data_6P7B
# 
_entry.id   6P7B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6P7B         
WWPDB D_1000242020 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6P7B 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, N.'       1 ?                   
'Shi, K.'      2 0000-0003-4175-3714 
'Rao, T.'      3 0000-0002-1307-0433 
'Banerjee, S.' 4 0000-0002-9414-7163 
'Aihara, H.'   5 0000-0001-7508-6230 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                393 
_citation.page_last                 393 
_citation.title                     
'Structural insights into the promiscuous DNA binding and broad substrate selectivity of fowlpox virus resolvase.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41598-019-56825-w 
_citation.pdbx_database_id_PubMed   31941902 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, N.'       1 ?                   
primary 'Shi, K.'      2 ?                   
primary 'Rao, T.'      3 ?                   
primary 'Banerjee, S.' 4 ?                   
primary 'Aihara, H.'   5 0000-0001-7508-6230 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6P7B 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     143.510 
_cell.length_a_esd                 ? 
_cell.length_b                     143.510 
_cell.length_b_esd                 ? 
_cell.length_c                     56.545 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6P7B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                75 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Holliday junction resolvase' 17372.885 4 ? ? ? ? 
2 polymer syn 'DNA (29-MER)'                8971.765  1 ? ? ? ? 
3 polymer syn 'DNA (29-MER)'                8829.697  1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MIICSVDIGIKNPAYAIFNYDNTSNTIKLIAIEKSDWTKNWERSVARDLTRYNPDVVILEKQGFKSPNSKIIYFIKGFFY
NSNTKVIVRNPTFKGGSYRNRKKQSIDVFIQKISEYTDYKNDILNKYTKLDDIANSFNLGLSYMESLLK
;
;MIICSVDIGIKNPAYAIFNYDNTSNTIKLIAIEKSDWTKNWERSVARDLTRYNPDVVILEKQGFKSPNSKIIYFIKGFFY
NSNTKVIVRNPTFKGGSYRNRKKQSIDVFIQKISEYTDYKNDILNKYTKLDDIANSFNLGLSYMESLLK
;
A,B,C,D ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DT)(DC)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DT)(DT)(DT)(DC)(DT)(DT)(DC)
(DC)(DT)(DG)(DA)(DG)(DT)(DT)(DG)(DA)
;
ATCGTCGGGGAAGTTTCTTCCTGAGTTGA E       ? 
3 polydeoxyribonucleotide no no 
;(DT)(DC)(DA)(DA)(DC)(DT)(DC)(DA)(DA)(DC)(DT)(DC)(DG)(DT)(DT)(DT)(DC)(DG)(DA)(DG)
(DT)(DC)(DC)(DG)(DA)(DC)(DG)(DA)(DT)
;
TCAACTCAACTCGTTTCGAGTCCGACGAT F       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   ILE n 
1 4   CYS n 
1 5   SER n 
1 6   VAL n 
1 7   ASP n 
1 8   ILE n 
1 9   GLY n 
1 10  ILE n 
1 11  LYS n 
1 12  ASN n 
1 13  PRO n 
1 14  ALA n 
1 15  TYR n 
1 16  ALA n 
1 17  ILE n 
1 18  PHE n 
1 19  ASN n 
1 20  TYR n 
1 21  ASP n 
1 22  ASN n 
1 23  THR n 
1 24  SER n 
1 25  ASN n 
1 26  THR n 
1 27  ILE n 
1 28  LYS n 
1 29  LEU n 
1 30  ILE n 
1 31  ALA n 
1 32  ILE n 
1 33  GLU n 
1 34  LYS n 
1 35  SER n 
1 36  ASP n 
1 37  TRP n 
1 38  THR n 
1 39  LYS n 
1 40  ASN n 
1 41  TRP n 
1 42  GLU n 
1 43  ARG n 
1 44  SER n 
1 45  VAL n 
1 46  ALA n 
1 47  ARG n 
1 48  ASP n 
1 49  LEU n 
1 50  THR n 
1 51  ARG n 
1 52  TYR n 
1 53  ASN n 
1 54  PRO n 
1 55  ASP n 
1 56  VAL n 
1 57  VAL n 
1 58  ILE n 
1 59  LEU n 
1 60  GLU n 
1 61  LYS n 
1 62  GLN n 
1 63  GLY n 
1 64  PHE n 
1 65  LYS n 
1 66  SER n 
1 67  PRO n 
1 68  ASN n 
1 69  SER n 
1 70  LYS n 
1 71  ILE n 
1 72  ILE n 
1 73  TYR n 
1 74  PHE n 
1 75  ILE n 
1 76  LYS n 
1 77  GLY n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  ASN n 
1 82  SER n 
1 83  ASN n 
1 84  THR n 
1 85  LYS n 
1 86  VAL n 
1 87  ILE n 
1 88  VAL n 
1 89  ARG n 
1 90  ASN n 
1 91  PRO n 
1 92  THR n 
1 93  PHE n 
1 94  LYS n 
1 95  GLY n 
1 96  GLY n 
1 97  SER n 
1 98  TYR n 
1 99  ARG n 
1 100 ASN n 
1 101 ARG n 
1 102 LYS n 
1 103 LYS n 
1 104 GLN n 
1 105 SER n 
1 106 ILE n 
1 107 ASP n 
1 108 VAL n 
1 109 PHE n 
1 110 ILE n 
1 111 GLN n 
1 112 LYS n 
1 113 ILE n 
1 114 SER n 
1 115 GLU n 
1 116 TYR n 
1 117 THR n 
1 118 ASP n 
1 119 TYR n 
1 120 LYS n 
1 121 ASN n 
1 122 ASP n 
1 123 ILE n 
1 124 LEU n 
1 125 ASN n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 LYS n 
1 130 LEU n 
1 131 ASP n 
1 132 ASP n 
1 133 ILE n 
1 134 ALA n 
1 135 ASN n 
1 136 SER n 
1 137 PHE n 
1 138 ASN n 
1 139 LEU n 
1 140 GLY n 
1 141 LEU n 
1 142 SER n 
1 143 TYR n 
1 144 MET n 
1 145 GLU n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 LYS n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DG  n 
2 8   DG  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DG  n 
2 14  DT  n 
2 15  DT  n 
2 16  DT  n 
2 17  DC  n 
2 18  DT  n 
2 19  DT  n 
2 20  DC  n 
2 21  DC  n 
2 22  DT  n 
2 23  DG  n 
