  31.799 5.015   1.00 19.16  ? 331  PRO A CD    1 
ATOM   641  N N     . ILE C 3 37  ? 20.922  31.193 2.368   1.00 18.19  ? 332  ILE A N     1 
ATOM   642  C CA    . ILE C 3 37  ? 19.710  30.352 2.251   1.00 19.60  ? 332  ILE A CA    1 
ATOM   643  C C     . ILE C 3 37  ? 20.145  29.143 1.423   1.00 20.86  ? 332  ILE A C     1 
ATOM   644  O O     . ILE C 3 37  ? 20.605  29.335 0.314   1.00 21.82  ? 332  ILE A O     1 
ATOM   645  C CB    . ILE C 3 37  ? 18.592  31.188 1.619   1.00 18.48  ? 332  ILE A CB    1 
ATOM   646  C CG1   . ILE C 3 37  ? 18.214  32.346 2.544   1.00 19.86  ? 332  ILE A CG1   1 
ATOM   647  C CG2   . ILE C 3 37  ? 17.391  30.348 1.233   1.00 17.99  ? 332  ILE A CG2   1 
ATOM   648  C CD1   . ILE C 3 37  ? 17.309  33.392 1.897   1.00 18.72  ? 332  ILE A CD1   1 
ATOM   649  N N     . VAL C 3 38  ? 20.080  27.946 1.978   1.00 22.15  ? 333  VAL A N     1 
ATOM   650  C CA    . VAL C 3 38  ? 20.710  26.748 1.360   1.00 21.71  ? 333  VAL A CA    1 
ATOM   651  C C     . VAL C 3 38  ? 19.713  26.010 0.466   1.00 21.24  ? 333  VAL A C     1 
ATOM   652  O O     . VAL C 3 38  ? 20.147  25.153 -0.292  1.00 21.78  ? 333  VAL A O     1 
ATOM   653  C CB    . VAL C 3 38  ? 21.271  25.828 2.442   1.00 22.10  ? 333  VAL A CB    1 
ATOM   654  C CG1   . VAL C 3 38  ? 22.352  26.548 3.230   1.00 21.48  ? 333  VAL A CG1   1 
ATOM   655  C CG2   . VAL C 3 38  ? 20.163  25.283 3.337   1.00 21.91  ? 333  VAL A CG2   1 
ATOM   656  N N     . GLY C 3 39  ? 18.424  26.306 0.554   1.00 20.98  ? 334  GLY A N     1 
ATOM   657  C CA    . GLY C 3 39  ? 17.414  25.554 -0.210  1.00 20.25  ? 334  GLY A CA    1 
ATOM   658  C C     . GLY C 3 39  ? 16.020  26.003 0.149   1.00 19.32  ? 334  GLY A C     1 
ATOM   659  O O     . GLY C 3 39  ? 15.876  26.640 1.165   1.00 20.97  ? 334  GLY A O     1 
ATOM   660  N N     . ILE C 3 40  ? 15.049  25.671 -0.684  1.00 19.11  ? 335  ILE A N     1 
ATOM   661  C CA    . ILE C 3 40  ? 13.659  26.165 -0.606  1.00 20.18  ? 335  ILE A CA    1 
ATOM   662  C C     . ILE C 3 40  ? 12.740  24.979 -0.870  1.00 20.75  ? 335  ILE A C     1 
ATOM   663  O O     . ILE C 3 40  ? 13.082  24.152 -1.710  1.00 18.97  ? 335  ILE A O     1 
ATOM   664  C CB    . ILE C 3 40  ? 13.435  27.342 -1.578  1.00 21.33  ? 335  ILE A CB    1 
ATOM   665  C CG1   . ILE C 3 40  ? 14.309  28.522 -1.140  1.00 22.33  ? 335  ILE A CG1   1 
ATOM   666  C CG2   . ILE C 3 40  ? 11.959  27.702 -1.681  1.00 20.48  ? 335  ILE A CG2   1 
ATOM   667  C CD1   . ILE C 3 40  ? 14.132  29.782 -1.935  1.00 24.53  ? 335  ILE A CD1   1 
ATOM   668  N N     . ALA C 3 41  ? 11.669  24.863 -0.092  1.00 18.47  ? 336  ALA A N     1 
ATOM   669  C CA    . ALA C 3 41  ? 10.615  23.867 -0.365  1.00 19.46  ? 336  ALA A CA    1 
ATOM   670  C C     . ALA C 3 41  ? 9.274   24.564 -0.342  1.00 18.06  ? 336  ALA A C     1 
ATOM   671  O O     . ALA C 3 41  ? 9.075   25.484 0.455   1.00 18.15  ? 336  ALA A O     1 
ATOM   672  C CB    . ALA C 3 41  ? 10.674  22.697 0.591   1.00 19.25  ? 336  ALA A CB    1 
ATOM   673  N N     . VAL C 3 42  ? 8.420   24.157 -1.257  1.00 18.82  ? 337  VAL A N     1 
ATOM   674  C CA    . VAL C 3 42  ? 7.011   24.614 -1.330  1.00 18.97  ? 337  VAL A CA    1 
ATOM   675  C C     . VAL C 3 42  ? 6.143   23.364 -1.380  1.00 18.42  ? 337  VAL A C     1 
ATOM   676  O O     . VAL C 3 42  ? 6.417   22.465 -2.187  1.00 20.86  ? 337  VAL A O     1 
ATOM   677  C CB    . VAL C 3 42  ? 6.819   25.508 -2.560  1.00 19.57  ? 337  VAL A CB    1 
ATOM   678  C CG1   . VAL C 3 42  ? 5.392   25.988 -2.714  1.00 19.93  ? 337  VAL A CG1   1 
ATOM   679  C CG2   . VAL C 3 42  ? 7.793   26.674 -2.541  1.00 19.39  ? 337  VAL A CG2   1 
ATOM   680  N N     . VAL C 3 43  ? 5.160   23.282 -0.507  1.00 19.32  ? 338  VAL A N     1 
ATOM   681  C CA    . VAL C 3 43  ? 4.090   22.262 -0.614  1.00 18.28  ? 338  VAL A CA    1 
ATOM   682  C C     . VAL C 3 43  ? 2.790   23.036 -0.662  1.00 22.06  ? 338  VAL A C     1 
ATOM   683  O O     . VAL C 3 43  ? 2.578   23.954 0.197   1.00 23.14  ? 338  VAL A O     1 
ATOM   684  C CB    . VAL C 3 43  ? 4.126   21.265 0.545   1.00 18.16  ? 338  VAL A CB    1 
ATOM   685  C CG1   . VAL C 3 43  ? 2.857   20.399 0.614   1.00 17.76  ? 338  VAL A CG1   1 
ATOM   686  C CG2   . VAL C 3 43  ? 5.384   20.430 0.460   1.00 17.11  ? 338  VAL A CG2   1 
ATOM   687  N N     . ASN C 3 44  ? 1.981   22.687 -1.656  1.00 23.11  ? 339  ASN A N     1 
ATOM   688  C CA    . ASN C 3 44  ? 0.674   23.318 -1.928  1.00 24.76  ? 339  ASN A CA    1 
ATOM   689  C C     . ASN C 3 44  ? -0.228  22.235 -2.525  1.00 26.19  ? 339  ASN A C     1 
ATOM   690  O O     . ASN C 3 44  ? 0.236   21.094 -2.620  1.00 23.64  ? 339  ASN A O     1 
ATOM   691  C CB    . ASN C 3 44  ? 0.866   24.590 -2.762  1.00 26.57  ? 339  ASN A CB    1 
ATOM   692  C CG    . ASN C 3 44  ? 1.457   24.359 -4.137  1.00 24.11  ? 339  ASN A CG    1 
ATOM   693  O OD1   . ASN C 3 44  ? 1.291   23.293 -4.731  1.00 22.33  ? 339  ASN A OD1   1 
ATOM   694  N ND2   . ASN C 3 44  ? 2.123   25.377 -4.658  1.00 24.38  ? 339  ASN A ND2   1 
ATOM   695  N N     . GLU C 3 45  ? -1.473  22.588 -2.861  1.00 31.41  ? 340  GLU A N     1 
ATOM   696  C CA    . GLU C 3 45  ? -2.489  21.682 -3.464  1.00 35.15  ? 340  GLU A CA    1 
ATOM   697  C C     . GLU C 3 45  ? -1.888  20.978 -4.697  1.00 32.33  ? 340  GLU A C     1 
ATOM   698  O O     . GLU C 3 45  ? -2.327  19.878 -4.991  1.00 31.19  ? 340  GLU A O     1 
ATOM   699  C CB    . GLU C 3 45  ? -3.765  22.469 -3.806  1.00 39.54  ? 340  GLU A CB    1 
ATOM   700  C CG    . GLU C 3 45  ? -3.570  23.510 -4.909  1.00 46.74  ? 340  GLU A CG    1 
ATOM   701  C CD    . GLU C 3 45  ? -4.640  24.588 -5.057  1.00 54.93  ? 340  GLU A CD    1 
ATOM   702  O OE1   . GLU C 3 45  ? -5.766  24.253 -5.521  1.00 55.89  ? 340  GLU A OE1   1 
ATOM   703  O OE2   . GLU C 3 45  ? -4.344  25.774 -4.718  1.00 56.77  ? 340  GLU A OE2   1 
ATOM   704  N N     . HIS C 3 46  ? -0.919  21.583 -5.397  1.00 33.16  ? 341  HIS A N     1 
ATOM   705  C CA    . HIS C 3 46  ? -0.410  21.083 -6.703  1.00 31.07  ? 341  HIS A CA    1 
ATOM   706  C C     . HIS C 3 46  ? 0.690   20.054 -6.480  1.00 31.44  ? 341  HIS A C     1 
ATOM   707  O O     . HIS C 3 46  ? 1.038   19.383 -7.449  1.00 34.58  ? 341  HIS A O     1 
ATOM   708  C CB    . HIS C 3 46  ? 0.048   22.224 -7.615  1.00 32.05  ? 341  HIS A CB    1 
ATOM   709  C CG    . HIS C 3 46  ? -1.017  23.233 -7.901  1.00 33.29  ? 341  HIS A CG    1 
ATOM   710  N ND1   . HIS C 3 46  ? -2.260  22.878 -8.375  1.00 35.67  ? 341  HIS A ND1   1 
ATOM   711  C CD2   . HIS C 3 46  ? -1.033  24.579 -7.789  1.00 35.45  ? 341  HIS A CD2   1 
ATOM   712  C CE1   . HIS C 3 46  ? -3.004  23.965 -8.514  1.00 36.89  ? 341  HIS A CE1   1 
ATOM   713  N NE2   . HIS C 3 46  ? -2.275  25.022 -8.165  1.00 33.33  ? 341  HIS A NE2   1 
ATOM   714  N N     . GLY C 3 47  ? 1.215   19.915 -5.261  1.00 31.13  ? 342  GLY A N     1 
ATOM   715  C CA    . GLY C 3 47  ? 2.323   18.978 -4.993  1.00 26.65  ? 342  GLY A CA    1 
ATOM   716  C C     . GLY C 3 47  ? 3.457   19.568 -4.172  1.00 26.69  ? 342  GLY A C     1 
ATOM   717  O O     . GLY C 3 47  ? 3.244   20.571 -3.424  1.00 26.31  ? 342  GLY A O     1 
ATOM   718  N N     . ARG C 3 48  ? 4.619   18.913 -4.257  1.00 24.87  ? 343  ARG A N     1 
ATOM   719  C CA    . ARG C 3 48  ? 5.812   19.182 -3.430  1.00 24.86  ? 343  ARG A CA    1 
ATOM   720  C C     . ARG C 3 48  ? 7.001   19.505 -4.338  1.00 24.78  ? 343  ARG A C     1 
ATOM   721  O O     . ARG C 3 48  ? 7.291   18.694 -5.217  1.00 22.17  ? 343  ARG A O     1 
ATOM   722  C CB    . ARG C 3 48  ? 6.163   17.969 -2.570  1.00 25.39  ? 343  ARG A CB    1 
ATOM   723  C CG    . ARG C 3 48  ? 4.962   17.278 -1.938  1.00 25.33  ? 343  ARG A CG    1 
ATOM   724  C CD    . ARG C 3 48  ? 5.425   16.488 -0.734  1.00 26.33  ? 343  ARG A CD    1 
ATOM   725  N NE    . ARG C 3 48  ? 4.354   15.622 -0.285  1.00 29.88  ? 343  ARG A NE    1 
ATOM   726  C CZ    . ARG C 3 48  ? 4.126   14.375 -0.693  1.00 28.88  ? 343  ARG A CZ    1 
ATOM   727  N NH1   . ARG C 3 48  ? 4.922   13.768 -1.562  1.00 29.07  ? 343  ARG A NH1   1 
ATOM   728  N NH2   . ARG C 3 48  ? 3.087   13.729 -0.198  1.00 27.96  ? 343  ARG A NH2   1 
ATOM   729  N N     . PHE C 3 49  ? 7.706   20.594 -4.024  1.00 22.98  ? 344  PHE A N     1 
ATOM   730  C CA    . PHE C 3 49  ? 8.770   21.194 -4.846  1.00 24.17  ? 344  PHE A CA    1 
ATOM   731  C C     . PHE C 3 49  ? 9.946   21.604 -3.962  1.00 25.34  ? 344  PHE A C     1 
ATOM   732  O O     . PHE C 3 49  ? 9.730   22.210 -2.881  1.00 26.19  ? 344  PHE A O     1 
ATOM   733  C CB    . PHE C 3 49  ? 8.200   22.412 -5.568  1.00 24.16  ? 344  PHE A CB    1 
ATOM   734  C CG    . PHE C 3 49  ? 6.883   22.176 -6.264  1.00 24.98  ? 344  PHE A CG    1 
ATOM   735  C CD1   . PHE C 3 49  ? 6.844   21.655 -7.559  1.00 25.59  ? 344  PHE A CD1   1 
ATOM   736  C CD2   . PHE C 3 49  ? 5.688   22.516 -5.645  1.00 24.21  ? 344  PHE A CD2   1 
ATOM   737  C CE1   . PHE C 3 49  ? 5.636   21.453 -8.204  1.00 24.10  ? 344  PHE A CE1   1 
ATOM   738  C CE2   . PHE C 3 49  ? 4.481   22.346 -6.304  1.00 24.58  ? 344  PHE A CE2   1 
ATOM   739  C CZ    . PHE C 3 49  ? 4.456   21.810 -7.581  1.00 25.37  ? 344  PHE A CZ    1 
ATOM   740  N N     . PHE C 3 50  ? 11.153  21.251 -4.395  1.00 23.53  ? 345  PHE A N     1 
ATOM   741  C CA    . PHE C 3 50  ? 12.411  21.854 -3.910  1.00 23.33  ? 345  PHE A CA    1 
ATOM   742  C C     . PHE C 3 50  ? 12.976  22.712 -5.045  1.00 23.67  ? 345  PHE A C     1 
ATOM   743  O O     . PHE C 3 50  ? 12.933  22.324 -6.231  1.00 24.33  ? 345  PHE A O     1 
ATOM   744  C CB    . PHE C 3 50  ? 13.367  20.777 -3.418  1.00 23.80  ? 345  PHE A CB    1 
ATOM   745  C CG    . PHE C 3 50  ? 14.767  21.268 -3.173  1.00 24.80  ? 345  PHE A CG    1 
ATOM   746  C CD1   . PHE C 3 50  ? 15.691  21.324 -4.211  1.00 26.27  ? 345  PHE A CD1   1 
ATOM   747  C CD2   . PHE C 3 50  ? 15.181  21.624 -1.907  1.00 24.86  ? 345  PHE A CD2   1 
ATOM   748  C CE1   . PHE C 3 50  ? 16.985  21.782 -3.994  1.00 26.60  ? 345  PHE A CE1   1 
ATOM   749  C CE2   . PHE C 3 50  ? 16.478  22.072 -1.691  1.00 26.39  ? 345  PHE A CE2   1 
ATOM   750  C CZ    . PHE C 3 50  ? 17.374  22.166 -2.734  1.00 25.42  ? 345  PHE A CZ    1 
ATOM   751  N N     . LEU C 3 51  ? 13.434  23.900 -4.682  1.00 25.84  ? 346  LEU A N     1 
ATOM   752  C CA    . LEU C 3 51  ? 14.118  24.865 -5.577  1.00 26.09  ? 346  LEU A CA    1 
ATOM   753  C C     . LEU C 3 51  ? 15.470  25.212 -4.988  1.00 25.52  ? 346  LEU A C     1 
ATOM   754  O O     . LEU C 3 51  ? 15.545  25.407 -3.757  1.00 26.58  ? 346  LEU A O     1 
ATOM   755  C CB    . LEU C 3 51  ? 13.292  26.136 -5.643  1.00 27.97  ? 346  LEU A CB    1 
ATOM   756  C CG    . LEU C 3 51  ? 11.995  26.008 -6.409  1.00 29.21  ? 346  LEU A CG    1 
ATOM   757  C CD1   . LEU C 3 51  ? 11.065  27.151 -6.048  1.00 28.56  ? 346  LEU A CD1   1 
ATOM   758  C CD2   . LEU C 3 51  ? 12.284  25.961 -7.905  1.00 31.05  ? 346  LEU A CD2   1 
ATOM   759  N N     . ARG C 3 52  ? 16.469  25.361 -5.847  1.00 27.70  ? 347  ARG A N     1 
ATOM   760  C CA    . ARG C 3 52  ? 17.783  25.896 -5.453  1.00 28.51  ? 347  ARG A CA    1 
ATOM   761  C C     . ARG C 3 52  ? 17.572  27.386 -5.264  1.00 26.97  ? 347  ARG A C     1 
ATOM   762  O O     . ARG C 3 52  ? 16.880  28.038 -6.039  1.00 27.16  ? 347  ARG A O     1 
ATOM   763  C CB    . ARG C 3 52  ? 18.851  25.547 -6.493  1.00 33.47  ? 347  ARG A CB    1 
ATOM   764  C CG    . ARG C 3 52  ? 19.003  24.057 -6.762  1.00 35.79  ? 347  ARG A CG    1 
ATOM   765  C CD    . ARG C 3 52  ? 20.071  23.707 -7.799  1.00 39.10  ? 347  ARG A CD    1 
ATOM   766  N NE    . ARG C 3 52  ? 19.967  22.281 -8.088  1.00 43.01  ? 347  ARG A NE    1 
ATOM   767  C CZ    . ARG C 3 52  ? 19.094  21.727 -8.934  1.00 46.23  ? 347  ARG A CZ    1 
ATOM   768  N NH1   . ARG C 3 52  ? 18.264  22.471 -9.655  1.00 45.89  ? 347  ARG A NH1   1 
ATOM   769  N NH2   . ARG C 3 52  ? 19.060  20.412 -9.054  1.00 43.89  ? 347  ARG A NH2   1 
ATOM   770  N N     . PRO C 3 53  ? 18.139  27.976 -4.207  1.00 26.83  ? 348  PRO A N     1 
ATOM   771  C CA    . PRO C 3 53  ? 17.896  29.388 -3.909  1.00 28.40  ? 348  PRO A CA    1 
ATOM   772  C C     . PRO C 3 53  ? 18.458  30.375 -4.955  1.00 29.60  ? 348  PRO A C     1 
ATOM   773  O O     . PRO C 3 53  ? 17.812  31.393 -5.172  1.00 28.50  ? 348  PRO A O     1 
ATOM   774  C CB    . PRO C 3 53  ? 18.595  29.547 -2.550  1.00 29.74  ? 348  PRO A CB    1 
ATOM   775  C CG    . PRO C 3 53  ? 19.733  28.525 -2.623  1.00 30.86  ? 348  PRO A CG    1 
ATOM   776  C CD    . PRO C 3 53  ? 19.113  27.335 -3.322  1.00 27.45  ? 348  PRO A CD    1 
ATOM   777  N N     . GLU C 3 54  ? 19.619  30.090 -5.575  1.00 33.45  ? 349  GLU A N     1 
ATOM   778  C CA    . GLU C 3 54  ? 20.204  30.973 -6.643  1.00 39.52  ? 349  GLU A CA    1 
ATOM   779  C C     . GLU C 3 54  ? 19.215  31.063 -7.806  1.00 34.55  ? 349  GLU A C     1 
ATOM   780  O O     . GLU C 3 54  ? 19.157  32.092 -8.422  1.00 40.85  ? 349  GLU A O     1 
ATOM   781  C CB    . GLU C 3 54  ? 21.518  30.493 -7.278  1.00 45.67  ? 349  GLU A CB    1 
ATOM   782  C CG    . GLU C 3 54  ? 22.401  29.633 -6.392  1.00 53.42  ? 349  GLU A CG    1 
ATOM   783  C CD    . GLU C 3 54  ? 21.975  28.169 -6.309  1.00 53.88  ? 349  GLU A CD    1 
ATOM   784  O OE1   . GLU C 3 54  ? 22.303  27.390 -7.244  1.00 48.88  ? 349  GLU A OE1   1 
ATOM   785  O OE2   . GLU C 3 54  ? 21.294  27.818 -5.318  1.00 48.71  ? 349  GLU A OE2   1 
ATOM   786  N N     . THR C 3 55  ? 18.500  29.982 -8.097  1.00 35.85  ? 350  THR A N     1 
ATOM   787  C CA    . THR C 3 55  ? 17.376  29.930 -9.063  1.00 36.38  ? 350  THR A CA    1 
ATOM   788  C C     . THR C 3 55  ? 16.199  30.752 -8.520  1.00 35.76  ? 350  THR A C     1 
ATOM   789  O O     . THR C 3 55  ? 15.826  31.764 -9.158  1.00 34.16  ? 350  THR A O     1 
ATOM   790  C CB    . THR C 3 55  ? 16.923  28.481 -9.308  1.00 38.16  ? 350  THR A CB    1 
ATOM   791  O OG1   . THR C 3 55  ? 18.036  27.746 -9.811  1.00 40.44  ? 350  THR A OG1   1 
ATOM   792  C CG2   . THR C 3 55  ? 15.752  28.350 -10.265 1.00 38.89  ? 350  THR A CG2   1 
ATOM   793  N N     . ALA C 3 56  ? 15.594  30.321 -7.404  1.00 32.66  ? 351  ALA A N     1 
ATOM   794  C CA    . ALA C 3 56  ? 14.282  30.851 -6.954  1.00 28.40  ? 351  ALA A CA    1 
ATOM   795  C C     . ALA C 3 56  ? 14.409  32.344 -6.633  1.00 27.45  ? 351  ALA A C     1 
ATOM   796  O O     . ALA C 3 56  ? 13.543  33.102 -7.042  1.00 22.47  ? 351  ALA A O     1 
ATOM   797  C CB    . ALA C 3 56  ? 13.763  30.080 -5.774  1.00 28.50  ? 351  ALA A CB    1 
ATOM   798  N N     . LEU C 3 57  ? 15.455  32.750 -5.927  1.00 26.66  ? 352  LEU A N     1 
ATOM   799  C CA    . LEU C 3 57  ? 15.570  34.153 -5.459  1.00 29.89  ? 352  LEU A CA    1 
ATOM   800  C C     . LEU C 3 57  ? 15.953  35.119 -6.599  1.00 29.79  ? 352  LEU A C     1 
ATOM   801  O O     . LEU C 3 57  ? 15.789  36.323 -6.396  1.00 30.50  ? 352  LEU A O     1 
ATOM   802  C CB    . LEU C 3 57  ? 16.562  34.187 -4.298  1.00 28.22  ? 352  LEU A CB    1 
ATOM   803  C CG    . LEU C 3 57  ? 16.125  33.362 -3.094  1.00 29.96  ? 352  LEU A CG    1 
ATOM   804  C CD1   . LEU C 3 57  ? 17.094  33.527 -1.935  1.00 33.11  ? 352  LEU A CD1   1 
ATOM   805  C CD2   . LEU C 3 57  ? 14.729  33.743 -2.662  1.00 29.90  ? 352  LEU A CD2   1 
ATOM   806  N N     . ALA C 3 58  ? 16.412  34.630 -7.747  1.00 30.03  ? 353  ALA A N     1 
ATOM   807  C CA    . ALA C 3 58  ? 16.731  35.457 -8.938  1.00 34.74  ? 353  ALA A CA    1 
ATOM   808  C C     . ALA C 3 58  ? 15.531  35.501 -9.887  1.00 34.03  ? 353  ALA A C     1 
ATOM   809  O O     . ALA C 3 58  ? 15.576  36.263 -10.873 1.00 36.83  ? 353  ALA A O     1 
ATOM   810  C CB    . ALA C 3 58  ? 17.945  34.901 -9.657  1.00 34.82  ? 353  ALA A CB    1 
ATOM   811  N N     . ASP C 3 59  ? 14.514  34.680 -9.627  1.00 31.98  ? 354  ASP A N     1 
ATOM   812  C CA    . ASP C 3 59  ? 13.290  34.606 -10.460 1.00 30.48  ? 354  ASP A CA    1 
ATOM   813  C C     . ASP C 3 59  ? 12.320  35.692 -10.016 1.00 30.31  ? 354  ASP A C     1 
ATOM   814  O O     . ASP C 3 59  ? 11.804  35.624 -8.912  1.00 34.72  ? 354  ASP A O     1 
ATOM   815  C CB    . ASP C 3 59  ? 12.671  33.211 -10.407 1.00 30.25  ? 354  ASP A CB    1 
ATOM   816  C CG    . ASP C 3 59  ? 11.444  33.119 -11.292 1.00 33.17  ? 354  ASP A CG    1 
ATOM   817  O OD1   . ASP C 3 59  ? 10.514  33.924 -11.078 1.00 34.56  ? 354  ASP A OD1   1 
ATOM   818  O OD2   . ASP C 3 59  ? 11.447  32.286 -12.217 1.00 39.79  ? 354  ASP A OD2   1 
ATOM   819  N N     . PRO C 3 60  ? 11.978  36.686 -10.870 1.00 31.24  ? 355  PRO A N     1 
ATOM   820  C CA    . PRO C 3 60  ? 11.034  37.743 -10.489 1.00 31.13  ? 355  PRO A CA    1 
ATOM   821  C C     . PRO C 3 60  ? 9.627   37.289 -10.063 1.00 28.51  ? 355  PRO A C     1 
ATOM   822  O O     . PRO C 3 60  ? 9.035   37.950 -9.253  1.00 27.02  ? 355  PRO A O     1 
ATOM   823  C CB    . PRO C 3 60  ? 10.887  38.584 -11.776 1.00 30.42  ? 355  PRO A CB    1 
ATOM   824  C CG    . PRO C 3 60  ? 12.160  38.302 -12.544 1.00 31.05  ? 355  PRO A CG    1 
ATOM   825  C CD    . PRO C 3 60  ? 12.478  36.857 -12.247 1.00 32.25  ? 355  PRO A CD    1 
ATOM   826  N N     . GLN C 3 61  ? 9.116   36.212 -10.656 1.00 29.16  ? 356  GLN A N     1 
ATOM   827  C CA    . GLN C 3 61  ? 7.777   35.646 -10.340 1.00 33.19  ? 356  GLN A CA    1 
ATOM   828  C C     . GLN C 3 61  ? 7.794   35.114 -8.896  1.00 29.22  ? 356  GLN A C     1 
ATOM   829  O O     . GLN C 3 61  ? 6.821   35.398 -8.170  1.00 29.36  ? 356  GLN A O     1 
ATOM   830  C CB    . GLN C 3 61  ? 7.362   34.548 -11.335 1.00 38.13  ? 356  GLN A CB    1 
ATOM   831  C CG    . GLN C 3 61  ? 6.949   35.062 -12.724 1.00 44.16  ? 356  GLN A CG    1 
ATOM   832  C CD    . GLN C 3 61  ? 8.166   35.327 -13.583 1.00 51.95  ? 356  GLN A CD    1 
ATOM   833  O OE1   . GLN C 3 61  ? 8.990   34.436 -13.812 1.00 55.04  ? 356  GLN A OE1   1 
ATOM   834  N NE2   . GLN C 3 61  ? 8.310   36.568 -14.035 1.00 53.46  ? 356  GLN A NE2   1 
ATOM   835  N N     . PHE C 3 62  ? 8.850   34.395 -8.500  1.00 24.38  ? 357  PHE A N     1 
ATOM   836  C CA    . PHE C 3 62  ? 8.990   33.816 -7.141  1.00 25.91  ? 357  PHE A CA    1 
ATOM   837  C C     . PHE C 3 62  ? 9.107   34.936 -6.108  1.00 25.12  ? 357  PHE A C     1 
ATOM   838  O O     . PHE C 3 62  ? 8.348   34.940 -5.142  1.00 25.60  ? 357  PHE A O     1 
ATOM   839  C CB    . PHE C 3 62  ? 10.183  32.866 -7.051  1.00 27.61  ? 357  PHE A CB    1 
ATOM   840  C CG    . PHE C 3 62  ? 10.158  32.073 -5.776  1.00 29.68  ? 357  PHE A CG    1 
ATOM   841  C CD1   . PHE C 3 62  ? 9.209   31.072 -5.596  1.00 31.08  ? 357  PHE A CD1   1 
ATOM   842  C CD2   . PHE C 3 62  ? 10.987  32.405 -4.713  1.00 28.51  ? 357  PHE A CD2   1 
ATOM   843  C CE1   . PHE C 3 62  ? 9.154   30.355 -4.408  1.00 30.51  ? 357  PHE A CE1   1 
ATOM   844  C CE2   . PHE C 3 62  ? 10.901  31.710 -3.515  1.00 28.75  ? 357  PHE A CE2   1 
ATOM   845  C CZ    . PHE C 3 62  ? 10.009  30.674 -3.373  1.00 28.01  ? 357  PHE A CZ    1 
ATOM   846  N N     . VAL C 3 63  ? 10.012  35.880 -6.341  1.00 24.94  ? 358  VAL A N     1 
ATOM   847  C CA    . VAL C 3 63  ? 10.220  37.082 -5.479  1.00 25.29  ? 358  VAL A CA    1 
ATOM   848  C C     . VAL C 3 63  ? 8.875   37.808 -5.294  1.00 26.08  ? 358  VAL A C     1 
ATOM   849  O O     . VAL C 3 63  ? 8.568   38.201 -4.131  1.00 23.30  ? 358  VAL A O     1 
ATOM   850  C CB    . VAL C 3 63  ? 11.312  38.015 -6.055  1.00 25.43  ? 358  VAL A CB    1 
ATOM   851  C CG1   . VAL C 3 63  ? 11.392  39.349 -5.337  1.00 24.57  ? 358  VAL A CG1   1 
ATOM   852  C CG2   . VAL C 3 63  ? 12.687  37.350 -6.068  1.00 26.37  ? 358  VAL A CG2   1 
ATOM   853  N N     . ALA C 3 64  ? 8.106   38.031 -6.368  1.00 24.75  ? 359  ALA A N     1 
ATOM   854  C CA    . ALA C 3 64  ? 6.829   38.779 -6.248  1.00 26.39  ? 359  ALA A CA    1 
ATOM   855  C C     . ALA C 3 64  ? 5.846   37.922 -5.432  1.00 24.33  ? 359  ALA A C     1 
ATOM   856  O O     . ALA C 3 64  ? 5.125   38.484 -4.616  1.00 26.88  ? 359  ALA A O     1 
ATOM   857  C CB    . ALA C 3 64  ? 6.257   39.158 -7.606  1.00 28.17  ? 359  ALA A CB    1 
ATOM   858  N N     . TRP C 3 65  ? 5.861   36.603 -5.606  1.00 22.51  ? 360  TRP A N     1 
ATOM   859  C CA    . TRP C 3 65  ? 4.990   35.692 -4.826  1.00 22.44  ? 360  TRP A CA    1 
ATOM   860  C C     . TRP C 3 65  ? 5.364   35.788 -3.336  1.00 20.88  ? 360  TRP A C     1 
ATOM   861  O O     . TRP C 3 65  ? 4.448   35.923 -2.516  1.00 20.90  ? 360  TRP A O     1 
ATOM   862  C CB    . TRP C 3 65  ? 5.041   34.266 -5.382  1.00 22.77  ? 360  TRP A CB    1 
ATOM   863  C CG    . TRP C 3 65  ? 4.303   33.260 -4.543  1.00 23.56  ? 360  TRP A CG    1 
ATOM   864  C CD1   . TRP C 3 65  ? 2.975   32.935 -4.592  1.00 23.21  ? 360  TRP A CD1   1 
ATOM   865  C CD2   . TRP C 3 65  ? 4.877   32.432 -3.513  1.00 22.75  ? 360  TRP A CD2   1 
ATOM   866  N NE1   . TRP C 3 65  ? 2.694   31.942 -3.689  1.00 21.68  ? 360  TRP A NE1   1 
ATOM   867  C CE2   . TRP C 3 65  ? 3.841   31.612 -3.017  1.00 21.81  ? 360  TRP A CE2   1 
ATOM   868  C CE3   . TRP C 3 65  ? 6.170   32.291 -2.990  1.00 23.50  ? 360  TRP A CE3   1 
ATOM   869  C CZ2   . TRP C 3 65  ? 4.048   30.688 -2.001  1.00 21.85  ? 360  TRP A CZ2   1 
ATOM   870  C CZ3   . TRP C 3 65  ? 6.381   31.345 -2.009  1.00 24.46  ? 360  TRP A CZ3   1 
ATOM   871  C CH2   . TRP C 3 65  ? 5.324   30.571 -1.506  1.00 23.47  ? 360  TRP A CH2   1 
ATOM   872  N N     . LEU C 3 66  ? 6.657   35.785 -3.011  1.00 20.04  ? 361  LEU A N     1 
ATOM   873  C CA    . LEU C 3 66  ? 7.156   35.944 -1.624  1.00 20.04  ? 361  LEU A CA    1 
ATOM   874  C C     . LEU C 3 66  ? 6.599   37.230 -1.043  1.00 21.13  ? 361  LEU A C     1 
ATOM   875  O O     . LEU C 3 66  ? 6.132   37.178 0.116   1.00 23.47  ? 361  LEU A O     1 
ATOM   876  C CB    . LEU C 3 66  ? 8.682   36.000 -1.603  1.00 19.75  ? 361  LEU A CB    1 
ATOM   877  C CG    . LEU C 3 66  ? 9.402   34.680 -1.814  1.00 19.86  ? 361  LEU A CG    1 
ATOM   878  C CD1   . LEU C 3 66  ? 10.905  34.933 -1.920  1.00 20.79  ? 361  LEU A CD1   1 
ATOM   879  C CD2   . LEU C 3 66  ? 9.095   33.677 -0.702  1.00 18.17  ? 361  LEU A CD2   1 
ATOM   880  N N     . GLY C 3 67  ? 6.659   38.323 -1.817  1.00 20.08  ? 362  GLY A N     1 
ATOM   881  C CA    . GLY C 3 67  ? 6.235   39.661 -1.373  1.00 20.84  ? 362  GLY A CA    1 
ATOM   882  C C     . GLY C 3 67  ? 4.723   39.885 -1.421  1.00 21.01  ? 362  GLY A C     1 
ATOM   883  O O     . GLY C 3 67  ? 4.269   40.949 -1.009  1.00 18.02  ? 362  GLY A O     1 
ATOM   884  N N     . ASP C 3 68  ? 3.943   38.939 -1.924  1.00 24.53  ? 363  ASP A N     1 
ATOM   885  C CA    . ASP C 3 68  ? 2.481   39.154 -2.116  1.00 25.53  ? 363  ASP A CA    1 
ATOM   886  C C     . ASP C 3 68  ? 1.755   38.733 -0.835  1.00 25.81  ? 363  ASP A C     1 
ATOM   887  O O     . ASP C 3 68  ? 1.626   37.534 -0.611  1.00 23.72  ? 363  ASP A O     1 
ATOM   888  C CB    . ASP C 3 68  ? 1.958   38.384 -3.338  1.00 27.21  ? 363  ASP A CB    1 
ATOM   889  C CG    . ASP C 3 68  ? 0.558   38.790 -3.791  1.00 28.63  ? 363  ASP A CG    1 
ATOM   890  O OD1   . ASP C 3 68  ? -0.239  39.251 -2.935  1.00 28.25  ? 363  ASP A OD1   1 
ATOM   891  O OD2   . ASP C 3 68  ? 0.265   38.601 -4.994  1.00 29.76  ? 363  ASP A OD2   1 
ATOM   892  N N     . GLU C 3 69  ? 1.296   39.705 -0.056  1.00 26.15  ? 364  GLU A N     1 
ATOM   893  C CA    . GLU C 3 69  ? 0.436   39.543 1.142   1.00 29.81  ? 364  GLU A CA    1 
ATOM   894  C C     . GLU C 3 69  ? -0.743  38.589 0.889   1.00 28.95  ? 364  GLU A C     1 
ATOM   895  O O     . GLU C 3 69  ? -1.231  37.989 1.868   1.00 28.11  ? 364  GLU A O     1 
ATOM   896  C CB    . GLU C 3 69  ? -0.109  40.917 1.527   1.00 34.51  ? 364  GLU A CB    1 
ATOM   897  C CG    . GLU C 3 69  ? -0.582  41.015 2.955   1.00 43.97  ? 364  GLU A CG    1 
ATOM   898  C CD    . GLU C 3 69  ? -0.396  42.420 3.508   1.00 54.54  ? 364  GLU A CD    1 
ATOM   899  O OE1   . GLU C 3 69  ? -0.342  43.386 2.681   1.00 49.78  ? 364  GLU A OE1   1 
ATOM   900  O OE2   . GLU C 3 69  ? -0.248  42.547 4.754   1.00 57.58  ? 364  GLU A OE2   1 
ATOM   901  N N     . THR C 3 70  ? -1.262  38.502 -0.337  1.00 27.06  ? 365  THR A N     1 
ATOM   902  C CA    . THR C 3 70  ? -2.494  37.722 -0.626  1.00 26.85  ? 365  THR A CA    1 
ATOM   903  C C     . THR C 3 70  ? -2.118  36.279 -0.936  1.00 24.37  ? 365  THR A C     1 
ATOM   904  O O     . THR C 3 70  ? -3.029  35.466 -1.117  1.00 26.91  ? 365  THR A O     1 
ATOM   905  C CB    . THR C 3 70  ? -3.333  38.332 -1.758  1.00 27.23  ? 365  THR A CB    1 
ATOM   906  O OG1   . THR C 3 70  ? -2.608  38.214 -2.979  1.00 25.65  ? 365  THR A OG1   1 
ATOM   907  C CG2   . THR C 3 70  ? -3.671  39.786 -1.503  1.00 28.17  ? 365  THR A CG2   1 
ATOM   908  N N     . LYS C 3 71  ? -0.835  35.984 -1.047  1.00 23.62  ? 366  LYS A N     1 
ATOM   909  C CA    . LYS C 3 71  ? -0.344  34.601 -1.229  1.00 24.38  ? 366  LYS A CA    1 
ATOM   910  C C     . LYS C 3 71  ? 0.080   34.103 0.144   1.00 24.82  ? 366  LYS A C     1 
ATOM   911  O O     . LYS C 3 71  ? 1.123   34.553 0.599   1.00 27.47  ? 366  LYS A O     1 
ATOM   912  C CB    . LYS C 3 71  ? 0.796   34.580 -2.240  1.00 25.65  ? 366  LYS A CB    1 
ATOM   913  C CG    . LYS C 3 71  ? 0.466   35.229 -3.575  1.00 27.72  ? 366  LYS A CG    1 
ATOM   914  C CD    . LYS C 3 71  ? -0.509  34.472 -4.461  1.00 31.30  ? 366  LYS A CD    1 
ATOM   915  C CE    . LYS C 3 71  ? -0.773  35.218 -5.759  1.00 34.12  ? 366  LYS A CE    1 
ATOM   916  N NZ    . LYS C 3 71  ? -2.220  35.343 -6.030  1.00 35.96  ? 366  LYS A NZ    1 
ATOM   917  N N     . LYS C 3 72  ? -0.749  33.282 0.794   1.00 24.17  ? 367  LYS A N     1 
ATOM   918  C CA    . LYS C 3 72  ? -0.600  32.939 2.225   1.00 23.73  ? 367  LYS A CA    1 
ATOM   919  C C     . LYS C 3 72  ? 0.430   31.819 2.353   1.00 22.60  ? 367  LYS A C     1 
ATOM   920  O O     . LYS C 3 72  ? 0.349   30.854 1.568   1.00 22.02  ? 367  LYS A O     1 
ATOM   921  C CB    . LYS C 3 72  ? -1.943  32.533 2.832   1.00 25.12  ? 367  LYS A CB    1 
ATOM   922  C CG    . LYS C 3 72  ? -3.031  33.583 2.676   1.00 26.12  ? 367  LYS A CG    1 
ATOM   923  C CD    . LYS C 3 72  ? -2.574  34.993 2.997   1.00 29.04  ? 367  LYS A CD    1 
ATOM   924  C CE    . LYS C 3 72  ? -3.735  35.958 3.170   1.00 29.61  ? 367  LYS A CE    1 
ATOM   925  N NZ    . LYS C 3 72  ? -3.300  37.202 3.832   1.00 29.86  ? 367  LYS A NZ    1 
ATOM   926  N N     . LYS C 3 73  ? 1.355   31.960 3.298   1.00 20.51  ? 368  LYS A N     1 
ATOM   927  C CA    . LYS C 3 73  ? 2.401   30.947 3.571   1.00 21.20  ? 368  LYS A CA    1 
ATOM   928  C C     . LYS C 3 73  ? 2.291   30.495 5.024   1.00 20.27  ? 368  LYS A C     1 
ATOM   929  O O     . LYS C 3 73  ? 2.033   31.351 5.910   1.00 19.84  ? 368  LYS A O     1 
ATOM   930  C CB    . LYS C 3 73  ? 3.806   31.496 3.316   1.00 20.76  ? 368  LYS A CB    1 
ATOM   931  C CG    . LYS C 3 73  ? 4.066   31.948 1.880   1.00 21.47  ? 368  LYS A CG    1 
ATOM   932  C CD    . LYS C 3 73  ? 3.926   33.442 1.694   1.00 21.23  ? 368  LYS A CD    1 
ATOM   933  C CE    . LYS C 3 73  ? 4.043   33.888 0.251   1.00 21.70  ? 368  LYS A CE    1 
ATOM   934  N NZ    . LYS C 3 73  ? 3.722   35.328 0.078   1.00 21.24  ? 368  LYS A NZ    1 
ATOM   935  N N     . SER C 3 74  ? 2.467   29.193 5.209   1.00 18.43  ? 369  SER A N     1 
ATOM   936  C CA    . SER C 3 74  ? 2.659   28.506 6.492   1.00 17.70  ? 369  SER A CA    1 
ATOM   937  C C     . SER C 3 74  ? 4.132   28.147 6.628   1.00 16.31  ? 369  SER A C     1 
ATOM   938  O O     . SER C 3 74  ? 4.698   27.559 5.700   1.00 15.81  ? 369  SER A O     1 
ATOM   939  C CB    . SER C 3 74  ? 1.758   27.343 6.563   1.00 18.62  ? 369  SER A CB    1 
ATOM   940  O OG    . SER C 3 74  ? 0.423   27.827 6.481   1.00 22.54  ? 369  SER A OG    1 
ATOM   941  N N     . MET C 3 75  ? 4.742   28.559 7.729   1.00 15.69  ? 370  MET A N     1 
ATOM   942  C CA    . MET C 3 75  ? 6.197   28.397 7.940   1.00 15.80  ? 370  MET A CA    1 
ATOM   943  C C     . MET C 3 75  ? 6.456   27.901 9.364   1.00 16.26  ? 370  MET A C     1 
ATOM   944  O O     . MET C 3 75  ? 5.513   27.836 10.194  1.00 14.39  ? 370  MET A O     1 
ATOM   945  C CB    . MET C 3 75  ? 6.927   29.710 7.684   1.00 15.49  ? 370  MET A CB    1 
ATOM   946  C CG    . MET C 3 75  ? 6.639   30.260 6.289   1.00 16.43  ? 370  MET A CG    1 
ATOM   947  S SD    . MET C 3 75  ? 7.713   31.618 5.748   1.00 17.51  ? 370  MET A SD    1 
ATOM   948  C CE    . MET C 3 75  ? 9.290   30.787 5.621   1.00 16.60  ? 370  MET A CE    1 
ATOM   949  N N     . PHE C 3 76  ? 7.686   27.485 9.601   1.00 15.83  ? 371  PHE A N     1 
ATOM   950  C CA    . PHE C 3 76  ? 8.246   27.387 10.960  1.00 16.38  ? 371  PHE A CA    1 
ATOM   951  C C     . PHE C 3 76  ? 9.395   28.383 11.081  1.00 17.73  ? 371  PHE A C     1 
ATOM   952  O O     . PHE C 3 76  ? 10.343  28.279 10.287  1.00 20.11  ? 371  PHE A O     1 
ATOM   953  C CB    . PHE C 3 76  ? 8.685   25.952 11.206  1.00 15.67  ? 371  PHE A CB    1 
ATOM   954  C CG    . PHE C 3 76  ? 9.262   25.686 12.572  1.00 14.91  ? 371  PHE A CG    1 
ATOM   955  C CD1   . PHE C 3 76  ? 10.569  26.047 12.875  1.00 13.47  ? 371  PHE A CD1   1 
ATOM   956  C CD2   . PHE C 3 76  ? 8.521   25.009 13.527  1.00 14.61  ? 371  PHE A CD2   1 
ATOM   957  C CE1   . PHE C 3 76  ? 11.115  25.731 14.111  1.00 13.03  ? 371  PHE A CE1   1 
ATOM   958  C CE2   . PHE C 3 76  ? 9.074   24.693 14.765  1.00 14.16  ? 371  PHE A CE2   1 
ATOM   959  C CZ    . PHE C 3 76  ? 10.360  25.082 15.062  1.00 13.16  ? 371  PHE A CZ    1 
ATOM   960  N N     . ASP C 3 77  ? 9.325   29.270 12.071  1.00 18.39  ? 372  ASP A N     1 
ATOM   961  C CA    . ASP C 3 77  ? 10.339  30.320 12.381  1.00 17.64  ? 372  ASP A CA    1 
ATOM   962  C C     . ASP C 3 77  ? 10.441  31.260 11.182  1.00 16.93  ? 372  ASP A C     1 
ATOM   963  O O     . ASP C 3 77  ? 11.559  31.375 10.617  1.00 16.71  ? 372  ASP A O     1 
ATOM   964  C CB    . ASP C 3 77  ? 11.716  29.741 12.721  1.00 19.03  ? 372  ASP A CB    1 
ATOM   965  C CG    . ASP C 3 77  ? 12.672  30.751 13.366  1.00 20.19  ? 372  ASP A CG    1 
ATOM   966  O OD1   . ASP C 3 77  ? 12.311  31.923 13.448  1.00 20.30  ? 372  ASP A OD1   1 
ATOM   967  O OD2   . ASP C 3 77  ? 13.801  30.360 13.764  1.00 21.35  ? 372  ASP A OD2   1 
ATOM   968  N N     . SER C 3 78  ? 9.333   31.926 10.842  1.00 15.75  ? 373  SER A N     1 
ATOM   969  C CA    . SER C 3 78  ? 9.241   32.845 9.683   1.00 16.27  ? 373  SER A CA    1 
ATOM   970  C C     . SER C 3 78  ? 10.207  34.030 9.889   1.00 16.66  ? 373  SER A C     1 
ATOM   971  O O     . SER C 3 78  ? 10.820  34.442 8.921   1.00 18.28  ? 373  SER A O     1 
ATOM   972  C CB    . SER C 3 78  ? 7.828   33.279 9.446   1.00 15.69  ? 373  SER A CB    1 
ATOM   973  O OG    . SER C 3 78  ? 7.297   33.882 10.607  1.00 15.73  ? 373  SER A OG    1 
ATOM   974  N N     . LYS C 3 79  ? 10.475  34.456 11.119  1.00 15.62  ? 374  LYS A N     1 
ATOM   975  C CA    . LYS C 3 79  ? 11.430  35.563 11.373  1.00 15.90  ? 374  LYS A CA    1 
ATOM   976  C C     . LYS C 3 79  ? 12.815  35.256 10.783  1.00 16.65  ? 374  LYS A C     1 
ATOM   977  O O     . LYS C 3 79  ? 13.396  36.163 10.180  1.00 17.25  ? 374  LYS A O     1 
ATOM   978  C CB    . LYS C 3 79  ? 11.600  35.833 12.865  1.00 15.80  ? 374  LYS A CB    1 
ATOM   979  C CG    . LYS C 3 79  ? 12.463  37.038 13.178  1.00 16.03  ? 374  LYS A CG    1 
ATOM   980  C CD    . LYS C 3 79  ? 12.195  37.654 14.539  1.00 15.80  ? 374  LYS A CD    1 
ATOM   981  C CE    . LYS C 3 79  ? 12.352  36.707 15.703  1.00 15.96  ? 374  LYS A CE    1 
ATOM   982  N NZ    . LYS C 3 79  ? 13.776  36.375 15.970  1.00 15.84  ? 374  LYS A NZ    1 
ATOM   983  N N     . ARG C 3 80  ? 13.320  34.040 10.957  1.00 16.41  ? 375  ARG A N     1 
ATOM   984  C CA    . ARG C 3 80  ? 14.642  33.597 10.438  1.00 16.35  ? 375  ARG A CA    1 
ATOM   985  C C     . ARG C 3 80  ? 14.654  33.811 8.922   1.00 15.63  ? 375  ARG A C     1 
ATOM   986  O O     . ARG C 3 80  ? 15.608  34.387 8.428   1.00 15.42  ? 375  ARG A O     1 
ATOM   987  C CB    . ARG C 3 80  ? 14.890  32.148 10.886  1.00 16.66  ? 375  ARG A CB    1 
ATOM   988  C CG    . ARG C 3 80  ? 15.886  31.305 10.097  1.00 17.73  ? 375  ARG A CG    1 
ATOM   989  C CD    . ARG C 3 80  ? 15.977  29.868 10.700  1.00 18.42  ? 375  ARG A CD    1 
ATOM   990  N NE    . ARG C 3 80  ? 16.632  30.000 11.980  1.00 17.81  ? 375  ARG A NE    1 
ATOM   991  C CZ    . ARG C 3 80  ? 17.946  30.018 12.163  1.00 19.83  ? 375  ARG A CZ    1 
ATOM   992  N NH1   . ARG C 3 80  ? 18.779  29.802 11.157  1.00 20.27  ? 375  ARG A NH1   1 
ATOM   993  N NH2   . ARG C 3 80  ? 18.430  30.252 13.368  1.00 19.33  ? 375  ARG A NH2   1 
ATOM   994  N N     . ALA C 3 81  ? 13.620  33.364 8.220   1.00 15.79  ? 376  ALA A N     1 
ATOM   995  C CA    . ALA C 3 81  ? 13.503  33.486 6.752   1.00 14.61  ? 376  ALA A CA    1 
ATOM   996  C C     . ALA C 3 81  ? 13.366  34.961 6.412   1.00 14.79  ? 376  ALA A C     1 
ATOM   997  O O     . ALA C 3 81  ? 14.052  35.431 5.481   1.00 13.45  ? 376  ALA A O     1 
ATOM   998  C CB    . ALA C 3 81  ? 12.325  32.722 6.240   1.00 14.44  ? 376  ALA A CB    1 
ATOM   999  N N     . ALA C 3 82  ? 12.503  35.668 7.147   1.00 14.42  ? 377  ALA A N     1 
ATOM   1000 C CA    . ALA C 3 82  ? 12.217  37.089 6.863   1.00 15.17  ? 377  ALA A CA    1 
ATOM   1001 C C     . ALA C 3 82  ? 13.531  37.881 6.903   1.00 15.73  ? 377  ALA A C     1 
ATOM   1002 O O     . ALA C 3 82  ? 13.785  38.693 6.001   1.00 15.93  ? 377  ALA A O     1 
ATOM   1003 C CB    . ALA C 3 82  ? 11.225  37.653 7.842   1.00 15.48  ? 377  ALA A CB    1 
ATOM   1004 N N     . VAL C 3 83  ? 14.329  37.658 7.936   1.00 15.01  ? 378  VAL A N     1 
ATOM   1005 C CA    . VAL C 3 83  ? 15.556  38.446 8.152   1.00 15.18  ? 378  VAL A CA    1 
ATOM   1006 C C     . VAL C 3 83  ? 16.591  38.040 7.101   1.00 15.90  ? 378  VAL A C     1 
ATOM   1007 O O     . VAL C 3 83  ? 17.148  38.952 6.489   1.00 14.28  ? 378  VAL A O     1 
ATOM   1008 C CB    . VAL C 3 83  ? 16.089  38.296 9.577   1.00 15.57  ? 378  VAL A CB    1 
ATOM   1009 C CG1   . VAL C 3 83  ? 17.451  38.978 9.696   1.00 16.04  ? 378  VAL A CG1   1 
ATOM   1010 C CG2   . VAL C 3 83  ? 15.094  38.868 10.565  1.00 15.36  ? 378  VAL A CG2   1 
ATOM   1011 N N     . ALA C 3 84  ? 16.828  36.739 6.879   1.00 14.76  ? 379  ALA A N     1 
ATOM   1012 C CA    . ALA C 3 84  ? 17.806  36.315 5.855   1.00 15.49  ? 379  ALA A CA    1 
ATOM   1013 C C     . ALA C 3 84  ? 17.391  36.914 4.507   1.00 15.41  ? 379  ALA A C     1 
ATOM   1014 O O     . ALA C 3 84  ? 18.276  37.267 3.708   1.00 15.29  ? 379  ALA A O     1 
ATOM   1015 C CB    . ALA C 3 84  ? 17.923  34.812 5.794   1.00 15.91  ? 379  ALA A CB    1 
ATOM   1016 N N     . LEU C 3 85  ? 16.095  36.994 4.223   1.00 16.42  ? 380  LEU A N     1 
ATOM   1017 C CA    . LEU C 3 85  ? 15.615  37.576 2.936   1.00 16.93  ? 380  LEU A CA    1 
ATOM   1018 C C     . LEU C 3 85  ? 15.821  39.097 2.959   1.00 16.46  ? 380  LEU A C     1 
ATOM   1019 O O     . LEU C 3 85  ? 16.251  39.641 1.945   1.00 17.08  ? 380  LEU A O     1 
ATOM   1020 C CB    . LEU C 3 85  ? 14.164  37.176 2.686   1.00 16.35  ? 380  LEU A CB    1 
ATOM   1021 C CG    . LEU C 3 85  ? 13.983  35.715 2.246   1.00 16.60  ? 380  LEU A CG    1 
ATOM   1022 C CD1   . LEU C 3 85  ? 12.523  35.306 2.265   1.00 16.27  ? 380  LEU A CD1   1 
ATOM   1023 C CD2   . LEU C 3 85  ? 14.547  35.441 0.874   1.00 16.76  ? 380  LEU A CD2   1 
ATOM   1024 N N     . LYS C 3 86  ? 15.601  39.768 4.087   1.00 16.60  ? 381  LYS A N     1 
ATOM   1025 C CA    . LYS C 3 86  ? 15.852  41.230 4.175   1.00 17.55  ? 381  LYS A CA    1 
ATOM   1026 C C     . LYS C 3 86  ? 17.317  41.541 3.821   1.00 17.72  ? 381  LYS A C     1 
ATOM   1027 O O     . LYS C 3 86  ? 17.569  42.564 3.144   1.00 16.68  ? 381  LYS A O     1 
ATOM   1028 C CB    . LYS C 3 86  ? 15.567  41.776 5.569   1.00 18.55  ? 381  LYS A CB    1 
ATOM   1029 C CG    . LYS C 3 86  ? 14.127  42.109 5.887   1.00 18.99  ? 381  LYS A CG    1 
ATOM   1030 C CD    . LYS C 3 86  ? 14.004  42.552 7.337   1.00 21.65  ? 381  LYS A CD    1 
ATOM   1031 C CE    . LYS C 3 86  ? 12.579  42.489 7.873   1.00 21.51  ? 381  LYS A CE    1 
ATOM   1032 N NZ    . LYS C 3 86  ? 11.730  43.455 7.147   1.00 22.81  ? 381  LYS A NZ    1 
ATOM   1033 N N     . TRP C 3 87  ? 18.257  40.726 4.286   1.00 16.86  ? 382  TRP A N     1 
ATOM   1034 C CA    . TRP C 3 87  ? 19.687  40.952 3.985   1.00 18.61  ? 382  TRP A CA    1 
ATOM   1035 C C     . TRP C 3 87  ? 19.949  40.820 2.478   1.00 19.08  ? 382  TRP A C     1 
ATOM   1036 O O     . TRP C 3 87  ? 20.959  41.336 2.046   1.00 19.59  ? 382  TRP A O     1 
ATOM   1037 C CB    . TRP C 3 87  ? 20.574  40.015 4.800   1.00 17.58  ? 382  TRP A CB    1 
ATOM   1038 C CG    . TRP C 3 87  ? 20.765  40.450 6.208   1.00 16.53  ? 382  TRP A CG    1 
ATOM   1039 C CD1   . TRP C 3 87  ? 20.050  40.019 7.274   1.00 16.29  ? 382  TRP A CD1   1 
ATOM   1040 C CD2   . TRP C 3 87  ? 21.739  41.379 6.716   1.00 17.14  ? 382  TRP A CD2   1 
ATOM   1041 N NE1   . TRP C 3 87  ? 20.504  40.608 8.415   1.00 17.20  ? 382  TRP A NE1   1 
ATOM   1042 C CE2   . TRP C 3 87  ? 21.553  41.433 8.113   1.00 15.88  ? 382  TRP A CE2   1 
ATOM   1043 C CE3   . TRP C 3 87  ? 22.771  42.139 6.149   1.00 17.18  ? 382  TRP A CE3   1 
ATOM   1044 C CZ2   . TRP C 3 87  ? 22.350  42.214 8.941   1.00 15.50  ? 382  TRP A CZ2   1 
ATOM   1045 C CZ3   . TRP C 3 87  ? 23.582  42.901 6.970   1.00 16.74  ? 382  TRP A CZ3   1 
ATOM   1046 C CH2   . TRP C 3 87  ? 23.358  42.950 8.344   1.00 17.15  ? 382  TRP A CH2   1 
ATOM   1047 N N     . LYS C 3 88  ? 19.059  40.180 1.725   1.00 20.03  ? 383  LYS A N     1 
ATOM   1048 C CA    . LYS C 3 88  ? 19.171  40.000 0.251   1.00 21.43  ? 383  LYS A CA    1 
ATOM   1049 C C     . LYS C 3 88  ? 18.250  40.990 -0.464  1.00 21.90  ? 383  LYS A C     1 
ATOM   1050 O O     . LYS C 3 88  ? 18.143  40.896 -1.677  1.00 22.92  ? 383  LYS A O     1 
ATOM   1051 C CB    . LYS C 3 88  ? 18.835  38.554 -0.131  1.00 22.64  ? 383  LYS A CB    1 
ATOM   1052 C CG    . LYS C 3 88  ? 19.897  37.529 0.254   1.00 23.14  ? 383  LYS A CG    1 
ATOM   1053 C CD    . LYS C 3 88  ? 19.448  36.112 -0.007  1.00 25.32  ? 383  LYS A CD    1 
ATOM   1054 C CE    . LYS C 3 88  ? 20.451  35.065 0.438   1.00 26.27  ? 383  LYS A CE    1 
ATOM   1055 N NZ    . LYS C 3 88  ? 21.614  34.978 -0.478  1.00 26.37  ? 383  LYS A NZ    1 
ATOM   1056 N N     . GLY C 3 89  ? 17.625  41.921 0.261   1.00 22.40  ? 384  GLY A N     1 
ATOM   1057 C CA    . GLY C 3 89  ? 16.735  42.948 -0.320  1.00 21.41  ? 384  GLY A CA    1 
ATOM   1058 C C     . GLY C 3 89  ? 15.427  42.335 -0.783  1.00 23.79  ? 384  GLY A C     1 
ATOM   1059 O O     . GLY C 3 89  ? 14.872  42.869 -1.730  1.00 24.98  ? 384  GLY A O     1 
ATOM   1060 N N     . ILE C 3 90  ? 14.953  41.247 -0.148  1.00 22.37  ? 385  ILE A N     1 
ATOM   1061 C CA    . ILE C 3 90  ? 13.705  40.540 -0.558  1.00 22.65  ? 385  ILE A CA    1 
ATOM   1062 C C     . ILE C 3 90  ? 12.699  40.586 0.598   1.00 22.51  ? 385  ILE A C     1 
ATOM   1063 O O     . ILE C 3 90  ? 13.049  40.217 1.720   1.00 22.55  ? 385  ILE A O     1 
ATOM   1064 C CB    . ILE C 3 90  ? 14.027  39.109 -1.024  1.00 23.72  ? 385  ILE A CB    1 
ATOM   1065 C CG1   . ILE C 3 90  ? 14.863  39.120 -2.308  1.00 22.17  ? 385  ILE A CG1   1 
ATOM   1066 C CG2   . ILE C 3 90  ? 12.766  38.250 -1.190  1.00 23.52  ? 385  ILE A CG2   1 
ATOM   1067 C CD1   . ILE C 3 90  ? 15.387  37.765 -2.705  1.00 20.96  ? 385  ILE A CD1   1 
ATOM   1068 N N     . GLU C 3 91  ? 11.488  41.063 0.328   1.00 23.73  ? 386  GLU A N     1 
ATOM   1069 C CA    . GLU C 3 91  ? 10.399  41.183 1.331   1.00 23.90  ? 386  GLU A CA    1 
ATOM   1070 C C     . GLU C 3 91  ? 9.596   39.870 1.333   1.00 21.91  ? 386  GLU A C     1 
ATOM   1071 O O     . GLU C 3 91  ? 9.234   39.374 0.239   1.00 23.44  ? 386  GLU A O     1 
ATOM   1072 C CB    . GLU C 3 91  ? 9.548   42.409 1.008   1.00 28.85  ? 386  GLU A CB    1 
ATOM   1073 C CG    . GLU C 3 91  ? 8.872   43.002 2.234   1.00 36.12  ? 386  GLU A CG    1 
ATOM   1074 C CD    . GLU C 3 91  ? 7.759   44.014 1.993   1.00 39.41  ? 386  GLU A CD    1 
ATOM   1075 O OE1   . GLU C 3 91  ? 7.387   44.702 2.971   1.00 42.63  ? 386  GLU A OE1   1 
ATOM   1076 O OE2   . GLU C 3 91  ? 7.219   44.068 0.855   1.00 40.25  ? 386  GLU A OE2   1 
ATOM   1077 N N     . LEU C 3 92  ? 9.394   39.289 2.509   1.00 19.30  ? 387  LEU A N     1 
ATOM   1078 C CA    . LEU C 3 92  ? 8.469   38.169 2.745   1.00 20.00  ? 387  LEU A CA    1 
ATOM   1079 C C     . LEU C 3 92  ? 7.186   38.721 3.354   1.00 20.12  ? 387  LEU A C     1 
ATOM   1080 O O     . LEU C 3 92  ? 7.271   39.272 4.442   1.00 22.11  ? 387  LEU A O     1 
ATOM   1081 C CB    . LEU C 3 92  ? 9.130   37.161 3.690   1.00 20.24  ? 387  LEU A CB    1 
ATOM   1082 C CG    . LEU C 3 92  ? 8.281   35.953 4.128   1.00 19.53  ? 387  LEU A CG    1 
ATOM   1083 C CD1   . LEU C 3 92  ? 7.938   35.034 2.949   1.00 18.63  ? 387  LEU A CD1   1 
ATOM   1084 C CD2   . LEU C 3 92  ? 9.028   35.155 5.193   1.00 19.06  ? 387  LEU A CD2   1 
ATOM   1085 N N     . CYS C 3 93  ? 6.038   38.501 2.716   1.00 21.07  ? 388  CYS A N     1 
ATOM   1086 C CA    . CYS C 3 93  ? 4.697   38.828 3.273   1.00 22.39  ? 388  CYS A CA    1 
ATOM   1087 C C     . CYS C 3 93  ? 3.798   37.588 3.171   1.00 22.16  ? 388  CYS A C     1 
ATOM   1088 O O     . CYS C 3 93  ? 4.197   36.553 2.537   1.00 21.20  ? 388  CYS A O     1 
ATOM   1089 C CB    . CYS C 3 93  ? 4.089   40.037 2.553   1.00 24.88  ? 388  CYS A CB    1 
ATOM   1090 S SG    . CYS C 3 93  ? 5.192   41.485 2.425   1.00 28.02  ? 388  CYS A SG    1 
ATOM   1091 N N     . GLY C 3 94  ? 2.631   37.680 3.802   1.00 21.95  ? 389  GLY A N     1 
ATOM   1092 C CA    . GLY C 3 94  ? 1.533   36.696 3.733   1.00 20.46  ? 389  GLY A CA    1 
ATOM   1093 C C     . GLY C 3 94  ? 1.772   35.461 4.590   1.00 19.17  ? 389  GLY A C     1 
ATOM   1094 O O     . GLY C 3 94  ? 1.106   34.423 4.348   1.00 18.28  ? 389  GLY A O     1 
ATOM   1095 N N     . VAL C 3 95  ? 2.645   35.553 5.592   1.00 18.52  ? 390  VAL A N     1 
ATOM   1096 C CA    . VAL C 3 95  ? 2.865   34.415 6.513   1.00 18.76  ? 390  VAL A CA    1 
ATOM   1097 C C     . VAL C 3 95  ? 1.705   34.437 7.512   1.00 18.66  ? 390  VAL A C     1 
ATOM   1098 O O     . VAL C 3 95  ? 1.704   35.294 8.402   1.00 18.19  ? 390  VAL A O     1 
ATOM   1099 C CB    . VAL C 3 95  ? 4.244   34.473 7.178   1.00 19.99  ? 390  VAL A CB    1 
ATOM   1100 C CG1   . VAL C 3 95  ? 4.397   33.302 8.113   1.00 20.56  ? 390  VAL A CG1   1 
ATOM   1101 C CG2   . VAL C 3 95  ? 5.359   34.486 6.136   1.00 20.73  ? 390  VAL A CG2   1 
ATOM   1102 N N     . SER C 3 96  ? 0.748   33.536 7.326   1.00 16.95  ? 391  SER A N     1 
ATOM   1103 C CA    . SER C 3 96  ? -0.540  33.501 8.068   1.00 17.60  ? 391  SER A CA    1 
ATOM   1104 C C     . SER C 3 96  ? -0.455  32.467 9.182   1.00 16.31  ? 391  SER A C     1 
ATOM   1105 O O     . SER C 3 96  ? -1.286  32.507 10.051  1.00 16.90  ? 391  SER A O     1 
ATOM   1106 C CB    . SER C 3 96  ? -1.720  33.216 7.157   1.00 16.90  ? 391  SER A CB    1 
ATOM   1107 O OG    . SER C 3 96  ? -1.500  32.009 6.434   1.00 16.64  ? 391  SER A OG    1 
ATOM   1108 N N     . PHE C 3 97  ? 0.585   31.643 9.210   1.00 17.66  ? 392  PHE A N     1 
ATOM   1109 C CA    . PHE C 3 97  ? 0.752   30.618 10.269  1.00 17.13  ? 392  PHE A CA    1 
ATOM   1110 C C     . PHE C 3 97  ? 2.224   30.254 10.421  1.00 17.59  ? 392  PHE A C     1 
ATOM   1111 O O     . PHE C 3 97  ? 2.842   29.841 9.417   1.00 16.95  ? 392  PHE A O     1 
ATOM   1112 C CB    . PHE C 3 97  ? -0.092  29.392 9.956   1.00 16.70  ? 392  PHE A CB    1 
ATOM   1113 C CG    . PHE C 3 97  ? 0.113   28.265 10.925  1.00 17.55  ? 392  PHE A CG    1 
ATOM   1114 C CD1   . PHE C 3 97  ? -0.602  28.213 12.108  1.00 17.41  ? 392  PHE A CD1   1 
ATOM   1115 C CD2   . PHE C 3 97  ? 1.008   27.252 10.642  1.00 16.18  ? 392  PHE A CD2   1 
ATOM   1116 C CE1   . PHE C 3 97  ? -0.416  27.163 12.988  1.00 16.92  ? 392  PHE A CE1   1 
ATOM   1117 C CE2   . PHE C 3 97  ? 1.230   26.237 11.553  1.00 16.70  ? 392  PHE A CE2   1 
ATOM   1118 C CZ    . PHE C 3 97  ? 0.512   26.195 12.719  1.00 16.15  ? 392  PHE A CZ    1 
ATOM   1119 N N     . ASP C 3 98  ? 2.718   30.378 11.659  1.00 17.07  ? 393  ASP A N     1 
ATOM   1120 C CA    . ASP C 3 98  ? 4.098   30.042 12.073  1.00 16.23  ? 393  ASP A CA    1 
ATOM   1121 C C     . ASP C 3 98  ? 4.012   28.947 13.132  1.00 16.20  ? 393  ASP A C     1 
ATOM   1122 O O     . ASP C 3 98  ? 3.645   29.246 14.307  1.00 16.68  ? 393  ASP A O     1 
ATOM   1123 C CB    . ASP C 3 98  ? 4.824   31.295 12.549  1.00 15.79  ? 393  ASP A CB    1 
ATOM   1124 C CG    . ASP C 3 98  ? 6.305   31.077 12.799  1.00 15.47  ? 393  ASP A CG    1 
ATOM   1125 O OD1   . ASP C 3 98  ? 6.676   29.962 13.217  1.00 15.92  ? 393  ASP A OD1   1 
ATOM   1126 O OD2   . ASP C 3 98  ? 7.077   32.012 12.535  1.00 15.56  ? 393  ASP A OD2   1 
ATOM   1127 N N     . LEU C 3 99  ? 4.375   27.723 12.740  1.00 15.93  ? 394  LEU A N     1 
ATOM   1128 C CA    . LEU C 3 99  ? 4.277   26.511 13.584  1.00 14.73  ? 394  LEU A CA    1 
ATOM   1129 C C     . LEU C 3 99  ? 5.120   26.666 14.854  1.00 15.17  ? 394  LEU A C     1 
ATOM   1130 O O     . LEU C 3 99  ? 4.655   26.169 15.930  1.00 13.64  ? 394  LEU A O     1 
ATOM   1131 C CB    . LEU C 3 99  ? 4.765   25.334 12.758  1.00 15.25  ? 394  LEU A CB    1 
ATOM   1132 C CG    . LEU C 3 99  ? 4.711   23.955 13.398  1.00 14.99  ? 394  LEU A CG    1 
ATOM   1133 C CD1   . LEU C 3 99  ? 3.314   23.627 13.895  1.00 15.93  ? 394  LEU A CD1   1 
ATOM   1134 C CD2   . LEU C 3 99  ? 5.156   22.922 12.382  1.00 15.27  ? 394  LEU A CD2   1 
ATOM   1135 N N     . LEU C 3 100 ? 6.329   27.256 14.757  1.00 14.36  ? 395  LEU A N     1 
ATOM   1136 C CA    . LEU C 3 100 ? 7.165   27.509 15.969  1.00 13.67  ? 395  LEU A CA    1 
ATOM   1137 C C     . LEU C 3 100 ? 6.329   28.297 16.982  1.00 12.97  ? 395  LEU A C     1 
ATOM   1138 O O     . LEU C 3 100 ? 6.259   27.905 18.127  1.00 12.53  ? 395  LEU A O     1 
ATOM   1139 C CB    . LEU C 3 100 ? 8.432   28.288 15.618  1.00 14.45  ? 395  LEU A CB    1 
ATOM   1140 C CG    . LEU C 3 100 ? 9.226   28.794 16.826  1.00 15.63  ? 395  LEU A CG    1 
ATOM   1141 C CD1   . LEU C 3 100 ? 9.778   27.641 17.680  1.00 14.81  ? 395  LEU A CD1   1 
ATOM   1142 C CD2   . LEU C 3 100 ? 10.358  29.719 16.396  1.00 16.24  ? 395  LEU A CD2   1 
ATOM   1143 N N     . LEU C 3 101 ? 5.674   29.374 16.561  1.00 13.19  ? 396  LEU A N     1 
ATOM   1144 C CA    . LEU C 3 101 ? 4.935   30.242 17.517  1.00 13.60  ? 396  LEU A CA    1 
ATOM   1145 C C     . LEU C 3 101 ? 3.679   29.505 18.008  1.00 14.66  ? 396  LEU A C     1 
ATOM   1146 O O     . LEU C 3 101 ? 3.332   29.665 19.197  1.00 14.86  ? 396  LEU A O     1 
ATOM   1147 C CB    . LEU C 3 101 ? 4.634   31.570 16.831  1.00 13.51  ? 396  LEU A CB    1 
ATOM   1148 C CG    . LEU C 3 101 ? 5.886   32.372 16.499  1.00 14.28  ? 396  LEU A CG    1 
ATOM   1149 C CD1   . LEU C 3 101 ? 5.512   33.695 15.837  1.00 14.77  ? 396  LEU A CD1   1 
ATOM   1150 C CD2   . LEU C 3 101 ? 6.747   32.572 17.752  1.00 14.09  ? 396  LEU A CD2   1 
ATOM   1151 N N     . ALA C 3 102 ? 3.073   28.669 17.154  1.00 14.80  ? 397  ALA A N     1 
ATOM   1152 C CA    . ALA C 3 102 ? 1.850   27.914 17.490  1.00 15.95  ? 397  ALA A CA    1 
ATOM   1153 C C     . ALA C 3 102 ? 2.211   26.936 18.616  1.00 16.06  ? 397  ALA A C     1 
ATOM   1154 O O     . ALA C 3 102 ? 1.533   26.923 19.638  1.00 15.39  ? 397  ALA A O     1 
ATOM   1155 C CB    . ALA C 3 102 ? 1.276   27.222 16.282  1.00 15.45  ? 397  ALA A CB    1 
ATOM   1156 N N     . ALA C 3 103 ? 3.285   26.188 18.442  1.00 16.17  ? 398  ALA A N     1 
ATOM   1157 C CA    . ALA C 3 103 ? 3.743   25.185 19.422  1.00 16.42  ? 398  ALA A CA    1 
ATOM   1158 C C     . ALA C 3 103 ? 4.142   25.888 20.719  1.00 16.56  ? 398  ALA A C     1 
ATOM   1159 O O     . ALA C 3 103 ? 3.894   25.356 21.798  1.00 16.49  ? 398  ALA A O     1 
ATOM   1160 C CB    . ALA C 3 103 ? 4.896   24.406 18.867  1.00 15.77  ? 398  ALA A CB    1 
ATOM   1161 N N     . TYR C 3 104 ? 4.817   27.015 20.601  1.00 16.23  ? 399  TYR A N     1 
ATOM   1162 C CA    . TYR C 3 104 ? 5.236   27.785 21.784  1.00 16.86  ? 399  TYR A CA    1 
ATOM   1163 C C     . TYR C 3 104 ? 4.002   28.194 22.617  1.00 16.50  ? 399  TYR A C     1 
ATOM   1164 O O     . TYR C 3 104 ? 4.053   28.074 23.830  1.00 15.78  ? 399  TYR A O     1 
ATOM   1165 C CB    . TYR C 3 104 ? 6.033   28.989 21.318  1.00 16.60  ? 399  TYR A CB    1 
ATOM   1166 C CG    . TYR C 3 104 ? 6.462   29.906 22.418  1.00 16.49  ? 399  TYR A CG    1 
ATOM   1167 C CD1   . TYR C 3 104 ? 7.298   29.453 23.423  1.00 16.43  ? 399  TYR A CD1   1 
ATOM   1168 C CD2   . TYR C 3 104 ? 6.031   31.223 22.444  1.00 17.09  ? 399  TYR A CD2   1 
ATOM   1169 C CE1   . TYR C 3 104 ? 7.719   30.296 24.435  1.00 16.72  ? 399  TYR A CE1   1 
ATOM   1170 C CE2   . TYR C 3 104 ? 6.428   32.069 23.461  1.00 17.75  ? 399  TYR A CE2   1 
ATOM   1171 C CZ    . TYR C 3 104 ? 7.292   31.613 24.442  1.00 16.67  ? 399  TYR A CZ    1 
ATOM   1172 O OH    . TYR C 3 104 ? 7.701   32.470 25.419  1.00 16.79  ? 399  TYR A OH    1 
ATOM   1173 N N     . LEU C 3 105 ? 2.948   28.721 22.006  1.00 15.75  ? 400  LEU A N     1 
ATOM   1174 C CA    . LEU C 3 105 ? 1.766   29.144 22.786  1.00 15.63  ? 400  LEU A CA    1 
ATOM   1175 C C     . LEU C 3 105 ? 1.107   27.910 23.396  1.00 17.22  ? 400  LEU A C     1 
ATOM   1176 O O     . LEU C 3 105 ? 0.756   28.020 24.551  1.00 16.95  ? 400  LEU A O     1 
ATOM   1177 C CB    . LEU C 3 105 ? 0.785   29.940 21.926  1.00 14.83  ? 400  LEU A CB    1 
ATOM   1178 C CG    . LEU C 3 105 ? 1.310   31.287 21.448  1.00 13.71  ? 400  LEU A CG    1 
ATOM   1179 C CD1   . LEU C 3 105 ? 0.289   31.972 20.563  1.00 13.24  ? 400  LEU A CD1   1 
ATOM   1180 C CD2   . LEU C 3 105 ? 1.701   32.175 22.638  1.00 13.61  ? 400  LEU A CD2   1 
ATOM   1181 N N     . LEU C 3 106 ? 0.996   26.787 22.671  1.00 18.42  ? 401  LEU A N     1 
ATOM   1182 C CA    . LEU C 3 106 ? 0.307   25.558 23.183  1.00 19.52  ? 401  LEU A CA    1 
ATOM   1183 C C     . LEU C 3 106 ? 1.068   24.973 24.362  1.00 18.97  ? 401  LEU A C     1 
ATOM   1184 O O     . LEU C 3 106 ? 0.409   24.424 25.264  1.00 20.13  ? 401  LEU A O     1 
ATOM   1185 C CB    . LEU C 3 106 ? 0.193   24.469 22.110  1.00 18.62  ? 401  LEU A CB    1 
ATOM   1186 C CG    . LEU C 3 106 ? -0.833  24.720 21.011  1.00 18.83  ? 401  LEU A CG    1 
ATOM   1187 C CD1   . LEU C 3 106 ? -0.977  23.464 20.157  1.00 20.02  ? 401  LEU A CD1   1 
ATOM   1188 C CD2   . LEU C 3 106 ? -2.176  25.138 21.580  1.00 17.38  ? 401  LEU A CD2   1 
ATOM   1189 N N     . ASP C 3 107 ? 2.397   25.032 24.330  1.00 18.66  ? 402  ASP A N     1 
ATOM   1190 C CA    . ASP C 3 107 ? 3.216   24.473 25.435  1.00 19.39  ? 402  ASP A CA    1 
ATOM   1191 C C     . ASP C 3 107 ? 4.669   24.908 25.327  1.00 18.03  ? 402  ASP A C     1 
ATOM   1192 O O     . ASP C 3 107 ? 5.469   24.229 24.696  1.00 16.97  ? 402  ASP A O     1 
ATOM   1193 C CB    . ASP C 3 107 ? 3.150   22.949 25.500  1.00 19.51  ? 402  ASP A CB    1 
ATOM   1194 C CG    . ASP C 3 107 ? 3.741   22.390 26.776  1.00 22.64  ? 402  ASP A CG    1 
ATOM   1195 O OD1   . ASP C 3 107 ? 4.180   23.190 27.694  1.00 22.34  ? 402  ASP A OD1   1 
ATOM   1196 O OD2   . ASP C 3 107 ? 3.747   21.166 26.870  1.00 28.29  ? 402  ASP A OD2   1 
ATOM   1197 N N     . PRO C 3 108 ? 5.047   25.967 26.075  1.00 17.57  ? 403  PRO A N     1 
ATOM   1198 C CA    . PRO C 3 108 ? 6.412   26.465 26.091  1.00 19.96  ? 403  PRO A CA    1 
ATOM   1199 C C     . PRO C 3 108 ? 7.424   25.467 26.671  1.00 21.52  ? 403  PRO A C     1 
ATOM   1200 O O     . PRO C 3 108 ? 8.576   25.615 26.305  1.00 22.64  ? 403  PRO A O     1 
ATOM   1201 C CB    . PRO C 3 108 ? 6.379   27.780 26.910  1.00 19.66  ? 403  PRO A CB    1 
ATOM   1202 C CG    . PRO C 3 108 ? 4.987   27.882 27.486  1.00 19.07  ? 403  PRO A CG    1 
ATOM   1203 C CD    . PRO C 3 108 ? 4.130   26.803 26.852  1.00 18.23  ? 403  PRO A CD    1 
ATOM   1204 N N     . ALA C 3 109 ? 6.998   24.491 27.486  1.00 21.42  ? 404  ALA A N     1 
ATOM   1205 C CA    . ALA C 3 109 ? 7.896   23.551 28.218  1.00 23.32  ? 404  ALA A CA    1 
ATOM   1206 C C     . ALA C 3 109 ? 8.480   22.488 27.267  1.00 26.64  ? 404  ALA A C     1 
ATOM   1207 O O     . ALA C 3 109 ? 9.503   21.849 27.606  1.00 25.58  ? 404  ALA A O     1 
ATOM   1208 C CB    . ALA C 3 109 ? 7.170   22.882 29.362  1.00 20.46  ? 404  ALA A CB    1 
ATOM   1209 N N     . GLN C 3 110 ? 7.844   22.305 26.117  1.00 29.53  ? 405  GLN A N     1 
ATOM   1210 C CA    . GLN C 3 110 ? 8.265   21.357 25.063  1.00 31.55  ? 405  GLN A CA    1 
ATOM   1211 C C     . GLN C 3 110 ? 9.661   21.758 24.525  1.00 33.03  ? 405  GLN A C     1 
ATOM   1212 O O     . GLN C 3 110 ? 10.389  20.872 24.076  1.00 30.60  ? 405  GLN A O     1 
ATOM   1213 C CB    . GLN C 3 110 ? 7.157   21.369 24.011  1.00 35.64  ? 405  GLN A CB    1 
ATOM   1214 C CG    . GLN C 3 110 ? 7.024   20.060 23.270  1.00 45.32  ? 405  GLN A CG    1 
ATOM   1215 C CD    . GLN C 3 110 ? 6.665   18.969 24.244  1.00 47.00  ? 405  GLN A CD    1 
ATOM   1216 O OE1   . GLN C 3 110 ? 5.793   19.142 25.100  1.00 48.08  ? 405  GLN A OE1   1 
ATOM   1217 N NE2   . GLN C 3 110 ? 7.395   17.868 24.154  1.00 43.35  ? 405  GLN A NE2   1 
ATOM   1218 N N     . GLY C 3 111 ? 10.036  23.046 24.575  1.00 33.62  ? 406  GLY A N     1 
ATOM   1219 C CA    . GLY C 3 111 ? 11.295  23.556 23.998  1.00 36.14  ? 406  GLY A CA    1 
ATOM   1220 C C     . GLY C 3 111 ? 11.349  23.304 22.489  1.00 35.76  ? 406  GLY A C     1 
ATOM   1221 O O     . GLY C 3 111 ? 12.425  22.944 21.993  1.00 39.11  ? 406  GLY A O     1 
ATOM   1222 N N     . VAL C 3 112 ? 10.223  23.463 21.785  1.00 32.41  ? 407  VAL A N     1 
ATOM   1223 C CA    . VAL C 3 112 ? 10.115  23.124 20.340  1.00 28.09  ? 407  VAL A CA    1 
ATOM   1224 C C     . VAL C 3 112 ? 11.057  24.067 19.595  1.00 27.62  ? 407  VAL A C     1 
ATOM   1225 O O     . VAL C 3 112 ? 10.771  25.258 19.566  1.00 26.65  ? 407  VAL A O     1 
ATOM   1226 C CB    . VAL C 3 112 ? 8.666   23.183 19.819  1.00 25.85  ? 407  VAL A CB    1 
ATOM   1227 C CG1   . VAL C 3 112 ? 8.611   23.264 18.298  1.00 25.70  ? 407  VAL A CG1   1 
ATOM   1228 C CG2   . VAL C 3 112 ? 7.847   21.989 20.291  1.00 25.93  ? 407  VAL A CG2   1 
ATOM   1229 N N     . ASP C 3 113 ? 12.166  23.543 19.073  1.00 27.35  ? 408  ASP A N     1 
ATOM   1230 C CA    . ASP C 3 113 ? 13.155  24.334 18.296  1.00 31.43  ? 408  ASP A CA    1 
ATOM   1231 C C     . ASP C 3 113 ? 13.172  23.840 16.847  1.00 28.88  ? 408  ASP A C     1 
ATOM   1232 O O     . ASP C 3 113 ? 13.841  24.507 16.028  1.00 29.66  ? 408  ASP A O     1 
ATOM   1233 C CB    . ASP C 3 113 ? 14.565  24.276 18.899  1.00 37.36  ? 408  ASP A CB    1 
ATOM   1234 C CG    . ASP C 3 113 ? 15.016  22.873 19.284  1.00 40.89  ? 408  ASP A CG    1 
ATOM   1235 O OD1   . ASP C 3 113 ? 14.165  21.920 19.254  1.00 44.19  ? 408  ASP A OD1   1 
ATOM   1236 O OD2   . ASP C 3 113 ? 16.191  22.747 19.650  1.00 44.87  ? 408  ASP A OD2   1 
ATOM   1237 N N     . ASP C 3 114 ? 12.431  22.778 16.500  1.00 23.40  ? 409  ASP A N     1 
ATOM   1238 C CA    . ASP C 3 114 ? 12.421  22.330 15.092  1.00 22.57  ? 409  ASP A CA    1 
ATOM   1239 C C     . ASP C 3 114 ? 11.067  21.738 14.730  1.00 20.47  ? 409  ASP A C     1 
ATOM   1240 O O     . ASP C 3 114 ? 10.248  21.426 15.626  1.00 18.99  ? 409  ASP A O     1 
ATOM   1241 C CB    . ASP C 3 114 ? 13.605  21.407 14.765  1.00 23.40  ? 409  ASP A CB    1 
ATOM   1242 C CG    . ASP C 3 114 ? 13.592  20.060 15.475  1.00 25.42  ? 409  ASP A CG    1 
ATOM   1243 O OD1   . ASP C 3 114 ? 12.623  19.772 16.224  1.00 27.27  ? 409  ASP A OD1   1 
ATOM   1244 O OD2   . ASP C 3 114 ? 14.575  19.346 15.322  1.00 24.57  ? 409  ASP A OD2   1 
ATOM   1245 N N     . VAL C 3 115 ? 10.862  21.591 13.428  1.00 18.86  ? 410  VAL A N     1 
ATOM   1246 C CA    . VAL C 3 115 ? 9.593   21.036 12.875  1.00 19.50  ? 410  VAL A CA    1 
ATOM   1247 C C     . VAL C 3 115 ? 9.330   19.655 13.474  1.00 16.68  ? 410  VAL A C     1 
ATOM   1248 O O     . VAL C 3 115 ? 8.218   19.459 13.940  1.00 14.33  ? 410  VAL A O     1 
ATOM   1249 C CB    . VAL C 3 115 ? 9.581   21.018 11.348  1.00 18.67  ? 410  VAL A CB    1 
ATOM   1250 C CG1   . VAL C 3 115 ? 8.338   20.287 10.860  1.00 20.50  ? 410  VAL A CG1   1 
ATOM   1251 C CG2   . VAL C 3 115 ? 9.658   22.436 10.800  1.00 18.50  ? 410  VAL A CG2   1 
ATOM   1252 N N     . ALA C 3 116 ? 10.354  18.819 13.635  1.00 16.75  ? 411  ALA A N     1 
ATOM   1253 C CA    . ALA C 3 116 ? 10.163  17.438 14.137  1.00 17.80  ? 411  ALA A CA    1 
ATOM   1254 C C     . ALA C 3 116 ? 9.510   17.477 15.521  1.00 18.55  ? 411  ALA A C     1 
ATOM   1255 O O     . ALA C 3 116 ? 8.563   16.664 15.775  1.00 21.05  ? 411  ALA A O     1 
ATOM   1256 C CB    . ALA C 3 116 ? 11.463  16.672 14.128  1.00 17.31  ? 411  ALA A CB    1 
ATOM   1257 N N     . ALA C 3 117 ? 9.990   18.343 16.410  1.00 18.17  ? 412  ALA A N     1 
ATOM   1258 C CA    . ALA C 3 117 ? 9.502   18.376 17.809  1.00 18.75  ? 412  ALA A CA    1 
ATOM   1259 C C     . ALA C 3 117 ? 8.071   18.931 17.823  1.00 17.52  ? 412  ALA A C     1 
ATOM   1260 O O     . ALA C 3 117 ? 7.274   18.444 18.632  1.00 18.17  ? 412  ALA A O     1 
ATOM   1261 C CB    . ALA C 3 117 ? 10.436  19.174 18.686  1.00 19.08  ? 412  ALA A CB    1 
ATOM   1262 N N     . ALA C 3 118 ? 7.734   19.876 16.939  1.00 15.85  ? 413  ALA A N     1 
ATOM   1263 C CA    . ALA C 3 118 ? 6.356   20.394 16.807  1.00 15.74  ? 413  ALA A CA    1 
ATOM   1264 C C     . ALA C 3 118 ? 5.434   19.282 16.317  1.00 16.19  ? 413  ALA A C     1 
ATOM   1265 O O     . ALA C 3 118 ? 4.345   19.058 16.895  1.00 17.75  ? 413  ALA A O     1 
ATOM   1266 C CB    . ALA C 3 118 ? 6.319   21.574 15.874  1.00 16.87  ? 413  ALA A CB    1 
ATOM   1267 N N     . ALA C 3 119 ? 5.871   18.566 15.293  1.00 18.32  ? 414  ALA A N     1 
ATOM   1268 C CA    . ALA C 3 119 ? 5.134   17.443 14.679  1.00 18.41  ? 414  ALA A CA    1 
ATOM   1269 C C     . ALA C 3 119 ? 4.915   16.317 15.693  1.00 19.96  ? 414  ALA A C     1 
ATOM   1270 O O     . ALA C 3 119 ? 3.867   15.635 15.629  1.00 20.61  ? 414  ALA A O     1 
ATOM   1271 C CB    . ALA C 3 119 ? 5.898   16.946 13.476  1.00 18.92  ? 414  ALA A CB    1 
ATOM   1272 N N     . LYS C 3 120 ? 5.879   16.061 16.563  1.00 22.30  ? 415  LYS A N     1 
ATOM   1273 C CA    . LYS C 3 120 ? 5.728   14.955 17.536  1.00 26.58  ? 415  LYS A CA    1 
ATOM   1274 C C     . LYS C 3 120 ? 4.558   15.310 18.483  1.00 26.29  ? 415  LYS A C     1 
ATOM   1275 O O     . LYS C 3 120 ? 3.899   14.394 18.948  1.00 26.96  ? 415  LYS A O     1 
ATOM   1276 C CB    . LYS C 3 120 ? 7.101   14.660 18.168  1.00 31.38  ? 415  LYS A CB    1 
ATOM   1277 C CG    . LYS C 3 120 ? 7.149   13.492 19.146  1.00 37.74  ? 415  LYS A CG    1 
ATOM   1278 C CD    . LYS C 3 120 ? 8.431   12.660 19.154  1.00 42.18  ? 415  LYS A CD    1 
ATOM   1279 C CE    . LYS C 3 120 ? 8.288   11.466 20.088  1.00 47.50  ? 415  LYS A CE    1 
ATOM   1280 N NZ    . LYS C 3 120 ? 9.414   10.507 20.003  1.00 50.72  ? 415  LYS A NZ    1 
ATOM   1281 N N     . MET C 3 121 ? 4.225   16.587 18.700  1.00 27.08  ? 416  MET A N     1 
ATOM   1282 C CA    . MET C 3 121 ? 3.068   16.960 19.561  1.00 29.20  ? 416  MET A CA    1 
ATOM   1283 C C     . MET C 3 121 ? 1.760   16.384 18.995  1.00 28.17  ? 416  MET A C     1 
ATOM   1284 O O     . MET C 3 121 ? 0.829   16.175 19.824  1.00 21.11  ? 416  MET A O     1 
ATOM   1285 C CB    . MET C 3 121 ? 2.904   18.475 19.730  1.00 31.25  ? 416  MET A CB    1 
ATOM   1286 C CG    . MET C 3 121 ? 4.021   19.144 20.541  1.00 35.45  ? 416  MET A CG    1 
ATOM   1287 S SD    . MET C 3 121 ? 3.935   20.976 20.375  1.00 39.73  ? 416  MET A SD    1 
ATOM   1288 C CE    . MET C 3 121 ? 2.804   21.402 21.702  1.00 46.99  ? 416  MET A CE    1 
ATOM   1289 N N     . LYS C 3 122 ? 1.675   16.164 17.668  1.00 23.41  ? 417  LYS A N     1 
ATOM   1290 C CA    . LYS C 3 122 ? 0.450   15.626 17.017  1.00 25.15  ? 417  LYS A CA    1 
ATOM   1291 C C     . LYS C 3 122 ? 0.720   14.245 16.396  1.00 22.28  ? 417  LYS A C     1 
ATOM   1292 O O     . LYS C 3 122 ? -0.035  13.872 15.521  1.00 21.51  ? 417  LYS A O     1 
ATOM   1293 C CB    . LYS C 3 122 ? -0.100  16.635 15.992  1.00 25.67  ? 417  LYS A CB    1 
ATOM   1294 C CG    . LYS C 3 122 ? -0.483  17.997 16.574  1.00 25.67  ? 417  LYS A CG    1 
ATOM   1295 C CD    . LYS C 3 122 ? -1.750  17.954 17.440  1.00 24.90  ? 417  LYS A CD    1 
ATOM   1296 C CE    . LYS C 3 122 ? -1.890  19.153 18.343  1.00 24.66  ? 417  LYS A CE    1 
ATOM   1297 N NZ    . LYS C 3 122 ? -3.048  19.004 19.253  1.00 27.05  ? 417  LYS A NZ    1 
ATOM   1298 N N     . GLN C 3 123 ? 1.698   13.475 16.880  1.00 23.24  ? 418  GLN A N     1 
ATOM   1299 C CA    . GLN C 3 123 ? 1.904   12.045 16.475  1.00 25.39  ? 418  GLN A CA    1 
ATOM   1300 C C     . GLN C 3 123 ? 2.328   11.978 14.989  1.00 24.17  ? 418  GLN A C     1 
ATOM   1301 O O     . GLN C 3 123 ? 2.073   10.966 14.327  1.00 24.11  ? 418  GLN A O     1 
ATOM   1302 C CB    . GLN C 3 123 ? 0.629   11.217 16.711  1.00 33.40  ? 418  GLN A CB    1 
ATOM   1303 C CG    . GLN C 3 123 ? -0.095  11.460 18.050  1.00 38.84  ? 418  GLN A CG    1 
ATOM   1304 C CD    . GLN C 3 123 ? 0.806   11.374 19.260  1.00 45.06  ? 418  GLN A CD    1 
ATOM   1305 O OE1   . GLN C 3 123 ? 1.474   10.359 19.512  1.00 50.22  ? 418  GLN A OE1   1 
ATOM   1306 N NE2   . GLN C 3 123 ? 0.844   12.460 20.023  1.00 47.80  ? 418  GLN A NE2   1 
ATOM   1307 N N     . TYR C 3 124 ? 2.974   13.033 14.482  1.00 21.94  ? 419  TYR A N     1 
ATOM   1308 C CA    . TYR C 3 124 ? 3.519   13.116 13.113  1.00 20.71  ? 419  TYR A CA    1 
ATOM   1309 C C     . TYR C 3 124 ? 5.031   12.933 13.210  1.00 20.39  ? 419  TYR A C     1 
ATOM   1310 O O     . TYR C 3 124 ? 5.736   13.807 13.862  1.00 19.35  ? 419  TYR A O     1 
ATOM   1311 C CB    . TYR C 3 124 ? 3.088   14.438 12.468  1.00 21.16  ? 419  TYR A CB    1 
ATOM   1312 C CG    . TYR C 3 124 ? 3.394   14.531 10.994  1.00 20.41  ? 419  TYR A CG    1 
ATOM   1313 C CD1   . TYR C 3 124 ? 4.695   14.714 10.541  1.00 18.78  ? 419  TYR A CD1   1 
ATOM   1314 C CD2   . TYR C 3 124 ? 2.380   14.434 10.055  1.00 21.49  ? 419  TYR A CD2   1 
ATOM   1315 C CE1   . TYR C 3 124 ? 4.985   14.784 9.188   1.00 18.74  ? 419  TYR A CE1   1 
ATOM   1316 C CE2   . TYR C 3 124 ? 2.652   14.475 8.696   1.00 20.94  ? 419  TYR A CE2   1 
ATOM   1317 C CZ    . TYR C 3 124 ? 3.965   14.654 8.263   1.00 19.42  ? 419  TYR A CZ    1 
ATOM   1318 O OH    . TYR C 3 124 ? 4.217   14.728 6.928   1.00 17.53  ? 419  TYR A OH    1 
ATOM   1319 N N     . GLU C 3 125 ? 5.542   11.855 12.605  1.00 19.37  ? 420  GLU A N     1 
ATOM   1320 C CA    . GLU C 3 125 ? 6.975   11.478 12.771  1.00 21.52  ? 420  GLU A CA    1 
ATOM   1321 C C     . GLU C 3 125 ? 7.672   11.272 11.425  1.00 20.55  ? 420  GLU A C     1 
ATOM   1322 O O     . GLU C 3 125 ? 8.859   10.841 11.441  1.00 19.53  ? 420  GLU A O     1 
ATOM   1323 C CB    . GLU C 3 125 ? 7.065   10.261 13.690  1.00 23.92  ? 420  GLU A CB    1 
ATOM   1324 C CG    . GLU C 3 125 ? 6.897   10.671 15.132  1.00 27.25  ? 420  GLU A CG    1 
ATOM   1325 C CD    . GLU C 3 125 ? 7.020   9.593  16.184  1.00 27.57  ? 420  GLU A CD    1 
ATOM   1326 O OE1   . GLU C 3 125 ? 7.723   8.619  15.934  1.00 28.05  ? 420  GLU A OE1   1 
ATOM   1327 O OE2   . GLU C 3 125 ? 6.415   9.769  17.266  1.00 32.34  ? 420  GLU A OE2   1 
ATOM   1328 N N     . ALA C 3 126 ? 7.011   11.607 10.310  1.00 19.48  ? 421  ALA A N     1 
ATOM   1329 C CA    . ALA C 3 126 ? 7.578   11.452 8.945   1.00 19.78  ? 421  ALA A CA    1 
ATOM   1330 C C     . ALA C 3 126 ? 8.498   12.642 8.614   1.00 19.97  ? 421  ALA A C     1 
ATOM   1331 O O     . ALA C 3 126 ? 8.434   13.209 7.479   1.00 18.39  ? 421  ALA A O     1 
ATOM   1332 C CB    . ALA C 3 126 ? 6.449   11.320 7.956   1.00 20.29  ? 421  ALA A CB    1 
ATOM   1333 N N     . VAL C 3 127 ? 9.305   13.061 9.582   1.00 18.70  ? 422  VAL A N     1 
ATOM   1334 C CA    . VAL C 3 127 ? 10.258  14.191 9.384   1.00 19.56  ? 422  VAL A CA    1 
ATOM   1335 C C     . VAL C 3 127 ? 11.357  14.026 10.425  1.00 19.13  ? 422  VAL A C     1 
ATOM   1336 O O     . VAL C 3 127 ? 11.077  13.581 11.518  1.00 22.04  ? 422  VAL A O     1 
ATOM   1337 C CB    . VAL C 3 127 ? 9.591   15.590 9.436   1.00 20.60  ? 422  VAL A CB    1 
ATOM   1338 C CG1   . VAL C 3 127 ? 8.757   15.779 10.700  1.00 19.35  ? 422  VAL A CG1   1 
ATOM   1339 C CG2   . VAL C 3 127 ? 10.632  16.719 9.291   1.00 19.60  ? 422  VAL A CG2   1 
ATOM   1340 N N     . ARG C 3 128 ? 12.588  14.322 10.064  1.00 22.07  ? 423  ARG A N     1 
ATOM   1341 C CA    . ARG C 3 128 ? 13.761  14.181 10.972  1.00 22.62  ? 423  ARG A CA    1 
ATOM   1342 C C     . ARG C 3 128 ? 13.995  15.489 11.733  1.00 20.55  ? 423  ARG A C     1 
ATOM   1343 O O     . ARG C 3 128 ? 13.675  16.581 11.249  1.00 16.48  ? 423  ARG A O     1 
ATOM   1344 C CB    . ARG C 3 128 ? 14.974  13.755 10.142  1.00 25.63  ? 423  ARG A CB    1 
ATOM   1345 C CG    . ARG C 3 128 ? 14.764  12.423 9.426   1.00 29.69  ? 423  ARG A CG    1 
ATOM   1346 C CD    . ARG C 3 128 ? 15.801  12.168 8.364   1.00 32.21  ? 423  ARG A CD    1 
ATOM   1347 N NE    . ARG C 3 128 ? 17.056  11.761 8.962   1.00 37.65  ? 423  ARG A NE    1 
ATOM   1348 C CZ    . ARG C 3 128 ? 18.261  11.924 8.405   1.00 41.68  ? 423  ARG A CZ    1 
ATOM   1349 N NH1   . ARG C 3 128 ? 18.413  12.501 7.211   1.00 41.94  ? 423  ARG A NH1   1 
ATOM   1350 N NH2   . ARG C 3 128 ? 19.316  11.489 9.067   1.00 37.97  ? 423  ARG A NH2   1 
ATOM   1351 N N     . PRO C 3 129 ? 14.512  15.391 12.980  1.00 18.80  ? 424  PRO A N     1 
ATOM   1352 C CA    . PRO C 3 129 ? 15.073  16.548 13.660  1.00 18.19  ? 424  PRO A CA    1 
ATOM   1353 C C     . PRO C 3 129 ? 16.204  17.165 12.810  1.00 20.29  ? 424  PRO A C     1 
ATOM   1354 O O     . PRO C 3 129 ? 16.958  16.450 12.186  1.00 20.06  ? 424  PRO A O     1 
ATOM   1355 C CB    . PRO C 3 129 ? 15.610  16.037 15.007  1.00 16.92  ? 424  PRO A CB    1 
ATOM   1356 C CG    . PRO C 3 129 ? 15.134  14.579 15.148  1.00 18.64  ? 424  PRO A CG    1 
ATOM   1357 C CD    . PRO C 3 129 ? 14.590  14.147 13.780  1.00 18.65  ? 424  PRO A CD    1 
ATOM   1358 N N     . ASP C 3 130 ? 16.277  18.490 12.776  1.00 20.87  ? 425  ASP A N     1 
ATOM   1359 C CA    . ASP C 3 130 ? 17.349  19.238 12.066  1.00 25.04  ? 425  ASP A CA    1 
ATOM   1360 C C     . ASP C 3 130 ? 18.735  18.698 12.505  1.00 27.00  ? 425  ASP A C     1 
ATOM   1361 O O     . ASP C 3 130 ? 19.643  18.567 11.664  1.00 26.32  ? 425  ASP A O     1 
ATOM   1362 C CB    . ASP C 3 130 ? 17.185  20.739 12.345  1.00 23.90  ? 425  ASP A CB    1 
ATOM   1363 C CG    . ASP C 3 130 ? 16.047  21.405 11.594  1.00 26.97  ? 425  ASP A CG    1 
ATOM   1364 O OD1   . ASP C 3 130 ? 15.706  20.935 10.511  1.00 26.09  ? 425  ASP A OD1   1 
ATOM   1365 O OD2   . ASP C 3 130 ? 15.533  22.426 12.093  1.00 30.76  ? 425  ASP A OD2   1 
ATOM   1366 N N     . GLU C 3 131 ? 18.897  18.400 13.790  1.00 29.03  ? 426  GLU A N     1 
ATOM   1367 C CA    . GLU C 3 131 ? 20.190  17.990 14.391  1.00 35.57  ? 426  GLU A CA    1 
ATOM   1368 C C     . GLU C 3 131 ? 20.665  16.675 13.759  1.00 31.81  ? 426  GLU A C     1 
ATOM   1369 O O     . GLU C 3 131 ? 21.877  16.532 13.476  1.00 30.73  ? 426  GLU A O     1 
ATOM   1370 C CB    . GLU C 3 131 ? 20.015  17.867 15.901  1.00 41.76  ? 426  GLU A CB    1 
ATOM   1371 C CG    . GLU C 3 131 ? 21.323  17.669 16.649  1.00 51.79  ? 426  GLU A CG    1 
ATOM   1372 C CD    . GLU C 3 131 ? 21.211  17.940 18.142  1.00 53.29  ? 426  GLU A CD    1 
ATOM   1373 O OE1   . GLU C 3 131 ? 21.349  16.980 18.907  1.00 56.14  ? 426  GLU A OE1   1 
ATOM   1374 O OE2   . GLU C 3 131 ? 20.961  19.112 18.528  1.00 55.94  ? 426  GLU A OE2   1 
ATOM   1375 N N     . ALA C 3 132 ? 19.743  15.758 13.483  1.00 26.96  ? 427  ALA A N     1 
ATOM   1376 C CA    . ALA C 3 132 ? 20.062  14.492 12.800  1.00 25.57  ? 427  ALA A CA    1 
ATOM   1377 C C     . ALA C 3 132 ? 20.529  14.799 11.364  1.00 27.24  ? 427  ALA A C     1 
ATOM   1378 O O     . ALA C 3 132 ? 21.337  14.048 10.822  1.00 27.10  ? 427  ALA A O     1 
ATOM   1379 C CB    . ALA C 3 132 ? 18.862  13.575 12.827  1.00 24.69  ? 427  ALA A CB    1 
ATOM   1380 N N     . VAL C 3 133 ? 20.001  15.828 10.709  1.00 27.22  ? 428  VAL A N     1 
ATOM   1381 C CA    . VAL C 3 133 ? 20.331  16.053 9.272   1.00 27.30  ? 428  VAL A CA    1 
ATOM   1382 C C     . VAL C 3 133 ? 21.623  16.868 9.210   1.00 28.29  ? 428  VAL A C     1 
ATOM   1383 O O     . VAL C 3 133 ? 22.456  16.564 8.382   1.00 30.31  ? 428  VAL A O     1 
ATOM   1384 C CB    . VAL C 3 133 ? 19.175  16.727 8.512   1.00 26.31  ? 428  VAL A CB    1 
ATOM   1385 C CG1   . VAL C 3 133 ? 19.489  16.913 7.041   1.00 26.74  ? 428  VAL A CG1   1 
ATOM   1386 C CG2   . VAL C 3 133 ? 17.879  15.940 8.672   1.00 25.39  ? 428  VAL A CG2   1 
ATOM   1387 N N     . TYR C 3 134 ? 21.764  17.879 10.051  1.00 29.04  ? 429  TYR A N     1 
ATOM   1388 C CA    . TYR C 3 134 ? 22.855  18.875 9.940   1.00 29.22  ? 429  TYR A CA    1 
ATOM   1389 C C     . TYR C 3 134 ? 24.023  18.503 10.858  1.00 33.65  ? 429  TYR A C     1 
ATOM   1390 O O     . TYR C 3 134 ? 25.099  19.044 10.604  1.00 31.83  ? 429  TYR A O     1 
ATOM   1391 C CB    . TYR C 3 134 ? 22.304  20.276 10.211  1.00 27.10  ? 429  TYR A CB    1 
ATOM   1392 C CG    . TYR C 3 134 ? 21.231  20.678 9.231   1.00 25.56  ? 429  TYR A CG    1 
ATOM   1393 C CD1   . TYR C 3 134 ? 21.421  20.549 7.868   1.00 25.13  ? 429  TYR A CD1   1 
ATOM   1394 C CD2   . TYR C 3 134 ? 20.028  21.192 9.672   1.00 24.03  ? 429  TYR A CD2   1 
ATOM   1395 C CE1   . TYR C 3 134 ? 20.433  20.906 6.960   1.00 25.09  ? 429  TYR A CE1   1 
ATOM   1396 C CE2   . TYR C 3 134 ? 19.046  21.581 8.781   1.00 24.92  ? 429  TYR A CE2   1 
ATOM   1397 C CZ    . TYR C 3 134 ? 19.243  21.434 7.420   1.00 23.65  ? 429  TYR A CZ    1 
ATOM   1398 O OH    . TYR C 3 134 ? 18.241  21.784 6.563   1.00 23.92  ? 429  TYR A OH    1 
ATOM   1399 N N     . GLY C 3 135 ? 23.832  17.607 11.838  1.00 35.75  ? 430  GLY A N     1 
ATOM   1400 C CA    . GLY C 3 135 ? 24.793  17.389 12.934  1.00 39.38  ? 430  GLY A CA    1 
ATOM   1401 C C     . GLY C 3 135 ? 24.768  18.567 13.898  1.00 46.99  ? 430  GLY A C     1 
ATOM   1402 O O     . GLY C 3 135 ? 23.902  19.454 13.737  1.00 45.90  ? 430  GLY A O     1 
ATOM   1403 N N     . LYS C 3 136 ? 25.686  18.607 14.862  1.00 61.02  ? 431  LYS A N     1 
ATOM   1404 C CA    . LYS C 3 136 ? 25.655  19.615 15.959  1.00 72.00  ? 431  LYS A CA    1 
ATOM   1405 C C     . LYS C 3 136 ? 27.041  20.248 16.150  1.00 73.19  ? 431  LYS A C     1 
ATOM   1406 O O     . LYS C 3 136 ? 28.060  19.527 15.996  1.00 55.29  ? 431  LYS A O     1 
ATOM   1407 C CB    . LYS C 3 136 ? 25.142  18.960 17.247  1.00 76.31  ? 431  LYS A CB    1 
ATOM   1408 C CG    . LYS C 3 136 ? 25.641  17.540 17.482  1.00 84.59  ? 431  LYS A CG    1 
ATOM   1409 C CD    . LYS C 3 136 ? 25.718  17.149 18.944  1.00 91.50  ? 431  LYS A CD    1 
ATOM   1410 C CE    . LYS C 3 136 ? 26.648  15.978 19.189  1.00 94.20  ? 431  LYS A CE    1 
ATOM   1411 N NZ    . LYS C 3 136 ? 26.904  15.782 20.636  1.00 94.12  ? 431  LYS A NZ    1 
ATOM   1412 N N     . GLY C 3 137 ? 27.054  21.555 16.452  1.00 79.15  ? 432  GLY A N     1 
ATOM   1413 C CA    . GLY C 3 137 ? 28.228  22.315 16.926  1.00 81.61  ? 432  GLY A CA    1 
ATOM   1414 C C     . GLY C 3 137 ? 29.302  22.453 15.861  1.00 86.51  ? 432  GLY A C     1 
ATOM   1415 O O     . GLY C 3 137 ? 29.152  23.337 14.997  1.00 87.16  ? 432  GLY A O     1 
ATOM   1416 N N     . ALA C 3 138 ? 30.348  21.618 15.934  1.00 86.21  ? 433  ALA A N     1 
ATOM   1417 C CA    . ALA C 3 138 ? 31.549  21.647 15.063  1.00 91.24  ? 433  ALA A CA    1 
ATOM   1418 C C     . ALA C 3 138 ? 31.296  20.819 13.798  1.00 89.56  ? 433  ALA A C     1 
ATOM   1419 O O     . ALA C 3 138 ? 31.497  21.360 12.695  1.00 78.60  ? 433  ALA A O     1 
ATOM   1420 C CB    . ALA C 3 138 ? 32.759  21.139 15.817  1.00 91.10  ? 433  ALA A CB    1 
ATOM   1421 N N     . LYS C 3 139 ? 30.843  19.569 13.967  1.00 88.65  ? 434  LYS A N     1 
ATOM   1422 C CA    . LYS C 3 139 ? 30.593  18.568 12.886  1.00 85.41  ? 434  LYS A CA    1 
ATOM   1423 C C     . LYS C 3 139 ? 29.466  19.035 11.937  1.00 77.75  ? 434  LYS A C     1 
ATOM   1424 O O     . LYS C 3 139 ? 29.087  18.247 11.048  1.00 67.34  ? 434  LYS A O     1 
ATOM   1425 C CB    . LYS C 3 139 ? 30.258  17.206 13.521  1.00 91.26  ? 434  LYS A CB    1 
ATOM   1426 C CG    . LYS C 3 139 ? 31.338  16.128 13.417  1.00 93.08  ? 434  LYS A CG    1 
ATOM   1427 C CD    . LYS C 3 139 ? 31.266  15.036 14.489  1.00 94.12  ? 434  LYS A CD    1 
ATOM   1428 C CE    . LYS C 3 139 ? 30.297  13.909 14.181  1.00 98.56  ? 434  LYS A CE    1 
ATOM   1429 N NZ    . LYS C 3 139 ? 30.830  12.964 13.170  1.00 98.85  ? 434  LYS A NZ    1 
ATOM   1430 N N     . ARG C 3 140 ? 28.981  20.277 12.069  1.00 66.67  ? 435  ARG A N     1 
ATOM   1431 C CA    . ARG C 3 140 ? 27.676  20.734 11.519  1.00 62.62  ? 435  ARG A CA    1 
ATOM   1432 C C     . ARG C 3 140 ? 27.829  21.188 10.065  1.00 61.01  ? 435  ARG A C     1 
ATOM   1433 O O     . ARG C 3 140 ? 28.568  22.153 9.812   1.00 74.62  ? 435  ARG A O     1 
ATOM   1434 C CB    . ARG C 3 140 ? 27.092  21.874 12.356  1.00 61.22  ? 435  ARG A CB    1 
ATOM   1435 C CG    . ARG C 3 140 ? 25.964  22.614 11.660  1.00 61.53  ? 435  ARG A CG    1 
ATOM   1436 C CD    . ARG C 3 140 ? 25.161  23.450 12.630  1.00 64.24  ? 435  ARG A CD    1 
ATOM   1437 N NE    . ARG C 3 140 ? 23.788  23.579 12.167  1.00 66.19  ? 435  ARG A NE    1 
ATOM   1438 C CZ    . ARG C 3 140 ? 22.813  24.177 12.835  1.00 64.73  ? 435  ARG A CZ    1 
ATOM   1439 N NH1   . ARG C 3 140 ? 23.060  24.726 14.013  1.00 74.51  ? 435  ARG A NH1   1 
ATOM   1440 N NH2   . ARG C 3 140 ? 21.595  24.230 12.325  1.00 61.87  ? 435  ARG A NH2   1 
ATOM   1441 N N     . ALA C 3 141 ? 27.078  20.569 9.161   1.00 49.11  ? 436  ALA A N     1 
ATOM   1442 C CA    . ALA C 3 141 ? 27.285  20.666 7.706   1.00 45.21  ? 436  ALA A CA    1 
ATOM   1443 C C     . ALA C 3 141 ? 25.938  20.616 6.973   1.00 43.35  ? 436  ALA A C     1 
ATOM   1444 O O     . ALA C 3 141 ? 25.106  19.773 7.320   1.00 36.71  ? 436  ALA A O     1 
ATOM   1445 C CB    . ALA C 3 141 ? 28.184  19.523 7.291   1.00 45.47  ? 436  ALA A CB    1 
ATOM   1446 N N     . VAL C 3 142 ? 25.746  21.470 5.967   1.00 41.06  ? 437  VAL A N     1 
ATOM   1447 C CA    . VAL C 3 142 ? 24.740  21.216 4.908   1.00 39.00  ? 437  VAL A CA    1 
ATOM   1448 C C     . VAL C 3 142 ? 25.126  19.899 4.256   1.00 38.17  ? 437  VAL A C     1 
ATOM   1449 O O     . VAL C 3 142 ? 26.237  19.787 3.768   1.00 38.31  ? 437  VAL A O     1 
ATOM   1450 C CB    . VAL C 3 142 ? 24.685  22.317 3.840   1.00 40.26  ? 437  VAL A CB    1 
ATOM   1451 C CG1   . VAL C 3 142 ? 23.472  22.109 2.944   1.00 37.04  ? 437  VAL A CG1   1 
ATOM   1452 C CG2   . VAL C 3 142 ? 24.691  23.707 4.449   1.00 43.43  ? 437  VAL A CG2   1 
ATOM   1453 N N     . PRO C 3 143 ? 24.214  18.903 4.176   1.00 36.89  ? 438  PRO A N     1 
ATOM   1454 C CA    . PRO C 3 143 ? 24.490  17.659 3.456   1.00 34.50  ? 438  PRO A CA    1 
ATOM   1455 C C     . PRO C 3 143 ? 24.298  17.836 1.942   1.00 34.80  ? 438  PRO A C     1 
ATOM   1456 O O     . PRO C 3 143 ? 23.943  18.917 1.506   1.00 36.42  ? 438  PRO A O     1 
ATOM   1457 C CB    . PRO C 3 143 ? 23.480  16.682 4.068   1.00 33.79  ? 438  PRO A CB    1 
ATOM   1458 C CG    . PRO C 3 143 ? 22.301  17.564 4.436   1.00 36.46  ? 438  PRO A CG    1 
ATOM   1459 C CD    . PRO C 3 143 ? 22.854  18.949 4.730   1.00 33.20  ? 438  PRO A CD    1 
ATOM   1460 N N     . ASP C 3 144 ? 24.557  16.793 1.158   1.00 34.58  ? 439  ASP A N     1 
ATOM   1461 C CA    . ASP C 3 144 ? 24.382  16.841 -0.319  1.00 36.72  ? 439  ASP A CA    1 
ATOM   1462 C C     . ASP C 3 144 ? 22.906  17.083 -0.652  1.00 34.87  ? 439  ASP A C     1 
ATOM   1463 O O     . ASP C 3 144 ? 22.034  16.798 0.185   1.00 34.19  ? 439  ASP A O     1 
ATOM   1464 C CB    . ASP C 3 144 ? 24.830  15.545 -0.997  1.00 40.29  ? 439  ASP A CB    1 
ATOM   1465 C CG    . ASP C 3 144 ? 26.287  15.189 -0.773  1.00 43.60  ? 439  ASP A CG    1 
ATOM   1466 O OD1   . ASP C 3 144 ? 27.088  16.096 -0.463  1.00 44.99  ? 439  ASP A OD1   1 
ATOM   1467 O OD2   . ASP C 3 144 ? 26.609  14.005 -0.939  1.00 53.11  ? 439  ASP A OD2   1 
ATOM   1468 N N     . GLU C 3 145 ? 22.643  17.516 -1.875  1.00 32.96  ? 440  GLU A N     1 
ATOM   1469 C CA    . GLU C 3 145 ? 21.323  18.033 -2.300  1.00 34.82  ? 440  GLU A CA    1 
ATOM   1470 C C     . GLU C 3 145 ? 20.203  17.007 -2.105  1.00 36.03  ? 440  GLU A C     1 
ATOM   1471 O O     . GLU C 3 145 ? 19.085  17.366 -1.749  1.00 31.78  ? 440  GLU A O     1 
ATOM   1472 C CB    . GLU C 3 145 ? 21.408  18.430 -3.765  1.00 35.51  ? 440  GLU A CB    1 
ATOM   1473 C CG    . GLU C 3 145 ? 20.196  19.190 -4.221  1.00 37.30  ? 440  GLU A CG    1 
ATOM   1474 C CD    . GLU C 3 145 ? 20.416  19.872 -5.549  1.00 39.16  ? 440  GLU A CD    1 
ATOM   1475 O OE1   . GLU C 3 145 ? 20.145  19.222 -6.561  1.00 38.53  ? 440  GLU A OE1   1 
ATOM   1476 O OE2   . GLU C 3 145 ? 20.870  21.040 -5.550  1.00 44.26  ? 440  GLU A OE2   1 
ATOM   1477 N N     . PRO C 3 146 ? 20.409  15.703 -2.399  1.00 38.47  ? 441  PRO A N     1 
ATOM   1478 C CA    . PRO C 3 146 ? 19.295  14.758 -2.353  1.00 35.24  ? 441  PRO A CA    1 
ATOM   1479 C C     . PRO C 3 146 ? 18.774  14.643 -0.910  1.00 32.51  ? 441  PRO A C     1 
ATOM   1480 O O     . PRO C 3 146 ? 17.568  14.641 -0.732  1.00 29.49  ? 441  PRO A O     1 
ATOM   1481 C CB    . PRO C 3 146 ? 19.890  13.443 -2.891  1.00 35.13  ? 441  PRO A CB    1 
ATOM   1482 C CG    . PRO C 3 146 ? 21.180  13.860 -3.580  1.00 36.65  ? 441  PRO A CG    1 
ATOM   1483 C CD    . PRO C 3 146 ? 21.676  15.069 -2.808  1.00 36.83  ? 441  PRO A CD    1 
ATOM   1484 N N     . VAL C 3 147 ? 19.689  14.565 0.062   1.00 30.23  ? 442  VAL A N     1 
ATOM   1485 C CA    . VAL C 3 147 ? 19.387  14.513 1.525   1.00 31.34  ? 442  VAL A CA    1 
ATOM   1486 C C     . VAL C 3 147 ? 18.745  15.852 1.923   1.00 30.98  ? 442  VAL A C     1 
ATOM   1487 O O     . VAL C 3 147 ? 17.682  15.821 2.574   1.00 28.09  ? 442  VAL A O     1 
ATOM   1488 C CB    . VAL C 3 147 ? 20.650  14.212 2.365   1.00 35.01  ? 442  VAL A CB    1 
ATOM   1489 C CG1   . VAL C 3 147 ? 20.371  14.243 3.865   1.00 33.26  ? 442  VAL A CG1   1 
ATOM   1490 C CG2   . VAL C 3 147 ? 21.305  12.884 1.978   1.00 34.51  ? 442  VAL A CG2   1 
ATOM   1491 N N     . LEU C 3 148 ? 19.340  16.988 1.523   1.00 27.77  ? 443  LEU A N     1 
ATOM   1492 C CA    . LEU C 3 148 ? 18.857  18.338 1.927   1.00 26.27  ? 443  LEU A CA    1 
ATOM   1493 C C     . LEU C 3 148 ? 17.414  18.536 1.454   1.00 25.89  ? 443  LEU A C     1 
ATOM   1494 O O     . LEU C 3 148 ? 16.530  18.935 2.287   1.00 22.61  ? 443  LEU A O     1 
ATOM   1495 C CB    . LEU C 3 148 ? 19.777  19.415 1.361   1.00 25.30  ? 443  LEU A CB    1 
ATOM   1496 C CG    . LEU C 3 148 ? 19.281  20.850 1.523   1.00 25.55  ? 443  LEU A CG    1 
ATOM   1497 C CD1   . LEU C 3 148 ? 19.143  21.236 2.984   1.00 25.34  ? 443  LEU A CD1   1 
ATOM   1498 C CD2   . LEU C 3 148 ? 20.193  21.816 0.781   1.00 25.81  ? 443  LEU A CD2   1 
ATOM   1499 N N     . ALA C 3 149 ? 17.174  18.269 0.174   1.00 23.96  ? 444  ALA A N     1 
ATOM   1500 C CA    . ALA C 3 149 ? 15.882  18.559 -0.471  1.00 25.54  ? 444  ALA A CA    1 
ATOM   1501 C C     . ALA C 3 149 ? 14.817  17.672 0.162   1.00 25.15  ? 444  ALA A C     1 
ATOM   1502 O O     . ALA C 3 149 ? 13.703  18.163 0.387   1.00 26.83  ? 444  ALA A O     1 
ATOM   1503 C CB    . ALA C 3 149 ? 15.951  18.355 -1.966  1.00 25.96  ? 444  ALA A CB    1 
ATOM   1504 N N     . GLU C 3 150 ? 15.131  16.403 0.401   1.00 25.38  ? 445  GLU A N     1 
ATOM   1505 C CA    . GLU C 3 150 ? 14.130  15.491 1.005   1.00 27.32  ? 445  GLU A CA    1 
ATOM   1506 C C     . GLU C 3 150 ? 13.786  16.038 2.388   1.00 23.05  ? 445  GLU A C     1 
ATOM   1507 O O     . GLU C 3 150 ? 12.624  16.029 2.746   1.00 22.60  ? 445  GLU A O     1 
ATOM   1508 C CB    . GLU C 3 150 ? 14.580  14.032 1.088   1.00 28.54  ? 445  GLU A CB    1 
ATOM   1509 C CG    . GLU C 3 150 ? 13.595  13.197 1.890   1.00 32.66  ? 445  GLU A CG    1 
ATOM   1510 C CD    . GLU C 3 150 ? 13.593  11.710 1.645   1.00 37.22  ? 445  GLU A CD    1 
ATOM   1511 O OE1   . GLU C 3 150 ? 14.542  11.219 0.972   1.00 40.73  ? 445  GLU A OE1   1 
ATOM   1512 O OE2   . GLU C 3 150 ? 12.636  11.048 2.125   1.00 38.53  ? 445  GLU A OE2   1 
ATOM   1513 N N     . HIS C 3 151 ? 14.773  16.532 3.127   1.00 23.82  ? 446  HIS A N     1 
ATOM   1514 C CA    . HIS C 3 151 ? 14.551  17.064 4.490   1.00 21.98  ? 446  HIS A CA    1 
ATOM   1515 C C     . HIS C 3 151 ? 13.639  18.289 4.413   1.00 19.94  ? 446  HIS A C     1 
ATOM   1516 O O     . HIS C 3 151 ? 12.653  18.327 5.130   1.00 19.22  ? 446  HIS A O     1 
ATOM   1517 C CB    . HIS C 3 151 ? 15.875  17.368 5.179   1.00 22.53  ? 446  HIS A CB    1 
ATOM   1518 C CG    . HIS C 3 151 ? 15.657  17.930 6.540   1.00 23.30  ? 446  HIS A CG    1 
ATOM   1519 N ND1   . HIS C 3 151 ? 14.788  17.347 7.446   1.00 21.70  ? 446  HIS A ND1   1 
ATOM   1520 C CD2   . HIS C 3 151 ? 16.193  19.000 7.160   1.00 22.79  ? 446  HIS A CD2   1 
ATOM   1521 C CE1   . HIS C 3 151 ? 14.842  18.022 8.574   1.00 22.07  ? 446  HIS A CE1   1 
ATOM   1522 N NE2   . HIS C 3 151 ? 15.676  19.042 8.418   1.00 20.99  ? 446  HIS A NE2   1 
ATOM   1523 N N     . LEU C 3 152 ? 13.938  19.244 3.540   1.00 17.94  ? 447  LEU A N     1 
ATOM   1524 C CA    . LEU C 3 152 ? 13.145  20.489 3.453   1.00 17.57  ? 447  LEU A CA    1 
ATOM   1525 C C     . LEU C 3 152 ? 11.717  20.175 2.996   1.00 17.37  ? 447  LEU A C     1 
ATOM   1526 O O     . LEU C 3 152 ? 10.740  20.850 3.499   1.00 14.64  ? 447  LEU A O     1 
ATOM   1527 C CB    . LEU C 3 152 ? 13.799  21.447 2.463   1.00 18.90  ? 447  LEU A CB    1 
ATOM   1528 C CG    . LEU C 3 152 ? 15.208  21.902 2.795   1.00 19.13  ? 447  LEU A CG    1 
ATOM   1529 C CD1   . LEU C 3 152 ? 15.444  23.266 2.191   1.00 20.62  ? 447  LEU A CD1   1 
ATOM   1530 C CD2   . LEU C 3 152 ? 15.470  21.932 4.288   1.00 19.42  ? 447  LEU A CD2   1 
ATOM   1531 N N     . VAL C 3 153 ? 11.576  19.258 2.037   1.00 15.51  ? 448  VAL A N     1 
ATOM   1532 C CA    . VAL C 3 153 ? 10.221  18.878 1.549   1.00 15.85  ? 448  VAL A CA    1 
ATOM   1533 C C     . VAL C 3 153 ? 9.441   18.224 2.711   1.00 15.00  ? 448  VAL A C     1 
ATOM   1534 O O     . VAL C 3 153 ? 8.325   18.587 2.931   1.00 13.87  ? 448  VAL A O     1 
ATOM   1535 C CB    . VAL C 3 153 ? 10.313  17.992 0.305   1.00 16.38  ? 448  VAL A CB    1 
ATOM   1536 C CG1   . VAL C 3 153 ? 9.021   17.246 0.043   1.00 16.64  ? 448  VAL A CG1   1 
ATOM   1537 C CG2   . VAL C 3 153 ? 10.738  18.804 -0.917  1.00 17.97  ? 448  VAL A CG2   1 
ATOM   1538 N N     . ARG C 3 154 ? 10.034  17.334 3.480   1.00 16.11  ? 449  ARG A N     1 
ATOM   1539 C CA    . ARG C 3 154 ? 9.355   16.727 4.665   1.00 16.40  ? 449  ARG A CA    1 
ATOM   1540 C C     . ARG C 3 154 ? 8.967   17.803 5.702   1.00 17.22  ? 449  ARG A C     1 
ATOM   1541 O O     . ARG C 3 154 ? 7.868   17.686 6.304   1.00 16.98  ? 449  ARG A O     1 
ATOM   1542 C CB    . ARG C 3 154 ? 10.250  15.675 5.316   1.00 16.04  ? 449  ARG A CB    1 
ATOM   1543 C CG    . ARG C 3 154 ? 10.229  14.330 4.598   1.00 18.01  ? 449  ARG A CG    1 
ATOM   1544 C CD    . ARG C 3 154 ? 11.149  13.291 5.261   1.00 17.43  ? 449  ARG A CD    1 
ATOM   1545 N NE    . ARG C 3 154 ? 11.093  12.017 4.564   1.00 18.73  ? 449  ARG A NE    1 
ATOM   1546 C CZ    . ARG C 3 154 ? 10.088  11.126 4.653   1.00 19.97  ? 449  ARG A CZ    1 
ATOM   1547 N NH1   . ARG C 3 154 ? 9.023   11.356 5.429   1.00 19.76  ? 449  ARG A NH1   1 
ATOM   1548 N NH2   . ARG C 3 154 ? 10.142  10.010 3.944   1.00 18.21  ? 449  ARG A NH2   1 
ATOM   1549 N N     . LYS C 3 155 ? 9.819   18.807 5.953   1.00 15.77  ? 450  LYS A N     1 
ATOM   1550 C CA    . LYS C 3 155 ? 9.471   19.882 6.913   1.00 14.77  ? 450  LYS A CA    1 
ATOM   1551 C C     . LYS C 3 155 ? 8.234   20.619 6.384   1.00 14.49  ? 450  LYS A C     1 
ATOM   1552 O O     . LYS C 3 155 ? 7.250   20.845 7.165   1.00 14.62  ? 450  LYS A O     1 
ATOM   1553 C CB    . LYS C 3 155 ? 10.661  20.804 7.159   1.00 14.73  ? 450  LYS A CB    1 
ATOM   1554 C CG    . LYS C 3 155 ? 11.765  20.180 7.993   1.00 15.91  ? 450  LYS A CG    1 
ATOM   1555 C CD    . LYS C 3 155 ? 12.599  21.169 8.817   1.00 16.86  ? 450  LYS A CD    1 
ATOM   1556 C CE    . LYS C 3 155 ? 13.441  22.128 8.002   1.00 17.87  ? 450  LYS A CE    1 
ATOM   1557 N NZ    . LYS C 3 155 ? 14.384  22.869 8.882   1.00 18.35  ? 450  LYS A NZ    1 
ATOM   1558 N N     . ALA C 3 156 ? 8.232   20.930 5.096   1.00 13.54  ? 451  ALA A N     1 
ATOM   1559 C CA    . ALA C 3 156 ? 7.133   21.665 4.446   1.00 13.96  ? 451  ALA A CA    1 
ATOM   1560 C C     . ALA C 3 156 ? 5.871   20.806 4.489   1.00 13.92  ? 451  ALA A C     1 
ATOM   1561 O O     . ALA C 3 156 ? 4.813   21.352 4.818   1.00 14.01  ? 451  ALA A O     1 
ATOM   1562 C CB    . ALA C 3 156 ? 7.511   22.051 3.042   1.00 14.46  ? 451  ALA A CB    1 
ATOM   1563 N N     . ALA C 3 157 ? 5.978   19.515 4.185   1.00 14.06  ? 452  ALA A N     1 
ATOM   1564 C CA    . ALA C 3 157 ? 4.810   18.602 4.170   1.00 15.90  ? 452  ALA A CA    1 
ATOM   1565 C C     . ALA C 3 157 ? 4.230   18.539 5.600   1.00 17.35  ? 452  ALA A C     1 
ATOM   1566 O O     . ALA C 3 157 ? 3.022   18.706 5.750   1.00 17.03  ? 452  ALA A O     1 
ATOM   1567 C CB    . ALA C 3 157 ? 5.196   17.254 3.631   1.00 15.27  ? 452  ALA A CB    1 
ATOM   1568 N N     . ALA C 3 158 ? 5.089   18.439 6.617   1.00 18.21  ? 453  ALA A N     1 
ATOM   1569 C CA    . ALA C 3 158 ? 4.701   18.462 8.055   1.00 19.24  ? 453  ALA A CA    1 
ATOM   1570 C C     . ALA C 3 158 ? 3.924   19.748 8.363   1.00 18.59  ? 453  ALA A C     1 
ATOM   1571 O O     . ALA C 3 158 ? 2.749   19.658 8.870   1.00 17.27  ? 453  ALA A O     1 
ATOM   1572 C CB    . ALA C 3 158 ? 5.911   18.331 8.958   1.00 17.60  ? 453  ALA A CB    1 
ATOM   1573 N N     . ILE C 3 159 ? 4.503   20.896 8.002   1.00 17.53  ? 454  ILE A N     1 
ATOM   1574 C CA    . ILE C 3 159 ? 3.843   22.213 8.222   1.00 18.19  ? 454  ILE A CA    1 
ATOM   1575 C C     . ILE C 3 159 ? 2.469   22.230 7.546   1.00 18.74  ? 454  ILE A C     1 
ATOM   1576 O O     . ILE C 3 159 ? 1.452   22.596 8.190   1.00 20.38  ? 454  ILE A O     1 
ATOM   1577 C CB    . ILE C 3 159 ? 4.727   23.351 7.708   1.00 17.95  ? 454  ILE A CB    1 
ATOM   1578 C CG1   . ILE C 3 159 ? 5.987   23.472 8.564   1.00 17.61  ? 454  ILE A CG1   1 
ATOM   1579 C CG2   . ILE C 3 159 ? 3.914   24.643 7.651   1.00 17.67  ? 454  ILE A CG2   1 
ATOM   1580 C CD1   . ILE C 3 159 ? 7.077   24.301 7.934   1.00 18.36  ? 454  ILE A CD1   1 
ATOM   1581 N N     . TRP C 3 160 ? 2.427   21.867 6.281   1.00 19.92  ? 455  TRP A N     1 
ATOM   1582 C CA    . TRP C 3 160 ? 1.168   21.733 5.508   1.00 20.97  ? 455  TRP A CA    1 
ATOM   1583 C C     . TRP C 3 160 ? 0.137   20.942 6.309   1.00 22.00  ? 455  TRP A C     1 
ATOM   1584 O O     . TRP C 3 160 ? -1.013  21.429 6.457   1.00 21.88  ? 455  TRP A O     1 
ATOM   1585 C CB    . TRP C 3 160 ? 1.464   21.042 4.185   1.00 21.28  ? 455  TRP A CB    1 
ATOM   1586 C CG    . TRP C 3 160 ? 0.310   21.021 3.240   1.00 20.73  ? 455  TRP A CG    1 
ATOM   1587 C CD1   . TRP C 3 160 ? -0.341  19.915 2.779   1.00 20.56  ? 455  TRP A CD1   1 
ATOM   1588 C CD2   . TRP C 3 160 ? -0.275  22.147 2.571   1.00 20.55  ? 455  TRP A CD2   1 
ATOM   1589 N NE1   . TRP C 3 160 ? -1.306  20.288 1.881   1.00 21.06  ? 455  TRP A NE1   1 
ATOM   1590 C CE2   . TRP C 3 160 ? -1.308  21.646 1.747   1.00 20.65  ? 455  TRP A CE2   1 
ATOM   1591 C CE3   . TRP C 3 160 ? -0.068  23.534 2.616   1.00 21.19  ? 455  TRP A CE3   1 
ATOM   1592 C CZ2   . TRP C 3 160 ? -2.098  22.472 0.947   1.00 20.75  ? 455  TRP A CZ2   1 
ATOM   1593 C CZ3   . TRP C 3 160 ? -0.838  24.349 1.810   1.00 20.81  ? 455  TRP A CZ3   1 
ATOM   1594 C CH2   . TRP C 3 160 ? -1.832  23.823 0.981   1.00 20.48  ? 455  TRP A CH2   1 
ATOM   1595 N N     . GLU C 3 161 ? 0.524   19.777 6.838   1.00 22.38  ? 456  GLU A N     1 
ATOM   1596 C CA    . GLU C 3 161 ? -0.428  18.883 7.565   1.00 24.32  ? 456  GLU A CA    1 
ATOM   1597 C C     . GLU C 3 161 ? -0.749  19.401 8.969   1.00 22.13  ? 456  GLU A C     1 
ATOM   1598 O O     . GLU C 3 161 ? -1.840  19.125 9.450   1.00 21.14  ? 456  GLU A O     1 
ATOM   1599 C CB    . GLU C 3 161 ? 0.136   17.464 7.666   1.00 29.12  ? 456  GLU A CB    1 
ATOM   1600 C CG    . GLU C 3 161 ? 0.190   16.780 6.312   1.00 35.44  ? 456  GLU A CG    1 
ATOM   1601 C CD    . GLU C 3 161 ? -1.173  16.504 5.688   1.00 35.67  ? 456  GLU A CD    1 
ATOM   1602 O OE1   . GLU C 3 161 ? -2.118  16.176 6.457   1.00 39.93  ? 456  GLU A OE1   1 
ATOM   1603 O OE2   . GLU C 3 161 ? -1.273  16.596 4.452   1.00 32.91  ? 456  GLU A OE2   1 
ATOM   1604 N N     . LEU C 3 162 ? 0.175   20.075 9.649   1.00 21.19  ? 457  LEU A N     1 
ATOM   1605 C CA    . LEU C 3 162 ? -0.003  20.353 11.095  1.00 19.61  ? 457  LEU A CA    1 
ATOM   1606 C C     . LEU C 3 162 ? -0.726  21.681 11.329  1.00 19.04  ? 457  LEU A C     1 
ATOM   1607 O O     . LEU C 3 162 ? -1.128  21.942 12.474  1.00 21.38  ? 457  LEU A O     1 
ATOM   1608 C CB    . LEU C 3 162 ? 1.363   20.318 11.777  1.00 20.17  ? 457  LEU A CB    1 
ATOM   1609 C CG    . LEU C 3 162 ? 2.032   18.952 11.792  1.00 20.42  ? 457  LEU A CG    1 
ATOM   1610 C CD1   . LEU C 3 162 ? 3.453   19.080 12.256  1.00 21.76  ? 457  LEU A CD1   1 
ATOM   1611 C CD2   . LEU C 3 162 ? 1.295   17.975 12.681  1.00 22.33  ? 457  LEU A CD2   1 
ATOM   1612 N N     . GLU C 3 163 ? -0.900  22.500 10.306  1.00 19.50  ? 458  GLU A N     1 
ATOM   1613 C CA    . GLU C 3 163 ? -1.538  23.825 10.476  1.00 19.98  ? 458  GLU A CA    1 
ATOM   1614 C C     . GLU C 3 163 ? -2.909  23.626 11.147  1.00 20.63  ? 458  GLU A C     1 
ATOM   1615 O O     . GLU C 3 163 ? -3.154  24.265 12.176  1.00 17.33  ? 458  GLU A O     1 
ATOM   1616 C CB    . GLU C 3 163 ? -1.641  24.551 9.138   1.00 19.60  ? 458  GLU A CB    1 
ATOM   1617 C CG    . GLU C 3 163 ? -2.610  25.714 9.171   1.00 21.75  ? 458  GLU A CG    1 
ATOM   1618 C CD    . GLU C 3 163 ? -2.513  26.698 8.019   1.00 22.72  ? 458  GLU A CD    1 
ATOM   1619 O OE1   . GLU C 3 163 ? -3.163  27.742 8.115   1.00 28.87  ? 458  GLU A OE1   1 
ATOM   1620 O OE2   . GLU C 3 163 ? -1.739  26.458 7.074   1.00 24.62  ? 458  GLU A OE2   1 
ATOM   1621 N N     . ARG C 3 164 ? -3.744  22.753 10.581  1.00 22.76  ? 459  ARG A N     1 
ATOM   1622 C CA    . ARG C 3 164 ? -5.157  22.572 10.981  1.00 24.56  ? 459  ARG A CA    1 
ATOM   1623 C C     . ARG C 3 164 ? -5.214  22.145 12.451  1.00 21.17  ? 459  ARG A C     1 
ATOM   1624 O O     . ARG C 3 164 ? -5.837  22.811 13.251  1.00 21.45  ? 459  ARG A O     1 
ATOM   1625 C CB    . ARG C 3 164 ? -5.847  21.622 9.994   1.00 29.25  ? 459  ARG A CB    1 
ATOM   1626 C CG    . ARG C 3 164 ? -7.307  21.298 10.298  1.00 35.96  ? 459  ARG A CG    1 
ATOM   1627 C CD    . ARG C 3 164 ? -8.123  22.484 10.787  1.00 43.87  ? 459  ARG A CD    1 
ATOM   1628 N NE    . ARG C 3 164 ? -7.804  23.749 10.107  1.00 52.93  ? 459  ARG A NE    1 
ATOM   1629 C CZ    . ARG C 3 164 ? -8.003  24.983 10.604  1.00 53.24  ? 459  ARG A CZ    1 
ATOM   1630 N NH1   . ARG C 3 164 ? -8.523  25.155 11.813  1.00 53.13  ? 459  ARG A NH1   1 
ATOM   1631 N NH2   . ARG C 3 164 ? -7.664  26.043 9.886   1.00 51.24  ? 459  ARG A NH2   1 
ATOM   1632 N N     . PRO C 3 165 ? -4.592  21.037 12.883  1.00 20.04  ? 460  PRO A N     1 
ATOM   1633 C CA    . PRO C 3 165 ? -4.673  20.633 14.291  1.00 18.99  ? 460  PRO A CA    1 
ATOM   1634 C C     . PRO C 3 165 ? -4.017  21.588 15.309  1.00 19.08  ? 460  PRO A C     1 
ATOM   1635 O O     . PRO C 3 165 ? -4.546  21.731 16.399  1.00 16.83  ? 460  PRO A O     1 
ATOM   1636 C CB    . PRO C 3 165 ? -4.012  19.246 14.339  1.00 18.41  ? 460  PRO A CB    1 
ATOM   1637 C CG    . PRO C 3 165 ? -3.275  19.119 13.018  1.00 19.31  ? 460  PRO A CG    1 
ATOM   1638 C CD    . PRO C 3 165 ? -3.973  20.015 12.027  1.00 19.70  ? 460  PRO A CD    1 
ATOM   1639 N N     . PHE C 3 166 ? -2.948  22.294 14.941  1.00 17.28  ? 461  PHE A N     1 
ATOM   1640 C CA    . PHE C 3 166 ? -2.369  23.325 15.838  1.00 17.60  ? 461  PHE A CA    1 
ATOM   1641 C C     . PHE C 3 166 ? -3.403  24.441 16.025  1.00 16.73  ? 461  PHE A C     1 
ATOM   1642 O O     . PHE C 3 166 ? -3.684  24.839 17.181  1.00 16.53  ? 461  PHE A O     1 
ATOM   1643 C CB    . PHE C 3 166 ? -1.022  23.823 15.313  1.00 16.59  ? 461  PHE A CB    1 
ATOM   1644 C CG    . PHE C 3 166 ? 0.093   22.976 15.831  1.00 16.55  ? 461  PHE A CG    1 
ATOM   1645 C CD1   . PHE C 3 166 ? 0.354   21.735 15.279  1.00 16.72  ? 461  PHE A CD1   1 
ATOM   1646 C CD2   . PHE C 3 166 ? 0.863   23.412 16.881  1.00 15.84  ? 461  PHE A CD2   1 
ATOM   1647 C CE1   . PHE C 3 166 ? 1.351   20.934 15.796  1.00 16.31  ? 461  PHE A CE1   1 
ATOM   1648 C CE2   . PHE C 3 166 ? 1.856   22.606 17.387  1.00 15.67  ? 461  PHE A CE2   1 
ATOM   1649 C CZ    . PHE C 3 166 ? 2.114   21.380 16.837  1.00 15.42  ? 461  PHE A CZ    1 
ATOM   1650 N N     . LEU C 3 167 ? -4.019  24.876 14.929  1.00 17.28  ? 462  LEU A N     1 
ATOM   1651 C CA    . LEU C 3 167 ? -5.015  25.984 14.968  1.00 18.31  ? 462  LEU A CA    1 
ATOM   1652 C C     . LEU C 3 167 ? -6.262  25.550 15.754  1.00 18.55  ? 462  LEU A C     1 
ATOM   1653 O O     . LEU C 3 167 ? -6.799  26.387 16.474  1.00 18.98  ? 462  LEU A O     1 
ATOM   1654 C CB    . LEU C 3 167 ? -5.388  26.419 13.551  1.00 18.17  ? 462  LEU A CB    1 
ATOM   1655 C CG    . LEU C 3 167 ? -4.405  27.345 12.824  1.00 17.88  ? 462  LEU A CG    1 
ATOM   1656 C CD1   . LEU C 3 167 ? -4.929  27.645 11.414  1.00 17.12  ? 462  LEU A CD1   1 
ATOM   1657 C CD2   . LEU C 3 167 ? -4.174  28.656 13.589  1.00 17.23  ? 462  LEU A CD2   1 
ATOM   1658 N N     . ASP C 3 168 ? -6.687  24.293 15.635  1.00 19.59  ? 463  ASP A N     1 
ATOM   1659 C CA    . ASP C 3 168 ? -7.871  23.742 16.348  1.00 21.13  ? 463  ASP A CA    1 
ATOM   1660 C C     . ASP C 3 168 ? -7.581  23.792 17.850  1.00 19.27  ? 463  ASP A C     1 
ATOM   1661 O O     . ASP C 3 168 ? -8.402  24.324 18.588  1.00 18.99  ? 463  ASP A O     1 
ATOM   1662 C CB    . ASP C 3 168 ? -8.201  22.308 15.897  1.00 23.81  ? 463  ASP A CB    1 
ATOM   1663 C CG    . ASP C 3 168 ? -8.960  22.226 14.574  1.00 27.36  ? 463  ASP A CG    1 
ATOM   1664 O OD1   . ASP C 3 168 ? -9.475  23.266 14.141  1.00 28.82  ? 463  ASP A OD1   1 
ATOM   1665 O OD2   . ASP C 3 168 ? -9.027  21.113 13.976  1.00 29.25  ? 463  ASP A OD2   1 
ATOM   1666 N N     . GLU C 3 169 ? -6.434  23.264 18.278  1.00 18.28  ? 464  GLU A N     1 
ATOM   1667 C CA    . GLU C 3 169 ? -6.065  23.267 19.706  1.00 18.13  ? 464  GLU A CA    1 
ATOM   1668 C C     . GLU C 3 169 ? -5.869  24.714 20.209  1.00 17.03  ? 464  GLU A C     1 
ATOM   1669 O O     . GLU C 3 169 ? -6.350  25.025 21.286  1.00 16.01  ? 464  GLU A O     1 
ATOM   1670 C CB    . GLU C 3 169 ? -4.851  22.388 19.972  1.00 17.43  ? 464  GLU A CB    1 
ATOM   1671 C CG    . GLU C 3 169 ? -4.617  22.330 21.473  1.00 18.17  ? 464  GLU A CG    1 
ATOM   1672 C CD    . GLU C 3 169 ? -3.507  21.429 21.957  1.00 19.99  ? 464  GLU A CD    1 
ATOM   1673 O OE1   . GLU C 3 169 ? -3.377  21.284 23.194  1.00 20.62  ? 464  GLU A OE1   1 
ATOM   1674 O OE2   . GLU C 3 169 ? -2.776  20.888 21.104  1.00 19.92  ? 464  GLU A OE2   1 
ATOM   1675 N N     . LEU C 3 170 ? -5.188  25.589 19.483  1.00 16.99  ? 465  LEU A N     1 
ATOM   1676 C CA    . LEU C 3 170 ? -5.101  27.008 19.923  1.00 18.16  ? 465  LEU A CA    1 
ATOM   1677 C C     . LEU C 3 170 ? -6.508  27.590 20.144  1.00 17.82  ? 465  LEU A C     1 
ATOM   1678 O O     . LEU C 3 170 ? -6.703  28.295 21.168  1.00 15.70  ? 465  LEU A O     1 
ATOM   1679 C CB    . LEU C 3 170 ? -4.347  27.829 18.874  1.00 18.33  ? 465  LEU A CB    1 
ATOM   1680 C CG    . LEU C 3 170 ? -2.854  27.552 18.777  1.00 17.08  ? 465  LEU A CG    1 
ATOM   1681 C CD1   . LEU C 3 170 ? -2.332  28.130 17.482  1.00 17.68  ? 465  LEU A CD1   1 
ATOM   1682 C CD2   . LEU C 3 170 ? -2.123  28.159 19.965  1.00 17.73  ? 465  LEU A CD2   1 
ATOM   1683 N N     . ARG C 3 171 ? -7.434  27.301 19.233  1.00 19.99  ? 466  ARG A N     1 
ATOM   1684 C CA    . ARG C 3 171 ? -8.856  27.766 19.262  1.00 23.79  ? 466  ARG A CA    1 
ATOM   1685 C C     . ARG C 3 171 ? -9.528  27.226 20.533  1.00 21.10  ? 466  ARG A C     1 
ATOM   1686 O O     . ARG C 3 171 ? -10.117 28.008 21.256  1.00 17.42  ? 466  ARG A O     1 
ATOM   1687 C CB    . ARG C 3 171 ? -9.549  27.333 17.964  1.00 30.36  ? 466  ARG A CB    1 
ATOM   1688 C CG    . ARG C 3 171 ? -11.024 27.687 17.856  1.00 42.79  ? 466  ARG A CG    1 
ATOM   1689 C CD    . ARG C 3 171 ? -11.338 28.881 16.962  1.00 57.68  ? 466  ARG A CD    1 
ATOM   1690 N NE    . ARG C 3 171 ? -12.615 29.507 17.333  1.00 69.65  ? 466  ARG A NE    1 
ATOM   1691 C CZ    . ARG C 3 171 ? -12.817 30.257 18.429  1.00 79.36  ? 466  ARG A CZ    1 
ATOM   1692 N NH1   . ARG C 3 171 ? -11.822 30.496 19.275  1.00 83.98  ? 466  ARG A NH1   1 
ATOM   1693 N NH2   . ARG C 3 171 ? -14.016 30.764 18.685  1.00 74.47  ? 466  ARG A NH2   1 
ATOM   1694 N N     . ARG C 3 172 ? -9.333  25.952 20.861  1.00 20.37  ? 467  ARG A N     1 
ATOM   1695 C CA    . ARG C 3 172 ? -9.945  25.355 22.074  1.00 23.26  ? 467  ARG A CA    1 
ATOM   1696 C C     . ARG C 3 172 ? -9.371  26.062 23.314  1.00 20.83  ? 467  ARG A C     1 
ATOM   1697 O O     . ARG C 3 172 ? -10.113 26.251 24.277  1.00 16.83  ? 467  ARG A O     1 
ATOM   1698 C CB    . ARG C 3 172 ? -9.709  23.838 22.116  1.00 25.24  ? 467  ARG A CB    1 
ATOM   1699 C CG    . ARG C 3 172 ? -10.664 23.042 21.239  1.00 29.41  ? 467  ARG A CG    1 
ATOM   1700 C CD    . ARG C 3 172 ? -10.486 21.526 21.322  1.00 32.00  ? 467  ARG A CD    1 
ATOM   1701 N NE    . ARG C 3 172 ? -9.104  21.035 21.192  1.00 36.26  ? 467  ARG A NE    1 
ATOM   1702 C CZ    . ARG C 3 172 ? -8.533  20.553 20.071  1.00 33.44  ? 467  ARG A CZ    1 
ATOM   1703 N NH1   . ARG C 3 172 ? -9.210  20.492 18.934  1.00 34.94  ? 467  ARG A NH1   1 
ATOM   1704 N NH2   . ARG C 3 172 ? -7.280  20.121 20.097  1.00 28.20  ? 467  ARG A NH2   1 
ATOM   1705 N N     . ASN C 3 173 ? -8.079  26.419 23.282  1.00 19.14  ? 468  ASN A N     1 
ATOM   1706 C CA    . ASN C 3 173 ? -7.392  27.115 24.404  1.00 17.67  ? 468  ASN A CA    1 
ATOM   1707 C C     . ASN C 3 173 ? -7.714  28.616 24.415  1.00 16.25  ? 468  ASN A C     1 
ATOM   1708 O O     . ASN C 3 173 ? -7.174  29.294 25.315  1.00 14.67  ? 468  ASN A O     1 
ATOM   1709 C CB    . ASN C 3 173 ? -5.868  26.977 24.324  1.00 17.60  ? 468  ASN A CB    1 
ATOM   1710 C CG    . ASN C 3 173 ? -5.355  25.588 24.626  1.00 19.39  ? 468  ASN A CG    1 
ATOM   1711 O OD1   . ASN C 3 173 ? -6.148  24.672 24.876  1.00 17.48  ? 468  ASN A OD1   1 
ATOM   1712 N ND2   . ASN C 3 173 ? -4.030  25.431 24.584  1.00 18.37  ? 468  ASN A ND2   1 
ATOM   1713 N N     . GLU C 3 174 ? -8.424  29.147 23.410  1.00 16.76  ? 469  GLU A N     1 
ATOM   1714 C CA    . GLU C 3 174 ? -8.658  30.616 23.238  1.00 20.39  ? 469  GLU A CA    1 
ATOM   1715 C C     . GLU C 3 174 ? -7.326  31.356 23.035  1.00 18.00  ? 469  GLU A C     1 
ATOM   1716 O O     . GLU C 3 174 ? -7.208  32.486 23.500  1.00 16.98  ? 469  GLU A O     1 
ATOM   1717 C CB    . GLU C 3 174 ? -9.397  31.218 24.443  1.00 24.30  ? 469  GLU A CB    1 
ATOM   1718 C CG    . GLU C 3 174 ? -10.712 30.525 24.709  1.00 32.56  ? 469  GLU A CG    1 
ATOM   1719 C CD    . GLU C 3 174 ? -11.687 31.286 25.594  1.00 42.06  ? 469  GLU A CD    1 
ATOM   1720 O OE1   . GLU C 3 174 ? -11.361 32.425 26.017  1.00 44.08  ? 469  GLU A OE1   1 
ATOM   1721 O OE2   . GLU C 3 174 ? -12.777 30.736 25.854  1.00 50.88  ? 469  GLU A OE2   1 
ATOM   1722 N N     . GLN C 3 175 ? -6.396  30.748 22.308  1.00 17.70  ? 470  GLN A N     1 
ATOM   1723 C CA    . GLN C 3 175 ? -5.065  31.305 21.983  1.00 17.31  ? 470  GLN A CA    1 
ATOM   1724 C C     . GLN C 3 175 ? -4.991  31.646 20.499  1.00 18.62  ? 470  GLN A C     1 
ATOM   1725 O O     . GLN C 3 175 ? -3.916  32.046 20.039  1.00 17.17  ? 470  GLN A O     1 
ATOM   1726 C CB    . GLN C 3 175 ? -3.995  30.298 22.377  1.00 17.20  ? 470  GLN A CB    1 
ATOM   1727 C CG    . GLN C 3 175 ? -3.929  30.059 23.873  1.00 16.13  ? 470  GLN A CG    1 
ATOM   1728 C CD    . GLN C 3 175 ? -2.853  29.055 24.173  1.00 16.67  ? 470  GLN A CD    1 
ATOM   1729 O OE1   . GLN C 3 175 ? -2.776  27.999 23.543  1.00 15.58  ? 470  GLN A OE1   1 
ATOM   1730 N NE2   . GLN C 3 175 ? -1.993  29.397 25.123  1.00 16.75  ? 470  GLN A NE2   1 
ATOM   1731 N N     . ASP C 3 176 ? -6.101  31.533 19.767  1.00 21.32  ? 471  ASP A N     1 
ATOM   1732 C CA    . ASP C 3 176 ? -6.078  31.729 18.291  1.00 23.03  ? 471  ASP A CA    1 
ATOM   1733 C C     . ASP C 3 176 ? -5.720  33.185 18.009  1.00 20.44  ? 471  ASP A C     1 
ATOM   1734 O O     . ASP C 3 176 ? -4.869  33.438 17.140  1.00 20.74  ? 471  ASP A O     1 
ATOM   1735 C CB    . ASP C 3 176 ? -7.380  31.286 17.613  1.00 26.24  ? 471  ASP A CB    1 
ATOM   1736 C CG    . ASP C 3 176 ? -8.651  31.863 18.212  1.00 28.52  ? 471  ASP A CG    1 
ATOM   1737 O OD1   . ASP C 3 176 ? -8.911  31.714 19.470  1.00 29.75  ? 471  ASP A OD1   1 
ATOM   1738 O OD2   . ASP C 3 176 ? -9.385  32.446 17.426  1.00 37.78  ? 471  ASP A OD2   1 
ATOM   1739 N N     . ARG C 3 177 ? -6.307  34.108 18.741  1.00 20.35  ? 472  ARG A N     1 
ATOM   1740 C CA    . ARG C 3 177 ? -6.009  35.550 18.561  1.00 21.43  ? 472  ARG A CA    1 
ATOM   1741 C C     . ARG C 3 177 ? -4.643  35.868 19.161  1.00 17.34  ? 472  ARG A C     1 
ATOM   1742 O O     . ARG C 3 177 ? -3.961  36.676 18.577  1.00 16.87  ? 472  ARG A O     1 
ATOM   1743 C CB    . ARG C 3 177 ? -7.116  36.407 19.168  1.00 24.80  ? 472  ARG A CB    1 
ATOM   1744 C CG    . ARG C 3 177 ? -8.475  36.155 18.526  1.00 29.48  ? 472  ARG A CG    1 
ATOM   1745 C CD    . ARG C 3 177 ? -9.572  36.930 19.248  1.00 36.48  ? 472  ARG A CD    1 
ATOM   1746 N NE    . ARG C 3 177 ? -9.343  38.348 19.013  1.00 44.58  ? 472  ARG A NE    1 
ATOM   1747 C CZ    . ARG C 3 177 ? -9.907  39.361 19.665  1.00 50.91  ? 472  ARG A CZ    1 
ATOM   1748 N NH1   . ARG C 3 177 ? -10.755 39.145 20.657  1.00 58.95  ? 472  ARG A NH1   1 
ATOM   1749 N NH2   . ARG C 3 177 ? -9.615  40.601 19.307  1.00 51.96  ? 472  ARG A NH2   1 
ATOM   1750 N N     . LEU C 3 178 ? -4.232  35.217 20.243  1.00 15.63  ? 473  LEU A N     1 
ATOM   1751 C CA    . LEU C 3 178 ? -2.850  35.394 20.772  1.00 16.25  ? 473  LEU A CA    1 
ATOM   1752 C C     . LEU C 3 178 ? -1.845  35.044 19.659  1.00 15.69  ? 473  LEU A C     1 
ATOM   1753 O O     . LEU C 3 178 ? -0.882  35.802 19.459  1.00 15.32  ? 473  LEU A O     1 
ATOM   1754 C CB    . LEU C 3 178 ? -2.680  34.548 22.038  1.00 16.29  ? 473  LEU A CB    1 
ATOM   1755 C CG    . LEU C 3 178 ? -1.333  34.624 22.755  1.00 16.81  ? 473  LEU A CG    1 
ATOM   1756 C CD1   . LEU C 3 178 ? -1.045  36.031 23.256  1.00 16.02  ? 473  LEU A CD1   1 
ATOM   1757 C CD2   . LEU C 3 178 ? -1.301  33.618 23.915  1.00 17.00  ? 473  LEU A CD2   1 
ATOM   1758 N N     . LEU C 3 179 ? -2.108  34.023 18.849  1.00 16.13  ? 474  LEU A N     1 
ATOM   1759 C CA    . LEU C 3 179 ? -1.207  33.719 17.707  1.00 17.05  ? 474  LEU A CA    1 
ATOM   1760 C C     . LEU C 3 179 ? -1.311  34.806 16.625  1.00 17.54  ? 474  LEU A C     1 
ATOM   1761 O O     . LEU C 3 179 ? -0.275  35.384 16.242  1.00 16.81  ? 474  LEU A O     1 
ATOM   1762 C CB    . LEU C 3 179 ? -1.516  32.351 17.111  1.00 17.15  ? 474  LEU A CB    1 
ATOM   1763 C CG    . LEU C 3 179 ? -0.587  31.960 15.960  1.00 17.10  ? 474  LEU A CG    1 
ATOM   1764 C CD1   . LEU C 3 179 ? 0.820   31.723 16.458  1.00 17.43  ? 474  LEU A CD1   1 
ATOM   1765 C CD2   . LEU C 3 179 ? -1.081  30.740 15.246  1.00 17.63  ? 474  LEU A CD2   1 
ATOM   1766 N N     . VAL C 3 180 ? -2.517  35.077 16.140  1.00 19.42  ? 475  VAL A N     1 
ATOM   1767 C CA    . VAL C 3 180 ? -2.751  35.770 14.835  1.00 19.09  ? 475  VAL A CA    1 
ATOM   1768 C C     . VAL C 3 180 ? -2.571  37.276 15.025  1.00 18.30  ? 475  VAL A C     1 
ATOM   1769 O O     . VAL C 3 180 ? -2.076  37.906 14.098  1.00 16.93  ? 475  VAL A O     1 
ATOM   1770 C CB    . VAL C 3 180 ? -4.123  35.374 14.243  1.00 20.16  ? 475  VAL A CB    1 
ATOM   1771 C CG1   . VAL C 3 180 ? -4.587  36.267 13.100  1.00 19.58  ? 475  VAL A CG1   1 
ATOM   1772 C CG2   . VAL C 3 180 ? -4.071  33.923 13.784  1.00 21.42  ? 475  VAL A CG2   1 
ATOM   1773 N N     . GLU C 3 181 ? -2.900  37.799 16.198  1.00 17.72  ? 476  GLU A N     1 
ATOM   1774 C CA    . GLU C 3 181 ? -2.979  39.258 16.451  1.00 20.53  ? 476  GLU A CA    1 
ATOM   1775 C C     . GLU C 3 181 ? -1.831  39.732 17.334  1.00 20.70  ? 476  GLU A C     1 
ATOM   1776 O O     . GLU C 3 181 ? -1.588  40.950 17.341  1.00 22.16  ? 476  GLU A O     1 
ATOM   1777 C CB    . GLU C 3 181 ? -4.331  39.591 17.083  1.00 22.33  ? 476  GLU A CB    1 
ATOM   1778 C CG    . GLU C 3 181 ? -5.468  39.236 16.129  1.00 24.68  ? 476  GLU A CG    1 
ATOM   1779 C CD    . GLU C 3 181 ? -6.895  39.476 16.594  1.00 28.82  ? 476  GLU A CD    1 
ATOM   1780 O OE1   . GLU C 3 181 ? -7.799  38.782 16.074  1.00 33.60  ? 476  GLU A OE1   1 
ATOM   1781 O OE2   . GLU C 3 181 ? -7.102  40.338 17.464  1.00 29.89  ? 476  GLU A OE2   1 
ATOM   1782 N N     . LEU C 3 182 ? -1.161  38.838 18.056  1.00 19.73  ? 477  LEU A N     1 
ATOM   1783 C CA    . LEU C 3 182 ? -0.019  39.267 18.889  1.00 19.08  ? 477  LEU A CA    1 
ATOM   1784 C C     . LEU C 3 182 ? 1.288   38.690 18.341  1.00 16.32  ? 477  LEU A C     1 
ATOM   1785 O O     . LEU C 3 182 ? 2.079   39.503 17.847  1.00 15.45  ? 477  LEU A O     1 
ATOM   1786 C CB    . LEU C 3 182 ? -0.229  38.884 20.349  1.00 20.09  ? 477  LEU A CB    1 
ATOM   1787 C CG    . LEU C 3 182 ? 0.718   39.607 21.306  1.00 21.30  ? 477  LEU A CG    1 
ATOM   1788 C CD1   . LEU C 3 182 ? 0.072   40.867 21.823  1.00 21.95  ? 477  LEU A CD1   1 
ATOM   1789 C CD2   . LEU C 3 182 ? 1.116   38.731 22.468  1.00 24.12  ? 477  LEU A CD2   1 
ATOM   1790 N N     . GLU C 3 183 ? 1.537   37.389 18.494  1.00 14.90  ? 478  GLU A N     1 
ATOM   1791 C CA    . GLU C 3 183 ? 2.891   36.802 18.287  1.00 14.93  ? 478  GLU A CA    1 
ATOM   1792 C C     . GLU C 3 183 ? 3.293   36.878 16.806  1.00 14.58  ? 478  GLU A C     1 
ATOM   1793 O O     . GLU C 3 183 ? 4.482   37.201 16.530  1.00 14.64  ? 478  GLU A O     1 
ATOM   1794 C CB    . GLU C 3 183 ? 3.007   35.365 18.771  1.00 14.43  ? 478  GLU A CB    1 
ATOM   1795 C CG    . GLU C 3 183 ? 2.773   35.186 20.259  1.00 15.01  ? 478  GLU A CG    1 
ATOM   1796 C CD    . GLU C 3 183 ? 3.781   35.801 21.217  1.00 14.31  ? 478  GLU A CD    1 
ATOM   1797 O OE1   . GLU C 3 183 ? 4.780   36.387 20.747  1.00 15.71  ? 478  GLU A OE1   1 
ATOM   1798 O OE2   . GLU C 3 183 ? 3.569   35.677 22.433  1.00 12.94  ? 478  GLU A OE2   1 
ATOM   1799 N N     . GLN C 3 184 ? 2.382   36.611 15.867  1.00 14.52  ? 479  GLN A N     1 
ATOM   1800 C CA    . GLN C 3 184 ? 2.762   36.663 14.424  1.00 14.74  ? 479  GLN A CA    1 
ATOM   1801 C C     . GLN C 3 184 ? 3.095   38.093 14.029  1.00 15.53  ? 479  GLN A C     1 
ATOM   1802 O O     . GLN C 3 184 ? 4.160   38.291 13.476  1.00 14.82  ? 479  GLN A O     1 
ATOM   1803 C CB    . GLN C 3 184 ? 1.752   35.987 13.514  1.00 14.36  ? 479  GLN A CB    1 
ATOM   1804 C CG    . GLN C 3 184 ? 1.844   34.476 13.700  1.00 15.42  ? 479  GLN A CG    1 
ATOM   1805 C CD    . GLN C 3 184 ? 0.856   33.642 12.922  1.00 16.64  ? 479  GLN A CD    1 
ATOM   1806 O OE1   . GLN C 3 184 ? 0.979   32.406 12.940  1.00 15.29  ? 479  GLN A OE1   1 
ATOM   1807 N NE2   . GLN C 3 184 ? -0.068  34.301 12.199  1.00 14.93  ? 479  GLN A NE2   1 
ATOM   1808 N N     . PRO C 3 185 ? 2.251   39.125 14.291  1.00 15.68  ? 480  PRO A N     1 
ATOM   1809 C CA    . PRO C 3 185 ? 2.623   40.489 13.933  1.00 15.99  ? 480  PRO A CA    1 
ATOM   1810 C C     . PRO C 3 185 ? 3.886   40.934 14.688  1.00 16.19  ? 480  PRO A C     1 
ATOM   1811 O O     . PRO C 3 185 ? 4.693   41.681 14.115  1.00 14.94  ? 480  PRO A O     1 
ATOM   1812 C CB    . PRO C 3 185 ? 1.383   41.327 14.287  1.00 15.57  ? 480  PRO A CB    1 
ATOM   1813 C CG    . PRO C 3 185 ? 0.240   40.324 14.233  1.00 15.59  ? 480  PRO A CG    1 
ATOM   1814 C CD    . PRO C 3 185 ? 0.861   39.042 14.764  1.00 15.89  ? 480  PRO A CD    1 
ATOM   1815 N N     . LEU C 3 186 ? 4.039   40.519 15.944  1.00 14.23  ? 481  LEU A N     1 
ATOM   1816 C CA    . LEU C 3 186 ? 5.260   40.911 16.693  1.00 14.17  ? 481  LEU A CA    1 
ATOM   1817 C C     . LEU C 3 186 ? 6.514   40.326 16.001  1.00 15.00  ? 481  LEU A C     1 
ATOM   1818 O O     . LEU C 3 186 ? 7.561   40.983 15.996  1.00 14.21  ? 481  LEU A O     1 
ATOM   1819 C CB    . LEU C 3 186 ? 5.157   40.411 18.129  1.00 13.27  ? 481  LEU A CB    1 
ATOM   1820 C CG    . LEU C 3 186 ? 6.397   40.706 18.955  1.00 13.22  ? 481  LEU A CG    1 
ATOM   1821 C CD1   . LEU C 3 186 ? 6.580   42.203 19.050  1.00 14.28  ? 481  LEU A CD1   1 
ATOM   1822 C CD2   . LEU C 3 186 ? 6.323   40.076 20.333  1.00 12.91  ? 481  LEU A CD2   1 
ATOM   1823 N N     . SER C 3 187 ? 6.428   39.076 15.551  1.00 15.05  ? 482  SER A N     1 
ATOM   1824 C CA    . SER C 3 187 ? 7.462   38.361 14.766  1.00 16.03  ? 482  SER A CA    1 
ATOM   1825 C C     . SER C 3 187 ? 8.044   39.272 13.662  1.00 16.67  ? 482  SER A C     1 
ATOM   1826 O O     . SER C 3 187 ? 9.274   39.365 13.546  1.00 16.27  ? 482  SER A O     1 
ATOM   1827 C CB    . SER C 3 187 ? 6.882   37.106 14.176  1.00 15.98  ? 482  SER A CB    1 
ATOM   1828 O OG    . SER C 3 187 ? 7.912   36.363 13.578  1.00 20.60  ? 482  SER A OG    1 
ATOM   1829 N N     . SER C 3 188 ? 7.195   39.887 12.839  1.00 16.55  ? 483  SER A N     1 
ATOM   1830 C CA    . SER C 3 188 ? 7.626   40.814 11.756  1.00 18.10  ? 483  SER A CA    1 
ATOM   1831 C C     . SER C 3 188 ? 8.276   42.073 12.353  1.00 16.66  ? 483  SER A C     1 
ATOM   1832 O O     . SER C 3 188 ? 9.166   42.617 11.711  1.00 15.71  ? 483  SER A O     1 
ATOM   1833 C CB    . SER C 3 188 ? 6.445   41.162 10.837  1.00 18.99  ? 483  SER A CB    1 
ATOM   1834 O OG    . SER C 3 188 ? 5.906   39.941 10.310  1.00 19.82  ? 483  SER A OG    1 
ATOM   1835 N N     . ILE C 3 189 ? 7.836   42.532 13.528  1.00 15.69  ? 484  ILE A N     1 
ATOM   1836 C CA    . ILE C 3 189 ? 8.398   43.761 14.146  1.00 15.29  ? 484  ILE A CA    1 
ATOM   1837 C C     . ILE C 3 189 ? 9.800   43.433 14.663  1.00 14.41  ? 484  ILE A C     1 
ATOM   1838 O O     . ILE C 3 189 ? 10.721  44.233 14.441  1.00 14.88  ? 484  ILE A O     1 
ATOM   1839 C CB    . ILE C 3 189 ? 7.452   44.346 15.207  1.00 15.73  ? 484  ILE A CB    1 
ATOM   1840 C CG1   . ILE C 3 189 ? 6.156   44.868 14.573  1.00 15.67  ? 484  ILE A CG1   1 
ATOM   1841 C CG2   . ILE C 3 189 ? 8.149   45.432 16.019  1.00 16.05  ? 484  ILE A CG2   1 
ATOM   1842 C CD1   . ILE C 3 189 ? 5.059   45.102 15.612  1.00 15.33  ? 484  ILE A CD1   1 
ATOM   1843 N N     . LEU C 3 190 ? 9.962   42.291 15.314  1.00 13.96  ? 485  LEU A N     1 
ATOM   1844 C CA    . LEU C 3 190 ? 11.287  41.832 15.793  1.00 13.73  ? 485  LEU A CA    1 
ATOM   1845 C C     . LEU C 3 190 ? 12.228  41.700 14.589  1.00 12.62  ? 485  LEU A C     1 
ATOM   1846 O O     . LEU C 3 190 ? 13.348  42.156 14.712  1.00 12.14  ? 485  LEU A O     1 
ATOM   1847 C CB    . LEU C 3 190 ? 11.152  40.508 16.556  1.00 14.66  ? 485  LEU A CB    1 
ATOM   1848 C CG    . LEU C 3 190 ? 10.359  40.559 17.869  1.00 15.27  ? 485  LEU A CG    1 
ATOM   1849 C CD1   . LEU C 3 190 ? 10.261  39.160 18.498  1.00 15.59  ? 485  LEU A CD1   1 
ATOM   1850 C CD2   . LEU C 3 190 ? 10.984  41.540 18.836  1.00 14.11  ? 485  LEU A CD2   1 
ATOM   1851 N N     . ALA C 3 191 ? 11.780  41.116 13.476  1.00 12.61  ? 486  ALA A N     1 
ATOM   1852 C CA    . ALA C 3 191 ? 12.548  41.024 12.215  1.00 13.90  ? 486  ALA A CA    1 
ATOM   1853 C C     . ALA C 3 191 ? 13.107  42.399 11.861  1.00 14.22  ? 486  ALA A C     1 
ATOM   1854 O O     . ALA C 3 191 ? 14.290  42.470 11.556  1.00 15.33  ? 486  ALA A O     1 
ATOM   1855 C CB    . ALA C 3 191 ? 11.697  40.497 11.071  1.00 15.27  ? 486  ALA A CB    1 
ATOM   1856 N N     . GLU C 3 192 ? 12.277  43.438 11.867  1.00 14.67  ? 487  GLU A N     1 
ATOM   1857 C CA    . GLU C 3 192 ? 12.719  44.799 11.497  1.00 16.21  ? 487  GLU A CA    1 
ATOM   1858 C C     . GLU C 3 192 ? 13.770  45.281 12.487  1.00 14.98  ? 487  GLU A C     1 
ATOM   1859 O O     . GLU C 3 192 ? 14.817  45.799 12.035  1.00 14.93  ? 487  GLU A O     1 
ATOM   1860 C CB    . GLU C 3 192 ? 11.560  45.777 11.417  1.00 18.71  ? 487  GLU A CB    1 
ATOM   1861 C CG    . GLU C 3 192 ? 10.621  45.463 10.260  1.00 22.43  ? 487  GLU A CG    1 
ATOM   1862 C CD    . GLU C 3 192 ? 9.289   46.222 10.275  1.00 27.65  ? 487  GLU A CD    1 
ATOM   1863 O OE1   . GLU C 3 192 ? 9.053   47.059 11.210  1.00 26.97  ? 487  GLU A OE1   1 
ATOM   1864 O OE2   . GLU C 3 192 ? 8.480   45.980 9.348   1.00 34.39  ? 487  GLU A OE2   1 
ATOM   1865 N N     . MET C 3 193 ? 13.525  45.065 13.775  1.00 15.23  ? 488  MET A N     1 