2 24  DA  n 
2 25  DG  n 
2 26  DT  n 
2 27  DT  n 
2 28  DG  n 
2 29  DA  n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DA  n 
3 5   DC  n 
3 6   DT  n 
3 7   DC  n 
3 8   DA  n 
3 9   DA  n 
3 10  DC  n 
3 11  DT  n 
3 12  DC  n 
3 13  DG  n 
3 14  DT  n 
3 15  DT  n 
3 16  DT  n 
3 17  DC  n 
3 18  DG  n 
3 19  DA  n 
3 20  DG  n 
3 21  DT  n 
3 22  DC  n 
3 23  DC  n 
3 24  DG  n 
3 25  DA  n 
3 26  DC  n 
3 27  DG  n 
3 28  DA  n 
3 29  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   149 
_entity_src_gen.gene_src_common_name               FPV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 FPV187 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Fowlpox virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 29 'Fowlpox virus' ? 10261 ? 
3 1 sample 1 29 'Fowlpox virus' ? 10261 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP A0A385H9X4_FOWPV A0A385H9X4 ? 1 
;MIICSVDIGIKNPAYAIFNYDNTSNTIKLIAIEKSDWTKNWERSVARDLTRYNPDVVILEKQGFKSPNSKIIYFIKGFFY
NSNTKVIVRNPTFKGGSYRNRKKQSIDVFIQKISEYTDYKNDILNKYTKLDDIADSFNLGLSYMESLLK
;
1 
2 PDB 6P7B             6P7B       ? 2 ? 1 
3 PDB 6P7B             6P7B       ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6P7B A 1 ? 149 ? A0A385H9X4 1 ? 149 ? 1 149 
2 1 6P7B B 1 ? 149 ? A0A385H9X4 1 ? 149 ? 1 149 
3 1 6P7B C 1 ? 149 ? A0A385H9X4 1 ? 149 ? 1 149 
4 1 6P7B D 1 ? 149 ? A0A385H9X4 1 ? 149 ? 1 149 
5 2 6P7B E 1 ? 29  ? 6P7B       1 ? 29  ? 1 29  
6 3 6P7B F 1 ? 29  ? 6P7B       1 ? 29  ? 1 29  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6P7B ASN A 135 ? UNP A0A385H9X4 ASP 135 conflict 135 1 
2 6P7B ASN B 135 ? UNP A0A385H9X4 ASP 135 conflict 135 2 
3 6P7B ASN C 135 ? UNP A0A385H9X4 ASP 135 conflict 135 3 
4 6P7B ASN D 135 ? UNP A0A385H9X4 ASP 135 conflict 135 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6P7B 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.34 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M sodium cacodylate, pH6.6, 0.15M sodium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9791 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6P7B 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.3 
_reflns.d_resolution_low                 39.803 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17192 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                0.0539 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.3 
_reflns_shell.d_res_low                   3.4 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6167 
_reflns_shell.percent_possible_all        97.02 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.947 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.68 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6P7B 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.317 
_refine.ls_d_res_low                             39.803 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17139 
_refine.ls_number_reflns_R_free                  805 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.36 
_refine.ls_percent_reflns_R_free                 4.70 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2133 
_refine.ls_R_factor_R_free                       0.2677 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2102 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'AB INITIO PHASING' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.20 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.36 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.70 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4857 
_refine_hist.pdbx_number_atoms_nucleic_acid   1144 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6001 
_refine_hist.d_res_high                       3.317 
_refine_hist.d_res_low                        39.803 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 6237 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.656  ? 8656 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.414 ? 3564 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.047  ? 960  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.010  ? 919  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.3173 3.5250  . . 125 2681 98.00 . . . 0.4530 . 0.3436 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5250 3.7970  . . 149 2645 98.00 . . . 0.3876 . 0.3113 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7970 4.1787  . . 154 2703 99.00 . . . 0.3680 . 0.2686 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1787 4.7825  . . 99  2765 98.00 . . . 0.2460 . 0.2030 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7825 6.0221  . . 135 2744 99.00 . . . 0.2725 . 0.2256 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0221 39.8054 . . 143 2796 98.00 . . . 0.2320 . 0.1723 . . . . . . . . . . 
# 
_struct.entry_id                     6P7B 
_struct.title                        'Crystal structure of Fowlpox virus resolvase and substrate Holliday junction DNA complex' 
_struct.pdbx_descriptor              'Holliday junction resolvase/DNA complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6P7B 
_struct_keywords.text            'resolvase-DNA complex, HYDROLASE-DNA complex, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 40  ? ARG A 51  ? ASN A 40  ARG A 51  1 ? 12 
HELX_P HELX_P2  AA2 SER A 66  ? TYR A 80  ? SER A 66  TYR A 80  1 ? 15 
HELX_P HELX_P3  AA3 SER A 97  ? ILE A 113 ? SER A 97  ILE A 113 1 ? 17 
HELX_P HELX_P4  AA4 ILE A 113 ? ASP A 118 ? ILE A 113 ASP A 118 1 ? 6  
HELX_P HELX_P5  AA5 TYR A 119 ? LYS A 126 ? TYR A 119 LYS A 126 1 ? 8  
HELX_P HELX_P6  AA6 ASP A 132 ? SER A 146 ? ASP A 132 SER A 146 1 ? 15 
HELX_P HELX_P7  AA7 ASN B 40  ? ARG B 51  ? ASN B 40  ARG B 51  1 ? 12 
HELX_P HELX_P8  AA8 PRO B 67  ? PHE B 79  ? PRO B 67  PHE B 79  1 ? 13 
HELX_P HELX_P9  AA9 ASN B 100 ? ILE B 113 ? ASN B 100 ILE B 113 1 ? 14 
HELX_P HELX_P10 AB1 ILE B 113 ? ASP B 118 ? ILE B 113 ASP B 118 1 ? 6  
HELX_P HELX_P11 AB2 TYR B 119 ? ASN B 125 ? TYR B 119 ASN B 125 1 ? 7  
HELX_P HELX_P12 AB3 ASP B 132 ? SER B 146 ? ASP B 132 SER B 146 1 ? 15 
HELX_P HELX_P13 AB4 ASN C 40  ? ARG C 51  ? ASN C 40  ARG C 51  1 ? 12 
HELX_P HELX_P14 AB5 PRO C 67  ? ASN C 81  ? PRO C 67  ASN C 81  1 ? 15 
HELX_P HELX_P15 AB6 TYR C 98  ? ILE C 113 ? TYR C 98  ILE C 113 1 ? 16 
HELX_P HELX_P16 AB7 ILE C 113 ? ASP C 118 ? ILE C 113 ASP C 118 1 ? 6  
HELX_P HELX_P17 AB8 TYR C 119 ? TYR C 127 ? TYR C 119 TYR C 127 1 ? 9  
HELX_P HELX_P18 AB9 ASP C 132 ? SER C 146 ? ASP C 132 SER C 146 1 ? 15 
HELX_P HELX_P19 AC1 ASN D 40  ? THR D 50  ? ASN D 40  THR D 50  1 ? 11 
HELX_P HELX_P20 AC2 PRO D 67  ? PHE D 79  ? PRO D 67  PHE D 79  1 ? 13 
HELX_P HELX_P21 AC3 ASN D 100 ? ILE D 113 ? ASN D 100 ILE D 113 1 ? 14 
HELX_P HELX_P22 AC4 ILE D 113 ? ASP D 118 ? ILE D 113 ASP D 118 1 ? 6  
HELX_P HELX_P23 AC5 TYR D 119 ? ASN D 125 ? TYR D 119 ASN D 125 1 ? 7  
HELX_P HELX_P24 AC6 ASP D 132 ? SER D 146 ? ASP D 132 SER D 146 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? E DA 1  N1 ? ? ? 1_555 F DT 29 N3 ? ? E DA 1  F DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? E DA 1  N6 ? ? ? 1_555 F DT 29 O4 ? ? E DA 1  F DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? E DT 2  N3 ? ? ? 1_555 F DA 28 N1 ? ? E DT 2  F DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? E DT 2  O4 ? ? ? 1_555 F DA 28 N6 ? ? E DT 2  F DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? E DC 3  N3 ? ? ? 1_555 F DG 27 N1 ? ? E DC 3  F DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? E DC 3  N4 ? ? ? 1_555 F DG 27 O6 ? ? E DC 3  F DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? E DC 3  O2 ? ? ? 1_555 F DG 27 N2 ? ? E DC 3  F DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? E DG 4  N1 ? ? ? 1_555 F DC 26 N3 ? ? E DG 4  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? E DG 4  N2 ? ? ? 1_555 F DC 26 O2 ? ? E DG 4  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? E DG 4  O6 ? ? ? 1_555 F DC 26 N4 ? ? E DG 4  F DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 25 N1 ? ? E DT 5  F DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 25 N6 ? ? E DT 5  F DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? E DC 6  N3 ? ? ? 