ATOM   1866 C CA    . MET C 3 193 ? 14.405  45.571 14.847  1.00 15.04  ? 488  MET A CA    1 
ATOM   1867 C C     . MET C 3 193 ? 15.770  44.911 14.674  1.00 15.02  ? 488  MET A C     1 
ATOM   1868 O O     . MET C 3 193 ? 16.763  45.625 14.792  1.00 15.30  ? 488  MET A O     1 
ATOM   1869 C CB    . MET C 3 193 ? 13.844  45.247 16.230  1.00 15.03  ? 488  MET A CB    1 
ATOM   1870 C CG    . MET C 3 193 ? 12.664  46.125 16.604  1.00 15.81  ? 488  MET A CG    1 
ATOM   1871 S SD    . MET C 3 193 ? 11.633  45.410 17.913  1.00 14.96  ? 488  MET A SD    1 
ATOM   1872 C CE    . MET C 3 193 ? 12.683  45.679 19.347  1.00 15.21  ? 488  MET A CE    1 
ATOM   1873 N N     . GLU C 3 194 ? 15.786  43.601 14.412  1.00 14.43  ? 489  GLU A N     1 
ATOM   1874 C CA    . GLU C 3 194 ? 17.021  42.790 14.355  1.00 14.30  ? 489  GLU A CA    1 
ATOM   1875 C C     . GLU C 3 194 ? 17.811  43.274 13.136  1.00 15.16  ? 489  GLU A C     1 
ATOM   1876 O O     . GLU C 3 194 ? 19.011  43.499 13.229  1.00 15.52  ? 489  GLU A O     1 
ATOM   1877 C CB    . GLU C 3 194 ? 16.698  41.305 14.252  1.00 14.02  ? 489  GLU A CB    1 
ATOM   1878 C CG    . GLU C 3 194 ? 16.052  40.709 15.491  1.00 14.28  ? 489  GLU A CG    1 
ATOM   1879 C CD    . GLU C 3 194 ? 15.697  39.241 15.345  1.00 14.37  ? 489  GLU A CD    1 
ATOM   1880 O OE1   . GLU C 3 194 ? 15.178  38.650 16.334  1.00 13.37  ? 489  GLU A OE1   1 
ATOM   1881 O OE2   . GLU C 3 194 ? 15.910  38.693 14.235  1.00 14.89  ? 489  GLU A OE2   1 
ATOM   1882 N N     . PHE C 3 195 ? 17.123  43.430 12.017  1.00 15.41  ? 490  PHE A N     1 
ATOM   1883 C CA    . PHE C 3 195 ? 17.732  43.821 10.735  1.00 15.72  ? 490  PHE A CA    1 
ATOM   1884 C C     . PHE C 3 195 ? 18.315  45.241 10.826  1.00 16.01  ? 490  PHE A C     1 
ATOM   1885 O O     . PHE C 3 195 ? 19.405  45.439 10.312  1.00 14.89  ? 490  PHE A O     1 
ATOM   1886 C CB    . PHE C 3 195 ? 16.708  43.694 9.613   1.00 14.74  ? 490  PHE A CB    1 
ATOM   1887 C CG    . PHE C 3 195 ? 17.264  44.107 8.278   1.00 14.70  ? 490  PHE A CG    1 
ATOM   1888 C CD1   . PHE C 3 195 ? 18.312  43.397 7.701   1.00 14.27  ? 490  PHE A CD1   1 
ATOM   1889 C CD2   . PHE C 3 195 ? 16.762  45.232 7.619   1.00 14.34  ? 490  PHE A CD2   1 
ATOM   1890 C CE1   . PHE C 3 195 ? 18.829  43.796 6.478   1.00 14.88  ? 490  PHE A CE1   1 
ATOM   1891 C CE2   . PHE C 3 195 ? 17.286  45.629 6.395   1.00 13.88  ? 490  PHE A CE2   1 
ATOM   1892 C CZ    . PHE C 3 195 ? 18.303  44.902 5.818   1.00 14.75  ? 490  PHE A CZ    1 
ATOM   1893 N N     . ALA C 3 196 ? 17.602  46.203 11.415  1.00 16.44  ? 491  ALA A N     1 
ATOM   1894 C CA    . ALA C 3 196 ? 18.083  47.601 11.519  1.00 16.39  ? 491  ALA A CA    1 
ATOM   1895 C C     . ALA C 3 196 ? 19.308  47.600 12.442  1.00 17.06  ? 491  ALA A C     1 
ATOM   1896 O O     . ALA C 3 196 ? 20.303  48.281 12.152  1.00 18.25  ? 491  ALA A O     1 
ATOM   1897 C CB    . ALA C 3 196 ? 16.988  48.488 12.055  1.00 17.35  ? 491  ALA A CB    1 
ATOM   1898 N N     . GLY C 3 197 ? 19.238  46.844 13.529  1.00 15.35  ? 492  GLY A N     1 
ATOM   1899 C CA    . GLY C 3 197 ? 20.358  46.694 14.456  1.00 15.40  ? 492  GLY A CA    1 
ATOM   1900 C C     . GLY C 3 197 ? 20.626  47.986 15.191  1.00 15.96  ? 492  GLY A C     1 
ATOM   1901 O O     . GLY C 3 197 ? 19.884  48.933 15.002  1.00 15.39  ? 492  GLY A O     1 
ATOM   1902 N N     . VAL C 3 198 ? 21.692  48.012 15.981  1.00 17.30  ? 493  VAL A N     1 
ATOM   1903 C CA    . VAL C 3 198 ? 22.059  49.148 16.864  1.00 18.01  ? 493  VAL A CA    1 
ATOM   1904 C C     . VAL C 3 198 ? 23.496  49.519 16.529  1.00 18.55  ? 493  VAL A C     1 
ATOM   1905 O O     . VAL C 3 198 ? 24.359  48.631 16.581  1.00 19.91  ? 493  VAL A O     1 
ATOM   1906 C CB    . VAL C 3 198 ? 21.907  48.792 18.356  1.00 18.29  ? 493  VAL A CB    1 
ATOM   1907 C CG1   . VAL C 3 198 ? 22.255  49.980 19.246  1.00 19.60  ? 493  VAL A CG1   1 
ATOM   1908 C CG2   . VAL C 3 198 ? 20.508  48.292 18.669  1.00 18.61  ? 493  VAL A CG2   1 
ATOM   1909 N N     . LYS C 3 199 ? 23.728  50.788 16.225  1.00 19.82  ? 494  LYS A N     1 
ATOM   1910 C CA    . LYS C 3 199 ? 25.075  51.340 15.950  1.00 21.14  ? 494  LYS A CA    1 
ATOM   1911 C C     . LYS C 3 199 ? 25.916  51.306 17.223  1.00 20.13  ? 494  LYS A C     1 
ATOM   1912 O O     . LYS C 3 199 ? 25.435  51.747 18.284  1.00 18.05  ? 494  LYS A O     1 
ATOM   1913 C CB    . LYS C 3 199 ? 24.949  52.785 15.478  1.00 25.03  ? 494  LYS A CB    1 
ATOM   1914 C CG    . LYS C 3 199 ? 26.197  53.369 14.845  1.00 27.75  ? 494  LYS A CG    1 
ATOM   1915 C CD    . LYS C 3 199 ? 26.538  52.683 13.577  1.00 30.76  ? 494  LYS A CD    1 
ATOM   1916 C CE    . LYS C 3 199 ? 27.292  53.583 12.629  1.00 40.10  ? 494  LYS A CE    1 
ATOM   1917 N NZ    . LYS C 3 199 ? 26.362  54.500 11.922  1.00 47.58  ? 494  LYS A NZ    1 
ATOM   1918 N N     . VAL C 3 200 ? 27.159  50.858 17.113  1.00 20.31  ? 495  VAL A N     1 
ATOM   1919 C CA    . VAL C 3 200 ? 28.109  50.882 18.260  1.00 21.23  ? 495  VAL A CA    1 
ATOM   1920 C C     . VAL C 3 200 ? 29.266  51.829 17.939  1.00 21.52  ? 495  VAL A C     1 
ATOM   1921 O O     . VAL C 3 200 ? 29.769  51.818 16.795  1.00 21.71  ? 495  VAL A O     1 
ATOM   1922 C CB    . VAL C 3 200 ? 28.632  49.480 18.571  1.00 22.04  ? 495  VAL A CB    1 
ATOM   1923 C CG1   . VAL C 3 200 ? 29.669  49.509 19.679  1.00 23.60  ? 495  VAL A CG1   1 
ATOM   1924 C CG2   . VAL C 3 200 ? 27.502  48.529 18.892  1.00 22.64  ? 495  VAL A CG2   1 
ATOM   1925 N N     . ASP C 3 201 ? 29.680  52.592 18.942  1.00 22.87  ? 496  ASP A N     1 
ATOM   1926 C CA    . ASP C 3 201 ? 30.902  53.433 18.926  1.00 23.81  ? 496  ASP A CA    1 
ATOM   1927 C C     . ASP C 3 201 ? 32.084  52.537 19.275  1.00 23.24  ? 496  ASP A C     1 
ATOM   1928 O O     . ASP C 3 201 ? 32.441  52.462 20.487  1.00 21.27  ? 496  ASP A O     1 
ATOM   1929 C CB    . ASP C 3 201 ? 30.777  54.566 19.947  1.00 27.30  ? 496  ASP A CB    1 
ATOM   1930 C CG    . ASP C 3 201 ? 31.888  55.602 19.856  1.00 28.56  ? 496  ASP A CG    1 
ATOM   1931 O OD1   . ASP C 3 201 ? 32.968  55.269 19.306  1.00 27.22  ? 496  ASP A OD1   1 
ATOM   1932 O OD2   . ASP C 3 201 ? 31.635  56.742 20.303  1.00 27.76  ? 496  ASP A OD2   1 
ATOM   1933 N N     . THR C 3 202 ? 32.604  51.800 18.292  1.00 22.83  ? 497  THR A N     1 
ATOM   1934 C CA    . THR C 3 202 ? 33.655  50.778 18.545  1.00 27.15  ? 497  THR A CA    1 
ATOM   1935 C C     . THR C 3 202 ? 34.909  51.455 19.120  1.00 29.10  ? 497  THR A C     1 
ATOM   1936 O O     . THR C 3 202 ? 35.589  50.799 19.918  1.00 30.50  ? 497  THR A O     1 
ATOM   1937 C CB    . THR C 3 202 ? 34.064  49.991 17.297  1.00 26.37  ? 497  THR A CB    1 
ATOM   1938 O OG1   . THR C 3 202 ? 34.256  50.990 16.294  1.00 26.38  ? 497  THR A OG1   1 
ATOM   1939 C CG2   . THR C 3 202 ? 33.049  48.950 16.877  1.00 26.46  ? 497  THR A CG2   1 
ATOM   1940 N N     . LYS C 3 203 ? 35.222  52.688 18.720  1.00 32.63  ? 498  LYS A N     1 
ATOM   1941 C CA    . LYS C 3 203 ? 36.415  53.419 19.245  1.00 40.76  ? 498  LYS A CA    1 
ATOM   1942 C C     . LYS C 3 203 ? 36.253  53.584 20.756  1.00 36.49  ? 498  LYS A C     1 
ATOM   1943 O O     . LYS C 3 203 ? 37.206  53.272 21.470  1.00 32.94  ? 498  LYS A O     1 
ATOM   1944 C CB    . LYS C 3 203 ? 36.626  54.792 18.590  1.00 44.52  ? 498  LYS A CB    1 
ATOM   1945 C CG    . LYS C 3 203 ? 37.343  54.764 17.252  1.00 50.68  ? 498  LYS A CG    1 
ATOM   1946 C CD    . LYS C 3 203 ? 38.812  54.387 17.364  1.00 60.04  ? 498  LYS A CD    1 
ATOM   1947 C CE    . LYS C 3 203 ? 39.334  53.605 16.171  1.00 65.13  ? 498  LYS A CE    1 
ATOM   1948 N NZ    . LYS C 3 203 ? 39.157  54.352 14.903  1.00 61.72  ? 498  LYS A NZ    1 
ATOM   1949 N N     . ARG C 3 204 ? 35.076  54.024 21.205  1.00 36.49  ? 499  ARG A N     1 
ATOM   1950 C CA    . ARG C 3 204 ? 34.759  54.165 22.647  1.00 38.98  ? 499  ARG A CA    1 
ATOM   1951 C C     . ARG C 3 204 ? 34.967  52.809 23.325  1.00 38.54  ? 499  ARG A C     1 
ATOM   1952 O O     . ARG C 3 204 ? 35.632  52.787 24.378  1.00 35.66  ? 499  ARG A O     1 
ATOM   1953 C CB    . ARG C 3 204 ? 33.342  54.708 22.844  1.00 46.44  ? 499  ARG A CB    1 
ATOM   1954 C CG    . ARG C 3 204 ? 32.943  54.946 24.295  1.00 48.54  ? 499  ARG A CG    1 
ATOM   1955 C CD    . ARG C 3 204 ? 33.870  55.909 25.004  1.00 53.26  ? 499  ARG A CD    1 
ATOM   1956 N NE    . ARG C 3 204 ? 33.154  56.786 25.915  1.00 57.90  ? 499  ARG A NE    1 
ATOM   1957 C CZ    . ARG C 3 204 ? 32.409  57.829 25.542  1.00 65.56  ? 499  ARG A CZ    1 
ATOM   1958 N NH1   . ARG C 3 204 ? 32.256  58.124 24.262  1.00 69.59  ? 499  ARG A NH1   1 
ATOM   1959 N NH2   . ARG C 3 204 ? 31.801  58.574 26.452  1.00 68.28  ? 499  ARG A NH2   1 
ATOM   1960 N N     . LEU C 3 205 ? 34.445  51.717 22.756  1.00 33.93  ? 500  LEU A N     1 
ATOM   1961 C CA    . LEU C 3 205 ? 34.595  50.373 23.375  1.00 32.19  ? 500  LEU A CA    1 
ATOM   1962 C C     . LEU C 3 205 ? 36.093  50.007 23.432  1.00 34.14  ? 500  LEU A C     1 
ATOM   1963 O O     . LEU C 3 205 ? 36.543  49.506 24.477  1.00 29.69  ? 500  LEU A O     1 
ATOM   1964 C CB    . LEU C 3 205 ? 33.799  49.326 22.590  1.00 29.48  ? 500  LEU A CB    1 
ATOM   1965 C CG    . LEU C 3 205 ? 32.304  49.231 22.887  1.00 31.06  ? 500  LEU A CG    1 
ATOM   1966 C CD1   . LEU C 3 205 ? 31.672  48.126 22.073  1.00 30.03  ? 500  LEU A CD1   1 
ATOM   1967 C CD2   . LEU C 3 205 ? 32.022  49.001 24.364  1.00 33.57  ? 500  LEU A CD2   1 
ATOM   1968 N N     . GLU C 3 206 ? 36.841  50.218 22.343  1.00 32.29  ? 501  GLU A N     1 
ATOM   1969 C CA    . GLU C 3 206 ? 38.296  49.895 22.293  1.00 36.55  ? 501  GLU A CA    1 
ATOM   1970 C C     . GLU C 3 206 ? 39.031  50.652 23.413  1.00 34.06  ? 501  GLU A C     1 
ATOM   1971 O O     . GLU C 3 206 ? 39.845  50.028 24.102  1.00 31.62  ? 501  GLU A O     1 
ATOM   1972 C CB    . GLU C 3 206 ? 38.882  50.180 20.909  1.00 36.43  ? 501  GLU A CB    1 
ATOM   1973 C CG    . GLU C 3 206 ? 38.744  48.983 19.979  1.00 39.59  ? 501  GLU A CG    1 
ATOM   1974 C CD    . GLU C 3 206 ? 38.679  49.323 18.498  1.00 44.67  ? 501  GLU A CD    1 
ATOM   1975 O OE1   . GLU C 3 206 ? 39.031  50.477 18.139  1.00 48.46  ? 501  GLU A OE1   1 
ATOM   1976 O OE2   . GLU C 3 206 ? 38.257  48.436 17.707  1.00 43.97  ? 501  GLU A OE2   1 
ATOM   1977 N N     . GLN C 3 207 ? 38.708  51.925 23.609  1.00 32.86  ? 502  GLN A N     1 
ATOM   1978 C CA    . GLN C 3 207 ? 39.377  52.801 24.598  1.00 40.83  ? 502  GLN A CA    1 
ATOM   1979 C C     . GLN C 3 207 ? 39.006  52.305 26.005  1.00 41.77  ? 502  GLN A C     1 
ATOM   1980 O O     . GLN C 3 207 ? 39.942  52.130 26.819  1.00 39.11  ? 502  GLN A O     1 
ATOM   1981 C CB    . GLN C 3 207 ? 39.054  54.273 24.297  1.00 44.23  ? 502  GLN A CB    1 
ATOM   1982 C CG    . GLN C 3 207 ? 39.818  55.277 25.151  1.00 50.39  ? 502  GLN A CG    1 
ATOM   1983 C CD    . GLN C 3 207 ? 41.265  54.909 25.401  1.00 58.91  ? 502  GLN A CD    1 
ATOM   1984 O OE1   . GLN C 3 207 ? 42.020  54.538 24.492  1.00 59.83  ? 502  GLN A OE1   1 
ATOM   1985 N NE2   . GLN C 3 207 ? 41.671  55.022 26.658  1.00 58.99  ? 502  GLN A NE2   1 
ATOM   1986 N N     . MET C 3 208 ? 37.731  51.988 26.260  1.00 37.75  ? 503  MET A N     1 
ATOM   1987 C CA    . MET C 3 208 ? 37.310  51.352 27.538  1.00 40.68  ? 503  MET A CA    1 
ATOM   1988 C C     . MET C 3 208 ? 38.089  50.046 27.721  1.00 38.96  ? 503  MET A C     1 
ATOM   1989 O O     . MET C 3 208 ? 38.583  49.820 28.825  1.00 34.37  ? 503  MET A O     1 
ATOM   1990 C CB    . MET C 3 208 ? 35.806  51.082 27.587  1.00 43.25  ? 503  MET A CB    1 
ATOM   1991 C CG    . MET C 3 208 ? 34.988  52.362 27.646  1.00 47.58  ? 503  MET A CG    1 
ATOM   1992 S SD    . MET C 3 208 ? 33.205  52.045 27.567  1.00 53.40  ? 503  MET A SD    1 
ATOM   1993 C CE    . MET C 3 208 ? 33.025  51.205 29.143  1.00 50.76  ? 503  MET A CE    1 
ATOM   1994 N N     . GLY C 3 209 ? 38.206  49.244 26.664  1.00 39.82  ? 504  GLY A N     1 
ATOM   1995 C CA    . GLY C 3 209 ? 39.045  48.032 26.623  1.00 41.75  ? 504  GLY A CA    1 
ATOM   1996 C C     . GLY C 3 209 ? 40.424  48.270 27.225  1.00 45.41  ? 504  GLY A C     1 
ATOM   1997 O O     . GLY C 3 209 ? 40.830  47.456 28.101  1.00 41.13  ? 504  GLY A O     1 
ATOM   1998 N N     . LYS C 3 210 ? 41.109  49.340 26.794  1.00 46.37  ? 505  LYS A N     1 
ATOM   1999 C CA    . LYS C 3 210 ? 42.516  49.643 27.180  1.00 51.75  ? 505  LYS A CA    1 
ATOM   2000 C C     . LYS C 3 210 ? 42.579  49.998 28.669  1.00 46.12  ? 505  LYS A C     1 
ATOM   2001 O O     . LYS C 3 210 ? 43.412  49.390 29.354  1.00 42.17  ? 505  LYS A O     1 
ATOM   2002 C CB    . LYS C 3 210 ? 43.129  50.756 26.323  1.00 58.90  ? 505  LYS A CB    1 
ATOM   2003 C CG    . LYS C 3 210 ? 43.736  50.272 25.013  1.00 67.92  ? 505  LYS A CG    1 
ATOM   2004 C CD    . LYS C 3 210 ? 44.201  51.373 24.067  1.00 73.61  ? 505  LYS A CD    1 
ATOM   2005 C CE    . LYS C 3 210 ? 44.441  50.844 22.663  1.00 78.11  ? 505  LYS A CE    1 
ATOM   2006 N NZ    . LYS C 3 210 ? 45.165  51.815 21.809  1.00 79.34  ? 505  LYS A NZ    1 
ATOM   2007 N N     . GLU C 3 211 ? 41.744  50.934 29.138  1.00 46.48  ? 506  GLU A N     1 
ATOM   2008 C CA    . GLU C 3 211 ? 41.689  51.375 30.563  1.00 54.66  ? 506  GLU A CA    1 
ATOM   2009 C C     . GLU C 3 211 ? 41.456  50.168 31.484  1.00 57.69  ? 506  GLU A C     1 
ATOM   2010 O O     . GLU C 3 211 ? 42.153  50.077 32.524  1.00 62.10  ? 506  GLU A O     1 
ATOM   2011 C CB    . GLU C 3 211 ? 40.587  52.410 30.787  1.00 58.14  ? 506  GLU A CB    1 
ATOM   2012 C CG    . GLU C 3 211 ? 40.907  53.777 30.201  1.00 63.08  ? 506  GLU A CG    1 
ATOM   2013 C CD    . GLU C 3 211 ? 39.736  54.753 30.181  1.00 67.85  ? 506  GLU A CD    1 
ATOM   2014 O OE1   . GLU C 3 211 ? 38.658  54.395 30.712  1.00 66.72  ? 506  GLU A OE1   1 
ATOM   2015 O OE2   . GLU C 3 211 ? 39.895  55.863 29.618  1.00 63.73  ? 506  GLU A OE2   1 
ATOM   2016 N N     . LEU C 3 212 ? 40.523  49.282 31.111  1.00 51.34  ? 507  LEU A N     1 
ATOM   2017 C CA    . LEU C 3 212 ? 40.164  48.056 31.874  1.00 48.16  ? 507  LEU A CA    1 
ATOM   2018 C C     . LEU C 3 212 ? 41.373  47.119 31.961  1.00 46.72  ? 507  LEU A C     1 
ATOM   2019 O O     . LEU C 3 212 ? 41.645  46.643 33.073  1.00 44.21  ? 507  LEU A O     1 
ATOM   2020 C CB    . LEU C 3 212 ? 38.978  47.352 31.209  1.00 44.90  ? 507  LEU A CB    1 
ATOM   2021 C CG    . LEU C 3 212 ? 37.608  47.931 31.546  1.00 47.22  ? 507  LEU A CG    1 
ATOM   2022 C CD1   . LEU C 3 212 ? 36.558  47.379 30.596  1.00 48.96  ? 507  LEU A CD1   1 
ATOM   2023 C CD2   . LEU C 3 212 ? 37.228  47.639 32.992  1.00 43.14  ? 507  LEU A CD2   1 
ATOM   2024 N N     . ALA C 3 213 ? 42.059  46.876 30.839  1.00 46.02  ? 508  ALA A N     1 
ATOM   2025 C CA    . ALA C 3 213 ? 43.222  45.961 30.725  1.00 50.02  ? 508  ALA A CA    1 
ATOM   2026 C C     . ALA C 3 213 ? 44.357  46.424 31.654  1.00 48.93  ? 508  ALA A C     1 
ATOM   2027 O O     . ALA C 3 213 ? 45.020  45.548 32.251  1.00 44.67  ? 508  ALA A O     1 
ATOM   2028 C CB    . ALA C 3 213 ? 43.693  45.883 29.289  1.00 52.38  ? 508  ALA A CB    1 
ATOM   2029 N N     . GLU C 3 214 ? 44.572  47.739 31.749  1.00 50.03  ? 509  GLU A N     1 
ATOM   2030 C CA    . GLU C 3 214 ? 45.580  48.359 32.648  1.00 57.39  ? 509  GLU A CA    1 
ATOM   2031 C C     . GLU C 3 214 ? 45.140  48.152 34.098  1.00 57.07  ? 509  GLU A C     1 
ATOM   2032 O O     . GLU C 3 214 ? 45.972  47.665 34.880  1.00 55.85  ? 509  GLU A O     1 
ATOM   2033 C CB    . GLU C 3 214 ? 45.778  49.845 32.342  1.00 58.65  ? 509  GLU A CB    1 
ATOM   2034 C CG    . GLU C 3 214 ? 47.008  50.099 31.495  1.00 65.34  ? 509  GLU A CG    1 
ATOM   2035 C CD    . GLU C 3 214 ? 47.040  51.460 30.825  1.00 68.63  ? 509  GLU A CD    1 
ATOM   2036 O OE1   . GLU C 3 214 ? 46.766  52.452 31.515  1.00 68.35  ? 509  GLU A OE1   1 
ATOM   2037 O OE2   . GLU C 3 214 ? 47.323  51.516 29.611  1.00 71.99  ? 509  GLU A OE2   1 
ATOM   2038 N N     . GLN C 3 215 ? 43.884  48.491 34.420  1.00 55.56  ? 510  GLN A N     1 
ATOM   2039 C CA    . GLN C 3 215 ? 43.303  48.368 35.786  1.00 55.90  ? 510  GLN A CA    1 
ATOM   2040 C C     . GLN C 3 215 ? 43.297  46.900 36.243  1.00 57.23  ? 510  GLN A C     1 
ATOM   2041 O O     . GLN C 3 215 ? 43.599  46.662 37.433  1.00 61.44  ? 510  GLN A O     1 
ATOM   2042 C CB    . GLN C 3 215 ? 41.900  48.971 35.827  1.00 54.93  ? 510  GLN A CB    1 
ATOM   2043 C CG    . GLN C 3 215 ? 41.903  50.488 35.750  1.00 58.20  ? 510  GLN A CG    1 
ATOM   2044 C CD    . GLN C 3 215 ? 40.654  51.094 36.343  1.00 62.62  ? 510  GLN A CD    1 
ATOM   2045 O OE1   . GLN C 3 215 ? 39.568  50.523 36.276  1.00 64.01  ? 510  GLN A OE1   1 
ATOM   2046 N NE2   . GLN C 3 215 ? 40.800  52.272 36.929  1.00 64.12  ? 510  GLN A NE2   1 
ATOM   2047 N N     . LEU C 3 216 ? 42.972  45.957 35.351  1.00 53.25  ? 511  LEU A N     1 
ATOM   2048 C CA    . LEU C 3 216 ? 42.989  44.498 35.651  1.00 54.91  ? 511  LEU A CA    1 
ATOM   2049 C C     . LEU C 3 216 ? 44.421  44.076 36.003  1.00 56.92  ? 511  LEU A C     1 
ATOM   2050 O O     . LEU C 3 216 ? 44.576  43.353 36.994  1.00 60.72  ? 511  LEU A O     1 
ATOM   2051 C CB    . LEU C 3 216 ? 42.469  43.683 34.458  1.00 52.15  ? 511  LEU A CB    1 
ATOM   2052 C CG    . LEU C 3 216 ? 40.953  43.484 34.381  1.00 52.96  ? 511  LEU A CG    1 
ATOM   2053 C CD1   . LEU C 3 216 ? 40.548  42.950 33.014  1.00 48.19  ? 511  LEU A CD1   1 
ATOM   2054 C CD2   . LEU C 3 216 ? 40.459  42.539 35.467  1.00 52.31  ? 511  LEU A CD2   1 
ATOM   2055 N N     . GLY C 3 217 ? 45.411  44.490 35.198  1.00 63.70  ? 512  GLY A N     1 
ATOM   2056 C CA    . GLY C 3 217 ? 46.849  44.184 35.376  1.00 63.12  ? 512  GLY A CA    1 
ATOM   2057 C C     . GLY C 3 217 ? 47.357  44.637 36.736  1.00 64.98  ? 512  GLY A C     1 
ATOM   2058 O O     . GLY C 3 217 ? 48.068  43.843 37.384  1.00 56.58  ? 512  GLY A O     1 
ATOM   2059 N N     . THR C 3 218 ? 46.987  45.863 37.137  1.00 63.31  ? 513  THR A N     1 
ATOM   2060 C CA    . THR C 3 218 ? 47.174  46.460 38.490  1.00 65.52  ? 513  THR A CA    1 
ATOM   2061 C C     . THR C 3 218 ? 46.589  45.524 39.557  1.00 67.68  ? 513  THR A C     1 
ATOM   2062 O O     . THR C 3 218 ? 47.363  45.070 40.424  1.00 70.80  ? 513  THR A O     1 
ATOM   2063 C CB    . THR C 3 218 ? 46.529  47.855 38.567  1.00 67.49  ? 513  THR A CB    1 
ATOM   2064 O OG1   . THR C 3 218 ? 47.320  48.711 37.744  1.00 63.70  ? 513  THR A OG1   1 
ATOM   2065 C CG2   . THR C 3 218 ? 46.425  48.427 39.969  1.00 63.34  ? 513  THR A CG2   1 
ATOM   2066 N N     . VAL C 3 219 ? 45.280  45.254 39.484  1.00 64.09  ? 514  VAL A N     1 
ATOM   2067 C CA    . VAL C 3 219 ? 44.508  44.510 40.523  1.00 60.95  ? 514  VAL A CA    1 
ATOM   2068 C C     . VAL C 3 219 ? 44.970  43.045 40.538  1.00 59.05  ? 514  VAL A C     1 
ATOM   2069 O O     . VAL C 3 219 ? 45.014  42.475 41.641  1.00 59.29  ? 514  VAL A O     1 
ATOM   2070 C CB    . VAL C 3 219 ? 42.979  44.644 40.352  1.00 58.41  ? 514  VAL A CB    1 
ATOM   2071 C CG1   . VAL C 3 219 ? 42.228  43.898 41.442  1.00 58.44  ? 514  VAL A CG1   1 
ATOM   2072 C CG2   . VAL C 3 219 ? 42.527  46.095 40.349  1.00 60.16  ? 514  VAL A CG2   1 
ATOM   2073 N N     . GLU C 3 220 ? 45.324  42.459 39.389  1.00 53.91  ? 515  GLU A N     1 
ATOM   2074 C CA    . GLU C 3 220 ? 45.934  41.101 39.317  1.00 56.07  ? 515  GLU A CA    1 
ATOM   2075 C C     . GLU C 3 220 ? 47.184  41.054 40.208  1.00 63.26  ? 515  GLU A C     1 
ATOM   2076 O O     . GLU C 3 220 ? 47.321  40.094 41.016  1.00 55.19  ? 515  GLU A O     1 
ATOM   2077 C CB    . GLU C 3 220 ? 46.350  40.731 37.894  1.00 58.90  ? 515  GLU A CB    1 
ATOM   2078 C CG    . GLU C 3 220 ? 45.493  39.661 37.255  1.00 61.47  ? 515  GLU A CG    1 
ATOM   2079 C CD    . GLU C 3 220 ? 45.571  39.649 35.739  1.00 62.99  ? 515  GLU A CD    1 
ATOM   2080 O OE1   . GLU C 3 220 ? 44.524  39.409 35.095  1.00 67.80  ? 515  GLU A OE1   1 
ATOM   2081 O OE2   . GLU C 3 220 ? 46.676  39.890 35.209  1.00 57.46  ? 515  GLU A OE2   1 
ATOM   2082 N N     . GLN C 3 221 ? 48.069  42.046 40.052  1.00 66.80  ? 516  GLN A N     1 
ATOM   2083 C CA    . GLN C 3 221 ? 49.400  42.104 40.721  1.00 72.88  ? 516  GLN A CA    1 
ATOM   2084 C C     . GLN C 3 221 ? 49.185  42.242 42.235  1.00 65.82  ? 516  GLN A C     1 
ATOM   2085 O O     . GLN C 3 221 ? 49.810  41.471 42.978  1.00 64.03  ? 516  GLN A O     1 
ATOM   2086 C CB    . GLN C 3 221 ? 50.266  43.229 40.133  1.00 73.86  ? 516  GLN A CB    1 
ATOM   2087 C CG    . GLN C 3 221 ? 51.750  42.878 40.041  1.00 74.18  ? 516  GLN A CG    1 
ATOM   2088 C CD    . GLN C 3 221 ? 52.035  41.673 39.169  1.00 73.33  ? 516  GLN A CD    1 
ATOM   2089 O OE1   . GLN C 3 221 ? 51.148  41.113 38.524  1.00 66.56  ? 516  GLN A OE1   1 
ATOM   2090 N NE2   . GLN C 3 221 ? 53.292  41.256 39.145  1.00 66.30  ? 516  GLN A NE2   1 
ATOM   2091 N N     . ARG C 3 222 ? 48.313  43.164 42.653  1.00 62.00  ? 517  ARG A N     1 
ATOM   2092 C CA    . ARG C 3 222 ? 47.911  43.377 44.069  1.00 61.37  ? 517  ARG A CA    1 
ATOM   2093 C C     . ARG C 3 222 ? 47.469  42.025 44.656  1.00 60.25  ? 517  ARG A C     1 
ATOM   2094 O O     . ARG C 3 222 ? 47.974  41.653 45.729  1.00 62.30  ? 517  ARG A O     1 
ATOM   2095 C CB    . ARG C 3 222 ? 46.809  44.445 44.160  1.00 66.40  ? 517  ARG A CB    1 
ATOM   2096 C CG    . ARG C 3 222 ? 46.979  45.492 45.257  1.00 72.63  ? 517  ARG A CG    1 
ATOM   2097 C CD    . ARG C 3 222 ? 47.821  45.025 46.433  1.00 80.78  ? 517  ARG A CD    1 
ATOM   2098 N NE    . ARG C 3 222 ? 47.659  45.806 47.653  1.00 84.34  ? 517  ARG A NE    1 
ATOM   2099 C CZ    . ARG C 3 222 ? 48.473  45.740 48.708  1.00 86.07  ? 517  ARG A CZ    1 
ATOM   2100 N NH1   . ARG C 3 222 ? 49.526  44.937 48.703  1.00 79.03  ? 517  ARG A NH1   1 
ATOM   2101 N NH2   . ARG C 3 222 ? 48.231  46.488 49.771  1.00 89.14  ? 517  ARG A NH2   1 
ATOM   2102 N N     . ILE C 3 223 ? 46.606  41.290 43.951  1.00 56.69  ? 518  ILE A N     1 
ATOM   2103 C CA    . ILE C 3 223 ? 46.014  40.007 44.432  1.00 58.58  ? 518  ILE A CA    1 
ATOM   2104 C C     . ILE C 3 223 ? 47.136  39.006 44.715  1.00 57.58  ? 518  ILE A C     1 
ATOM   2105 O O     . ILE C 3 223 ? 47.046  38.320 45.737  1.00 59.74  ? 518  ILE A O     1 
ATOM   2106 C CB    . ILE C 3 223 ? 44.997  39.416 43.433  1.00 58.57  ? 518  ILE A CB    1 
ATOM   2107 C CG1   . ILE C 3 223 ? 43.858  40.388 43.103  1.00 64.28  ? 518  ILE A CG1   1 
ATOM   2108 C CG2   . ILE C 3 223 ? 44.481  38.077 43.941  1.00 59.22  ? 518  ILE A CG2   1 
ATOM   2109 C CD1   . ILE C 3 223 ? 42.519  40.043 43.700  1.00 63.89  ? 518  ILE A CD1   1 
ATOM   2110 N N     . TYR C 3 224 ? 48.124  38.890 43.826  1.00 64.61  ? 519  TYR A N     1 
ATOM   2111 C CA    . TYR C 3 224 ? 49.234  37.905 43.947  1.00 73.93  ? 519  TYR A CA    1 
ATOM   2112 C C     . TYR C 3 224 ? 50.204  38.332 45.063  1.00 77.97  ? 519  TYR A C     1 
ATOM   2113 O O     . TYR C 3 224 ? 50.883  37.455 45.642  1.00 73.36  ? 519  TYR A O     1 
ATOM   2114 C CB    . TYR C 3 224 ? 50.000  37.750 42.630  1.00 79.67  ? 519  TYR A CB    1 
ATOM   2115 C CG    . TYR C 3 224 ? 49.180  37.413 41.407  1.00 80.93  ? 519  TYR A CG    1 
ATOM   2116 C CD1   . TYR C 3 224 ? 48.251  36.382 41.409  1.00 78.69  ? 519  TYR A CD1   1 
ATOM   2117 C CD2   . TYR C 3 224 ? 49.376  38.099 40.216  1.00 80.54  ? 519  TYR A CD2   1 
ATOM   2118 C CE1   . TYR C 3 224 ? 47.521  36.064 40.273  1.00 77.58  ? 519  TYR A CE1   1 
ATOM   2119 C CE2   . TYR C 3 224 ? 48.651  37.797 39.073  1.00 77.90  ? 519  TYR A CE2   1 
ATOM   2120 C CZ    . TYR C 3 224 ? 47.720  36.773 39.098  1.00 77.75  ? 519  TYR A CZ    1 
ATOM   2121 O OH    . TYR C 3 224 ? 47.016  36.482 37.961  1.00 73.68  ? 519  TYR A OH    1 
ATOM   2122 N N     . GLU C 3 225 ? 50.283  39.641 45.340  1.00 83.82  ? 520  GLU A N     1 
ATOM   2123 C CA    . GLU C 3 225 ? 51.090  40.216 46.451  1.00 87.73  ? 520  GLU A CA    1 
ATOM   2124 C C     . GLU C 3 225 ? 50.428  39.839 47.785  1.00 83.10  ? 520  GLU A C     1 
ATOM   2125 O O     . GLU C 3 225 ? 51.160  39.393 48.694  1.00 93.20  ? 520  GLU A O     1 
ATOM   2126 C CB    . GLU C 3 225 ? 51.240  41.734 46.298  1.00 93.81  ? 520  GLU A CB    1 
ATOM   2127 C CG    . GLU C 3 225 ? 52.491  42.290 46.960  1.00 96.46  ? 520  GLU A CG    1 
ATOM   2128 C CD    . GLU C 3 225 ? 52.530  43.803 47.099  1.00 102.83 ? 520  GLU A CD    1 
ATOM   2129 O OE1   . GLU C 3 225 ? 51.460  44.444 46.997  1.00 107.54 ? 520  GLU A OE1   1 
ATOM   2130 O OE2   . GLU C 3 225 ? 53.633  44.337 47.314  1.00 102.16 ? 520  GLU A OE2   1 
ATOM   2131 N N     . LEU C 3 226 ? 49.100  39.975 47.890  1.00 67.45  ? 521  LEU A N     1 
ATOM   2132 C CA    . LEU C 3 226 ? 48.331  39.721 49.142  1.00 62.81  ? 521  LEU A CA    1 
ATOM   2133 C C     . LEU C 3 226 ? 48.243  38.217 49.432  1.00 60.78  ? 521  LEU A C     1 
ATOM   2134 O O     . LEU C 3 226 ? 48.224  37.845 50.624  1.00 65.17  ? 521  LEU A O     1 
ATOM   2135 C CB    . LEU C 3 226 ? 46.947  40.357 49.006  1.00 60.61  ? 521  LEU A CB    1 
ATOM   2136 C CG    . LEU C 3 226 ? 46.937  41.874 49.189  1.00 65.27  ? 521  LEU A CG    1 
ATOM   2137 C CD1   . LEU C 3 226 ? 45.732  42.502 48.511  1.00 62.57  ? 521  LEU A CD1   1 
ATOM   2138 C CD2   . LEU C 3 226 ? 46.978  42.245 50.672  1.00 68.63  ? 521  LEU A CD2   1 
ATOM   2139 N N     . ALA C 3 227 ? 48.175  37.391 48.384  1.00 56.21  ? 522  ALA A N     1 
ATOM   2140 C CA    . ALA C 3 227 ? 48.147  35.914 48.457  1.00 57.54  ? 522  ALA A CA    1 
ATOM   2141 C C     . ALA C 3 227 ? 49.572  35.355 48.551  1.00 63.23  ? 522  ALA A C     1 
ATOM   2142 O O     . ALA C 3 227 ? 49.702  34.128 48.775  1.00 58.42  ? 522  ALA A O     1 
ATOM   2143 C CB    . ALA C 3 227 ? 47.439  35.357 47.249  1.00 58.05  ? 522  ALA A CB    1 
ATOM   2144 N N     . GLY C 3 228 ? 50.586  36.210 48.350  1.00 68.57  ? 523  GLY A N     1 
ATOM   2145 C CA    . GLY C 3 228 ? 52.008  35.837 48.245  1.00 67.50  ? 523  GLY A CA    1 
ATOM   2146 C C     . GLY C 3 228 ? 52.190  34.639 47.331  1.00 75.85  ? 523  GLY A C     1 
ATOM   2147 O O     . GLY C 3 228 ? 52.828  33.661 47.774  1.00 75.53  ? 523  GLY A O     1 
ATOM   2148 N N     . GLN C 3 229 ? 51.607  34.694 46.126  1.00 71.00  ? 524  GLN A N     1 
ATOM   2149 C CA    . GLN C 3 229 ? 51.809  33.695 45.038  1.00 71.15  ? 524  GLN A CA    1 
ATOM   2150 C C     . GLN C 3 229 ? 50.820  33.936 43.887  1.00 74.72  ? 524  GLN A C     1 
ATOM   2151 O O     . GLN C 3 229 ? 49.722  34.478 44.126  1.00 79.60  ? 524  GLN A O     1 
ATOM   2152 C CB    . GLN C 3 229 ? 51.651  32.250 45.528  1.00 67.34  ? 524  GLN A CB    1 
ATOM   2153 C CG    . GLN C 3 229 ? 50.326  31.953 46.213  1.00 64.32  ? 524  GLN A CG    1 
ATOM   2154 C CD    . GLN C 3 229 ? 50.077  30.474 46.370  1.00 64.69  ? 524  GLN A CD    1 
ATOM   2155 O OE1   . GLN C 3 229 ? 50.348  29.888 47.414  1.00 70.53  ? 524  GLN A OE1   1 
ATOM   2156 N NE2   . GLN C 3 229 ? 49.546  29.854 45.330  1.00 64.72  ? 524  GLN A NE2   1 
ATOM   2157 N N     . GLU C 3 230 ? 51.201  33.485 42.692  1.00 74.43  ? 525  GLU A N     1 
ATOM   2158 C CA    . GLU C 3 230 ? 50.371  33.505 41.461  1.00 79.98  ? 525  GLU A CA    1 
ATOM   2159 C C     . GLU C 3 230 ? 49.403  32.316 41.485  1.00 74.76  ? 525  GLU A C     1 
ATOM   2160 O O     . GLU C 3 230 ? 49.812  31.208 41.872  1.00 70.17  ? 525  GLU A O     1 
ATOM   2161 C CB    . GLU C 3 230 ? 51.254  33.455 40.209  1.00 85.49  ? 525  GLU A CB    1 
ATOM   2162 C CG    . GLU C 3 230 ? 52.371  34.489 40.207  1.00 89.25  ? 525  GLU A CG    1 
ATOM   2163 C CD    . GLU C 3 230 ? 52.951  34.806 38.839  1.00 90.67  ? 525  GLU A CD    1 
ATOM   2164 O OE1   . GLU C 3 230 ? 53.600  35.860 38.709  1.00 89.43  ? 525  GLU A OE1   1 
ATOM   2165 O OE2   . GLU C 3 230 ? 52.748  34.002 37.906  1.00 91.44  ? 525  GLU A OE2   1 
ATOM   2166 N N     . PHE C 3 231 ? 48.158  32.550 41.075  1.00 64.72  ? 526  PHE A N     1 
ATOM   2167 C CA    . PHE C 3 231 ? 47.143  31.495 40.832  1.00 60.64  ? 526  PHE A CA    1 
ATOM   2168 C C     . PHE C 3 231 ? 46.164  32.004 39.771  1.00 54.99  ? 526  PHE A C     1 
ATOM   2169 O O     . PHE C 3 231 ? 46.149  33.217 39.491  1.00 52.05  ? 526  PHE A O     1 
ATOM   2170 C CB    . PHE C 3 231 ? 46.448  31.121 42.147  1.00 58.58  ? 526  PHE A CB    1 
ATOM   2171 C CG    . PHE C 3 231 ? 45.609  32.215 42.762  1.00 53.81  ? 526  PHE A CG    1 
ATOM   2172 C CD1   . PHE C 3 231 ? 46.203  33.303 43.388  1.00 50.39  ? 526  PHE A CD1   1 
ATOM   2173 C CD2   . PHE C 3 231 ? 44.223  32.161 42.708  1.00 49.72  ? 526  PHE A CD2   1 
ATOM   2174 C CE1   . PHE C 3 231 ? 45.433  34.310 43.948  1.00 47.65  ? 526  PHE A CE1   1 
ATOM   2175 C CE2   . PHE C 3 231 ? 43.456  33.174 43.260  1.00 48.67  ? 526  PHE A CE2   1 
ATOM   2176 C CZ    . PHE C 3 231 ? 44.061  34.241 43.886  1.00 48.87  ? 526  PHE A CZ    1 
ATOM   2177 N N     . ASN C 3 232 ? 45.346  31.121 39.210  1.00 51.09  ? 527  ASN A N     1 
ATOM   2178 C CA    . ASN C 3 232 ? 44.231  31.569 38.342  1.00 51.08  ? 527  ASN A CA    1 
ATOM   2179 C C     . ASN C 3 232 ? 43.096  32.080 39.245  1.00 46.06  ? 527  ASN A C     1 
ATOM   2180 O O     . ASN C 3 232 ? 42.355  31.263 39.787  1.00 48.63  ? 527  ASN A O     1 
ATOM   2181 C CB    . ASN C 3 232 ? 43.796  30.493 37.350  1.00 49.81  ? 527  ASN A CB    1 
ATOM   2182 C CG    . ASN C 3 232 ? 42.736  30.997 36.389  1.00 51.12  ? 527  ASN A CG    1 
ATOM   2183 O OD1   . ASN C 3 232 ? 42.425  32.186 36.364  1.00 49.73  ? 527  ASN A OD1   1 
ATOM   2184 N ND2   . ASN C 3 232 ? 42.168  30.103 35.599  1.00 50.01  ? 527  ASN A ND2   1 
ATOM   2185 N N     . ILE C 3 233 ? 42.955  33.399 39.347  1.00 44.84  ? 528  ILE A N     1 
ATOM   2186 C CA    . ILE C 3 233 ? 41.876  34.099 40.106  1.00 47.47  ? 528  ILE A CA    1 
ATOM   2187 C C     . ILE C 3 233 ? 40.488  33.666 39.606  1.00 55.82  ? 528  ILE A C     1 
ATOM   2188 O O     . ILE C 3 233 ? 39.499  33.921 40.333  1.00 54.22  ? 528  ILE A O     1 
ATOM   2189 C CB    . ILE C 3 233 ? 42.075  35.624 39.995  1.00 46.28  ? 528  ILE A CB    1 
ATOM   2190 C CG1   . ILE C 3 233 ? 43.428  36.047 40.574  1.00 42.01  ? 528  ILE A CG1   1 
ATOM   2191 C CG2   . ILE C 3 233 ? 40.921  36.378 40.648  1.00 45.85  ? 528  ILE A CG2   1 
ATOM   2192 C CD1   . ILE C 3 233 ? 43.908  37.386 40.108  1.00 43.38  ? 528  ILE A CD1   1 
ATOM   2193 N N     . ASN C 3 234 ? 40.392  33.066 38.412  1.00 59.90  ? 529  ASN A N     1 
ATOM   2194 C CA    . ASN C 3 234 ? 39.091  32.646 37.822  1.00 60.85  ? 529  ASN A CA    1 
ATOM   2195 C C     . ASN C 3 234 ? 38.805  31.174 38.142  1.00 60.21  ? 529  ASN A C     1 
ATOM   2196 O O     . ASN C 3 234 ? 37.671  30.745 37.865  1.00 58.16  ? 529  ASN A O     1 
ATOM   2197 C CB    . ASN C 3 234 ? 39.026  32.941 36.323  1.00 55.73  ? 529  ASN A CB    1 
ATOM   2198 C CG    . ASN C 3 234 ? 38.739  34.399 36.045  1.00 58.71  ? 529  ASN A CG    1 
ATOM   2199 O OD1   . ASN C 3 234 ? 39.431  35.035 35.259  1.00 61.59  ? 529  ASN A OD1   1 
ATOM   2200 N ND2   . ASN C 3 234 ? 37.723  34.939 36.696  1.00 61.02  ? 529  ASN A ND2   1 
ATOM   2201 N N     . SER C 3 235 ? 39.771  30.428 38.692  1.00 62.76  ? 530  SER A N     1 
ATOM   2202 C CA    . SER C 3 235 ? 39.571  29.016 39.129  1.00 70.76  ? 530  SER A CA    1 
ATOM   2203 C C     . SER C 3 235 ? 38.623  29.016 40.320  1.00 77.04  ? 530  SER A C     1 
ATOM   2204 O O     . SER C 3 235 ? 38.978  29.557 41.360  1.00 70.55  ? 530  SER A O     1 
ATOM   2205 C CB    . SER C 3 235 ? 40.854  28.331 39.505  1.00 68.00  ? 530  SER A CB    1 
ATOM   2206 O OG    . SER C 3 235 ? 41.681  28.097 38.380  1.00 72.47  ? 530  SER A OG    1 
ATOM   2207 N N     . PRO C 3 236 ? 37.414  28.411 40.235  1.00 89.63  ? 531  PRO A N     1 
ATOM   2208 C CA    . PRO C 3 236 ? 36.477  28.453 41.353  1.00 92.20  ? 531  PRO A CA    1 
ATOM   2209 C C     . PRO C 3 236 ? 37.130  27.726 42.538  1.00 88.47  ? 531  PRO A C     1 
ATOM   2210 O O     . PRO C 3 236 ? 36.876  28.119 43.672  1.00 87.33  ? 531  PRO A O     1 
ATOM   2211 C CB    . PRO C 3 236 ? 35.195  27.754 40.861  1.00 100.01 ? 531  PRO A CB    1 
ATOM   2212 C CG    . PRO C 3 236 ? 35.418  27.476 39.377  1.00 98.61  ? 531  PRO A CG    1 
ATOM   2213 C CD    . PRO C 3 236 ? 36.909  27.597 39.119  1.00 95.26  ? 531  PRO A CD    1 
ATOM   2214 N N     . LYS C 3 237 ? 37.987  26.739 42.232  1.00 84.86  ? 532  LYS A N     1 
ATOM   2215 C CA    . LYS C 3 237 ? 38.682  25.869 43.216  1.00 82.58  ? 532  LYS A CA    1 
ATOM   2216 C C     . LYS C 3 237 ? 39.937  26.588 43.734  1.00 77.84  ? 532  LYS A C     1 
ATOM   2217 O O     . LYS C 3 237 ? 40.085  26.629 44.974  1.00 75.51  ? 532  LYS A O     1 
ATOM   2218 C CB    . LYS C 3 237 ? 38.968  24.481 42.619  1.00 87.24  ? 532  LYS A CB    1 
ATOM   2219 C CG    . LYS C 3 237 ? 40.375  24.239 42.077  1.00 91.94  ? 532  LYS A CG    1 
ATOM   2220 C CD    . LYS C 3 237 ? 41.456  24.161 43.159  1.00 92.76  ? 532  LYS A CD    1 
ATOM   2221 C CE    . LYS C 3 237 ? 42.071  22.791 43.362  1.00 90.41  ? 532  LYS A CE    1 
ATOM   2222 N NZ    . LYS C 3 237 ? 43.446  22.726 42.810  1.00 85.45  ? 532  LYS A NZ    1 
ATOM   2223 N N     . GLN C 3 238 ? 40.811  27.109 42.854  1.00 68.60  ? 533  GLN A N     1 
ATOM   2224 C CA    . GLN C 3 238 ? 42.142  27.657 43.257  1.00 71.28  ? 533  GLN A CA    1 
ATOM   2225 C C     . GLN C 3 238 ? 41.945  28.865 44.179  1.00 68.43  ? 533  GLN A C     1 
ATOM   2226 O O     . GLN C 3 238 ? 42.773  29.040 45.091  1.00 66.88  ? 533  GLN A O     1 
ATOM   2227 C CB    . GLN C 3 238 ? 42.999  28.135 42.085  1.00 71.88  ? 533  GLN A CB    1 
ATOM   2228 C CG    . GLN C 3 238 ? 43.682  27.031 41.297  1.00 72.56  ? 533  GLN A CG    1 
ATOM   2229 C CD    . GLN C 3 238 ? 44.508  27.598 40.166  1.00 72.15  ? 533  GLN A CD    1 
ATOM   2230 O OE1   . GLN C 3 238 ? 44.860  28.776 40.144  1.00 71.76  ? 533  GLN A OE1   1 
ATOM   2231 N NE2   . GLN C 3 238 ? 44.826  26.754 39.202  1.00 76.30  ? 533  GLN A NE2   1 
ATOM   2232 N N     . LEU C 3 239 ? 40.911  29.672 43.913  1.00 64.06  ? 534  LEU A N     1 
ATOM   2233 C CA    . LEU C 3 239 ? 40.503  30.835 44.746  1.00 60.65  ? 534  LEU A CA    1 
ATOM   2234 C C     . LEU C 3 239 ? 40.101  30.353 46.141  1.00 53.66  ? 534  LEU A C     1 
ATOM   2235 O O     . LEU C 3 239 ? 40.497  31.016 47.094  1.00 45.55  ? 534  LEU A O     1 
ATOM   2236 C CB    . LEU C 3 239 ? 39.329  31.580 44.102  1.00 57.78  ? 534  LEU A CB    1 
ATOM   2237 C CG    . LEU C 3 239 ? 38.927  32.866 44.824  1.00 56.45  ? 534  LEU A CG    1 
ATOM   2238 C CD1   . LEU C 3 239 ? 40.076  33.867 44.807  1.00 51.90  ? 534  LEU A CD1   1 
ATOM   2239 C CD2   . LEU C 3 239 ? 37.670  33.474 44.214  1.00 57.34  ? 534  LEU A CD2   1 
ATOM   2240 N N     . GLY C 3 240 ? 39.328  29.263 46.221  1.00 55.66  ? 535  GLY A N     1 
ATOM   2241 C CA    . GLY C 3 240 ? 38.890  28.604 47.469  1.00 58.10  ? 535  GLY A CA    1 
ATOM   2242 C C     . GLY C 3 240 ? 40.055  28.084 48.309  1.00 59.79  ? 535  GLY A C     1 
ATOM   2243 O O     . GLY C 3 240 ? 39.893  28.007 49.538  1.00 65.40  ? 535  GLY A O     1 
ATOM   2244 N N     . VAL C 3 241 ? 41.177  27.727 47.677  1.00 57.84  ? 536  VAL A N     1 
ATOM   2245 C CA    . VAL C 3 241 ? 42.421  27.231 48.342  1.00 57.36  ? 536  VAL A CA    1 
ATOM   2246 C C     . VAL C 3 241 ? 43.204  28.425 48.890  1.00 53.97  ? 536  VAL A C     1 
ATOM   2247 O O     . VAL C 3 241 ? 43.876  28.271 49.936  1.00 53.55  ? 536  VAL A O     1 
ATOM   2248 C CB    . VAL C 3 241 ? 43.287  26.413 47.364  1.00 58.73  ? 536  VAL A CB    1 
ATOM   2249 C CG1   . VAL C 3 241 ? 44.690  26.159 47.904  1.00 54.77  ? 536  VAL A CG1   1 
ATOM   2250 C CG2   . VAL C 3 241 ? 42.598  25.111 46.971  1.00 58.73  ? 536  VAL A CG2   1 
ATOM   2251 N N     . ILE C 3 242 ? 43.173  29.548 48.172  1.00 48.72  ? 537  ILE A N     1 
ATOM   2252 C CA    . ILE C 3 242 ? 43.859  30.803 48.587  1.00 46.62  ? 537  ILE A CA    1 
ATOM   2253 C C     . ILE C 3 242 ? 43.070  31.393 49.758  1.00 44.44  ? 537  ILE A C     1 
ATOM   2254 O O     . ILE C 3 242 ? 43.699  31.745 50.766  1.00 41.07  ? 537  ILE A O     1 
ATOM   2255 C CB    . ILE C 3 242 ? 44.003  31.773 47.394  1.00 49.76  ? 537  ILE A CB    1 
ATOM   2256 C CG1   . ILE C 3 242 ? 44.939  31.200 46.323  1.00 51.68  ? 537  ILE A CG1   1 
ATOM   2257 C CG2   . ILE C 3 242 ? 44.444  33.162 47.843  1.00 47.19  ? 537  ILE A CG2   1 
ATOM   2258 C CD1   . ILE C 3 242 ? 46.150  30.459 46.871  1.00 55.63  ? 537  ILE A CD1   1 
ATOM   2259 N N     . LEU C 3 243 ? 41.742  31.432 49.660  1.00 39.94  ? 538  LEU A N     1 
ATOM   2260 C CA    . LEU C 3 243 ? 40.903  32.125 50.667  1.00 42.06  ? 538  LEU A CA    1 
ATOM   2261 C C     . LEU C 3 243 ? 40.793  31.246 51.916  1.00 41.52  ? 538  LEU A C     1 
ATOM   2262 O O     . LEU C 3 243 ? 41.204  31.731 52.987  1.00 32.81  ? 538  LEU A O     1 
ATOM   2263 C CB    . LEU C 3 243 ? 39.524  32.468 50.099  1.00 39.23  ? 538  LEU A CB    1 
ATOM   2264 C CG    . LEU C 3 243 ? 39.476  33.571 49.035  1.00 43.11  ? 538  LEU A CG    1 
ATOM   2265 C CD1   . LEU C 3 243 ? 38.057  34.097 48.910  1.00 40.43  ? 538  LEU A CD1   1 
ATOM   2266 C CD2   . LEU C 3 243 ? 40.447  34.723 49.319  1.00 42.28  ? 538  LEU A CD2   1 
ATOM   2267 N N     . PHE C 3 244 ? 40.299  30.014 51.761  1.00 40.58  ? 539  PHE A N     1 
ATOM   2268 C CA    . PHE C 3 244 ? 39.853  29.149 52.882  1.00 44.68  ? 539  PHE A CA    1 
ATOM   2269 C C     . PHE C 3 244 ? 40.975  28.244 53.408  1.00 44.69  ? 539  PHE A C     1 
ATOM   2270 O O     . PHE C 3 244 ? 40.794  27.769 54.534  1.00 47.93  ? 539  PHE A O     1 
ATOM   2271 C CB    . PHE C 3 244 ? 38.592  28.397 52.468  1.00 44.63  ? 539  PHE A CB    1 
ATOM   2272 C CG    . PHE C 3 244 ? 37.532  29.335 51.960  1.00 51.37  ? 539  PHE A CG    1 
ATOM   2273 C CD1   . PHE C 3 244 ? 37.097  30.388 52.749  1.00 52.88  ? 539  PHE A CD1   1 
ATOM   2274 C CD2   . PHE C 3 244 ? 37.037  29.230 50.670  1.00 53.07  ? 539  PHE A CD2   1 
ATOM   2275 C CE1   . PHE C 3 244 ? 36.156  31.287 52.273  1.00 54.97  ? 539  PHE A CE1   1 
ATOM   2276 C CE2   . PHE C 3 244 ? 36.096  30.132 50.195  1.00 54.52  ? 539  PHE A CE2   1 
ATOM   2277 C CZ    . PHE C 3 244 ? 35.653  31.154 51.000  1.00 55.68  ? 539  PHE A CZ    1 
ATOM   2278 N N     . GLU C 3 245 ? 42.096  28.054 52.699  1.00 46.75  ? 540  GLU A N     1 
ATOM   2279 C CA    . GLU C 3 245 ? 43.178  27.125 53.145  1.00 49.76  ? 540  GLU A CA    1 
ATOM   2280 C C     . GLU C 3 245 ? 44.450  27.908 53.486  1.00 48.19  ? 540  GLU A C     1 
ATOM   2281 O O     . GLU C 3 245 ? 44.921  27.768 54.627  1.00 55.29  ? 540  GLU A O     1 
ATOM   2282 C CB    . GLU C 3 245 ? 43.394  26.007 52.119  1.00 52.71  ? 540  GLU A CB    1 
ATOM   2283 C CG    . GLU C 3 245 ? 42.196  25.075 52.020  1.00 53.76  ? 540  GLU A CG    1 
ATOM   2284 C CD    . GLU C 3 245 ? 42.286  23.926 51.022  1.00 57.17  ? 540  GLU A CD    1 
ATOM   2285 O OE1   . GLU C 3 245 ? 43.366  23.742 50.406  1.00 57.17  ? 540  GLU A OE1   1 
ATOM   2286 O OE2   . GLU C 3 245 ? 41.264  23.214 50.868  1.00 47.61  ? 540  GLU A OE2   1 
ATOM   2287 N N     . LYS C 3 246 ? 44.987  28.708 52.564  1.00 50.64  ? 541  LYS A N     1 
ATOM   2288 C CA    . LYS C 3 246 ? 46.245  29.473 52.813  1.00 53.25  ? 541  LYS A CA    1 
ATOM   2289 C C     . LYS C 3 246 ? 45.984  30.625 53.807  1.00 51.78  ? 541  LYS A C     1 
ATOM   2290 O O     . LYS C 3 246 ? 46.727  30.734 54.810  1.00 48.85  ? 541  LYS A O     1 
ATOM   2291 C CB    . LYS C 3 246 ? 46.847  29.973 51.494  1.00 54.17  ? 541  LYS A CB    1 
ATOM   2292 C CG    . LYS C 3 246 ? 48.122  30.804 51.638  1.00 58.02  ? 541  LYS A CG    1 
ATOM   2293 C CD    . LYS C 3 246 ? 48.893  31.032 50.336  1.00 59.20  ? 541  LYS A CD    1 
ATOM   2294 C CE    . LYS C 3 246 ? 50.288  31.588 50.562  1.00 59.24  ? 541  LYS A CE    1 
ATOM   2295 N NZ    . LYS C 3 246 ? 50.273  32.797 51.426  1.00 56.95  ? 541  LYS A NZ    1 
ATOM   2296 N N     . LEU C 3 247 ? 44.980  31.467 53.541  1.00 46.35  ? 542  LEU A N     1 
ATOM   2297 C CA    . LEU C 3 247 ? 44.674  32.668 54.364  1.00 47.29  ? 542  LEU A CA    1 
ATOM   2298 C C     . LEU C 3 247 ? 43.686  32.303 55.474  1.00 41.90  ? 542  LEU A C     1 
ATOM   2299 O O     . LEU C 3 247 ? 43.544  33.110 56.371  1.00 44.04  ? 542  LEU A O     1 
ATOM   2300 C CB    . LEU C 3 247 ? 44.103  33.764 53.464  1.00 47.35  ? 542  LEU A CB    1 
ATOM   2301 C CG    . LEU C 3 247 ? 45.049  34.274 52.380  1.00 48.40  ? 542  LEU A CG    1 
ATOM   2302 C CD1   . LEU C 3 247 ? 44.378  35.372 51.569  1.00 44.79  ? 542  LEU A CD1   1 
ATOM   2303 C CD2   . LEU C 3 247 ? 46.374  34.753 52.980  1.00 49.10  ? 542  LEU A CD2   1 
ATOM   2304 N N     . GLN C 3 248 ? 43.014  31.158 55.346  1.00 41.57  ? 543  GLN A N     1 
ATOM   2305 C CA    . GLN C 3 248 ? 42.215  30.470 56.391  1.00 43.26  ? 543  GLN A CA    1 
ATOM   2306 C C     . GLN C 3 248 ? 40.966  31.263 56.773  1.00 44.52  ? 543  GLN A C     1 
ATOM   2307 O O     . GLN C 3 248 ? 40.512  31.118 57.934  1.00 39.19  ? 543  GLN A O     1 
ATOM   2308 C CB    . GLN C 3 248 ? 43.088  30.243 57.618  1.00 47.44  ? 543  GLN A CB    1 
ATOM   2309 C CG    . GLN C 3 248 ? 44.024  29.065 57.455  1.00 47.59  ? 543  GLN A CG    1 
ATOM   2310 C CD    . GLN C 3 248 ? 44.492  28.663 58.822  1.00 49.50  ? 543  GLN A CD    1 
ATOM   2311 O OE1   . GLN C 3 248 ? 45.120  29.453 59.525  1.00 52.83  ? 543  GLN A OE1   1 
ATOM   2312 N NE2   . GLN C 3 248 ? 44.143  27.453 59.216  1.00 49.47  ? 543  GLN A NE2   1 
ATOM   2313 N N     . LEU C 3 249 ? 40.405  32.022 55.828  1.00 39.40  ? 544  LEU A N     1 
ATOM   2314 C CA    . LEU C 3 249 ? 39.204  32.857 56.070  1.00 37.96  ? 544  LEU A CA    1 
ATOM   2315 C C     . LEU C 3 249 ? 38.062  31.920 56.452  1.00 36.11  ? 544  LEU A C     1 
ATOM   2316 O O     . LEU C 3 249 ? 38.062  30.747 56.087  1.00 36.37  ? 544  LEU A O     1 
ATOM   2317 C CB    . LEU C 3 249 ? 38.891  33.679 54.811  1.00 36.60  ? 544  LEU A CB    1 
ATOM   2318 C CG    . LEU C 3 249 ? 40.019  34.585 54.303  1.00 37.79  ? 544  LEU A CG    1 
ATOM   2319 C CD1   . LEU C 3 249 ? 39.506  35.540 53.233  1.00 39.76  ? 544  LEU A CD1   1 
ATOM   2320 C CD2   . LEU C 3 249 ? 40.658  35.372 55.434  1.00 36.93  ? 544  LEU A CD2   1 
ATOM   2321 N N     . PRO C 3 250 ? 37.072  32.377 57.245  1.00 36.01  ? 545  PRO A N     1 
ATOM   2322 C CA    . PRO C 3 250 ? 35.964  31.513 57.627  1.00 38.07  ? 545  PRO A CA    1 
ATOM   2323 C C     . PRO C 3 250 ? 35.183  31.053 56.393  1.00 42.64  ? 545  PRO A C     1 
ATOM   2324 O O     . PRO C 3 250 ? 35.035  31.832 55.446  1.00 40.36  ? 545  PRO A O     1 
ATOM   2325 C CB    . PRO C 3 250 ? 35.071  32.369 58.535  1.00 35.57  ? 545  PRO A CB    1 
ATOM   2326 C CG    . PRO C 3 250 ? 35.576  33.789 58.388  1.00 35.56  ? 545  PRO A CG    1 
ATOM   2327 C CD    . PRO C 3 250 ? 36.986  33.711 57.850  1.00 35.92  ? 545  PRO A CD    1 
ATOM   2328 N N     . VAL C 3 251 ? 34.712  29.809 56.451  1.00 48.95  ? 546  VAL A N     1 
ATOM   2329 C CA    . VAL C 3 251 ? 33.762  29.214 55.469  1.00 50.81  ? 546  VAL A CA    1 
ATOM   2330 C C     . VAL C 3 251 ? 32.357  29.556 55.960  1.00 53.94  ? 546  VAL A C     1 
ATOM   2331 O O     . VAL C 3 251 ? 31.904  28.929 56.913  1.00 52.34  ? 546  VAL A O     1 
ATOM   2332 C CB    . VAL C 3 251 ? 33.975  27.694 55.318  1.00 52.18  ? 546  VAL A CB    1 
ATOM   2333 C CG1   . VAL C 3 251 ? 33.141  27.129 54.167  1.00 50.62  ? 546  VAL A CG1   1 
ATOM   2334 C CG2   . VAL C 3 251 ? 35.453  27.341 55.146  1.00 49.45  ? 546  VAL A CG2   1 
ATOM   2335 N N     . LEU C 3 252 ? 31.715  30.551 55.350  1.00 65.39  ? 547  LEU A N     1 
ATOM   2336 C CA    . LEU C 3 252 ? 30.350  31.002 55.729  1.00 65.55  ? 547  LEU A CA    1 
ATOM   2337 C C     . LEU C 3 252 ? 29.309  30.236 54.907  1.00 69.09  ? 547  LEU A C     1 
ATOM   2338 O O     . LEU C 3 252 ? 28.130  30.310 55.283  1.00 63.08  ? 547  LEU A O     1 
ATOM   2339 C CB    . LEU C 3 252 ? 30.246  32.511 55.494  1.00 63.96  ? 547  LEU A CB    1 
ATOM   2340 C CG    . LEU C 3 252 ? 31.356  33.337 56.140  1.00 64.01  ? 547  LEU A CG    1 
ATOM   2341 C CD1   . LEU C 3 252 ? 31.289  34.783 55.677  1.00 65.93  ? 547  LEU A CD1   1 
ATOM   2342 C CD2   . LEU C 3 252 ? 31.272  33.246 57.657  1.00 63.41  ? 547  LEU A CD2   1 
ATOM   2343 N N     . LYS C 3 253 ? 29.732  29.538 53.840  1.00 75.71  ? 548  LYS A N     1 
ATOM   2344 C CA    . LYS C 3 253 ? 28.832  28.777 52.928  1.00 82.31  ? 548  LYS A CA    1 
ATOM   2345 C C     . LYS C 3 253 ? 29.650  27.838 52.020  1.00 83.93  ? 548  LYS A C     1 
ATOM   2346 O O     . LYS C 3 253 ? 30.710  28.284 51.502  1.00 75.56  ? 548  LYS A O     1 
ATOM   2347 C CB    . LYS C 3 253 ? 28.006  29.770 52.103  1.00 86.31  ? 548  LYS A CB    1 
ATOM   2348 C CG    . LYS C 3 253 ? 26.516  29.466 52.000  1.00 90.77  ? 548  LYS A CG    1 
ATOM   2349 C CD    . LYS C 3 253 ? 25.795  30.315 50.969  1.00 93.29  ? 548  LYS A CD    1 
ATOM   2350 C CE    . LYS C 3 253 ? 26.481  30.294 49.619  1.00 97.72  ? 548  LYS A CE    1 
ATOM   2351 N NZ    . LYS C 3 253 ? 25.559  30.681 48.528  1.00 102.71 ? 548  LYS A NZ    1 
ATOM   2352 N N     . LYS C 3 254 ? 29.163  26.597 51.839  1.00 89.42  ? 549  LYS A N     1 
ATOM   2353 C CA    . LYS C 3 254 ? 29.666  25.573 50.870  1.00 91.94  ? 549  LYS A CA    1 
ATOM   2354 C C     . LYS C 3 254 ? 28.750  25.541 49.623  1.00 91.34  ? 549  LYS A C     1 
ATOM   2355 O O     . LYS C 3 254 ? 27.722  26.255 49.627  1.00 80.78  ? 549  LYS A O     1 
ATOM   2356 C CB    . LYS C 3 254 ? 29.764  24.204 51.561  1.00 90.23  ? 549  LYS A CB    1 
ATOM   2357 C CG    . LYS C 3 254 ? 30.970  24.017 52.477  1.00 90.47  ? 549  LYS A CG    1 
ATOM   2358 C CD    . LYS C 3 254 ? 31.359  22.561 52.699  1.00 94.73  ? 549  LYS A CD    1 
ATOM   2359 C CE    . LYS C 3 254 ? 32.127  21.937 51.546  1.00 96.53  ? 549  LYS A CE    1 
ATOM   2360 N NZ    . LYS C 3 254 ? 33.593  22.151 51.652  1.00 92.59  ? 549  LYS A NZ    1 
ATOM   2361 N N     . THR C 3 255 ? 29.111  24.775 48.578  1.00 94.73  ? 550  THR A N     1 
ATOM   2362 C CA    . THR C 3 255 ? 28.320  24.603 47.317  1.00 92.47  ? 550  THR A CA    1 
ATOM   2363 C C     . THR C 3 255 ? 28.262  23.116 46.922  1.00 97.89  ? 550  THR A C     1 
ATOM   2364 O O     . THR C 3 255 ? 27.180  22.505 47.069  1.00 88.51  ? 550  THR A O     1 
ATOM   2365 C CB    . THR C 3 255 ? 28.863  25.460 46.160  1.00 87.78  ? 550  THR A CB    1 
ATOM   2366 O OG1   . THR C 3 255 ? 30.290  25.412 46.154  1.00 77.66  ? 550  THR A OG1   1 
ATOM   2367 C CG2   . THR C 3 255 ? 28.419  26.906 46.223  1.00 88.57  ? 550  THR A CG2   1 
ATOM   2368 N N     . LYS C 3 256 ? 29.367  22.554 46.415  1.00 102.66 ? 551  LYS A N     1 
ATOM   2369 C CA    . LYS C 3 256 ? 29.441  21.125 46.002  1.00 102.50 ? 551  LYS A CA    1 
ATOM   2370 C C     . LYS C 3 256 ? 30.907  20.674 45.909  1.00 107.88 ? 551  LYS A C     1 
ATOM   2371 O O     . LYS C 3 256 ? 31.310  19.860 46.766  1.00 115.80 ? 551  LYS A O     1 
ATOM   2372 C CB    . LYS C 3 256 ? 28.660  20.915 44.700  1.00 105.32 ? 551  LYS A CB    1 
ATOM   2373 C CG    . LYS C 3 256 ? 28.092  19.515 44.503  1.00 106.29 ? 551  LYS A CG    1 
ATOM   2374 C CD    . LYS C 3 256 ? 27.241  19.010 45.661  1.00 103.28 ? 551  LYS A CD    1 
ATOM   2375 C CE    . LYS C 3 256 ? 26.980  17.517 45.622  1.00 101.69 ? 551  LYS A CE    1 
ATOM   2376 N NZ    . LYS C 3 256 ? 25.593  17.206 45.209  1.00 98.71  ? 551  LYS A NZ    1 
ATOM   2377 N N     . THR C 3 257 ? 31.674  21.174 44.929  1.00 108.74 ? 552  THR A N     1 
ATOM   2378 C CA    . THR C 3 257 ? 33.130  20.880 44.744  1.00 112.31 ? 552  THR A CA    1 
ATOM   2379 C C     . THR C 3 257 ? 33.910  21.336 45.987  1.00 111.02 ? 552  THR A C     1 
ATOM   2380 O O     . THR C 3 257 ? 34.921  20.675 46.341  1.00 104.89 ? 552  THR A O     1 
ATOM   2381 C CB    . THR C 3 257 ? 33.671  21.519 43.453  1.00 116.46 ? 552  THR A CB    1 
ATOM   2382 O OG1   . THR C 3 257 ? 33.372  20.624 42.382  1.00 119.43 ? 552  THR A OG1   1 
ATOM   2383 C CG2   . THR C 3 257 ? 35.161  21.796 43.465  1.00 113.99 ? 552  THR A CG2   1 
ATOM   2384 N N     . GLY C 3 258 ? 33.461  22.428 46.616  1.00 99.74  ? 553  GLY A N     1 
ATOM   2385 C CA    . GLY C 3 258 ? 34.052  22.976 47.850  1.00 86.62  ? 553  GLY A CA    1 
ATOM   2386 C C     . GLY C 3 258 ? 33.276  24.176 48.363  1.00 75.29  ? 553  GLY A C     1 
ATOM   2387 O O     . GLY C 3 258 ? 32.119  24.007 48.790  1.00 73.25  ? 553  GLY A O     1 
ATOM   2388 N N     . TYR C 3 259 ? 33.881  25.360 48.282  1.00 64.71  ? 554  TYR A N     1 
ATOM   2389 C CA    . TYR C 3 259 ? 33.486  26.564 49.057  1.00 60.91  ? 554  TYR A CA    1 
ATOM   2390 C C     . TYR C 3 259 ? 32.839  27.613 48.129  1.00 57.70  ? 554  TYR A C     1 
ATOM   2391 O O     . TYR C 3 259 ? 33.311  27.782 46.975  1.00 48.44  ? 554  TYR A O     1 
ATOM   2392 C CB    . TYR C 3 259 ? 34.714  27.151 49.759  1.00 61.11  ? 554  TYR A CB    1 
ATOM   2393 C CG    . TYR C 3 259 ? 35.798  26.203 50.226  1.00 59.17  ? 554  TYR A CG    1 
ATOM   2394 C CD1   . TYR C 3 259 ? 36.925  25.958 49.447  1.00 56.70  ? 554  TYR A CD1   1 
ATOM   2395 C CD2   . TYR C 3 259 ? 35.763  25.641 51.497  1.00 59.41  ? 554  TYR A CD2   1 
ATOM   2396 C CE1   . TYR C 3 259 ? 37.959  25.147 49.890  1.00 53.17  ? 554  TYR A CE1   1 
ATOM   2397 C CE2   . TYR C 3 259 ? 36.786  24.823 51.957  1.00 58.50  ? 554  TYR A CE2   1 
ATOM   2398 C CZ    . TYR C 3 259 ? 37.885  24.577 51.151  1.00 57.25  ? 554  TYR A CZ    1 
ATOM   2399 O OH    . TYR C 3 259 ? 38.885  23.778 51.615  1.00 60.36  ? 554  TYR A OH    1 
ATOM   2400 N N     . SER C 3 260 ? 31.806  28.324 48.604  1.00 48.68  ? 555  SER A N     1 
ATOM   2401 C CA    . SER C 3 260 ? 31.204  29.450 47.846  1.00 52.61  ? 555  SER A CA    1 
ATOM   2402 C C     . SER C 3 260 ? 32.216  30.596 47.819  1.00 51.07  ? 555  SER A C     1 
ATOM   2403 O O     . SER C 3 260 ? 32.817  30.890 48.888  1.00 47.67  ? 555  SER A O     1 
ATOM   2404 C CB    . SER C 3 260 ? 29.868  29.910 48.381  1.00 55.66  ? 555  SER A CB    1 
ATOM   2405 O OG    . SER C 3 260 ? 29.394  31.043 47.649  1.00 54.98  ? 555  SER A OG    1 
ATOM   2406 N N     . THR C 3 261 ? 32.426  31.175 46.632  1.00 47.20  ? 556  THR A N     1 
ATOM   2407 C CA    . THR C 3 261 ? 33.154  32.450 46.444  1.00 45.11  ? 556  THR A CA    1 
ATOM   2408 C C     . THR C 3 261 ? 32.227  33.472 45.770  1.00 44.94  ? 556  THR A C     1 
ATOM   2409 O O     . THR C 3 261 ? 32.769  34.417 45.171  1.00 46.23  ? 556  THR A O     1 
ATOM   2410 C CB    . THR C 3 261 ? 34.494  32.234 45.718  1.00 46.42  ? 556  THR A CB    1 
ATOM   2411 O OG1   . THR C 3 261 ? 34.308  32.084 44.308  1.00 45.52  ? 556  THR A OG1   1 
ATOM   2412 C CG2   . THR C 3 261 ? 35.256  31.040 46.250  1.00 45.79  ? 556  THR A CG2   1 
ATOM   2413 N N     . SER C 3 262 ? 30.902  33.355 45.917  1.00 44.30  ? 557  SER A N     1 
ATOM   2414 C CA    . SER C 3 262 ? 29.942  34.386 45.426  1.00 49.20  ? 557  SER A CA    1 
ATOM   2415 C C     . SER C 3 262 ? 30.202  35.739 46.127  1.00 54.59  ? 557  SER A C     1 
ATOM   2416 O O     . SER C 3 262 ? 30.840  35.755 47.220  1.00 51.59  ? 557  SER A O     1 
ATOM   2417 C CB    . SER C 3 262 ? 28.508  33.949 45.567  1.00 48.92  ? 557  SER A CB    1 
ATOM   2418 O OG    . SER C 3 262 ? 27.842  34.674 46.590  1.00 50.68  ? 557  SER A OG    1 
ATOM   2419 N N     . ALA C 3 263 ? 29.748  36.843 45.510  1.00 53.43  ? 558  ALA A N     1 
ATOM   2420 C CA    . ALA C 3 263 ? 29.981  38.235 45.967  1.00 55.54  ? 558  ALA A CA    1 
ATOM   2421 C C     . ALA C 3 263 ? 29.244  38.473 47.295  1.00 53.34  ? 558  ALA A C     1 
ATOM   2422 O O     . ALA C 3 263 ? 29.749  39.267 48.111  1.00 54.62  ? 558  ALA A O     1 
ATOM   2423 C CB    . ALA C 3 263 ? 29.568  39.231 44.896  1.00 52.57  ? 558  ALA A CB    1 
ATOM   2424 N N     . ASP C 3 264 ? 28.098  37.816 47.487  1.00 56.76  ? 559  ASP A N     1 
ATOM   2425 C CA    . ASP C 3 264 ? 27.392  37.673 48.793  1.00 67.27  ? 559  ASP A CA    1 
ATOM   2426 C C     . ASP C 3 264 ? 28.440  37.392 49.886  1.00 61.03  ? 559  ASP A C     1 
ATOM   2427 O O     . ASP C 3 264 ? 28.698  38.274 50.741  1.00 50.74  ? 559  ASP A O     1 
ATOM   2428 C CB    . ASP C 3 264 ? 26.331  36.562 48.703  1.00 71.64  ? 559  ASP A CB    1 
ATOM   2429 C CG    . ASP C 3 264 ? 25.041  36.848 49.460  1.00 80.47  ? 559  ASP A CG    1 
ATOM   2430 O OD1   . ASP C 3 264 ? 25.106  36.976 50.704  1.00 81.97  ? 559  ASP A OD1   1 
ATOM   2431 O OD2   . ASP C 3 264 ? 23.976  36.936 48.801  1.00 79.46  ? 559  ASP A OD2   1 
ATOM   2432 N N     . VAL C 3 265 ? 29.088  36.231 49.795  1.00 58.32  ? 560  VAL A N     1 
ATOM   2433 C CA    . VAL C 3 265 ? 30.058  35.720 50.803  1.00 57.25  ? 560  VAL A CA    1 
ATOM   2434 C C     . VAL C 3 265 ? 31.279  36.648 50.866  1.00 53.21  ? 560  VAL A C     1 
ATOM   2435 O O     . VAL C 3 265 ? 31.620  37.099 51.985  1.00 54.41  ? 560  VAL A O     1 
ATOM   2436 C CB    . VAL C 3 265 ? 30.452  34.267 50.486  1.00 59.26  ? 560  VAL A CB    1 
ATOM   2437 C CG1   . VAL C 3 265 ? 31.524  33.739 51.430  1.00 59.46  ? 560  VAL A CG1   1 
ATOM   2438 C CG2   . VAL C 3 265 ? 29.229  33.366 50.505  1.00 62.94  ? 560  VAL A CG2   1 
ATOM   2439 N N     . LEU C 3 266 ? 31.929  36.920 49.732  1.00 45.79  ? 561  LEU A N     1 
ATOM   2440 C CA    . LEU C 3 266 ? 33.211  37.680 49.715  1.00 45.84  ? 561  LEU A CA    1 
ATOM   2441 C C     . LEU C 3 266 ? 33.051  39.000 50.482  1.00 46.68  ? 561  LEU A C     1 
ATOM   2442 O O     . LEU C 3 266 ? 34.013  39.388 51.167  1.00 46.68  ? 561  LEU A O     1 
ATOM   2443 C CB    . LEU C 3 266 ? 33.686  37.936 48.279  1.00 41.38  ? 561  LEU A CB    1 
ATOM   2444 C CG    . LEU C 3 266 ? 34.251  36.730 47.535  1.00 42.41  ? 561  LEU A CG    1 
ATOM   2445 C CD1   . LEU C 3 266 ? 34.831  37.148 46.194  1.00 44.23  ? 561  LEU A CD1   1 
ATOM   2446 C CD2   . LEU C 3 266 ? 35.302  36.008 48.355  1.00 41.82  ? 561  LEU A CD2   1 
ATOM   2447 N N     . GLU C 3 267 ? 31.900  39.668 50.383  1.00 48.77  ? 562  GLU A N     1 
ATOM   2448 C CA    . GLU C 3 267 ? 31.694  41.001 51.018  1.00 57.18  ? 562  GLU A CA    1 
ATOM   2449 C C     . GLU C 3 267 ? 31.871  40.883 52.534  1.00 51.77  ? 562  GLU A C     1 
ATOM   2450 O O     . GLU C 3 267 ? 32.606  41.725 53.088  1.00 51.96  ? 562  GLU A O     1 
ATOM   2451 C CB    . GLU C 3 267 ? 30.330  41.600 50.678  1.00 62.01  ? 562  GLU A CB    1 
ATOM   2452 C CG    . GLU C 3 267 ? 30.399  42.626 49.565  1.00 65.10  ? 562  GLU A CG    1 
ATOM   2453 C CD    . GLU C 3 267 ? 29.065  42.838 48.880  1.00 70.06  ? 562  GLU A CD    1 
ATOM   2454 O OE1   . GLU C 3 267 ? 28.888  42.306 47.768  1.00 72.85  ? 562  GLU A OE1   1 
ATOM   2455 O OE2   . GLU C 3 267 ? 28.201  43.511 49.477  1.00 71.28  ? 562  GLU A OE2   1 
ATOM   2456 N N     . LYS C 3 268 ? 31.237  39.872 53.143  1.00 50.85  ? 563  LYS A N     1 
ATOM   2457 C CA    . LYS C 3 268 ? 31.331  39.518 54.590  1.00 50.73  ? 563  LYS A CA    1 
ATOM   2458 C C     . LYS C 3 268 ? 32.775  39.183 54.995  1.00 45.90  ? 563  LYS A C     1 
ATOM   2459 O O     . LYS C 3 268 ? 33.094  39.352 56.179  1.00 45.27  ? 563  LYS A O     1 
ATOM   2460 C CB    . LYS C 3 268 ? 30.442  38.313 54.907  1.00 53.07  ? 563  LYS A CB    1 
ATOM   2461 C CG    . LYS C 3 268 ? 28.945  38.559 54.792  1.00 59.18  ? 563  LYS A CG    1 
ATOM   2462 C CD    . LYS C 3 268 ? 28.129  37.296 55.022  1.00 60.38  ? 563  LYS A CD    1 
ATOM   2463 C CE    . LYS C 3 268 ? 26.647  37.550 55.210  1.00 58.83  ? 563  LYS A CE    1 
ATOM   2464 N NZ    . LYS C 3 268 ? 25.861  37.155 54.020  1.00 58.03  ? 563  LYS A NZ    1 
ATOM   2465 N N     . LEU C 3 269 ? 33.606  38.710 54.060  1.00 40.68  ? 564  LEU A N     1 
ATOM   2466 C CA    . LEU C 3 269 ? 35.002  38.270 54.325  1.00 36.46  ? 564  LEU A CA    1 
ATOM   2467 C C     . LEU C 3 269 ? 35.996  39.432 54.168  1.00 38.83  ? 564  LEU A C     1 
ATOM   2468 O O     . LEU C 3 269 ? 37.170  39.297 54.639  1.00 34.46  ? 564  LEU A O     1 
ATOM   2469 C CB    . LEU C 3 269 ? 35.352  37.113 53.377  1.00 36.57  ? 564  LEU A CB    1 
ATOM   2470 C CG    . LEU C 3 269 ? 34.484  35.849 53.483  1.00 37.44  ? 564  LEU A CG    1 
ATOM   2471 C CD1   . LEU C 3 269 ? 35.049  34.744 52.622  1.00 36.78  ? 564  LEU A CD1   1 
ATOM   2472 C CD2   . LEU C 3 269 ? 34.344  35.346 54.920  1.00 37.13  ? 564  LEU A CD2   1 
ATOM   2473 N N     . ALA C 3 270 ? 35.590  40.540 53.535  1.00 44.51  ? 565  ALA A N     1 
ATOM   2474 C CA    . ALA C 3 270 ? 36.490  41.693 53.267  1.00 48.85  ? 565  ALA A CA    1 
ATOM   2475 C C     . ALA C 3 270 ? 37.188  42.144 54.556  1.00 48.78  ? 565  ALA A C     1 
ATOM   2476 O O     . ALA C 3 270 ? 38.409  42.319 54.557  1.00 45.53  ? 565  ALA A O     1 
ATOM   2477 C CB    . ALA C 3 270 ? 35.740  42.824 52.596  1.00 53.99  ? 565  ALA A CB    1 
ATOM   2478 N N     . PRO C 3 271 ? 36.470  42.328 55.695  1.00 48.29  ? 566  PRO A N     1 
ATOM   2479 C CA    . PRO C 3 271 ? 37.116  42.777 56.931  1.00 46.65  ? 566  PRO A CA    1 
ATOM   2480 C C     . PRO C 3 271 ? 38.320  41.910 57.338  1.00 47.44  ? 566  PRO A C     1 
ATOM   2481 O O     . PRO C 3 271 ? 39.249  42.464 57.931  1.00 47.27  ? 566  PRO A O     1 
ATOM   2482 C CB    . PRO C 3 271 ? 36.003  42.715 57.989  1.00 46.65  ? 566  PRO A CB    1 
ATOM   2483 C CG    . PRO C 3 271 ? 34.709  42.828 57.189  1.00 49.07  ? 566  PRO A CG    1 
ATOM   2484 C CD    . PRO C 3 271 ? 35.011  42.165 55.857  1.00 49.48  ? 566  PRO A CD    1 
ATOM   2485 N N     . TYR C 3 272 ? 38.303  40.608 57.004  1.00 42.06  ? 567  TYR A N     1 
ATOM   2486 C CA    . TYR C 3 272 ? 39.303  39.619 57.485  1.00 40.84  ? 567  TYR A CA    1 
ATOM   2487 C C     . TYR C 3 272 ? 40.638  39.881 56.791  1.00 44.27  ? 567  TYR A C     1 
ATOM   2488 O O     . TYR C 3 272 ? 41.700  39.750 57.443  1.00 40.21  ? 567  TYR A O     1 
ATOM   2489 C CB    . TYR C 3 272 ? 38.789  38.184 57.313  1.00 39.66  ? 567  TYR A CB    1 
ATOM   2490 C CG    . TYR C 3 272 ? 37.682  37.858 58.283  1.00 41.19  ? 567  TYR A CG    1 
ATOM   2491 C CD1   . TYR C 3 272 ? 37.960  37.630 59.626  1.00 41.37  ? 567  TYR A CD1   1 
ATOM   2492 C CD2   . TYR C 3 272 ? 36.357  37.875 57.891  1.00 41.10  ? 567  TYR A CD2   1 
ATOM   2493 C CE1   . TYR C 3 272 ? 36.954  37.378 60.545  1.00 41.21  ? 567  TYR A CE1   1 
ATOM   2494 C CE2   . TYR C 3 272 ? 35.335  37.610 58.790  1.00 41.36  ? 567  TYR A CE2   1 
ATOM   2495 C CZ    . TYR C 3 272 ? 35.636  37.361 60.121  1.00 42.39  ? 567  TYR A CZ    1 
ATOM   2496 O OH    . TYR C 3 272 ? 34.641  37.096 61.012  1.00 38.85  ? 567  TYR A OH    1 
ATOM   2497 N N     . HIS C 3 273 ? 40.592  40.266 55.514  1.00 46.16  ? 568  HIS A N     1 
ATOM   2498 C CA    . HIS C 3 273 ? 41.799  40.318 54.650  1.00 51.20  ? 568  HIS A CA    1 
ATOM   2499 C C     . HIS C 3 273 ? 41.572  41.266 53.463  1.00 50.74  ? 568  HIS A C     1 
ATOM   2500 O O     . HIS C 3 273 ? 40.431  41.315 52.892  1.00 46.32  ? 568  HIS A O     1 
ATOM   2501 C CB    . HIS C 3 273 ? 42.211  38.894 54.235  1.00 49.00  ? 568  HIS A CB    1 
ATOM   2502 C CG    . HIS C 3 273 ? 43.670  38.752 53.946  1.00 51.38  ? 568  HIS A CG    1 
ATOM   2503 N ND1   . HIS C 3 273 ? 44.251  39.241 52.786  1.00 51.84  ? 568  HIS A ND1   1 
ATOM   2504 C CD2   . HIS C 3 273 ? 44.667  38.166 54.644  1.00 52.59  ? 568  HIS A CD2   1 
ATOM   2505 C CE1   . HIS C 3 273 ? 45.544  38.970 52.791  1.00 53.76  ? 568  HIS A CE1   1 
ATOM   2506 N NE2   . HIS C 3 273 ? 45.825  38.310 53.922  1.00 54.62  ? 568  HIS A NE2   1 
ATOM   2507 N N     . GLU C 3 274 ? 42.637  41.993 53.122  1.00 52.55  ? 569  GLU A N     1 
ATOM   2508 C CA    . GLU C 3 274 ? 42.660  43.049 52.080  1.00 56.04  ? 569  GLU A CA    1 
ATOM   2509 C C     . GLU C 3 274 ? 42.554  42.419 50.679  1.00 54.75  ? 569  GLU A C     1 
ATOM   2510 O O     . GLU C 3 274 ? 42.309  43.169 49.718  1.00 56.77  ? 569  GLU A O     1 
ATOM   2511 C CB    . GLU C 3 274 ? 43.949  43.858 52.218  1.00 61.09  ? 569  GLU A CB    1 
ATOM   2512 C CG    . GLU C 3 274 ? 43.780  45.328 51.884  1.00 65.21  ? 569  GLU A CG    1 
ATOM   2513 C CD    . GLU C 3 274 ? 45.079  46.033 51.547  1.00 67.33  ? 569  GLU A CD    1 
ATOM   2514 O OE1   . GLU C 3 274 ? 46.161  45.470 51.850  1.00 63.99  ? 569  GLU A OE1   1 
ATOM   2515 O OE2   . GLU C 3 274 ? 45.002  47.135 50.971  1.00 67.76  ? 569  GLU A OE2   1 
ATOM   2516 N N     . ILE C 3 275 ? 42.740  41.098 50.557  1.00 48.95  ? 570  ILE A N     1 
ATOM   2517 C CA    . ILE C 3 275 ? 42.682  40.363 49.261  1.00 43.88  ? 570  ILE A CA    1 
ATOM   2518 C C     . ILE C 3 275 ? 41.253  40.381 48.726  1.00 42.91  ? 570  ILE A C     1 
ATOM   2519 O O     . ILE C 3 275 ? 41.110  40.303 47.487  1.00 44.06  ? 570  ILE A O     1 
ATOM   2520 C CB    . ILE C 3 275 ? 43.173  38.905 49.365  1.00 41.81  ? 570  ILE A CB    1 
ATOM   2521 C CG1   . ILE C 3 275 ? 43.643  38.415 47.992  1.00 41.46  ? 570  ILE A CG1   1 
ATOM   2522 C CG2   . ILE C 3 275 ? 42.092  38.010 49.970  1.00 39.19  ? 570  ILE A CG2   1 
ATOM   2523 C CD1   . ILE C 3 275 ? 44.210  37.023 47.968  1.00 43.16  ? 570  ILE A CD1   1 
ATOM   2524 N N     . VAL C 3 276 ? 40.241  40.414 49.598  1.00 40.40  ? 571  VAL A N     1 
ATOM   2525 C CA    . VAL C 3 276 ? 38.850  40.079 49.181  1.00 40.65  ? 571  VAL A CA    1 
ATOM   2526 C C     . VAL C 3 276 ? 38.320  41.205 48.281  1.00 45.42  ? 571  VAL A C     1 
ATOM   2527 O O     . VAL C 3 276 ? 37.760  40.883 47.207  1.00 39.07  ? 571  VAL A O     1 
ATOM   2528 C CB    . VAL C 3 276 ? 37.932  39.809 50.381  1.00 42.52  ? 571  VAL A CB    1 
ATOM   2529 C CG1   . VAL C 3 276 ? 36.512  39.517 49.928  1.00 40.66  ? 571  VAL A CG1   1 
ATOM   2530 C CG2   . VAL C 3 276 ? 38.462  38.666 51.248  1.00 44.82  ? 571  VAL A CG2   1 
ATOM   2531 N N     . GLU C 3 277 ? 38.513  42.468 48.687  1.00 47.95  ? 572  GLU A N     1 
ATOM   2532 C CA    . GLU C 3 277 ? 37.978  43.656 47.969  1.00 48.20  ? 572  GLU A CA    1 
ATOM   2533 C C     . GLU C 3 277 ? 38.640  43.742 46.588  1.00 43.38  ? 572  GLU A C     1 
ATOM   2534 O O     . GLU C 3 277 ? 37.928  44.028 45.627  1.00 39.65  ? 572  GLU A O     1 
ATOM   2535 C CB    . GLU C 3 277 ? 38.173  44.930 48.794  1.00 53.01  ? 572  GLU A CB    1 
ATOM   2536 C CG    . GLU C 3 277 ? 39.627  45.347 48.952  1.00 58.96  ? 572  GLU A CG    1 
ATOM   2537 C CD    . GLU C 3 277 ? 39.864  46.372 50.046  1.00 66.69  ? 572  GLU A CD    1 
ATOM   2538 O OE1   . GLU C 3 277 ? 39.320  46.182 51.159  1.00 69.64  ? 572  GLU A OE1   1 
ATOM   2539 O OE2   . GLU C 3 277 ? 40.588  47.359 49.784  1.00 75.29  ? 572  GLU A OE2   1 
ATOM   2540 N N     . ASN C 3 278 ? 39.949  43.489 46.504  1.00 42.29  ? 573  ASN A N     1 
ATOM   2541 C CA    . ASN C 3 278 ? 40.699  43.378 45.225  1.00 44.78  ? 573  ASN A CA    1 
ATOM   2542 C C     . ASN C 3 278 ? 40.048  42.299 44.335  1.00 44.96  ? 573  ASN A C     1 
ATOM   2543 O O     . ASN C 3 278 ? 39.878  42.556 43.132  1.00 45.76  ? 573  ASN A O     1 
ATOM   2544 C CB    . ASN C 3 278 ? 42.188  43.122 45.482  1.00 48.16  ? 573  ASN A CB    1 
ATOM   2545 C CG    . ASN C 3 278 ? 42.937  44.353 45.967  1.00 52.61  ? 573  ASN A CG    1 
ATOM   2546 O OD1   . ASN C 3 278 ? 43.155  45.293 45.204  1.00 59.13  ? 573  ASN A OD1   1 
ATOM   2547 N ND2   . ASN C 3 278 ? 43.368  44.350 47.221  1.00 46.38  ? 573  ASN A ND2   1 
ATOM   2548 N N     . ILE C 3 279 ? 39.705  41.131 44.898  1.00 44.31  ? 574  ILE A N     1 
ATOM   2549 C CA    . ILE C 3 279 ? 39.056  39.998 44.170  1.00 40.36  ? 574  ILE A CA    1 
ATOM   2550 C C     . ILE C 3 279 ? 37.713  40.468 43.621  1.00 36.90  ? 574  ILE A C     1 
ATOM   2551 O O     . ILE C 3 279 ? 37.409  40.126 42.460  1.00 34.53  ? 574  ILE A O     1 
ATOM   2552 C CB    . ILE C 3 279 ? 38.912  38.731 45.043  1.00 38.81  ? 574  ILE A CB    1 
ATOM   2553 C CG1   . ILE C 3 279 ? 40.264  38.028 45.165  1.00 41.30  ? 574  ILE A CG1   1 
ATOM   2554 C CG2   . ILE C 3 279 ? 37.840  37.777 44.519  1.00 33.70  ? 574  ILE A CG2   1 
ATOM   2555 C CD1   . ILE C 3 279 ? 40.337  37.063 46.306  1.00 46.33  ? 574  ILE A CD1   1 
ATOM   2556 N N     . LEU C 3 280 ? 36.943  41.200 44.420  1.00 36.55  ? 575  LEU A N     1 
ATOM   2557 C CA    . LEU C 3 280 ? 35.585  41.665 44.025  1.00 41.67  ? 575  LEU A CA    1 
ATOM   2558 C C     . LEU C 3 280 ? 35.675  42.683 42.878  1.00 40.68  ? 575  LEU A C     1 
ATOM   2559 O O     . LEU C 3 280 ? 34.853  42.605 41.970  1.00 37.61  ? 575  LEU A O     1 
ATOM   2560 C CB    . LEU C 3 280 ? 34.910  42.292 45.245  1.00 45.00  ? 575  LEU A CB    1 
ATOM   2561 C CG    . LEU C 3 280 ? 34.198  41.300 46.157  1.00 47.27  ? 575  LEU A CG    1 
ATOM   2562 C CD1   . LEU C 3 280 ? 33.958  41.920 47.529  1.00 49.82  ? 575  LEU A CD1   1 
ATOM   2563 C CD2   . LEU C 3 280 ? 32.900  40.839 45.513  1.00 44.35  ? 575  LEU A CD2   1 
ATOM   2564 N N     . HIS C 3 281 ? 36.615  43.625 42.976  1.00 44.30  ? 576  HIS A N     1 
ATOM   2565 C CA    . HIS C 3 281 ? 36.891  44.698 41.984  1.00 50.03  ? 576  HIS A CA    1 
ATOM   2566 C C     . HIS C 3 281 ? 37.355  44.035 40.686  1.00 47.89  ? 576  HIS A C     1 
ATOM   2567 O O     . HIS C 3 281 ? 36.786  44.362 39.647  1.00 48.50  ? 576  HIS A O     1 
ATOM   2568 C CB    . HIS C 3 281 ? 37.922  45.688 42.552  1.00 53.36  ? 576  HIS A CB    1 
ATOM   2569 C CG    . HIS C 3 281 ? 38.169  46.900 41.716  1.00 60.56  ? 576  HIS A CG    1 
ATOM   2570 N ND1   . HIS C 3 281 ? 37.137  47.651 41.163  1.00 62.65  ? 576  HIS A ND1   1 
ATOM   2571 C CD2   . HIS C 3 281 ? 39.324  47.513 41.366  1.00 60.60  ? 576  HIS A CD2   1 
ATOM   2572 C CE1   . HIS C 3 281 ? 37.651  48.668 40.499  1.00 62.56  ? 576  HIS A CE1   1 
ATOM   2573 N NE2   . HIS C 3 281 ? 38.993  48.598 40.601  1.00 61.77  ? 576  HIS A NE2   1 
ATOM   2574 N N     . TYR C 3 282 ? 38.313  43.102 40.786  1.00 45.67  ? 577  TYR A N     1 
ATOM   2575 C CA    . TYR C 3 282 ? 38.859  42.280 39.670  1.00 43.09  ? 577  TYR A CA    1 
ATOM   2576 C C     . TYR C 3 282 ? 37.731  41.572 38.905  1.00 39.75  ? 577  TYR A C     1 
ATOM   2577 O O     . TYR C 3 282 ? 37.776  41.571 37.668  1.00 40.56  ? 577  TYR A O     1 
ATOM   2578 C CB    . TYR C 3 282 ? 39.875  41.253 40.174  1.00 43.26  ? 577  TYR A CB    1 
ATOM   2579 C CG    . TYR C 3 282 ? 40.323  40.291 39.104  1.00 44.27  ? 577  TYR A CG    1 
ATOM   2580 C CD1   . TYR C 3 282 ? 41.369  40.609 38.255  1.00 46.97  ? 577  TYR A CD1   1 
ATOM   2581 C CD2   . TYR C 3 282 ? 39.650  39.099 38.887  1.00 45.26  ? 577  TYR A CD2   1 
ATOM   2582 C CE1   . TYR C 3 282 ? 41.762  39.748 37.243  1.00 47.74  ? 577  TYR A CE1   1 
ATOM   2583 C CE2   . TYR C 3 282 ? 40.034  38.223 37.885  1.00 46.45  ? 577  TYR A CE2   1 
ATOM   2584 C CZ    . TYR C 3 282 ? 41.093  38.550 37.054  1.00 46.44  ? 577  TYR A CZ    1 
ATOM   2585 O OH    . TYR C 3 282 ? 41.497  37.687 36.072  1.00 43.87  ? 577  TYR A OH    1 
ATOM   2586 N N     . ARG C 3 283 ? 36.762  40.982 39.608  1.00 37.09  ? 578  ARG A N     1 
ATOM   2587 C CA    . ARG C 3 283 ? 35.587  40.299 39.006  1.00 37.56  ? 578  ARG A CA    1 
ATOM   2588 C C     . ARG C 3 283 ? 34.693  41.310 38.272  1.00 35.15  ? 578  ARG A C     1 
ATOM   2589 O O     . ARG C 3 283 ? 34.235  40.996 37.148  1.00 36.37  ? 578  ARG A O     1 
ATOM   2590 C CB    . ARG C 3 283 ? 34.767  39.583 40.083  1.00 35.60  ? 578  ARG A CB    1 
ATOM   2591 C CG    . ARG C 3 283 ? 35.422  38.312 40.599  1.00 39.56  ? 578  ARG A CG    1 
ATOM   2592 C CD    . ARG C 3 283 ? 34.391  37.212 40.647  1.00 39.51  ? 578  ARG A CD    1 
ATOM   2593 N NE    . ARG C 3 283 ? 34.944  35.967 41.142  1.00 39.49  ? 578  ARG A NE    1 
ATOM   2594 C CZ    . ARG C 3 283 ? 34.478  35.289 42.185  1.00 38.01  ? 578  ARG A CZ    1 
ATOM   2595 N NH1   . ARG C 3 283 ? 33.430  35.732 42.853  1.00 36.40  ? 578  ARG A NH1   1 
ATOM   2596 N NH2   . ARG C 3 283 ? 35.050  34.154 42.544  1.00 39.42  ? 578  ARG A NH2   1 
ATOM   2597 N N     . GLN C 3 284 ? 34.411  42.450 38.898  1.00 35.57  ? 579  GLN A N     1 
ATOM   2598 C CA    . GLN C 3 284 ? 33.672  43.562 38.252  1.00 39.14  ? 579  GLN A CA    1 
ATOM   2599 C C     . GLN C 3 284 ? 34.365  43.918 36.926  1.00 34.82  ? 579  GLN A C     1 
ATOM   2600 O O     . GLN C 3 284 ? 33.714  43.760 35.871  1.00 34.76  ? 579  GLN A O     1 
ATOM   2601 C CB    . GLN C 3 284 ? 33.553  44.774 39.170  1.00 47.25  ? 579  GLN A CB    1 
ATOM   2602 C CG    . GLN C 3 284 ? 32.404  45.700 38.762  1.00 57.69  ? 579  GLN A CG    1 
ATOM   2603 C CD    . GLN C 3 284 ? 32.653  47.162 39.059  1.00 66.51  ? 579  GLN A CD    1 
ATOM   2604 O OE1   . GLN C 3 284 ? 33.682  47.542 39.625  1.00 69.41  ? 579  GLN A OE1   1 
ATOM   2605 N NE2   . GLN C 3 284 ? 31.706  48.000 38.656  1.00 79.02  ? 579  GLN A NE2   1 
ATOM   2606 N N     . LEU C 3 285 ? 35.638  44.334 36.968  1.00 32.75  ? 580  LEU A N     1 
ATOM   2607 C CA    . LEU C 3 285 ? 36.428  44.720 35.765  1.00 34.32  ? 580  LEU A CA    1 
ATOM   2608 C C     . LEU C 3 285 ? 36.386  43.563 34.752  1.00 32.20  ? 580  LEU A C     1 
ATOM   2609 O O     . LEU C 3 285 ? 36.043  43.820 33.582  1.00 30.37  ? 580  LEU A O     1 
ATOM   2610 C CB    . LEU C 3 285 ? 37.873  45.064 36.143  1.00 37.51  ? 580  LEU A CB    1 
ATOM   2611 C CG    . LEU C 3 285 ? 38.085  46.193 37.159  1.00 42.88  ? 580  LEU A CG    1 
ATOM   2612 C CD1   . LEU C 3 285 ? 39.570  46.363 37.494  1.00 45.12  ? 580  LEU A CD1   1 
ATOM   2613 C CD2   . LEU C 3 285 ? 37.502  47.512 36.674  1.00 45.15  ? 580  LEU A CD2   1 
ATOM   2614 N N     . GLY C 3 286 ? 36.657  42.335 35.203  1.00 29.86  ? 581  GLY A N     1 
ATOM   2615 C CA    . GLY C 3 286 ? 36.777  41.128 34.361  1.00 28.90  ? 581  GLY A CA    1 
ATOM   2616 C C     . GLY C 3 286 ? 35.491  40.825 33.609  1.00 28.73  ? 581  GLY A C     1 
ATOM   2617 O O     . GLY C 3 286 ? 35.567  40.381 32.448  1.00 25.35  ? 581  GLY A O     1 
ATOM   2618 N N     . LYS C 3 287 ? 34.353  41.118 34.231  1.00 27.90  ? 582  LYS A N     1 
ATOM   2619 C CA    . LYS C 3 287 ? 33.008  40.912 33.660  1.00 29.04  ? 582  LYS A CA    1 
ATOM   2620 C C     . LYS C 3 287 ? 32.789  41.935 32.542  1.00 27.36  ? 582  LYS A C     1 
ATOM   2621 O O     . LYS C 3 287 ? 32.449  41.540 31.403  1.00 24.51  ? 582  LYS A O     1 
ATOM   2622 C CB    . LYS C 3 287 ? 31.962  41.046 34.778  1.00 34.23  ? 582  LYS A CB    1 
ATOM   2623 C CG    . LYS C 3 287 ? 30.517  40.858 34.341  1.00 39.80  ? 582  LYS A CG    1 
ATOM   2624 C CD    . LYS C 3 287 ? 30.294  39.648 33.456  1.00 44.26  ? 582  LYS A CD    1 
ATOM   2625 C CE    . LYS C 3 287 ? 28.829  39.326 33.263  1.00 51.28  ? 582  LYS A CE    1 
ATOM   2626 N NZ    . LYS C 3 287 ? 28.557  37.882 33.475  1.00 52.08  ? 582  LYS A NZ    1 
ATOM   2627 N N     . LEU C 3 288 ? 32.966  43.216 32.856  1.00 26.77  ? 583  LEU A N     1 
ATOM   2628 C CA    . LEU C 3 288 ? 32.927  44.282 31.833  1.00 29.01  ? 583  LEU A CA    1 
ATOM   2629 C C     . LEU C 3 288 ? 33.822  43.894 30.654  1.00 29.69  ? 583  LEU A C     1 
ATOM   2630 O O     . LEU C 3 288 ? 33.321  43.989 29.503  1.00 26.35  ? 583  LEU A O     1 
ATOM   2631 C CB    . LEU C 3 288 ? 33.355  45.615 32.438  1.00 28.40  ? 583  LEU A CB    1 
ATOM   2632 C CG    . LEU C 3 288 ? 32.437  46.146 33.542  1.00 31.30  ? 583  LEU A CG    1 
ATOM   2633 C CD1   . LEU C 3 288 ? 32.796  47.594 33.877  1.00 29.70  ? 583  LEU A CD1   1 
ATOM   2634 C CD2   . LEU C 3 288 ? 30.964  46.010 33.162  1.00 29.49  ? 583  LEU A CD2   1 
ATOM   2635 N N     . GLN C 3 289 ? 35.062  43.450 30.923  1.00 31.81  ? 584  GLN A N     1 
ATOM   2636 C CA    . GLN C 3 289 ? 36.087  43.193 29.869  1.00 32.38  ? 584  GLN A CA    1 
ATOM   2637 C C     . GLN C 3 289 ? 35.622  42.021 29.008  1.00 31.15  ? 584  GLN A C     1 
ATOM   2638 O O     . GLN C 3 289 ? 35.505  42.225 27.791  1.00 31.59  ? 584  GLN A O     1 
ATOM   2639 C CB    . GLN C 3 289 ? 37.482  42.927 30.438  1.00 32.07  ? 584  GLN A CB    1 
ATOM   2640 C CG    . GLN C 3 289 ? 38.536  42.630 29.365  1.00 35.80  ? 584  GLN A CG    1 
ATOM   2641 C CD    . GLN C 3 289 ? 39.061  43.879 28.694  1.00 39.43  ? 584  GLN A CD    1 
ATOM   2642 O OE1   . GLN C 3 289 ? 38.357  44.565 27.952  1.00 42.41  ? 584  GLN A OE1   1 
ATOM   2643 N NE2   . GLN C 3 289 ? 40.310  44.217 28.975  1.00 39.30  ? 584  GLN A NE2   1 
ATOM   2644 N N     . SER C 3 290 ? 35.343  40.872 29.624  1.00 31.37  ? 585  SER A N     1 
ATOM   2645 C CA    . SER C 3 290 ? 35.109  39.586 28.916  1.00 38.19  ? 585  SER A CA    1 
ATOM   2646 C C     . SER C 3 290 ? 33.775  39.633 28.178  1.00 37.10  ? 585  SER A C     1 
ATOM   2647 O O     . SER C 3 290 ? 33.768  39.438 26.960  1.00 34.95  ? 585  SER A O     1 
ATOM   2648 C CB    . SER C 3 290 ? 35.134  38.420 29.859  1.00 40.97  ? 585  SER A CB    1 
ATOM   2649 O OG    . SER C 3 290 ? 36.423  38.271 30.442  1.00 46.29  ? 585  SER A OG    1 
ATOM   2650 N N     . THR C 3 291 ? 32.696  39.861 28.927  1.00 36.90  ? 586  THR A N     1 
ATOM   2651 C CA    . THR C 3 291 ? 31.294  39.731 28.455  1.00 34.04  ? 586  THR A CA    1 
ATOM   2652 C C     . THR C 3 291 ? 30.938  40.924 27.570  1.00 35.18  ? 586  THR A C     1 
ATOM   2653 O O     . THR C 3 291 ? 30.296  40.710 26.562  1.00 38.10  ? 586  THR A O     1 
ATOM   2654 C CB    . THR C 3 291 ? 30.312  39.637 29.628  1.00 36.16  ? 586  THR A CB    1 
ATOM   2655 O OG1   . THR C 3 291 ? 30.617  38.469 30.403  1.00 32.07  ? 586  THR A OG1   1 
ATOM   2656 C CG2   . THR C 3 291 ? 28.863  39.624 29.171  1.00 35.20  ? 586  THR A CG2   1 
ATOM   2657 N N     . TYR C 3 292 ? 31.335  42.140 27.941  1.00 34.39  ? 587  TYR A N     1 
ATOM   2658 C CA    . TYR C 3 292 ? 30.733  43.367 27.376  1.00 32.72  ? 587  TYR A CA    1 
ATOM   2659 C C     . TYR C 3 292 ? 31.660  44.027 26.364  1.00 33.62  ? 587  TYR A C     1 
ATOM   2660 O O     . TYR C 3 292 ? 31.195  44.298 25.270  1.00 41.67  ? 587  TYR A O     1 
ATOM   2661 C CB    . TYR C 3 292 ? 30.274  44.283 28.503  1.00 30.22  ? 587  TYR A CB    1 
ATOM   2662 C CG    . TYR C 3 292 ? 29.120  43.671 29.243  1.00 30.29  ? 587  TYR A CG    1 
ATOM   2663 C CD1   . TYR C 3 292 ? 27.917  43.414 28.586  1.00 27.60  ? 587  TYR A CD1   1 
ATOM   2664 C CD2   . TYR C 3 292 ? 29.252  43.273 30.564  1.00 28.92  ? 587  TYR A CD2   1 
ATOM   2665 C CE1   . TYR C 3 292 ? 26.845  42.840 29.242  1.00 27.05  ? 587  TYR A CE1   1 
ATOM   2666 C CE2   . TYR C 3 292 ? 28.180  42.713 31.240  1.00 29.53  ? 587  TYR A CE2   1 
ATOM   2667 C CZ    . TYR C 3 292 ? 26.981  42.486 30.572  1.00 28.21  ? 587  TYR A CZ    1 
ATOM   2668 O OH    . TYR C 3 292 ? 25.942  41.925 31.243  1.00 28.81  ? 587  TYR A OH    1 
ATOM   2669 N N     . ILE C 3 293 ? 32.912  44.281 26.703  1.00 31.73  ? 588  ILE A N     1 
ATOM   2670 C CA    . ILE C 3 293 ? 33.859  44.899 25.741  1.00 30.12  ? 588  ILE A CA    1 
ATOM   2671 C C     . ILE C 3 293 ? 34.188  43.867 24.661  1.00 30.93  ? 588  ILE A C     1 
ATOM   2672 O O     . ILE C 3 293 ? 33.860  44.131 23.489  1.00 32.23  ? 588  ILE A O     1 
ATOM   2673 C CB    . ILE C 3 293 ? 35.109  45.445 26.453  1.00 30.94  ? 588  ILE A CB    1 
ATOM   2674 C CG1   . ILE C 3 293 ? 34.756  46.485 27.524  1.00 30.18  ? 588  ILE A CG1   1 
ATOM   2675 C CG2   . ILE C 3 293 ? 36.108  45.999 25.439  1.00 30.64  ? 588  ILE A CG2   1 
ATOM   2676 C CD1   . ILE C 3 293 ? 33.965  47.662 27.025  1.00 32.24  ? 588  ILE A CD1   1 
ATOM   2677 N N     . GLU C 3 294 ? 34.825  42.750 25.022  1.00 31.89  ? 589  GLU A N     1 
ATOM   2678 C CA    . GLU C 3 294 ? 35.341  41.765 24.035  1.00 34.80  ? 589  GLU A CA    1 
ATOM   2679 C C     . GLU C 3 294 ? 34.171  41.080 23.321  1.00 32.97  ? 589  GLU A C     1 
ATOM   2680 O O     . GLU C 3 294 ? 34.220  40.968 22.085  1.00 32.76  ? 589  GLU A O     1 
ATOM   2681 C CB    . GLU C 3 294 ? 36.270  40.768 24.712  1.00 38.21  ? 589  GLU A CB    1 
ATOM   2682 C CG    . GLU C 3 294 ? 37.656  41.342 24.974  1.00 42.78  ? 589  GLU A CG    1 
ATOM   2683 C CD    . GLU C 3 294 ? 38.510  40.454 25.874  1.00 46.05  ? 589  GLU A CD    1 
ATOM   2684 O OE1   . GLU C 3 294 ? 37.979  39.401 26.313  1.00 44.42  ? 589  GLU A OE1   1 
ATOM   2685 O OE2   . GLU C 3 294 ? 39.693  40.818 26.144  1.00 43.46  ? 589  GLU A OE2   1 
ATOM   2686 N N     . GLY C 3 295 ? 33.145  40.682 24.066  1.00 33.79  ? 590  GLY A N     1 
ATOM   2687 C CA    . GLY C 3 295 ? 31.914  40.069 23.524  1.00 34.18  ? 590  GLY A CA    1 
ATOM   2688 C C     . GLY C 3 295 ? 31.246  40.935 22.469  1.00 31.47  ? 590  GLY A C     1 
ATOM   2689 O O     . GLY C 3 295 ? 30.866  40.391 21.400  1.00 31.44  ? 590  GLY A O     1 
ATOM   2690 N N     . LEU C 3 296 ? 31.105  42.231 22.745  1.00 28.99  ? 591  LEU A N     1 
ATOM   2691 C CA    . LEU C 3 296 ? 30.416  43.177 21.833  1.00 29.12  ? 591  LEU A CA    1 
ATOM   2692 C C     . LEU C 3 296 ? 31.289  43.351 20.591  1.00 28.09  ? 591  LEU A C     1 
ATOM   2693 O O     . LEU C 3 296 ? 30.757  43.263 19.480  1.00 29.67  ? 591  LEU A O     1 
ATOM   2694 C CB    . LEU C 3 296 ? 30.196  44.516 22.548  1.00 29.62  ? 591  LEU A CB    1 
ATOM   2695 C CG    . LEU C 3 296 ? 28.765  45.015 22.759  1.00 30.43  ? 591  LEU A CG    1 
ATOM   2696 C CD1   . LEU C 3 296 ? 27.687  43.951 22.544  1.00 29.07  ? 591  LEU A CD1   1 
ATOM   2697 C CD2   . LEU C 3 296 ? 28.633  45.652 24.137  1.00 31.76  ? 591  LEU A CD2   1 
ATOM   2698 N N     . LEU C 3 297 ? 32.589  43.552 20.770  1.00 27.20  ? 592  LEU A N     1 
ATOM   2699 C CA    . LEU C 3 297 ? 33.495  43.850 19.631  1.00 29.45  ? 592  LEU A CA    1 
ATOM   2700 C C     . LEU C 3 297 ? 33.581  42.627 18.729  1.00 29.39  ? 592  LEU A C     1 
ATOM   2701 O O     . LEU C 3 297 ? 33.635  42.826 17.504  1.00 33.77  ? 592  LEU A O     1 
ATOM   2702 C CB    . LEU C 3 297 ? 34.865  44.301 20.137  1.00 27.75  ? 592  LEU A CB    1 
ATOM   2703 C CG    . LEU C 3 297 ? 34.869  45.716 20.698  1.00 28.75  ? 592  LEU A CG    1 
ATOM   2704 C CD1   . LEU C 3 297 ? 36.114  45.994 21.518  1.00 30.53  ? 592  LEU A CD1   1 
ATOM   2705 C CD2   . LEU C 3 297 ? 34.739  46.727 19.578  1.00 31.10  ? 592  LEU A CD2   1 
ATOM   2706 N N     . LYS C 3 298 ? 33.469  41.427 19.294  1.00 30.98  ? 593  LYS A N     1 
ATOM   2707 C CA    . LYS C 3 298 ? 33.434  40.162 18.506  1.00 34.96  ? 593  LYS A CA    1 
ATOM   2708 C C     . LYS C 3 298 ? 32.241  40.146 17.538  1.00 31.43  ? 593  LYS A C     1 
ATOM   2709 O O     . LYS C 3 298 ? 32.378  39.503 16.510  1.00 27.67  ? 593  LYS A O     1 
ATOM   2710 C CB    . LYS C 3 298 ? 33.296  38.927 19.404  1.00 43.54  ? 593  LYS A CB    1 
ATOM   2711 C CG    . LYS C 3 298 ? 34.538  38.059 19.543  1.00 55.80  ? 593  LYS A CG    1 
ATOM   2712 C CD    . LYS C 3 298 ? 34.225  36.637 20.014  1.00 63.59  ? 593  LYS A CD    1 
ATOM   2713 C CE    . LYS C 3 298 ? 35.335  36.015 20.843  1.00 68.39  ? 593  LYS A CE    1 
ATOM   2714 N NZ    . LYS C 3 298 ? 35.652  36.844 22.036  1.00 67.10  ? 593  LYS A NZ    1 
ATOM   2715 N N     . VAL C 3 299 ? 31.078  40.715 17.893  1.00 27.58  ? 594  VAL A N     1 
ATOM   2716 C CA    . VAL C 3 299 ? 29.832  40.540 17.079  1.00 28.05  ? 594  VAL A CA    1 
ATOM   2717 C C     . VAL C 3 299 ? 29.478  41.830 16.336  1.00 26.12  ? 594  VAL A C     1 
ATOM   2718 O O     . VAL C 3 299 ? 28.538  41.776 15.558  1.00 26.47  ? 594  VAL A O     1 
ATOM   2719 C CB    . VAL C 3 299 ? 28.626  40.042 17.898  1.00 29.14  ? 594  VAL A CB    1 
ATOM   2720 C CG1   . VAL C 3 299 ? 28.804  38.587 18.306  1.00 29.50  ? 594  VAL A CG1   1 
ATOM   2721 C CG2   . VAL C 3 299 ? 28.320  40.928 19.099  1.00 27.58  ? 594  VAL A CG2   1 
ATOM   2722 N N     . VAL C 3 300 ? 30.200  42.930 16.533  1.00 24.39  ? 595  VAL A N     1 
ATOM   2723 C CA    . VAL C 3 300 ? 29.926  44.154 15.740  1.00 25.70  ? 595  VAL A CA    1 
ATOM   2724 C C     . VAL C 3 300 ? 30.298  43.852 14.291  1.00 25.47  ? 595  VAL A C     1 
ATOM   2725 O O     . VAL C 3 300 ? 31.318  43.180 14.068  1.00 25.43  ? 595  VAL A O     1 
ATOM   2726 C CB    . VAL C 3 300 ? 30.667  45.386 16.262  1.00 26.57  ? 595  VAL A CB    1 
ATOM   2727 C CG1   . VAL C 3 300 ? 30.235  46.615 15.499  1.00 28.07  ? 595  VAL A CG1   1 
ATOM   2728 C CG2   . VAL C 3 300 ? 30.421  45.597 17.741  1.00 30.06  ? 595  VAL A CG2   1 
ATOM   2729 N N     . ARG C 3 301 ? 29.488  44.303 13.347  1.00 24.21  ? 596  ARG A N     1 
ATOM   2730 C CA    . ARG C 3 301 ? 29.794  44.121 11.910  1.00 24.97  ? 596  ARG A CA    1 
ATOM   2731 C C     . ARG C 3 301 ? 30.769  45.226 11.547  1.00 25.64  ? 596  ARG A C     1 
ATOM   2732 O O     . ARG C 3 301 ? 30.509  46.405 11.758  1.00 23.68  ? 596  ARG A O     1 
ATOM   2733 C CB    . ARG C 3 301 ? 28.531  44.151 11.071  1.00 25.91  ? 596  ARG A CB    1 
ATOM   2734 C CG    . ARG C 3 301 ? 27.452  43.243 11.636  1.00 27.25  ? 596  ARG A CG    1 
ATOM   2735 C CD    . ARG C 3 301 ? 27.122  42.111 10.717  1.00 26.09  ? 596  ARG A CD    1 
ATOM   2736 N NE    . ARG C 3 301 ? 26.663  40.987 11.489  1.00 26.80  ? 596  ARG A NE    1 
ATOM   2737 C CZ    . ARG C 3 301 ? 26.340  39.810 10.960  1.00 25.76  ? 596  ARG A CZ    1 
ATOM   2738 N NH1   . ARG C 3 301 ? 26.385  39.653 9.643   1.00 24.22  ? 596  ARG A NH1   1 
ATOM   2739 N NH2   . ARG C 3 301 ? 25.968  38.814 11.755  1.00 22.96  ? 596  ARG A NH2   1 
ATOM   2740 N N     . PRO C 3 302 ? 31.973  44.866 11.078  1.00 26.18  ? 597  PRO A N     1 
ATOM   2741 C CA    . PRO C 3 302 ? 32.989  45.885 10.831  1.00 25.25  ? 597  PRO A CA    1 
ATOM   2742 C C     . PRO C 3 302 ? 32.559  46.859 9.725   1.00 25.45  ? 597  PRO A C     1 
ATOM   2743 O O     . PRO C 3 302 ? 33.032  47.943 9.680   1.00 28.66  ? 597  PRO A O     1 
ATOM   2744 C CB    . PRO C 3 302 ? 34.243  45.092 10.463  1.00 26.98  ? 597  PRO A CB    1 
ATOM   2745 C CG    . PRO C 3 302 ? 33.844  43.632 10.392  1.00 26.48  ? 597  PRO A CG    1 
ATOM   2746 C CD    . PRO C 3 302 ? 32.412  43.486 10.851  1.00 25.24  ? 597  PRO A CD    1 
ATOM   2747 N N     . ASP C 3 303 ? 31.667  46.448 8.836   1.00 23.24  ? 598  ASP A N     1 
ATOM   2748 C CA    . ASP C 3 303 ? 31.268  47.319 7.707   1.00 25.12  ? 598  ASP A CA    1 
ATOM   2749 C C     . ASP C 3 303 ? 30.338  48.429 8.208   1.00 28.46  ? 598  ASP A C     1 
ATOM   2750 O O     . ASP C 3 303 ? 30.531  49.573 7.800   1.00 34.80  ? 598  ASP A O     1 
ATOM   2751 C CB    . ASP C 3 303 ? 30.652  46.505 6.573   1.00 25.40  ? 598  ASP A CB    1 
ATOM   2752 C CG    . ASP C 3 303 ? 29.601  45.492 7.002   1.00 23.23  ? 598  ASP A CG    1 
ATOM   2753 O OD1   . ASP C 3 303 ? 29.722  44.938 8.102   1.00 24.73  ? 598  ASP A OD1   1 
ATOM   2754 O OD2   . ASP C 3 303 ? 28.708  45.233 6.203   1.00 23.74  ? 598  ASP A OD2   1 
ATOM   2755 N N     . THR C 3 304 ? 29.342  48.125 9.037   1.00 27.45  ? 599  THR A N     1 
ATOM   2756 C CA    . THR C 3 304 ? 28.346  49.141 9.483   1.00 25.27  ? 599  THR A CA    1 
ATOM   2757 C C     . THR C 3 304 ? 28.630  49.584 10.919  1.00 24.50  ? 599  THR A C     1 
ATOM   2758 O O     . THR C 3 304 ? 28.026  50.533 11.343  1.00 27.81  ? 599  THR A O     1 
ATOM   2759 C CB    . THR C 3 304 ? 26.931  48.577 9.328   1.00 24.48  ? 599  THR A CB    1 
ATOM   2760 O OG1   . THR C 3 304 ? 26.887  47.470 10.243  1.00 20.07  ? 599  THR A OG1   1 
ATOM   2761 C CG2   . THR C 3 304 ? 26.601  48.191 7.891   1.00 21.66  ? 599  THR A CG2   1 
ATOM   2762 N N     . LYS C 3 305 ? 29.436  48.851 11.673  1.00 26.44  ? 600  LYS A N     1 
ATOM   2763 C CA    . LYS C 3 305 ? 29.616  49.107 13.120  1.00 29.98  ? 600  LYS A CA    1 
ATOM   2764 C C     . LYS C 3 305 ? 28.270  48.889 13.827  1.00 27.00  ? 600  LYS A C     1 
ATOM   2765 O O     . LYS C 3 305 ? 28.005  49.550 14.850  1.00 24.73  ? 600  LYS A O     1 
ATOM   2766 C CB    . LYS C 3 305 ? 30.144  50.527 13.345  1.00 36.97  ? 600  LYS A CB    1 
ATOM   2767 C CG    . LYS C 3 305 ? 31.388  50.892 12.550  1.00 43.78  ? 600  LYS A CG    1 
ATOM   2768 C CD    . LYS C 3 305 ? 32.665  50.472 13.220  1.00 54.76  ? 600  LYS A CD    1 
ATOM   2769 C CE    . LYS C 3 305 ? 33.920  50.895 12.476  1.00 64.16  ? 600  LYS A CE    1 
ATOM   2770 N NZ    . LYS C 3 305 ? 34.478  49.781 11.661  1.00 66.57  ? 600  LYS A NZ    1 
ATOM   2771 N N     . LYS C 3 306 ? 27.453  47.953 13.353  1.00 23.56  ? 601  LYS A N     1 
ATOM   2772 C CA    . LYS C 3 306 ? 26.200  47.635 14.066  1.00 22.33  ? 601  LYS A CA    1 
ATOM   2773 C C     . LYS C 3 306 ? 26.266  46.246 14.703  1.00 20.78  ? 601  LYS A C     1 
ATOM   2774 O O     . LYS C 3 306 ? 26.973  45.347 14.190  1.00 19.12  ? 601  LYS A O     1 
ATOM   2775 C CB    . LYS C 3 306 ? 25.012  47.709 13.126  1.00 23.19  ? 601  LYS A CB    1 
ATOM   2776 C CG    . LYS C 3 306 ? 24.557  49.108 12.754  1.00 22.17  ? 601  LYS A CG    1 
ATOM   2777 C CD    . LYS C 3 306 ? 23.612  48.979 11.601  1.00 23.17  ? 601  LYS A CD    1 
ATOM   2778 C CE    . LYS C 3 306 ? 22.728  50.175 11.396  1.00 25.77  ? 601  LYS A CE    1 
ATOM   2779 N NZ    . LYS C 3 306 ? 21.644  49.792 10.452  1.00 28.26  ? 601  LYS A NZ    1 
ATOM   2780 N N     . VAL C 3 307 ? 25.508  46.085 15.780  1.00 18.32  ? 602  VAL A N     1 
ATOM   2781 C CA    . VAL C 3 307 ? 25.141  44.745 16.289  1.00 17.77  ? 602  VAL A CA    1 
ATOM   2782 C C     . VAL C 3 307 ? 23.689  44.439 15.904  1.00 16.58  ? 602  VAL A C     1 
ATOM   2783 O O     . VAL C 3 307 ? 22.816  45.323 15.981  1.00 16.96  ? 602  VAL A O     1 
ATOM   2784 C CB    . VAL C 3 307 ? 25.408  44.601 17.792  1.00 18.72  ? 602  VAL A CB    1 
ATOM   2785 C CG1   . VAL C 3 307 ? 26.903  44.656 18.062  1.00 20.06  ? 602  VAL A CG1   1 
ATOM   2786 C CG2   . VAL C 3 307 ? 24.666  45.608 18.636  1.00 17.97  ? 602  VAL A CG2   1 
ATOM   2787 N N     . HIS C 3 308 ? 23.466  43.187 15.530  1.00 16.58  ? 603  HIS A N     1 
ATOM   2788 C CA    . HIS C 3 308 ? 22.184  42.609 15.075  1.00 16.06  ? 603  HIS A CA    1 
ATOM   2789 C C     . HIS C 3 308 ? 21.900  41.428 16.001  1.00 16.84  ? 603  HIS A C     1 
ATOM   2790 O O     . HIS C 3 308 ? 22.323  40.294 15.694  1.00 19.38  ? 603  HIS A O     1 
ATOM   2791 C CB    . HIS C 3 308 ? 22.295  42.244 13.594  1.00 16.12  ? 603  HIS A CB    1 
ATOM   2792 C CG    . HIS C 3 308 ? 22.555  43.415 12.695  1.00 17.49  ? 603  HIS A CG    1 
ATOM   2793 N ND1   . HIS C 3 308 ? 21.537  44.129 12.072  1.00 16.39  ? 603  HIS A ND1   1 
ATOM   2794 C CD2   . HIS C 3 308 ? 23.708  43.977 12.266  1.00 17.64  ? 603  HIS A CD2   1 
ATOM   2795 C CE1   . HIS C 3 308 ? 22.062  45.064 11.281  1.00 17.29  ? 603  HIS A CE1   1 
ATOM   2796 N NE2   . HIS C 3 308 ? 23.384  45.008 11.395  1.00 18.21  ? 603  HIS A NE2   1 
ATOM   2797 N N     . THR C 3 309 ? 21.235  41.703 17.120  1.00 15.70  ? 604  THR A N     1 
ATOM   2798 C CA    . THR C 3 309 ? 20.771  40.683 18.076  1.00 15.38  ? 604  THR A CA    1 
ATOM   2799 C C     . THR C 3 309 ? 19.732  39.785 17.389  1.00 15.22  ? 604  THR A C     1 
ATOM   2800 O O     . THR C 3 309 ? 19.192  40.129 16.336  1.00 15.08  ? 604  THR A O     1 
ATOM   2801 C CB    . THR C 3 309 ? 20.238  41.348 19.354  1.00 15.20  ? 604  THR A CB    1 
ATOM   2802 O OG1   . THR C 3 309 ? 20.188  40.331 20.354  1.00 14.69  ? 604  THR A OG1   1 
ATOM   2803 C CG2   . THR C 3 309 ? 18.881  42.000 19.161  1.00 14.61  ? 604  THR A CG2   1 
ATOM   2804 N N     . ILE C 3 310 ? 19.530  38.611 17.940  1.00 16.26  ? 605  ILE A N     1 
ATOM   2805 C CA    . ILE C 3 310 ? 18.399  37.720 17.575  1.00 17.40  ? 605  ILE A CA    1 
ATOM   2806 C C     . ILE C 3 310 ? 17.521  37.618 18.824  1.00 18.29  ? 605  ILE A C     1 
ATOM   2807 O O     . ILE C 3 310 ? 18.029  37.230 19.902  1.00 16.98  ? 605  ILE A O     1 
ATOM   2808 C CB    . ILE C 3 310 ? 18.948  36.394 17.024  1.00 17.99  ? 605  ILE A CB    1 
ATOM   2809 C CG1   . ILE C 3 310 ? 19.674  36.674 15.697  1.00 17.01  ? 605  ILE A CG1   1 
ATOM   2810 C CG2   . ILE C 3 310 ? 17.859  35.350 16.853  1.00 19.48  ? 605  ILE A CG2   1 
ATOM   2811 C CD1   . ILE C 3 310 ? 20.197  35.464 15.000  1.00 16.64  ? 605  ILE A CD1   1 
ATOM   2812 N N     . PHE C 3 311 ? 16.310  38.139 18.731  1.00 17.59  ? 606  PHE A N     1 
ATOM   2813 C CA    . PHE C 3 311 ? 15.278  37.928 19.778  1.00 19.11  ? 606  PHE A CA    1 
ATOM   2814 C C     . PHE C 3 311 ? 14.725  36.522 19.608  1.00 19.02  ? 606  PHE A C     1 
ATOM   2815 O O     . PHE C 3 311 ? 14.149  36.264 18.516  1.00 23.52  ? 606  PHE A O     1 
ATOM   2816 C CB    . PHE C 3 311 ? 14.185  38.984 19.656  1.00 17.56  ? 606  PHE A CB    1 
ATOM   2817 C CG    . PHE C 3 311 ? 14.684  40.362 19.990  1.00 18.45  ? 606  PHE A CG    1 
ATOM   2818 C CD1   . PHE C 3 311 ? 14.947  40.711 21.303  1.00 18.16  ? 606  PHE A CD1   1 
ATOM   2819 C CD2   . PHE C 3 311 ? 14.890  41.305 18.990  1.00 17.14  ? 606  PHE A CD2   1 
ATOM   2820 C CE1   . PHE C 3 311 ? 15.389  41.991 21.605  1.00 19.62  ? 606  PHE A CE1   1 
ATOM   2821 C CE2   . PHE C 3 311 ? 15.353  42.568 19.300  1.00 17.32  ? 606  PHE A CE2   1 
ATOM   2822 C CZ    . PHE C 3 311 ? 15.634  42.901 20.596  1.00 18.66  ? 606  PHE A CZ    1 
ATOM   2823 N N     . ASN C 3 312 ? 14.931  35.635 20.578  1.00 17.51  ? 607  ASN A N     1 
ATOM   2824 C CA    . ASN C 3 312 ? 14.224  34.329 20.568  1.00 17.24  ? 607  ASN A CA    1 
ATOM   2825 C C     . ASN C 3 312 ? 12.831  34.614 21.129  1.00 16.40  ? 607  ASN A C     1 
ATOM   2826 O O     . ASN C 3 312 ? 12.741  35.076 22.261  1.00 15.35  ? 607  ASN A O     1 
ATOM   2827 C CB    . ASN C 3 312 ? 14.996  33.252 21.322  1.00 19.98  ? 607  ASN A CB    1 
ATOM   2828 C CG    . ASN C 3 312 ? 14.451  31.853 21.102  1.00 21.61  ? 607  ASN A CG    1 
ATOM   2829 O OD1   . ASN C 3 312 ? 13.277  31.659 20.749  1.00 22.74  ? 607  ASN A OD1   1 
ATOM   2830 N ND2   . ASN C 3 312 ? 15.304  30.863 21.319  1.00 22.10  ? 607  ASN A ND2   1 
ATOM   2831 N N     . GLN C 3 313 ? 11.810  34.478 20.307  1.00 15.57  ? 608  GLN A N     1 
ATOM   2832 C CA    . GLN C 3 313 ? 10.408  34.762 20.683  1.00 16.06  ? 608  GLN A CA    1 
ATOM   2833 C C     . GLN C 3 313 ? 9.718   33.496 21.217  1.00 16.16  ? 608  GLN A C     1 
ATOM   2834 O O     . GLN C 3 313 ? 8.599   33.618 21.713  1.00 15.44  ? 608  GLN A O     1 
ATOM   2835 C CB    . GLN C 3 313 ? 9.689   35.270 19.445  1.00 15.57  ? 608  GLN A CB    1 
ATOM   2836 C CG    . GLN C 3 313 ? 8.313   35.821 19.700  1.00 15.80  ? 608  GLN A CG    1 
ATOM   2837 C CD    . GLN C 3 313 ? 7.705   36.265 18.394  1.00 16.62  ? 608  GLN A CD    1 
ATOM   2838 O OE1   . GLN C 3 313 ? 8.389   36.233 17.347  1.00 17.04  ? 608  GLN A OE1   1 
ATOM   2839 N NE2   . GLN C 3 313 ? 6.422   36.641 18.445  1.00 14.14  ? 608  GLN A NE2   1 
ATOM   2840 N N     . ALA C 3 314 ? 10.348  32.319 21.117  1.00 16.89  ? 609  ALA A N     1 
ATOM   2841 C CA    . ALA C 3 314 ? 9.723   31.012 21.456  1.00 16.96  ? 609  ALA A CA    1 
ATOM   2842 C C     . ALA C 3 314 ? 10.585  30.234 22.441  1.00 17.44  ? 609  ALA A C     1 
ATOM   2843 O O     . ALA C 3 314 ? 10.736  28.993 22.245  1.00 16.99  ? 609  ALA A O     1 
ATOM   2844 C CB    . ALA C 3 314 ? 9.507   30.206 20.200  1.00 16.88  ? 609  ALA A CB    1 
ATOM   2845 N N     . LEU C 3 315 ? 11.102  30.896 23.481  1.00 17.32  ? 610  LEU A N     1 
ATOM   2846 C CA    . LEU C 3 315 ? 12.030  30.230 24.439  1.00 17.14  ? 610  LEU A CA    1 
ATOM   2847 C C     . LEU C 3 315 ? 11.495  30.362 25.865  1.00 15.92  ? 610  LEU A C     1 
ATOM   2848 O O     . LEU C 3 315 ? 11.381  29.343 26.520  1.00 15.94  ? 610  LEU A O     1 
ATOM   2849 C CB    . LEU C 3 315 ? 13.441  30.821 24.356  1.00 18.70  ? 610  LEU A CB    1 
ATOM   2850 C CG    . LEU C 3 315 ? 14.516  30.047 25.132  1.00 22.30  ? 610  LEU A CG    1 
ATOM   2851 C CD1   . LEU C 3 315 ? 15.863  30.106 24.429  1.00 24.15  ? 610  LEU A CD1   1 
ATOM   2852 C CD2   . LEU C 3 315 ? 14.678  30.582 26.543  1.00 23.56  ? 610  LEU A CD2   1 
ATOM   2853 N N     . THR C 3 316 ? 11.260  31.557 26.382  1.00 15.27  ? 611  THR A N     1 
ATOM   2854 C CA    . THR C 3 316 ? 11.014  31.695 27.841  1.00 16.73  ? 611  THR A CA    1 
ATOM   2855 C C     . THR C 3 316 ? 9.685   31.027 28.225  1.00 16.44  ? 611  THR A C     1 
ATOM   2856 O O     . THR C 3 316 ? 8.745   30.983 27.414  1.00 17.76  ? 611  THR A O     1 
ATOM   2857 C CB    . THR C 3 316 ? 11.072  33.154 28.296  1.00 17.11  ? 611  THR A CB    1 
ATOM   2858 O OG1   . THR C 3 316 ? 9.823   33.761 27.980  1.00 15.05  ? 611  THR A OG1   1 
ATOM   2859 C CG2   . THR C 3 316 ? 12.231  33.874 27.653  1.00 17.71  ? 611  THR A CG2   1 
ATOM   2860 N N     . GLN C 3 317 ? 9.627   30.479 29.418  1.00 16.96  ? 612  GLN A N     1 
ATOM   2861 C CA    . GLN C 3 317 ? 8.426   29.789 29.947  1.00 17.08  ? 612  GLN A CA    1 
ATOM   2862 C C     . GLN C 3 317 ? 7.340   30.817 30.315  1.00 16.68  ? 612  GLN A C     1 
ATOM   2863 O O     . GLN C 3 317 ? 6.212   30.411 30.572  1.00 16.62  ? 612  GLN A O     1 
ATOM   2864 C CB    . GLN C 3 317 ? 8.828   28.910 31.129  1.00 17.27  ? 612  GLN A CB    1 
ATOM   2865 C CG    . GLN C 3 317 ? 9.894   27.866 30.785  1.00 17.59  ? 612  GLN A CG    1 
ATOM   2866 C CD    . GLN C 3 317 ? 9.356   26.943 29.723  1.00 20.82  ? 612  GLN A CD    1 
ATOM   2867 O OE1   . GLN C 3 317 ? 8.314   26.304 29.920  1.00 22.65  ? 612  GLN A OE1   1 
ATOM   2868 N NE2   . GLN C 3 317 ? 10.002  26.936 28.558  1.00 19.21  ? 612  GLN A NE2   1 
ATOM   2869 N N     . THR C 3 318 ? 7.622   32.111 30.296  1.00 17.74  ? 613  THR A N     1 
ATOM   2870 C CA    . THR C 3 318 ? 6.655   33.135 30.767  1.00 17.75  ? 613  THR A CA    1 
ATOM   2871 C C     . THR C 3 318 ? 6.079   33.982 29.624  1.00 18.08  ? 613  THR A C     1 
ATOM   2872 O O     . THR C 3 318 ? 5.152   34.737 29.933  1.00 18.48  ? 613  THR A O     1 
ATOM   2873 C CB    . THR C 3 318 ? 7.320   34.037 31.805  1.00 18.52  ? 613  THR A CB    1 
ATOM   2874 O OG1   . THR C 3 318 ? 8.545   34.534 31.270  1.00 18.88  ? 613  THR A OG1   1 
ATOM   2875 C CG2   . THR C 3 318 ? 7.592   33.292 33.089  1.00 18.81  ? 613  THR A CG2   1 
ATOM   2876 N N     . GLY C 3 319 ? 6.622   33.918 28.394  1.00 16.47  ? 614  GLY A N     1 
ATOM   2877 C CA    . GLY C 3 319 ? 6.177   34.753 27.259  1.00 14.51  ? 614  GLY A CA    1 
ATOM   2878 C C     . GLY C 3 319 ? 7.096   35.942 27.015  1.00 14.22  ? 614  GLY A C     1 
ATOM   2879 O O     . GLY C 3 319 ? 6.844   36.707 26.074  1.00 14.15  ? 614  GLY A O     1 
ATOM   2880 N N     . ARG C 3 320 ? 8.114   36.134 27.849  1.00 14.05  ? 615  ARG A N     1 
ATOM   2881 C CA    . ARG C 3 320 ? 9.184   37.111 27.585  1.00 14.63  ? 615  ARG A CA    1 
ATOM   2882 C C     . ARG C 3 320 ? 9.969   36.701 26.337  1.00 14.65  ? 615  ARG A C     1 
ATOM   2883 O O     . ARG C 3 320 ? 10.008  35.492 25.944  1.00 13.31  ? 615  ARG A O     1 
ATOM   2884 C CB    . ARG C 3 320 ? 10.167  37.214 28.755  1.00 16.30  ? 615  ARG A CB    1 
ATOM   2885 C CG    . ARG C 3 320 ? 9.665   38.032 29.928  1.00 16.59  ? 615  ARG A CG    1 
ATOM   2886 C CD    . ARG C 3 320 ? 10.792  38.260 30.888  1.00 17.15  ? 615  ARG A CD    1 
ATOM   2887 N NE    . ARG C 3 320 ? 10.415  39.166 31.965  1.00 18.40  ? 615  ARG A NE    1 
ATOM   2888 C CZ    . ARG C 3 320 ? 11.289  39.619 32.863  1.00 19.81  ? 615  ARG A CZ    1 
ATOM   2889 N NH1   . ARG C 3 320 ? 12.558  39.236 32.808  1.00 20.05  ? 615  ARG A NH1   1 
ATOM   2890 N NH2   . ARG C 3 320 ? 10.899  40.431 33.819  1.00 19.30  ? 615  ARG A NH2   1 
ATOM   2891 N N     . LEU C 3 321 ? 10.555  37.704 25.717  1.00 15.49  ? 616  LEU A N     1 
ATOM   2892 C CA    . LEU C 3 321 ? 11.662  37.520 24.752  1.00 16.73  ? 616  LEU A CA    1 
ATOM   2893 C C     . LEU C 3 321 ? 12.933  37.144 25.512  1.00 16.94  ? 616  LEU A C     1 
ATOM   2894 O O     . LEU C 3 321 ? 13.042  37.485 26.704  1.00 18.43  ? 616  LEU A O     1 
ATOM   2895 C CB    . LEU C 3 321 ? 11.881  38.847 24.021  1.00 16.36  ? 616  LEU A CB    1 
ATOM   2896 C CG    . LEU C 3 321 ? 10.629  39.433 23.399  1.00 16.69  ? 616  LEU A CG    1 
ATOM   2897 C CD1   . LEU C 3 321 ? 10.999  40.696 22.633  1.00 17.74  ? 616  LEU A CD1   1 
ATOM   2898 C CD2   . LEU C 3 321 ? 9.940   38.413 22.485  1.00 16.79  ? 616  LEU A CD2   1 
ATOM   2899 N N     . SER C 3 322 ? 13.864  36.508 24.817  1.00 17.62  ? 617  SER A N     1 
ATOM   2900 C CA    . SER C 3 322 ? 15.305  36.527 25.137  1.00 18.23  ? 617  SER A CA    1 
ATOM   2901 C C     . SER C 3 322 ? 16.041  37.123 23.938  1.00 18.33  ? 617  SER A C     1 
ATOM   2902 O O     . SER C 3 322 ? 15.438  37.280 22.900  1.00 17.90  ? 617  SER A O     1 
ATOM   2903 C CB    . SER C 3 322 ? 15.806  35.163 25.512  1.00 18.53  ? 617  SER A CB    1 
ATOM   2904 O OG    . SER C 3 322 ? 15.980  34.330 24.375  1.00 20.08  ? 617  SER A OG    1 
ATOM   2905 N N     . SER C 3 323 ? 17.314  37.424 24.116  1.00 18.26  ? 618  SER A N     1 
ATOM   2906 C CA    . SER C 3 323 ? 18.162  38.194 23.192  1.00 18.86  ? 618  SER A CA    1 
ATOM   2907 C C     . SER C 3 323 ? 19.529  37.514 23.210  1.00 18.64  ? 618  SER A C     1 
ATOM   2908 O O     . SER C 3 323 ? 20.007  37.223 24.332  1.00 17.30  ? 618  SER A O     1 
ATOM   2909 C CB    . SER C 3 323 ? 18.208  39.647 23.640  1.00 19.94  ? 618  SER A CB    1 
ATOM   2910 O OG    . SER C 3 323 ? 19.169  40.415 22.929  1.00 21.33  ? 618  SER A OG    1 
ATOM   2911 N N     . THR C 3 324 ? 20.093  37.218 22.036  1.00 17.47  ? 619  THR A N     1 
ATOM   2912 C CA    . THR C 3 324 ? 21.397  36.526 21.909  1.00 19.09  ? 619  THR A CA    1 
ATOM   2913 C C     . THR C 3 324 ? 22.276  37.239 20.883  1.00 19.92  ? 619  THR A C     1 
ATOM   2914 O O     . THR C 3 324 ? 21.716  37.886 19.961  1.00 18.84  ? 619  THR A O     1 
ATOM   2915 C CB    . THR C 3 324 ? 21.225  35.053 21.527  1.00 20.07  ? 619  THR A CB    1 
ATOM   2916 O OG1   . THR C 3 324 ? 20.509  34.946 20.306  1.00 21.52  ? 619  THR A OG1   1 
ATOM   2917 C CG2   . THR C 3 324 ? 20.457  34.256 22.555  1.00 22.17  ? 619  THR A CG2   1 
ATOM   2918 N N     . GLU C 3 325 ? 23.596  37.145 21.086  1.00 20.79  ? 620  GLU A N     1 
ATOM   2919 C CA    . GLU C 3 325 ? 24.636  37.250 20.043  1.00 23.63  ? 620  GLU A CA    1 
ATOM   2920 C C     . GLU C 3 325 ? 24.523  38.610 19.351  1.00 21.68  ? 620  GLU A C     1 
ATOM   2921 O O     . GLU C 3 325 ? 24.401  38.694 18.138  1.00 23.88  ? 620  GLU A O     1 
ATOM   2922 C CB    . GLU C 3 325 ? 24.472  36.053 19.098  1.00 28.81  ? 620  GLU A CB    1 
ATOM   2923 C CG    . GLU C 3 325 ? 25.750  35.257 18.901  1.00 37.32  ? 620  GLU A CG    1 
ATOM   2924 C CD    . GLU C 3 325 ? 25.712  34.345 17.680  1.00 41.90  ? 620  GLU A CD    1 
ATOM   2925 O OE1   . GLU C 3 325 ? 26.463  34.642 16.702  1.00 36.14  ? 620  GLU A OE1   1 
ATOM   2926 O OE2   . GLU C 3 325 ? 24.922  33.347 17.701  1.00 41.64  ? 620  GLU A OE2   1 
ATOM   2927 N N     . PRO C 3 326 ? 24.590  39.735 20.082  1.00 19.24  ? 621  PRO A N     1 
ATOM   2928 C CA    . PRO C 3 326 ? 24.742  39.746 21.536  1.00 17.75  ? 621  PRO A CA    1 
ATOM   2929 C C     . PRO C 3 326 ? 23.418  39.847 22.314  1.00 17.09  ? 621  PRO A C     1 
ATOM   2930 O O     . PRO C 3 326 ? 22.423  40.269 21.783  1.00 14.11  ? 621  PRO A O     1 
ATOM   2931 C CB    . PRO C 3 326 ? 25.508  41.058 21.720  1.00 18.00  ? 621  PRO A CB    1 
ATOM   2932 C CG    . PRO C 3 326 ? 24.873  41.975 20.715  1.00 18.31  ? 621  PRO A CG    1 
ATOM   2933 C CD    . PRO C 3 326 ? 24.562  41.089 19.522  1.00 19.28  ? 621  PRO A CD    1 
ATOM   2934 N N     . ASN C 3 327 ? 23.452  39.470 23.585  1.00 18.11  ? 622  ASN A N     1 
ATOM   2935 C CA    . ASN C 3 327 ? 22.365  39.784 24.533  1.00 18.15  ? 622  ASN A CA    1 
ATOM   2936 C C     . ASN C 3 327 ? 22.361  41.299 24.801  1.00 19.86  ? 622  ASN A C     1 
ATOM   2937 O O     . ASN C 3 327 ? 23.257  41.787 25.527  1.00 21.62  ? 622  ASN A O     1 
ATOM   2938 C CB    . ASN C 3 327 ? 22.511  38.942 25.790  1.00 18.03  ? 622  ASN A CB    1 
ATOM   2939 C CG    . ASN C 3 327 ? 21.336  39.142 26.726  1.00 18.59  ? 622  ASN A CG    1 
ATOM   2940 O OD1   . ASN C 3 327 ? 20.496  40.020 26.497  1.00 17.17  ? 622  ASN A OD1   1 
ATOM   2941 N ND2   . ASN C 3 327 ? 21.295  38.357 27.789  1.00 16.19  ? 622  ASN A ND2   1 
ATOM   2942 N N     . LEU C 3 328 ? 21.373  42.037 24.273  1.00 19.87  ? 623  LEU A N     1 
ATOM   2943 C CA    . LEU C 3 328 ? 21.256  43.499 24.523  1.00 18.56  ? 623  LEU A CA    1 
ATOM   2944 C C     . LEU C 3 328 ? 20.238  43.756 25.638  1.00 19.64  ? 623  LEU A C     1 
ATOM   2945 O O     . LEU C 3 328 ? 19.972  44.937 25.926  1.00 19.93  ? 623  LEU A O     1 
ATOM   2946 C CB    . LEU C 3 328 ? 20.941  44.221 23.213  1.00 19.82  ? 623  LEU A CB    1 
ATOM   2947 C CG    . LEU C 3 328 ? 22.037  44.100 22.136  1.00 20.60  ? 623  LEU A CG    1 
ATOM   2948 C CD1   . LEU C 3 328 ? 21.680  44.852 20.853  1.00 19.40  ? 623  LEU A CD1   1 
ATOM   2949 C CD2   . LEU C 3 328 ? 23.393  44.597 22.664  1.00 20.47  ? 623  LEU A CD2   1 
ATOM   2950 N N     . GLN C 3 329 ? 19.771  42.704 26.318  1.00 19.03  ? 624  GLN A N     1 
ATOM   2951 C CA    . GLN C 3 329 ? 18.827  42.825 27.462  1.00 20.16  ? 624  GLN A CA    1 
ATOM   2952 C C     . GLN C 3 329 ? 19.575  42.684 28.800  1.00 19.53  ? 624  GLN A C     1 
ATOM   2953 O O     . GLN C 3 329 ? 18.906  42.662 29.858  1.00 17.62  ? 624  GLN A O     1 
ATOM   2954 C CB    . GLN C 3 329 ? 17.714  41.772 27.394  1.00 18.91  ? 624  GLN A CB    1 
ATOM   2955 C CG    . GLN C 3 329 ? 16.830  41.887 26.168  1.00 19.49  ? 624  GLN A CG    1 
ATOM   2956 C CD    . GLN C 3 329 ? 15.758  40.833 26.198  1.00 19.19  ? 624  GLN A CD    1 
ATOM   2957 O OE1   . GLN C 3 329 ? 16.020  39.655 26.466  1.00 16.35  ? 624  GLN A OE1   1 
ATOM   2958 N NE2   . GLN C 3 329 ? 14.540  41.269 25.917  1.00 19.58  ? 624  GLN A NE2   1 
ATOM   2959 N N     . ASN C 3 330 ? 20.900  42.594 28.802  1.00 19.38  ? 625  ASN A N     1 
ATOM   2960 C CA    . ASN C 3 330 ? 21.617  42.582 30.109  1.00 20.49  ? 625  ASN A CA    1 
ATOM   2961 C C     . ASN C 3 330 ? 22.842  43.516 30.083  1.00 20.38  ? 625  ASN A C     1 
ATOM   2962 O O     . ASN C 3 330 ? 23.802  43.197 30.737  1.00 17.51  ? 625  ASN A O     1 
ATOM   2963 C CB    . ASN C 3 330 ? 21.948  41.158 30.545  1.00 19.59  ? 625  ASN A CB    1 
ATOM   2964 C CG    . ASN C 3 330 ? 23.077  40.568 29.731  1.00 21.72  ? 625  ASN A CG    1 
ATOM   2965 O OD1   . ASN C 3 330 ? 23.266  40.925 28.563  1.00 21.05  ? 625  ASN A OD1   1 
ATOM   2966 N ND2   . ASN C 3 330 ? 23.802  39.639 30.335  1.00 20.77  ? 625  ASN A ND2   1 
ATOM   2967 N N     . ILE C 3 331 ? 22.749  44.668 29.408  1.00 22.32  ? 626  ILE A N     1 
ATOM   2968 C CA    . ILE C 3 331 ? 23.802  45.711 29.401  1.00 20.99  ? 626  ILE A CA    1 
ATOM   2969 C C     . ILE C 3 331 ? 23.785  46.404 30.763  1.00 22.74  ? 626  ILE A C     1 
ATOM   2970 O O     . ILE C 3 331 ? 22.728  46.786 31.267  1.00 20.75  ? 626  ILE A O     1 
ATOM   2971 C CB    . ILE C 3 331 ? 23.597  46.668 28.223  1.00 23.23  ? 626  ILE A CB    1 
ATOM   2972 C CG1   . ILE C 3 331 ? 23.588  45.925 26.880  1.00 23.88  ? 626  ILE A CG1   1 
ATOM   2973 C CG2   . ILE C 3 331 ? 24.637  47.781 28.252  1.00 23.13  ? 626  ILE A CG2   1 
ATOM   2974 C CD1   . ILE C 3 331 ? 24.809  45.017 26.619  1.00 24.28  ? 626  ILE A CD1   1 
ATOM   2975 N N     . PRO C 3 332 ? 24.957  46.519 31.436  1.00 23.94  ? 627  PRO A N     1 
ATOM   2976 C CA    . PRO C 3 332 ? 25.040  47.085 32.781  1.00 23.57  ? 627  PRO A CA    1 
ATOM   2977 C C     . PRO C 3 332 ? 24.400  48.469 32.913  1.00 23.27  ? 627  PRO A C     1 
ATOM   2978 O O     . PRO C 3 332 ? 24.396  49.237 31.949  1.00 19.50  ? 627  PRO A O     1 
ATOM   2979 C CB    . PRO C 3 332 ? 26.551  47.199 33.032  1.00 23.90  ? 627  PRO A CB    1 
ATOM   2980 C CG    . PRO C 3 332 ? 27.142  46.107 32.209  1.00 24.26  ? 627  PRO A CG    1 
ATOM   2981 C CD    . PRO C 3 332 ? 26.257  46.001 30.983  1.00 24.11  ? 627  PRO A CD    1 
ATOM   2982 N N     . ILE C 3 333 ? 23.888  48.742 34.109  1.00 23.88  ? 628  ILE A N     1 
ATOM   2983 C CA    . ILE C 3 333 ? 23.220  50.031 34.435  1.00 27.20  ? 628  ILE A CA    1 
ATOM   2984 C C     . ILE C 3 333 ? 23.392  50.358 35.929  1.00 28.02  ? 628  ILE A C     1 
ATOM   2985 O O     . ILE C 3 333 ? 23.558  51.581 36.236  1.00 23.35  ? 628  ILE A O     1 
ATOM   2986 C CB    . ILE C 3 333 ? 21.746  50.023 33.966  1.00 28.82  ? 628  ILE A CB    1 
ATOM   2987 C CG1   . ILE C 3 333 ? 21.161  51.439 33.912  1.00 30.99  ? 628  ILE A CG1   1 
ATOM   2988 C CG2   . ILE C 3 333 ? 20.874  49.093 34.800  1.00 31.75  ? 628  ILE A CG2   1 
ATOM   2989 C CD1   . ILE C 3 333 ? 19.775  51.509 33.302  1.00 33.07  ? 628  ILE A CD1   1 
ATOM   2990 N N     . ARG C 3 334 ? 23.396  49.333 36.798  1.00 29.88  ? 629  ARG A N     1 
ATOM   2991 C CA    . ARG C 3 334 ? 23.317  49.470 38.279  1.00 37.25  ? 629  ARG A CA    1 
ATOM   2992 C C     . ARG C 3 334 ? 24.590  50.129 38.826  1.00 35.18  ? 629  ARG A C     1 
ATOM   2993 O O     . ARG C 3 334 ? 24.434  51.005 39.653  1.00 37.63  ? 629  ARG A O     1 
ATOM   2994 C CB    . ARG C 3 334 ? 23.077  48.120 38.969  1.00 41.33  ? 629  ARG A CB    1 
ATOM   2995 C CG    . ARG C 3 334 ? 21.606  47.826 39.226  1.00 50.95  ? 629  ARG A CG    1 
ATOM   2996 C CD    . ARG C 3 334 ? 21.281  46.342 39.208  1.00 58.42  ? 629  ARG A CD    1 
ATOM   2997 N NE    . ARG C 3 334 ? 19.930  46.143 38.700  1.00 65.21  ? 629  ARG A NE    1 
ATOM   2998 C CZ    . ARG C 3 334 ? 19.398  44.984 38.299  1.00 64.61  ? 629  ARG A CZ    1 
ATOM   2999 N NH1   . ARG C 3 334 ? 20.098  43.859 38.336  1.00 58.49  ? 629  ARG A NH1   1 
ATOM   3000 N NH2   . ARG C 3 334 ? 18.146  44.970 37.865  1.00 65.37  ? 629  ARG A NH2   1 
ATOM   3001 N N     . LEU C 3 335 ? 25.779  49.684 38.413  1.00 32.70  ? 630  LEU A N     1 
ATOM   3002 C CA    . LEU C 3 335 ? 27.089  50.245 38.854  1.00 37.45  ? 630  LEU A CA    1 
ATOM   3003 C C     . LEU C 3 335 ? 27.581  51.179 37.756  1.00 34.26  ? 630  LEU A C     1 
ATOM   3004 O O     . LEU C 3 335 ? 27.539  50.770 36.580  1.00 30.40  ? 630  LEU A O     1 
ATOM   3005 C CB    . LEU C 3 335 ? 28.103  49.129 39.138  1.00 36.25  ? 630  LEU A CB    1 
ATOM   3006 C CG    . LEU C 3 335 ? 27.602  48.071 40.121  1.00 42.72  ? 630  LEU A CG    1 
ATOM   3007 C CD1   . LEU C 3 335 ? 28.497  46.841 40.134  1.00 41.09  ? 630  LEU A CD1   1 
ATOM   3008 C CD2   . LEU C 3 335 ? 27.433  48.671 41.521  1.00 42.93  ? 630  LEU A CD2   1 
ATOM   3009 N N     . GLU C 3 336 ? 28.033  52.369 38.154  1.00 33.48  ? 631  GLU A N     1 
ATOM   3010 C CA    . GLU C 3 336 ? 28.324  53.494 37.238  1.00 34.46  ? 631  GLU A CA    1 
ATOM   3011 C C     . GLU C 3 336 ? 29.408  53.065 36.236  1.00 34.34  ? 631  GLU A C     1 
ATOM   3012 O O     . GLU C 3 336 ? 29.308  53.486 35.072  1.00 31.88  ? 631  GLU A O     1 
ATOM   3013 C CB    . GLU C 3 336 ? 28.657  54.742 38.054  1.00 34.04  ? 631  GLU A CB    1 
ATOM   3014 C CG    . GLU C 3 336 ? 28.980  55.965 37.207  1.00 39.68  ? 631  GLU A CG    1 
ATOM   3015 C CD    . GLU C 3 336 ? 27.942  56.404 36.172  1.00 44.51  ? 631  GLU A CD    1 
ATOM   3016 O OE1   . GLU C 3 336 ? 26.720  56.374 36.480  1.00 50.08  ? 631  GLU A OE1   1 
ATOM   3017 O OE2   . GLU C 3 336 ? 28.360  56.801 35.059  1.00 44.40  ? 631  GLU A OE2   1 
ATOM   3018 N N     . GLU C 3 337 ? 30.397  52.264 36.654  1.00 33.86  ? 632  GLU A N     1 
ATOM   3019 C CA    . GLU C 3 337 ? 31.517  51.839 35.779  1.00 37.04  ? 632  GLU A CA    1 
ATOM   3020 C C     . GLU C 3 337 ? 30.951  51.038 34.603  1.00 35.99  ? 632  GLU A C     1 
ATOM   3021 O O     . GLU C 3 337 ? 31.358  51.304 33.454  1.00 35.01  ? 632  GLU A O     1 
ATOM   3022 C CB    . GLU C 3 337 ? 32.537  51.000 36.541  1.00 42.55  ? 632  GLU A CB    1 
ATOM   3023 C CG    . GLU C 3 337 ? 33.327  51.790 37.557  1.00 48.94  ? 632  GLU A CG    1 
ATOM   3024 C CD    . GLU C 3 337 ? 32.908  51.527 38.993  1.00 56.33  ? 632  GLU A CD    1 
ATOM   3025 O OE1   . GLU C 3 337 ? 31.658  51.496 39.271  1.00 46.67  ? 632  GLU A OE1   1 
ATOM   3026 O OE2   . GLU C 3 337 ? 33.836  51.344 39.833  1.00 61.84  ? 632  GLU A OE2   1 
ATOM   3027 N N     . GLY C 3 338 ? 30.021  50.120 34.887  1.00 29.70  ? 633  GLY A N     1 
ATOM   3028 C CA    . GLY C 3 338 ? 29.364  49.293 33.859  1.00 29.50  ? 633  GLY A CA    1 
ATOM   3029 C C     . GLY C 3 338 ? 28.427  50.109 32.981  1.00 26.28  ? 633  GLY A C     1 
ATOM   3030 O O     . GLY C 3 338 ? 28.420  49.868 31.759  1.00 20.97  ? 633  GLY A O     1 
ATOM   3031 N N     . ARG C 3 339 ? 27.694  51.050 33.589  1.00 24.36  ? 634  ARG A N     1 
ATOM   3032 C CA    . ARG C 3 339 ? 26.651  51.860 32.923  1.00 26.34  ? 634  ARG A CA    1 
ATOM   3033 C C     . ARG C 3 339 ? 27.300  52.623 31.775  1.00 26.10  ? 634  ARG A C     1 
ATOM   3034 O O     . ARG C 3 339 ? 26.654  52.778 30.752  1.00 24.89  ? 634  ARG A O     1 
ATOM   3035 C CB    . ARG C 3 339 ? 25.981  52.823 33.910  1.00 29.59  ? 634  ARG A CB    1 
ATOM   3036 C CG    . ARG C 3 339 ? 24.784  53.579 33.340  1.00 32.36  ? 634  ARG A CG    1 
ATOM   3037 C CD    . ARG C 3 339 ? 24.212  54.582 34.338  1.00 36.36  ? 634  ARG A CD    1 
ATOM   3038 N NE    . ARG C 3 339 ? 22.879  55.007 33.926  1.00 42.55  ? 634  ARG A NE    1 
ATOM   3039 C CZ    . ARG C 3 339 ? 21.831  55.209 34.734  1.00 43.95  ? 634  ARG A CZ    1 
ATOM   3040 N NH1   . ARG C 3 339 ? 21.938  55.081 36.046  1.00 46.18  ? 634  ARG A NH1   1 
ATOM   3041 N NH2   . ARG C 3 339 ? 20.664  55.557 34.219  1.00 45.60  ? 634  ARG A NH2   1 
ATOM   3042 N N     . LYS C 3 340 ? 28.554  53.035 31.935  1.00 26.83  ? 635  LYS A N     1 
ATOM   3043 C CA    . LYS C 3 340 ? 29.290  53.787 30.893  1.00 31.46  ? 635  LYS A CA    1 
ATOM   3044 C C     . LYS C 3 340 ? 29.393  52.986 29.593  1.00 28.64  ? 635  LYS A C     1 
ATOM   3045 O O     . LYS C 3 340 ? 29.666  53.600 28.558  1.00 26.02  ? 635  LYS A O     1 
ATOM   3046 C CB    . LYS C 3 340 ? 30.674  54.189 31.401  1.00 37.17  ? 635  LYS A CB    1 
ATOM   3047 C CG    . LYS C 3 340 ? 30.660  55.358 32.383  1.00 40.13  ? 635  LYS A CG    1 
ATOM   3048 C CD    . LYS C 3 340 ? 31.770  56.352 32.118  1.00 45.68  ? 635  LYS A CD    1 
ATOM   3049 C CE    . LYS C 3 340 ? 32.419  56.869 33.387  1.00 49.37  ? 635  LYS A CE    1 
ATOM   3050 N NZ    . LYS C 3 340 ? 31.412  57.405 34.334  1.00 48.20  ? 635  LYS A NZ    1 
ATOM   3051 N N     . ILE C 3 341 ? 29.213  51.671 29.635  1.00 30.27  ? 636  ILE A N     1 
ATOM   3052 C CA    . ILE C 3 341 ? 29.157  50.825 28.403  1.00 30.90  ? 636  ILE A CA    1 
ATOM   3053 C C     . ILE C 3 341 ? 28.071  51.385 27.478  1.00 24.58  ? 636  ILE A C     1 
ATOM   3054 O O     . ILE C 3 341 ? 28.216  51.329 26.264  1.00 23.76  ? 636  ILE A O     1 
ATOM   3055 C CB    . ILE C 3 341 ? 28.877  49.353 28.755  1.00 34.88  ? 636  ILE A CB    1 
ATOM   3056 C CG1   . ILE C 3 341 ? 30.026  48.741 29.564  1.00 37.48  ? 636  ILE A CG1   1 
ATOM   3057 C CG2   . ILE C 3 341 ? 28.574  48.544 27.499  1.00 37.84  ? 636  ILE A CG2   1 
ATOM   3058 C CD1   . ILE C 3 341 ? 31.268  48.478 28.781  1.00 39.94  ? 636  ILE A CD1   1 
ATOM   3059 N N     . ARG C 3 342 ? 27.020  51.950 28.041  1.00 22.25  ? 637  ARG A N     1 
ATOM   3060 C CA    . ARG C 3 342 ? 25.877  52.379 27.216  1.00 23.18  ? 637  ARG A CA    1 
ATOM   3061 C C     . ARG C 3 342 ? 26.232  53.615 26.412  1.00 21.85  ? 637  ARG A C     1 
ATOM   3062 O O     . ARG C 3 342 ? 25.507  53.890 25.496  1.00 23.82  ? 637  ARG A O     1 
ATOM   3063 C CB    . ARG C 3 342 ? 24.662  52.603 28.095  1.00 24.35  ? 637  ARG A CB    1 
ATOM   3064 C CG    . ARG C 3 342 ? 24.082  51.299 28.603  1.00 24.02  ? 637  ARG A CG    1 
ATOM   3065 C CD    . ARG C 3 342 ? 23.168  51.583 29.760  1.00 23.11  ? 637  ARG A CD    1 
ATOM   3066 N NE    . ARG C 3 342 ? 22.559  50.331 30.161  1.00 24.82  ? 637  ARG A NE    1 
ATOM   3067 C CZ    . ARG C 3 342 ? 21.261  50.044 30.095  1.00 23.97  ? 637  ARG A CZ    1 
ATOM   3068 N NH1   . ARG C 3 342 ? 20.378  50.931 29.662  1.00 22.99  ? 637  ARG A NH1   1 
ATOM   3069 N NH2   . ARG C 3 342 ? 20.862  48.866 30.508  1.00 22.43  ? 637  ARG A NH2   1 
ATOM   3070 N N     . GLN C 3 343 ? 27.297  54.325 26.759  1.00 23.82  ? 638  GLN A N     1 
ATOM   3071 C CA    . GLN C 3 343 ? 27.816  55.471 25.971  1.00 26.71  ? 638  GLN A CA    1 
ATOM   3072 C C     . GLN C 3 343 ? 28.207  55.012 24.556  1.00 25.69  ? 638  GLN A C     1 
ATOM   3073 O O     . GLN C 3 343 ? 28.285  55.859 23.667  1.00 23.90  ? 638  GLN A O     1 
ATOM   3074 C CB    . GLN C 3 343 ? 29.014  56.097 26.683  1.00 28.02  ? 638  GLN A CB    1 
ATOM   3075 C CG    . GLN C 3 343 ? 28.603  56.948 27.860  1.00 30.17  ? 638  GLN A CG    1 
ATOM   3076 C CD    . GLN C 3 343 ? 29.771  57.464 28.662  1.00 31.98  ? 638  GLN A CD    1 
ATOM   3077 O OE1   . GLN C 3 343 ? 30.907  57.033 28.512  1.00 35.80  ? 638  GLN A OE1   1 
ATOM   3078 N NE2   . GLN C 3 343 ? 29.477  58.392 29.548  1.00 37.68  ? 638  GLN A NE2   1 
ATOM   3079 N N     . ALA C 3 344 ? 28.434  53.712 24.369  1.00 26.12  ? 639  ALA A N     1 
ATOM   3080 C CA    . ALA C 3 344 ? 28.947  53.125 23.111  1.00 26.24  ? 639  ALA A CA    1 
ATOM   3081 C C     . ALA C 3 344 ? 27.798  52.728 22.182  1.00 22.82  ? 639  ALA A C     1 
ATOM   3082 O O     . ALA C 3 344 ? 28.113  52.353 21.054  1.00 22.29  ? 639  ALA A O     1 
ATOM   3083 C CB    . ALA C 3 344 ? 29.790  51.918 23.442  1.00 27.09  ? 639  ALA A CB    1 
ATOM   3084 N N     . PHE C 3 345 ? 26.543  52.747 22.657  1.00 19.85  ? 640  PHE A N     1 
ATOM   3085 C CA    . PHE C 3 345 ? 25.330  52.488 21.835  1.00 18.73  ? 640  PHE A CA    1 
ATOM   3086 C C     . PHE C 3 345 ? 24.778  53.837 21.379  1.00 17.79  ? 640  PHE A C     1 
ATOM   3087 O O     . PHE C 3 345 ? 24.420  54.671 22.226  1.00 18.55  ? 640  PHE A O     1 
ATOM   3088 C CB    . PHE C 3 345 ? 24.308  51.654 22.613  1.00 18.79  ? 640  PHE A CB    1 
ATOM   3089 C CG    . PHE C 3 345 ? 24.786  50.254 22.894  1.00 19.83  ? 640  PHE A CG    1 
ATOM   3090 C CD1   . PHE C 3 345 ? 25.552  49.963 24.014  1.00 21.38  ? 640  PHE A CD1   1 