1_555 F DG 24 N1 ? ? E DC 6  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? E DC 6  N4 ? ? ? 1_555 F DG 24 O6 ? ? E DC 6  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? E DC 6  O2 ? ? ? 1_555 F DG 24 N2 ? ? E DC 6  F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? E DG 7  N1 ? ? ? 1_555 F DC 23 N3 ? ? E DG 7  F DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? E DG 7  N2 ? ? ? 1_555 F DC 23 O2 ? ? E DG 7  F DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? E DG 7  O6 ? ? ? 1_555 F DC 23 N4 ? ? E DG 7  F DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? E DG 8  N1 ? ? ? 1_555 F DC 22 N3 ? ? E DG 8  F DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? E DG 8  N2 ? ? ? 1_555 F DC 22 O2 ? ? E DG 8  F DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? E DG 8  O6 ? ? ? 1_555 F DC 22 N4 ? ? E DG 8  F DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? E DG 9  N1 ? ? ? 1_555 E DC 21 N3 ? ? E DG 9  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? E DG 9  N2 ? ? ? 1_555 E DC 21 O2 ? ? E DG 9  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? E DG 9  O6 ? ? ? 1_555 E DC 21 N4 ? ? E DG 9  E DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? E DG 10 N1 ? ? ? 1_555 E DC 20 N3 ? ? E DG 10 E DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? E DG 10 N2 ? ? ? 1_555 E DC 20 O2 ? ? E DG 10 E DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? E DG 10 O6 ? ? ? 1_555 E DC 20 N4 ? ? E DG 10 E DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? E DA 11 N1 ? ? ? 1_555 E DT 19 N3 ? ? E DA 11 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? E DA 11 N6 ? ? ? 1_555 E DT 19 O4 ? ? E DA 11 E DT 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? E DA 12 N1 ? ? ? 1_555 E DT 18 N3 ? ? E DA 12 E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? E DA 12 N6 ? ? ? 1_555 E DT 18 O4 ? ? E DA 12 E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? E DG 13 N1 ? ? ? 1_555 E DC 17 N3 ? ? E DG 13 E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? E DG 13 N2 ? ? ? 1_555 E DC 17 O2 ? ? E DG 13 E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? E DG 13 O6 ? ? ? 1_555 E DC 17 N4 ? ? E DG 13 E DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? E DT 22 N3 ? ? ? 1_555 F DA 8  N1 ? ? E DT 22 F DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? E DT 22 O4 ? ? ? 1_555 F DA 8  N6 ? ? E DT 22 F DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? E DG 23 N1 ? ? ? 1_555 F DC 7  N3 ? ? E DG 23 F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? E DG 23 N2 ? ? ? 1_555 F DC 7  O2 ? ? E DG 23 F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? E DG 23 O6 ? ? ? 1_555 F DC 7  N4 ? ? E DG 23 F DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DA 24 N1 ? ? ? 1_555 F DT 6  N3 ? ? E DA 24 F DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DA 24 N6 ? ? ? 1_555 F DT 6  O4 ? ? E DA 24 F DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DG 25 N1 ? ? ? 1_555 F DC 5  N3 ? ? E DG 25 F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DG 25 N2 ? ? ? 1_555 F DC 5  O2 ? ? E DG 25 F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DG 25 O6 ? ? ? 1_555 F DC 5  N4 ? ? E DG 25 F DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DT 26 N3 ? ? ? 1_555 F DA 4  N1 ? ? E DT 26 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DT 26 O4 ? ? ? 