ATOM   3091 C CD2   . PHE C 3 345 ? 24.538  49.233 21.998  1.00 20.81  ? 640  PHE A CD2   1 
ATOM   3092 C CE1   . PHE C 3 345 ? 26.005  48.671 24.254  1.00 21.85  ? 640  PHE A CE1   1 
ATOM   3093 C CE2   . PHE C 3 345 ? 25.005  47.947 22.225  1.00 20.55  ? 640  PHE A CE2   1 
ATOM   3094 C CZ    . PHE C 3 345 ? 25.722  47.665 23.363  1.00 21.98  ? 640  PHE A CZ    1 
ATOM   3095 N N     . VAL C 3 346 ? 24.806  54.090 20.079  1.00 17.53  ? 641  VAL A N     1 
ATOM   3096 C CA    . VAL C 3 346 ? 24.605  55.463 19.534  1.00 17.80  ? 641  VAL A CA    1 
ATOM   3097 C C     . VAL C 3 346 ? 23.526  55.380 18.468  1.00 17.68  ? 641  VAL A C     1 
ATOM   3098 O O     . VAL C 3 346 ? 23.210  54.292 18.008  1.00 18.17  ? 641  VAL A O     1 
ATOM   3099 C CB    . VAL C 3 346 ? 25.938  56.077 19.036  1.00 17.47  ? 641  VAL A CB    1 
ATOM   3100 C CG1   . VAL C 3 346 ? 27.004  56.028 20.134  1.00 17.78  ? 641  VAL A CG1   1 
ATOM   3101 C CG2   . VAL C 3 346 ? 26.475  55.467 17.742  1.00 18.02  ? 641  VAL A CG2   1 
ATOM   3102 N N     . PRO C 3 347 ? 22.911  56.514 18.080  1.00 19.44  ? 642  PRO A N     1 
ATOM   3103 C CA    . PRO C 3 347 ? 21.999  56.558 16.934  1.00 19.60  ? 642  PRO A CA    1 
ATOM   3104 C C     . PRO C 3 347 ? 22.713  56.153 15.634  1.00 20.72  ? 642  PRO A C     1 
ATOM   3105 O O     . PRO C 3 347 ? 23.874  56.460 15.483  1.00 20.66  ? 642  PRO A O     1 
ATOM   3106 C CB    . PRO C 3 347 ? 21.596  58.034 16.835  1.00 18.35  ? 642  PRO A CB    1 
ATOM   3107 C CG    . PRO C 3 347 ? 21.911  58.614 18.191  1.00 19.52  ? 642  PRO A CG    1 
ATOM   3108 C CD    . PRO C 3 347 ? 23.109  57.838 18.690  1.00 19.62  ? 642  PRO A CD    1 
ATOM   3109 N N     . SER C 3 348 ? 22.018  55.469 14.735  1.00 20.71  ? 643  SER A N     1 
ATOM   3110 C CA    . SER C 3 348 ? 22.608  54.934 13.484  1.00 21.53  ? 643  SER A CA    1 
ATOM   3111 C C     . SER C 3 348 ? 22.752  56.043 12.424  1.00 23.62  ? 643  SER A C     1 
ATOM   3112 O O     . SER C 3 348 ? 23.355  55.772 11.388  1.00 22.68  ? 643  SER A O     1 
ATOM   3113 C CB    . SER C 3 348 ? 21.791  53.792 12.974  1.00 20.54  ? 643  SER A CB    1 
ATOM   3114 O OG    . SER C 3 348 ? 20.511  54.249 12.589  1.00 18.37  ? 643  SER A OG    1 
ATOM   3115 N N     . GLU C 3 349 ? 22.251  57.254 12.669  1.00 26.11  ? 644  GLU A N     1 
ATOM   3116 C CA    . GLU C 3 349 ? 22.327  58.355 11.675  1.00 28.68  ? 644  GLU A CA    1 
ATOM   3117 C C     . GLU C 3 349 ? 22.629  59.650 12.407  1.00 29.95  ? 644  GLU A C     1 
ATOM   3118 O O     . GLU C 3 349 ? 22.426  59.732 13.629  1.00 31.08  ? 644  GLU A O     1 
ATOM   3119 C CB    . GLU C 3 349 ? 21.028  58.449 10.865  1.00 35.83  ? 644  GLU A CB    1 
ATOM   3120 C CG    . GLU C 3 349 ? 20.933  57.397 9.771   1.00 41.52  ? 644  GLU A CG    1 
ATOM   3121 C CD    . GLU C 3 349 ? 19.764  57.597 8.824   1.00 52.05  ? 644  GLU A CD    1 
ATOM   3122 O OE1   . GLU C 3 349 ? 19.685  58.683 8.178   1.00 55.20  ? 644  GLU A OE1   1 
ATOM   3123 O OE2   . GLU C 3 349 ? 18.918  56.680 8.745   1.00 52.67  ? 644  GLU A OE2   1 
ATOM   3124 N N     . SER C 3 350 ? 23.169  60.611 11.681  1.00 32.47  ? 645  SER A N     1 
ATOM   3125 C CA    . SER C 3 350 ? 23.570  61.922 12.232  1.00 31.14  ? 645  SER A CA    1 
ATOM   3126 C C     . SER C 3 350 ? 22.318  62.692 12.652  1.00 26.10  ? 645  SER A C     1 
ATOM   3127 O O     . SER C 3 350 ? 21.309  62.655 11.909  1.00 26.32  ? 645  SER A O     1 
ATOM   3128 C CB    . SER C 3 350 ? 24.387  62.684 11.218  1.00 33.69  ? 645  SER A CB    1 
ATOM   3129 O OG    . SER C 3 350 ? 25.638  62.041 11.054  1.00 42.04  ? 645  SER A OG    1 
ATOM   3130 N N     . ASP C 3 351 ? 22.386  63.372 13.791  1.00 24.01  ? 646  ASP A N     1 
ATOM   3131 C CA    . ASP C 3 351 ? 21.271  64.219 14.282  1.00 26.45  ? 646  ASP A CA    1 
ATOM   3132 C C     . ASP C 3 351 ? 20.073  63.337 14.687  1.00 23.59  ? 646  ASP A C     1 
ATOM   3133 O O     . ASP C 3 351 ? 18.941  63.847 14.701  1.00 23.88  ? 646  ASP A O     1 
ATOM   3134 C CB    . ASP C 3 351 ? 20.901  65.277 13.227  1.00 29.76  ? 646  ASP A CB    1 
ATOM   3135 C CG    . ASP C 3 351 ? 22.081  66.173 12.855  1.00 35.89  ? 646  ASP A CG    1 
ATOM   3136 O OD1   . ASP C 3 351 ? 22.784  66.648 13.789  1.00 33.32  ? 646  ASP A OD1   1 
ATOM   3137 O OD2   . ASP C 3 351 ? 22.323  66.347 11.629  1.00 39.68  ? 646  ASP A OD2   1 
ATOM   3138 N N     . TRP C 3 352 ? 20.294  62.059 14.967  1.00 20.86  ? 647  TRP A N     1 
ATOM   3139 C CA    . TRP C 3 352 ? 19.278  61.194 15.609  1.00 18.99  ? 647  TRP A CA    1 
ATOM   3140 C C     . TRP C 3 352 ? 19.601  61.087 17.093  1.00 17.79  ? 647  TRP A C     1 
ATOM   3141 O O     . TRP C 3 352 ? 20.729  61.379 17.487  1.00 17.36  ? 647  TRP A O     1 
ATOM   3142 C CB    . TRP C 3 352 ? 19.177  59.831 14.937  1.00 18.05  ? 647  TRP A CB    1 
ATOM   3143 C CG    . TRP C 3 352 ? 18.482  59.876 13.616  1.00 18.34  ? 647  TRP A CG    1 
ATOM   3144 C CD1   . TRP C 3 352 ? 18.559  60.870 12.679  1.00 19.52  ? 647  TRP A CD1   1 
ATOM   3145 C CD2   . TRP C 3 352 ? 17.608  58.877 13.072  1.00 17.88  ? 647  TRP A CD2   1 
ATOM   3146 N NE1   . TRP C 3 352 ? 17.808  60.540 11.586  1.00 18.19  ? 647  TRP A NE1   1 
ATOM   3147 C CE2   . TRP C 3 352 ? 17.202  59.336 11.804  1.00 18.07  ? 647  TRP A CE2   1 
ATOM   3148 C CE3   . TRP C 3 352 ? 17.118  57.651 13.537  1.00 17.51  ? 647  TRP A CE3   1 
ATOM   3149 C CZ2   . TRP C 3 352 ? 16.350  58.600 10.987  1.00 19.52  ? 647  TRP A CZ2   1 
ATOM   3150 C CZ3   . TRP C 3 352 ? 16.271  56.924 12.734  1.00 18.54  ? 647  TRP A CZ3   1 
ATOM   3151 C CH2   . TRP C 3 352 ? 15.886  57.394 11.477  1.00 20.40  ? 647  TRP A CH2   1 
ATOM   3152 N N     . LEU C 3 353 ? 18.611  60.709 17.887  1.00 17.50  ? 648  LEU A N     1 
ATOM   3153 C CA    . LEU C 3 353 ? 18.777  60.522 19.338  1.00 16.94  ? 648  LEU A CA    1 
ATOM   3154 C C     . LEU C 3 353 ? 18.141  59.180 19.702  1.00 17.50  ? 648  LEU A C     1 
ATOM   3155 O O     . LEU C 3 353 ? 17.289  58.678 18.918  1.00 17.57  ? 648  LEU A O     1 
ATOM   3156 C CB    . LEU C 3 353 ? 18.105  61.705 20.051  1.00 17.98  ? 648  LEU A CB    1 
ATOM   3157 C CG    . LEU C 3 353 ? 18.705  63.086 19.758  1.00 19.53  ? 648  LEU A CG    1 
ATOM   3158 C CD1   . LEU C 3 353 ? 17.919  64.193 20.441  1.00 19.58  ? 648  LEU A CD1   1 
ATOM   3159 C CD2   . LEU C 3 353 ? 20.158  63.174 20.212  1.00 20.15  ? 648  LEU A CD2   1 
ATOM   3160 N N     . ILE C 3 354 ? 18.589  58.629 20.828  1.00 16.94  ? 649  ILE A N     1 
ATOM   3161 C CA    . ILE C 3 354 ? 18.075  57.412 21.493  1.00 16.65  ? 649  ILE A CA    1 
ATOM   3162 C C     . ILE C 3 354 ? 16.938  57.848 22.405  1.00 17.06  ? 649  ILE A C     1 
ATOM   3163 O O     . ILE C 3 354 ? 17.122  58.797 23.170  1.00 16.02  ? 649  ILE A O     1 
ATOM   3164 C CB    . ILE C 3 354 ? 19.201  56.729 22.275  1.00 17.96  ? 649  ILE A CB    1 
ATOM   3165 C CG1   . ILE C 3 354 ? 20.382  56.404 21.357  1.00 18.35  ? 649  ILE A CG1   1 
ATOM   3166 C CG2   . ILE C 3 354 ? 18.698  55.507 23.027  1.00 18.98  ? 649  ILE A CG2   1 
ATOM   3167 C CD1   . ILE C 3 354 ? 20.030  55.524 20.204  1.00 17.86  ? 649  ILE A CD1   1 
ATOM   3168 N N     . PHE C 3 355 ? 15.790  57.195 22.255  1.00 17.77  ? 650  PHE A N     1 
ATOM   3169 C CA    . PHE C 3 355 ? 14.568  57.414 23.065  1.00 17.52  ? 650  PHE A CA    1 
ATOM   3170 C C     . PHE C 3 355 ? 14.260  56.119 23.826  1.00 16.94  ? 650  PHE A C     1 
ATOM   3171 O O     . PHE C 3 355 ? 13.989  55.143 23.144  1.00 20.81  ? 650  PHE A O     1 
ATOM   3172 C CB    . PHE C 3 355 ? 13.409  57.827 22.154  1.00 16.48  ? 650  PHE A CB    1 
ATOM   3173 C CG    . PHE C 3 355 ? 12.205  58.274 22.933  1.00 16.55  ? 650  PHE A CG    1 
ATOM   3174 C CD1   . PHE C 3 355 ? 11.315  57.353 23.448  1.00 16.90  ? 650  PHE A CD1   1 
ATOM   3175 C CD2   . PHE C 3 355 ? 12.014  59.605 23.221  1.00 17.45  ? 650  PHE A CD2   1 
ATOM   3176 C CE1   . PHE C 3 355 ? 10.221  57.765 24.189  1.00 18.01  ? 650  PHE A CE1   1 
ATOM   3177 C CE2   . PHE C 3 355 ? 10.938  60.017 23.990  1.00 18.23  ? 650  PHE A CE2   1 
ATOM   3178 C CZ    . PHE C 3 355 ? 10.043  59.096 24.475  1.00 18.32  ? 650  PHE A CZ    1 
ATOM   3179 N N     . ALA C 3 356 ? 14.255  56.144 25.158  1.00 16.38  ? 651  ALA A N     1 
ATOM   3180 C CA    . ALA C 3 356 ? 13.995  55.006 26.074  1.00 17.62  ? 651  ALA A CA    1 
ATOM   3181 C C     . ALA C 3 356 ? 12.714  55.279 26.874  1.00 18.12  ? 651  ALA A C     1 
ATOM   3182 O O     . ALA C 3 356 ? 12.673  56.267 27.624  1.00 18.04  ? 651  ALA A O     1 
ATOM   3183 C CB    . ALA C 3 356 ? 15.176  54.778 27.000  1.00 16.71  ? 651  ALA A CB    1 
ATOM   3184 N N     . ALA C 3 357 ? 11.712  54.409 26.761  1.00 17.95  ? 652  ALA A N     1 
ATOM   3185 C CA    . ALA C 3 357 ? 10.504  54.467 27.608  1.00 18.51  ? 652  ALA A CA    1 
ATOM   3186 C C     . ALA C 3 357 ? 10.346  53.135 28.355  1.00 18.63  ? 652  ALA A C     1 
ATOM   3187 O O     . ALA C 3 357 ? 10.420  52.062 27.719  1.00 17.48  ? 652  ALA A O     1 
ATOM   3188 C CB    . ALA C 3 357 ? 9.294   54.802 26.777  1.00 18.65  ? 652  ALA A CB    1 
ATOM   3189 N N     . ASP C 3 358 ? 10.080  53.217 29.660  1.00 18.65  ? 653  ASP A N     1 
ATOM   3190 C CA    . ASP C 3 358 ? 9.980   52.044 30.559  1.00 18.73  ? 653  ASP A CA    1 
ATOM   3191 C C     . ASP C 3 358 ? 8.715   52.175 31.402  1.00 17.72  ? 653  ASP A C     1 
ATOM   3192 O O     . ASP C 3 358 ? 8.425   53.276 31.906  1.00 17.24  ? 653  ASP A O     1 
ATOM   3193 C CB    . ASP C 3 358 ? 11.209  51.907 31.463  1.00 20.15  ? 653  ASP A CB    1 
ATOM   3194 C CG    . ASP C 3 358 ? 11.297  53.019 32.495  1.00 23.02  ? 653  ASP A CG    1 
ATOM   3195 O OD1   . ASP C 3 358 ? 11.572  54.176 32.079  1.00 23.22  ? 653  ASP A OD1   1 
ATOM   3196 O OD2   . ASP C 3 358 ? 11.059  52.727 33.694  1.00 23.39  ? 653  ASP A OD2   1 
ATOM   3197 N N     . TYR C 3 359 ? 8.026   51.055 31.601  1.00 15.67  ? 654  TYR A N     1 
ATOM   3198 C CA    . TYR C 3 359 ? 6.900   50.957 32.543  1.00 14.68  ? 654  TYR A CA    1 
ATOM   3199 C C     . TYR C 3 359 ? 7.446   51.048 33.964  1.00 14.75  ? 654  TYR A C     1 
ATOM   3200 O O     . TYR C 3 359 ? 8.453   50.381 34.280  1.00 13.49  ? 654  TYR A O     1 
ATOM   3201 C CB    . TYR C 3 359 ? 6.142   49.644 32.381  1.00 14.30  ? 654  TYR A CB    1 
ATOM   3202 C CG    . TYR C 3 359 ? 5.340   49.529 31.118  1.00 13.63  ? 654  TYR A CG    1 
ATOM   3203 C CD1   . TYR C 3 359 ? 4.114   50.167 31.010  1.00 13.66  ? 654  TYR A CD1   1 
ATOM   3204 C CD2   . TYR C 3 359 ? 5.758   48.730 30.065  1.00 13.11  ? 654  TYR A CD2   1 
ATOM   3205 C CE1   . TYR C 3 359 ? 3.324   50.030 29.880  1.00 13.96  ? 654  TYR A CE1   1 
ATOM   3206 C CE2   . TYR C 3 359 ? 4.986   48.603 28.915  1.00 13.47  ? 654  TYR A CE2   1 
ATOM   3207 C CZ    . TYR C 3 359 ? 3.758   49.235 28.828  1.00 13.57  ? 654  TYR A CZ    1 
ATOM   3208 O OH    . TYR C 3 359 ? 2.976   49.136 27.711  1.00 13.17  ? 654  TYR A OH    1 
ATOM   3209 N N     . SER C 3 360 ? 6.740   51.829 34.781  1.00 14.90  ? 655  SER A N     1 
ATOM   3210 C CA    . SER C 3 360 ? 6.967   51.963 36.232  1.00 16.15  ? 655  SER A CA    1 
ATOM   3211 C C     . SER C 3 360 ? 6.217   50.857 36.965  1.00 15.01  ? 655  SER A C     1 
ATOM   3212 O O     . SER C 3 360 ? 4.987   50.902 36.978  1.00 14.37  ? 655  SER A O     1 
ATOM   3213 C CB    . SER C 3 360 ? 6.550   53.329 36.734  1.00 16.67  ? 655  SER A CB    1 
ATOM   3214 O OG    . SER C 3 360 ? 6.755   53.402 38.137  1.00 18.86  ? 655  SER A OG    1 
ATOM   3215 N N     . GLN C 3 361 ? 6.967   49.951 37.594  1.00 15.63  ? 656  GLN A N     1 
ATOM   3216 C CA    . GLN C 3 361 ? 6.452   48.878 38.474  1.00 15.47  ? 656  GLN A CA    1 
ATOM   3217 C C     . GLN C 3 361 ? 5.339   48.100 37.759  1.00 14.43  ? 656  GLN A C     1 
ATOM   3218 O O     . GLN C 3 361 ? 4.275   47.854 38.385  1.00 13.24  ? 656  GLN A O     1 
ATOM   3219 C CB    . GLN C 3 361 ? 5.939   49.460 39.789  1.00 17.84  ? 656  GLN A CB    1 
ATOM   3220 C CG    . GLN C 3 361 ? 6.976   50.270 40.564  1.00 20.26  ? 656  GLN A CG    1 
ATOM   3221 C CD    . GLN C 3 361 ? 8.211   49.506 40.985  1.00 21.48  ? 656  GLN A CD    1 
ATOM   3222 O OE1   . GLN C 3 361 ? 8.197   48.290 41.131  1.00 22.65  ? 656  GLN A OE1   1 
ATOM   3223 N NE2   . GLN C 3 361 ? 9.300   50.227 41.240  1.00 24.44  ? 656  GLN A NE2   1 
ATOM   3224 N N     . ILE C 3 362 ? 5.568   47.664 36.520  1.00 13.71  ? 657  ILE A N     1 
ATOM   3225 C CA    . ILE C 3 362 ? 4.506   46.923 35.781  1.00 14.98  ? 657  ILE A CA    1 
ATOM   3226 C C     . ILE C 3 362 ? 4.144   45.637 36.544  1.00 15.03  ? 657  ILE A C     1 
ATOM   3227 O O     . ILE C 3 362 ? 2.954   45.299 36.572  1.00 13.07  ? 657  ILE A O     1 
ATOM   3228 C CB    . ILE C 3 362 ? 4.819   46.633 34.299  1.00 14.59  ? 657  ILE A CB    1 
ATOM   3229 C CG1   . ILE C 3 362 ? 3.544   46.111 33.618  1.00 15.34  ? 657  ILE A CG1   1 
ATOM   3230 C CG2   . ILE C 3 362 ? 6.021   45.690 34.127  1.00 13.93  ? 657  ILE A CG2   1 
ATOM   3231 C CD1   . ILE C 3 362 ? 3.530   46.271 32.122  1.00 16.55  ? 657  ILE A CD1   1 
ATOM   3232 N N     . GLU C 3 363 ? 5.104   44.946 37.154  1.00 16.27  ? 658  GLU A N     1 
ATOM   3233 C CA    . GLU C 3 363 ? 4.768   43.657 37.830  1.00 17.17  ? 658  GLU A CA    1 
ATOM   3234 C C     . GLU C 3 363 ? 3.798   43.945 38.982  1.00 16.67  ? 658  GLU A C     1 
ATOM   3235 O O     . GLU C 3 363 ? 2.774   43.264 39.071  1.00 17.43  ? 658  GLU A O     1 
ATOM   3236 C CB    . GLU C 3 363 ? 6.014   42.914 38.296  1.00 19.01  ? 658  GLU A CB    1 
ATOM   3237 C CG    . GLU C 3 363 ? 6.832   42.345 37.138  1.00 22.24  ? 658  GLU A CG    1 
ATOM   3238 C CD    . GLU C 3 363 ? 8.032   41.509 37.589  1.00 26.65  ? 658  GLU A CD    1 
ATOM   3239 O OE1   . GLU C 3 363 ? 8.361   40.543 36.886  1.00 32.02  ? 658  GLU A OE1   1 
ATOM   3240 O OE2   . GLU C 3 363 ? 8.635   41.829 38.657  1.00 29.57  ? 658  GLU A OE2   1 
ATOM   3241 N N     . LEU C 3 364 ? 4.050   44.961 39.801  1.00 15.32  ? 659  LEU A N     1 
ATOM   3242 C CA    . LEU C 3 364 ? 3.187   45.198 40.981  1.00 15.99  ? 659  LEU A CA    1 
ATOM   3243 C C     . LEU C 3 364 ? 1.848   45.798 40.549  1.00 15.34  ? 659  LEU A C     1 
ATOM   3244 O O     . LEU C 3 364 ? 0.830   45.521 41.210  1.00 14.15  ? 659  LEU A O     1 
ATOM   3245 C CB    . LEU C 3 364 ? 3.954   46.045 41.996  1.00 16.63  ? 659  LEU A CB    1 
ATOM   3246 C CG    . LEU C 3 364 ? 5.001   45.233 42.745  1.00 18.21  ? 659  LEU A CG    1 
ATOM   3247 C CD1   . LEU C 3 364 ? 6.062   46.129 43.361  1.00 20.67  ? 659  LEU A CD1   1 
ATOM   3248 C CD2   . LEU C 3 364 ? 4.341   44.356 43.800  1.00 18.57  ? 659  LEU A CD2   1 
ATOM   3249 N N     . ARG C 3 365 ? 1.815   46.537 39.446  1.00 14.78  ? 660  ARG A N     1 
ATOM   3250 C CA    . ARG C 3 365 ? 0.536   47.096 38.937  1.00 14.79  ? 660  ARG A CA    1 
ATOM   3251 C C     . ARG C 3 365 ? -0.326  45.954 38.383  1.00 14.98  ? 660  ARG A C     1 
ATOM   3252 O O     . ARG C 3 365 ? -1.537  45.863 38.735  1.00 14.40  ? 660  ARG A O     1 
ATOM   3253 C CB    . ARG C 3 365 ? 0.804   48.177 37.897  1.00 14.90  ? 660  ARG A CB    1 
ATOM   3254 C CG    . ARG C 3 365 ? 1.213   49.521 38.483  1.00 14.91  ? 660  ARG A CG    1 
ATOM   3255 C CD    . ARG C 3 365 ? 1.762   50.395 37.374  1.00 14.99  ? 660  ARG A CD    1 
ATOM   3256 N NE    . ARG C 3 365 ? 2.383   51.522 38.005  1.00 15.88  ? 660  ARG A NE    1 
ATOM   3257 C CZ    . ARG C 3 365 ? 1.757   52.646 38.345  1.00 16.71  ? 660  ARG A CZ    1 
ATOM   3258 N NH1   . ARG C 3 365 ? 0.479   52.844 38.051  1.00 16.47  ? 660  ARG A NH1   1 
ATOM   3259 N NH2   . ARG C 3 365 ? 2.450   53.599 38.942  1.00 16.44  ? 660  ARG A NH2   1 
ATOM   3260 N N     . VAL C 3 366 ? 0.290   45.057 37.623  1.00 14.98  ? 661  VAL A N     1 
ATOM   3261 C CA    . VAL C 3 366 ? -0.363  43.785 37.177  1.00 14.76  ? 661  VAL A CA    1 
ATOM   3262 C C     . VAL C 3 366 ? -0.836  42.995 38.410  1.00 13.65  ? 661  VAL A C     1 
ATOM   3263 O O     . VAL C 3 366 ? -1.985  42.562 38.402  1.00 13.38  ? 661  VAL A O     1 
ATOM   3264 C CB    . VAL C 3 366 ? 0.579   42.967 36.274  1.00 13.82  ? 661  VAL A CB    1 
ATOM   3265 C CG1   . VAL C 3 366 ? 0.099   41.552 36.028  1.00 13.32  ? 661  VAL A CG1   1 
ATOM   3266 C CG2   . VAL C 3 366 ? 0.737   43.702 34.963  1.00 14.25  ? 661  VAL A CG2   1 
ATOM   3267 N N     . LEU C 3 367 ? -0.005  42.840 39.433  1.00 13.39  ? 662  LEU A N     1 
ATOM   3268 C CA    . LEU C 3 367 ? -0.430  42.116 40.665  1.00 14.26  ? 662  LEU A CA    1 
ATOM   3269 C C     . LEU C 3 367 ? -1.668  42.786 41.288  1.00 14.02  ? 662  LEU A C     1 
ATOM   3270 O O     . LEU C 3 367 ? -2.659  42.072 41.592  1.00 12.72  ? 662  LEU A O     1 
ATOM   3271 C CB    . LEU C 3 367 ? 0.709   42.035 41.673  1.00 14.30  ? 662  LEU A CB    1 
ATOM   3272 C CG    . LEU C 3 367 ? 0.354   41.400 43.010  1.00 14.39  ? 662  LEU A CG    1 
ATOM   3273 C CD1   . LEU C 3 367 ? -0.362  40.076 42.831  1.00 15.55  ? 662  LEU A CD1   1 
ATOM   3274 C CD2   . LEU C 3 367 ? 1.597   41.208 43.831  1.00 14.88  ? 662  LEU A CD2   1 
ATOM   3275 N N     . ALA C 3 368 ? -1.650  44.104 41.431  1.00 14.03  ? 663  ALA A N     1 
ATOM   3276 C CA    . ALA C 3 368 ? -2.803  44.857 41.969  1.00 14.33  ? 663  ALA A CA    1 
ATOM   3277 C C     . ALA C 3 368 ? -4.037  44.532 41.124  1.00 14.62  ? 663  ALA A C     1 
ATOM   3278 O O     . ALA C 3 368 ? -5.120  44.354 41.686  1.00 14.49  ? 663  ALA A O     1 
ATOM   3279 C CB    . ALA C 3 368 ? -2.530  46.333 42.015  1.00 13.39  ? 663  ALA A CB    1 
ATOM   3280 N N     . HIS C 3 369 ? -3.875  44.404 39.815  1.00 16.44  ? 664  HIS A N     1 
ATOM   3281 C CA    . HIS C 3 369 ? -5.031  44.181 38.919  1.00 17.15  ? 664  HIS A CA    1 
ATOM   3282 C C     . HIS C 3 369 ? -5.580  42.763 39.094  1.00 18.40  ? 664  HIS A C     1 
ATOM   3283 O O     . HIS C 3 369 ? -6.821  42.633 39.197  1.00 19.37  ? 664  HIS A O     1 
ATOM   3284 C CB    . HIS C 3 369 ? -4.681  44.485 37.467  1.00 16.58  ? 664  HIS A CB    1 
ATOM   3285 C CG    . HIS C 3 369 ? -5.707  44.020 36.494  1.00 15.42  ? 664  HIS A CG    1 
ATOM   3286 N ND1   . HIS C 3 369 ? -6.691  44.830 36.046  1.00 15.49  ? 664  HIS A ND1   1 
ATOM   3287 C CD2   . HIS C 3 369 ? -5.869  42.837 35.857  1.00 15.31  ? 664  HIS A CD2   1 
ATOM   3288 C CE1   . HIS C 3 369 ? -7.427  44.187 35.145  1.00 15.54  ? 664  HIS A CE1   1 
ATOM   3289 N NE2   . HIS C 3 369 ? -6.937  42.948 35.022  1.00 15.00  ? 664  HIS A NE2   1 
ATOM   3290 N N     . ILE C 3 370 ? -4.733  41.735 39.019  1.00 19.26  ? 665  ILE A N     1 
ATOM   3291 C CA    . ILE C 3 370 ? -5.227  40.327 38.956  1.00 20.06  ? 665  ILE A CA    1 
ATOM   3292 C C     . ILE C 3 370 ? -5.766  39.917 40.336  1.00 19.99  ? 665  ILE A C     1 
ATOM   3293 O O     . ILE C 3 370 ? -6.747  39.210 40.359  1.00 20.87  ? 665  ILE A O     1 
ATOM   3294 C CB    . ILE C 3 370 ? -4.157  39.346 38.436  1.00 22.03  ? 665  ILE A CB    1 
ATOM   3295 C CG1   . ILE C 3 370 ? -2.933  39.273 39.350  1.00 23.79  ? 665  ILE A CG1   1 
ATOM   3296 C CG2   . ILE C 3 370 ? -3.788  39.683 36.999  1.00 22.18  ? 665  ILE A CG2   1 
ATOM   3297 C CD1   . ILE C 3 370 ? -1.690  38.628 38.717  1.00 26.69  ? 665  ILE A CD1   1 
ATOM   3298 N N     . ALA C 3 371 ? -5.121  40.345 41.426  1.00 21.78  ? 666  ALA A N     1 
ATOM   3299 C CA    . ALA C 3 371 ? -5.494  40.093 42.844  1.00 22.65  ? 666  ALA A CA    1 
ATOM   3300 C C     . ALA C 3 371 ? -6.713  40.934 43.250  1.00 22.18  ? 666  ALA A C     1 
ATOM   3301 O O     . ALA C 3 371 ? -7.347  40.558 44.201  1.00 21.92  ? 666  ALA A O     1 
ATOM   3302 C CB    . ALA C 3 371 ? -4.332  40.398 43.765  1.00 22.01  ? 666  ALA A CB    1 
ATOM   3303 N N     . GLU C 3 372 ? -6.959  42.064 42.578  1.00 25.07  ? 667  GLU A N     1 
ATOM   3304 C CA    . GLU C 3 372 ? -8.001  43.077 42.923  1.00 26.23  ? 667  GLU A CA    1 
ATOM   3305 C C     . GLU C 3 372 ? -7.861  43.409 44.401  1.00 25.06  ? 667  GLU A C     1 
ATOM   3306 O O     . GLU C 3 372 ? -8.877  43.403 45.106  1.00 22.64  ? 667  GLU A O     1 
ATOM   3307 C CB    . GLU C 3 372 ? -9.420  42.597 42.625  1.00 26.44  ? 667  GLU A CB    1 
ATOM   3308 C CG    . GLU C 3 372 ? -9.599  42.103 41.206  1.00 29.75  ? 667  GLU A CG    1 
ATOM   3309 C CD    . GLU C 3 372 ? -11.014 41.635 40.885  1.00 33.18  ? 667  GLU A CD    1 
ATOM   3310 O OE1   . GLU C 3 372 ? -11.171 40.468 40.486  1.00 35.39  ? 667  GLU A OE1   1 
ATOM   3311 O OE2   . GLU C 3 372 ? -11.954 42.438 41.044  1.00 34.37  ? 667  GLU A OE2   1 
ATOM   3312 N N     . ASP C 3 373 ? -6.631  43.664 44.843  1.00 22.97  ? 668  ASP A N     1 
ATOM   3313 C CA    . ASP C 3 373 ? -6.362  44.047 46.246  1.00 22.65  ? 668  ASP A CA    1 
ATOM   3314 C C     . ASP C 3 373 ? -6.721  45.524 46.400  1.00 21.71  ? 668  ASP A C     1 
ATOM   3315 O O     . ASP C 3 373 ? -6.094  46.347 45.721  1.00 20.50  ? 668  ASP A O     1 
ATOM   3316 C CB    . ASP C 3 373 ? -4.918  43.746 46.614  1.00 23.34  ? 668  ASP A CB    1 
ATOM   3317 C CG    . ASP C 3 373 ? -4.678  44.005 48.069  1.00 24.52  ? 668  ASP A CG    1 
ATOM   3318 O OD1   . ASP C 3 373 ? -4.420  45.157 48.400  1.00 26.81  ? 668  ASP A OD1   1 
ATOM   3319 O OD2   . ASP C 3 373 ? -4.807  43.049 48.855  1.00 30.55  ? 668  ASP A OD2   1 
ATOM   3320 N N     . ASP C 3 374 ? -7.738  45.842 47.201  1.00 23.95  ? 669  ASP A N     1 
ATOM   3321 C CA    . ASP C 3 374 ? -8.277  47.223 47.320  1.00 24.62  ? 669  ASP A CA    1 
ATOM   3322 C C     . ASP C 3 374 ? -7.146  48.179 47.723  1.00 23.08  ? 669  ASP A C     1 
ATOM   3323 O O     . ASP C 3 374 ? -7.019  49.251 47.138  1.00 23.34  ? 669  ASP A O     1 
ATOM   3324 C CB    . ASP C 3 374 ? -9.446  47.253 48.308  1.00 30.80  ? 669  ASP A CB    1 
ATOM   3325 C CG    . ASP C 3 374 ? -10.771 46.781 47.722  1.00 35.80  ? 669  ASP A CG    1 
ATOM   3326 O OD1   . ASP C 3 374 ? -10.946 46.862 46.475  1.00 39.05  ? 669  ASP A OD1   1 
ATOM   3327 O OD2   . ASP C 3 374 ? -11.627 46.339 48.522  1.00 43.13  ? 669  ASP A OD2   1 
ATOM   3328 N N     . ASN C 3 375 ? -6.297  47.768 48.653  1.00 23.49  ? 670  ASN A N     1 
ATOM   3329 C CA    . ASN C 3 375 ? -5.264  48.644 49.259  1.00 23.54  ? 670  ASN A CA    1 
ATOM   3330 C C     . ASN C 3 375 ? -4.129  48.882 48.256  1.00 21.45  ? 670  ASN A C     1 
ATOM   3331 O O     . ASN C 3 375 ? -3.672  50.030 48.122  1.00 20.62  ? 670  ASN A O     1 
ATOM   3332 C CB    . ASN C 3 375 ? -4.816  48.046 50.589  1.00 25.66  ? 670  ASN A CB    1 
ATOM   3333 C CG    . ASN C 3 375 ? -5.954  48.002 51.601  1.00 32.29  ? 670  ASN A CG    1 
ATOM   3334 O OD1   . ASN C 3 375 ? -6.968  48.690 51.435  1.00 30.80  ? 670  ASN A OD1   1 
ATOM   3335 N ND2   . ASN C 3 375 ? -5.794  47.210 52.661  1.00 33.18  ? 670  ASN A ND2   1 
ATOM   3336 N N     . LEU C 3 376 ? -3.686  47.831 47.571  1.00 19.94  ? 671  LEU A N     1 
ATOM   3337 C CA    . LEU C 3 376 ? -2.590  47.911 46.582  1.00 19.00  ? 671  LEU A CA    1 
ATOM   3338 C C     . LEU C 3 376 ? -3.079  48.714 45.379  1.00 18.59  ? 671  LEU A C     1 
ATOM   3339 O O     . LEU C 3 376 ? -2.320  49.576 44.925  1.00 20.08  ? 671  LEU A O     1 
ATOM   3340 C CB    . LEU C 3 376 ? -2.161  46.504 46.185  1.00 18.80  ? 671  LEU A CB    1 
ATOM   3341 C CG    . LEU C 3 376 ? -0.895  46.442 45.347  1.00 19.64  ? 671  LEU A CG    1 
ATOM   3342 C CD1   . LEU C 3 376 ? 0.284   47.107 46.051  1.00 18.73  ? 671  LEU A CD1   1 
ATOM   3343 C CD2   . LEU C 3 376 ? -0.574  44.991 45.017  1.00 21.01  ? 671  LEU A CD2   1 
ATOM   3344 N N     . MET C 3 377 ? -4.321  48.500 44.932  1.00 18.68  ? 672  MET A N     1 
ATOM   3345 C CA    . MET C 3 377 ? -4.936  49.296 43.832  1.00 18.87  ? 672  MET A CA    1 
ATOM   3346 C C     . MET C 3 377 ? -4.996  50.770 44.237  1.00 19.14  ? 672  MET A C     1 
ATOM   3347 O O     . MET C 3 377 ? -4.651  51.616 43.385  1.00 19.39  ? 672  MET A O     1 
ATOM   3348 C CB    . MET C 3 377 ? -6.341  48.824 43.464  1.00 18.54  ? 672  MET A CB    1 
ATOM   3349 C CG    . MET C 3 377 ? -6.356  47.503 42.718  1.00 19.95  ? 672  MET A CG    1 
ATOM   3350 S SD    . MET C 3 377 ? -8.003  46.977 42.111  1.00 24.54  ? 672  MET A SD    1 
ATOM   3351 C CE    . MET C 3 377 ? -9.015  46.910 43.586  1.00 20.72  ? 672  MET A CE    1 
ATOM   3352 N N     . GLU C 3 378 ? -5.448  51.075 45.455  1.00 17.40  ? 673  GLU A N     1 
ATOM   3353 C CA    . GLU C 3 378 ? -5.499  52.481 45.937  1.00 17.52  ? 673  GLU A CA    1 
ATOM   3354 C C     . GLU C 3 378 ? -4.080  53.074 45.887  1.00 16.86  ? 673  GLU A C     1 
ATOM   3355 O O     . GLU C 3 378 ? -3.922  54.232 45.446  1.00 15.07  ? 673  GLU A O     1 
ATOM   3356 C CB    . GLU C 3 378 ? -6.069  52.596 47.357  1.00 16.71  ? 673  GLU A CB    1 
ATOM   3357 C CG    . GLU C 3 378 ? -6.042  54.021 47.912  1.00 16.19  ? 673  GLU A CG    1 
ATOM   3358 C CD    . GLU C 3 378 ? -7.051  54.947 47.215  1.00 17.89  ? 673  GLU A CD    1 
ATOM   3359 O OE1   . GLU C 3 378 ? -7.768  54.460 46.330  1.00 17.46  ? 673  GLU A OE1   1 
ATOM   3360 O OE2   . GLU C 3 378 ? -7.128  56.163 47.554  1.00 18.75  ? 673  GLU A OE2   1 
ATOM   3361 N N     . ALA C 3 379 ? -3.093  52.342 46.381  1.00 16.09  ? 674  ALA A N     1 
ATOM   3362 C CA    . ALA C 3 379 ? -1.684  52.809 46.423  1.00 16.73  ? 674  ALA A CA    1 
ATOM   3363 C C     . ALA C 3 379 ? -1.258  53.263 45.024  1.00 16.45  ? 674  ALA A C     1 
ATOM   3364 O O     . ALA C 3 379 ? -0.614  54.316 44.919  1.00 15.76  ? 674  ALA A O     1 
ATOM   3365 C CB    . ALA C 3 379 ? -0.773  51.732 46.934  1.00 16.10  ? 674  ALA A CB    1 
ATOM   3366 N N     . PHE C 3 380 ? -1.630  52.509 43.984  1.00 17.06  ? 675  PHE A N     1 
ATOM   3367 C CA    . PHE C 3 380 ? -1.251  52.833 42.583  1.00 16.71  ? 675  PHE A CA    1 
ATOM   3368 C C     . PHE C 3 380 ? -2.172  53.943 42.026  1.00 17.01  ? 675  PHE A C     1 
ATOM   3369 O O     . PHE C 3 380 ? -1.689  54.822 41.286  1.00 16.40  ? 675  PHE A O     1 
ATOM   3370 C CB    . PHE C 3 380 ? -1.172  51.560 41.741  1.00 15.78  ? 675  PHE A CB    1 
ATOM   3371 C CG    . PHE C 3 380 ? 0.123   50.789 41.914  1.00 14.61  ? 675  PHE A CG    1 
ATOM   3372 C CD1   . PHE C 3 380 ? 1.341   51.371 41.583  1.00 13.89  ? 675  PHE A CD1   1 
ATOM   3373 C CD2   . PHE C 3 380 ? 0.123   49.488 42.400  1.00 13.91  ? 675  PHE A CD2   1 
ATOM   3374 C CE1   . PHE C 3 380 ? 2.532   50.683 41.760  1.00 13.96  ? 675  PHE A CE1   1 
ATOM   3375 C CE2   . PHE C 3 380 ? 1.312   48.794 42.575  1.00 14.15  ? 675  PHE A CE2   1 
ATOM   3376 C CZ    . PHE C 3 380 ? 2.516   49.383 42.245  1.00 14.01  ? 675  PHE A CZ    1 
ATOM   3377 N N     . ARG C 3 381 ? -3.426  54.026 42.464  1.00 17.47  ? 676  ARG A N     1 
ATOM   3378 C CA    . ARG C 3 381 ? -4.300  55.150 42.032  1.00 18.30  ? 676  ARG A CA    1 
ATOM   3379 C C     . ARG C 3 381 ? -3.758  56.464 42.618  1.00 17.43  ? 676  ARG A C     1 
ATOM   3380 O O     . ARG C 3 381 ? -3.908  57.496 41.974  1.00 16.53  ? 676  ARG A O     1 
ATOM   3381 C CB    . ARG C 3 381 ? -5.749  54.838 42.381  1.00 19.70  ? 676  ARG A CB    1 
ATOM   3382 C CG    . ARG C 3 381 ? -6.294  53.669 41.587  1.00 20.80  ? 676  ARG A CG    1 
ATOM   3383 C CD    . ARG C 3 381 ? -7.706  53.355 42.015  1.00 22.81  ? 676  ARG A CD    1 
ATOM   3384 N NE    . ARG C 3 381 ? -8.208  52.280 41.175  1.00 25.03  ? 676  ARG A NE    1 
ATOM   3385 C CZ    . ARG C 3 381 ? -9.104  51.369 41.543  1.00 27.10  ? 676  ARG A CZ    1 
ATOM   3386 N NH1   . ARG C 3 381 ? -9.606  51.386 42.767  1.00 25.11  ? 676  ARG A NH1   1 
ATOM   3387 N NH2   . ARG C 3 381 ? -9.509  50.455 40.669  1.00 27.16  ? 676  ARG A NH2   1 
ATOM   3388 N N     . ARG C 3 382 ? -3.053  56.421 43.743  1.00 18.64  ? 677  ARG A N     1 
ATOM   3389 C CA    . ARG C 3 382 ? -2.404  57.635 44.309  1.00 19.76  ? 677  ARG A CA    1 
ATOM   3390 C C     . ARG C 3 382 ? -1.000  57.828 43.729  1.00 19.51  ? 677  ARG A C     1 
ATOM   3391 O O     . ARG C 3 382 ? -0.322  58.772 44.167  1.00 21.38  ? 677  ARG A O     1 
ATOM   3392 C CB    . ARG C 3 382 ? -2.277  57.534 45.819  1.00 19.99  ? 677  ARG A CB    1 
ATOM   3393 C CG    . ARG C 3 382 ? -3.602  57.406 46.542  1.00 23.30  ? 677  ARG A CG    1 
ATOM   3394 C CD    . ARG C 3 382 ? -3.366  57.527 48.033  1.00 22.94  ? 677  ARG A CD    1 
ATOM   3395 N NE    . ARG C 3 382 ? -4.566  57.107 48.705  1.00 25.03  ? 677  ARG A NE    1 
ATOM   3396 C CZ    . ARG C 3 382 ? -4.659  56.933 50.014  1.00 26.70  ? 677  ARG A CZ    1 
ATOM   3397 N NH1   . ARG C 3 382 ? -3.609  57.189 50.785  1.00 26.71  ? 677  ARG A NH1   1 
ATOM   3398 N NH2   . ARG C 3 382 ? -5.806  56.523 50.528  1.00 25.22  ? 677  ARG A NH2   1 
ATOM   3399 N N     . ASP C 3 383 ? -0.571  56.937 42.830  1.00 19.21  ? 678  ASP A N     1 
ATOM   3400 C CA    . ASP C 3 383 ? 0.816   56.870 42.323  1.00 18.94  ? 678  ASP A CA    1 
ATOM   3401 C C     . ASP C 3 383 ? 1.793   56.949 43.498  1.00 19.53  ? 678  ASP A C     1 
ATOM   3402 O O     . ASP C 3 383 ? 2.757   57.708 43.381  1.00 20.69  ? 678  ASP A O     1 
ATOM   3403 C CB    . ASP C 3 383 ? 1.062   58.009 41.339  1.00 19.19  ? 678  ASP A CB    1 
ATOM   3404 C CG    . ASP C 3 383 ? 2.337   57.851 40.543  1.00 21.05  ? 678  ASP A CG    1 
ATOM   3405 O OD1   . ASP C 3 383 ? 2.840   56.719 40.441  1.00 23.18  ? 678  ASP A OD1   1 
ATOM   3406 O OD2   . ASP C 3 383 ? 2.813   58.868 40.017  1.00 24.03  ? 678  ASP A OD2   1 
ATOM   3407 N N     . LEU C 3 384 ? 1.574   56.227 44.597  1.00 20.19  ? 679  LEU A N     1 
ATOM   3408 C CA    . LEU C 3 384 ? 2.538   56.274 45.745  1.00 22.07  ? 679  LEU A CA    1 
ATOM   3409 C C     . LEU C 3 384 ? 3.842   55.613 45.317  1.00 19.97  ? 679  LEU A C     1 
ATOM   3410 O O     . LEU C 3 384 ? 3.816   54.723 44.473  1.00 21.72  ? 679  LEU A O     1 
ATOM   3411 C CB    . LEU C 3 384 ? 2.020   55.552 47.001  1.00 22.47  ? 679  LEU A CB    1 
ATOM   3412 C CG    . LEU C 3 384 ? 0.808   56.168 47.707  1.00 25.50  ? 679  LEU A CG    1 
ATOM   3413 C CD1   . LEU C 3 384 ? 0.406   55.343 48.936  1.00 25.29  ? 679  LEU A CD1   1 
ATOM   3414 C CD2   . LEU C 3 384 ? 1.058   57.617 48.099  1.00 25.52  ? 679  LEU A CD2   1 
ATOM   3415 N N     . ASP C 3 385 ? 4.921   55.956 45.987  1.00 19.64  ? 680  ASP A N     1 
ATOM   3416 C CA    . ASP C 3 385 ? 6.167   55.162 45.953  1.00 19.97  ? 680  ASP A CA    1 
ATOM   3417 C C     . ASP C 3 385 ? 5.863   53.816 46.609  1.00 19.05  ? 680  ASP A C     1 
ATOM   3418 O O     . ASP C 3 385 ? 5.578   53.772 47.826  1.00 18.90  ? 680  ASP A O     1 
ATOM   3419 C CB    . ASP C 3 385 ? 7.282   55.934 46.656  1.00 22.47  ? 680  ASP A CB    1 
ATOM   3420 C CG    . ASP C 3 385 ? 8.518   55.085 46.848  1.00 26.73  ? 680  ASP A CG    1 
ATOM   3421 O OD1   . ASP C 3 385 ? 8.388   53.858 47.088  1.00 28.09  ? 680  ASP A OD1   1 
ATOM   3422 O OD2   . ASP C 3 385 ? 9.589   55.643 46.767  1.00 38.22  ? 680  ASP A OD2   1 
ATOM   3423 N N     . ILE C 3 386 ? 5.871   52.733 45.844  1.00 18.98  ? 681  ILE A N     1 
ATOM   3424 C CA    . ILE C 3 386 ? 5.270   51.469 46.344  1.00 18.29  ? 681  ILE A CA    1 
ATOM   3425 C C     . ILE C 3 386 ? 6.136   50.839 47.444  1.00 18.28  ? 681  ILE A C     1 
ATOM   3426 O O     . ILE C 3 386 ? 5.578   50.142 48.311  1.00 18.42  ? 681  ILE A O     1 
ATOM   3427 C CB    . ILE C 3 386 ? 4.952   50.488 45.196  1.00 18.02  ? 681  ILE A CB    1 
ATOM   3428 C CG1   . ILE C 3 386 ? 4.077   49.357 45.733  1.00 18.68  ? 681  ILE A CG1   1 
ATOM   3429 C CG2   . ILE C 3 386 ? 6.198   49.969 44.508  1.00 17.51  ? 681  ILE A CG2   1 
ATOM   3430 C CD1   . ILE C 3 386 ? 2.827   49.863 46.425  1.00 19.58  ? 681  ILE A CD1   1 
ATOM   3431 N N     . HIS C 3 387 ? 7.452   51.003 47.400  1.00 19.06  ? 682  HIS A N     1 
ATOM   3432 C CA    . HIS C 3 387 ? 8.373   50.405 48.403  1.00 19.11  ? 682  HIS A CA    1 
ATOM   3433 C C     . HIS C 3 387 ? 8.254   51.146 49.746  1.00 21.58  ? 682  HIS A C     1 
ATOM   3434 O O     . HIS C 3 387 ? 8.194   50.479 50.838  1.00 19.26  ? 682  HIS A O     1 
ATOM   3435 C CB    . HIS C 3 387 ? 9.777   50.391 47.807  1.00 19.09  ? 682  HIS A CB    1 
ATOM   3436 C CG    . HIS C 3 387 ? 9.823   49.564 46.566  1.00 17.93  ? 682  HIS A CG    1 
ATOM   3437 N ND1   . HIS C 3 387 ? 9.208   48.317 46.502  1.00 16.68  ? 682  HIS A ND1   1 
ATOM   3438 C CD2   . HIS C 3 387 ? 10.421  49.771 45.369  1.00 16.52  ? 682  HIS A CD2   1 
ATOM   3439 C CE1   . HIS C 3 387 ? 9.432   47.807 45.298  1.00 16.66  ? 682  HIS A CE1   1 
ATOM   3440 N NE2   . HIS C 3 387 ? 10.152  48.686 44.584  1.00 15.06  ? 682  HIS A NE2   1 
ATOM   3441 N N     . THR C 3 388 ? 8.175   52.479 49.674  1.00 21.91  ? 683  THR A N     1 
ATOM   3442 C CA    . THR C 3 388 ? 7.912   53.361 50.840  1.00 20.93  ? 683  THR A CA    1 
ATOM   3443 C C     . THR C 3 388 ? 6.585   52.950 51.455  1.00 20.14  ? 683  THR A C     1 
ATOM   3444 O O     . THR C 3 388 ? 6.544   52.699 52.673  1.00 19.54  ? 683  THR A O     1 
ATOM   3445 C CB    . THR C 3 388 ? 7.979   54.832 50.432  1.00 21.05  ? 683  THR A CB    1 
ATOM   3446 O OG1   . THR C 3 388 ? 9.320   55.044 49.988  1.00 21.01  ? 683  THR A OG1   1 
ATOM   3447 C CG2   . THR C 3 388 ? 7.626   55.772 51.557  1.00 22.35  ? 683  THR A CG2   1 
ATOM   3448 N N     . LYS C 3 389 ? 5.546   52.816 50.639  1.00 21.99  ? 684  LYS A N     1 
ATOM   3449 C CA    . LYS C 3 389 ? 4.205   52.454 51.148  1.00 21.20  ? 684  LYS A CA    1 
ATOM   3450 C C     . LYS C 3 389 ? 4.219   51.046 51.771  1.00 20.16  ? 684  LYS A C     1 
ATOM   3451 O O     . LYS C 3 389 ? 3.577   50.858 52.843  1.00 20.44  ? 684  LYS A O     1 
ATOM   3452 C CB    . LYS C 3 389 ? 3.183   52.533 50.028  1.00 23.05  ? 684  LYS A CB    1 
ATOM   3453 C CG    . LYS C 3 389 ? 1.815   51.981 50.391  1.00 26.20  ? 684  LYS A CG    1 
ATOM   3454 C CD    . LYS C 3 389 ? 1.137   52.776 51.490  1.00 30.02  ? 684  LYS A CD    1 
ATOM   3455 C CE    . LYS C 3 389 ? -0.261  52.265 51.781  1.00 35.22  ? 684  LYS A CE    1 
ATOM   3456 N NZ    . LYS C 3 389 ? -0.719  52.762 53.104  1.00 39.80  ? 684  LYS A NZ    1 
ATOM   3457 N N     . THR C 3 390 ? 4.861   50.062 51.145  1.00 17.74  ? 685  THR A N     1 
ATOM   3458 C CA    . THR C 3 390 ? 4.926   48.678 51.720  1.00 17.96  ? 685  THR A CA    1 
ATOM   3459 C C     . THR C 3 390 ? 5.661   48.760 53.074  1.00 17.63  ? 685  THR A C     1 
ATOM   3460 O O     . THR C 3 390 ? 5.197   48.152 54.038  1.00 15.12  ? 685  THR A O     1 
ATOM   3461 C CB    . THR C 3 390 ? 5.550   47.690 50.721  1.00 19.16  ? 685  THR A CB    1 
ATOM   3462 O OG1   . THR C 3 390 ? 4.799   47.711 49.511  1.00 18.20  ? 685  THR A OG1   1 
ATOM   3463 C CG2   . THR C 3 390 ? 5.598   46.263 51.226  1.00 20.16  ? 685  THR A CG2   1 
ATOM   3464 N N     . ALA C 3 391 ? 6.745   49.548 53.155  1.00 17.89  ? 686  ALA A N     1 
ATOM   3465 C CA    . ALA C 3 391 ? 7.465   49.833 54.424  1.00 19.54  ? 686  ALA A CA    1 
ATOM   3466 C C     . ALA C 3 391 ? 6.500   50.406 55.471  1.00 19.84  ? 686  ALA A C     1 
ATOM   3467 O O     . ALA C 3 391 ? 6.475   49.865 56.577  1.00 20.80  ? 686  ALA A O     1 
ATOM   3468 C CB    . ALA C 3 391 ? 8.656   50.731 54.193  1.00 18.33  ? 686  ALA A CB    1 
ATOM   3469 N N     . MET C 3 392 ? 5.734   51.455 55.155  1.00 21.07  ? 687  MET A N     1 
ATOM   3470 C CA    . MET C 3 392 ? 4.777   52.065 56.116  1.00 20.63  ? 687  MET A CA    1 
ATOM   3471 C C     . MET C 3 392 ? 3.830   50.992 56.642  1.00 21.74  ? 687  MET A C     1 
ATOM   3472 O O     . MET C 3 392 ? 3.664   50.898 57.882  1.00 20.78  ? 687  MET A O     1 
ATOM   3473 C CB    . MET C 3 392 ? 3.941   53.160 55.464  1.00 23.09  ? 687  MET A CB    1 
ATOM   3474 C CG    . MET C 3 392 ? 4.761   54.398 55.123  1.00 25.38  ? 687  MET A CG    1 
ATOM   3475 S SD    . MET C 3 392 ? 3.904   55.508 53.990  1.00 27.28  ? 687  MET A SD    1 
ATOM   3476 C CE    . MET C 3 392 ? 2.387   55.781 54.911  1.00 26.34  ? 687  MET A CE    1 
ATOM   3477 N N     . ASP C 3 393 ? 3.278   50.167 55.747  1.00 22.90  ? 688  ASP A N     1 
ATOM   3478 C CA    . ASP C 3 393 ? 2.336   49.077 56.107  1.00 24.33  ? 688  ASP A CA    1 
ATOM   3479 C C     . ASP C 3 393 ? 3.023   47.982 56.932  1.00 24.61  ? 688  ASP A C     1 
ATOM   3480 O O     . ASP C 3 393 ? 2.459   47.653 57.977  1.00 24.02  ? 688  ASP A O     1 
ATOM   3481 C CB    . ASP C 3 393 ? 1.666   48.459 54.884  1.00 26.50  ? 688  ASP A CB    1 
ATOM   3482 C CG    . ASP C 3 393 ? 0.737   49.426 54.190  1.00 27.72  ? 688  ASP A CG    1 
ATOM   3483 O OD1   . ASP C 3 393 ? 0.197   50.293 54.873  1.00 30.70  ? 688  ASP A OD1   1 
ATOM   3484 O OD2   . ASP C 3 393 ? 0.609   49.323 52.966  1.00 32.66  ? 688  ASP A OD2   1 
ATOM   3485 N N     . ILE C 3 394 ? 4.143   47.393 56.504  1.00 23.49  ? 689  ILE A N     1 
ATOM   3486 C CA    . ILE C 3 394 ? 4.605   46.158 57.201  1.00 25.65  ? 689  ILE A CA    1 
ATOM   3487 C C     . ILE C 3 394 ? 5.274   46.558 58.515  1.00 28.18  ? 689  ILE A C     1 
ATOM   3488 O O     . ILE C 3 394 ? 5.181   45.767 59.441  1.00 30.58  ? 689  ILE A O     1 
ATOM   3489 C CB    . ILE C 3 394 ? 5.488   45.199 56.369  1.00 26.67  ? 689  ILE A CB    1 
ATOM   3490 C CG1   . ILE C 3 394 ? 6.851   45.765 56.001  1.00 26.20  ? 689  ILE A CG1   1 
ATOM   3491 C CG2   . ILE C 3 394 ? 4.759   44.693 55.139  1.00 27.89  ? 689  ILE A CG2   1 
ATOM   3492 C CD1   . ILE C 3 394 ? 7.533   44.933 54.935  1.00 28.12  ? 689  ILE A CD1   1 
ATOM   3493 N N     . PHE C 3 395 ? 5.878   47.740 58.631  1.00 28.39  ? 690  PHE A N     1 
ATOM   3494 C CA    . PHE C 3 395 ? 6.558   48.154 59.887  1.00 28.48  ? 690  PHE A CA    1 
ATOM   3495 C C     . PHE C 3 395 ? 5.666   49.067 60.739  1.00 32.26  ? 690  PHE A C     1 
ATOM   3496 O O     . PHE C 3 395 ? 6.093   49.361 61.845  1.00 36.86  ? 690  PHE A O     1 
ATOM   3497 C CB    . PHE C 3 395 ? 7.903   48.788 59.574  1.00 25.70  ? 690  PHE A CB    1 
ATOM   3498 C CG    . PHE C 3 395 ? 8.812   47.885 58.791  1.00 26.14  ? 690  PHE A CG    1 
ATOM   3499 C CD1   . PHE C 3 395 ? 9.047   46.592 59.209  1.00 25.76  ? 690  PHE A CD1   1 
ATOM   3500 C CD2   . PHE C 3 395 ? 9.423   48.323 57.628  1.00 25.41  ? 690  PHE A CD2   1 
ATOM   3501 C CE1   . PHE C 3 395 ? 9.843   45.744 58.459  1.00 26.43  ? 690  PHE A CE1   1 
ATOM   3502 C CE2   . PHE C 3 395 ? 10.248  47.486 56.903  1.00 24.74  ? 690  PHE A CE2   1 
ATOM   3503 C CZ    . PHE C 3 395 ? 10.447  46.195 57.309  1.00 25.49  ? 690  PHE A CZ    1 
ATOM   3504 N N     . GLN C 3 396 ? 4.477   49.445 60.259  1.00 35.66  ? 691  GLN A N     1 
ATOM   3505 C CA    . GLN C 3 396 ? 3.469   50.269 60.982  1.00 38.31  ? 691  GLN A CA    1 
ATOM   3506 C C     . GLN C 3 396 ? 4.129   51.588 61.400  1.00 38.19  ? 691  GLN A C     1 
ATOM   3507 O O     . GLN C 3 396 ? 4.256   51.853 62.602  1.00 38.21  ? 691  GLN A O     1 
ATOM   3508 C CB    . GLN C 3 396 ? 2.911   49.508 62.184  1.00 42.03  ? 691  GLN A CB    1 
ATOM   3509 C CG    . GLN C 3 396 ? 2.277   48.165 61.847  1.00 44.88  ? 691  GLN A CG    1 
ATOM   3510 C CD    . GLN C 3 396 ? 2.213   47.239 63.043  1.00 51.44  ? 691  GLN A CD    1 
ATOM   3511 O OE1   . GLN C 3 396 ? 2.175   46.018 62.908  1.00 57.73  ? 691  GLN A OE1   1 
ATOM   3512 N NE2   . GLN C 3 396 ? 2.206   47.808 64.237  1.00 54.77  ? 691  GLN A NE2   1 
ATOM   3513 N N     . VAL C 3 397 ? 4.557   52.376 60.417  1.00 33.49  ? 692  VAL A N     1 
ATOM   3514 C CA    . VAL C 3 397 ? 5.146   53.729 60.608  1.00 30.35  ? 692  VAL A CA    1 
ATOM   3515 C C     . VAL C 3 397 ? 4.536   54.673 59.567  1.00 31.58  ? 692  VAL A C     1 
ATOM   3516 O O     . VAL C 3 397 ? 3.972   54.185 58.545  1.00 30.99  ? 692  VAL A O     1 
ATOM   3517 C CB    . VAL C 3 397 ? 6.682   53.684 60.506  1.00 28.99  ? 692  VAL A CB    1 
ATOM   3518 C CG1   . VAL C 3 397 ? 7.299   52.828 61.613  1.00 29.66  ? 692  VAL A CG1   1 
ATOM   3519 C CG2   . VAL C 3 397 ? 7.142   53.214 59.134  1.00 26.69  ? 692  VAL A CG2   1 
ATOM   3520 N N     . SER C 3 398 ? 4.650   55.973 59.824  1.00 31.04  ? 693  SER A N     1 
ATOM   3521 C CA    . SER C 3 398 ? 4.284   57.079 58.907  1.00 31.58  ? 693  SER A CA    1 
ATOM   3522 C C     . SER C 3 398 ? 5.394   57.213 57.869  1.00 30.05  ? 693  SER A C     1 
ATOM   3523 O O     . SER C 3 398 ? 6.496   56.693 58.113  1.00 32.07  ? 693  SER A O     1 
ATOM   3524 C CB    . SER C 3 398 ? 4.131   58.381 59.647  1.00 32.99  ? 693  SER A CB    1 
ATOM   3525 O OG    . SER C 3 398 ? 5.422   58.861 60.015  1.00 39.78  ? 693  SER A OG    1 
ATOM   3526 N N     . GLU C 3 399 ? 5.090   57.864 56.757  1.00 29.16  ? 694  GLU A N     1 
ATOM   3527 C CA    . GLU C 3 399 ? 6.029   58.078 55.635  1.00 32.71  ? 694  GLU A CA    1 
ATOM   3528 C C     . GLU C 3 399 ? 7.335   58.655 56.188  1.00 32.67  ? 694  GLU A C     1 
ATOM   3529 O O     . GLU C 3 399 ? 8.396   58.183 55.777  1.00 31.85  ? 694  GLU A O     1 
ATOM   3530 C CB    . GLU C 3 399 ? 5.405   58.989 54.572  1.00 31.61  ? 694  GLU A CB    1 
ATOM   3531 C CG    . GLU C 3 399 ? 6.315   59.171 53.365  1.00 34.49  ? 694  GLU A CG    1 
ATOM   3532 C CD    . GLU C 3 399 ? 5.715   59.921 52.183  1.00 36.38  ? 694  GLU A CD    1 
ATOM   3533 O OE1   . GLU C 3 399 ? 6.464   60.227 51.249  1.00 39.53  ? 694  GLU A OE1   1 
ATOM   3534 O OE2   . GLU C 3 399 ? 4.508   60.196 52.201  1.00 37.96  ? 694  GLU A OE2   1 
ATOM   3535 N N     . ASP C 3 400 ? 7.236   59.652 57.065  1.00 34.17  ? 695  ASP A N     1 
ATOM   3536 C CA    . ASP C 3 400 ? 8.382   60.417 57.621  1.00 40.39  ? 695  ASP A CA    1 
ATOM   3537 C C     . ASP C 3 400 ? 9.282   59.487 58.449  1.00 32.76  ? 695  ASP A C     1 
ATOM   3538 O O     . ASP C 3 400 ? 10.427  59.814 58.588  1.00 31.29  ? 695  ASP A O     1 
ATOM   3539 C CB    . ASP C 3 400 ? 7.899   61.630 58.442  1.00 45.74  ? 695  ASP A CB    1 
ATOM   3540 C CG    . ASP C 3 400 ? 7.526   62.839 57.581  1.00 56.68  ? 695  ASP A CG    1 
ATOM   3541 O OD1   . ASP C 3 400 ? 7.885   62.848 56.368  1.00 51.43  ? 695  ASP A OD1   1 
ATOM   3542 O OD2   . ASP C 3 400 ? 6.877   63.777 58.123  1.00 59.18  ? 695  ASP A OD2   1 
ATOM   3543 N N     . GLU C 3 401 ? 8.764   58.399 59.001  1.00 29.47  ? 696  GLU A N     1 
ATOM   3544 C CA    . GLU C 3 401 ? 9.536   57.479 59.878  1.00 31.59  ? 696  GLU A CA    1 
ATOM   3545 C C     . GLU C 3 401 ? 10.127  56.313 59.084  1.00 30.12  ? 696  GLU A C     1 
ATOM   3546 O O     . GLU C 3 401 ? 10.668  55.397 59.727  1.00 31.01  ? 696  GLU A O     1 
ATOM   3547 C CB    . GLU C 3 401 ? 8.633   56.913 60.968  1.00 34.61  ? 696  GLU A CB    1 
ATOM   3548 C CG    . GLU C 3 401 ? 7.948   57.982 61.804  1.00 41.63  ? 696  GLU A CG    1 
ATOM   3549 C CD    . GLU C 3 401 ? 7.006   57.385 62.834  1.00 44.68  ? 696  GLU A CD    1 
ATOM   3550 O OE1   . GLU C 3 401 ? 5.947   56.809 62.438  1.00 44.54  ? 696  GLU A OE1   1 
ATOM   3551 O OE2   . GLU C 3 401 ? 7.370   57.429 64.020  1.00 48.54  ? 696  GLU A OE2   1 
ATOM   3552 N N     . VAL C 3 402 ? 9.980   56.291 57.755  1.00 27.02  ? 697  VAL A N     1 
ATOM   3553 C CA    . VAL C 3 402 ? 10.536  55.186 56.920  1.00 23.57  ? 697  VAL A CA    1 
ATOM   3554 C C     . VAL C 3 402 ? 12.003  55.524 56.690  1.00 22.56  ? 697  VAL A C     1 
ATOM   3555 O O     . VAL C 3 402 ? 12.268  56.521 56.004  1.00 21.95  ? 697  VAL A O     1 
ATOM   3556 C CB    . VAL C 3 402 ? 9.806   54.973 55.577  1.00 21.76  ? 697  VAL A CB    1 
ATOM   3557 C CG1   . VAL C 3 402 ? 10.595  54.041 54.668  1.00 21.83  ? 697  VAL A CG1   1 
ATOM   3558 C CG2   . VAL C 3 402 ? 8.391   54.432 55.757  1.00 20.29  ? 697  VAL A CG2   1 
ATOM   3559 N N     . THR C 3 403 ? 12.901  54.680 57.195  1.00 21.04  ? 698  THR A N     1 
ATOM   3560 C CA    . THR C 3 403 ? 14.372  54.820 57.061  1.00 19.88  ? 698  THR A CA    1 
ATOM   3561 C C     . THR C 3 403 ? 14.794  54.193 55.741  1.00 20.67  ? 698  THR A C     1 
ATOM   3562 O O     . THR C 3 403 ? 14.030  53.405 55.174  1.00 17.13  ? 698  THR A O     1 
ATOM   3563 C CB    . THR C 3 403 ? 15.078  54.158 58.250  1.00 19.49  ? 698  THR A CB    1 
ATOM   3564 O OG1   . THR C 3 403 ? 14.729  52.768 58.209  1.00 19.56  ? 698  THR A OG1   1 
ATOM   3565 C CG2   . THR C 3 403 ? 14.684  54.768 59.585  1.00 18.77  ? 698  THR A CG2   1 
ATOM   3566 N N     . PRO C 3 404 ? 16.007  54.522 55.223  1.00 19.44  ? 699  PRO A N     1 
ATOM   3567 C CA    . PRO C 3 404 ? 16.498  53.905 54.003  1.00 19.89  ? 699  PRO A CA    1 
ATOM   3568 C C     . PRO C 3 404 ? 16.568  52.373 54.137  1.00 21.49  ? 699  PRO A C     1 
ATOM   3569 O O     . PRO C 3 404 ? 16.289  51.690 53.182  1.00 20.14  ? 699  PRO A O     1 
ATOM   3570 C CB    . PRO C 3 404 ? 17.871  54.560 53.798  1.00 21.05  ? 699  PRO A CB    1 
ATOM   3571 C CG    . PRO C 3 404 ? 17.697  55.936 54.419  1.00 20.21  ? 699  PRO A CG    1 
ATOM   3572 C CD    . PRO C 3 404 ? 16.867  55.629 55.660  1.00 20.40  ? 699  PRO A CD    1 
ATOM   3573 N N     . ASN C 3 405 ? 16.903  51.859 55.316  1.00 19.62  ? 700  ASN A N     1 
ATOM   3574 C CA    . ASN C 3 405 ? 16.965  50.395 55.522  1.00 19.39  ? 700  ASN A CA    1 
ATOM   3575 C C     . ASN C 3 405 ? 15.561  49.772 55.496  1.00 19.36  ? 700  ASN A C     1 
ATOM   3576 O O     . ASN C 3 405 ? 15.419  48.671 54.951  1.00 18.92  ? 700  ASN A O     1 
ATOM   3577 C CB    . ASN C 3 405 ? 17.713  50.012 56.794  1.00 18.49  ? 700  ASN A CB    1 
ATOM   3578 C CG    . ASN C 3 405 ? 18.278  48.615 56.715  1.00 18.29  ? 700  ASN A CG    1 
ATOM   3579 O OD1   . ASN C 3 405 ? 18.879  48.240 55.705  1.00 18.26  ? 700  ASN A OD1   1 
ATOM   3580 N ND2   . ASN C 3 405 ? 18.052  47.842 57.757  1.00 18.67  ? 700  ASN A ND2   1 
ATOM   3581 N N     . MET C 3 406 ? 14.576  50.395 56.118  1.00 20.78  ? 701  MET A N     1 
ATOM   3582 C CA    . MET C 3 406 ? 13.181  49.918 56.030  1.00 22.38  ? 701  MET A CA    1 
ATOM   3583 C C     . MET C 3 406 ? 12.763  49.820 54.551  1.00 21.84  ? 701  MET A C     1 
ATOM   3584 O O     . MET C 3 406 ? 12.207  48.783 54.185  1.00 21.06  ? 701  MET A O     1 
ATOM   3585 C CB    . MET C 3 406 ? 12.247  50.848 56.794  1.00 23.93  ? 701  MET A CB    1 
ATOM   3586 C CG    . MET C 3 406 ? 12.365  50.656 58.301  1.00 28.36  ? 701  MET A CG    1 
ATOM   3587 S SD    . MET C 3 406 ? 11.594  51.971 59.275  1.00 31.11  ? 701  MET A SD    1 
ATOM   3588 C CE    . MET C 3 406 ? 9.890   51.681 58.855  1.00 29.11  ? 701  MET A CE    1 
ATOM   3589 N N     . ARG C 3 407 ? 13.060  50.832 53.739  1.00 19.38  ? 702  ARG A N     1 
ATOM   3590 C CA    . ARG C 3 407 ? 12.644  50.886 52.318  1.00 21.47  ? 702  ARG A CA    1 
ATOM   3591 C C     . ARG C 3 407 ? 13.325  49.759 51.563  1.00 19.98  ? 702  ARG A C     1 
ATOM   3592 O O     . ARG C 3 407 ? 12.659  49.100 50.805  1.00 20.42  ? 702  ARG A O     1 
ATOM   3593 C CB    . ARG C 3 407 ? 12.973  52.212 51.637  1.00 20.73  ? 702  ARG A CB    1 
ATOM   3594 C CG    . ARG C 3 407 ? 12.339  52.315 50.260  1.00 21.71  ? 702  ARG A CG    1 
ATOM   3595 C CD    . ARG C 3 407 ? 12.695  53.629 49.604  1.00 21.13  ? 702  ARG A CD    1 
ATOM   3596 N NE    . ARG C 3 407 ? 11.971  53.841 48.382  1.00 21.02  ? 702  ARG A NE    1 
ATOM   3597 C CZ    . ARG C 3 407 ? 12.292  53.308 47.204  1.00 23.02  ? 702  ARG A CZ    1 
ATOM   3598 N NH1   . ARG C 3 407 ? 13.309  52.468 47.089  1.00 23.63  ? 702  ARG A NH1   1 
ATOM   3599 N NH2   . ARG C 3 407 ? 11.562  53.586 46.141  1.00 22.03  ? 702  ARG A NH2   1 
ATOM   3600 N N     . ARG C 3 408 ? 14.593  49.523 51.826  1.00 21.45  ? 703  ARG A N     1 
ATOM   3601 C CA    . ARG C 3 408 ? 15.394  48.470 51.144  1.00 23.58  ? 703  ARG A CA    1 
ATOM   3602 C C     . ARG C 3 408 ? 14.762  47.115 51.480  1.00 21.31  ? 703  ARG A C     1 
ATOM   3603 O O     . ARG C 3 408 ? 14.613  46.266 50.564  1.00 20.60  ? 703  ARG A O     1 
ATOM   3604 C CB    . ARG C 3 408 ? 16.864  48.569 51.566  1.00 24.29  ? 703  ARG A CB    1 
ATOM   3605 C CG    . ARG C 3 408 ? 17.789  47.594 50.849  1.00 27.03  ? 703  ARG A CG    1 
ATOM   3606 C CD    . ARG C 3 408 ? 19.221  47.553 51.386  1.00 28.95  ? 703  ARG A CD    1 
ATOM   3607 N NE    . ARG C 3 408 ? 19.252  47.143 52.795  1.00 33.29  ? 703  ARG A NE    1 
ATOM   3608 C CZ    . ARG C 3 408 ? 19.161  45.891 53.275  1.00 37.46  ? 703  ARG A CZ    1 
ATOM   3609 N NH1   . ARG C 3 408 ? 19.039  44.844 52.471  1.00 40.90  ? 703  ARG A NH1   1 
ATOM   3610 N NH2   . ARG C 3 408 ? 19.181  45.693 54.585  1.00 36.49  ? 703  ARG A NH2   1 
ATOM   3611 N N     . GLN C 3 409 ? 14.368  46.936 52.735  1.00 19.77  ? 704  GLN A N     1 
ATOM   3612 C CA    . GLN C 3 409 ? 13.750  45.672 53.181  1.00 21.48  ? 704  GLN A CA    1 
ATOM   3613 C C     . GLN C 3 409 ? 12.337  45.528 52.593  1.00 20.35  ? 704  GLN A C     1 
ATOM   3614 O O     . GLN C 3 409 ? 12.042  44.415 52.105  1.00 21.00  ? 704  GLN A O     1 
ATOM   3615 C CB    . GLN C 3 409 ? 13.942  45.535 54.680  1.00 23.20  ? 704  GLN A CB    1 
ATOM   3616 C CG    . GLN C 3 409 ? 15.418  45.229 54.971  1.00 27.37  ? 704  GLN A CG    1 
ATOM   3617 C CD    . GLN C 3 409 ? 15.596  44.476 56.263  1.00 30.22  ? 704  GLN A CD    1 
ATOM   3618 O OE1   . GLN C 3 409 ? 15.716  43.255 56.285  1.00 31.74  ? 704  GLN A OE1   1 
ATOM   3619 N NE2   . GLN C 3 409 ? 15.526  45.210 57.355  1.00 31.63  ? 704  GLN A NE2   1 
ATOM   3620 N N     . ALA C 3 410 ? 11.535  46.589 52.544  1.00 17.54  ? 705  ALA A N     1 
ATOM   3621 C CA    . ALA C 3 410 ? 10.166  46.536 51.987  1.00 17.94  ? 705  ALA A CA    1 
ATOM   3622 C C     . ALA C 3 410 ? 10.239  46.210 50.494  1.00 19.33  ? 705  ALA A C     1 
ATOM   3623 O O     . ALA C 3 410 ? 9.374   45.445 50.009  1.00 19.53  ? 705  ALA A O     1 
ATOM   3624 C CB    . ALA C 3 410 ? 9.450   47.832 52.217  1.00 17.23  ? 705  ALA A CB    1 
ATOM   3625 N N     . LYS C 3 411 ? 11.257  46.751 49.815  1.00 19.02  ? 706  LYS A N     1 
ATOM   3626 C CA    . LYS C 3 411 ? 11.517  46.519 48.384  1.00 21.19  ? 706  LYS A CA    1 
ATOM   3627 C C     . LYS C 3 411 ? 11.762  45.025 48.159  1.00 23.46  ? 706  LYS A C     1 
ATOM   3628 O O     . LYS C 3 411 ? 11.112  44.462 47.238  1.00 23.65  ? 706  LYS A O     1 
ATOM   3629 C CB    . LYS C 3 411 ? 12.687  47.365 47.901  1.00 23.00  ? 706  LYS A CB    1 
ATOM   3630 C CG    . LYS C 3 411 ? 12.954  47.265 46.411  1.00 25.05  ? 706  LYS A CG    1 
ATOM   3631 C CD    . LYS C 3 411 ? 14.006  48.238 45.947  1.00 26.43  ? 706  LYS A CD    1 
ATOM   3632 C CE    . LYS C 3 411 ? 14.234  48.140 44.455  1.00 29.07  ? 706  LYS A CE    1 
ATOM   3633 N NZ    . LYS C 3 411 ? 15.421  48.930 44.041  1.00 30.14  ? 706  LYS A NZ    1 
ATOM   3634 N N     . ALA C 3 412 ? 12.610  44.391 48.982  1.00 21.59  ? 707  ALA A N     1 
ATOM   3635 C CA    . ALA C 3 412 ? 12.941  42.949 48.866  1.00 21.08  ? 707  ALA A CA    1 
ATOM   3636 C C     . ALA C 3 412 ? 11.688  42.104 49.112  1.00 20.56  ? 707  ALA A C     1 
ATOM   3637 O O     . ALA C 3 412 ? 11.515  41.094 48.412  1.00 19.24  ? 707  ALA A O     1 
ATOM   3638 C CB    . ALA C 3 412 ? 14.059  42.533 49.810  1.00 20.79  ? 707  ALA A CB    1 
ATOM   3639 N N     . VAL C 3 413 ? 10.873  42.469 50.093  1.00 20.10  ? 708  VAL A N     1 
ATOM   3640 C CA    . VAL C 3 413 ? 9.586   41.772 50.359  1.00 20.59  ? 708  VAL A CA    1 
ATOM   3641 C C     . VAL C 3 413 ? 8.703   41.907 49.116  1.00 21.72  ? 708  VAL A C     1 
ATOM   3642 O O     . VAL C 3 413 ? 8.151   40.906 48.705  1.00 21.54  ? 708  VAL A O     1 
ATOM   3643 C CB    . VAL C 3 413 ? 8.907   42.341 51.609  1.00 22.66  ? 708  VAL A CB    1 
ATOM   3644 C CG1   . VAL C 3 413 ? 7.493   41.809 51.783  1.00 22.53  ? 708  VAL A CG1   1 
ATOM   3645 C CG2   . VAL C 3 413 ? 9.758   42.057 52.837  1.00 24.10  ? 708  VAL A CG2   1 
ATOM   3646 N N     . ASN C 3 414 ? 8.594   43.094 48.515  1.00 22.40  ? 709  ASN A N     1 
ATOM   3647 C CA    . ASN C 3 414 ? 7.766   43.254 47.289  1.00 22.37  ? 709  ASN A CA    1 
ATOM   3648 C C     . ASN C 3 414 ? 8.237   42.237 46.247  1.00 24.60  ? 709  ASN A C     1 
ATOM   3649 O O     . ASN C 3 414 ? 7.373   41.516 45.722  1.00 22.50  ? 709  ASN A O     1 
ATOM   3650 C CB    . ASN C 3 414 ? 7.701   44.694 46.789  1.00 20.98  ? 709  ASN A CB    1 
ATOM   3651 C CG    . ASN C 3 414 ? 6.662   45.519 47.527  1.00 19.09  ? 709  ASN A CG    1 
ATOM   3652 O OD1   . ASN C 3 414 ? 5.679   44.986 48.008  1.00 19.66  ? 709  ASN A OD1   1 
ATOM   3653 N ND2   . ASN C 3 414 ? 6.860   46.822 47.600  1.00 19.40  ? 709  ASN A ND2   1 
ATOM   3654 N N     . PHE C 3 415 ? 9.545   42.095 46.030  1.00 26.96  ? 710  PHE A N     1 
ATOM   3655 C CA    . PHE C 3 415 ? 10.107  41.104 45.070  1.00 31.57  ? 710  PHE A CA    1 
ATOM   3656 C C     . PHE C 3 415 ? 9.739   39.689 45.535  1.00 28.46  ? 710  PHE A C     1 
ATOM   3657 O O     . PHE C 3 415 ? 9.278   38.886 44.722  1.00 27.27  ? 710  PHE A O     1 
ATOM   3658 C CB    . PHE C 3 415 ? 11.607  41.340 44.847  1.00 38.78  ? 710  PHE A CB    1 
ATOM   3659 C CG    . PHE C 3 415 ? 11.878  42.421 43.826  1.00 48.11  ? 710  PHE A CG    1 
ATOM   3660 C CD1   . PHE C 3 415 ? 11.401  43.713 44.008  1.00 59.61  ? 710  PHE A CD1   1 
ATOM   3661 C CD2   . PHE C 3 415 ? 12.525  42.136 42.632  1.00 57.60  ? 710  PHE A CD2   1 
ATOM   3662 C CE1   . PHE C 3 415 ? 11.607  44.697 43.049  1.00 62.12  ? 710  PHE A CE1   1 
ATOM   3663 C CE2   . PHE C 3 415 ? 12.729  43.120 41.672  1.00 56.85  ? 710  PHE A CE2   1 
ATOM   3664 C CZ    . PHE C 3 415 ? 12.284  44.402 41.886  1.00 58.37  ? 710  PHE A CZ    1 
ATOM   3665 N N     . GLY C 3 416 ? 9.876   39.414 46.828  1.00 29.34  ? 711  GLY A N     1 
ATOM   3666 C CA    . GLY C 3 416 ? 9.581   38.103 47.434  1.00 29.85  ? 711  GLY A CA    1 
ATOM   3667 C C     . GLY C 3 416 ? 8.137   37.670 47.201  1.00 30.81  ? 711  GLY A C     1 
ATOM   3668 O O     . GLY C 3 416 ? 7.907   36.472 46.923  1.00 33.47  ? 711  GLY A O     1 
ATOM   3669 N N     . ILE C 3 417 ? 7.191   38.610 47.299  1.00 27.81  ? 712  ILE A N     1 
ATOM   3670 C CA    . ILE C 3 417 ? 5.754   38.391 46.968  1.00 25.13  ? 712  ILE A CA    1 
ATOM   3671 C C     . ILE C 3 417 ? 5.630   38.068 45.470  1.00 25.09  ? 712  ILE A C     1 
ATOM   3672 O O     . ILE C 3 417 ? 4.923   37.124 45.162  1.00 22.37  ? 712  ILE A O     1 
ATOM   3673 C CB    . ILE C 3 417 ? 4.873   39.586 47.384  1.00 25.74  ? 712  ILE A CB    1 
ATOM   3674 C CG1   . ILE C 3 417 ? 4.996   39.901 48.882  1.00 26.79  ? 712  ILE A CG1   1 
ATOM   3675 C CG2   . ILE C 3 417 ? 3.418   39.318 47.007  1.00 26.33  ? 712  ILE A CG2   1 
ATOM   3676 C CD1   . ILE C 3 417 ? 4.644   38.724 49.787  1.00 26.50  ? 712  ILE A CD1   1 
ATOM   3677 N N     . VAL C 3 418 ? 6.287   38.807 44.574  1.00 23.59  ? 713  VAL A N     1 
ATOM   3678 C CA    . VAL C 3 418 ? 6.103   38.629 43.100  1.00 26.09  ? 713  VAL A CA    1 
ATOM   3679 C C     . VAL C 3 418 ? 6.721   37.284 42.669  1.00 25.46  ? 713  VAL A C     1 
ATOM   3680 O O     . VAL C 3 418 ? 6.189   36.655 41.725  1.00 24.25  ? 713  VAL A O     1 
ATOM   3681 C CB    . VAL C 3 418 ? 6.668   39.813 42.285  1.00 25.82  ? 713  VAL A CB    1 
ATOM   3682 C CG1   . VAL C 3 418 ? 6.744   39.475 40.815  1.00 28.55  ? 713  VAL A CG1   1 
ATOM   3683 C CG2   . VAL C 3 418 ? 5.856   41.086 42.466  1.00 27.51  ? 713  VAL A CG2   1 
ATOM   3684 N N     . TYR C 3 419 ? 7.798   36.862 43.333  1.00 26.92  ? 714  TYR A N     1 
ATOM   3685 C CA    . TYR C 3 419 ? 8.547   35.608 43.046  1.00 27.78  ? 714  TYR A CA    1 
ATOM   3686 C C     . TYR C 3 419 ? 7.937   34.423 43.818  1.00 29.42  ? 714  TYR A C     1 
ATOM   3687 O O     . TYR C 3 419 ? 8.396   33.288 43.610  1.00 33.04  ? 714  TYR A O     1 
ATOM   3688 C CB    . TYR C 3 419 ? 10.025  35.791 43.401  1.00 25.95  ? 714  TYR A CB    1 
ATOM   3689 C CG    . TYR C 3 419 ? 10.763  36.851 42.619  1.00 26.14  ? 714  TYR A CG    1 
ATOM   3690 C CD1   . TYR C 3 419 ? 10.245  37.385 41.452  1.00 25.91  ? 714  TYR A CD1   1 
ATOM   3691 C CD2   . TYR C 3 419 ? 12.012  37.307 43.030  1.00 28.00  ? 714  TYR A CD2   1 
ATOM   3692 C CE1   . TYR C 3 419 ? 10.920  38.355 40.726  1.00 25.59  ? 714  TYR A CE1   1 
ATOM   3693 C CE2   . TYR C 3 419 ? 12.703  38.288 42.316  1.00 29.35  ? 714  TYR A CE2   1 
ATOM   3694 C CZ    . TYR C 3 419 ? 12.156  38.801 41.148  1.00 26.94  ? 714  TYR A CZ    1 
ATOM   3695 O OH    . TYR C 3 419 ? 12.804  39.746 40.411  1.00 27.13  ? 714  TYR A OH    1 
ATOM   3696 N N     . GLY C 3 420 ? 6.954   34.694 44.680  1.00 29.85  ? 715  GLY A N     1 
ATOM   3697 C CA    . GLY C 3 420 ? 6.327   33.766 45.636  1.00 31.43  ? 715  GLY A CA    1 
ATOM   3698 C C     . GLY C 3 420 ? 7.309   33.102 46.582  1.00 36.10  ? 715  GLY A C     1 
ATOM   3699 O O     . GLY C 3 420 ? 7.101   31.909 46.855  1.00 36.45  ? 715  GLY A O     1 
ATOM   3700 N N     . MET C 3 421 ? 8.348   33.781 47.091  1.00 41.02  ? 716  MET A N     1 
ATOM   3701 C CA    . MET C 3 421 ? 9.359   33.024 47.884  1.00 45.63  ? 716  MET A CA    1 
ATOM   3702 C C     . MET C 3 421 ? 8.798   32.707 49.285  1.00 45.56  ? 716  MET A C     1 
ATOM   3703 O O     . MET C 3 421 ? 7.875   33.401 49.780  1.00 44.41  ? 716  MET A O     1 