1_555 F DA 4  N6 ? ? E DT 26 F DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? E DT 27 N3 ? ? ? 1_555 F DA 3  N1 ? ? E DT 27 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? E DT 27 O4 ? ? ? 1_555 F DA 3  N6 ? ? E DT 27 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? E DG 28 N1 ? ? ? 1_555 F DC 2  N3 ? ? E DG 28 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? E DG 28 N2 ? ? ? 1_555 F DC 2  O2 ? ? E DG 28 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? E DG 28 O6 ? ? ? 1_555 F DC 2  N4 ? ? E DG 28 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? E DA 29 N1 ? ? ? 1_555 F DT 1  N3 ? ? E DA 29 F DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? E DA 29 N6 ? ? ? 1_555 F DT 1  O4 ? ? E DA 29 F DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? F DA 9  N1 ? ? ? 1_555 F DT 21 N3 ? ? F DA 9  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? F DA 9  N6 ? ? ? 1_555 F DT 21 O4 ? ? F DA 9  F DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? F DC 10 N3 ? ? ? 1_555 F DG 20 N1 ? ? F DC 10 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? F DC 10 N4 ? ? ? 1_555 F DG 20 O6 ? ? F DC 10 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? F DC 10 O2 ? ? ? 1_555 F DG 20 N2 ? ? F DC 10 F DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? F DT 11 N3 ? ? ? 1_555 F DA 19 N1 ? ? F DT 11 F DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? F DT 11 O4 ? ? ? 1_555 F DA 19 N6 ? ? F DT 11 F DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? F DC 12 N3 ? ? ? 1_555 F DG 18 N1 ? ? F DC 12 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? F DC 12 N4 ? ? ? 1_555 F DG 18 O6 ? ? F DC 12 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? F DC 12 O2 ? ? ? 1_555 F DG 18 N2 ? ? F DC 12 F DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? F DG 13 N1 ? ? ? 1_555 F DC 17 O2 ? ? F DG 13 F DC 17 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 27 ? LYS A 34 ? ILE A 27 LYS A 34 
AA1 2 ALA A 14 ? TYR A 20 ? ALA A 14 TYR A 20 
AA1 3 ILE A 2  ? ASP A 7  ? ILE A 2  ASP A 7  
AA1 4 VAL A 56 ? GLU A 60 ? VAL A 56 GLU A 60 
AA1 5 LYS A 85 ? ARG A 89 ? LYS A 85 ARG A 89 
AA2 1 ILE B 27 ? LYS B 34 ? ILE B 27 LYS B 34 
AA2 2 ALA B 14 ? TYR B 20 ? ALA B 14 TYR B 20 
AA2 3 ILE B 2  ? ASP B 7  ? ILE B 2  ASP B 7  
AA2 4 VAL B 56 ? GLU B 60 ? VAL B 56 GLU B 60 
AA2 5 LYS B 85 ? ARG B 89 ? LYS B 85 ARG B 89 
AA3 1 ILE C 27 ? LYS C 34 ? ILE C 27 LYS C 34 
AA3 2 ALA C 14 ? TYR C 20 ? ALA C 14 TYR C 20 
AA3 3 ILE C 2  ? ASP C 7  ? ILE C 2  ASP C 7  
AA3 4 VAL C 56 ? GLU C 60 ? VAL C 56 GLU C 60 
AA3 5 LYS C 85 ? ARG C 89 ? LYS C 85 ARG C 89 
AA4 1 THR D 26 ? LYS D 34 ? THR D 26 LYS D 34 
AA4 2 ALA D 14 ? ASP D 21 ? ALA D 14 ASP D 21 
AA4 3 ILE D 3  ? ASP D 7  ? ILE D 3  ASP D 7  
AA4 4 VAL D 56 ? GLU D 60 ? VAL D 56 GLU D 60 
AA4 5 LYS D 85 ? ARG D 89 ? LYS D 85 ARG D 89 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LYS A 28 ? O LYS A 28 N ASN A 19 ? N ASN A 19 
AA1 2 3 O ALA A 16 ? O ALA A 16 N SER A 5  ? N SER A 5  
AA1 3 4 N CYS A 4  ? N CYS A 4  O ILE A 58 ? O ILE A 58 
AA1 4 5 N VAL A 57 ? N VAL A 57 O LYS A 85 ? O LYS A 85 
AA2 1 2 O ALA B 31 ? O ALA B 31 N ILE B 17 ? N ILE B 17 
AA2 2 3 O ALA B 16 ? O ALA B 16 N SER B 5  ? N SER B 5  
AA2 3 4 N VAL B 6  ? N VAL B 6  O ILE B 58 ? O ILE B 58 