ATOM   3704 C CB    . MET C 3 421 ? 10.777  33.627 47.957  1.00 49.94  ? 716  MET A CB    1 
ATOM   3705 C CG    . MET C 3 421 ? 10.914  35.101 47.676  1.00 52.47  ? 716  MET A CG    1 
ATOM   3706 S SD    . MET C 3 421 ? 12.571  35.771 48.109  1.00 54.62  ? 716  MET A SD    1 
ATOM   3707 C CE    . MET C 3 421 ? 13.393  35.793 46.512  1.00 53.85  ? 716  MET A CE    1 
ATOM   3708 N N     . SER C 3 422 ? 9.281   31.591 49.829  1.00 45.49  ? 717  SER A N     1 
ATOM   3709 C CA    . SER C 3 422 ? 9.094   31.112 51.224  1.00 50.06  ? 717  SER A CA    1 
ATOM   3710 C C     . SER C 3 422 ? 9.835   32.036 52.194  1.00 48.90  ? 717  SER A C     1 
ATOM   3711 O O     . SER C 3 422 ? 10.731  32.774 51.726  1.00 44.45  ? 717  SER A O     1 
ATOM   3712 C CB    . SER C 3 422 ? 9.643   29.710 51.360  1.00 49.35  ? 717  SER A CB    1 
ATOM   3713 O OG    . SER C 3 422 ? 11.018  29.677 50.955  1.00 43.79  ? 717  SER A OG    1 
ATOM   3714 N N     . ASP C 3 423 ? 9.518   31.938 53.492  1.00 48.07  ? 718  ASP A N     1 
ATOM   3715 C CA    . ASP C 3 423 ? 10.400  32.408 54.595  1.00 50.92  ? 718  ASP A CA    1 
ATOM   3716 C C     . ASP C 3 423 ? 11.880  32.139 54.236  1.00 57.02  ? 718  ASP A C     1 
ATOM   3717 O O     . ASP C 3 423 ? 12.677  33.119 54.172  1.00 57.74  ? 718  ASP A O     1 
ATOM   3718 C CB    . ASP C 3 423 ? 9.963   31.824 55.945  1.00 54.53  ? 718  ASP A CB    1 
ATOM   3719 C CG    . ASP C 3 423 ? 9.378   30.417 55.934  1.00 57.94  ? 718  ASP A CG    1 
ATOM   3720 O OD1   . ASP C 3 423 ? 9.937   29.558 55.222  1.00 59.44  ? 718  ASP A OD1   1 
ATOM   3721 O OD2   . ASP C 3 423 ? 8.368   30.186 56.658  1.00 55.68  ? 718  ASP A OD2   1 
ATOM   3722 N N     . TYR C 3 424 ? 12.268  30.888 53.967  1.00 61.80  ? 719  TYR A N     1 
ATOM   3723 C CA    . TYR C 3 424 ? 13.691  30.530 53.705  1.00 72.29  ? 719  TYR A CA    1 
ATOM   3724 C C     . TYR C 3 424 ? 14.244  31.433 52.596  1.00 62.39  ? 719  TYR A C     1 
ATOM   3725 O O     . TYR C 3 424 ? 15.332  31.991 52.798  1.00 65.13  ? 719  TYR A O     1 
ATOM   3726 C CB    . TYR C 3 424 ? 13.894  29.051 53.343  1.00 86.71  ? 719  TYR A CB    1 
ATOM   3727 C CG    . TYR C 3 424 ? 15.323  28.682 52.999  1.00 104.34 ? 719  TYR A CG    1 
ATOM   3728 C CD1   . TYR C 3 424 ? 15.809  28.826 51.702  1.00 109.66 ? 719  TYR A CD1   1 
ATOM   3729 C CD2   . TYR C 3 424 ? 16.200  28.200 53.964  1.00 109.19 ? 719  TYR A CD2   1 
ATOM   3730 C CE1   . TYR C 3 424 ? 17.118  28.507 51.375  1.00 109.60 ? 719  TYR A CE1   1 
ATOM   3731 C CE2   . TYR C 3 424 ? 17.512  27.872 53.652  1.00 112.53 ? 719  TYR A CE2   1 
ATOM   3732 C CZ    . TYR C 3 424 ? 17.971  28.026 52.354  1.00 116.79 ? 719  TYR A CZ    1 
ATOM   3733 O OH    . TYR C 3 424 ? 19.258  27.702 52.036  1.00 121.52 ? 719  TYR A OH    1 
ATOM   3734 N N     . GLY C 3 425 ? 13.539  31.548 51.465  1.00 56.94  ? 720  GLY A N     1 
ATOM   3735 C CA    . GLY C 3 425 ? 14.029  32.290 50.286  1.00 56.22  ? 720  GLY A CA    1 
ATOM   3736 C C     . GLY C 3 425 ? 14.269  33.751 50.630  1.00 55.63  ? 720  GLY A C     1 
ATOM   3737 O O     . GLY C 3 425 ? 15.325  34.319 50.199  1.00 44.66  ? 720  GLY A O     1 
ATOM   3738 N N     . LEU C 3 426 ? 13.335  34.327 51.405  1.00 48.22  ? 721  LEU A N     1 
ATOM   3739 C CA    . LEU C 3 426 ? 13.350  35.758 51.795  1.00 47.18  ? 721  LEU A CA    1 
ATOM   3740 C C     . LEU C 3 426 ? 14.472  35.970 52.822  1.00 47.76  ? 721  LEU A C     1 
ATOM   3741 O O     . LEU C 3 426 ? 15.222  36.959 52.682  1.00 49.63  ? 721  LEU A O     1 
ATOM   3742 C CB    . LEU C 3 426 ? 11.970  36.148 52.339  1.00 40.60  ? 721  LEU A CB    1 
ATOM   3743 C CG    . LEU C 3 426 ? 11.747  37.639 52.615  1.00 37.18  ? 721  LEU A CG    1 
ATOM   3744 C CD1   . LEU C 3 426 ? 12.144  38.493 51.418  1.00 35.24  ? 721  LEU A CD1   1 
ATOM   3745 C CD2   . LEU C 3 426 ? 10.304  37.916 53.023  1.00 35.83  ? 721  LEU A CD2   1 
ATOM   3746 N N     . ALA C 3 427 ? 14.592  35.052 53.784  1.00 48.61  ? 722  ALA A N     1 
ATOM   3747 C CA    . ALA C 3 427 ? 15.685  34.995 54.784  1.00 48.28  ? 722  ALA A CA    1 
ATOM   3748 C C     . ALA C 3 427 ? 17.034  34.968 54.066  1.00 45.30  ? 722  ALA A C     1 
ATOM   3749 O O     . ALA C 3 427 ? 17.882  35.817 54.357  1.00 42.10  ? 722  ALA A O     1 
ATOM   3750 C CB    . ALA C 3 427 ? 15.500  33.786 55.663  1.00 50.83  ? 722  ALA A CB    1 
ATOM   3751 N N     . GLN C 3 428 ? 17.211  34.038 53.130  1.00 52.25  ? 723  GLN A N     1 
ATOM   3752 C CA    . GLN C 3 428 ? 18.460  33.918 52.328  1.00 60.80  ? 723  GLN A CA    1 
ATOM   3753 C C     . GLN C 3 428 ? 18.714  35.250 51.619  1.00 57.20  ? 723  GLN A C     1 
ATOM   3754 O O     . GLN C 3 428 ? 19.861  35.755 51.675  1.00 61.12  ? 723  GLN A O     1 
ATOM   3755 C CB    . GLN C 3 428 ? 18.380  32.767 51.315  1.00 70.20  ? 723  GLN A CB    1 
ATOM   3756 C CG    . GLN C 3 428 ? 19.726  32.417 50.678  1.00 75.43  ? 723  GLN A CG    1 
ATOM   3757 C CD    . GLN C 3 428 ? 19.837  32.772 49.212  1.00 80.68  ? 723  GLN A CD    1 
ATOM   3758 O OE1   . GLN C 3 428 ? 19.509  33.879 48.782  1.00 77.63  ? 723  GLN A OE1   1 
ATOM   3759 N NE2   . GLN C 3 428 ? 20.332  31.827 48.427  1.00 82.57  ? 723  GLN A NE2   1 
ATOM   3760 N N     . ASN C 3 429 ? 17.680  35.797 50.975  1.00 57.08  ? 724  ASN A N     1 
ATOM   3761 C CA    . ASN C 3 429 ? 17.786  37.043 50.172  1.00 53.72  ? 724  ASN A CA    1 
ATOM   3762 C C     . ASN C 3 429 ? 18.152  38.216 51.095  1.00 52.53  ? 724  ASN A C     1 
ATOM   3763 O O     . ASN C 3 429 ? 18.977  39.055 50.670  1.00 51.56  ? 724  ASN A O     1 
ATOM   3764 C CB    . ASN C 3 429 ? 16.508  37.304 49.375  1.00 57.91  ? 724  ASN A CB    1 
ATOM   3765 C CG    . ASN C 3 429 ? 16.667  38.452 48.405  1.00 57.86  ? 724  ASN A CG    1 
ATOM   3766 O OD1   . ASN C 3 429 ? 16.447  39.609 48.770  1.00 60.89  ? 724  ASN A OD1   1 
ATOM   3767 N ND2   . ASN C 3 429 ? 17.051  38.139 47.176  1.00 50.27  ? 724  ASN A ND2   1 
ATOM   3768 N N     . LEU C 3 430 ? 17.599  38.274 52.315  1.00 47.85  ? 725  LEU A N     1 
ATOM   3769 C CA    . LEU C 3 430 ? 17.795  39.436 53.230  1.00 53.00  ? 725  LEU A CA    1 
ATOM   3770 C C     . LEU C 3 430 ? 18.930  39.191 54.243  1.00 59.62  ? 725  LEU A C     1 
ATOM   3771 O O     . LEU C 3 430 ? 19.281  40.154 54.954  1.00 56.44  ? 725  LEU A O     1 
ATOM   3772 C CB    . LEU C 3 430 ? 16.469  39.746 53.935  1.00 52.75  ? 725  LEU A CB    1 
ATOM   3773 C CG    . LEU C 3 430 ? 15.488  40.555 53.087  1.00 54.65  ? 725  LEU A CG    1 
ATOM   3774 C CD1   . LEU C 3 430 ? 14.173  40.796 53.819  1.00 51.12  ? 725  LEU A CD1   1 
ATOM   3775 C CD2   . LEU C 3 430 ? 16.127  41.872 52.656  1.00 56.02  ? 725  LEU A CD2   1 
ATOM   3776 N N     . ASN C 3 431 ? 19.507  37.981 54.295  1.00 63.51  ? 726  ASN A N     1 
ATOM   3777 C CA    . ASN C 3 431 ? 20.464  37.561 55.360  1.00 64.27  ? 726  ASN A CA    1 
ATOM   3778 C C     . ASN C 3 431 ? 19.811  37.843 56.717  1.00 55.36  ? 726  ASN A C     1 
ATOM   3779 O O     . ASN C 3 431 ? 20.385  38.619 57.493  1.00 57.82  ? 726  ASN A O     1 
ATOM   3780 C CB    . ASN C 3 431 ? 21.821  38.278 55.278  1.00 70.19  ? 726  ASN A CB    1 
ATOM   3781 C CG    . ASN C 3 431 ? 22.433  38.303 53.891  1.00 78.59  ? 726  ASN A CG    1 
ATOM   3782 O OD1   . ASN C 3 431 ? 22.314  37.345 53.125  1.00 83.95  ? 726  ASN A OD1   1 
ATOM   3783 N ND2   . ASN C 3 431 ? 23.109  39.394 53.562  1.00 75.01  ? 726  ASN A ND2   1 
ATOM   3784 N N     . ILE C 3 432 ? 18.623  37.285 56.953  1.00 46.89  ? 727  ILE A N     1 
ATOM   3785 C CA    . ILE C 3 432 ? 17.896  37.357 58.257  1.00 48.98  ? 727  ILE A CA    1 
ATOM   3786 C C     . ILE C 3 432 ? 17.439  35.936 58.600  1.00 49.38  ? 727  ILE A C     1 
ATOM   3787 O O     . ILE C 3 432 ? 17.805  35.017 57.821  1.00 48.56  ? 727  ILE A O     1 
ATOM   3788 C CB    . ILE C 3 432 ? 16.738  38.383 58.201  1.00 47.49  ? 727  ILE A CB    1 
ATOM   3789 C CG1   . ILE C 3 432 ? 15.618  37.957 57.238  1.00 49.18  ? 727  ILE A CG1   1 
ATOM   3790 C CG2   . ILE C 3 432 ? 17.280  39.765 57.861  1.00 45.25  ? 727  ILE A CG2   1 
ATOM   3791 C CD1   . ILE C 3 432 ? 14.314  38.742 57.377  1.00 46.87  ? 727  ILE A CD1   1 
ATOM   3792 N N     . SER C 3 433 ? 16.682  35.749 59.693  1.00 50.65  ? 728  SER A N     1 
ATOM   3793 C CA    . SER C 3 433 ? 16.116  34.426 60.086  1.00 53.81  ? 728  SER A CA    1 
ATOM   3794 C C     . SER C 3 433 ? 14.839  34.125 59.276  1.00 63.19  ? 728  SER A C     1 
ATOM   3795 O O     . SER C 3 433 ? 14.370  35.009 58.509  1.00 61.49  ? 728  SER A O     1 
ATOM   3796 C CB    . SER C 3 433 ? 15.904  34.308 61.591  1.00 47.42  ? 728  SER A CB    1 
ATOM   3797 O OG    . SER C 3 433 ? 14.634  34.778 62.008  1.00 47.80  ? 728  SER A OG    1 
ATOM   3798 N N     . ARG C 3 434 ? 14.331  32.893 59.402  1.00 69.98  ? 729  ARG A N     1 
ATOM   3799 C CA    . ARG C 3 434 ? 13.115  32.400 58.702  1.00 71.17  ? 729  ARG A CA    1 
ATOM   3800 C C     . ARG C 3 434 ? 11.878  32.877 59.460  1.00 65.77  ? 729  ARG A C     1 
ATOM   3801 O O     . ARG C 3 434 ? 10.947  33.375 58.815  1.00 66.31  ? 729  ARG A O     1 
ATOM   3802 C CB    . ARG C 3 434 ? 13.122  30.873 58.583  1.00 79.82  ? 729  ARG A CB    1 
ATOM   3803 C CG    . ARG C 3 434 ? 14.091  30.353 57.529  1.00 89.44  ? 729  ARG A CG    1 
ATOM   3804 C CD    . ARG C 3 434 ? 13.661  29.037 56.902  1.00 98.93  ? 729  ARG A CD    1 
ATOM   3805 N NE    . ARG C 3 434 ? 13.485  27.978 57.887  1.00 106.34 ? 729  ARG A NE    1 
ATOM   3806 C CZ    . ARG C 3 434 ? 13.396  26.681 57.609  1.00 100.93 ? 729  ARG A CZ    1 
ATOM   3807 N NH1   . ARG C 3 434 ? 13.468  26.251 56.359  1.00 92.68  ? 729  ARG A NH1   1 
ATOM   3808 N NH2   . ARG C 3 434 ? 13.241  25.816 58.597  1.00 101.88 ? 729  ARG A NH2   1 
ATOM   3809 N N     . LYS C 3 435 ? 11.879  32.740 60.782  1.00 60.96  ? 730  LYS A N     1 
ATOM   3810 C CA    . LYS C 3 435 ? 10.783  33.239 61.651  1.00 64.88  ? 730  LYS A CA    1 
ATOM   3811 C C     . LYS C 3 435 ? 10.570  34.740 61.385  1.00 60.15  ? 730  LYS A C     1 
ATOM   3812 O O     . LYS C 3 435 ? 9.417   35.207 61.457  1.00 55.04  ? 730  LYS A O     1 
ATOM   3813 C CB    . LYS C 3 435 ? 11.142  32.930 63.106  1.00 69.56  ? 730  LYS A CB    1 
ATOM   3814 C CG    . LYS C 3 435 ? 10.078  33.266 64.140  1.00 76.46  ? 730  LYS A CG    1 
ATOM   3815 C CD    . LYS C 3 435 ? 10.526  32.933 65.550  1.00 81.27  ? 730  LYS A CD    1 
ATOM   3816 C CE    . LYS C 3 435 ? 9.564   33.433 66.604  1.00 83.63  ? 730  LYS A CE    1 
ATOM   3817 N NZ    . LYS C 3 435 ? 10.169  33.355 67.953  1.00 86.45  ? 730  LYS A NZ    1 
ATOM   3818 N N     . GLU C 3 436 ? 11.649  35.476 61.105  1.00 59.21  ? 731  GLU A N     1 
ATOM   3819 C CA    . GLU C 3 436 ? 11.603  36.939 60.838  1.00 61.34  ? 731  GLU A CA    1 
ATOM   3820 C C     . GLU C 3 436 ? 10.950  37.174 59.467  1.00 52.36  ? 731  GLU A C     1 
ATOM   3821 O O     . GLU C 3 436 ? 9.916   37.867 59.406  1.00 45.76  ? 731  GLU A O     1 
ATOM   3822 C CB    . GLU C 3 436 ? 13.011  37.542 60.897  1.00 64.24  ? 731  GLU A CB    1 
ATOM   3823 C CG    . GLU C 3 436 ? 13.499  37.836 62.307  1.00 63.19  ? 731  GLU A CG    1 
ATOM   3824 C CD    . GLU C 3 436 ? 15.009  37.963 62.441  1.00 64.19  ? 731  GLU A CD    1 
ATOM   3825 O OE1   . GLU C 3 436 ? 15.729  37.882 61.412  1.00 68.08  ? 731  GLU A OE1   1 
ATOM   3826 O OE2   . GLU C 3 436 ? 15.469  38.127 63.578  1.00 64.42  ? 731  GLU A OE2   1 
ATOM   3827 N N     . ALA C 3 437 ? 11.556  36.615 58.418  1.00 45.73  ? 732  ALA A N     1 
ATOM   3828 C CA    . ALA C 3 437 ? 11.040  36.605 57.033  1.00 45.13  ? 732  ALA A CA    1 
ATOM   3829 C C     . ALA C 3 437 ? 9.537   36.262 57.035  1.00 43.37  ? 732  ALA A C     1 
ATOM   3830 O O     . ALA C 3 437 ? 8.773   36.983 56.360  1.00 38.39  ? 732  ALA A O     1 
ATOM   3831 C CB    . ALA C 3 437 ? 11.878  35.677 56.189  1.00 43.42  ? 732  ALA A CB    1 
ATOM   3832 N N     . ALA C 3 438 ? 9.092   35.306 57.856  1.00 41.42  ? 733  ALA A N     1 
ATOM   3833 C CA    . ALA C 3 438 ? 7.665   34.897 57.954  1.00 43.50  ? 733  ALA A CA    1 
ATOM   3834 C C     . ALA C 3 438 ? 6.793   35.991 58.595  1.00 42.05  ? 733  ALA A C     1 
ATOM   3835 O O     . ALA C 3 438 ? 5.584   36.092 58.205  1.00 40.96  ? 733  ALA A O     1 
ATOM   3836 C CB    . ALA C 3 438 ? 7.536   33.590 58.714  1.00 44.58  ? 733  ALA A CB    1 
ATOM   3837 N N     . GLU C 3 439 ? 7.318   36.741 59.574  1.00 44.44  ? 734  GLU A N     1 
ATOM   3838 C CA    . GLU C 3 439 ? 6.583   37.877 60.207  1.00 47.61  ? 734  GLU A CA    1 
ATOM   3839 C C     . GLU C 3 439 ? 6.362   38.980 59.151  1.00 42.22  ? 734  GLU A C     1 
ATOM   3840 O O     . GLU C 3 439 ? 5.247   39.547 59.121  1.00 40.18  ? 734  GLU A O     1 
ATOM   3841 C CB    . GLU C 3 439 ? 7.329   38.411 61.436  1.00 57.16  ? 734  GLU A CB    1 
ATOM   3842 C CG    . GLU C 3 439 ? 7.015   37.660 62.723  1.00 65.63  ? 734  GLU A CG    1 
ATOM   3843 C CD    . GLU C 3 439 ? 7.949   37.969 63.890  1.00 74.57  ? 734  GLU A CD    1 
ATOM   3844 O OE1   . GLU C 3 439 ? 8.146   39.174 64.187  1.00 76.21  ? 734  GLU A OE1   1 
ATOM   3845 O OE2   . GLU C 3 439 ? 8.490   37.006 64.500  1.00 72.16  ? 734  GLU A OE2   1 
ATOM   3846 N N     . PHE C 3 440 ? 7.379   39.255 58.316  1.00 37.48  ? 735  PHE A N     1 
ATOM   3847 C CA    . PHE C 3 440 ? 7.354   40.247 57.203  1.00 37.76  ? 735  PHE A CA    1 
ATOM   3848 C C     . PHE C 3 440 ? 6.226   39.854 56.242  1.00 35.12  ? 735  PHE A C     1 
ATOM   3849 O O     . PHE C 3 440 ? 5.263   40.638 56.061  1.00 37.59  ? 735  PHE A O     1 
ATOM   3850 C CB    . PHE C 3 440 ? 8.696   40.299 56.454  1.00 39.44  ? 735  PHE A CB    1 
ATOM   3851 C CG    . PHE C 3 440 ? 9.825   41.063 57.104  1.00 38.70  ? 735  PHE A CG    1 
ATOM   3852 C CD1   . PHE C 3 440 ? 9.781   41.446 58.437  1.00 41.06  ? 735  PHE A CD1   1 
ATOM   3853 C CD2   . PHE C 3 440 ? 10.965  41.362 56.378  1.00 41.82  ? 735  PHE A CD2   1 
ATOM   3854 C CE1   . PHE C 3 440 ? 10.839  42.131 59.021  1.00 42.30  ? 735  PHE A CE1   1 
ATOM   3855 C CE2   . PHE C 3 440 ? 12.027  42.039 56.964  1.00 42.86  ? 735  PHE A CE2   1 
ATOM   3856 C CZ    . PHE C 3 440 ? 11.965  42.415 58.288  1.00 40.48  ? 735  PHE A CZ    1 
ATOM   3857 N N     . ILE C 3 441 ? 6.305   38.630 55.720  1.00 34.07  ? 736  ILE A N     1 
ATOM   3858 C CA    . ILE C 3 441 ? 5.300   38.032 54.790  1.00 34.79  ? 736  ILE A CA    1 
ATOM   3859 C C     . ILE C 3 441 ? 3.915   38.070 55.441  1.00 36.82  ? 736  ILE A C     1 
ATOM   3860 O O     . ILE C 3 441 ? 2.973   38.538 54.754  1.00 35.91  ? 736  ILE A O     1 
ATOM   3861 C CB    . ILE C 3 441 ? 5.701   36.623 54.337  1.00 34.76  ? 736  ILE A CB    1 
ATOM   3862 C CG1   . ILE C 3 441 ? 6.939   36.649 53.447  1.00 34.04  ? 736  ILE A CG1   1 
ATOM   3863 C CG2   . ILE C 3 441 ? 4.533   35.938 53.634  1.00 39.79  ? 736  ILE A CG2   1 
ATOM   3864 C CD1   . ILE C 3 441 ? 7.441   35.277 53.122  1.00 36.66  ? 736  ILE A CD1   1 
ATOM   3865 N N     . GLU C 3 442 ? 3.783   37.700 56.717  1.00 36.10  ? 737  GLU A N     1 
ATOM   3866 C CA    . GLU C 3 442 ? 2.442   37.666 57.361  1.00 39.78  ? 737  GLU A CA    1 
ATOM   3867 C C     . GLU C 3 442 ? 1.901   39.093 57.436  1.00 37.50  ? 737  GLU A C     1 
ATOM   3868 O O     . GLU C 3 442 ? 0.700   39.285 57.196  1.00 34.57  ? 737  GLU A O     1 
ATOM   3869 C CB    . GLU C 3 442 ? 2.493   36.997 58.737  1.00 49.54  ? 737  GLU A CB    1 
ATOM   3870 C CG    . GLU C 3 442 ? 1.199   37.115 59.543  1.00 58.39  ? 737  GLU A CG    1 
ATOM   3871 C CD    . GLU C 3 442 ? 1.277   36.540 60.960  1.00 69.61  ? 737  GLU A CD    1 
ATOM   3872 O OE1   . GLU C 3 442 ? 0.985   37.286 61.939  1.00 60.36  ? 737  GLU A OE1   1 
ATOM   3873 O OE2   . GLU C 3 442 ? 1.639   35.341 61.091  1.00 75.98  ? 737  GLU A OE2   1 
ATOM   3874 N N     . ARG C 3 443 ? 2.759   40.054 57.778  1.00 38.92  ? 738  ARG A N     1 
ATOM   3875 C CA    . ARG C 3 443 ? 2.373   41.486 57.922  1.00 40.07  ? 738  ARG A CA    1 
ATOM   3876 C C     . ARG C 3 443 ? 2.004   42.037 56.534  1.00 33.67  ? 738  ARG A C     1 
ATOM   3877 O O     . ARG C 3 443 ? 0.995   42.743 56.418  1.00 39.69  ? 738  ARG A O     1 
ATOM   3878 C CB    . ARG C 3 443 ? 3.516   42.259 58.602  1.00 49.23  ? 738  ARG A CB    1 
ATOM   3879 C CG    . ARG C 3 443 ? 3.671   41.975 60.097  1.00 54.78  ? 738  ARG A CG    1 
ATOM   3880 C CD    . ARG C 3 443 ? 3.481   43.134 61.060  1.00 57.92  ? 738  ARG A CD    1 
ATOM   3881 N NE    . ARG C 3 443 ? 2.922   44.321 60.426  1.00 67.28  ? 738  ARG A NE    1 
ATOM   3882 C CZ    . ARG C 3 443 ? 1.640   44.499 60.103  1.00 74.56  ? 738  ARG A CZ    1 
ATOM   3883 N NH1   . ARG C 3 443 ? 0.747   43.552 60.346  1.00 78.71  ? 738  ARG A NH1   1 
ATOM   3884 N NH2   . ARG C 3 443 ? 1.258   45.624 59.521  1.00 73.74  ? 738  ARG A NH2   1 
ATOM   3885 N N     . TYR C 3 444 ? 2.779   41.712 55.505  1.00 27.99  ? 739  TYR A N     1 
ATOM   3886 C CA    . TYR C 3 444 ? 2.448   42.052 54.102  1.00 28.07  ? 739  TYR A CA    1 
ATOM   3887 C C     . TYR C 3 444 ? 1.021   41.582 53.791  1.00 28.18  ? 739  TYR A C     1 
ATOM   3888 O O     . TYR C 3 444 ? 0.217   42.372 53.281  1.00 27.90  ? 739  TYR A O     1 
ATOM   3889 C CB    . TYR C 3 444 ? 3.430   41.433 53.103  1.00 26.37  ? 739  TYR A CB    1 
ATOM   3890 C CG    . TYR C 3 444 ? 3.088   41.829 51.696  1.00 24.82  ? 739  TYR A CG    1 
ATOM   3891 C CD1   . TYR C 3 444 ? 2.093   41.174 50.991  1.00 23.05  ? 739  TYR A CD1   1 
ATOM   3892 C CD2   . TYR C 3 444 ? 3.682   42.936 51.112  1.00 23.91  ? 739  TYR A CD2   1 
ATOM   3893 C CE1   . TYR C 3 444 ? 1.735   41.588 49.718  1.00 24.18  ? 739  TYR A CE1   1 
ATOM   3894 C CE2   . TYR C 3 444 ? 3.337   43.359 49.841  1.00 23.11  ? 739  TYR A CE2   1 
ATOM   3895 C CZ    . TYR C 3 444 ? 2.372   42.671 49.133  1.00 22.83  ? 739  TYR A CZ    1 
ATOM   3896 O OH    . TYR C 3 444 ? 2.020   43.098 47.893  1.00 20.37  ? 739  TYR A OH    1 
ATOM   3897 N N     . PHE C 3 445 ? 0.709   40.324 54.096  1.00 28.05  ? 740  PHE A N     1 
ATOM   3898 C CA    . PHE C 3 445 ? -0.601  39.708 53.749  1.00 29.36  ? 740  PHE A CA    1 
ATOM   3899 C C     . PHE C 3 445 ? -1.711  40.359 54.572  1.00 29.18  ? 740  PHE A C     1 
ATOM   3900 O O     . PHE C 3 445 ? -2.802  40.542 54.014  1.00 32.06  ? 740  PHE A O     1 
ATOM   3901 C CB    . PHE C 3 445 ? -0.542  38.183 53.877  1.00 29.90  ? 740  PHE A CB    1 
ATOM   3902 C CG    . PHE C 3 445 ? 0.173   37.516 52.732  1.00 29.91  ? 740  PHE A CG    1 
ATOM   3903 C CD1   . PHE C 3 445 ? 0.006   37.969 51.432  1.00 30.83  ? 740  PHE A CD1   1 
ATOM   3904 C CD2   . PHE C 3 445 ? 1.011   36.437 52.946  1.00 34.33  ? 740  PHE A CD2   1 
ATOM   3905 C CE1   . PHE C 3 445 ? 0.666   37.366 50.379  1.00 32.28  ? 740  PHE A CE1   1 
ATOM   3906 C CE2   . PHE C 3 445 ? 1.663   35.819 51.887  1.00 33.57  ? 740  PHE A CE2   1 
ATOM   3907 C CZ    . PHE C 3 445 ? 1.503   36.297 50.608  1.00 33.27  ? 740  PHE A CZ    1 
ATOM   3908 N N     . GLU C 3 446 ? -1.422  40.814 55.790  1.00 30.10  ? 741  GLU A N     1 
ATOM   3909 C CA    . GLU C 3 446 ? -2.393  41.607 56.592  1.00 34.57  ? 741  GLU A CA    1 
ATOM   3910 C C     . GLU C 3 446 ? -2.655  42.976 55.953  1.00 33.44  ? 741  GLU A C     1 
ATOM   3911 O O     . GLU C 3 446 ? -3.798  43.429 56.019  1.00 31.78  ? 741  GLU A O     1 
ATOM   3912 C CB    . GLU C 3 446 ? -1.903  41.768 58.030  1.00 43.89  ? 741  GLU A CB    1 
ATOM   3913 C CG    . GLU C 3 446 ? -2.306  40.602 58.911  1.00 51.34  ? 741  GLU A CG    1 
ATOM   3914 C CD    . GLU C 3 446 ? -1.551  40.505 60.225  1.00 57.71  ? 741  GLU A CD    1 
ATOM   3915 O OE1   . GLU C 3 446 ? -1.312  39.363 60.683  1.00 68.99  ? 741  GLU A OE1   1 
ATOM   3916 O OE2   . GLU C 3 446 ? -1.204  41.565 60.783  1.00 60.35  ? 741  GLU A OE2   1 
ATOM   3917 N N     . SER C 3 447 ? -1.643  43.630 55.372  1.00 32.08  ? 742  SER A N     1 
ATOM   3918 C CA    . SER C 3 447 ? -1.810  44.927 54.661  1.00 32.10  ? 742  SER A CA    1 
ATOM   3919 C C     . SER C 3 447 ? -2.477  44.714 53.287  1.00 27.27  ? 742  SER A C     1 
ATOM   3920 O O     . SER C 3 447 ? -3.239  45.607 52.856  1.00 25.31  ? 742  SER A O     1 
ATOM   3921 C CB    . SER C 3 447 ? -0.478  45.637 54.557  1.00 38.61  ? 742  SER A CB    1 
ATOM   3922 O OG    . SER C 3 447 ? 0.170   45.711 55.831  1.00 39.38  ? 742  SER A OG    1 
ATOM   3923 N N     . PHE C 3 448 ? -2.283  43.545 52.660  1.00 24.80  ? 743  PHE A N     1 
ATOM   3924 C CA    . PHE C 3 448 ? -2.725  43.234 51.268  1.00 24.26  ? 743  PHE A CA    1 
ATOM   3925 C C     . PHE C 3 448 ? -3.446  41.887 51.209  1.00 22.90  ? 743  PHE A C     1 
ATOM   3926 O O     . PHE C 3 448 ? -2.953  40.918 50.633  1.00 20.90  ? 743  PHE A O     1 
ATOM   3927 C CB    . PHE C 3 448 ? -1.514  43.261 50.339  1.00 23.63  ? 743  PHE A CB    1 
ATOM   3928 C CG    . PHE C 3 448 ? -0.830  44.592 50.368  1.00 24.36  ? 743  PHE A CG    1 
ATOM   3929 C CD1   . PHE C 3 448 ? -1.510  45.729 49.955  1.00 28.21  ? 743  PHE A CD1   1 
ATOM   3930 C CD2   . PHE C 3 448 ? 0.452   44.721 50.866  1.00 24.81  ? 743  PHE A CD2   1 
ATOM   3931 C CE1   . PHE C 3 448 ? -0.907  46.978 50.019  1.00 26.68  ? 743  PHE A CE1   1 
ATOM   3932 C CE2   . PHE C 3 448 ? 1.058   45.962 50.914  1.00 26.61  ? 743  PHE A CE2   1 
ATOM   3933 C CZ    . PHE C 3 448 ? 0.383   47.083 50.483  1.00 25.80  ? 743  PHE A CZ    1 
ATOM   3934 N N     . PRO C 3 449 ? -4.639  41.783 51.816  1.00 22.06  ? 744  PRO A N     1 
ATOM   3935 C CA    . PRO C 3 449 ? -5.278  40.480 51.985  1.00 22.09  ? 744  PRO A CA    1 
ATOM   3936 C C     . PRO C 3 449 ? -5.782  39.921 50.647  1.00 20.83  ? 744  PRO A C     1 
ATOM   3937 O O     . PRO C 3 449 ? -5.911  38.730 50.541  1.00 22.17  ? 744  PRO A O     1 
ATOM   3938 C CB    . PRO C 3 449 ? -6.452  40.760 52.975  1.00 21.64  ? 744  PRO A CB    1 
ATOM   3939 C CG    . PRO C 3 449 ? -6.742  42.282 52.806  1.00 22.31  ? 744  PRO A CG    1 
ATOM   3940 C CD    . PRO C 3 449 ? -5.404  42.899 52.417  1.00 21.66  ? 744  PRO A CD    1 
ATOM   3941 N N     . GLY C 3 450 ? -6.092  40.786 49.682  1.00 20.69  ? 745  GLY A N     1 
ATOM   3942 C CA    . GLY C 3 450 ? -6.447  40.394 48.300  1.00 19.53  ? 745  GLY A CA    1 
ATOM   3943 C C     . GLY C 3 450 ? -5.276  39.729 47.584  1.00 19.83  ? 745  GLY A C     1 
ATOM   3944 O O     . GLY C 3 450 ? -5.501  38.770 46.833  1.00 22.52  ? 745  GLY A O     1 
ATOM   3945 N N     . VAL C 3 451 ? -4.043  40.149 47.851  1.00 19.00  ? 746  VAL A N     1 
ATOM   3946 C CA    . VAL C 3 451 ? -2.832  39.487 47.269  1.00 18.48  ? 746  VAL A CA    1 
ATOM   3947 C C     . VAL C 3 451 ? -2.681  38.097 47.906  1.00 19.02  ? 746  VAL A C     1 
ATOM   3948 O O     . VAL C 3 451 ? -2.362  37.131 47.187  1.00 15.52  ? 746  VAL A O     1 
ATOM   3949 C CB    . VAL C 3 451 ? -1.584  40.360 47.461  1.00 19.16  ? 746  VAL A CB    1 
ATOM   3950 C CG1   . VAL C 3 451 ? -0.301  39.664 47.016  1.00 20.56  ? 746  VAL A CG1   1 
ATOM   3951 C CG2   . VAL C 3 451 ? -1.751  41.710 46.782  1.00 19.28  ? 746  VAL A CG2   1 
ATOM   3952 N N     . LYS C 3 452 ? -2.959  37.982 49.202  1.00 20.70  ? 747  LYS A N     1 
ATOM   3953 C CA    . LYS C 3 452 ? -2.893  36.690 49.913  1.00 23.59  ? 747  LYS A CA    1 
ATOM   3954 C C     . LYS C 3 452 ? -3.906  35.719 49.296  1.00 22.00  ? 747  LYS A C     1 
ATOM   3955 O O     . LYS C 3 452 ? -3.506  34.609 48.946  1.00 19.89  ? 747  LYS A O     1 
ATOM   3956 C CB    . LYS C 3 452 ? -3.172  36.864 51.406  1.00 26.36  ? 747  LYS A CB    1 
ATOM   3957 C CG    . LYS C 3 452 ? -2.843  35.622 52.214  1.00 28.75  ? 747  LYS A CG    1 
ATOM   3958 C CD    . LYS C 3 452 ? -3.476  35.560 53.582  1.00 32.51  ? 747  LYS A CD    1 
ATOM   3959 C CE    . LYS C 3 452 ? -2.924  34.366 54.339  1.00 34.74  ? 747  LYS A CE    1 
ATOM   3960 N NZ    . LYS C 3 452 ? -3.643  34.156 55.612  1.00 37.09  ? 747  LYS A NZ    1 
ATOM   3961 N N     . ARG C 3 453 ? -5.164  36.131 49.187  1.00 24.58  ? 748  ARG A N     1 
ATOM   3962 C CA    . ARG C 3 453 ? -6.248  35.380 48.499  1.00 29.61  ? 748  ARG A CA    1 
ATOM   3963 C C     . ARG C 3 453 ? -5.767  34.978 47.089  1.00 24.97  ? 748  ARG A C     1 
ATOM   3964 O O     . ARG C 3 453 ? -5.843  33.778 46.788  1.00 23.82  ? 748  ARG A O     1 
ATOM   3965 C CB    . ARG C 3 453 ? -7.548  36.198 48.544  1.00 37.22  ? 748  ARG A CB    1 
ATOM   3966 C CG    . ARG C 3 453 ? -8.666  35.754 47.607  1.00 47.61  ? 748  ARG A CG    1 
ATOM   3967 C CD    . ARG C 3 453 ? -9.752  34.890 48.249  1.00 61.77  ? 748  ARG A CD    1 
ATOM   3968 N NE    . ARG C 3 453 ? -10.959 34.759 47.417  1.00 68.31  ? 748  ARG A NE    1 
ATOM   3969 C CZ    . ARG C 3 453 ? -11.969 33.905 47.637  1.00 72.70  ? 748  ARG A CZ    1 
ATOM   3970 N NH1   . ARG C 3 453 ? -11.940 33.073 48.666  1.00 70.38  ? 748  ARG A NH1   1 
ATOM   3971 N NH2   . ARG C 3 453 ? -13.006 33.886 46.813  1.00 70.87  ? 748  ARG A NH2   1 
ATOM   3972 N N     . TYR C 3 454 ? -5.261  35.907 46.272  1.00 21.75  ? 749  TYR A N     1 
ATOM   3973 C CA    . TYR C 3 454 ? -4.819  35.604 44.881  1.00 22.88  ? 749  TYR A CA    1 
ATOM   3974 C C     . TYR C 3 454 ? -3.775  34.488 44.941  1.00 21.51  ? 749  TYR A C     1 
ATOM   3975 O O     . TYR C 3 454 ? -3.889  33.579 44.143  1.00 21.87  ? 749  TYR A O     1 
ATOM   3976 C CB    . TYR C 3 454 ? -4.270  36.798 44.075  1.00 22.25  ? 749  TYR A CB    1 
ATOM   3977 C CG    . TYR C 3 454 ? -3.401  36.385 42.902  1.00 23.11  ? 749  TYR A CG    1 
ATOM   3978 C CD1   . TYR C 3 454 ? -3.920  35.952 41.676  1.00 24.30  ? 749  TYR A CD1   1 
ATOM   3979 C CD2   . TYR C 3 454 ? -2.029  36.390 43.040  1.00 23.02  ? 749  TYR A CD2   1 
ATOM   3980 C CE1   . TYR C 3 454 ? -3.093  35.540 40.634  1.00 23.75  ? 749  TYR A CE1   1 
ATOM   3981 C CE2   . TYR C 3 454 ? -1.192  35.967 42.018  1.00 25.49  ? 749  TYR A CE2   1 
ATOM   3982 C CZ    . TYR C 3 454 ? -1.716  35.555 40.807  1.00 25.92  ? 749  TYR A CZ    1 
ATOM   3983 O OH    . TYR C 3 454 ? -0.794  35.110 39.883  1.00 29.86  ? 749  TYR A OH    1 
ATOM   3984 N N     . MET C 3 455 ? -2.795  34.583 45.831  1.00 20.19  ? 750  MET A N     1 
ATOM   3985 C CA    . MET C 3 455 ? -1.675  33.625 45.892  1.00 22.73  ? 750  MET A CA    1 
ATOM   3986 C C     . MET C 3 455 ? -2.225  32.233 46.215  1.00 22.22  ? 750  MET A C     1 
ATOM   3987 O O     . MET C 3 455 ? -1.799  31.271 45.567  1.00 22.40  ? 750  MET A O     1 
ATOM   3988 C CB    . MET C 3 455 ? -0.639  34.034 46.939  1.00 25.87  ? 750  MET A CB    1 
ATOM   3989 C CG    . MET C 3 455 ? 0.188   35.252 46.534  1.00 29.37  ? 750  MET A CG    1 
ATOM   3990 S SD    . MET C 3 455 ? 0.836   35.129 44.843  1.00 31.23  ? 750  MET A SD    1 
ATOM   3991 C CE    . MET C 3 455 ? 1.784   36.647 44.708  1.00 30.23  ? 750  MET A CE    1 
ATOM   3992 N N     . GLU C 3 456 ? -3.148  32.136 47.165  1.00 21.81  ? 751  GLU A N     1 
ATOM   3993 C CA    . GLU C 3 456 ? -3.813  30.859 47.523  1.00 24.11  ? 751  GLU A CA    1 
ATOM   3994 C C     . GLU C 3 456 ? -4.680  30.399 46.348  1.00 20.79  ? 751  GLU A C     1 
ATOM   3995 O O     . GLU C 3 456 ? -4.600  29.248 46.004  1.00 21.18  ? 751  GLU A O     1 
ATOM   3996 C CB    . GLU C 3 456 ? -4.701  30.996 48.766  1.00 25.69  ? 751  GLU A CB    1 
ATOM   3997 C CG    . GLU C 3 456 ? -3.932  31.370 50.033  1.00 29.73  ? 751  GLU A CG    1 
ATOM   3998 C CD    . GLU C 3 456 ? -4.814  31.789 51.212  1.00 29.93  ? 751  GLU A CD    1 
ATOM   3999 O OE1   . GLU C 3 456 ? -4.337  31.657 52.345  1.00 26.68  ? 751  GLU A OE1   1 
ATOM   4000 O OE2   . GLU C 3 456 ? -6.001  32.208 50.989  1.00 29.19  ? 751  GLU A OE2   1 
ATOM   4001 N N     . ASN C 3 457 ? -5.474  31.277 45.746  1.00 20.96  ? 752  ASN A N     1 
ATOM   4002 C CA    . ASN C 3 457 ? -6.425  30.857 44.679  1.00 21.59  ? 752  ASN A CA    1 
ATOM   4003 C C     . ASN C 3 457 ? -5.658  30.346 43.454  1.00 20.85  ? 752  ASN A C     1 
ATOM   4004 O O     . ASN C 3 457 ? -6.135  29.362 42.859  1.00 21.31  ? 752  ASN A O     1 
ATOM   4005 C CB    . ASN C 3 457 ? -7.429  31.938 44.284  1.00 21.45  ? 752  ASN A CB    1 
ATOM   4006 C CG    . ASN C 3 457 ? -8.450  32.182 45.374  1.00 23.01  ? 752  ASN A CG    1 
ATOM   4007 O OD1   . ASN C 3 457 ? -8.474  31.471 46.365  1.00 22.49  ? 752  ASN A OD1   1 
ATOM   4008 N ND2   . ASN C 3 457 ? -9.233  33.231 45.240  1.00 24.69  ? 752  ASN A ND2   1 
ATOM   4009 N N     . ILE C 3 458 ? -4.523  30.964 43.098  1.00 19.42  ? 753  ILE A N     1 
ATOM   4010 C CA    . ILE C 3 458 ? -3.829  30.650 41.821  1.00 19.16  ? 753  ILE A CA    1 
ATOM   4011 C C     . ILE C 3 458 ? -3.098  29.308 41.983  1.00 18.50  ? 753  ILE A C     1 
ATOM   4012 O O     . ILE C 3 458 ? -2.994  28.574 40.986  1.00 17.45  ? 753  ILE A O     1 
ATOM   4013 C CB    . ILE C 3 458 ? -2.912  31.798 41.355  1.00 18.90  ? 753  ILE A CB    1 
ATOM   4014 C CG1   . ILE C 3 458 ? -2.624  31.707 39.848  1.00 19.79  ? 753  ILE A CG1   1 
ATOM   4015 C CG2   . ILE C 3 458 ? -1.644  31.857 42.177  1.00 19.18  ? 753  ILE A CG2   1 
ATOM   4016 C CD1   . ILE C 3 458 ? -3.881  31.960 38.966  1.00 19.51  ? 753  ILE A CD1   1 
ATOM   4017 N N     . VAL C 3 459 ? -2.602  28.994 43.177  1.00 18.94  ? 754  VAL A N     1 
ATOM   4018 C CA    . VAL C 3 459 ? -1.993  27.666 43.449  1.00 20.70  ? 754  VAL A CA    1 
ATOM   4019 C C     . VAL C 3 459 ? -3.085  26.598 43.306  1.00 20.92  ? 754  VAL A C     1 
ATOM   4020 O O     . VAL C 3 459 ? -2.831  25.622 42.600  1.00 17.87  ? 754  VAL A O     1 
ATOM   4021 C CB    . VAL C 3 459 ? -1.294  27.623 44.816  1.00 23.18  ? 754  VAL A CB    1 
ATOM   4022 C CG1   . VAL C 3 459 ? -0.924  26.206 45.236  1.00 23.25  ? 754  VAL A CG1   1 
ATOM   4023 C CG2   . VAL C 3 459 ? -0.060  28.510 44.806  1.00 23.48  ? 754  VAL A CG2   1 
ATOM   4024 N N     . GLN C 3 460 ? -4.263  26.803 43.907  1.00 23.04  ? 755  GLN A N     1 
ATOM   4025 C CA    . GLN C 3 460 ? -5.418  25.867 43.802  1.00 24.80  ? 755  GLN A CA    1 
ATOM   4026 C C     . GLN C 3 460 ? -5.931  25.779 42.358  1.00 23.97  ? 755  GLN A C     1 
ATOM   4027 O O     . GLN C 3 460 ? -6.465  24.722 41.974  1.00 20.62  ? 755  GLN A O     1 
ATOM   4028 C CB    . GLN C 3 460 ? -6.574  26.290 44.710  1.00 29.00  ? 755  GLN A CB    1 
ATOM   4029 C CG    . GLN C 3 460 ? -6.312  25.992 46.191  1.00 36.72  ? 755  GLN A CG    1 
ATOM   4030 C CD    . GLN C 3 460 ? -5.869  24.558 46.414  1.00 40.85  ? 755  GLN A CD    1 
ATOM   4031 O OE1   . GLN C 3 460 ? -6.645  23.611 46.209  1.00 43.43  ? 755  GLN A OE1   1 
ATOM   4032 N NE2   . GLN C 3 460 ? -4.604  24.385 46.794  1.00 37.45  ? 755  GLN A NE2   1 
ATOM   4033 N N     . GLU C 3 461 ? -5.875  26.868 41.599  1.00 22.91  ? 756  GLU A N     1 
ATOM   4034 C CA    . GLU C 3 461 ? -6.326  26.837 40.191  1.00 23.53  ? 756  GLU A CA    1 
ATOM   4035 C C     . GLU C 3 461 ? -5.264  26.089 39.352  1.00 23.11  ? 756  GLU A C     1 
ATOM   4036 O O     . GLU C 3 461 ? -5.653  25.242 38.507  1.00 20.75  ? 756  GLU A O     1 
ATOM   4037 C CB    . GLU C 3 461 ? -6.679  28.262 39.793  1.00 26.06  ? 756  GLU A CB    1 
ATOM   4038 C CG    . GLU C 3 461 ? -7.292  28.410 38.424  1.00 31.65  ? 756  GLU A CG    1 
ATOM   4039 C CD    . GLU C 3 461 ? -7.156  29.826 37.862  1.00 31.78  ? 756  GLU A CD    1 
ATOM   4040 O OE1   . GLU C 3 461 ? -7.544  30.768 38.553  1.00 33.78  ? 756  GLU A OE1   1 
ATOM   4041 O OE2   . GLU C 3 461 ? -6.661  29.969 36.758  1.00 34.10  ? 756  GLU A OE2   1 
ATOM   4042 N N     . ALA C 3 462 ? -3.967  26.281 39.601  1.00 19.91  ? 757  ALA A N     1 
ATOM   4043 C CA    . ALA C 3 462 ? -2.944  25.515 38.860  1.00 21.21  ? 757  ALA A CA    1 
ATOM   4044 C C     . ALA C 3 462 ? -3.147  24.024 39.139  1.00 21.41  ? 757  ALA A C     1 
ATOM   4045 O O     . ALA C 3 462 ? -3.007  23.216 38.191  1.00 18.57  ? 757  ALA A O     1 
ATOM   4046 C CB    . ALA C 3 462 ? -1.552  25.947 39.224  1.00 22.16  ? 757  ALA A CB    1 
ATOM   4047 N N     . LYS C 3 463 ? -3.465  23.663 40.381  1.00 21.88  ? 758  LYS A N     1 
ATOM   4048 C CA    . LYS C 3 463 ? -3.669  22.242 40.765  1.00 25.11  ? 758  LYS A CA    1 
ATOM   4049 C C     . LYS C 3 463 ? -4.887  21.703 39.998  1.00 22.55  ? 758  LYS A C     1 
ATOM   4050 O O     . LYS C 3 463 ? -4.759  20.651 39.379  1.00 23.43  ? 758  LYS A O     1 
ATOM   4051 C CB    . LYS C 3 463 ? -3.862  22.056 42.275  1.00 28.28  ? 758  LYS A CB    1 
ATOM   4052 C CG    . LYS C 3 463 ? -4.042  20.598 42.689  1.00 34.52  ? 758  LYS A CG    1 
ATOM   4053 C CD    . LYS C 3 463 ? -4.334  20.368 44.165  1.00 43.64  ? 758  LYS A CD    1 
ATOM   4054 C CE    . LYS C 3 463 ? -3.168  20.668 45.094  1.00 51.38  ? 758  LYS A CE    1 
ATOM   4055 N NZ    . LYS C 3 463 ? -3.377  20.097 46.455  1.00 51.26  ? 758  LYS A NZ    1 
ATOM   4056 N N     . GLN C 3 464 ? -5.990  22.449 39.966  1.00 20.15  ? 759  GLN A N     1 
ATOM   4057 C CA    . GLN C 3 464 ? -7.297  21.995 39.415  1.00 22.18  ? 759  GLN A CA    1 
ATOM   4058 C C     . GLN C 3 464 ? -7.230  21.918 37.877  1.00 19.15  ? 759  GLN A C     1 
ATOM   4059 O O     . GLN C 3 464 ? -7.665  20.903 37.315  1.00 17.69  ? 759  GLN A O     1 
ATOM   4060 C CB    . GLN C 3 464 ? -8.428  22.925 39.872  1.00 23.68  ? 759  GLN A CB    1 
ATOM   4061 C CG    . GLN C 3 464 ? -9.793  22.517 39.331  1.00 28.86  ? 759  GLN A CG    1 
ATOM   4062 C CD    . GLN C 3 464 ? -10.252 23.346 38.151  1.00 32.75  ? 759  GLN A CD    1 
ATOM   4063 O OE1   . GLN C 3 464 ? -10.481 24.542 38.299  1.00 37.21  ? 759  GLN A OE1   1 
ATOM   4064 N NE2   . GLN C 3 464 ? -10.442 22.719 36.983  1.00 29.25  ? 759  GLN A NE2   1 
ATOM   4065 N N     . LYS C 3 465 ? -6.680  22.941 37.232  1.00 17.77  ? 760  LYS A N     1 
ATOM   4066 C CA    . LYS C 3 465 ? -6.699  23.101 35.753  1.00 20.45  ? 760  LYS A CA    1 
ATOM   4067 C C     . LYS C 3 465 ? -5.484  22.389 35.149  1.00 17.00  ? 760  LYS A C     1 
ATOM   4068 O O     . LYS C 3 465 ? -5.602  21.879 34.068  1.00 16.38  ? 760  LYS A O     1 
ATOM   4069 C CB    . LYS C 3 465 ? -6.705  24.579 35.362  1.00 23.31  ? 760  LYS A CB    1 
ATOM   4070 C CG    . LYS C 3 465 ? -8.023  25.298 35.565  1.00 28.60  ? 760  LYS A CG    1 
ATOM   4071 C CD    . LYS C 3 465 ? -8.190  26.466 34.593  1.00 34.03  ? 760  LYS A CD    1 
ATOM   4072 C CE    . LYS C 3 465 ? -9.286  27.440 34.977  1.00 38.12  ? 760  LYS A CE    1 
ATOM   4073 N NZ    . LYS C 3 465 ? -10.454 26.756 35.582  1.00 40.06  ? 760  LYS A NZ    1 
ATOM   4074 N N     . GLY C 3 466 ? -4.377  22.325 35.874  1.00 16.09  ? 761  GLY A N     1 
ATOM   4075 C CA    . GLY C 3 466 ? -3.109  21.760 35.374  1.00 16.24  ? 761  GLY A CA    1 
ATOM   4076 C C     . GLY C 3 466 ? -2.192  22.854 34.845  1.00 15.13  ? 761  GLY A C     1 
ATOM   4077 O O     . GLY C 3 466 ? -1.016  22.553 34.594  1.00 14.52  ? 761  GLY A O     1 
ATOM   4078 N N     . TYR C 3 467 ? -2.692  24.089 34.701  1.00 15.91  ? 762  TYR A N     1 
ATOM   4079 C CA    . TYR C 3 467 ? -1.900  25.234 34.154  1.00 16.17  ? 762  TYR A CA    1 
ATOM   4080 C C     . TYR C 3 467 ? -2.371  26.560 34.763  1.00 16.51  ? 762  TYR A C     1 
ATOM   4081 O O     . TYR C 3 467 ? -3.431  26.582 35.450  1.00 16.07  ? 762  TYR A O     1 
ATOM   4082 C CB    . TYR C 3 467 ? -2.046  25.328 32.637  1.00 15.86  ? 762  TYR A CB    1 
ATOM   4083 C CG    . TYR C 3 467 ? -3.475  25.513 32.198  1.00 16.78  ? 762  TYR A CG    1 
ATOM   4084 C CD1   . TYR C 3 467 ? -4.309  24.412 32.067  1.00 15.94  ? 762  TYR A CD1   1 
ATOM   4085 C CD2   . TYR C 3 467 ? -4.018  26.773 31.952  1.00 17.31  ? 762  TYR A CD2   1 
ATOM   4086 C CE1   . TYR C 3 467 ? -5.619  24.560 31.641  1.00 16.35  ? 762  TYR A CE1   1 
ATOM   4087 C CE2   . TYR C 3 467 ? -5.340  26.940 31.549  1.00 16.32  ? 762  TYR A CE2   1 
ATOM   4088 C CZ    . TYR C 3 467 ? -6.145  25.819 31.408  1.00 17.42  ? 762  TYR A CZ    1 
ATOM   4089 O OH    . TYR C 3 467 ? -7.453  25.900 31.032  1.00 16.69  ? 762  TYR A OH    1 
ATOM   4090 N N     . VAL C 3 468 ? -1.589  27.622 34.524  1.00 15.37  ? 763  VAL A N     1 
ATOM   4091 C CA    . VAL C 3 468 ? -1.993  29.028 34.816  1.00 16.65  ? 763  VAL A CA    1 
ATOM   4092 C C     . VAL C 3 468 ? -1.936  29.828 33.523  1.00 15.74  ? 763  VAL A C     1 
ATOM   4093 O O     . VAL C 3 468 ? -1.125  29.500 32.657  1.00 16.64  ? 763  VAL A O     1 
ATOM   4094 C CB    . VAL C 3 468 ? -1.101  29.681 35.891  1.00 16.74  ? 763  VAL A CB    1 
ATOM   4095 C CG1   . VAL C 3 468 ? -1.253  28.991 37.234  1.00 17.61  ? 763  VAL A CG1   1 
ATOM   4096 C CG2   . VAL C 3 468 ? 0.369   29.726 35.481  1.00 16.92  ? 763  VAL A CG2   1 
ATOM   4097 N N     . THR C 3 469 ? -2.670  30.917 33.476  1.00 15.71  ? 764  THR A N     1 
ATOM   4098 C CA    . THR C 3 469 ? -2.787  31.784 32.286  1.00 16.76  ? 764  THR A CA    1 
ATOM   4099 C C     . THR C 3 469 ? -2.452  33.239 32.621  1.00 16.36  ? 764  THR A C     1 
ATOM   4100 O O     . THR C 3 469 ? -2.510  33.629 33.803  1.00 15.51  ? 764  THR A O     1 
ATOM   4101 C CB    . THR C 3 469 ? -4.191  31.663 31.690  1.00 18.07  ? 764  THR A CB    1 
ATOM   4102 O OG1   . THR C 3 469 ? -5.061  32.145 32.698  1.00 20.45  ? 764  THR A OG1   1 
ATOM   4103 C CG2   . THR C 3 469 ? -4.602  30.249 31.361  1.00 18.22  ? 764  THR A CG2   1 
ATOM   4104 N N     . THR C 3 470 ? -2.136  34.008 31.576  1.00 16.06  ? 765  THR A N     1 
ATOM   4105 C CA    . THR C 3 470 ? -1.879  35.466 31.597  1.00 15.98  ? 765  THR A CA    1 
ATOM   4106 C C     . THR C 3 470 ? -3.109  36.192 31.078  1.00 17.05  ? 765  THR A C     1 
ATOM   4107 O O     . THR C 3 470 ? -3.972  35.529 30.517  1.00 17.38  ? 765  THR A O     1 
ATOM   4108 C CB    . THR C 3 470 ? -0.640  35.782 30.752  1.00 15.31  ? 765  THR A CB    1 
ATOM   4109 O OG1   . THR C 3 470 ? -0.973  35.590 29.381  1.00 14.51  ? 765  THR A OG1   1 
ATOM   4110 C CG2   . THR C 3 470 ? 0.543   34.916 31.097  1.00 14.50  ? 765  THR A CG2   1 
ATOM   4111 N N     . LEU C 3 471 ? -3.130  37.517 31.197  1.00 21.13  ? 766  LEU A N     1 
ATOM   4112 C CA    . LEU C 3 471 ? -4.194  38.408 30.681  1.00 23.09  ? 766  LEU A CA    1 
ATOM   4113 C C     . LEU C 3 471 ? -4.580  38.039 29.261  1.00 21.84  ? 766  LEU A C     1 
ATOM   4114 O O     . LEU C 3 471 ? -5.770  38.097 28.950  1.00 23.03  ? 766  LEU A O     1 
ATOM   4115 C CB    . LEU C 3 471 ? -3.679  39.840 30.644  1.00 30.61  ? 766  LEU A CB    1 
ATOM   4116 C CG    . LEU C 3 471 ? -3.830  40.644 31.927  1.00 36.93  ? 766  LEU A CG    1 
ATOM   4117 C CD1   . LEU C 3 471 ? -3.529  42.107 31.617  1.00 42.91  ? 766  LEU A CD1   1 
ATOM   4118 C CD2   . LEU C 3 471 ? -5.221  40.490 32.529  1.00 36.22  ? 766  LEU A CD2   1 
ATOM   4119 N N     . LEU C 3 472 ? -3.607  37.764 28.399  1.00 20.40  ? 767  LEU A N     1 
ATOM   4120 C CA    . LEU C 3 472 ? -3.927  37.532 26.969  1.00 19.93  ? 767  LEU A CA    1 
ATOM   4121 C C     . LEU C 3 472 ? -3.895  36.025 26.633  1.00 20.61  ? 767  LEU A C     1 
ATOM   4122 O O     . LEU C 3 472 ? -3.790  35.701 25.439  1.00 20.15  ? 767  LEU A O     1 
ATOM   4123 C CB    . LEU C 3 472 ? -2.963  38.367 26.116  1.00 20.51  ? 767  LEU A CB    1 
ATOM   4124 C CG    . LEU C 3 472 ? -3.130  39.886 26.186  1.00 21.04  ? 767  LEU A CG    1 
ATOM   4125 C CD1   . LEU C 3 472 ? -2.379  40.558 25.047  1.00 21.93  ? 767  LEU A CD1   1 
ATOM   4126 C CD2   . LEU C 3 472 ? -4.602  40.312 26.132  1.00 21.47  ? 767  LEU A CD2   1 
ATOM   4127 N N     . HIS C 3 473 ? -4.066  35.143 27.634  1.00 21.54  ? 768  HIS A N     1 
ATOM   4128 C CA    . HIS C 3 473 ? -4.381  33.691 27.502  1.00 21.45  ? 768  HIS A CA    1 
ATOM   4129 C C     . HIS C 3 473 ? -3.133  32.882 27.117  1.00 18.87  ? 768  HIS A C     1 
ATOM   4130 O O     . HIS C 3 473 ? -3.293  31.740 26.658  1.00 17.58  ? 768  HIS A O     1 
ATOM   4131 C CB    . HIS C 3 473 ? -5.523  33.414 26.508  1.00 24.84  ? 768  HIS A CB    1 
ATOM   4132 C CG    . HIS C 3 473 ? -6.756  34.212 26.738  1.00 29.22  ? 768  HIS A CG    1 
ATOM   4133 N ND1   . HIS C 3 473 ? -7.137  34.646 27.991  1.00 35.54  ? 768  HIS A ND1   1 
ATOM   4134 C CD2   . HIS C 3 473 ? -7.695  34.678 25.884  1.00 35.78  ? 768  HIS A CD2   1 
ATOM   4135 C CE1   . HIS C 3 473 ? -8.241  35.374 27.896  1.00 34.94  ? 768  HIS A CE1   1 
ATOM   4136 N NE2   . HIS C 3 473 ? -8.599  35.417 26.612  1.00 34.60  ? 768  HIS A NE2   1 
ATOM   4137 N N     . ARG C 3 474 ? -1.937  33.421 27.339  1.00 16.01  ? 769  ARG A N     1 
ATOM   4138 C CA    . ARG C 3 474 ? -0.720  32.591 27.425  1.00 16.73  ? 769  ARG A CA    1 
ATOM   4139 C C     . ARG C 3 474 ? -0.913  31.584 28.559  1.00 16.29  ? 769  ARG A C     1 
ATOM   4140 O O     . ARG C 3 474 ? -1.510  31.921 29.593  1.00 15.36  ? 769  ARG A O     1 
ATOM   4141 C CB    . ARG C 3 474 ? 0.530   33.441 27.665  1.00 16.51  ? 769  ARG A CB    1 
ATOM   4142 C CG    . ARG C 3 474 ? 1.853   32.753 27.384  1.00 15.67  ? 769  ARG A CG    1 
ATOM   4143 C CD    . ARG C 3 474 ? 2.995   33.737 27.619  1.00 16.05  ? 769  ARG A CD    1 
ATOM   4144 N NE    . ARG C 3 474 ? 2.786   34.977 26.875  1.00 16.38  ? 769  ARG A NE    1 
ATOM   4145 C CZ    . ARG C 3 474 ? 3.030   35.151 25.579  1.00 16.06  ? 769  ARG A CZ    1 
ATOM   4146 N NH1   . ARG C 3 474 ? 3.561   34.171 24.882  1.00 16.58  ? 769  ARG A NH1   1 
ATOM   4147 N NH2   . ARG C 3 474 ? 2.744   36.302 24.985  1.00 16.67  ? 769  ARG A NH2   1 
ATOM   4148 N N     . ARG C 3 475 ? -0.309  30.424 28.400  1.00 16.19  ? 770  ARG A N     1 
ATOM   4149 C CA    . ARG C 3 475 ? -0.472  29.278 29.306  1.00 16.50  ? 770  ARG A CA    1 
ATOM   4150 C C     . ARG C 3 475 ? 0.902   28.836 29.785  1.00 15.48  ? 770  ARG A C     1 
ATOM   4151 O O     . ARG C 3 475 ? 1.843   28.746 28.970  1.00 14.50  ? 770  ARG A O     1 
ATOM   4152 C CB    . ARG C 3 475 ? -1.133  28.214 28.441  1.00 19.18  ? 770  ARG A CB    1 
ATOM   4153 C CG    . ARG C 3 475 ? -2.048  27.241 29.142  1.00 22.37  ? 770  ARG A CG    1 
ATOM   4154 C CD    . ARG C 3 475 ? -2.753  26.382 28.092  1.00 21.73  ? 770  ARG A CD    1 
ATOM   4155 N NE    . ARG C 3 475 ? -4.132  26.830 27.961  1.00 21.38  ? 770  ARG A NE    1 
ATOM   4156 C CZ    . ARG C 3 475 ? -5.210  26.052 28.053  1.00 21.15  ? 770  ARG A CZ    1 
ATOM   4157 N NH1   . ARG C 3 475 ? -5.086  24.749 28.238  1.00 21.13  ? 770  ARG A NH1   1 
ATOM   4158 N NH2   . ARG C 3 475 ? -6.416  26.583 27.939  1.00 21.18  ? 770  ARG A NH2   1 
ATOM   4159 N N     . ARG C 3 476 ? 0.993   28.402 31.028  1.00 16.05  ? 771  ARG A N     1 
ATOM   4160 C CA    . ARG C 3 476 ? 2.111   27.538 31.437  1.00 15.63  ? 771  ARG A CA    1 
ATOM   4161 C C     . ARG C 3 476 ? 1.538   26.332 32.169  1.00 16.08  ? 771  ARG A C     1 
ATOM   4162 O O     . ARG C 3 476 ? 0.793   26.539 33.173  1.00 14.50  ? 771  ARG A O     1 
ATOM   4163 C CB    . ARG C 3 476 ? 3.099   28.326 32.285  1.00 16.96  ? 771  ARG A CB    1 
ATOM   4164 C CG    . ARG C 3 476 ? 4.325   27.512 32.665  1.00 18.14  ? 771  ARG A CG    1 
ATOM   4165 C CD    . ARG C 3 476 ? 5.250   28.428 33.436  1.00 18.46  ? 771  ARG A CD    1 
ATOM   4166 N NE    . ARG C 3 476 ? 6.564   27.854 33.616  1.00 19.77  ? 771  ARG A NE    1 
ATOM   4167 C CZ    . ARG C 3 476 ? 7.547   28.435 34.309  1.00 20.66  ? 771  ARG A CZ    1 
ATOM   4168 N NH1   . ARG C 3 476 ? 7.342   29.599 34.902  1.00 21.30  ? 771  ARG A NH1   1 
ATOM   4169 N NH2   . ARG C 3 476 ? 8.741   27.872 34.383  1.00 19.44  ? 771  ARG A NH2   1 
ATOM   4170 N N     . TYR C 3 477 ? 1.921   25.131 31.726  1.00 15.08  ? 772  TYR A N     1 
ATOM   4171 C CA    . TYR C 3 477 ? 1.545   23.869 32.403  1.00 16.88  ? 772  TYR A CA    1 
ATOM   4172 C C     . TYR C 3 477 ? 2.470   23.674 33.608  1.00 16.54  ? 772  TYR A C     1 
ATOM   4173 O O     . TYR C 3 477 ? 3.691   23.843 33.501  1.00 15.93  ? 772  TYR A O     1 
ATOM   4174 C CB    . TYR C 3 477 ? 1.552   22.685 31.428  1.00 17.20  ? 772  TYR A CB    1 
ATOM   4175 C CG    . TYR C 3 477 ? 0.445   22.750 30.403  1.00 17.59  ? 772  TYR A CG    1 
ATOM   4176 C CD1   . TYR C 3 477 ? -0.852  22.379 30.721  1.00 17.36  ? 772  TYR A CD1   1 
ATOM   4177 C CD2   . TYR C 3 477 ? 0.677   23.262 29.133  1.00 16.34  ? 772  TYR A CD2   1 
ATOM   4178 C CE1   . TYR C 3 477 ? -1.879  22.470 29.788  1.00 17.07  ? 772  TYR A CE1   1 
ATOM   4179 C CE2   . TYR C 3 477 ? -0.330  23.319 28.182  1.00 17.20  ? 772  TYR A CE2   1 
ATOM   4180 C CZ    . TYR C 3 477 ? -1.613  22.914 28.504  1.00 17.31  ? 772  TYR A CZ    1 
ATOM   4181 O OH    . TYR C 3 477 ? -2.592  22.984 27.554  1.00 17.34  ? 772  TYR A OH    1 
ATOM   4182 N N     . LEU C 3 478 ? 1.888   23.343 34.750  1.00 16.88  ? 773  LEU A N     1 
ATOM   4183 C CA    . LEU C 3 478 ? 2.661   23.089 35.987  1.00 17.73  ? 773  LEU A CA    1 
ATOM   4184 C C     . LEU C 3 478 ? 2.341   21.708 36.554  1.00 19.32  ? 773  LEU A C     1 
ATOM   4185 O O     . LEU C 3 478 ? 1.735   21.605 37.626  1.00 18.28  ? 773  LEU A O     1 
ATOM   4186 C CB    . LEU C 3 478 ? 2.295   24.191 36.977  1.00 17.85  ? 773  LEU A CB    1 
ATOM   4187 C CG    . LEU C 3 478 ? 2.730   25.585 36.573  1.00 18.25  ? 773  LEU A CG    1 
ATOM   4188 C CD1   . LEU C 3 478 ? 2.211   26.617 37.553  1.00 19.85  ? 773  LEU A CD1   1 
ATOM   4189 C CD2   . LEU C 3 478 ? 4.244   25.651 36.493  1.00 18.73  ? 773  LEU A CD2   1 
ATOM   4190 N N     . PRO C 3 479 ? 2.793   20.605 35.906  1.00 20.87  ? 774  PRO A N     1 
ATOM   4191 C CA    . PRO C 3 479 ? 2.493   19.259 36.402  1.00 21.58  ? 774  PRO A CA    1 
ATOM   4192 C C     . PRO C 3 479 ? 3.111   18.990 37.791  1.00 22.64  ? 774  PRO A C     1 
ATOM   4193 O O     . PRO C 3 479 ? 2.557   18.210 38.523  1.00 22.23  ? 774  PRO A O     1 
ATOM   4194 C CB    . PRO C 3 479 ? 3.055   18.316 35.315  1.00 20.94  ? 774  PRO A CB    1 
ATOM   4195 C CG    . PRO C 3 479 ? 4.127   19.134 34.585  1.00 19.97  ? 774  PRO A CG    1 
ATOM   4196 C CD    . PRO C 3 479 ? 3.656   20.580 34.706  1.00 20.69  ? 774  PRO A CD    1 
ATOM   4197 N N     . ASP C 3 480 ? 4.181   19.699 38.177  1.00 23.40  ? 775  ASP A N     1 
ATOM   4198 C CA    . ASP C 3 480 ? 4.900   19.435 39.452  1.00 21.21  ? 775  ASP A CA    1 
ATOM   4199 C C     . ASP C 3 480 ? 4.109   19.978 40.651  1.00 20.63  ? 775  ASP A C     1 
ATOM   4200 O O     . ASP C 3 480 ? 4.543   19.785 41.816  1.00 18.49  ? 775  ASP A O     1 
ATOM   4201 C CB    . ASP C 3 480 ? 6.297   20.047 39.426  1.00 22.57  ? 775  ASP A CB    1 
ATOM   4202 C CG    . ASP C 3 480 ? 7.292   19.420 38.457  1.00 24.36  ? 775  ASP A CG    1 
ATOM   4203 O OD1   . ASP C 3 480 ? 6.985   18.362 37.912  1.00 25.43  ? 775  ASP A OD1   1 
ATOM   4204 O OD2   . ASP C 3 480 ? 8.363   20.045 38.226  1.00 26.10  ? 775  ASP A OD2   1 
ATOM   4205 N N     . ILE C 3 481 ? 3.022   20.694 40.425  1.00 20.66  ? 776  ILE A N     1 
ATOM   4206 C CA    . ILE C 3 481 ? 2.221   21.275 41.533  1.00 24.03  ? 776  ILE A CA    1 
ATOM   4207 C C     . ILE C 3 481 ? 1.613   20.136 42.378  1.00 27.48  ? 776  ILE A C     1 
ATOM   4208 O O     . ILE C 3 481 ? 1.170   20.420 43.499  1.00 25.38  ? 776  ILE A O     1 
ATOM   4209 C CB    . ILE C 3 481 ? 1.150   22.234 40.968  1.00 27.96  ? 776  ILE A CB    1 
ATOM   4210 C CG1   . ILE C 3 481 ? 0.742   23.325 41.963  1.00 29.31  ? 776  ILE A CG1   1 
ATOM   4211 C CG2   . ILE C 3 481 ? -0.063  21.464 40.475  1.00 29.97  ? 776  ILE A CG2   1 
ATOM   4212 C CD1   . ILE C 3 481 ? 1.189   24.700 41.551  1.00 29.46  ? 776  ILE A CD1   1 
ATOM   4213 N N     . THR C 3 482 ? 1.567   18.898 41.873  1.00 31.08  ? 777  THR A N     1 
ATOM   4214 C CA    . THR C 3 482 ? 1.077   17.704 42.626  1.00 36.85  ? 777  THR A CA    1 
ATOM   4215 C C     . THR C 3 482 ? 2.220   16.712 42.951  1.00 37.33  ? 777  THR A C     1 
ATOM   4216 O O     . THR C 3 482 ? 1.915   15.588 43.322  1.00 45.73  ? 777  THR A O     1 
ATOM   4217 C CB    . THR C 3 482 ? -0.030  16.954 41.871  1.00 36.81  ? 777  THR A CB    1 
ATOM   4218 O OG1   . THR C 3 482 ? 0.648   16.398 40.744  1.00 43.06  ? 777  THR A OG1   1 
ATOM   4219 C CG2   . THR C 3 482 ? -1.207  17.814 41.457  1.00 37.79  ? 777  THR A CG2   1 
ATOM   4220 N N     . SER C 3 483 ? 3.490   17.091 42.885  1.00 37.99  ? 778  SER A N     1 
ATOM   4221 C CA    . SER C 3 483 ? 4.618   16.207 43.287  1.00 36.07  ? 778  SER A CA    1 
ATOM   4222 C C     . SER C 3 483 ? 4.582   15.982 44.804  1.00 38.74  ? 778  SER A C     1 
ATOM   4223 O O     . SER C 3 483 ? 4.204   16.896 45.545  1.00 32.07  ? 778  SER A O     1 
ATOM   4224 C CB    . SER C 3 483 ? 5.926   16.774 42.853  1.00 35.65  ? 778  SER A CB    1 
ATOM   4225 O OG    . SER C 3 483 ? 7.007   16.166 43.537  1.00 34.95  ? 778  SER A OG    1 
ATOM   4226 N N     . ARG C 3 484 ? 5.006   14.810 45.269  1.00 40.42  ? 779  ARG A N     1 
ATOM   4227 C CA    . ARG C 3 484 ? 5.104   14.592 46.728  1.00 46.37  ? 779  ARG A CA    1 
ATOM   4228 C C     . ARG C 3 484 ? 6.510   14.965 47.218  1.00 42.54  ? 779  ARG A C     1 
ATOM   4229 O O     . ARG C 3 484 ? 6.685   14.977 48.439  1.00 39.65  ? 779  ARG A O     1 
ATOM   4230 C CB    . ARG C 3 484 ? 4.586   13.197 47.083  1.00 55.45  ? 779  ARG A CB    1 
ATOM   4231 C CG    . ARG C 3 484 ? 3.077   13.179 47.324  1.00 59.06  ? 779  ARG A CG    1 
ATOM   4232 C CD    . ARG C 3 484 ? 2.251   13.296 46.045  1.00 62.57  ? 779  ARG A CD    1 
ATOM   4233 N NE    . ARG C 3 484 ? 2.291   12.064 45.250  1.00 65.59  ? 779  ARG A NE    1 
ATOM   4234 C CZ    . ARG C 3 484 ? 2.701   11.939 43.981  1.00 70.12  ? 779  ARG A CZ    1 
ATOM   4235 N NH1   . ARG C 3 484 ? 3.128   12.979 43.278  1.00 69.05  ? 779  ARG A NH1   1 
ATOM   4236 N NH2   . ARG C 3 484 ? 2.680   10.746 43.410  1.00 74.89  ? 779  ARG A NH2   1 
ATOM   4237 N N     . ASN C 3 485 ? 7.443   15.352 46.337  1.00 35.70  ? 780  ASN A N     1 
ATOM   4238 C CA    . ASN C 3 485 ? 8.708   16.026 46.758  1.00 35.03  ? 780  ASN A CA    1 
ATOM   4239 C C     . ASN C 3 485 ? 8.394   17.505 47.057  1.00 34.89  ? 780  ASN A C     1 
ATOM   4240 O O     . ASN C 3 485 ? 7.828   18.193 46.172  1.00 33.24  ? 780  ASN A O     1 
ATOM   4241 C CB    . ASN C 3 485 ? 9.824   15.838 45.720  1.00 37.40  ? 780  ASN A CB    1 
ATOM   4242 C CG    . ASN C 3 485 ? 11.171  16.384 46.164  1.00 41.03  ? 780  ASN A CG    1 
ATOM   4243 O OD1   . ASN C 3 485 ? 11.402  17.593 46.156  1.00 40.65  ? 780  ASN A OD1   1 
ATOM   4244 N ND2   . ASN C 3 485 ? 12.083  15.494 46.523  1.00 38.03  ? 780  ASN A ND2   1 
ATOM   4245 N N     . PHE C 3 486 ? 8.714   17.975 48.269  1.00 37.03  ? 781  PHE A N     1 
ATOM   4246 C CA    . PHE C 3 486 ? 8.429   19.341 48.789  1.00 37.58  ? 781  PHE A CA    1 
ATOM   4247 C C     . PHE C 3 486 ? 9.093   20.410 47.905  1.00 36.39  ? 781  PHE A C     1 
ATOM   4248 O O     . PHE C 3 486 ? 8.415   21.399 47.583  1.00 35.88  ? 781  PHE A O     1 
ATOM   4249 C CB    . PHE C 3 486 ? 8.897   19.494 50.241  1.00 41.65  ? 781  PHE A CB    1 
ATOM   4250 C CG    . PHE C 3 486 ? 8.650   20.851 50.865  1.00 44.74  ? 781  PHE A CG    1 
ATOM   4251 C CD1   . PHE C 3 486 ? 7.389   21.201 51.344  1.00 44.89  ? 781  PHE A CD1   1 
ATOM   4252 C CD2   . PHE C 3 486 ? 9.678   21.778 50.989  1.00 46.41  ? 781  PHE A CD2   1 
ATOM   4253 C CE1   . PHE C 3 486 ? 7.158   22.442 51.923  1.00 43.98  ? 781  PHE A CE1   1 
ATOM   4254 C CE2   . PHE C 3 486 ? 9.443   23.024 51.560  1.00 48.25  ? 781  PHE A CE2   1 
ATOM   4255 C CZ    . PHE C 3 486 ? 8.184   23.356 52.025  1.00 46.11  ? 781  PHE A CZ    1 
ATOM   4256 N N     . ASN C 3 487 ? 10.372  20.243 47.550  1.00 35.24  ? 782  ASN A N     1 
ATOM   4257 C CA    . ASN C 3 487 ? 11.161  21.246 46.782  1.00 37.15  ? 782  ASN A CA    1 
ATOM   4258 C C     . ASN C 3 487 ? 10.579  21.401 45.364  1.00 37.01  ? 782  ASN A C     1 
ATOM   4259 O O     . ASN C 3 487 ? 10.448  22.544 44.927  1.00 31.02  ? 782  ASN A O     1 
ATOM   4260 C CB    . ASN C 3 487 ? 12.650  20.892 46.712  1.00 38.28  ? 782  ASN A CB    1 
ATOM   4261 C CG    . ASN C 3 487 ? 13.391  21.184 48.003  1.00 42.58  ? 782  ASN A CG    1 
ATOM   4262 O OD1   . ASN C 3 487 ? 12.861  21.828 48.917  1.00 40.25  ? 782  ASN A OD1   1 
ATOM   4263 N ND2   . ASN C 3 487 ? 14.616  20.692 48.093  1.00 39.63  ? 782  ASN A ND2   1 
ATOM   4264 N N     . VAL C 3 488 ? 10.270  20.284 44.687  1.00 33.84  ? 783  VAL A N     1 
ATOM   4265 C CA    . VAL C 3 488 ? 9.699   20.252 43.315  1.00 33.48  ? 783  VAL A CA    1 
ATOM   4266 C C     . VAL C 3 488 ? 8.289   20.871 43.361  1.00 29.56  ? 783  VAL A C     1 
ATOM   4267 O O     . VAL C 3 488 ? 8.017   21.751 42.536  1.00 27.94  ? 783  VAL A O     1 
ATOM   4268 C CB    . VAL C 3 488 ? 9.750   18.820 42.752  1.00 37.23  ? 783  VAL A CB    1 
ATOM   4269 C CG1   . VAL C 3 488 ? 9.030   18.678 41.417  1.00 37.56  ? 783  VAL A CG1   1 
ATOM   4270 C CG2   . VAL C 3 488 ? 11.191  18.341 42.624  1.00 35.63  ? 783  VAL A CG2   1 
ATOM   4271 N N     . ARG C 3 489 ? 7.469   20.508 44.345  1.00 28.35  ? 784  ARG A N     1 
ATOM   4272 C CA    . ARG C 3 489 ? 6.116   21.083 44.544  1.00 30.04  ? 784  ARG A CA    1 
ATOM   4273 C C     . ARG C 3 489 ? 6.227   22.596 44.787  1.00 26.63  ? 784  ARG A C     1 
ATOM   4274 O O     . ARG C 3 489 ? 5.493   23.339 44.136  1.00 24.14  ? 784  ARG A O     1 
ATOM   4275 C CB    . ARG C 3 489 ? 5.359   20.414 45.692  1.00 30.07  ? 784  ARG A CB    1 
ATOM   4276 C CG    . ARG C 3 489 ? 4.064   21.127 46.036  1.00 34.96  ? 784  ARG A CG    1 
ATOM   4277 C CD    . ARG C 3 489 ? 3.016   20.305 46.765  1.00 42.26  ? 784  ARG A CD    1 
ATOM   4278 N NE    . ARG C 3 489 ? 3.422   20.168 48.148  1.00 49.91  ? 784  ARG A NE    1 
ATOM   4279 C CZ    . ARG C 3 489 ? 3.855   19.045 48.705  1.00 52.84  ? 784  ARG A CZ    1 
ATOM   4280 N NH1   . ARG C 3 489 ? 3.869   17.909 48.020  1.00 50.97  ? 784  ARG A NH1   1 
ATOM   4281 N NH2   . ARG C 3 489 ? 4.254   19.070 49.967  1.00 55.99  ? 784  ARG A NH2   1 
ATOM   4282 N N     . SER C 3 490 ? 7.089   23.032 45.707  1.00 25.65  ? 785  SER A N     1 
ATOM   4283 C CA    . SER C 3 490 ? 7.246   24.469 46.082  1.00 26.57  ? 785  SER A CA    1 
ATOM   4284 C C     . SER C 3 490 ? 7.665   25.285 44.858  1.00 22.75  ? 785  SER A C     1 
ATOM   4285 O O     . SER C 3 490 ? 7.167   26.381 44.714  1.00 22.38  ? 785  SER A O     1 
ATOM   4286 C CB    . SER C 3 490 ? 8.230   24.675 47.201  1.00 25.95  ? 785  SER A CB    1 
ATOM   4287 O OG    . SER C 3 490 ? 7.769   24.020 48.366  1.00 30.50  ? 785  SER A OG    1 
ATOM   4288 N N     . PHE C 3 491 ? 8.537   24.753 44.011  1.00 21.30  ? 786  PHE A N     1 
ATOM   4289 C CA    . PHE C 3 491 ? 9.027   25.473 42.807  1.00 24.79  ? 786  PHE A CA    1 
ATOM   4290 C C     . PHE C 3 491 ? 7.835   25.693 41.853  1.00 21.61  ? 786  PHE A C     1 
ATOM   4291 O O     . PHE C 3 491 ? 7.612   26.815 41.376  1.00 19.44  ? 786  PHE A O     1 
ATOM   4292 C CB    . PHE C 3 491 ? 10.240  24.733 42.234  1.00 29.33  ? 786  PHE A CB    1 
ATOM   4293 C CG    . PHE C 3 491 ? 11.068  25.466 41.205  1.00 38.45  ? 786  PHE A CG    1 
ATOM   4294 C CD1   . PHE C 3 491 ? 11.040  26.854 41.087  1.00 45.38  ? 786  PHE A CD1   1 
ATOM   4295 C CD2   . PHE C 3 491 ? 11.920  24.755 40.366  1.00 47.05  ? 786  PHE A CD2   1 
ATOM   4296 C CE1   . PHE C 3 491 ? 11.811  27.504 40.129  1.00 49.08  ? 786  PHE A CE1   1 
ATOM   4297 C CE2   . PHE C 3 491 ? 12.698  25.407 39.413  1.00 51.91  ? 786  PHE A CE2   1 
ATOM   4298 C CZ    . PHE C 3 491 ? 12.640  26.781 39.296  1.00 50.48  ? 786  PHE A CZ    1 
ATOM   4299 N N     . ALA C 3 492 ? 7.016   24.662 41.645  1.00 19.69  ? 787  ALA A N     1 
ATOM   4300 C CA    . ALA C 3 492 ? 5.771   24.763 40.854  1.00 18.43  ? 787  ALA A CA    1 
ATOM   4301 C C     . ALA C 3 492 ? 4.824   25.798 41.480  1.00 17.67  ? 787  ALA A C     1 
ATOM   4302 O O     . ALA C 3 492 ? 4.176   26.532 40.743  1.00 16.89  ? 787  ALA A O     1 
ATOM   4303 C CB    . ALA C 3 492 ? 5.136   23.404 40.743  1.00 18.40  ? 787  ALA A CB    1 
ATOM   4304 N N     . GLU C 3 493 ? 4.759   25.913 42.804  1.00 18.44  ? 788  GLU A N     1 
ATOM   4305 C CA    . GLU C 3 493 ? 3.819   26.876 43.439  1.00 20.11  ? 788  GLU A CA    1 
ATOM   4306 C C     . GLU C 3 493 ? 4.305   28.307 43.148  1.00 20.44  ? 788  GLU A C     1 
ATOM   4307 O O     . GLU C 3 493 ? 3.460   29.218 42.917  1.00 19.99  ? 788  GLU A O     1 
ATOM   4308 C CB    . GLU C 3 493 ? 3.671   26.574 44.936  1.00 20.95  ? 788  GLU A CB    1 
ATOM   4309 C CG    . GLU C 3 493 ? 2.848   25.324 45.224  1.00 22.57  ? 788  GLU A CG    1 
ATOM   4310 C CD    . GLU C 3 493 ? 2.825   24.826 46.672  1.00 25.25  ? 788  GLU A CD    1 
ATOM   4311 O OE1   . GLU C 3 493 ? 2.010   23.936 47.000  1.00 26.90  ? 788  GLU A OE1   1 
ATOM   4312 O OE2   . GLU C 3 493 ? 3.635   25.298 47.462  1.00 27.86  ? 788  GLU A OE2   1 
ATOM   4313 N N     . ARG C 3 494 ? 5.620   28.505 43.123  1.00 19.79  ? 789  ARG A N     1 
ATOM   4314 C CA    . ARG C 3 494 ? 6.213   29.847 42.924  1.00 20.45  ? 789  ARG A CA    1 
ATOM   4315 C C     . ARG C 3 494 ? 5.923   30.252 41.478  1.00 19.61  ? 789  ARG A C     1 