AA2 4 5 N VAL B 57 ? N VAL B 57 O ILE B 87 ? O ILE B 87 
AA3 1 2 O LYS C 28 ? O LYS C 28 N ASN C 19 ? N ASN C 19 
AA3 2 3 O PHE C 18 ? O PHE C 18 N ILE C 3  ? N ILE C 3  
AA3 3 4 N VAL C 6  ? N VAL C 6  O ILE C 58 ? O ILE C 58 
AA3 4 5 N VAL C 57 ? N VAL C 57 O ILE C 87 ? O ILE C 87 
AA4 1 2 O LYS D 28 ? O LYS D 28 N ASN D 19 ? N ASN D 19 
AA4 2 3 O PHE D 18 ? O PHE D 18 N ILE D 3  ? N ILE D 3  
AA4 3 4 N VAL D 6  ? N VAL D 6  O ILE D 58 ? O ILE D 58 
AA4 4 5 N LEU D 59 ? N LEU D 59 O ARG D 89 ? O ARG D 89 
# 
_atom_sites.entry_id                    6P7B 
_atom_sites.fract_transf_matrix[1][1]   0.006968 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006968 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017685 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N     . MET A 1 1   ? 70.003 5.482   -0.575  1.00 111.20 ? 1   MET A N     1 
ATOM 2    C CA    . MET A 1 1   ? 69.137 6.049   0.451   1.00 109.61 ? 1   MET A CA    1 
ATOM 3    C C     . MET A 1 1   ? 69.108 5.202   1.717   1.00 104.58 ? 1   MET A C     1 
ATOM 4    O O     . MET A 1 1   ? 68.537 4.113   1.724   1.00 105.90 ? 1   MET A O     1 
ATOM 5    C CB    . MET A 1 1   ? 67.703 6.197   -0.071  1.00 117.35 ? 1   MET A CB    1 
ATOM 6    C CG    . MET A 1 1   ? 67.492 7.277   -1.112  1.00 126.15 ? 1   MET A CG    1 
ATOM 7    S SD    . MET A 1 1   ? 67.710 8.949   -0.494  1.00 186.56 ? 1   MET A SD    1 
ATOM 8    C CE    . MET A 1 1   ? 67.054 9.892   -1.870  1.00 201.78 ? 1   MET A CE    1 
ATOM 9    N N     . ILE A 1 2   ? 69.716 5.696   2.790   1.00 101.58 ? 2   ILE A N     1 
ATOM 10   C CA    . ILE A 1 2   ? 69.460 5.159   4.121   1.00 105.77 ? 2   ILE A CA    1 
ATOM 11   C C     . ILE A 1 2   ? 68.356 6.007   4.733   1.00 111.51 ? 2   ILE A C     1 
ATOM 12   O O     . ILE A 1 2   ? 68.534 7.209   4.954   1.00 97.88  ? 2   ILE A O     1 
ATOM 13   C CB    . ILE A 1 2   ? 70.724 5.171   4.993   1.00 93.22  ? 2   ILE A CB    1 
ATOM 14   C CG1   . ILE A 1 2   ? 71.748 4.160   4.469   1.00 109.85 ? 2   ILE A CG1   1 
ATOM 15   C CG2   . ILE A 1 2   ? 70.370 4.853   6.432   1.00 97.59  ? 2   ILE A CG2   1 
ATOM 16   C CD1   . ILE A 1 2   ? 71.315 2.714   4.612   1.00 98.27  ? 2   ILE A CD1   1 
ATOM 17   N N     . ILE A 1 3   ? 67.222 5.381   5.019   1.00 120.55 ? 3   ILE A N     1 
ATOM 18   C CA    . ILE A 1 3   ? 66.024 6.087   5.451   1.00 107.12 ? 3   ILE A CA    1 
ATOM 19   C C     . ILE A 1 3   ? 65.771 5.798   6.922   1.00 95.49  ? 3   ILE A C     1 
ATOM 20   O O     . ILE A 1 3   ? 65.884 4.652   7.372   1.00 102.93 ? 3   ILE A O     1 
ATOM 21   C CB    . ILE A 1 3   ? 64.810 5.695   4.586   1.00 90.65  ? 3   ILE A CB    1 
ATOM 22   C CG1   . ILE A 1 3   ? 65.070 6.058   3.123   1.00 108.58 ? 3   ILE A CG1   1 
ATOM 23   C CG2   . ILE A 1 3   ? 63.563 6.376   5.089   1.00 89.34  ? 3   ILE A CG2   1 
ATOM 24   C CD1   . ILE A 1 3   ? 63.855 5.935   2.235   1.00 127.57 ? 3   ILE A CD1   1 
ATOM 25   N N     . CYS A 1 4   ? 65.435 6.847   7.669   1.00 109.50 ? 4   CYS A N     1 
ATOM 26   C CA    . CYS A 1 4   ? 65.137 6.755   9.093   1.00 100.80 ? 4   CYS A CA    1 
ATOM 27   C C     . CYS A 1 4   ? 63.778 7.396   9.333   1.00 116.25 ? 4   CYS A C     1 
ATOM 28   O O     . CYS A 1 4   ? 63.644 8.621   9.251   1.00 108.65 ? 4   CYS A O     1 
ATOM 29   C CB    . CYS A 1 4   ? 66.217 7.443   9.928   1.00 92.95  ? 4   CYS A CB    1 
ATOM 30   S SG    . CYS A 1 4   ? 65.796 7.619   11.677  1.00 107.17 ? 4   CYS A SG    1 
ATOM 31   N N     . SER A 1 5   ? 62.775 6.580   9.640   1.00 92.42  ? 5   SER A N     1 
ATOM 32   C CA    . SER A 1 5   ? 61.435 7.075   9.912   1.00 94.72  ? 5   SER A CA    1 
ATOM 33   C C     . SER A 1 5   ? 61.188 7.014   11.412  1.00 111.27 ? 5   SER A C     1 
ATOM 34   O O     . SER A 1 5   ? 61.506 6.014   12.062  1.00 109.30 ? 5   SER A O     1 
ATOM 35   C CB    . SER A 1 5   ? 60.379 6.269   9.160   1.00 98.70  ? 5   SER A CB    1 
ATOM 36   O OG    . SER A 1 5   ? 60.399 4.911   9.552   1.00 128.34 ? 5   SER A OG    1 
ATOM 37   N N     . VAL A 1 6   ? 60.622 8.087   11.961  1.00 113.67 ? 6   VAL A N     1 
ATOM 38   C CA    . VAL A 1 6   ? 60.568 8.287   13.403  1.00 93.91  ? 6   VAL A CA    1 
ATOM 39   C C     . VAL A 1 6   ? 59.129 8.520   13.840  1.00 115.54 ? 6   VAL A C     1 
ATOM 40   O O     . VAL A 1 6   ? 58.455 9.422   13.328  1.00 98.23  ? 6   VAL A O     1 
ATOM 41   C CB    . VAL A 1 6   ? 61.446 9.479   13.833  1.00 86.02  ? 6   VAL A CB    1 
ATOM 42   C CG1   . VAL A 1 6   ? 61.483 9.600   15.350  1.00 98.53  ? 6   VAL A CG1   1 
ATOM 43   C CG2   . VAL A 1 6   ? 62.838 9.352   13.260  1.00 82.19  ? 6   VAL A CG2   1 
ATOM 44   N N     . ASP A 1 7   ? 58.666 7.711   14.793  1.00 104.71 ? 7   ASP A N     1 
ATOM 45   C CA    . ASP A 1 7   ? 57.492 8.039   15.591  1.00 117.21 ? 7   ASP A CA    1 
ATOM 46   C C     . ASP A 1 7   ? 57.995 8.809   16.808  1.00 103.48 ? 7   ASP A C     1 
ATOM 47   O O     . ASP A 1 7   ? 58.705 8.253   17.658  1.00 104.25 ? 7   ASP A O     1 
ATOM 48   C CB    . ASP A 1 7   ? 56.723 6.785   15.997  1.00 117.96 ? 7   ASP A CB    1 
ATOM 49   C CG    . ASP A 1 7   ? 55.493 7.099   16.831  1.00 150.31 ? 7   ASP A CG    1 
ATOM 50   O OD1   . ASP A 1 7   ? 55.002 8.247   16.765  1.00 175.61 ? 7   ASP A OD1   1 
ATOM 51   O OD2   . ASP A 1 7   ? 55.015 6.202   17.554  1.00 164.10 ? 7   ASP A OD2   1 
ATOM 52   N N     . ILE A 1 8   ? 57.627 10.089  16.880  1.00 158.22 ? 8   ILE A N     1 
ATOM 53   C CA    . ILE A 1 8   ? 58.148 11.013  17.876  1.00 93.36  ? 8   ILE A CA    1 
ATOM 54   C C     . ILE A 1 8   ? 57.309 10.920  19.143  1.00 109.74 ? 8   ILE A C     1 
ATOM 55   O O     . ILE A 1 8   ? 56.135 10.538  19.125  1.00 144.82 ? 8   ILE A O     1 
ATOM 56   C CB    . ILE A 1 8   ? 58.187 12.459  17.332  1.00 92.86  ? 8   ILE A CB    1 
ATOM 57   C CG1   . ILE A 1 8   ? 58.700 12.478  15.886  1.00 157.11 ? 8   ILE A CG1   1 
ATOM 58   C CG2   . ILE A 1 8   ? 59.053 13.355  18.208  1.00 93.41  ? 8   ILE A CG2   1 
ATOM 59   C CD1   . ILE A 1 8   ? 57.608 12.542  14.827  1.00 135.77 ? 8   ILE A CD1   1 
ATOM 60   N N     . GLY A 1 9   ? 57.923 11.294  20.258  1.00 99.13  ? 9   GLY A N     1 
ATOM 61   C CA    . GLY A 1 9   ? 57.284 11.255  21.554  1.00 136.00 ? 9   GLY A CA    1 
ATOM 62   C C     . GLY A 1 9   ? 58.346 11.220  22.629  1.00 134.09 ? 9   GLY A C     1 
ATOM 63   O O     . GLY A 1 9   ? 59.389 10.587  22.450  1.00 106.80 ? 9   GLY A O     1 
ATOM 64   N N     . ILE A 1 10  ? 58.112 11.932  23.733  1.00 164.07 ? 10  ILE A N     1 
ATOM 65   C CA    . ILE A 1 10  ? 59.067 11.919  24.837  1.00 144.87 ? 10  ILE A CA    1 
ATOM 66   C C     . ILE A 1 10  ? 59.082 10.563  25.530  1.00 142.71 ? 10  ILE A C     1 