ATOM   4316 O O     . ARG C 3 494 ? 5.534   31.374 41.255  1.00 18.33  ? 789  ARG A O     1 
ATOM   4317 C CB    . ARG C 3 494 ? 7.687   29.808 43.324  1.00 21.61  ? 789  ARG A CB    1 
ATOM   4318 C CG    . ARG C 3 494 ? 7.887   29.503 44.802  1.00 25.32  ? 789  ARG A CG    1 
ATOM   4319 C CD    . ARG C 3 494 ? 9.199   30.035 45.390  1.00 29.59  ? 789  ARG A CD    1 
ATOM   4320 N NE    . ARG C 3 494 ? 10.336  29.296 44.885  1.00 32.87  ? 789  ARG A NE    1 
ATOM   4321 C CZ    . ARG C 3 494 ? 10.704  28.066 45.282  1.00 37.98  ? 789  ARG A CZ    1 
ATOM   4322 N NH1   . ARG C 3 494 ? 10.041  27.418 46.227  1.00 39.38  ? 789  ARG A NH1   1 
ATOM   4323 N NH2   . ARG C 3 494 ? 11.743  27.482 44.713  1.00 38.69  ? 789  ARG A NH2   1 
ATOM   4324 N N     . MET C 3 495 ? 6.035   29.308 40.554  1.00 18.90  ? 790  MET A N     1 
ATOM   4325 C CA    . MET C 3 495 ? 5.760   29.533 39.128  1.00 17.70  ? 790  MET A CA    1 
ATOM   4326 C C     . MET C 3 495 ? 4.288   29.889 38.968  1.00 15.91  ? 790  MET A C     1 
ATOM   4327 O O     . MET C 3 495 ? 3.992   30.753 38.122  1.00 14.31  ? 790  MET A O     1 
ATOM   4328 C CB    . MET C 3 495 ? 6.099   28.275 38.334  1.00 18.85  ? 790  MET A CB    1 
ATOM   4329 C CG    . MET C 3 495 ? 7.591   28.040 38.255  1.00 20.57  ? 790  MET A CG    1 
ATOM   4330 S SD    . MET C 3 495 ? 7.906   26.552 37.280  1.00 24.04  ? 790  MET A SD    1 
ATOM   4331 C CE    . MET C 3 495 ? 9.657   26.319 37.595  1.00 25.36  ? 790  MET A CE    1 
ATOM   4332 N N     . ALA C 3 496 ? 3.402   29.252 39.749  1.00 14.43  ? 791  ALA A N     1 
ATOM   4333 C CA    . ALA C 3 496 ? 1.957   29.511 39.669  1.00 13.33  ? 791  ALA A CA    1 
ATOM   4334 C C     . ALA C 3 496 ? 1.716   30.930 40.155  1.00 13.17  ? 791  ALA A C     1 
ATOM   4335 O O     . ALA C 3 496 ? 0.920   31.597 39.590  1.00 13.01  ? 791  ALA A O     1 
ATOM   4336 C CB    . ALA C 3 496 ? 1.165   28.509 40.455  1.00 13.59  ? 791  ALA A CB    1 
ATOM   4337 N N     . MET C 3 497 ? 2.439   31.355 41.175  1.00 14.72  ? 792  MET A N     1 
ATOM   4338 C CA    . MET C 3 497 ? 2.321   32.711 41.748  1.00 15.68  ? 792  MET A CA    1 
ATOM   4339 C C     . MET C 3 497 ? 2.959   33.741 40.784  1.00 15.58  ? 792  MET A C     1 
ATOM   4340 O O     . MET C 3 497 ? 2.345   34.782 40.534  1.00 16.29  ? 792  MET A O     1 
ATOM   4341 C CB    . MET C 3 497 ? 2.964   32.696 43.135  1.00 17.17  ? 792  MET A CB    1 
ATOM   4342 C CG    . MET C 3 497 ? 2.087   31.973 44.154  1.00 19.44  ? 792  MET A CG    1 
ATOM   4343 S SD    . MET C 3 497 ? 2.735   32.016 45.835  1.00 24.07  ? 792  MET A SD    1 
ATOM   4344 C CE    . MET C 3 497 ? 3.848   30.614 45.891  1.00 25.49  ? 792  MET A CE    1 
ATOM   4345 N N     . ASN C 3 498 ? 4.075   33.416 40.150  1.00 14.37  ? 793  ASN A N     1 
ATOM   4346 C CA    . ASN C 3 498 ? 4.886   34.417 39.412  1.00 15.25  ? 793  ASN A CA    1 
ATOM   4347 C C     . ASN C 3 498 ? 4.432   34.511 37.944  1.00 15.47  ? 793  ASN A C     1 
ATOM   4348 O O     . ASN C 3 498 ? 4.418   35.614 37.416  1.00 13.66  ? 793  ASN A O     1 
ATOM   4349 C CB    . ASN C 3 498 ? 6.373   34.103 39.558  1.00 15.08  ? 793  ASN A CB    1 
ATOM   4350 C CG    . ASN C 3 498 ? 7.230   35.053 38.762  1.00 16.51  ? 793  ASN A CG    1 
ATOM   4351 O OD1   . ASN C 3 498 ? 7.694   34.712 37.669  1.00 15.35  ? 793  ASN A OD1   1 
ATOM   4352 N ND2   . ASN C 3 498 ? 7.372   36.265 39.276  1.00 17.47  ? 793  ASN A ND2   1 
ATOM   4353 N N     . THR C 3 499 ? 4.113   33.385 37.294  1.00 15.19  ? 794  THR A N     1 
ATOM   4354 C CA    . THR C 3 499 ? 3.982   33.325 35.823  1.00 15.13  ? 794  THR A CA    1 
ATOM   4355 C C     . THR C 3 499 ? 2.872   34.257 35.351  1.00 15.15  ? 794  THR A C     1 
ATOM   4356 O O     . THR C 3 499 ? 3.075   35.010 34.402  1.00 16.32  ? 794  THR A O     1 
ATOM   4357 C CB    . THR C 3 499 ? 3.859   31.891 35.301  1.00 15.84  ? 794  THR A CB    1 
ATOM   4358 O OG1   . THR C 3 499 ? 5.107   31.224 35.511  1.00 14.44  ? 794  THR A OG1   1 
ATOM   4359 C CG2   . THR C 3 499 ? 3.499   31.866 33.837  1.00 16.03  ? 794  THR A CG2   1 
ATOM   4360 N N     . PRO C 3 500 ? 1.667   34.282 35.963  1.00 14.55  ? 795  PRO A N     1 
ATOM   4361 C CA    . PRO C 3 500 ? 0.666   35.242 35.553  1.00 14.65  ? 795  PRO A CA    1 
ATOM   4362 C C     . PRO C 3 500 ? 1.123   36.700 35.660  1.00 15.07  ? 795  PRO A C     1 
ATOM   4363 O O     . PRO C 3 500 ? 0.586   37.522 34.944  1.00 15.02  ? 795  PRO A O     1 
ATOM   4364 C CB    . PRO C 3 500 ? -0.477  34.976 36.537  1.00 14.38  ? 795  PRO A CB    1 
ATOM   4365 C CG    . PRO C 3 500 ? -0.316  33.528 36.832  1.00 13.67  ? 795  PRO A CG    1 
ATOM   4366 C CD    . PRO C 3 500 ? 1.171   33.358 36.984  1.00 13.96  ? 795  PRO A CD    1 
ATOM   4367 N N     . ILE C 3 501 ? 1.993   37.029 36.613  1.00 16.01  ? 796  ILE A N     1 
ATOM   4368 C CA    . ILE C 3 501 ? 2.447   38.444 36.770  1.00 16.07  ? 796  ILE A CA    1 
ATOM   4369 C C     . ILE C 3 501 ? 3.454   38.755 35.654  1.00 15.60  ? 796  ILE A C     1 
ATOM   4370 O O     . ILE C 3 501 ? 3.193   39.686 34.890  1.00 15.49  ? 796  ILE A O     1 
ATOM   4371 C CB    . ILE C 3 501 ? 3.020   38.705 38.175  1.00 16.82  ? 796  ILE A CB    1 
ATOM   4372 C CG1   . ILE C 3 501 ? 1.941   38.496 39.245  1.00 18.05  ? 796  ILE A CG1   1 
ATOM   4373 C CG2   . ILE C 3 501 ? 3.645   40.096 38.239  1.00 15.83  ? 796  ILE A CG2   1 
ATOM   4374 C CD1   . ILE C 3 501 ? 2.447   38.184 40.644  1.00 17.22  ? 796  ILE A CD1   1 
ATOM   4375 N N     . GLN C 3 502 ? 4.550   37.996 35.579  1.00 15.14  ? 797  GLN A N     1 
ATOM   4376 C CA    . GLN C 3 502 ? 5.659   38.219 34.618  1.00 16.10  ? 797  GLN A CA    1 
ATOM   4377 C C     . GLN C 3 502 ? 5.107   38.060 33.187  1.00 16.77  ? 797  GLN A C     1 
ATOM   4378 O O     . GLN C 3 502 ? 5.441   38.904 32.352  1.00 18.13  ? 797  GLN A O     1 
ATOM   4379 C CB    . GLN C 3 502 ? 6.824   37.261 34.877  1.00 16.65  ? 797  GLN A CB    1 
ATOM   4380 C CG    . GLN C 3 502 ? 8.054   37.559 34.024  1.00 17.84  ? 797  GLN A CG    1 
ATOM   4381 C CD    . GLN C 3 502 ? 9.191   36.578 34.206  1.00 19.74  ? 797  GLN A CD    1 
ATOM   4382 O OE1   . GLN C 3 502 ? 9.641   35.983 33.219  1.00 22.42  ? 797  GLN A OE1   1 
ATOM   4383 N NE2   . GLN C 3 502 ? 9.623   36.347 35.452  1.00 16.70  ? 797  GLN A NE2   1 
ATOM   4384 N N     . GLY C 3 503 ? 4.285   37.031 32.942  1.00 14.67  ? 798  GLY A N     1 
ATOM   4385 C CA    . GLY C 3 503 ? 3.669   36.718 31.643  1.00 14.11  ? 798  GLY A CA    1 
ATOM   4386 C C     . GLY C 3 503 ? 2.692   37.783 31.215  1.00 15.02  ? 798  GLY A C     1 
ATOM   4387 O O     . GLY C 3 503 ? 2.748   38.182 30.052  1.00 15.17  ? 798  GLY A O     1 
ATOM   4388 N N     . SER C 3 504 ? 1.810   38.248 32.106  1.00 14.43  ? 799  SER A N     1 
ATOM   4389 C CA    . SER C 3 504 ? 0.898   39.370 31.758  1.00 13.45  ? 799  SER A CA    1 
ATOM   4390 C C     . SER C 3 504 ? 1.700   40.630 31.388  1.00 12.18  ? 799  SER A C     1 
ATOM   4391 O O     . SER C 3 504 ? 1.323   41.286 30.441  1.00 11.22  ? 799  SER A O     1 
ATOM   4392 C CB    . SER C 3 504 ? -0.072  39.624 32.848  1.00 12.61  ? 799  SER A CB    1 
ATOM   4393 O OG    . SER C 3 504 ? -0.891  38.489 32.965  1.00 13.50  ? 799  SER A OG    1 
ATOM   4394 N N     . ALA C 3 505 ? 2.772   40.941 32.112  1.00 11.87  ? 800  ALA A N     1 
ATOM   4395 C CA    . ALA C 3 505 ? 3.680   42.063 31.810  1.00 12.36  ? 800  ALA A CA    1 
ATOM   4396 C C     . ALA C 3 505 ? 4.269   41.865 30.403  1.00 11.84  ? 800  ALA A C     1 
ATOM   4397 O O     . ALA C 3 505 ? 4.351   42.819 29.626  1.00 12.26  ? 800  ALA A O     1 
ATOM   4398 C CB    . ALA C 3 505 ? 4.759   42.167 32.888  1.00 12.57  ? 800  ALA A CB    1 
ATOM   4399 N N     . ALA C 3 506 ? 4.610   40.643 30.039  1.00 11.90  ? 801  ALA A N     1 
ATOM   4400 C CA    . ALA C 3 506 ? 5.197   40.359 28.711  1.00 11.85  ? 801  ALA A CA    1 
ATOM   4401 C C     . ALA C 3 506 ? 4.111   40.581 27.656  1.00 12.04  ? 801  ALA A C     1 
ATOM   4402 O O     . ALA C 3 506 ? 4.387   41.247 26.610  1.00 12.15  ? 801  ALA A O     1 
ATOM   4403 C CB    . ALA C 3 506 ? 5.788   38.977 28.692  1.00 11.70  ? 801  ALA A CB    1 
ATOM   4404 N N     . ASP C 3 507 ? 2.887   40.146 27.941  1.00 12.31  ? 802  ASP A N     1 
ATOM   4405 C CA    . ASP C 3 507 ? 1.760   40.284 26.986  1.00 13.05  ? 802  ASP A CA    1 
ATOM   4406 C C     . ASP C 3 507 ? 1.571   41.779 26.696  1.00 13.37  ? 802  ASP A C     1 
ATOM   4407 O O     . ASP C 3 507 ? 1.385   42.153 25.527  1.00 15.49  ? 802  ASP A O     1 
ATOM   4408 C CB    . ASP C 3 507 ? 0.452   39.716 27.525  1.00 13.62  ? 802  ASP A CB    1 
ATOM   4409 C CG    . ASP C 3 507 ? 0.373   38.213 27.672  1.00 14.72  ? 802  ASP A CG    1 
ATOM   4410 O OD1   . ASP C 3 507 ? 1.267   37.491 27.121  1.00 16.28  ? 802  ASP A OD1   1 
ATOM   4411 O OD2   . ASP C 3 507 ? -0.560  37.780 28.371  1.00 14.39  ? 802  ASP A OD2   1 
ATOM   4412 N N     . ILE C 3 508 ? 1.599   42.609 27.724  1.00 12.84  ? 803  ILE A N     1 
ATOM   4413 C CA    . ILE C 3 508 ? 1.258   44.049 27.590  1.00 13.19  ? 803  ILE A CA    1 
ATOM   4414 C C     . ILE C 3 508 ? 2.328   44.744 26.761  1.00 13.30  ? 803  ILE A C     1 
ATOM   4415 O O     . ILE C 3 508 ? 1.969   45.498 25.862  1.00 13.65  ? 803  ILE A O     1 
ATOM   4416 C CB    . ILE C 3 508 ? 1.092   44.707 28.964  1.00 13.66  ? 803  ILE A CB    1 
ATOM   4417 C CG1   . ILE C 3 508 ? -0.128  44.147 29.687  1.00 13.54  ? 803  ILE A CG1   1 
ATOM   4418 C CG2   . ILE C 3 508 ? 1.055   46.237 28.860  1.00 13.17  ? 803  ILE A CG2   1 
ATOM   4419 C CD1   . ILE C 3 508 ? -0.164  44.547 31.131  1.00 14.30  ? 803  ILE A CD1   1 
ATOM   4420 N N     . ILE C 3 509 ? 3.599   44.537 27.065  1.00 14.02  ? 804  ILE A N     1 
ATOM   4421 C CA    . ILE C 3 509 ? 4.671   45.231 26.288  1.00 14.84  ? 804  ILE A CA    1 
ATOM   4422 C C     . ILE C 3 509 ? 4.657   44.745 24.831  1.00 14.26  ? 804  ILE A C     1 
ATOM   4423 O O     . ILE C 3 509 ? 4.850   45.591 23.959  1.00 14.62  ? 804  ILE A O     1 
ATOM   4424 C CB    . ILE C 3 509 ? 6.063   45.160 26.933  1.00 14.74  ? 804  ILE A CB    1 
ATOM   4425 C CG1   . ILE C 3 509 ? 7.000   46.151 26.242  1.00 15.72  ? 804  ILE A CG1   1 
ATOM   4426 C CG2   . ILE C 3 509 ? 6.640   43.762 26.927  1.00 15.50  ? 804  ILE A CG2   1 
ATOM   4427 C CD1   . ILE C 3 509 ? 8.225   46.530 27.052  1.00 15.40  ? 804  ILE A CD1   1 
ATOM   4428 N N     . LYS C 3 510 ? 4.342   43.478 24.553  1.00 14.54  ? 805  LYS A N     1 
ATOM   4429 C CA    . LYS C 3 510 ? 4.269   42.990 23.148  1.00 14.24  ? 805  LYS A CA    1 
ATOM   4430 C C     . LYS C 3 510 ? 3.118   43.696 22.427  1.00 15.14  ? 805  LYS A C     1 
ATOM   4431 O O     . LYS C 3 510 ? 3.315   44.117 21.276  1.00 14.72  ? 805  LYS A O     1 
ATOM   4432 C CB    . LYS C 3 510 ? 4.091   41.474 23.065  1.00 14.37  ? 805  LYS A CB    1 
ATOM   4433 C CG    . LYS C 3 510 ? 5.299   40.632 23.484  1.00 13.67  ? 805  LYS A CG    1 
ATOM   4434 C CD    . LYS C 3 510 ? 5.019   39.148 23.382  1.00 13.85  ? 805  LYS A CD    1 
ATOM   4435 C CE    . LYS C 3 510 ? 6.235   38.274 23.532  1.00 14.26  ? 805  LYS A CE    1 
ATOM   4436 N NZ    . LYS C 3 510 ? 5.874   36.837 23.643  1.00 14.54  ? 805  LYS A NZ    1 
ATOM   4437 N N     . LYS C 3 511 ? 1.958   43.843 23.074  1.00 15.96  ? 806  LYS A N     1 
ATOM   4438 C CA    . LYS C 3 511 ? 0.847   44.591 22.456  1.00 16.97  ? 806  LYS A CA    1 
ATOM   4439 C C     . LYS C 3 511 ? 1.262   46.054 22.207  1.00 16.35  ? 806  LYS A C     1 
ATOM   4440 O O     . LYS C 3 511 ? 0.870   46.615 21.172  1.00 15.26  ? 806  LYS A O     1 
ATOM   4441 C CB    . LYS C 3 511 ? -0.449  44.546 23.270  1.00 18.37  ? 806  LYS A CB    1 
ATOM   4442 C CG    . LYS C 3 511 ? -1.621  45.167 22.510  1.00 18.48  ? 806  LYS A CG    1 
ATOM   4443 C CD    . LYS C 3 511 ? -2.977  44.677 22.944  1.00 20.93  ? 806  LYS A CD    1 
ATOM   4444 C CE    . LYS C 3 511 ? -4.149  45.441 22.334  1.00 21.90  ? 806  LYS A CE    1 
ATOM   4445 N NZ    . LYS C 3 511 ? -3.970  46.921 22.372  1.00 21.64  ? 806  LYS A NZ    1 
ATOM   4446 N N     . ALA C 3 512 ? 1.950   46.681 23.151  1.00 16.27  ? 807  ALA A N     1 
ATOM   4447 C CA    . ALA C 3 512 ? 2.411   48.073 23.005  1.00 15.66  ? 807  ALA A CA    1 
ATOM   4448 C C     . ALA C 3 512 ? 3.347   48.134 21.797  1.00 16.10  ? 807  ALA A C     1 
ATOM   4449 O O     . ALA C 3 512 ? 3.260   49.120 21.052  1.00 16.17  ? 807  ALA A O     1 
ATOM   4450 C CB    . ALA C 3 512 ? 3.105   48.549 24.259  1.00 15.92  ? 807  ALA A CB    1 
ATOM   4451 N N     . MET C 3 513 ? 4.232   47.143 21.606  1.00 15.18  ? 808  MET A N     1 
ATOM   4452 C CA    . MET C 3 513 ? 5.159   47.189 20.449  1.00 14.61  ? 808  MET A CA    1 
ATOM   4453 C C     . MET C 3 513 ? 4.329   47.190 19.156  1.00 14.34  ? 808  MET A C     1 
ATOM   4454 O O     . MET C 3 513 ? 4.565   48.055 18.314  1.00 14.26  ? 808  MET A O     1 
ATOM   4455 C CB    . MET C 3 513 ? 6.154   46.038 20.471  1.00 14.26  ? 808  MET A CB    1 
ATOM   4456 C CG    . MET C 3 513 ? 7.077   46.139 21.644  1.00 14.56  ? 808  MET A CG    1 
ATOM   4457 S SD    . MET C 3 513 ? 8.042   44.638 21.875  1.00 15.14  ? 808  MET A SD    1 
ATOM   4458 C CE    . MET C 3 513 ? 9.163   44.804 20.491  1.00 13.97  ? 808  MET A CE    1 
ATOM   4459 N N     . ILE C 3 514 ? 3.299   46.353 19.073  1.00 14.02  ? 809  ILE A N     1 
ATOM   4460 C CA    . ILE C 3 514 ? 2.409   46.289 17.896  1.00 14.21  ? 809  ILE A CA    1 
ATOM   4461 C C     . ILE C 3 514 ? 1.702   47.635 17.727  1.00 14.99  ? 809  ILE A C     1 
ATOM   4462 O O     . ILE C 3 514 ? 1.706   48.168 16.592  1.00 13.88  ? 809  ILE A O     1 
ATOM   4463 C CB    . ILE C 3 514 ? 1.442   45.113 17.981  1.00 14.97  ? 809  ILE A CB    1 
ATOM   4464 C CG1   . ILE C 3 514 ? 2.231   43.805 17.943  1.00 15.75  ? 809  ILE A CG1   1 
ATOM   4465 C CG2   . ILE C 3 514 ? 0.405   45.214 16.858  1.00 15.03  ? 809  ILE A CG2   1 
ATOM   4466 C CD1   . ILE C 3 514 ? 1.442   42.582 18.361  1.00 16.72  ? 809  ILE A CD1   1 
ATOM   4467 N N     . ASP C 3 515 ? 1.138   48.182 18.798  1.00 15.46  ? 810  ASP A N     1 
ATOM   4468 C CA    . ASP C 3 515 ? 0.351   49.431 18.713  1.00 15.47  ? 810  ASP A CA    1 
ATOM   4469 C C     . ASP C 3 515 ? 1.298   50.557 18.318  1.00 16.31  ? 810  ASP A C     1 
ATOM   4470 O O     . ASP C 3 515 ? 0.936   51.371 17.456  1.00 15.54  ? 810  ASP A O     1 
ATOM   4471 C CB    . ASP C 3 515 ? -0.364  49.744 20.028  1.00 17.45  ? 810  ASP A CB    1 
ATOM   4472 C CG    . ASP C 3 515 ? -1.448  48.762 20.436  1.00 18.27  ? 810  ASP A CG    1 
ATOM   4473 O OD1   . ASP C 3 515 ? -1.866  47.968 19.609  1.00 21.59  ? 810  ASP A OD1   1 
ATOM   4474 O OD2   . ASP C 3 515 ? -1.862  48.815 21.589  1.00 21.90  ? 810  ASP A OD2   1 
ATOM   4475 N N     . LEU C 3 516 ? 2.491   50.582 18.906  1.00 16.67  ? 811  LEU A N     1 
ATOM   4476 C CA    . LEU C 3 516 ? 3.491   51.630 18.625  1.00 16.79  ? 811  LEU A CA    1 
ATOM   4477 C C     . LEU C 3 516 ? 3.982   51.596 17.163  1.00 17.49  ? 811  LEU A C     1 
ATOM   4478 O O     . LEU C 3 516 ? 4.078   52.676 16.585  1.00 17.68  ? 811  LEU A O     1 
ATOM   4479 C CB    . LEU C 3 516 ? 4.650   51.489 19.588  1.00 16.89  ? 811  LEU A CB    1 
ATOM   4480 C CG    . LEU C 3 516 ? 5.773   52.495 19.339  1.00 18.17  ? 811  LEU A CG    1 
ATOM   4481 C CD1   . LEU C 3 516 ? 5.266   53.900 19.567  1.00 17.22  ? 811  LEU A CD1   1 
ATOM   4482 C CD2   . LEU C 3 516 ? 6.983   52.192 20.219  1.00 18.70  ? 811  LEU A CD2   1 
ATOM   4483 N N     . ASN C 3 517 ? 4.270   50.445 16.574  1.00 18.57  ? 812  ASN A N     1 
ATOM   4484 C CA    . ASN C 3 517 ? 4.660   50.360 15.141  1.00 21.02  ? 812  ASN A CA    1 
ATOM   4485 C C     . ASN C 3 517 ? 3.554   50.898 14.237  1.00 20.53  ? 812  ASN A C     1 
ATOM   4486 O O     . ASN C 3 517 ? 3.879   51.649 13.296  1.00 19.40  ? 812  ASN A O     1 
ATOM   4487 C CB    . ASN C 3 517 ? 4.939   48.941 14.662  1.00 24.99  ? 812  ASN A CB    1 
ATOM   4488 C CG    . ASN C 3 517 ? 6.351   48.776 14.160  1.00 30.03  ? 812  ASN A CG    1 
ATOM   4489 O OD1   . ASN C 3 517 ? 6.551   48.323 13.038  1.00 38.52  ? 812  ASN A OD1   1 
ATOM   4490 N ND2   . ASN C 3 517 ? 7.321   49.129 14.983  1.00 36.14  ? 812  ASN A ND2   1 
ATOM   4491 N N     . ALA C 3 518 ? 2.295   50.532 14.495  1.00 20.44  ? 813  ALA A N     1 
ATOM   4492 C CA    . ALA C 3 518 ? 1.135   51.048 13.731  1.00 21.43  ? 813  ALA A CA    1 
ATOM   4493 C C     . ALA C 3 518 ? 1.062   52.577 13.896  1.00 21.98  ? 813  ALA A C     1 
ATOM   4494 O O     . ALA C 3 518 ? 0.912   53.256 12.889  1.00 23.79  ? 813  ALA A O     1 
ATOM   4495 C CB    . ALA C 3 518 ? -0.151  50.350 14.139  1.00 21.75  ? 813  ALA A CB    1 
ATOM   4496 N N     . ARG C 3 519 ? 1.227   53.127 15.098  1.00 21.90  ? 814  ARG A N     1 
ATOM   4497 C CA    . ARG C 3 519 ? 1.085   54.589 15.305  1.00 23.98  ? 814  ARG A CA    1 
ATOM   4498 C C     . ARG C 3 519 ? 2.225   55.328 14.588  1.00 20.95  ? 814  ARG A C     1 
ATOM   4499 O O     . ARG C 3 519 ? 1.920   56.311 13.930  1.00 18.98  ? 814  ARG A O     1 
ATOM   4500 C CB    . ARG C 3 519 ? 0.966   54.978 16.782  1.00 26.88  ? 814  ARG A CB    1 
ATOM   4501 C CG    . ARG C 3 519 ? -0.273  54.404 17.451  1.00 34.45  ? 814  ARG A CG    1 
ATOM   4502 C CD    . ARG C 3 519 ? -1.536  55.246 17.309  1.00 39.32  ? 814  ARG A CD    1 
ATOM   4503 N NE    . ARG C 3 519 ? -1.399  56.543 17.964  1.00 43.27  ? 814  ARG A NE    1 
ATOM   4504 C CZ    . ARG C 3 519 ? -1.337  57.715 17.335  1.00 44.52  ? 814  ARG A CZ    1 
ATOM   4505 N NH1   . ARG C 3 519 ? -1.449  57.779 16.017  1.00 45.15  ? 814  ARG A NH1   1 
ATOM   4506 N NH2   . ARG C 3 519 ? -1.212  58.829 18.038  1.00 41.27  ? 814  ARG A NH2   1 
ATOM   4507 N N     . LEU C 3 520 ? 3.469   54.876 14.689  1.00 19.11  ? 815  LEU A N     1 
ATOM   4508 C CA    . LEU C 3 520 ? 4.618   55.533 13.993  1.00 20.93  ? 815  LEU A CA    1 
ATOM   4509 C C     . LEU C 3 520 ? 4.391   55.599 12.472  1.00 20.01  ? 815  LEU A C     1 
ATOM   4510 O O     . LEU C 3 520 ? 4.695   56.645 11.887  1.00 17.13  ? 815  LEU A O     1 
ATOM   4511 C CB    . LEU C 3 520 ? 5.919   54.790 14.305  1.00 21.31  ? 815  LEU A CB    1 
ATOM   4512 C CG    . LEU C 3 520 ? 6.352   54.795 15.773  1.00 22.02  ? 815  LEU A CG    1 
ATOM   4513 C CD1   . LEU C 3 520 ? 7.456   53.781 15.970  1.00 23.11  ? 815  LEU A CD1   1 
ATOM   4514 C CD2   . LEU C 3 520 ? 6.796   56.176 16.241  1.00 20.95  ? 815  LEU A CD2   1 
ATOM   4515 N N     . LYS C 3 521 ? 3.841   54.552 11.863  1.00 23.59  ? 816  LYS A N     1 
ATOM   4516 C CA    . LYS C 3 521 ? 3.515   54.529 10.408  1.00 29.88  ? 816  LYS A CA    1 
ATOM   4517 C C     . LYS C 3 521 ? 2.386   55.524 10.101  1.00 29.24  ? 816  LYS A C     1 
ATOM   4518 O O     . LYS C 3 521 ? 2.589   56.361 9.196   1.00 27.66  ? 816  LYS A O     1 
ATOM   4519 C CB    . LYS C 3 521 ? 3.164   53.118 9.929   1.00 36.20  ? 816  LYS A CB    1 
ATOM   4520 C CG    . LYS C 3 521 ? 4.376   52.196 9.824   1.00 48.16  ? 816  LYS A CG    1 
ATOM   4521 C CD    . LYS C 3 521 ? 4.143   50.928 9.019   1.00 57.86  ? 816  LYS A CD    1 
ATOM   4522 C CE    . LYS C 3 521 ? 5.210   49.870 9.251   1.00 64.70  ? 816  LYS A CE    1 
ATOM   4523 N NZ    . LYS C 3 521 ? 5.258   49.403 10.661  1.00 62.86  ? 816  LYS A NZ    1 
ATOM   4524 N N     . GLU C 3 522 ? 1.281   55.472 10.848  1.00 27.43  ? 817  GLU A N     1 
ATOM   4525 C CA    . GLU C 3 522 ? 0.148   56.430 10.729  1.00 30.96  ? 817  GLU A CA    1 
ATOM   4526 C C     . GLU C 3 522 ? 0.714   57.858 10.767  1.00 28.00  ? 817  GLU A C     1 
ATOM   4527 O O     . GLU C 3 522 ? 0.314   58.671 9.945   1.00 26.69  ? 817  GLU A O     1 
ATOM   4528 C CB    . GLU C 3 522 ? -0.875  56.278 11.860  1.00 32.93  ? 817  GLU A CB    1 
ATOM   4529 C CG    . GLU C 3 522 ? -1.728  55.016 11.824  1.00 41.43  ? 817  GLU A CG    1 
ATOM   4530 C CD    . GLU C 3 522 ? -2.481  54.703 13.130  1.00 47.14  ? 817  GLU A CD    1 
ATOM   4531 O OE1   . GLU C 3 522 ? -2.945  55.671 13.824  1.00 38.61  ? 817  GLU A OE1   1 
ATOM   4532 O OE2   . GLU C 3 522 ? -2.576  53.487 13.485  1.00 49.69  ? 817  GLU A OE2   1 
ATOM   4533 N N     . GLU C 3 523 ? 1.641   58.125 11.685  1.00 25.92  ? 818  GLU A N     1 
ATOM   4534 C CA    . GLU C 3 523 ? 2.128   59.490 11.999  1.00 26.09  ? 818  GLU A CA    1 
ATOM   4535 C C     . GLU C 3 523 ? 3.238   59.884 11.022  1.00 24.89  ? 818  GLU A C     1 
ATOM   4536 O O     . GLU C 3 523 ? 3.711   60.997 11.150  1.00 25.91  ? 818  GLU A O     1 
ATOM   4537 C CB    . GLU C 3 523 ? 2.668   59.529 13.430  1.00 29.03  ? 818  GLU A CB    1 
ATOM   4538 C CG    . GLU C 3 523 ? 1.593   59.384 14.492  1.00 31.21  ? 818  GLU A CG    1 
ATOM   4539 C CD    . GLU C 3 523 ? 0.565   60.491 14.432  1.00 35.01  ? 818  GLU A CD    1 
ATOM   4540 O OE1   . GLU C 3 523 ? -0.637  60.168 14.572  1.00 33.91  ? 818  GLU A OE1   1 
ATOM   4541 O OE2   . GLU C 3 523 ? 0.972   61.663 14.170  1.00 38.07  ? 818  GLU A OE2   1 
ATOM   4542 N N     . ARG C 3 524 ? 3.698   58.965 10.172  1.00 23.87  ? 819  ARG A N     1 
ATOM   4543 C CA    . ARG C 3 524 ? 4.799   59.206 9.196   1.00 28.44  ? 819  ARG A CA    1 
ATOM   4544 C C     . ARG C 3 524 ? 6.117   59.521 9.917   1.00 25.57  ? 819  ARG A C     1 
ATOM   4545 O O     . ARG C 3 524 ? 6.950   60.271 9.350   1.00 27.74  ? 819  ARG A O     1 
ATOM   4546 C CB    . ARG C 3 524 ? 4.410   60.362 8.263   1.00 29.59  ? 819  ARG A CB    1 
ATOM   4547 C CG    . ARG C 3 524 ? 3.655   59.903 7.029   1.00 30.36  ? 819  ARG A CG    1 
ATOM   4548 C CD    . ARG C 3 524 ? 2.466   59.084 7.381   1.00 27.66  ? 819  ARG A CD    1 
ATOM   4549 N NE    . ARG C 3 524 ? 1.582   58.909 6.256   1.00 28.15  ? 819  ARG A NE    1 
ATOM   4550 C CZ    . ARG C 3 524 ? 0.835   57.828 6.031   1.00 28.42  ? 819  ARG A CZ    1 
ATOM   4551 N NH1   . ARG C 3 524 ? 0.896   56.765 6.826   1.00 25.89  ? 819  ARG A NH1   1 
ATOM   4552 N NH2   . ARG C 3 524 ? 0.027   57.814 4.979   1.00 30.61  ? 819  ARG A NH2   1 
ATOM   4553 N N     . LEU C 3 525 ? 6.305   59.020 11.134  1.00 22.26  ? 820  LEU A N     1 
ATOM   4554 C CA    . LEU C 3 525 ? 7.571   59.274 11.871  1.00 21.34  ? 820  LEU A CA    1 
ATOM   4555 C C     . LEU C 3 525 ? 8.625   58.332 11.289  1.00 18.93  ? 820  LEU A C     1 
ATOM   4556 O O     . LEU C 3 525 ? 8.248   57.260 10.888  1.00 19.90  ? 820  LEU A O     1 
ATOM   4557 C CB    . LEU C 3 525 ? 7.337   59.081 13.371  1.00 19.27  ? 820  LEU A CB    1 
ATOM   4558 C CG    . LEU C 3 525 ? 6.413   60.115 14.014  1.00 19.17  ? 820  LEU A CG    1 
ATOM   4559 C CD1   . LEU C 3 525 ? 6.007   59.694 15.407  1.00 19.34  ? 820  LEU A CD1   1 
ATOM   4560 C CD2   . LEU C 3 525 ? 7.073   61.474 14.058  1.00 19.44  ? 820  LEU A CD2   1 
ATOM   4561 N N     . GLN C 3 526 ? 9.875   58.760 11.207  1.00 19.04  ? 821  GLN A N     1 
ATOM   4562 C CA    . GLN C 3 526 ? 11.045  57.883 10.893  1.00 19.57  ? 821  GLN A CA    1 
ATOM   4563 C C     . GLN C 3 526 ? 11.483  57.093 12.128  1.00 19.13  ? 821  GLN A C     1 
ATOM   4564 O O     . GLN C 3 526 ? 12.258  56.163 11.954  1.00 18.28  ? 821  GLN A O     1 
ATOM   4565 C CB    . GLN C 3 526 ? 12.222  58.733 10.439  1.00 19.66  ? 821  GLN A CB    1 
ATOM   4566 C CG    . GLN C 3 526 ? 11.863  59.602 9.245   1.00 22.21  ? 821  GLN A CG    1 
ATOM   4567 C CD    . GLN C 3 526 ? 13.077  60.233 8.619   1.00 22.28  ? 821  GLN A CD    1 
ATOM   4568 O OE1   . GLN C 3 526 ? 13.135  61.440 8.464   1.00 26.11  ? 821  GLN A OE1   1 
ATOM   4569 N NE2   . GLN C 3 526 ? 14.081  59.427 8.321   1.00 25.63  ? 821  GLN A NE2   1 
ATOM   4570 N N     . ALA C 3 527 ? 11.063  57.493 13.327  1.00 16.84  ? 822  ALA A N     1 
ATOM   4571 C CA    . ALA C 3 527 ? 11.422  56.791 14.572  1.00 18.29  ? 822  ALA A CA    1 
ATOM   4572 C C     . ALA C 3 527 ? 11.151  55.307 14.376  1.00 18.32  ? 822  ALA A C     1 
ATOM   4573 O O     . ALA C 3 527 ? 10.145  54.960 13.774  1.00 19.49  ? 822  ALA A O     1 
ATOM   4574 C CB    . ALA C 3 527 ? 10.649  57.299 15.776  1.00 19.25  ? 822  ALA A CB    1 
ATOM   4575 N N     . HIS C 3 528 ? 12.003  54.457 14.931  1.00 18.85  ? 823  HIS A N     1 
ATOM   4576 C CA    . HIS C 3 528 ? 11.789  52.989 14.908  1.00 18.99  ? 823  HIS A CA    1 
ATOM   4577 C C     . HIS C 3 528 ? 12.344  52.355 16.182  1.00 16.05  ? 823  HIS A C     1 
ATOM   4578 O O     . HIS C 3 528 ? 13.297  52.907 16.824  1.00 14.61  ? 823  HIS A O     1 
ATOM   4579 C CB    . HIS C 3 528 ? 12.368  52.351 13.631  1.00 20.78  ? 823  HIS A CB    1 
ATOM   4580 C CG    . HIS C 3 528 ? 13.838  52.515 13.424  1.00 22.81  ? 823  HIS A CG    1 
ATOM   4581 N ND1   . HIS C 3 528 ? 14.355  53.170 12.327  1.00 26.33  ? 823  HIS A ND1   1 
ATOM   4582 C CD2   . HIS C 3 528 ? 14.905  52.079 14.120  1.00 27.16  ? 823  HIS A CD2   1 
ATOM   4583 C CE1   . HIS C 3 528 ? 15.670  53.118 12.346  1.00 26.38  ? 823  HIS A CE1   1 
ATOM   4584 N NE2   . HIS C 3 528 ? 16.036  52.456 13.430  1.00 26.25  ? 823  HIS A NE2   1 
ATOM   4585 N N     . LEU C 3 529 ? 11.756  51.221 16.497  1.00 14.45  ? 824  LEU A N     1 
ATOM   4586 C CA    . LEU C 3 529 ? 12.182  50.341 17.597  1.00 15.07  ? 824  LEU A CA    1 
ATOM   4587 C C     . LEU C 3 529 ? 13.555  49.755 17.283  1.00 14.44  ? 824  LEU A C     1 
ATOM   4588 O O     . LEU C 3 529 ? 13.761  49.271 16.153  1.00 14.00  ? 824  LEU A O     1 
ATOM   4589 C CB    . LEU C 3 529 ? 11.121  49.254 17.716  1.00 15.99  ? 824  LEU A CB    1 
ATOM   4590 C CG    . LEU C 3 529 ? 9.873   49.623 18.499  1.00 15.86  ? 824  LEU A CG    1 
ATOM   4591 C CD1   . LEU C 3 529 ? 8.836   48.526 18.357  1.00 17.12  ? 824  LEU A CD1   1 
ATOM   4592 C CD2   . LEU C 3 529 ? 10.232  49.784 19.964  1.00 17.12  ? 824  LEU A CD2   1 
ATOM   4593 N N     . LEU C 3 530 ? 14.443  49.785 18.272  1.00 15.28  ? 825  LEU A N     1 
ATOM   4594 C CA    . LEU C 3 530 ? 15.733  49.056 18.268  1.00 15.47  ? 825  LEU A CA    1 
ATOM   4595 C C     . LEU C 3 530 ? 15.669  47.861 19.221  1.00 15.25  ? 825  LEU A C     1 
ATOM   4596 O O     . LEU C 3 530 ? 16.108  46.767 18.828  1.00 14.70  ? 825  LEU A O     1 
ATOM   4597 C CB    . LEU C 3 530 ? 16.846  50.007 18.688  1.00 15.69  ? 825  LEU A CB    1 
ATOM   4598 C CG    . LEU C 3 530 ? 17.121  51.188 17.755  1.00 16.92  ? 825  LEU A CG    1 
ATOM   4599 C CD1   . LEU C 3 530 ? 18.394  51.909 18.191  1.00 17.18  ? 825  LEU A CD1   1 
ATOM   4600 C CD2   . LEU C 3 530 ? 17.271  50.728 16.319  1.00 17.30  ? 825  LEU A CD2   1 
ATOM   4601 N N     . LEU C 3 531 ? 15.221  48.077 20.455  1.00 15.12  ? 826  LEU A N     1 
ATOM   4602 C CA    . LEU C 3 531 ? 15.279  47.038 21.496  1.00 15.66  ? 826  LEU A CA    1 
ATOM   4603 C C     . LEU C 3 531 ? 14.010  47.037 22.331  1.00 15.03  ? 826  LEU A C     1 
ATOM   4604 O O     . LEU C 3 531 ? 13.355  48.100 22.468  1.00 14.07  ? 826  LEU A O     1 
ATOM   4605 C CB    . LEU C 3 531 ? 16.463  47.306 22.422  1.00 17.35  ? 826  LEU A CB    1 
ATOM   4606 C CG    . LEU C 3 531 ? 17.841  47.268 21.783  1.00 20.64  ? 826  LEU A CG    1 
ATOM   4607 C CD1   . LEU C 3 531 ? 18.890  47.691 22.813  1.00 21.63  ? 826  LEU A CD1   1 
ATOM   4608 C CD2   . LEU C 3 531 ? 18.150  45.885 21.199  1.00 19.98  ? 826  LEU A CD2   1 
ATOM   4609 N N     . GLN C 3 532 ? 13.756  45.875 22.929  1.00 15.20  ? 827  GLN A N     1 
ATOM   4610 C CA    . GLN C 3 532 ? 12.831  45.683 24.069  1.00 14.92  ? 827  GLN A CA    1 
ATOM   4611 C C     . GLN C 3 532 ? 13.679  45.070 25.176  1.00 14.37  ? 827  GLN A C     1 
ATOM   4612 O O     . GLN C 3 532 ? 14.478  44.197 24.864  1.00 15.63  ? 827  GLN A O     1 
ATOM   4613 C CB    . GLN C 3 532 ? 11.635  44.824 23.656  1.00 14.77  ? 827  GLN A CB    1 
ATOM   4614 C CG    . GLN C 3 532 ? 10.551  44.695 24.724  1.00 14.58  ? 827  GLN A CG    1 
ATOM   4615 C CD    . GLN C 3 532 ? 10.558  43.319 25.335  1.00 15.33  ? 827  GLN A CD    1 
ATOM   4616 O OE1   . GLN C 3 532 ? 11.568  42.863 25.812  1.00 17.78  ? 827  GLN A OE1   1 
ATOM   4617 N NE2   . GLN C 3 532 ? 9.453   42.601 25.265  1.00 18.25  ? 827  GLN A NE2   1 
ATOM   4618 N N     . VAL C 3 533 ? 13.554  45.556 26.405  1.00 14.42  ? 828  VAL A N     1 
ATOM   4619 C CA    . VAL C 3 533 ? 14.211  44.939 27.597  1.00 15.29  ? 828  VAL A CA    1 
ATOM   4620 C C     . VAL C 3 533 ? 13.145  44.692 28.662  1.00 15.18  ? 828  VAL A C     1 
ATOM   4621 O O     . VAL C 3 533 ? 13.204  45.322 29.680  1.00 15.96  ? 828  VAL A O     1 
ATOM   4622 C CB    . VAL C 3 533 ? 15.400  45.790 28.095  1.00 15.50  ? 828  VAL A CB    1 
ATOM   4623 C CG1   . VAL C 3 533 ? 16.270  45.044 29.082  1.00 15.34  ? 828  VAL A CG1   1 
ATOM   4624 C CG2   . VAL C 3 533 ? 16.270  46.262 26.932  1.00 17.12  ? 828  VAL A CG2   1 
ATOM   4625 N N     . HIS C 3 534 ? 12.161  43.835 28.364  1.00 16.61  ? 829  HIS A N     1 
ATOM   4626 C CA    . HIS C 3 534 ? 11.167  43.226 29.306  1.00 16.79  ? 829  HIS A CA    1 
ATOM   4627 C C     . HIS C 3 534 ? 10.054  44.207 29.695  1.00 17.46  ? 829  HIS A C     1 
ATOM   4628 O O     . HIS C 3 534 ? 8.844   43.888 29.399  1.00 18.94  ? 829  HIS A O     1 
ATOM   4629 C CB    . HIS C 3 534 ? 11.883  42.642 30.532  1.00 17.78  ? 829  HIS A CB    1 
ATOM   4630 C CG    . HIS C 3 534 ? 12.986  41.720 30.147  1.00 16.52  ? 829  HIS A CG    1 
ATOM   4631 N ND1   . HIS C 3 534 ? 12.838  40.846 29.103  1.00 16.15  ? 829  HIS A ND1   1 
ATOM   4632 C CD2   . HIS C 3 534 ? 14.225  41.529 30.649  1.00 17.20  ? 829  HIS A CD2   1 
ATOM   4633 C CE1   . HIS C 3 534 ? 13.963  40.165 28.945  1.00 17.85  ? 829  HIS A CE1   1 
ATOM   4634 N NE2   . HIS C 3 534 ? 14.849  40.578 29.877  1.00 18.23  ? 829  HIS A NE2   1 
ATOM   4635 N N     . ASP C 3 535 ? 10.418  45.375 30.245  1.00 17.38  ? 830  ASP A N     1 
ATOM   4636 C CA    . ASP C 3 535 ? 9.453   46.438 30.625  1.00 17.27  ? 830  ASP A CA    1 
ATOM   4637 C C     . ASP C 3 535 ? 9.877   47.769 30.012  1.00 16.21  ? 830  ASP A C     1 
ATOM   4638 O O     . ASP C 3 535 ? 9.429   48.821 30.478  1.00 15.46  ? 830  ASP A O     1 
ATOM   4639 C CB    . ASP C 3 535 ? 9.324   46.526 32.146  1.00 18.04  ? 830  ASP A CB    1 
ATOM   4640 C CG    . ASP C 3 535 ? 10.540  47.151 32.805  1.00 19.51  ? 830  ASP A CG    1 
ATOM   4641 O OD1   . ASP C 3 535 ? 11.608  47.263 32.124  1.00 18.75  ? 830  ASP A OD1   1 
ATOM   4642 O OD2   . ASP C 3 535 ? 10.407  47.543 33.966  1.00 19.24  ? 830  ASP A OD2   1 
ATOM   4643 N N     . GLU C 3 536 ? 10.661  47.729 28.955  1.00 18.20  ? 831  GLU A N     1 
ATOM   4644 C CA    . GLU C 3 536 ? 11.286  48.952 28.396  1.00 20.49  ? 831  GLU A CA    1 
ATOM   4645 C C     . GLU C 3 536 ? 11.437  48.803 26.869  1.00 17.94  ? 831  GLU A C     1 
ATOM   4646 O O     . GLU C 3 536 ? 11.741  47.692 26.372  1.00 15.28  ? 831  GLU A O     1 
ATOM   4647 C CB    . GLU C 3 536 ? 12.512  49.258 29.276  1.00 22.78  ? 831  GLU A CB    1 
ATOM   4648 C CG    . GLU C 3 536 ? 13.852  49.346 28.597  1.00 28.37  ? 831  GLU A CG    1 
ATOM   4649 C CD    . GLU C 3 536 ? 15.053  49.478 29.543  1.00 31.44  ? 831  GLU A CD    1 
ATOM   4650 O OE1   . GLU C 3 536 ? 14.867  49.509 30.785  1.00 31.52  ? 831  GLU A OE1   1 
ATOM   4651 O OE2   . GLU C 3 536 ? 16.188  49.535 29.033  1.00 38.95  ? 831  GLU A OE2   1 
ATOM   4652 N N     . LEU C 3 537 ? 11.126  49.889 26.158  1.00 17.01  ? 832  LEU A N     1 
ATOM   4653 C CA    . LEU C 3 537 ? 11.307  50.012 24.701  1.00 15.69  ? 832  LEU A CA    1 
ATOM   4654 C C     . LEU C 3 537 ? 12.352  51.093 24.426  1.00 16.14  ? 832  LEU A C     1 
ATOM   4655 O O     . LEU C 3 537 ? 12.249  52.211 24.964  1.00 14.22  ? 832  LEU A O     1 
ATOM   4656 C CB    . LEU C 3 537 ? 9.978   50.377 24.050  1.00 15.85  ? 832  LEU A CB    1 
ATOM   4657 C CG    . LEU C 3 537 ? 8.862   49.366 24.205  1.00 16.08  ? 832  LEU A CG    1 
ATOM   4658 C CD1   . LEU C 3 537 ? 7.603   49.825 23.477  1.00 16.82  ? 832  LEU A CD1   1 
ATOM   4659 C CD2   . LEU C 3 537 ? 9.307   48.017 23.685  1.00 17.27  ? 832  LEU A CD2   1 
ATOM   4660 N N     . ILE C 3 538 ? 13.292  50.772 23.541  1.00 17.18  ? 833  ILE A N     1 
ATOM   4661 C CA    . ILE C 3 538 ? 14.347  51.701 23.082  1.00 16.61  ? 833  ILE A CA    1 
ATOM   4662 C C     . ILE C 3 538 ? 14.185  51.879 21.585  1.00 16.70  ? 833  ILE A C     1 
ATOM   4663 O O     . ILE C 3 538 ? 14.099  50.870 20.869  1.00 16.25  ? 833  ILE A O     1 
ATOM   4664 C CB    . ILE C 3 538 ? 15.738  51.178 23.458  1.00 17.84  ? 833  ILE A CB    1 
ATOM   4665 C CG1   . ILE C 3 538 ? 15.867  51.023 24.978  1.00 19.31  ? 833  ILE A CG1   1 
ATOM   4666 C CG2   . ILE C 3 538 ? 16.791  52.119 22.909  1.00 17.08  ? 833  ILE A CG2   1 
ATOM   4667 C CD1   . ILE C 3 538 ? 15.685  49.661 25.425  1.00 22.97  ? 833  ILE A CD1   1 
ATOM   4668 N N     . LEU C 3 539 ? 14.127  53.142 21.178  1.00 16.39  ? 834  LEU A N     1 
ATOM   4669 C CA    . LEU C 3 539 ? 13.961  53.599 19.784  1.00 15.71  ? 834  LEU A CA    1 
ATOM   4670 C C     . LEU C 3 539 ? 15.124  54.534 19.444  1.00 14.38  ? 834  LEU A C     1 
ATOM   4671 O O     . LEU C 3 539 ? 15.819  55.010 20.379  1.00 14.28  ? 834  LEU A O     1 
ATOM   4672 C CB    . LEU C 3 539 ? 12.653  54.380 19.665  1.00 14.91  ? 834  LEU A CB    1 
ATOM   4673 C CG    . LEU C 3 539 ? 11.369  53.609 19.924  1.00 16.21  ? 834  LEU A CG    1 
ATOM   4674 C CD1   . LEU C 3 539 ? 10.997  53.553 21.405  1.00 15.21  ? 834  LEU A CD1   1 
ATOM   4675 C CD2   . LEU C 3 539 ? 10.244  54.259 19.141  1.00 16.93  ? 834  LEU A CD2   1 
ATOM   4676 N N     . GLU C 3 540 ? 15.257  54.833 18.162  1.00 12.76  ? 835  GLU A N     1 
ATOM   4677 C CA    . GLU C 3 540 ? 16.025  55.990 17.670  1.00 13.01  ? 835  GLU A CA    1 
ATOM   4678 C C     . GLU C 3 540 ? 15.149  56.727 16.655  1.00 13.01  ? 835  GLU A C     1 
ATOM   4679 O O     . GLU C 3 540 ? 14.321  56.090 15.990  1.00 12.68  ? 835  GLU A O     1 
ATOM   4680 C CB    . GLU C 3 540 ? 17.359  55.548 17.084  1.00 12.78  ? 835  GLU A CB    1 
ATOM   4681 C CG    . GLU C 3 540 ? 17.250  54.683 15.849  1.00 13.11  ? 835  GLU A CG    1 
ATOM   4682 C CD    . GLU C 3 540 ? 18.595  54.259 15.258  1.00 14.18  ? 835  GLU A CD    1 
ATOM   4683 O OE1   . GLU C 3 540 ? 19.612  54.643 15.839  1.00 13.91  ? 835  GLU A OE1   1 
ATOM   4684 O OE2   . GLU C 3 540 ? 18.619  53.576 14.177  1.00 15.60  ? 835  GLU A OE2   1 
ATOM   4685 N N     . ALA C 3 541 ? 15.327  58.036 16.603  1.00 12.93  ? 836  ALA A N     1 
ATOM   4686 C CA    . ALA C 3 541 ? 14.537  58.974 15.795  1.00 14.79  ? 836  ALA A CA    1 
ATOM   4687 C C     . ALA C 3 541 ? 15.381  60.207 15.523  1.00 14.53  ? 836  ALA A C     1 
ATOM   4688 O O     . ALA C 3 541 ? 16.296  60.536 16.276  1.00 15.35  ? 836  ALA A O     1 
ATOM   4689 C CB    . ALA C 3 541 ? 13.274  59.345 16.537  1.00 14.92  ? 836  ALA A CB    1 
ATOM   4690 N N     . PRO C 3 542 ? 15.092  60.913 14.426  1.00 15.87  ? 837  PRO A N     1 
ATOM   4691 C CA    . PRO C 3 542 ? 15.629  62.263 14.220  1.00 16.94  ? 837  PRO A CA    1 
ATOM   4692 C C     . PRO C 3 542 ? 15.325  63.105 15.461  1.00 18.23  ? 837  PRO A C     1 
ATOM   4693 O O     . PRO C 3 542 ? 14.263  62.903 16.079  1.00 16.59  ? 837  PRO A O     1 
ATOM   4694 C CB    . PRO C 3 542 ? 14.844  62.809 13.011  1.00 15.96  ? 837  PRO A CB    1 
ATOM   4695 C CG    . PRO C 3 542 ? 14.373  61.564 12.275  1.00 16.40  ? 837  PRO A CG    1 
ATOM   4696 C CD    . PRO C 3 542 ? 14.267  60.440 13.310  1.00 15.83  ? 837  PRO A CD    1 
ATOM   4697 N N     . LYS C 3 543 ? 16.230  64.008 15.810  1.00 20.39  ? 838  LYS A N     1 
ATOM   4698 C CA    . LYS C 3 543 ? 16.050  64.924 16.970  1.00 23.80  ? 838  LYS A CA    1 
ATOM   4699 C C     . LYS C 3 543 ? 14.746  65.714 16.837  1.00 21.58  ? 838  LYS A C     1 
ATOM   4700 O O     . LYS C 3 543 ? 14.216  66.066 17.852  1.00 23.26  ? 838  LYS A O     1 
ATOM   4701 C CB    . LYS C 3 543 ? 17.239  65.878 17.146  1.00 26.06  ? 838  LYS A CB    1 
ATOM   4702 C CG    . LYS C 3 543 ? 17.635  66.704 15.937  1.00 32.60  ? 838  LYS A CG    1 
ATOM   4703 C CD    . LYS C 3 543 ? 18.779  67.691 16.253  1.00 42.43  ? 838  LYS A CD    1 
ATOM   4704 C CE    . LYS C 3 543 ? 19.990  67.020 16.889  1.00 54.03  ? 838  LYS A CE    1 
ATOM   4705 N NZ    . LYS C 3 543 ? 21.251  67.770 16.646  1.00 59.54  ? 838  LYS A NZ    1 
ATOM   4706 N N     . GLU C 3 544 ? 14.295  66.000 15.624  1.00 22.87  ? 839  GLU A N     1 
ATOM   4707 C CA    . GLU C 3 544 ? 13.059  66.763 15.316  1.00 25.63  ? 839  GLU A CA    1 
ATOM   4708 C C     . GLU C 3 544 ? 11.819  65.986 15.793  1.00 22.93  ? 839  GLU A C     1 
ATOM   4709 O O     . GLU C 3 544 ? 10.752  66.570 15.797  1.00 19.72  ? 839  GLU A O     1 
ATOM   4710 C CB    . GLU C 3 544 ? 12.946  67.008 13.804  1.00 29.35  ? 839  GLU A CB    1 
ATOM   4711 C CG    . GLU C 3 544 ? 14.019  67.945 13.260  1.00 35.73  ? 839  GLU A CG    1 
ATOM   4712 C CD    . GLU C 3 544 ? 15.346  67.295 12.848  1.00 41.69  ? 839  GLU A CD    1 
ATOM   4713 O OE1   . GLU C 3 544 ? 15.443  66.033 12.817  1.00 36.37  ? 839  GLU A OE1   1 
ATOM   4714 O OE2   . GLU C 3 544 ? 16.303  68.065 12.567  1.00 49.27  ? 839  GLU A OE2   1 
ATOM   4715 N N     . GLU C 3 545 ? 11.947  64.700 16.135  1.00 20.23  ? 840  GLU A N     1 
ATOM   4716 C CA    . GLU C 3 545 ? 10.775  63.856 16.482  1.00 18.54  ? 840  GLU A CA    1 
ATOM   4717 C C     . GLU C 3 545 ? 10.619  63.747 17.997  1.00 17.40  ? 840  GLU A C     1 
ATOM   4718 O O     . GLU C 3 545 ? 9.576   63.272 18.442  1.00 16.86  ? 840  GLU A O     1 
ATOM   4719 C CB    . GLU C 3 545 ? 10.908  62.517 15.778  1.00 18.39  ? 840  GLU A CB    1 
ATOM   4720 C CG    . GLU C 3 545 ? 10.727  62.651 14.288  1.00 19.32  ? 840  GLU A CG    1 
ATOM   4721 C CD    . GLU C 3 545 ? 10.616  61.331 13.548  1.00 21.01  ? 840  GLU A CD    1 
ATOM   4722 O OE1   . GLU C 3 545 ? 10.592  61.378 12.313  1.00 23.96  ? 840  GLU A OE1   1 
ATOM   4723 O OE2   . GLU C 3 545 ? 10.530  60.270 14.205  1.00 18.73  ? 840  GLU A OE2   1 
ATOM   4724 N N     . MET C 3 546 ? 11.642  64.112 18.758  1.00 16.70  ? 841  MET A N     1 
ATOM   4725 C CA    . MET C 3 546 ? 11.646  63.871 20.220  1.00 18.77  ? 841  MET A CA    1 
ATOM   4726 C C     . MET C 3 546 ? 10.346  64.419 20.821  1.00 17.35  ? 841  MET A C     1 
ATOM   4727 O O     . MET C 3 546 ? 9.717   63.717 21.593  1.00 18.13  ? 841  MET A O     1 
ATOM   4728 C CB    . MET C 3 546 ? 12.853  64.532 20.908  1.00 18.58  ? 841  MET A CB    1 
ATOM   4729 C CG    . MET C 3 546 ? 14.179  63.885 20.551  1.00 18.74  ? 841  MET A CG    1 
ATOM   4730 S SD    . MET C 3 546 ? 14.257  62.103 20.890  1.00 19.61  ? 841  MET A SD    1 
ATOM   4731 C CE    . MET C 3 546 ? 13.836  61.436 19.289  1.00 19.71  ? 841  MET A CE    1 
ATOM   4732 N N     . GLU C 3 547 ? 9.969   65.639 20.484  1.00 17.30  ? 842  GLU A N     1 
ATOM   4733 C CA    . GLU C 3 547 ? 8.831   66.314 21.161  1.00 17.63  ? 842  GLU A CA    1 
ATOM   4734 C C     . GLU C 3 547 ? 7.569   65.483 20.930  1.00 17.27  ? 842  GLU A C     1 
ATOM   4735 O O     . GLU C 3 547 ? 6.836   65.291 21.885  1.00 16.86  ? 842  GLU A O     1 
ATOM   4736 C CB    . GLU C 3 547 ? 8.711   67.758 20.690  1.00 17.49  ? 842  GLU A CB    1 
ATOM   4737 C CG    . GLU C 3 547 ? 9.685   68.682 21.418  1.00 18.08  ? 842  GLU A CG    1 
ATOM   4738 C CD    . GLU C 3 547 ? 9.324   70.142 21.271  1.00 18.79  ? 842  GLU A CD    1 
ATOM   4739 O OE1   . GLU C 3 547 ? 8.601   70.642 22.138  1.00 19.11  ? 842  GLU A OE1   1 
ATOM   4740 O OE2   . GLU C 3 547 ? 9.693   70.745 20.242  1.00 21.47  ? 842  GLU A OE2   1 
ATOM   4741 N N     . ARG C 3 548 ? 7.361   64.985 19.717  1.00 16.08  ? 843  ARG A N     1 
ATOM   4742 C CA    . ARG C 3 548 ? 6.209   64.102 19.415  1.00 17.61  ? 843  ARG A CA    1 
ATOM   4743 C C     . ARG C 3 548 ? 6.342   62.754 20.130  1.00 16.41  ? 843  ARG A C     1 
ATOM   4744 O O     . ARG C 3 548 ? 5.336   62.254 20.567  1.00 16.69  ? 843  ARG A O     1 
ATOM   4745 C CB    . ARG C 3 548 ? 6.078   63.920 17.912  1.00 18.84  ? 843  ARG A CB    1 
ATOM   4746 C CG    . ARG C 3 548 ? 5.666   65.212 17.227  1.00 23.14  ? 843  ARG A CG    1 
ATOM   4747 C CD    . ARG C 3 548 ? 4.687   64.885 16.139  1.00 28.43  ? 843  ARG A CD    1 
ATOM   4748 N NE    . ARG C 3 548 ? 5.359   64.789 14.886  1.00 32.78  ? 843  ARG A NE    1 
ATOM   4749 C CZ    . ARG C 3 548 ? 4.917   64.145 13.804  1.00 37.85  ? 843  ARG A CZ    1 
ATOM   4750 N NH1   . ARG C 3 548 ? 3.793   63.430 13.817  1.00 35.04  ? 843  ARG A NH1   1 
ATOM   4751 N NH2   . ARG C 3 548 ? 5.661   64.223 12.708  1.00 35.61  ? 843  ARG A NH2   1 
ATOM   4752 N N     . LEU C 3 549 ? 7.529   62.167 20.224  1.00 16.26  ? 844  LEU A N     1 
ATOM   4753 C CA    . LEU C 3 549 ? 7.683   60.833 20.873  1.00 17.49  ? 844  LEU A CA    1 
ATOM   4754 C C     . LEU C 3 549 ? 7.414   60.935 22.369  1.00 16.62  ? 844  LEU A C     1 
ATOM   4755 O O     . LEU C 3 549 ? 6.859   59.965 22.897  1.00 17.07  ? 844  LEU A O     1 
ATOM   4756 C CB    . LEU C 3 549 ? 9.076   60.266 20.599  1.00 16.94  ? 844  LEU A CB    1 
ATOM   4757 C CG    . LEU C 3 549 ? 9.341   59.939 19.140  1.00 17.27  ? 844  LEU A CG    1 
ATOM   4758 C CD1   . LEU C 3 549 ? 10.761  59.432 18.982  1.00 19.20  ? 844  LEU A CD1   1 
ATOM   4759 C CD2   . LEU C 3 549 ? 8.353   58.919 18.615  1.00 16.06  ? 844  LEU A CD2   1 
ATOM   4760 N N     . CYS C 3 550 ? 7.765   62.060 23.001  1.00 17.60  ? 845  CYS A N     1 
ATOM   4761 C CA    . CYS C 3 550 ? 7.512   62.343 24.442  1.00 19.48  ? 845  CYS A CA    1 
ATOM   4762 C C     . CYS C 3 550 ? 6.022   62.176 24.787  1.00 19.32  ? 845  CYS A C     1 
ATOM   4763 O O     . CYS C 3 550 ? 5.740   61.763 25.903  1.00 22.48  ? 845  CYS A O     1 
ATOM   4764 C CB    . CYS C 3 550 ? 8.012   63.733 24.830  1.00 20.65  ? 845  CYS A CB    1 
ATOM   4765 S SG    . CYS C 3 550 ? 9.826   63.820 24.919  1.00 24.17  ? 845  CYS A SG    1 
ATOM   4766 N N     . ARG C 3 551 ? 5.116   62.455 23.857  1.00 18.36  ? 846  ARG A N     1 
ATOM   4767 C CA    . ARG C 3 551 ? 3.658   62.317 24.059  1.00 20.47  ? 846  ARG A CA    1 
ATOM   4768 C C     . ARG C 3 551 ? 3.191   60.990 23.498  1.00 18.87  ? 846  ARG A C     1 
ATOM   4769 O O     . ARG C 3 551 ? 2.433   60.330 24.184  1.00 20.08  ? 846  ARG A O     1 
ATOM   4770 C CB    . ARG C 3 551 ? 2.878   63.460 23.397  1.00 21.39  ? 846  ARG A CB    1 
ATOM   4771 C CG    . ARG C 3 551 ? 3.081   64.795 24.104  1.00 21.67  ? 846  ARG A CG    1 
ATOM   4772 C CD    . ARG C 3 551 ? 2.458   65.961 23.343  1.00 21.74  ? 846  ARG A CD    1 
ATOM   4773 N NE    . ARG C 3 551 ? 1.012   65.903 23.403  1.00 22.79  ? 846  ARG A NE    1 
ATOM   4774 C CZ    . ARG C 3 551 ? 0.297   66.233 24.485  1.00 22.59  ? 846  ARG A CZ    1 
ATOM   4775 N NH1   . ARG C 3 551 ? 0.893   66.605 25.606  1.00 23.23  ? 846  ARG A NH1   1 
ATOM   4776 N NH2   . ARG C 3 551 ? -1.011  66.161 24.441  1.00 23.82  ? 846  ARG A NH2   1 
ATOM   4777 N N     . LEU C 3 552 ? 3.650   60.609 22.313  1.00 19.03  ? 847  LEU A N     1 
ATOM   4778 C CA    . LEU C 3 552 ? 3.127   59.403 21.636  1.00 19.99  ? 847  LEU A CA    1 
ATOM   4779 C C     . LEU C 3 552 ? 3.605   58.107 22.319  1.00 18.01  ? 847  LEU A C     1 
ATOM   4780 O O     . LEU C 3 552 ? 2.791   57.208 22.524  1.00 17.88  ? 847  LEU A O     1 
ATOM   4781 C CB    . LEU C 3 552 ? 3.550   59.454 20.175  1.00 22.99  ? 847  LEU A CB    1 
ATOM   4782 C CG    . LEU C 3 552 ? 3.155   58.242 19.358  1.00 25.20  ? 847  LEU A CG    1 
ATOM   4783 C CD1   . LEU C 3 552 ? 1.637   58.115 19.375  1.00 31.00  ? 847  LEU A CD1   1 
ATOM   4784 C CD2   . LEU C 3 552 ? 3.653   58.394 17.939  1.00 28.85  ? 847  LEU A CD2   1 
ATOM   4785 N N     . VAL C 3 553 ? 4.888   57.932 22.575  1.00 17.43  ? 848  VAL A N     1 
ATOM   4786 C CA    . VAL C 3 553 ? 5.379   56.606 23.054  1.00 18.22  ? 848  VAL A CA    1 
ATOM   4787 C C     . VAL C 3 553 ? 4.718   56.265 24.399  1.00 17.38  ? 848  VAL A C     1 
ATOM   4788 O O     . VAL C 3 553 ? 4.156   55.195 24.528  1.00 16.97  ? 848  VAL A O     1 
ATOM   4789 C CB    . VAL C 3 553 ? 6.920   56.503 23.074  1.00 17.31  ? 848  VAL A CB    1 
ATOM   4790 C CG1   . VAL C 3 553 ? 7.383   55.184 23.655  1.00 15.67  ? 848  VAL A CG1   1 
ATOM   4791 C CG2   . VAL C 3 553 ? 7.496   56.669 21.670  1.00 17.68  ? 848  VAL A CG2   1 
ATOM   4792 N N     . PRO C 3 554 ? 4.764   57.111 25.451  1.00 18.78  ? 849  PRO A N     1 
ATOM   4793 C CA    . PRO C 3 554 ? 4.123   56.785 26.734  1.00 18.88  ? 849  PRO A CA    1 
ATOM   4794 C C     . PRO C 3 554 ? 2.619   56.507 26.599  1.00 20.54  ? 849  PRO A C     1 
ATOM   4795 O O     . PRO C 3 554 ? 2.137   55.551 27.208  1.00 19.70  ? 849  PRO A O     1 
ATOM   4796 C CB    . PRO C 3 554 ? 4.325   58.046 27.573  1.00 18.08  ? 849  PRO A CB    1 
ATOM   4797 C CG    . PRO C 3 554 ? 5.576   58.641 26.999  1.00 19.41  ? 849  PRO A CG    1 
ATOM   4798 C CD    . PRO C 3 554 ? 5.472   58.402 25.500  1.00 19.27  ? 849  PRO A CD    1 
ATOM   4799 N N     . GLU C 3 555 ? 1.934   57.331 25.804  1.00 21.01  ? 850  GLU A N     1 
ATOM   4800 C CA    . GLU C 3 555 ? 0.476   57.228 25.539  1.00 24.55  ? 850  GLU A CA    1 
ATOM   4801 C C     . GLU C 3 555 ? 0.183   55.819 25.000  1.00 22.72  ? 850  GLU A C     1 
ATOM   4802 O O     . GLU C 3 555 ? -0.669  55.122 25.596  1.00 17.78  ? 850  GLU A O     1 
ATOM   4803 C CB    . GLU C 3 555 ? 0.014   58.359 24.612  1.00 29.30  ? 850  GLU A CB    1 
ATOM   4804 C CG    . GLU C 3 555 ? -1.340  58.155 23.928  1.00 37.87  ? 850  GLU A CG    1 
ATOM   4805 C CD    . GLU C 3 555 ? -2.579  58.418 24.774  1.00 52.38  ? 850  GLU A CD    1 
ATOM   4806 O OE1   . GLU C 3 555 ? -2.446  58.687 25.998  1.00 57.47  ? 850  GLU A OE1   1 
ATOM   4807 O OE2   . GLU C 3 555 ? -3.695  58.354 24.202  1.00 70.34  ? 850  GLU A OE2   1 
ATOM   4808 N N     . VAL C 3 556 ? 0.860   55.400 23.926  1.00 19.70  ? 851  VAL A N     1 
ATOM   4809 C CA    . VAL C 3 556 ? 0.610   54.068 23.308  1.00 17.90  ? 851  VAL A CA    1 
ATOM   4810 C C     . VAL C 3 556 ? 0.929   52.984 24.338  1.00 16.96  ? 851  VAL A C     1 
ATOM   4811 O O     . VAL C 3 556 ? 0.153   52.002 24.418  1.00 18.94  ? 851  VAL A O     1 
ATOM   4812 C CB    . VAL C 3 556 ? 1.434   53.886 22.030  1.00 19.07  ? 851  VAL A CB    1 
ATOM   4813 C CG1   . VAL C 3 556 ? 1.533   52.429 21.637  1.00 19.07  ? 851  VAL A CG1   1 
ATOM   4814 C CG2   . VAL C 3 556 ? 0.852   54.720 20.907  1.00 20.14  ? 851  VAL A CG2   1 
ATOM   4815 N N     . MET C 3 557 ? 2.012   53.136 25.094  1.00 13.82  ? 852  MET A N     1 
ATOM   4816 C CA    . MET C 3 557 ? 2.422   52.079 26.033  1.00 14.83  ? 852  MET A CA    1 
ATOM   4817 C C     . MET C 3 557 ? 1.424   52.017 27.199  1.00 16.18  ? 852  MET A C     1 
ATOM   4818 O O     . MET C 3 557 ? 1.142   50.895 27.673  1.00 14.67  ? 852  MET A O     1 
ATOM   4819 C CB    . MET C 3 557 ? 3.852   52.287 26.529  1.00 13.60  ? 852  MET A CB    1 
ATOM   4820 C CG    . MET C 3 557 ? 4.881   51.984 25.458  1.00 13.94  ? 852  MET A CG    1 
ATOM   4821 S SD    . MET C 3 557 ? 6.572   52.468 25.970  1.00 14.24  ? 852  MET A SD    1 
ATOM   4822 C CE    . MET C 3 557 ? 6.909   51.270 27.253  1.00 13.32  ? 852  MET A CE    1 
ATOM   4823 N N     . GLU C 3 558 ? 0.913   53.172 27.631  1.00 17.07  ? 853  GLU A N     1 
ATOM   4824 C CA    . GLU C 3 558 ? -0.022  53.260 28.779  1.00 18.58  ? 853  GLU A CA    1 
ATOM   4825 C C     . GLU C 3 558 ? -1.392  52.670 28.372  1.00 18.91  ? 853  GLU A C     1 
ATOM   4826 O O     . GLU C 3 558 ? -2.078  52.165 29.255  1.00 18.62  ? 853  GLU A O     1 
ATOM   4827 C CB    . GLU C 3 558 ? -0.123  54.700 29.307  1.00 17.76  ? 853  GLU A CB    1 
ATOM   4828 C CG    . GLU C 3 558 ? 1.069   55.150 30.134  1.00 19.50  ? 853  GLU A CG    1 
ATOM   4829 C CD    . GLU C 3 558 ? 1.178   56.643 30.451  1.00 22.77  ? 853  GLU A CD    1 
ATOM   4830 O OE1   . GLU C 3 558 ? 2.081   57.027 31.293  1.00 26.76  ? 853  GLU A OE1   1 
ATOM   4831 O OE2   . GLU C 3 558 ? 0.408   57.436 29.857  1.00 20.54  ? 853  GLU A OE2   1 
ATOM   4832 N N     . GLN C 3 559 ? -1.793  52.769 27.106  1.00 17.77  ? 854  GLN A N     1 
ATOM   4833 C CA    . GLN C 3 559 ? -3.181  52.478 26.656  1.00 19.81  ? 854  GLN A CA    1 
ATOM   4834 C C     . GLN C 3 559 ? -3.228  51.098 25.984  1.00 19.93  ? 854  GLN A C     1 
ATOM   4835 O O     . GLN C 3 559 ? -4.282  50.770 25.494  1.00 18.37  ? 854  GLN A O     1 
ATOM   4836 C CB    . GLN C 3 559 ? -3.680  53.558 25.677  1.00 20.42  ? 854  GLN A CB    1 
ATOM   4837 C CG    . GLN C 3 559 ? -3.835  54.953 26.283  1.00 22.91  ? 854  GLN A CG    1 
ATOM   4838 C CD    . GLN C 3 559 ? -4.736  54.966 27.499  1.00 28.76  ? 854  GLN A CD    1 
ATOM   4839 O OE1   . GLN C 3 559 ? -5.899  54.569 27.413  1.00 35.30  ? 854  GLN A OE1   1 
ATOM   4840 N NE2   . GLN C 3 559 ? -4.209  55.407 28.645  1.00 28.57  ? 854  GLN A NE2   1 
ATOM   4841 N N     . ALA C 3 560 ? -2.086  50.402 25.852  1.00 20.78  ? 855  ALA A N     1 
ATOM   4842 C CA    . ALA C 3 560 ? -1.966  49.038 25.285  1.00 20.12  ? 855  ALA A CA    1 
ATOM   4843 C C     . ALA C 3 560 ? -3.016  48.089 25.898  1.00 20.13  ? 855  ALA A C     1 
ATOM   4844 O O     . ALA C 3 560 ? -3.603  47.307 25.160  1.00 21.93  ? 855  ALA A O     1 
ATOM   4845 C CB    . ALA C 3 560 ? -0.570  48.536 25.499  1.00 19.06  ? 855  ALA A CB    1 
ATOM   4846 N N     . VAL C 3 561 ? -3.214  48.095 27.216  1.00 20.64  ? 856  VAL A N     1 
ATOM   4847 C CA    . VAL C 3 561 ? -4.378  47.412 27.848  1.00 21.58  ? 856  VAL A CA    1 
ATOM   4848 C C     . VAL C 3 561 ? -4.929  48.363 28.907  1.00 22.57  ? 856  VAL A C     1 
ATOM   4849 O O     . VAL C 3 561 ? -4.207  49.289 29.337  1.00 26.36  ? 856  VAL A O     1 
ATOM   4850 C CB    . VAL C 3 561 ? -4.030  46.046 28.468  1.00 22.77  ? 856  VAL A CB    1 
ATOM   4851 C CG1   . VAL C 3 561 ? -3.309  45.126 27.497  1.00 22.47  ? 856  VAL A CG1   1 
ATOM   4852 C CG2   . VAL C 3 561 ? -3.221  46.245 29.735  1.00 25.48  ? 856  VAL A CG2   1 
ATOM   4853 N N     . THR C 3 562 ? -6.159  48.121 29.319  1.00 23.72  ? 857  THR A N     1 
ATOM   4854 C CA    . THR C 3 562 ? -6.858  48.850 30.402  1.00 23.66  ? 857  THR A CA    1 
ATOM   4855 C C     . THR C 3 562 ? -6.904  47.927 31.619  1.00 23.60  ? 857  THR A C     1 
ATOM   4856 O O     . THR C 3 562 ? -7.548  46.885 31.501  1.00 25.09  ? 857  THR A O     1 
ATOM   4857 C CB    . THR C 3 562 ? -8.266  49.204 29.920  1.00 27.61  ? 857  THR A CB    1 
ATOM   4858 O OG1   . THR C 3 562 ? -7.978  50.104 28.859  1.00 28.84  ? 857  THR A OG1   1 
ATOM   4859 C CG2   . THR C 3 562 ? -9.165  49.843 30.966  1.00 27.89  ? 857  THR A CG2   1 
ATOM   4860 N N     . LEU C 3 563 ? -6.211  48.264 32.708  1.00 20.91  ? 858  LEU A N     1 
ATOM   4861 C CA    . LEU C 3 563 ? -6.235  47.486 33.976  1.00 20.41  ? 858  LEU A CA    1 
ATOM   4862 C C     . LEU C 3 563 ? -7.071  48.267 34.989  1.00 19.31  ? 858  LEU A C     1 
ATOM   4863 O O     . LEU C 3 563 ? -7.465  49.385 34.645  1.00 16.39  ? 858  LEU A O     1 
ATOM   4864 C CB    . LEU C 3 563 ? -4.805  47.309 34.489  1.00 19.28  ? 858  LEU A CB    1 
ATOM   4865 C CG    . LEU C 3 563 ? -3.839  46.676 33.505  1.00 17.59  ? 858  LEU A CG    1 
ATOM   4866 C CD1   . LEU C 3 563 ? -2.462  46.523 34.137  1.00 18.75  ? 858  LEU A CD1   1 
ATOM   4867 C CD2   . LEU C 3 563 ? -4.357  45.351 33.025  1.00 17.08  ? 858  LEU A CD2   1 
ATOM   4868 N N     . ARG C 3 564 ? -7.234  47.741 36.207  1.00 19.40  ? 859  ARG A N     1 
ATOM   4869 C CA    . ARG C 3 564 ? -7.966  48.432 37.307  1.00 20.06  ? 859  ARG A CA    1 
ATOM   4870 C C     . ARG C 3 564 ? -7.075  49.515 37.908  1.00 18.87  ? 859  ARG A C     1 
ATOM   4871 O O     . ARG C 3 564 ? -7.569  50.318 38.685  1.00 18.20  ? 859  ARG A O     1 
ATOM   4872 C CB    . ARG C 3 564 ? -8.418  47.434 38.366  1.00 20.52  ? 859  ARG A CB    1 
ATOM   4873 C CG    . ARG C 3 564 ? -9.504  46.490 37.857  1.00 22.74  ? 859  ARG A CG    1 
ATOM   4874 C CD    . ARG C 3 564 ? -9.762  45.316 38.814  1.00 24.30  ? 859  ARG A CD    1 
ATOM   4875 N NE    . ARG C 3 564 ? -10.608 44.408 38.077  1.00 26.58  ? 859  ARG A NE    1 
ATOM   4876 C CZ    . ARG C 3 564 ? -10.249 43.254 37.508  1.00 28.19  ? 859  ARG A CZ    1 
ATOM   4877 N NH1   . ARG C 3 564 ? -9.046  42.723 37.644  1.00 27.50  ? 859  ARG A NH1   1 
ATOM   4878 N NH2   . ARG C 3 564 ? -11.154 42.604 36.807  1.00 31.88  ? 859  ARG A NH2   1 
ATOM   4879 N N     . VAL C 3 565 ? -5.793  49.520 37.557  1.00 18.65  ? 860  VAL A N     1 
ATOM   4880 C CA    . VAL C 3 565 ? -4.859  50.605 37.948  1.00 18.93  ? 860  VAL A CA    1 
ATOM   4881 C C     . VAL C 3 565 ? -4.326  51.266 36.692  1.00 17.97  ? 860  VAL A C     1 
ATOM   4882 O O     . VAL C 3 565 ? -4.201  50.625 35.667  1.00 20.70  ? 860  VAL A O     1 
ATOM   4883 C CB    . VAL C 3 565 ? -3.723  50.076 38.847  1.00 18.75  ? 860  VAL A CB    1 
ATOM   4884 C CG1   . VAL C 3 565 ? -4.280  49.660 40.196  1.00 20.28  ? 860  VAL A CG1   1 
ATOM   4885 C CG2   . VAL C 3 565 ? -2.934  48.942 38.210  1.00 17.90  ? 860  VAL A CG2   1 
ATOM   4886 N N     . PRO C 3 566 ? -3.885  52.534 36.757  1.00 18.51  ? 861  PRO A N     1 
ATOM   4887 C CA    . PRO C 3 566 ? -3.182  53.124 35.631  1.00 19.22  ? 861  PRO A CA    1 
ATOM   4888 C C     . PRO C 3 566 ? -1.874  52.362 35.383  1.00 19.49  ? 861  PRO A C     1 
ATOM   4889 O O     . PRO C 3 566 ? -1.328  51.709 36.288  1.00 17.59  ? 861  PRO A O     1 
ATOM   4890 C CB    . PRO C 3 566 ? -2.894  54.573 36.046  1.00 20.44  ? 861  PRO A CB    1 
ATOM   4891 C CG    . PRO C 3 566 ? -3.691  54.788 37.343  1.00 21.26  ? 861  PRO A CG    1 
ATOM   4892 C CD    . PRO C 3 566 ? -3.944  53.417 37.927  1.00 19.61  ? 861  PRO A CD    1 
ATOM   4893 N N     . LEU C 3 567 ? -1.446  52.392 34.133  1.00 19.32  ? 862  LEU A N     1 
ATOM   4894 C CA    . LEU C 3 567 ? -0.061  52.045 33.726  1.00 19.42  ? 862  LEU A CA    1 
ATOM   4895 C C     . LEU C 3 567 ? 0.718   53.355 33.595  1.00 19.29  ? 862  LEU A C     1 
ATOM   4896 O O     . LEU C 3 567 ? 0.171   54.316 33.107  1.00 19.91  ? 862  LEU A O     1 
ATOM   4897 C CB    . LEU C 3 567 ? -0.121  51.266 32.406  1.00 18.54  ? 862  LEU A CB    1 
ATOM   4898 C CG    . LEU C 3 567 ? -0.586  49.830 32.572  1.00 18.95  ? 862  LEU A CG    1 
ATOM   4899 C CD1   . LEU C 3 567 ? -0.656  49.106 31.246  1.00 19.14  ? 862  LEU A CD1   1 
ATOM   4900 C CD2   . LEU C 3 567 ? 0.330   49.099 33.529  1.00 19.59  ? 862  LEU A CD2   1 
ATOM   4901 N N     . LYS C 3 568 ? 1.941   53.395 34.074  1.00 21.31  ? 863  LYS A N     1 
ATOM   4902 C CA    . LYS C 3 568 ? 2.756   54.624 34.118  1.00 21.81  ? 863  LYS A CA    1 
ATOM   4903 C C     . LYS C 3 568 ? 4.039   54.299 33.360  1.00 21.85  ? 863  LYS A C     1 
ATOM   4904 O O     . LYS C 3 568 ? 4.654   53.210 33.616  1.00 18.33  ? 863  LYS A O     1 
ATOM   4905 C CB    . LYS C 3 568 ? 2.957   55.037 35.574  1.00 25.29  ? 863  LYS A CB    1 
ATOM   4906 C CG    . LYS C 3 568 ? 3.739   56.332 35.846  1.00 31.89  ? 863  LYS A CG    1 
ATOM   4907 C CD    . LYS C 3 568 ? 4.379   56.310 37.256  1.00 39.68  ? 863  LYS A CD    1 
ATOM   4908 C CE    . LYS C 3 568 ? 5.414   57.366 37.613  1.00 45.82  ? 863  LYS A CE    1 
ATOM   4909 N NZ    . LYS C 3 568 ? 4.768   58.673 37.878  1.00 49.47  ? 863  LYS A NZ    1 
ATOM   4910 N N     . VAL C 3 569 ? 4.380   55.160 32.405  1.00 20.81  ? 864  VAL A N     1 
ATOM   4911 C CA    . VAL C 3 569 ? 5.610   55.024 31.585  1.00 20.38  ? 864  VAL A CA    1 
ATOM   4912 C C     . VAL C 3 569 ? 6.470   56.253 31.810  1.00 20.98  ? 864  VAL A C     1 
ATOM   4913 O O     . VAL C 3 569 ? 5.943   57.351 31.668  1.00 18.65  ? 864  VAL A O     1 
ATOM   4914 C CB    . VAL C 3 569 ? 5.242   54.850 30.111  1.00 21.05  ? 864  VAL A CB    1 
ATOM   4915 C CG1   . VAL C 3 569 ? 6.458   54.847 29.203  1.00 21.83  ? 864  VAL A CG1   1 
ATOM   4916 C CG2   . VAL C 3 569 ? 4.432   53.592 29.921  1.00 21.17  ? 864  VAL A CG2   1 
ATOM   4917 N N     . ASP C 3 570 ? 7.740   56.052 32.160  1.00 20.74  ? 865  ASP A N     1 
ATOM   4918 C CA    . ASP C 3 570 ? 8.774   57.123 32.193  1.00 20.00  ? 865  ASP A CA    1 
ATOM   4919 C C     . ASP C 3 570 ? 9.564   57.024 30.890  1.00 19.51  ? 865  ASP A C     1 
ATOM   4920 O O     . ASP C 3 570 ? 9.602   55.959 30.318  1.00 19.16  ? 865  ASP A O     1 
ATOM   4921 C CB    . ASP C 3 570 ? 9.697   57.017 33.418  1.00 20.13  ? 865  ASP A CB    1 
ATOM   4922 C CG    . ASP C 3 570 ? 8.953   57.133 34.753  1.00 21.06  ? 865  ASP A CG    1 
ATOM   4923 O OD1   . ASP C 3 570 ? 8.030   57.965 34.860  1.00 22.07  ? 865  ASP A OD1   1 
ATOM   4924 O OD2   . ASP C 3 570 ? 9.254   56.358 35.649  1.00 19.46  ? 865  ASP A OD2   1 
ATOM   4925 N N     . TYR C 3 571 ? 10.201  58.106 30.479  1.00 19.73  ? 866  TYR A N     1 
ATOM   4926 C CA    . TYR C 3 571 ? 10.856  58.250 29.167  1.00 21.04  ? 866  TYR A CA    1 
ATOM   4927 C C     . TYR C 3 571 ? 11.942  59.311 29.292  1.00 22.38  ? 866  TYR A C     1 
ATOM   4928 O O     . TYR C 3 571 ? 11.782  60.325 30.066  1.00 19.09  ? 866  TYR A O     1 
ATOM   4929 C CB    . TYR C 3 571 ? 9.844   58.633 28.088  1.00 23.34  ? 866  TYR A CB    1 
ATOM   4930 C CG    . TYR C 3 571 ? 9.073   59.894 28.375  1.00 24.45  ? 866  TYR A CG    1 
ATOM   4931 C CD1   . TYR C 3 571 ? 7.895   59.839 29.096  1.00 27.56  ? 866  TYR A CD1   1 
ATOM   4932 C CD2   . TYR C 3 571 ? 9.498   61.137 27.926  1.00 28.05  ? 866  TYR A CD2   1 
ATOM   4933 C CE1   . TYR C 3 571 ? 7.155   60.977 29.378  1.00 28.36  ? 866  TYR A CE1   1 
ATOM   4934 C CE2   . TYR C 3 571 ? 8.782   62.294 28.226  1.00 30.40  ? 866  TYR A CE2   1 
ATOM   4935 C CZ    . TYR C 3 571 ? 7.602   62.209 28.952  1.00 27.85  ? 866  TYR A CZ    1 
ATOM   4936 O OH    . TYR C 3 571 ? 6.842   63.306 29.264  1.00 36.50  ? 866  TYR A OH    1 
ATOM   4937 N N     . HIS C 3 572 ? 13.025  59.059 28.563  1.00 20.84  ? 867  HIS A N     1 
ATOM   4938 C CA    . HIS C 3 572 ? 14.226  59.923 28.477  1.00 22.72  ? 867  HIS A CA    1 
ATOM   4939 C C     . HIS C 3 572 ? 14.840  59.709 27.090  1.00 23.03  ? 867  HIS A C     1 
ATOM   4940 O O     . HIS C 3 572 ? 14.557  58.654 26.449  1.00 19.67  ? 867  HIS A O     1 
ATOM   4941 C CB    . HIS C 3 572 ? 15.250  59.592 29.575  1.00 22.87  ? 867  HIS A CB    1 
ATOM   4942 C CG    . HIS C 3 572 ? 14.669  59.338 30.920  1.00 25.05  ? 867  HIS A CG    1 
ATOM   4943 N ND1   . HIS C 3 572 ? 14.444  60.362 31.828  1.00 25.11  ? 867  HIS A ND1   1 
ATOM   4944 C CD2   . HIS C 3 572 ? 14.320  58.176 31.531  1.00 27.97  ? 867  HIS A CD2   1 
ATOM   4945 C CE1   . HIS C 3 572 ? 13.934  59.849 32.934  1.00 28.57  ? 867  HIS A CE1   1 
ATOM   4946 N NE2   . HIS C 3 572 ? 13.853  58.497 32.779  1.00 29.98  ? 867  HIS A NE2   1 
ATOM   4947 N N     . TYR C 3 573 ? 15.635  60.674 26.649  1.00 20.23  ? 868  TYR A N     1 
ATOM   4948 C CA    . TYR C 3 573 ? 16.288  60.647 25.331  1.00 19.14  ? 868  TYR A CA    1 
ATOM   4949 C C     . TYR C 3 573 ? 17.645  61.333 25.489  1.00 19.61  ? 868  TYR A C     1 
ATOM   4950 O O     . TYR C 3 573 ? 17.857  62.067 26.454  1.00 18.71  ? 868  TYR A O     1 
ATOM   4951 C CB    . TYR C 3 573 ? 15.326  61.204 24.278  1.00 20.09  ? 868  TYR A CB    1 
ATOM   4952 C CG    . TYR C 3 573 ? 15.092  62.687 24.356  1.00 21.76  ? 868  TYR A CG    1 
ATOM   4953 C CD1   . TYR C 3 573 ? 16.008  63.596 23.837  1.00 23.27  ? 868  TYR A CD1   1 
ATOM   4954 C CD2   . TYR C 3 573 ? 13.936  63.178 24.936  1.00 24.29  ? 868  TYR A CD2   1 
ATOM   4955 C CE1   . TYR C 3 573 ? 15.797  64.963 23.931  1.00 24.83  ? 868  TYR A CE1   1 
ATOM   4956 C CE2   . TYR C 3 573 ? 13.703  64.535 25.035  1.00 26.95  ? 868  TYR A CE2   1 
ATOM   4957 C CZ    . TYR C 3 573 ? 14.638  65.428 24.533  1.00 27.86  ? 868  TYR A CZ    1 
ATOM   4958 O OH    . TYR C 3 573 ? 14.379  66.754 24.639  1.00 32.17  ? 868  TYR A OH    1 
ATOM   4959 N N     . GLY C 3 574 ? 18.563  61.034 24.582  1.00 19.46  ? 869  GLY A N     1 
ATOM   4960 C CA    . GLY C 3 574 ? 19.909  61.614 24.583  1.00 18.60  ? 869  GLY A CA    1 
ATOM   4961 C C     . GLY C 3 574 ? 20.710  61.089 23.425  1.00 18.52  ? 869  GLY A C     1 
ATOM   4962 O O     . GLY C 3 574 ? 20.170  60.303 22.604  1.00 16.63  ? 869  GLY A O     1 
ATOM   4963 N N     . SER C 3 575 ? 21.976  61.468 23.414  1.00 19.58  ? 870  SER A N     1 
ATOM   4964 C CA    . SER C 3 575 ? 22.948  61.232 22.320  1.00 20.72  ? 870  SER A CA    1 
ATOM   4965 C C     . SER C 3 575 ? 23.352  59.766 22.253  1.00 19.28  ? 870  SER A C     1 
ATOM   4966 O O     . SER C 3 575 ? 23.811  59.378 21.235  1.00 22.54  ? 870  SER A O     1 
ATOM   4967 C CB    . SER C 3 575 ? 24.181  62.075 22.523  1.00 20.45  ? 870  SER A CB    1 
ATOM   4968 O OG    . SER C 3 575 ? 23.840  63.401 22.282  1.00 21.76  ? 870  SER A OG    1 
ATOM   4969 N N     . THR C 3 576 ? 23.265  59.055 23.360  1.00 19.39  ? 871  THR A N     1 
ATOM   4970 C CA    . THR C 3 576 ? 23.658  57.640 23.529  1.00 19.71  ? 871  THR A CA    1 
ATOM   4971 C C     . THR C 3 576 ? 22.604  56.988 24.426  1.00 19.74  ? 871  THR A C     1 
ATOM   4972 O O     . THR C 3 576 ? 21.839  57.709 25.119  1.00 19.30  ? 871  THR A O     1 
ATOM   4973 C CB    . THR C 3 576 ? 25.061  57.542 24.153  1.00 19.65  ? 871  THR A CB    1 
ATOM   4974 O OG1   . THR C 3 576 ? 24.887  57.872 25.520  1.00 20.04  ? 871  THR A OG1   1 
ATOM   4975 C CG2   . THR C 3 576 ? 26.087  58.507 23.581  1.00 20.93  ? 871  THR A CG2   1 
ATOM   4976 N N     . TRP C 3 577 ? 22.584  55.674 24.464  1.00 19.70  ? 872  TRP A N     1 
ATOM   4977 C CA    . TRP C 3 577 ? 21.679  54.927 25.361  1.00 20.38  ? 872  TRP A CA    1 
ATOM   4978 C C     . TRP C 3 577 ? 21.943  55.365 26.798  1.00 21.44  ? 872  TRP A C     1 
ATOM   4979 O O     . TRP C 3 577 ? 20.995  55.479 27.559  1.00 20.52  ? 872  TRP A O     1 
ATOM   4980 C CB    . TRP C 3 577 ? 21.927  53.436 25.157  1.00 20.56  ? 872  TRP A CB    1 
ATOM   4981 C CG    . TRP C 3 577 ? 20.916  52.561 25.814  1.00 20.30  ? 872  TRP A CG    1 
ATOM   4982 C CD1   . TRP C 3 577 ? 19.797  52.929 26.497  1.00 21.09  ? 872  TRP A CD1   1 
ATOM   4983 C CD2   . TRP C 3 577 ? 20.911  51.134 25.783  1.00 20.12  ? 872  TRP A CD2   1 
ATOM   4984 N NE1   . TRP C 3 577 ? 19.098  51.824 26.891  1.00 19.49  ? 872  TRP A NE1   1 
ATOM   4985 C CE2   . TRP C 3 577 ? 19.765  50.713 26.479  1.00 19.41  ? 872  TRP A CE2   1 
ATOM   4986 C CE3   . TRP C 3 577 ? 21.768  50.179 25.229  1.00 20.68  ? 872  TRP A CE3   1 
ATOM   4987 C CZ2   . TRP C 3 577 ? 19.463  49.370 26.654  1.00 20.60  ? 872  TRP A CZ2   1 
ATOM   4988 C CZ3   . TRP C 3 577 ? 21.453  48.851 25.379  1.00 19.98  ? 872  TRP A CZ3   1 
ATOM   4989 C CH2   . TRP C 3 577 ? 20.342  48.458 26.114  1.00 20.25  ? 872  TRP A CH2   1 
ATOM   4990 N N     . TYR C 3 578 ? 23.219  55.561 27.148  1.00 23.29  ? 873  TYR A N     1 
ATOM   4991 C CA    . TYR C 3 578 ? 23.656  56.065 28.472  1.00 25.76  ? 873  TYR A CA    1 
ATOM   4992 C C     . TYR C 3 578 ? 22.894  57.343 28.821  1.00 23.79  ? 873  TYR A C     1 
ATOM   4993 O O     . TYR C 3 578 ? 22.490  57.495 29.950  1.00 23.18  ? 873  TYR A O     1 
ATOM   4994 C CB    . TYR C 3 578 ? 25.157  56.367 28.485  1.00 28.44  ? 873  TYR A CB    1 
ATOM   4995 C CG    . TYR C 3 578 ? 25.659  56.937 29.787  1.00 31.26  ? 873  TYR A CG    1 
ATOM   4996 C CD1   . TYR C 3 578 ? 25.982  56.092 30.832  1.00 33.40  ? 873  TYR A CD1   1 
ATOM   4997 C CD2   . TYR C 3 578 ? 25.793  58.307 29.986  1.00 33.59  ? 873  TYR A CD2   1 
ATOM   4998 C CE1   . TYR C 3 578 ? 26.475  56.574 32.030  1.00 36.24  ? 873  TYR A CE1   1 
ATOM   4999 C CE2   . TYR C 3 578 ? 26.256  58.817 31.191  1.00 35.62  ? 873  TYR A CE2   1 
ATOM   5000 C CZ    . TYR C 3 578 ? 26.600  57.943 32.218  1.00 39.82  ? 873  TYR A CZ    1 
ATOM   5001 O OH    . TYR C 3 578 ? 27.079  58.375 33.420  1.00 34.18  ? 873  TYR A OH    1 
ATOM   5002 N N     . ASP C 3 579 ? 22.783  58.277 27.886  1.00 26.51  ? 874  ASP A N     1 
ATOM   5003 C CA    . ASP C 3 579 ? 22.272  59.641 28.184  1.00 27.82  ? 874  ASP A CA    1 
ATOM   5004 C C     . ASP C 3 579 ? 20.753  59.606 28.175  1.00 27.27  ? 874  ASP A C     1 
ATOM   5005 O O     . ASP C 3 579 ? 20.157  60.612 28.598  1.00 27.39  ? 874  ASP A O     1 
ATOM   5006 C CB    . ASP C 3 579 ? 22.805  60.684 27.202  1.00 29.99  ? 874  ASP A CB    1 
ATOM   5007 C CG    . ASP C 3 579 ? 24.278  60.985 27.404  1.00 33.15  ? 874  ASP A CG    1 
ATOM   5008 O OD1   . ASP C 3 579 ? 24.626  61.470 28.484  1.00 38.06  ? 874  ASP A OD1   1 
ATOM   5009 O OD2   . ASP C 3 579 ? 25.066  60.697 26.491  1.00 41.29  ? 874  ASP A OD2   1 
ATOM   5010 N N     . ALA C 3 580 ? 20.155  58.516 27.675  1.00 26.32  ? 875  ALA A N     1 
ATOM   5011 C CA    . ALA C 3 580 ? 18.684  58.343 27.621  1.00 26.36  ? 875  ALA A CA    1 
ATOM   5012 C C     . ALA C 3 580 ? 18.220  57.902 29.008  1.00 29.46  ? 875  ALA A C     1 
ATOM   5013 O O     . ALA C 3 580 ? 17.658  56.794 29.134  1.00 21.74  ? 875  ALA A O     1 
ATOM   5014 C CB    . ALA C 3 580 ? 18.285  57.369 26.536  1.00 25.67  ? 875  ALA A CB    1 
ATOM   5015 N N     . LYS C 3 581 ? 18.505  58.763 29.994  1.00 35.51  ? 876  LYS A N     1 
ATOM   5016 C CA    . LYS C 3 581 ? 18.298  58.547 31.455  1.00 42.02  ? 876  LYS A CA    1 
ATOM   5017 C C     . LYS C 3 581 ? 17.855  59.870 32.079  1.00 40.96  ? 876  LYS A C     1 
ATOM   5018 O O     . LYS C 3 581 ? 17.927  60.931 31.428  1.00 36.07  ? 876  LYS A O     1 
ATOM   5019 C CB    . LYS C 3 581 ? 19.572  58.059 32.154  1.00 46.87  ? 876  LYS A CB    1 
ATOM   5020 C CG    . LYS C 3 581 ? 20.784  58.986 32.083  1.00 50.06  ? 876  LYS A CG    1 
ATOM   5021 C CD    . LYS C 3 581 ? 20.941  59.935 33.256  1.00 54.25  ? 876  LYS A CD    1 
ATOM   5022 C CE    . LYS C 3 581 ? 22.082  60.919 33.082  1.00 54.84  ? 876  LYS A CE    1 
ATOM   5023 N NZ    . LYS C 3 581 ? 23.387  60.226 33.083  1.00 52.02  ? 876  LYS A NZ    1 
ATOM   5024 O OXT   . LYS C 3 581 ? 17.426  59.859 33.228  1.00 42.57  ? 876  LYS A OXT   1 
HETATM 5025 S S     . SO4 D 4 .   ? 13.077  51.919 43.180  1.00 59.28  ? 901  SO4 A S     1 
HETATM 5026 O O1    . SO4 D 4 .   ? 13.990  52.687 42.375  1.00 56.15  ? 901  SO4 A O1    1 
HETATM 5027 O O2    . SO4 D 4 .   ? 12.648  50.701 42.479  1.00 49.55  ? 901  SO4 A O2    1 
HETATM 5028 O O3    . SO4 D 4 .   ? 13.767  51.602 44.413  1.00 49.42  ? 901  SO4 A O3    1 
HETATM 5029 O O4    . SO4 D 4 .   ? 11.910  52.705 43.461  1.00 52.40  ? 901  SO4 A O4    1 
HETATM 5030 S S     . SO4 E 4 .   ? -2.817  55.570 5.798   1.00 106.76 ? 902  SO4 A S     1 
HETATM 5031 O O1    . SO4 E 4 .   ? -3.191  56.843 5.233   1.00 99.94  ? 902  SO4 A O1    1 
HETATM 5032 O O2    . SO4 E 4 .   ? -1.550  55.165 5.247   1.00 101.50 ? 902  SO4 A O2    1 
HETATM 5033 O O3    . SO4 E 4 .   ? -2.716  55.679 7.236   1.00 75.09  ? 902  SO4 A O3    1 
HETATM 5034 O O4    . SO4 E 4 .   ? -3.809  54.586 5.455   1.00 104.37 ? 902  SO4 A O4    1 
HETATM 5035 S S     . SO4 F 4 .   ? 4.401   9.893  -1.679  1.00 34.16  ? 903  SO4 A S     1 
HETATM 5036 O O1    . SO4 F 4 .   ? 3.386   10.872 -1.965  1.00 32.78  ? 903  SO4 A O1    1 
HETATM 5037 O O2    . SO4 F 4 .   ? 4.771   9.206  -2.897  1.00 39.06  ? 903  SO4 A O2    1 
HETATM 5038 O O3    . SO4 F 4 .   ? 5.585   10.512 -1.121  1.00 33.11  ? 903  SO4 A O3    1 
HETATM 5039 O O4    . SO4 F 4 .   ? 3.874   8.950  -0.731  1.00 33.53  ? 903  SO4 A O4    1 
HETATM 5040 S S     . SO4 G 4 .   ? 17.296  30.754 60.869  1.00 120.10 ? 904  SO4 A S     1 
HETATM 5041 O O1    . SO4 G 4 .   ? 17.126  30.805 59.440  1.00 123.99 ? 904  SO4 A O1    1 
HETATM 5042 O O2    . SO4 G 4 .   ? 18.116  29.627 61.206  1.00 113.76 ? 904  SO4 A O2    1 
HETATM 5043 O O3    . SO4 G 4 .   ? 17.942  31.961 61.314  1.00 130.52 ? 904  SO4 A O3    1 
HETATM 5044 O O4    . SO4 G 4 .   ? 16.009  30.627 61.513  1.00 114.09 ? 904  SO4 A O4    1 
HETATM 5045 O O     . HOH H 5 .   ? 25.050  45.407 39.224  1.00 39.63  ? 101  HOH B O     1 
HETATM 5046 O O     . HOH I 5 .   ? 19.231  31.080 23.957  1.00 26.65  ? 101  HOH C O     1 
HETATM 5047 O O     . HOH I 5 .   ? 22.139  31.221 24.148  1.00 22.98  ? 102  HOH C O     1 
HETATM 5048 O O     . HOH I 5 .   ? 18.408  32.092 36.217  1.00 22.60  ? 103  HOH C O     1 
HETATM 5049 O O     . HOH I 5 .   ? 14.019  37.327 31.027  1.00 12.54  ? 104  HOH C O     1 
HETATM 5050 O O     . HOH I 5 .   ? 19.001  38.121 29.727  1.00 16.84  ? 105  HOH C O     1 
HETATM 5051 O O     . HOH I 5 .   ? 27.013  35.683 22.095  1.00 34.85  ? 106  HOH C O     1 
HETATM 5052 O O     . HOH I 5 .   ? 7.504   31.918 37.141  1.00 22.39  ? 107  HOH C O     1 
HETATM 5053 O O     . HOH I 5 .   ? 39.843  34.666 30.292  1.00 29.97  ? 108  HOH C O     1 
HETATM 5054 O O     . HOH J 5 .   ? 10.396  54.320 35.642  1.00 22.98  ? 1001 HOH A O     1 
HETATM 5055 O O     . HOH J 5 .   ? 7.357   25.674 31.969  1.00 20.10  ? 1002 HOH A O     1 
HETATM 5056 O O     . HOH J 5 .   ? 1.843   47.315 14.305  1.00 23.79  ? 1003 HOH A O     1 
HETATM 5057 O O     . HOH J 5 .   ? 23.538  41.447 2.565   1.00 24.92  ? 1004 HOH A O     1 
HETATM 5058 O O     . HOH J 5 .   ? 4.895   52.936 39.663  1.00 16.37  ? 1005 HOH A O     1 
HETATM 5059 O O     . HOH J 5 .   ? 16.501  52.651 50.931  1.00 19.09  ? 1006 HOH A O     1 
HETATM 5060 O O     . HOH J 5 .   ? -0.433  20.183 34.228  1.00 10.14  ? 1007 HOH A O     1 
HETATM 5061 O O     . HOH J 5 .   ? 17.615  40.671 30.550  1.00 16.35  ? 1008 HOH A O     1 
HETATM 5062 O O     . HOH J 5 .   ? 5.688   43.153 -0.864  1.00 33.60  ? 1009 HOH A O     1 
HETATM 5063 O O     . HOH J 5 .   ? 9.439   50.416 14.882  1.00 13.67  ? 1010 HOH A O     1 
HETATM 5064 O O     . HOH J 5 .   ? 8.997   38.231 37.580  1.00 25.61  ? 1011 HOH A O     1 
HETATM 5065 O O     . HOH J 5 .   ? -2.055  23.556 25.175  1.00 18.67  ? 1012 HOH A O     1 
HETATM 5066 O O     . HOH J 5 .   ? -5.778  18.635 21.449  1.00 23.40  ? 1013 HOH A O     1 
HETATM 5067 O O     . HOH J 5 .   ? 0.559   22.619 45.429  1.00 24.67  ? 1014 HOH A O     1 
HETATM 5068 O O     . HOH J 5 .   ? 12.990  55.703 33.509  1.00 33.93  ? 1015 HOH A O     1 
HETATM 5069 O O     . HOH J 5 .   ? 17.321  37.730 27.484  1.00 19.49  ? 1016 HOH A O     1 
HETATM 5070 O O     . HOH J 5 .   ? 24.988  45.947 9.515   1.00 17.20  ? 1017 HOH A O     1 
HETATM 5071 O O     . HOH J 5 .   ? 8.479   47.978 35.564  1.00 14.93  ? 1018 HOH A O     1 
HETATM 5072 O O     . HOH J 5 .   ? -1.732  51.247 22.886  1.00 13.62  ? 1019 HOH A O     1 
HETATM 5073 O O     . HOH J 5 .   ? 4.498   35.852 -9.111  1.00 26.78  ? 1020 HOH A O     1 
HETATM 5074 O O     . HOH J 5 .   ? 7.270   69.620 24.058  1.00 14.96  ? 1021 HOH A O     1 
HETATM 5075 O O     . HOH J 5 .   ? -5.071  22.136 24.906  1.00 23.01  ? 1022 HOH A O     1 
HETATM 5076 O O     . HOH J 5 .   ? 17.016  19.202 16.083  1.00 17.21  ? 1023 HOH A O     1 
HETATM 5077 O O     . HOH J 5 .   ? 8.810   66.370 17.464  1.00 14.27  ? 1024 HOH A O     1 
HETATM 5078 O O     . HOH J 5 .   ? 20.244  45.893 28.296  1.00 19.51  ? 1025 HOH A O     1 
HETATM 5079 O O     . HOH J 5 .   ? 15.866  31.284 14.991  1.00 20.95  ? 1026 HOH A O     1 
HETATM 5080 O O     . HOH J 5 .   ? 8.213   14.347 14.689  1.00 14.97  ? 1027 HOH A O     1 
HETATM 5081 O O     . HOH J 5 .   ? -2.593  42.762 15.799  1.00 16.82  ? 1028 HOH A O     1 
HETATM 5082 O O     . HOH J 5 .   ? 13.009  22.980 12.086  1.00 24.39  ? 1029 HOH A O     1 
HETATM 5083 O O     . HOH J 5 .   ? 3.592   51.047 34.562  1.00 17.39  ? 1030 HOH A O     1 
HETATM 5084 O O     . HOH J 5 .   ? 26.909  41.396 7.387   1.00 18.98  ? 1031 HOH A O     1 
HETATM 5085 O O     . HOH J 5 .   ? -6.463  34.507 22.044  1.00 17.85  ? 1032 HOH A O     1 
HETATM 5086 O O     . HOH J 5 .   ? 8.831   22.030 40.075  1.00 25.15  ? 1033 HOH A O     1 
HETATM 5087 O O     . HOH J 5 .   ? 8.151   35.343 23.617  1.00 16.96  ? 1034 HOH A O     1 
HETATM 5088 O O     . HOH J 5 .   ? 22.304  32.475 -0.206  1.00 22.95  ? 1035 HOH A O     1 
HETATM 5089 O O     . HOH J 5 .   ? 8.435   41.322 29.139  1.00 18.43  ? 1036 HOH A O     1 
HETATM 5090 O O     . HOH J 5 .   ? 21.008  36.559 4.166   1.00 16.81  ? 1037 HOH A O     1 
HETATM 5091 O O     . HOH J 5 .   ? 20.263  53.549 29.717  1.00 15.16  ? 1038 HOH A O     1 
HETATM 5092 O O     . HOH J 5 .   ? 16.060  45.822 48.423  1.00 22.69  ? 1039 HOH A O     1 
HETATM 5093 O O     . HOH J 5 .   ? 0.867   33.513 -8.041  1.00 35.36  ? 1040 HOH A O     1 
HETATM 5094 O O     . HOH J 5 .   ? 13.235  49.140 32.976  1.00 28.38  ? 1041 HOH A O     1 
HETATM 5095 O O     . HOH J 5 .   ? -4.860  29.727 27.284  1.00 19.03  ? 1042 HOH A O     1 
HETATM 5096 O O     . HOH J 5 .   ? -8.189  23.658 26.205  1.00 17.51  ? 1043 HOH A O     1 
HETATM 5097 O O     . HOH J 5 .   ? -0.730  29.679 4.993   1.00 29.89  ? 1044 HOH A O     1 
HETATM 5098 O O     . HOH J 5 .   ? 14.488  47.117 9.770   1.00 24.13  ? 1045 HOH A O     1 
HETATM 5099 O O     . HOH J 5 .   ? 1.093   31.378 -0.929  1.00 31.52  ? 1046 HOH A O     1 
HETATM 5100 O O     . HOH J 5 .   ? 7.904   38.628 9.148   1.00 21.92  ? 1047 HOH A O     1 
HETATM 5101 O O     . HOH J 5 .   ? -0.880  36.804 11.803  1.00 14.03  ? 1048 HOH A O     1 
HETATM 5102 O O     . HOH J 5 .   ? 26.731  44.324 7.736   1.00 22.71  ? 1049 HOH A O     1 
HETATM 5103 O O     . HOH J 5 .   ? 15.932  44.648 2.862   1.00 28.62  ? 1050 HOH A O     1 
HETATM 5104 O O     . HOH J 5 .   ? 6.591   44.538 30.673  1.00 15.73  ? 1051 HOH A O     1 
HETATM 5105 O O     . HOH J 5 .   ? 22.635  29.025 6.236   1.00 15.50  ? 1052 HOH A O     1 
HETATM 5106 O O     . HOH J 5 .   ? 17.003  13.793 4.174   1.00 27.60  ? 1053 HOH A O     1 
HETATM 5107 O O     . HOH J 5 .   ? 4.438   11.031 18.549  1.00 31.02  ? 1054 HOH A O     1 
HETATM 5108 O O     . HOH J 5 .   ? 13.424  17.437 17.267  1.00 22.46  ? 1055 HOH A O     1 
HETATM 5109 O O     . HOH J 5 .   ? 15.173  29.002 7.945   1.00 20.33  ? 1056 HOH A O     1 
HETATM 5110 O O     . HOH J 5 .   ? 22.655  24.255 -0.645  1.00 29.55  ? 1057 HOH A O     1 
HETATM 5111 O O     . HOH J 5 .   ? 1.520   29.923 26.289  1.00 15.22  ? 1058 HOH A O     1 
HETATM 5112 O O     . HOH J 5 .   ? 11.355  70.067 18.240  1.00 21.25  ? 1059 HOH A O     1 
HETATM 5113 O O     . HOH J 5 .   ? 3.969   24.776 29.856  1.00 14.39  ? 1060 HOH A O     1 
HETATM 5114 O O     . HOH J 5 .   ? 11.984  39.607 4.220   1.00 16.28  ? 1061 HOH A O     1 
HETATM 5115 O O     . HOH J 5 .   ? 3.930   30.825 29.198  1.00 36.42  ? 1062 HOH A O     1 
HETATM 5116 O O     . HOH J 5 .   ? 9.448   40.070 -2.399  1.00 21.91  ? 1063 HOH A O     1 
HETATM 5117 O O     . HOH J 5 .   ? 3.638   43.176 12.135  1.00 16.18  ? 1064 HOH A O     1 
HETATM 5118 O O     . HOH J 5 .   ? 21.587  52.714 16.532  1.00 14.90  ? 1065 HOH A O     1 
HETATM 5119 O O     . HOH J 5 .   ? 12.565  30.029 8.500   1.00 20.94  ? 1066 HOH A O     1 
HETATM 5120 O O     . HOH J 5 .   ? 19.697  51.203 13.442  1.00 18.94  ? 1067 HOH A O     1 
HETATM 5121 O O     . HOH J 5 .   ? 0.526   8.782  13.872  1.00 19.13  ? 1068 HOH A O     1 
HETATM 5122 O O     . HOH J 5 .   ? 2.978   62.992 19.439  1.00 20.10  ? 1069 HOH A O     1 
HETATM 5123 O O     . HOH J 5 .   ? -8.284  18.753 38.857  1.00 26.06  ? 1070 HOH A O     1 
HETATM 5124 O O     . HOH J 5 .   ? 9.279   27.176 7.232   1.00 16.50  ? 1071 HOH A O     1 
HETATM 5125 O O     . HOH J 5 .   ? 11.263  33.660 24.366  1.00 9.96   ? 1072 HOH A O     1 
HETATM 5126 O O     . HOH J 5 .   ? 18.158  45.887 17.121  1.00 15.40  ? 1073 HOH A O     1 
HETATM 5127 O O     . HOH J 5 .   ? 13.857  33.637 14.913  1.00 16.84  ? 1074 HOH A O     1 
HETATM 5128 O O     . HOH J 5 .   ? 2.403   14.283 4.926   1.00 23.02  ? 1075 HOH A O     1 
HETATM 5129 O O     . HOH J 5 .   ? -3.297  21.633 7.961   1.00 17.41  ? 1076 HOH A O     1 
HETATM 5130 O O     . HOH J 5 .   ? -3.296  52.070 49.929  1.00 24.80  ? 1077 HOH A O     1 
HETATM 5131 O O     . HOH J 5 .   ? 22.939  37.657 2.680   1.00 15.75  ? 1078 HOH A O     1 
HETATM 5132 O O     . HOH J 5 .   ? 10.936  40.214 27.204  1.00 24.93  ? 1079 HOH A O     1 
HETATM 5133 O O     . HOH J 5 .   ? 8.956   33.806 13.504  1.00 15.94  ? 1080 HOH A O     1 
HETATM 5134 O O     . HOH J 5 .   ? 10.733  42.058 4.977   1.00 24.10  ? 1081 HOH A O     1 
HETATM 5135 O O     . HOH J 5 .   ? 10.160  63.569 10.666  1.00 29.40  ? 1082 HOH A O     1 
HETATM 5136 O O     . HOH J 5 .   ? 12.743  48.650 13.645  1.00 14.61  ? 1083 HOH A O     1 
HETATM 5137 O O     . HOH J 5 .   ? -4.394  20.733 31.844  1.00 14.53  ? 1084 HOH A O     1 
HETATM 5138 O O     . HOH J 5 .   ? 13.203  15.064 7.398   1.00 13.49  ? 1085 HOH A O     1 
HETATM 5139 O O     . HOH J 5 .   ? 11.153  50.143 34.935  1.00 21.81  ? 1086 HOH A O     1 
HETATM 5140 O O     . HOH J 5 .   ? 13.485  55.044 30.001  1.00 38.32  ? 1087 HOH A O     1 
HETATM 5141 O O     . HOH J 5 .   ? 2.342   28.002 -3.700  1.00 27.12  ? 1088 HOH A O     1 
HETATM 5142 O O     . HOH J 5 .   ? 9.991   34.306 16.090  1.00 16.29  ? 1089 HOH A O     1 
HETATM 5143 O O     . HOH J 5 .   ? 9.767   50.132 37.474  1.00 22.06  ? 1090 HOH A O     1 
HETATM 5144 O O     . HOH J 5 .   ? 7.790   40.211 31.534  1.00 13.77  ? 1091 HOH A O     1 
HETATM 5145 O O     . HOH J 5 .   ? 11.848  67.332 18.680  1.00 16.98  ? 1092 HOH A O     1 
HETATM 5146 O O     . HOH J 5 .   ? 12.946  19.162 12.108  1.00 19.71  ? 1093 HOH A O     1 
HETATM 5147 O O     . HOH J 5 .   ? 3.111   37.501 9.446   1.00 23.99  ? 1094 HOH A O     1 
HETATM 5148 O O     . HOH J 5 .   ? 5.614   21.770 36.901  1.00 18.29  ? 1095 HOH A O     1 
HETATM 5149 O O     . HOH J 5 .   ? -4.878  50.878 32.937  1.00 20.50  ? 1096 HOH A O     1 
HETATM 5150 O O     . HOH J 5 .   ? 5.523   67.485 23.126  1.00 20.02  ? 1097 HOH A O     1 
HETATM 5151 O O     . HOH J 5 .   ? 14.941  36.761 28.697  1.00 14.25  ? 1098 HOH A O     1 
HETATM 5152 O O     . HOH J 5 .   ? -2.501  25.211 -2.390  1.00 26.01  ? 1099 HOH A O     1 
HETATM 5153 O O     . HOH J 5 .   ? -3.319  39.867 12.447  1.00 26.44  ? 1100 HOH A O     1 
HETATM 5154 O O     . HOH J 5 .   ? 20.524  44.555 17.524  1.00 15.33  ? 1101 HOH A O     1 
HETATM 5155 O O     . HOH J 5 .   ? -5.237  36.781 23.196  1.00 23.85  ? 1102 HOH A O     1 
HETATM 5156 O O     . HOH J 5 .   ? 26.096  38.852 24.566  1.00 28.21  ? 1103 HOH A O     1 
HETATM 5157 O O     . HOH J 5 .   ? 13.026  46.031 7.684   1.00 25.58  ? 1104 HOH A O     1 
HETATM 5158 O O     . HOH J 5 .   ? 7.667   24.731 22.790  1.00 26.68  ? 1105 HOH A O     1 
HETATM 5159 O O     . HOH J 5 .   ? -3.612  52.835 31.689  1.00 31.50  ? 1106 HOH A O     1 
HETATM 5160 O O     . HOH J 5 .   ? 10.122  47.987 13.806  1.00 31.85  ? 1107 HOH A O     1 
HETATM 5161 O O     . HOH J 5 .   ? 12.089  33.521 17.519  1.00 14.64  ? 1108 HOH A O     1 
HETATM 5162 O O     . HOH J 5 .   ? 11.678  28.282 6.655   1.00 13.54  ? 1109 HOH A O     1 
HETATM 5163 O O     . HOH J 5 .   ? 2.804   25.520 -13.614 1.00 28.18  ? 1110 HOH A O     1 
HETATM 5164 O O     . HOH J 5 .   ? 25.992  58.522 15.822  1.00 27.16  ? 1111 HOH A O     1 
HETATM 5165 O O     . HOH J 5 .   ? 25.138  18.277 -3.322  1.00 35.11  ? 1112 HOH A O     1 
HETATM 5166 O O     . HOH J 5 .   ? 26.005  31.217 13.361  1.00 22.49  ? 1113 HOH A O     1 
HETATM 5167 O O     . HOH J 5 .   ? -8.844  43.513 48.773  1.00 25.82  ? 1114 HOH A O     1 
HETATM 5168 O O     . HOH J 5 .   ? 3.865   31.213 25.411  1.00 21.42  ? 1115 HOH A O     1 
HETATM 5169 O O     . HOH J 5 .   ? 11.086  41.967 -2.569  1.00 23.56  ? 1116 HOH A O     1 
HETATM 5170 O O     . HOH J 5 .   ? 8.073   45.696 37.110  1.00 21.81  ? 1117 HOH A O     1 
HETATM 5171 O O     . HOH J 5 .   ? -3.327  27.865 -7.709  1.00 31.04  ? 1118 HOH A O     1 
HETATM 5172 O O     . HOH J 5 .   ? 5.929   53.170 42.772  1.00 24.51  ? 1119 HOH A O     1 
HETATM 5173 O O     . HOH J 5 .   ? -3.224  20.058 -9.264  1.00 33.54  ? 1120 HOH A O     1 
HETATM 5174 O O     . HOH J 5 .   ? 9.277   24.795 34.013  1.00 26.35  ? 1121 HOH A O     1 
HETATM 5175 O O     . HOH J 5 .   ? 15.596  63.206 28.555  1.00 24.31  ? 1122 HOH A O     1 
HETATM 5176 O O     . HOH J 5 .   ? 3.865   38.140 6.998   1.00 22.50  ? 1123 HOH A O     1 
HETATM 5177 O O     . HOH J 5 .   ? -7.305  20.487 23.767  1.00 30.17  ? 1124 HOH A O     1 
HETATM 5178 O O     . HOH J 5 .   ? 1.082   38.548 11.200  1.00 17.57  ? 1125 HOH A O     1 
HETATM 5179 O O     . HOH J 5 .   ? -4.577  20.359 26.829  1.00 23.06  ? 1126 HOH A O     1 
HETATM 5180 O O     . HOH J 5 .   ? 2.776   62.653 17.030  1.00 20.23  ? 1127 HOH A O     1 
HETATM 5181 O O     . HOH J 5 .   ? 11.496  13.128 21.091  1.00 40.90  ? 1128 HOH A O     1 
HETATM 5182 O O     . HOH J 5 .   ? 7.363   23.525 38.081  1.00 26.14  ? 1129 HOH A O     1 
HETATM 5183 O O     . HOH J 5 .   ? 10.329  52.808 38.256  1.00 29.11  ? 1130 HOH A O     1 
HETATM 5184 O O     . HOH J 5 .   ? 11.844  15.548 17.887  1.00 25.08  ? 1131 HOH A O     1 
HETATM 5185 O O     . HOH J 5 .   ? 4.686   27.433 -16.024 1.00 30.47  ? 1132 HOH A O     1 
HETATM 5186 O O     . HOH J 5 .   ? 2.636   65.763 19.910  1.00 19.61  ? 1133 HOH A O     1 
HETATM 5187 O O     . HOH J 5 .   ? 13.388  49.615 11.189  1.00 22.87  ? 1134 HOH A O     1 
HETATM 5188 O O     . HOH J 5 .   ? 9.880   66.798 25.310  1.00 44.08  ? 1135 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   21  21  DC  DC  B . n 
A 1 2   DG  2   22  22  DG  DG  B . n 
A 1 3   DA  3   23  23  DA  DA  B . n 
A 1 4   DT  4   24  24  DT  DT  B . n 
A 1 5   DC  5   25  25  DC  DC  B . n 
A 1 6   DA  6   26  26  DA  DA  B . n 
A 1 7   DC  7   27  27  DC  DC  B . n 
A 1 8   DG  8   28  28  DG  DG  B . n 
A 1 9   DC  9   29  29  DC  DC  B . n 
B 2 1   DG  1   6   6   DG  DG  C . n 
B 2 2   DC  2   7   7   DC  DC  C . n 
B 2 3   DG  3   8   8   DG  DG  C . n 
B 2 4   DT  4   9   9   DT  DT  C . n 
B 2 5   DG  5   10  10  DG  DG  C . n 
B 2 6   DA  6   11  11  DA  DA  C . n 
B 2 7   DT  7   12  12  DT  DT  C . n 
B 2 8   DC  8   13  13  DC  DC  C . n 
B 2 9   DG  9   14  14  DG  DG  C . n 
C 3 1   MET 1   296 296 MET MET A . n 
C 3 2   ALA 2   297 297 ALA ALA A . n 
C 3 3   LYS 3   298 298 LYS LYS A . n 
C 3 4   MET 4   299 299 MET MET A . n 
C 3 5   ALA 5   300 300 ALA ALA A . n 
C 3 6   PHE 6   301 301 PHE PHE A . n 
C 3 7   THR 7   302 302 THR THR A . n 
C 3 8   LEU 8   303 303 LEU LEU A . n 
C 3 9   ALA 9   304 304 ALA ALA A . n 
C 3 10  ASP 10  305 305 ASP ASP A . n 
C 3 11  ARG 11  306 306 ARG ARG A . n 
C 3 12  VAL 12  307 307 VAL VAL A . n 
C 3 13  THR 13  308 308 THR THR A . n 
C 3 14  GLU 14  309 309 GLU GLU A . n 
C 3 15  GLU 15  310 310 GLU GLU A . n 
C 3 16  MET 16  311 311 MET MET A . n 
C 3 17  LEU 17  312 312 LEU LEU A . n 
C 3 18  ALA 18  313 313 ALA ALA A . n 
C 3 19  ASP 19  314 314 ASP ASP A . n 
C 3 20  LYS 20  315 315 LYS LYS A . n 
C 3 21  ALA 21  316 316 ALA ALA A . n 
C 3 22  ALA 22  317 317 ALA ALA A . n 
C 3 23  LEU 23  318 318 LEU LEU A . n 
C 3 24  VAL 24  319 319 VAL VAL A . n 
C 3 25  VAL 25  320 320 VAL VAL A . n 
C 3 26  GLU 26  321 321 GLU GLU A . n 
C 3 27  VAL 27  322 322 VAL VAL A . n 
C 3 28  VAL 28  323 323 VAL VAL A . n 
C 3 29  GLU 29  324 324 GLU GLU A . n 
C 3 30  GLU 30  325 325 GLU GLU A . n 
C 3 31  ASN 31  326 326 ASN ASN A . n 
C 3 32  TYR 32  327 327 TYR TYR A . n 
C 3 33  HIS 33  328 328 HIS HIS A . n 
C 3 34  ASP 34  329 329 ASP ASP A . n 
C 3 35  ALA 35  330 330 ALA ALA A . n 
C 3 36  PRO 36  331 331 PRO PRO A . n 
C 3 37  ILE 37  332 332 ILE ILE A . n 
C 3 38  VAL 38  333 333 VAL VAL A . n 
C 3 39  GLY 39  334 334 GLY GLY A . n 
C 3 40  ILE 40  335 335 ILE ILE A . n 
C 3 41  ALA 41  336 336 ALA ALA A . n 
C 3 42  VAL 42  337 337 VAL VAL A . n 
C 3 43  VAL 43  338 338 VAL VAL A . n 
C 3 44  ASN 44  339 339 ASN ASN A . n 
C 3 45  GLU 45  340 340 GLU GLU A . n 
C 3 46  HIS 46  341 341 HIS HIS A . n 
C 3 47  GLY 47  342 342 GLY GLY A . n 
C 3 48  ARG 48  343 343 ARG ARG A . n 
C 3 49  PHE 49  344 344 PHE PHE A . n 
C 3 50  PHE 50  345 345 PHE PHE A . n 
C 3 51  LEU 51  346 346 LEU LEU A . n 
C 3 52  ARG 52  347 347 ARG ARG A . n 
C 3 53  PRO 53  348 348 PRO PRO A . n 
C 3 54  GLU 54  349 349 GLU GLU A . n 
C 3 55  THR 55  350 350 THR THR A . n 
C 3 56  ALA 56  351 351 ALA ALA A . n 
C 3 57  LEU 57  352 352 LEU LEU A . n 
C 3 58  ALA 58  353 353 ALA ALA A . n 
C 3 59  ASP 59  354 354 ASP ASP A . n 
C 3 60  PRO 60  355 355 PRO PRO A . n 
C 3 61  GLN 61  356 356 GLN GLN A . n 
C 3 62  PHE 62  357 357 PHE PHE A . n 
C 3 63  VAL 63  358 358 VAL VAL A . n 
C 3 64  ALA 64  359 359 ALA ALA A . n 
C 3 65  TRP 65  360 360 TRP TRP A . n 
C 3 66  LEU 66  361 361 LEU LEU A . n 
C 3 67  GLY 67  362 362 GLY GLY A . n 
C 3 68  ASP 68  363 363 ASP ASP A . n 
C 3 69  GLU 69  364 364 GLU GLU A . n 
C 3 70  THR 70  365 365 THR THR A . n 
C 3 71  LYS 71  366 366 LYS LYS A . n 
C 3 72  LYS 72  367 367 LYS LYS A . n 
C 3 73  LYS 73  368 368 LYS LYS A . n 
C 3 74  SER 74  369 369 SER SER A . n 
C 3 75  MET 75  370 370 MET MET A . n 
C 3 76  PHE 76  371 371 PHE PHE A . n 
C 3 77  ASP 77  372 372 ASP ASP A . n 
C 3 78  SER 78  373 373 SER SER A . n 
C 3 79  LYS 79  374 374 LYS LYS A . n 
C 3 80  ARG 80  375 375 ARG ARG A . n 
C 3 81  ALA 81  376 376 ALA ALA A . n 
C 3 82  ALA 82  377 377 ALA ALA A . n 
C 3 83  VAL 83  378 378 VAL VAL A . n 
C 3 84  ALA 84  379 379 ALA ALA A . n 
C 3 85  LEU 85  380 380 LEU LEU A . n 
C 3 86  LYS 86  381 381 LYS LYS A . n 
C 3 87  TRP 87  382 382 TRP TRP A . n 
C 3 88  LYS 88  383 383 LYS LYS A . n 
C 3 89  GLY 89  384 384 GLY GLY A . n 
C 3 90  ILE 90  385 385 ILE ILE A . n 
C 3 91  GLU 91  386 386 GLU GLU A . n 
C 3 92  LEU 92  387 387 LEU LEU A . n 
C 3 93  CYS 93  388 388 CYS CYS A . n 
C 3 94  GLY 94  389 389 GLY GLY A . n 
C 3 95  VAL 95  390 390 VAL VAL A . n 
C 3 96  SER 96  391 391 SER SER A . n 
C 3 97  PHE 97  392 392 PHE PHE A . n 
C 3 98  ASP 98  393 393 ASP ASP A . n 
C 3 99  LEU 99  394 394 LEU LEU A . n 
C 3 100 LEU 100 395 395 LEU LEU A . n 
C 3 101 LEU 101 396 396 LEU LEU A . n 
C 3 102 ALA 102 397 397 ALA ALA A . n 
C 3 103 ALA 103 398 398 ALA ALA A . n 
C 3 104 TYR 104 399 399 TYR TYR A . n 
C 3 105 LEU 105 400 400 LEU LEU A . n 
C 3 106 LEU 106 401 401 LEU LEU A . n 
C 3 107 ASP 107 402 402 ASP ASP A . n 
C 3 108 PRO 108 403 403 PRO PRO A . n 
C 3 109 ALA 109 404 404 ALA ALA A . n 
C 3 110 GLN 110 405 405 GLN GLN A . n 
C 3 111 GLY 111 406 406 GLY GLY A . n 
C 3 112 VAL 112 407 407 VAL VAL A . n 
C 3 113 ASP 113 408 408 ASP ASP A . n 
C 3 114 ASP 114 409 409 ASP ASP A . n 
C 3 115 VAL 115 410 410 VAL VAL A . n 
C 3 116 ALA 116 411 411 ALA ALA A . n 
C 3 117 ALA 117 412 412 ALA ALA A . n 
C 3 118 ALA 118 413 413 ALA ALA A . n 
C 3 119 ALA 119 414 414 ALA ALA A . n 
C 3 120 LYS 120 415 415 LYS LYS A . n 
C 3 121 MET 121 416 416 MET MET A . n 
C 3 122 LYS 122 417 417 LYS LYS A . n 
C 3 123 GLN 123 418 418 GLN GLN A . n 
C 3 124 TYR 124 419 419 TYR TYR A . n 
C 3 125 GLU 125 420 420 GLU GLU A . n 
C 3 126 ALA 126 421 421 ALA ALA A . n 
C 3 127 VAL 127 422 422 VAL VAL A . n 
C 3 128 ARG 128 423 423 ARG ARG A . n 
C 3 129 PRO 129 424 424 PRO PRO A . n 
C 3 130 ASP 130 425 425 ASP ASP A . n 
C 3 131 GLU 131 426 426 GLU GLU A . n 
C 3 132 ALA 132 427 427 ALA ALA A . n 
C 3 133 VAL 133 428 428 VAL VAL A . n 
C 3 134 TYR 134 429 429 TYR TYR A . n 
C 3 135 GLY 135 430 430 GLY GLY A . n 
C 3 136 LYS 136 431 431 LYS LYS A . n 
C 3 137 GLY 137 432 432 GLY GLY A . n 
C 3 138 ALA 138 433 433 ALA ALA A . n 
C 3 139 LYS 139 434 434 LYS LYS A . n 
C 3 140 ARG 140 435 435 ARG ARG A . n 
C 3 141 ALA 141 436 436 ALA ALA A . n 
C 3 142 VAL 142 437 437 VAL VAL A . n 
C 3 143 PRO 143 438 438 PRO PRO A . n 
C 3 144 ASP 144 439 439 ASP ASP A . n 
C 3 145 GLU 145 440 440 GLU GLU A . n 
C 3 146 PRO 146 441 441 PRO PRO A . n 
C 3 147 VAL 147 442 442 VAL VAL A . n 
C 3 148 LEU 148 443 443 LEU LEU A . n 
C 3 149 ALA 149 444 444 ALA ALA A . n 
C 3 150 GLU 150 445 445 GLU GLU A . n 
C 3 151 HIS 151 446 446 HIS HIS A . n 
C 3 152 LEU 152 447 447 LEU LEU A . n 
C 3 153 VAL 153 448 448 VAL VAL A . n 
C 3 154 ARG 154 449 449 ARG ARG A . n 
C 3 155 LYS 155 450 450 LYS LYS A . n 
C 3 156 ALA 156 451 451 ALA ALA A . n 
C 3 157 ALA 157 452 452 ALA ALA A . n 
C 3 158 ALA 158 453 453 ALA ALA A . n 
C 3 159 ILE 159 454 454 ILE ILE A . n 
C 3 160 TRP 160 455 455 TRP TRP A . n 
C 3 161 GLU 161 456 456 GLU GLU A . n 
C 3 162 LEU 162 457 457 LEU LEU A . n 
C 3 163 GLU 163 458 458 GLU GLU A . n 
C 3 164 ARG 164 459 459 ARG ARG A . n 
C 3 165 PRO 165 460 460 PRO PRO A . n 
C 3 166 PHE 166 461 461 PHE PHE A . n 
C 3 167 LEU 167 462 462 LEU LEU A . n 
C 3 168 ASP 168 463 463 ASP ASP A . n 
C 3 169 GLU 169 464 464 GLU GLU A . n 
C 3 170 LEU 170 465 465 LEU LEU A . n 
C 3 171 ARG 171 466 466 ARG ARG A . n 
C 3 172 ARG 172 467 467 ARG ARG A . n 
C 3 173 ASN 173 468 468 ASN ASN A . n 
C 3 174 GLU 174 469 469 GLU GLU A . n 
C 3 175 GLN 175 470 470 GLN GLN A . n 
C 3 176 ASP 176 471 471 ASP ASP A . n 
C 3 177 ARG 177 472 472 ARG ARG A . n 
C 3 178 LEU 178 473 473 LEU LEU A . n 
C 3 179 LEU 179 474 474 LEU LEU A . n 
C 3 180 VAL 180 475 475 VAL VAL A . n 
C 3 181 GLU 181 476 476 GLU GLU A . n 
C 3 182 LEU 182 477 477 LEU LEU A . n 
C 3 183 GLU 183 478 478 GLU GLU A . n 
C 3 184 GLN 184 479 479 GLN GLN A . n 
C 3 185 PRO 185 480 480 PRO PRO A . n 
C 3 186 LEU 186 481 481 LEU LEU A . n 
C 3 187 SER 187 482 482 SER SER A . n 
C 3 188 SER 188 483 483 SER SER A . n 
C 3 189 ILE 189 484 484 ILE ILE A . n 
C 3 190 LEU 190 485 485 LEU LEU A . n 
C 3 191 ALA 191 486 486 ALA ALA A . n 
C 3 192 GLU 192 487 487 GLU GLU A . n 
C 3 193 MET 193 488 488 MET MET A . n 
C 3 194 GLU 194 489 489 GLU GLU A . n 
C 3 195 PHE 195 490 490 PHE PHE A . n 
C 3 196 ALA 196 491 491 ALA ALA A . n 
C 3 197 GLY 197 492 492 GLY GLY A . n 
C 3 198 VAL 198 493 493 VAL VAL A . n 
C 3 199 LYS 199 494 494 LYS LYS A . n 
C 3 200 VAL 200 495 495 VAL VAL A . n 
C 3 201 ASP 201 496 496 ASP ASP A . n 
C 3 202 THR 202 497 497 THR THR A . n 
C 3 203 LYS 203 498 498 LYS LYS A . n 
C 3 204 ARG 204 499 499 ARG ARG A . n 
C 3 205 LEU 205 500 500 LEU LEU A . n 
C 3 206 GLU 206 501 501 GLU GLU A . n 
C 3 207 GLN 207 502 502 GLN GLN A . n 
C 3 208 MET 208 503 503 MET MET A . n 
C 3 209 GLY 209 504 504 GLY GLY A . n 
C 3 210 LYS 210 505 505 LYS LYS A . n 
C 3 211 GLU 211 506 506 GLU GLU A . n 
C 3 212 LEU 212 507 507 LEU LEU A . n 
C 3 213 ALA 213 508 508 ALA ALA A . n 
C 3 214 GLU 214 509 509 GLU GLU A . n 
C 3 215 GLN 215 510 510 GLN GLN A . n 
C 3 216 LEU 216 511 511 LEU LEU A . n 
C 3 217 GLY 217 512 512 GLY GLY A . n 
C 3 218 THR 218 513 513 THR THR A . n 
C 3 219 VAL 219 514 514 VAL VAL A . n 
C 3 220 GLU 220 515 515 GLU GLU A . n 
C 3 221 GLN 221 516 516 GLN GLN A . n 
C 3 222 ARG 222 517 517 ARG ARG A . n 
C 3 223 ILE 223 518 518 ILE ILE A . n 
C 3 224 TYR 224 519 519 TYR TYR A . n 
C 3 225 GLU 225 520 520 GLU GLU A . n 
C 3 226 LEU 226 521 521 LEU LEU A . n 
C 3 227 ALA 227 522 522 ALA ALA A . n 
C 3 228 GLY 228 523 523 GLY GLY A . n 
C 3 229 GLN 229 524 524 GLN GLN A . n 
C 3 230 GLU 230 525 525 GLU GLU A . n 
C 3 231 PHE 231 526 526 PHE PHE A . n 
C 3 232 ASN 232 527 527 ASN ASN A . n 
C 3 233 ILE 233 528 528 ILE ILE A . n 
C 3 234 ASN 234 529 529 ASN ASN A . n 
C 3 235 SER 235 530 530 SER SER A . n 
C 3 236 PRO 236 531 531 PRO PRO A . n 
C 3 237 LYS 237 532 532 LYS LYS A . n 
C 3 238 GLN 238 533 533 GLN GLN A . n 
C 3 239 LEU 239 534 534 LEU LEU A . n 
C 3 240 GLY 240 535 535 GLY GLY A . n 
C 3 241 VAL 241 536 536 VAL VAL A . n 
C 3 242 ILE 242 537 537 ILE ILE A . n 
C 3 243 LEU 243 538 538 LEU LEU A . n 
C 3 244 PHE 244 539 539 PHE PHE A . n 
C 3 245 GLU 245 540 540 GLU GLU A . n 
C 3 246 LYS 246 541 541 LYS LYS A . n 
C 3 247 LEU 247 542 542 LEU LEU A . n 
C 3 248 GLN 248 543 543 GLN GLN A . n 
C 3 249 LEU 249 544 544 LEU LEU A . n 
C 3 250 PRO 250 545 545 PRO PRO A . n 
C 3 251 VAL 251 546 546 VAL VAL A . n 
C 3 252 LEU 252 547 547 LEU LEU A . n 
C 3 253 LYS 253 548 548 LYS LYS A . n 
C 3 254 LYS 254 549 549 LYS LYS A . n 
C 3 255 THR 255 550 550 THR THR A . n 
C 3 256 LYS 256 551 551 LYS LYS A . n 
C 3 257 THR 257 552 552 THR THR A . n 
C 3 258 GLY 258 553 553 GLY GLY A . n 
C 3 259 TYR 259 554 554 TYR TYR A . n 
C 3 260 SER 260 555 555 SER SER A . n 
C 3 261 THR 261 556 556 THR THR A . n 
C 3 262 SER 262 557 557 SER SER A . n 
C 3 263 ALA 263 558 558 ALA ALA A . n 
C 3 264 ASP 264 559 559 ASP ASP A . n 
C 3 265 VAL 265 560 560 VAL VAL A . n 
C 3 266 LEU 266 561 561 LEU LEU A . n 
C 3 267 GLU 267 562 562 GLU GLU A . n 
C 3 268 LYS 268 563 563 LYS LYS A . n 
C 3 269 LEU 269 564 564 LEU LEU A . n 
C 3 270 ALA 270 565 565 ALA ALA A . n 
C 3 271 PRO 271 566 566 PRO PRO A . n 
C 3 272 TYR 272 567 567 TYR TYR A . n 
C 3 273 HIS 273 568 568 HIS HIS A . n 
C 3 274 GLU 274 569 569 GLU GLU A . n 
C 3 275 ILE 275 570 570 ILE ILE A . n 
C 3 276 VAL 276 571 571 VAL VAL A . n 
C 3 277 GLU 277 572 572 GLU GLU A . n 
C 3 278 ASN 278 573 573 ASN ASN A . n 
C 3 279 ILE 279 574 574 ILE ILE A . n 
C 3 280 LEU 280 575 575 LEU LEU A . n 
C 3 281 HIS 281 576 576 HIS HIS A . n 
C 3 282 TYR 282 577 577 TYR TYR A . n 
C 3 283 ARG 283 578 578 ARG ARG A . n 
C 3 284 GLN 284 579 579 GLN GLN A . n 
C 3 285 LEU 285 580 580 LEU LEU A . n 
C 3 286 GLY 286 581 581 GLY GLY A . n 
C 3 287 LYS 287 582 582 LYS LYS A . n 
C 3 288 LEU 288 583 583 LEU LEU A . n 
C 3 289 GLN 289 584 584 GLN GLN A . n 
C 3 290 SER 290 585 585 SER SER A . n 
C 3 291 THR 291 586 586 THR THR A . n 
C 3 292 TYR 292 587 587 TYR TYR A . n 
C 3 293 ILE 293 588 588 ILE ILE A . n 
C 3 294 GLU 294 589 589 GLU GLU A . n 
C 3 295 GLY 295 590 590 GLY GLY A . n 
C 3 296 LEU 296 591 591 LEU LEU A . n 
C 3 297 LEU 297 592 592 LEU LEU A . n 
C 3 298 LYS 298 593 593 LYS LYS A . n 
C 3 299 VAL 299 594 594 VAL VAL A . n 
C 3 300 VAL 300 595 595 VAL VAL A . n 
C 3 301 ARG 301 596 596 ARG ARG A . n 
C 3 302 PRO 302 597 597 PRO PRO A . n 
C 3 303 ASP 303 598 598 ASP ASP A . n 
C 3 304 THR 304 599 599 THR THR A . n 
C 3 305 LYS 305 600 600 LYS LYS A . n 
C 3 306 LYS 306 601 601 LYS LYS A . n 
C 3 307 VAL 307 602 602 VAL VAL A . n 
C 3 308 HIS 308 603 603 HIS HIS A . n 
C 3 309 THR 309 604 604 THR THR A . n 
C 3 310 ILE 310 605 605 ILE ILE A . n 
C 3 311 PHE 311 606 606 PHE PHE A . n 
C 3 312 ASN 312 607 607 ASN ASN A . n 
C 3 313 GLN 313 608 608 GLN GLN A . n 
C 3 314 ALA 314 609 609 ALA ALA A . n 
C 3 315 LEU 315 610 610 LEU LEU A . n 
C 3 316 THR 316 611 611 THR THR A . n 
C 3 317 GLN 317 612 612 GLN GLN A . n 
C 3 318 THR 318 613 613 THR THR A . n 
C 3 319 GLY 319 614 614 GLY GLY A . n 
C 3 320 ARG 320 615 615 ARG ARG A . n 
C 3 321 LEU 321 616 616 LEU LEU A . n 
C 3 322 SER 322 617 617 SER SER A . n 
C 3 323 SER 323 618 618 SER SER A . n 
C 3 324 THR 324 619 619 THR THR A . n 
C 3 325 GLU 325 620 620 GLU GLU A . n 
C 3 326 PRO 326 621 621 PRO PRO A . n 
C 3 327 ASN 327 622 622 ASN ASN A . n 
C 3 328 LEU 328 623 623 LEU LEU A . n 
C 3 329 GLN 329 624 624 GLN GLN A . n 
C 3 330 ASN 330 625 625 ASN ASN A . n 
C 3 331 ILE 331 626 626 ILE ILE A . n 
C 3 332 PRO 332 627 627 PRO PRO A . n 
C 3 333 ILE 333 628 628 ILE ILE A . n 
C 3 334 ARG 334 629 629 ARG ARG A . n 
C 3 335 LEU 335 630 630 LEU LEU A . n 
C 3 336 GLU 336 631 631 GLU GLU A . n 
C 3 337 GLU 337 632 632 GLU GLU A . n 
C 3 338 GLY 338 633 633 GLY GLY A . n 
C 3 339 ARG 339 634 634 ARG ARG A . n 
C 3 340 LYS 340 635 635 LYS LYS A . n 
C 3 341 ILE 341 636 636 ILE ILE A . n 
C 3 342 ARG 342 637 637 ARG ARG A . n 
C 3 343 GLN 343 638 638 GLN GLN A . n 
C 3 344 ALA 344 639 639 ALA ALA A . n 
C 3 345 PHE 345 640 640 PHE PHE A . n 
C 3 346 VAL 346 641 641 VAL VAL A . n 
C 3 347 PRO 347 642 642 PRO PRO A . n 
C 3 348 SER 348 643 643 SER SER A . n 
C 3 349 GLU 349 644 644 GLU GLU A . n 
C 3 350 SER 350 645 645 SER SER A . n 
C 3 351 ASP 351 646 646 ASP ASP A . n 
C 3 352 TRP 352 647 647 TRP TRP A . n 
C 3 353 LEU 353 648 648 LEU LEU A . n 
C 3 354 ILE 354 649 649 ILE ILE A . n 
C 3 355 PHE 355 650 650 PHE PHE A . n 
C 3 356 ALA 356 651 651 ALA ALA A . n 
C 3 357 ALA 357 652 652 ALA ALA A . n 
C 3 358 ASP 358 653 653 ASP ASP A . n 
C 3 359 TYR 359 654 654 TYR TYR A . n 
C 3 360 SER 360 655 655 SER SER A . n 
C 3 361 GLN 361 656 656 GLN GLN A . n 
C 3 362 ILE 362 657 657 ILE ILE A . n 
C 3 363 GLU 363 658 658 GLU GLU A . n 
C 3 364 LEU 364 659 659 LEU LEU A . n 
C 3 365 ARG 365 660 660 ARG ARG A . n 
C 3 366 VAL 366 661 661 VAL VAL A . n 
C 3 367 LEU 367 662 662 LEU LEU A . n 
C 3 368 ALA 368 663 663 ALA ALA A . n 
C 3 369 HIS 369 664 664 HIS HIS A . n 
C 3 370 ILE 370 665 665 ILE ILE A . n 
C 3 371 ALA 371 666 666 ALA ALA A . n 
C 3 372 GLU 372 667 667 GLU GLU A . n 
C 3 373 ASP 373 668 668 ASP ASP A . n 
C 3 374 ASP 374 669 669 ASP ASP A . n 
C 3 375 ASN 375 670 670 ASN ASN A . n 
C 3 376 LEU 376 671 671 LEU LEU A . n 
C 3 377 MET 377 672 672 MET MET A . n 
C 3 378 GLU 378 673 673 GLU GLU A . n 
C 3 379 ALA 379 674 674 ALA ALA A . n 
C 3 380 PHE 380 675 675 PHE PHE A . n 
C 3 381 ARG 381 676 676 ARG ARG A . n 
C 3 382 ARG 382 677 677 ARG ARG A . n 
C 3 383 ASP 383 678 678 ASP ASP A . n 
C 3 384 LEU 384 679 679 LEU LEU A . n 
C 3 385 ASP 385 680 680 ASP ASP A . n 
C 3 386 ILE 386 681 681 ILE ILE A . n 
C 3 387 HIS 387 682 682 HIS HIS A . n 
C 3 388 THR 388 683 683 THR THR A . n 
C 3 389 LYS 389 684 684 LYS LYS A . n 
C 3 390 THR 390 685 685 THR THR A . n 
C 3 391 ALA 391 686 686 ALA ALA A . n 
C 3 392 MET 392 687 687 MET MET A . n 
C 3 393 ASP 393 688 688 ASP ASP A . n 
C 3 394 ILE 394 689 689 ILE ILE A . n 
C 3 395 PHE 395 690 690 PHE PHE A . n 
C 3 396 GLN 396 691 691 GLN GLN A . n 
C 3 397 VAL 397 692 692 VAL VAL A . n 
C 3 398 SER 398 693 693 SER SER A . n 
C 3 399 GLU 399 694 694 GLU GLU A . n 
C 3 400 ASP 400 695 695 ASP ASP A . n 
C 3 401 GLU 401 696 696 GLU GLU A . n 
C 3 402 VAL 402 697 697 VAL VAL A . n 
C 3 403 THR 403 698 698 THR THR A . n 
C 3 404 PRO 404 699 699 PRO PRO A . n 
C 3 405 ASN 405 700 700 ASN ASN A . n 
C 3 406 MET 406 701 701 MET MET A . n 
C 3 407 ARG 407 702 702 ARG ARG A . n 
C 3 408 ARG 408 703 703 ARG ARG A . n 
C 3 409 GLN 409 704 704 GLN GLN A . n 
C 3 410 ALA 410 705 705 ALA ALA A . n 
C 3 411 LYS 411 706 706 LYS LYS A . n 
C 3 412 ALA 412 707 707 ALA ALA A . n 
C 3 413 VAL 413 708 708 VAL VAL A . n 
C 3 414 ASN 414 709 709 ASN ASN A . n 
C 3 415 PHE 415 710 710 PHE PHE A . n 
C 3 416 GLY 416 711 711 GLY GLY A . n 
C 3 417 ILE 417 712 712 ILE ILE A . n 
C 3 418 VAL 418 713 713 VAL VAL A . n 
C 3 419 TYR 419 714 714 TYR TYR A . n 
C 3 420 GLY 420 715 715 GLY GLY A . n 
C 3 421 MET 421 716 716 MET MET A . n 
C 3 422 SER 422 717 717 SER SER A . n 
C 3 423 ASP 423 718 718 ASP ASP A . n 
C 3 424 TYR 424 719 719 TYR TYR A . n 
C 3 425 GLY 425 720 720 GLY GLY A . n 
C 3 426 LEU 426 721 721 LEU LEU A . n 
C 3 427 ALA 427 722 722 ALA ALA A . n 
C 3 428 GLN 428 723 723 GLN GLN A . n 
C 3 429 ASN 429 724 724 ASN ASN A . n 
C 3 430 LEU 430 725 725 LEU LEU A . n 
C 3 431 ASN 431 726 726 ASN ASN A . n 
C 3 432 ILE 432 727 727 ILE ILE A . n 
C 3 433 SER 433 728 728 SER SER A . n 
C 3 434 ARG 434 729 729 ARG ARG A . n 
C 3 435 LYS 435 730 730 LYS LYS A . n 
C 3 436 GLU 436 731 731 GLU GLU A . n 
C 3 437 ALA 437 732 732 ALA ALA A . n 
C 3 438 ALA 438 733 733 ALA ALA A . n 
C 3 439 GLU 439 734 734 GLU GLU A . n 
C 3 440 PHE 440 735 735 PHE PHE A . n 
C 3 441 ILE 441 736 736 ILE ILE A . n 
C 3 442 GLU 442 737 737 GLU GLU A . n 
C 3 443 ARG 443 738 738 ARG ARG A . n 
C 3 444 TYR 444 739 739 TYR TYR A . n 
C 3 445 PHE 445 740 740 PHE PHE A . n 
C 3 446 GLU 446 741 741 GLU GLU A . n 
C 3 447 SER 447 742 742 SER SER A . n 
C 3 448 PHE 448 743 743 PHE PHE A . n 
C 3 449 PRO 449 744 744 PRO PRO A . n 
C 3 450 GLY 450 745 745 GLY GLY A . n 
C 3 451 VAL 451 746 746 VAL VAL A . n 
C 3 452 LYS 452 747 747 LYS LYS A . n 
C 3 453 ARG 453 748 748 ARG ARG A . n 
C 3 454 TYR 454 749 749 TYR TYR A . n 
C 3 455 MET 455 750 750 MET MET A . n 
C 3 456 GLU 456 751 751 GLU GLU A . n 
C 3 457 ASN 457 752 752 ASN ASN A . n 
C 3 458 ILE 458 753 753 ILE ILE A . n 
C 3 459 VAL 459 754 754 VAL VAL A . n 
C 3 460 GLN 460 755 755 GLN GLN A . n 
C 3 461 GLU 461 756 756 GLU GLU A . n 
C 3 462 ALA 462 757 757 ALA ALA A . n 
C 3 463 LYS 463 758 758 LYS LYS A . n 
C 3 464 GLN 464 759 759 GLN GLN A . n 
C 3 465 LYS 465 760 760 LYS LYS A . n 
C 3 466 GLY 466 761 761 GLY GLY A . n 
C 3 467 TYR 467 762 762 TYR TYR A . n 
C 3 468 VAL 468 763 763 VAL VAL A . n 
C 3 469 THR 469 764 764 THR THR A . n 
C 3 470 THR 470 765 765 THR THR A . n 
C 3 471 LEU 471 766 766 LEU LEU A . n 
C 3 472 LEU 472 767 767 LEU LEU A . n 
C 3 473 HIS 473 768 768 HIS HIS A . n 
C 3 474 ARG 474 769 769 ARG ARG A . n 
C 3 475 ARG 475 770 770 ARG ARG A . n 
C 3 476 ARG 476 771 771 ARG ARG A . n 
C 3 477 TYR 477 772 772 TYR TYR A . n 
C 3 478 LEU 478 773 773 LEU LEU A . n 
C 3 479 PRO 479 774 774 PRO PRO A . n 
C 3 480 ASP 480 775 775 ASP ASP A . n 
C 3 481 ILE 481 776 776 ILE ILE A . n 
C 3 482 THR 482 777 777 THR THR A . n 
C 3 483 SER 483 778 778 SER SER A . n 
C 3 484 ARG 484 779 779 ARG ARG A . n 
C 3 485 ASN 485 780 780 ASN ASN A . n 
C 3 486 PHE 486 781 781 PHE PHE A . n 
C 3 487 ASN 487 782 782 ASN ASN A . n 
C 3 488 VAL 488 783 783 VAL VAL A . n 
C 3 489 ARG 489 784 784 ARG ARG A . n 
C 3 490 SER 490 785 785 SER SER A . n 
C 3 491 PHE 491 786 786 PHE PHE A . n 
C 3 492 ALA 492 787 787 ALA ALA A . n 
C 3 493 GLU 493 788 788 GLU GLU A . n 
C 3 494 ARG 494 789 789 ARG ARG A . n 
C 3 495 MET 495 790 790 MET MET A . n 
C 3 496 ALA 496 791 791 ALA ALA A . n 
C 3 497 MET 497 792 792 MET MET A . n 
C 3 498 ASN 498 793 793 ASN ASN A . n 
C 3 499 THR 499 794 794 THR THR A . n 
C 3 500 PRO 500 795 795 PRO PRO A . n 
C 3 501 ILE 501 796 796 ILE ILE A . n 
C 3 502 GLN 502 797 797 GLN GLN A . n 
C 3 503 GLY 503 798 798 GLY GLY A . n 
C 3 504 SER 504 799 799 SER SER A . n 
C 3 505 ALA 505 800 800 ALA ALA A . n 
C 3 506 ALA 506 801 801 ALA ALA A . n 
C 3 507 ASP 507 802 802 ASP ASP A . n 
C 3 508 ILE 508 803 803 ILE ILE A . n 
C 3 509 ILE 509 804 804 ILE ILE A . n 
C 3 510 LYS 510 805 805 LYS LYS A . n 
C 3 511 LYS 511 806 806 LYS LYS A . n 
C 3 512 ALA 512 807 807 ALA ALA A . n 
C 3 513 MET 513 808 808 MET MET A . n 
C 3 514 ILE 514 809 809 ILE ILE A . n 
C 3 515 ASP 515 810 810 ASP ASP A . n 
C 3 516 LEU 516 811 811 LEU LEU A . n 
C 3 517 ASN 517 812 812 ASN ASN A . n 
C 3 518 ALA 518 813 813 ALA ALA A . n 
C 3 519 ARG 519 814 814 ARG ARG A . n 
C 3 520 LEU 520 815 815 LEU LEU A . n 
C 3 521 LYS 521 816 816 LYS LYS A . n 
C 3 522 GLU 522 817 817 GLU GLU A . n 
C 3 523 GLU 523 818 818 GLU GLU A . n 
C 3 524 ARG 524 819 819 ARG ARG A . n 
C 3 525 LEU 525 820 820 LEU LEU A . n 
C 3 526 GLN 526 821 821 GLN GLN A . n 
C 3 527 ALA 527 822 822 ALA ALA A . n 
C 3 528 HIS 528 823 823 HIS HIS A . n 
C 3 529 LEU 529 824 824 LEU LEU A . n 
C 3 530 LEU 530 825 825 LEU LEU A . n 
C 3 531 LEU 531 826 826 LEU LEU A . n 
C 3 532 GLN 532 827 827 GLN GLN A . n 
C 3 533 VAL 533 828 828 VAL VAL A . n 
C 3 534 HIS 534 829 829 HIS HIS A . n 
C 3 535 ASP 535 830 830 ASP ASP A . n 
C 3 536 GLU 536 831 831 GLU GLU A . n 
C 3 537 LEU 537 832 832 LEU LEU A . n 
C 3 538 ILE 538 833 833 ILE ILE A . n 
C 3 539 LEU 539 834 834 LEU LEU A . n 
C 3 540 GLU 540 835 835 GLU GLU A . n 
C 3 541 ALA 541 836 836 ALA ALA A . n 
C 3 542 PRO 542 837 837 PRO PRO A . n 
C 3 543 LYS 543 838 838 LYS LYS A . n 
C 3 544 GLU 544 839 839 GLU GLU A . n 
C 3 545 GLU 545 840 840 GLU GLU A . n 
C 3 546 MET 546 841 841 MET MET A . n 
C 3 547 GLU 547 842 842 GLU GLU A . n 
C 3 548 ARG 548 843 843 ARG ARG A . n 
C 3 549 LEU 549 844 844 LEU LEU A . n 
C 3 550 CYS 550 845 845 CYS CYS A . n 
C 3 551 ARG 551 846 846 ARG ARG A . n 
C 3 552 LEU 552 847 847 LEU LEU A . n 
C 3 553 VAL 553 848 848 VAL VAL A . n 
C 3 554 PRO 554 849 849 PRO PRO A . n 
C 3 555 GLU 555 850 850 GLU GLU A . n 
C 3 556 VAL 556 851 851 VAL VAL A . n 
C 3 557 MET 557 852 852 MET MET A . n 
C 3 558 GLU 558 853 853 GLU GLU A . n 
C 3 559 GLN 559 854 854 GLN GLN A . n 
C 3 560 ALA 560 855 855 ALA ALA A . n 
C 3 561 VAL 561 856 856 VAL VAL A . n 
C 3 562 THR 562 857 857 THR THR A . n 
C 3 563 LEU 563 858 858 LEU LEU A . n 
C 3 564 ARG 564 859 859 ARG ARG A . n 
C 3 565 VAL 565 860 860 VAL VAL A . n 
C 3 566 PRO 566 861 861 PRO PRO A . n 
C 3 567 LEU 567 862 862 LEU LEU A . n 
C 3 568 LYS 568 863 863 LYS LYS A . n 
C 3 569 VAL 569 864 864 VAL VAL A . n 
C 3 570 ASP 570 865 865 ASP ASP A . n 
C 3 571 TYR 571 866 866 TYR TYR A . n 
C 3 572 HIS 572 867 867 HIS HIS A . n 
C 3 573 TYR 573 868 868 TYR TYR A . n 
C 3 574 GLY 574 869 869 GLY GLY A . n 
C 3 575 SER 575 870 870 SER SER A . n 
C 3 576 THR 576 871 871 THR THR A . n 
C 3 577 TRP 577 872 872 TRP TRP A . n 
C 3 578 TYR 578 873 873 TYR TYR A . n 
C 3 579 ASP 579 874 874 ASP ASP A . n 
C 3 580 ALA 580 875 875 ALA ALA A . n 
C 3 581 LYS 581 876 876 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SO4 1   901  910 SO4 SO4 A . 
E 4 SO4 1   902  911 SO4 SO4 A . 
F 4 SO4 1   903  912 SO4 SO4 A . 
G 4 SO4 1   904  913 SO4 SO4 A . 
H 5 HOH 1   101  94  HOH HOH B . 
I 5 HOH 1   101  143 HOH HOH C . 
I 5 HOH 2   102  141 HOH HOH C . 
I 5 HOH 3   103  54  HOH HOH C . 
I 5 HOH 4   104  62  HOH HOH C . 
I 5 HOH 5   105  23  HOH HOH C . 
I 5 HOH 6   106  142 HOH HOH C . 
I 5 HOH 7   107  45  HOH HOH C . 
I 5 HOH 8   108  145 HOH HOH C . 
J 5 HOH 1   1001 114 HOH HOH A . 
J 5 HOH 2   1002 74  HOH HOH A . 
J 5 HOH 3   1003 59  HOH HOH A . 
J 5 HOH 4   1004 79  HOH HOH A . 
J 5 HOH 5   1005 9   HOH HOH A . 
J 5 HOH 6   1006 60  HOH HOH A . 
J 5 HOH 7   1007 6   HOH HOH A . 
J 5 HOH 8   1008 12  HOH HOH A . 
J 5 HOH 9   1009 137 HOH HOH A . 
J 5 HOH 10  1010 17  HOH HOH A . 
J 5 HOH 11  1011 70  HOH HOH A . 
J 5 HOH 12  1012 28  HOH HOH A . 
J 5 HOH 13  1013 4   HOH HOH A . 
J 5 HOH 14  1014 87  HOH HOH A . 
J 5 HOH 15  1015 115 HOH HOH A . 
J 5 HOH 16  1016 77  HOH HOH A . 
J 5 HOH 17  1017 61  HOH HOH A . 
J 5 HOH 18  1018 31  HOH HOH A . 
J 5 HOH 19  1019 1   HOH HOH A . 
J 5 HOH 20  1020 138 HOH HOH A . 
J 5 HOH 21  1021 99  HOH HOH A . 
J 5 HOH 22  1022 67  HOH HOH A . 
J 5 HOH 23  1023 36  HOH HOH A . 
J 5 HOH 24  1024 72  HOH HOH A . 
J 5 HOH 25  1025 40  HOH HOH A . 
J 5 HOH 26  1026 39  HOH HOH A . 
J 5 HOH 27  1027 20  HOH HOH A . 
J 5 HOH 28  1028 10  HOH HOH A . 
J 5 HOH 29  1029 97  HOH HOH A . 
J 5 HOH 30  1030 52  HOH HOH A . 
J 5 HOH 31  1031 42  HOH HOH A . 
J 5 HOH 32  1032 3   HOH HOH A . 
J 5 HOH 33  1033 106 HOH HOH A . 
J 5 HOH 34  1034 103 HOH HOH A . 
J 5 HOH 35  1035 47  HOH HOH A . 
J 5 HOH 36  1036 102 HOH HOH A . 
J 5 HOH 37  1037 46  HOH HOH A . 
J 5 HOH 38  1038 21  HOH HOH A . 
J 5 HOH 39  1039 90  HOH HOH A . 
J 5 HOH 40  1040 139 HOH HOH A . 
J 5 HOH 41  1041 110 HOH HOH A . 
J 5 HOH 42  1042 27  HOH HOH A . 
J 5 HOH 43  1043 38  HOH HOH A . 
J 5 HOH 44  1044 100 HOH HOH A . 
J 5 HOH 45  1045 104 HOH HOH A . 
J 5 HOH 46  1046 129 HOH HOH A . 
J 5 HOH 47  1047 69  HOH HOH A . 
J 5 HOH 48  1048 125 HOH HOH A . 
J 5 HOH 49  1049 7   HOH HOH A . 
J 5 HOH 50  1050 98  HOH HOH A . 
J 5 HOH 51  1051 55  HOH HOH A . 
J 5 HOH 52  1052 41  HOH HOH A . 
J 5 HOH 53  1053 66  HOH HOH A . 
J 5 HOH 54  1054 84  HOH HOH A . 
J 5 HOH 55  1055 108 HOH HOH A . 
J 5 HOH 56  1056 53  HOH HOH A . 
J 5 HOH 57  1057 91  HOH HOH A . 
J 5 HOH 58  1058 71  HOH HOH A . 
J 5 HOH 59  1059 119 HOH HOH A . 
J 5 HOH 60  1060 35  HOH HOH A . 
J 5 HOH 61  1061 80  HOH HOH A . 
J 5 HOH 62  1062 144 HOH HOH A . 
J 5 HOH 63  1063 136 HOH HOH A . 
J 5 HOH 64  1064 22  HOH HOH A . 
J 5 HOH 65  1065 29  HOH HOH A . 
J 5 HOH 66  1066 33  HOH HOH A . 
J 5 HOH 67  1067 8   HOH HOH A . 
J 5 HOH 68  1068 88  HOH HOH A . 
J 5 HOH 69  1069 120 HOH HOH A . 
J 5 HOH 70  1070 123 HOH HOH A . 
J 5 HOH 71  1071 76  HOH HOH A . 
J 5 HOH 72  1072 56  HOH HOH A . 
J 5 HOH 73  1073 57  HOH HOH A . 
J 5 HOH 74  1074 26  HOH HOH A . 
J 5 HOH 75  1075 49  HOH HOH A . 
J 5 HOH 76  1076 43  HOH HOH A . 
J 5 HOH 77  1077 30  HOH HOH A . 
J 5 HOH 78  1078 16  HOH HOH A . 
J 5 HOH 79  1079 50  HOH HOH A . 
J 5 HOH 80  1080 34  HOH HOH A . 
J 5 HOH 81  1081 37  HOH HOH A . 
J 5 HOH 82  1082 68  HOH HOH A . 
J 5 HOH 83  1083 2   HOH HOH A . 
J 5 HOH 84  1084 11  HOH HOH A . 
J 5 HOH 85  1085 51  HOH HOH A . 
J 5 HOH 86  1086 111 HOH HOH A . 
J 5 HOH 87  1087 116 HOH HOH A . 
J 5 HOH 88  1088 131 HOH HOH A . 
J 5 HOH 89  1089 75  HOH HOH A . 
J 5 HOH 90  1090 112 HOH HOH A . 
J 5 HOH 91  1091 24  HOH HOH A . 
J 5 HOH 92  1092 13  HOH HOH A . 
J 5 HOH 93  1093 5   HOH HOH A . 
J 5 HOH 94  1094 127 HOH HOH A . 
J 5 HOH 95  1095 82  HOH HOH A . 
J 5 HOH 96  1096 83  HOH HOH A . 
J 5 HOH 97  1097 86  HOH HOH A . 
J 5 HOH 98  1098 19  HOH HOH A . 
J 5 HOH 99  1099 130 HOH HOH A . 
J 5 HOH 100 1100 126 HOH HOH A . 
J 5 HOH 101 1101 73  HOH HOH A . 
J 5 HOH 102 1102 95  HOH HOH A . 
J 5 HOH 103 1103 93  HOH HOH A . 
J 5 HOH 104 1104 58  HOH HOH A . 
J 5 HOH 105 1105 140 HOH HOH A . 
J 5 HOH 106 1106 107 HOH HOH A . 
J 5 HOH 107 1107 101 HOH HOH A . 
J 5 HOH 108 1108 78  HOH HOH A . 
J 5 HOH 109 1109 25  HOH HOH A . 
J 5 HOH 110 1110 134 HOH HOH A . 
J 5 HOH 111 1111 63  HOH HOH A . 
J 5 HOH 112 1112 48  HOH HOH A . 
J 5 HOH 113 1113 18  HOH HOH A . 
J 5 HOH 114 1114 14  HOH HOH A . 
J 5 HOH 115 1115 65  HOH HOH A . 
J 5 HOH 116 1116 44  HOH HOH A . 
J 5 HOH 117 1117 64  HOH HOH A . 
J 5 HOH 118 1118 132 HOH HOH A . 
J 5 HOH 119 1119 32  HOH HOH A . 
J 5 HOH 120 1120 133 HOH HOH A . 
J 5 HOH 121 1121 85  HOH HOH A . 
J 5 HOH 122 1122 117 HOH HOH A . 
J 5 HOH 123 1123 128 HOH HOH A . 
J 5 HOH 124 1124 96  HOH HOH A . 
J 5 HOH 125 1125 124 HOH HOH A . 
J 5 HOH 126 1126 89  HOH HOH A . 
J 5 HOH 127 1127 121 HOH HOH A . 
J 5 HOH 128 1128 92  HOH HOH A . 
J 5 HOH 129 1129 105 HOH HOH A . 
J 5 HOH 130 1130 113 HOH HOH A . 
J 5 HOH 131 1131 109 HOH HOH A . 
J 5 HOH 132 1132 135 HOH HOH A . 
J 5 HOH 133 1133 122 HOH HOH A . 
J 5 HOH 134 1134 81  HOH HOH A . 
J 5 HOH 135 1135 118 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4630  ? 
1 MORE         -63   ? 
1 'SSA (A^2)'  28050 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2020-03-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_phasing_MR.entry_id                     6P5C 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          6.310 
_pdbx_phasing_MR.d_res_low_rotation           28.320 
_pdbx_phasing_MR.d_res_high_translation       6.310 
_pdbx_phasing_MR.d_res_low_translation        28.320 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.8.2    1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0238 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25     3 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O5'" B DC  27  ? ? P  B DC  27  ? ? OP2 B DC  27  ? ? 100.10 105.70 -5.60 0.90 N 
2 1 NE    A ARG 843 ? ? CZ A ARG 843 ? ? NH2 A ARG 843 ? ? 117.10 120.30 -3.20 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 372 ? ? 61.81   61.22  
2  1 ASP A 402 ? ? -168.04 97.31  
3  1 ALA A 421 ? ? -81.76  41.72  
4  1 LYS A 434 ? ? -64.19  7.94   
5  1 LEU A 477 ? ? -112.82 -72.67 
6  1 GLN A 524 ? ? 170.71  155.40 
7  1 THR A 550 ? ? -134.74 -73.70 
8  1 LYS A 551 ? ? -161.38 -69.16 
9  1 LEU A 610 ? ? -124.52 -57.47 
10 1 ILE A 628 ? ? -150.67 -34.75 
11 1 HIS A 829 ? ? 77.10   -56.44 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 298 ? CG ? C LYS 3 CG 
2 1 Y 1 A LYS 298 ? CD ? C LYS 3 CD 
3 1 Y 1 A LYS 298 ? CE ? C LYS 3 CE 
4 1 Y 1 A LYS 298 ? NZ ? C LYS 3 NZ 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6P5C 'double helix'        
6P5C 'a-form double helix' 
6P5C 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1 1_555 B DG 9 1_555 -0.453 0.141  -0.290 -14.402 -2.584  1.394  1 B_DC21:DG14_C B 21 ? C 14 ? 19 1 
1 A DG 2 1_555 B DC 8 1_555 -0.485 -0.541 -0.468 -3.232  -4.753  -8.671 2 B_DG22:DC13_C B 22 ? C 13 ? 19 1 
1 A DA 3 1_555 B DT 7 1_555 -0.334 -0.097 0.006  -1.103  -13.304 6.155  3 B_DA23:DT12_C B 23 ? C 12 ? 20 1 
1 A DT 4 1_555 B DA 6 1_555 -0.043 -0.013 -0.363 3.591   -13.325 1.697  4 B_DT24:DA11_C B 24 ? C 11 ? 20 1 
1 A DC 5 1_555 B DG 5 1_555 0.385  -0.020 -0.394 1.799   -10.357 5.610  5 B_DC25:DG10_C B 25 ? C 10 ? 19 1 
1 A DA 6 1_555 B DT 4 1_555 0.229  -0.149 -0.276 1.351   3.348   -4.074 6 B_DA26:DT9_C  B 26 ? C 9  ? 20 1 
1 A DC 7 1_555 B DG 3 1_555 0.234  -0.179 -0.284 12.603  -14.711 1.848  7 B_DC27:DG8_C  B 27 ? C 8  ? 19 1 
1 A DG 8 1_555 B DC 2 1_555 0.271  -0.239 0.257  9.502   -6.266  1.826  8 B_DG28:DC7_C  B 28 ? C 7  ? 19 1 
1 A DC 9 1_555 B DG 1 1_555 -0.023 -0.096 -0.432 22.029  -9.028  2.635  9 B_DC29:DG6_C  B 29 ? C 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1 1_555 B DG 9 1_555 A DG 2 1_555 B DC 8 1_555 -1.254 0.800  3.281 -1.057 10.535 31.557 -0.452 2.006  3.405 18.723 1.879  
33.243 1 BB_DC21DG22:DC13DG14_CC B 21 ? C 14 ? B 22 ? C 13 ? 
1 A DG 2 1_555 B DC 8 1_555 A DA 3 1_555 B DT 7 1_555 0.353  0.360  3.238 -7.642 4.107  38.447 0.054  -1.417 3.135 6.141  11.428 
39.378 2 BB_DG22DA23:DT12DC13_CC B 22 ? C 13 ? B 23 ? C 12 ? 
1 A DA 3 1_555 B DT 7 1_555 A DT 4 1_555 B DA 6 1_555 -0.336 -0.359 3.202 3.665  2.265  30.173 -1.120 1.348  3.106 4.324  -6.996 
30.472 3 BB_DA23DT24:DA11DT12_CC B 23 ? C 12 ? B 24 ? C 11 ? 
1 A DT 4 1_555 B DA 6 1_555 A DC 5 1_555 B DG 5 1_555 1.194  0.505  3.250 4.945  7.023  38.698 -0.101 -1.166 3.408 10.443 -7.352 
39.604 4 BB_DT24DC25:DG10DA11_CC B 24 ? C 11 ? B 25 ? C 10 ? 
1 A DC 5 1_555 B DG 5 1_555 A DA 6 1_555 B DT 4 1_555 -0.564 -0.409 3.473 -1.853 7.169  25.576 -2.866 0.714  3.271 15.778 4.077  
26.609 5 BB_DC25DA26:DT9DG10_CC  B 25 ? C 10 ? B 26 ? C 9  ? 
1 A DA 6 1_555 B DT 4 1_555 A DC 7 1_555 B DG 3 1_555 0.436  -0.714 3.210 -2.610 10.629 36.198 -2.405 -0.993 2.858 16.644 4.087  
37.763 6 BB_DA26DC27:DG8DT9_CC   B 26 ? C 9  ? B 27 ? C 8  ? 
1 A DC 7 1_555 B DG 3 1_555 A DG 8 1_555 B DC 2 1_555 -0.486 -1.642 3.457 -5.021 13.323 25.104 -6.139 -0.093 2.356 27.966 10.539 
28.804 7 BB_DC27DG28:DC7DG8_CC   B 27 ? C 8  ? B 28 ? C 7  ? 
1 A DG 8 1_555 B DC 2 1_555 A DC 9 1_555 B DG 1 1_555 -0.254 -1.449 3.067 2.193  8.808  28.253 -4.448 0.899  2.486 17.482 -4.352 
29.646 8 BB_DG28DC29:DG6DC7_CC   B 28 ? C 7  ? B 29 ? C 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SULFATE ION' SO4 
5 water         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#