ATOM 67   O O     . ILE A 1 10  ? 60.153 10.011  25.811  1.00 114.22 ? 10  ILE A O     1 
ATOM 68   C CB    . ILE A 1 10  ? 58.752 13.058  25.823  1.00 131.47 ? 10  ILE A CB    1 
ATOM 69   C CG1   . ILE A 1 10  ? 57.894 14.129  25.144  1.00 173.00 ? 10  ILE A CG1   1 
ATOM 70   C CG2   . ILE A 1 10  ? 60.035 13.656  26.372  1.00 129.42 ? 10  ILE A CG2   1 
ATOM 71   C CD1   . ILE A 1 10  ? 57.586 15.319  26.026  1.00 218.65 ? 10  ILE A CD1   1 
ATOM 72   N N     . LYS A 1 11  ? 57.906 9.998   25.809  1.00 182.25 ? 11  LYS A N     1 
ATOM 73   C CA    . LYS A 1 11  ? 57.842 8.795   26.635  1.00 190.22 ? 11  LYS A CA    1 
ATOM 74   C C     . LYS A 1 11  ? 58.482 7.602   25.935  1.00 180.47 ? 11  LYS A C     1 
ATOM 75   O O     . LYS A 1 11  ? 59.447 7.017   26.440  1.00 188.94 ? 11  LYS A O     1 
ATOM 76   C CB    . LYS A 1 11  ? 56.392 8.488   27.015  1.00 223.77 ? 11  LYS A CB    1 
ATOM 77   C CG    . LYS A 1 11  ? 56.225 7.168   27.757  1.00 236.60 ? 11  LYS A CG    1 
ATOM 78   C CD    . LYS A 1 11  ? 55.015 7.184   28.678  1.00 227.16 ? 11  LYS A CD    1 
ATOM 79   C CE    . LYS A 1 11  ? 55.235 8.119   29.856  1.00 212.74 ? 11  LYS A CE    1 
ATOM 80   N NZ    . LYS A 1 11  ? 54.111 8.060   30.830  1.00 223.60 ? 11  LYS A NZ    1 
ATOM 81   N N     . ASN A 1 12  ? 57.963 7.222   24.771  1.00 160.17 ? 12  ASN A N     1 
ATOM 82   C CA    . ASN A 1 12  ? 58.452 6.048   24.047  1.00 163.08 ? 12  ASN A CA    1 
ATOM 83   C C     . ASN A 1 12  ? 58.599 6.356   22.561  1.00 133.83 ? 12  ASN A C     1 
ATOM 84   O O     . ASN A 1 12  ? 57.760 5.973   21.739  1.00 145.20 ? 12  ASN A O     1 
ATOM 85   C CB    . ASN A 1 12  ? 57.531 4.845   24.277  1.00 200.39 ? 12  ASN A CB    1 
ATOM 86   C CG    . ASN A 1 12  ? 56.059 5.210   24.209  1.00 214.93 ? 12  ASN A CG    1 
ATOM 87   O OD1   . ASN A 1 12  ? 55.699 6.326   23.833  1.00 240.85 ? 12  ASN A OD1   1 
ATOM 88   N ND2   . ASN A 1 12  ? 55.199 4.265   24.575  1.00 185.19 ? 12  ASN A ND2   1 
ATOM 89   N N     . PRO A 1 13  ? 59.668 7.057   22.186  1.00 120.17 ? 13  PRO A N     1 
ATOM 90   C CA    . PRO A 1 13  ? 59.936 7.290   20.761  1.00 121.55 ? 13  PRO A CA    1 
ATOM 91   C C     . PRO A 1 13  ? 60.464 6.034   20.086  1.00 106.78 ? 13  PRO A C     1 
ATOM 92   O O     . PRO A 1 13  ? 61.100 5.184   20.714  1.00 133.06 ? 13  PRO A O     1 
ATOM 93   C CB    . PRO A 1 13  ? 60.993 8.399   20.780  1.00 110.08 ? 13  PRO A CB    1 
ATOM 94   C CG    . PRO A 1 13  ? 61.704 8.200   22.071  1.00 112.61 ? 13  PRO A CG    1 
ATOM 95   C CD    . PRO A 1 13  ? 60.663 7.713   23.049  1.00 117.47 ? 13  PRO A CD    1 
ATOM 96   N N     . ALA A 1 14  ? 60.179 5.907   18.790  1.00 107.54 ? 14  ALA A N     1 
ATOM 97   C CA    . ALA A 1 14  ? 60.607 4.726   18.047  1.00 101.66 ? 14  ALA A CA    1 
ATOM 98   C C     . ALA A 1 14  ? 61.074 5.130   16.657  1.00 93.29  ? 14  ALA A C     1 
ATOM 99   O O     . ALA A 1 14  ? 60.675 6.164   16.121  1.00 126.29 ? 14  ALA A O     1 
ATOM 100  C CB    . ALA A 1 14  ? 59.490 3.677   17.939  1.00 105.54 ? 14  ALA A CB    1 
ATOM 101  N N     . TYR A 1 15  ? 61.941 4.302   16.078  1.00 101.74 ? 15  TYR A N     1 
ATOM 102  C CA    . TYR A 1 15  ? 62.444 4.569   14.738  1.00 110.50 ? 15  TYR A CA    1 
ATOM 103  C C     . TYR A 1 15  ? 62.700 3.275   13.973  1.00 87.56  ? 15  TYR A C     1 
ATOM 104  O O     . TYR A 1 15  ? 63.028 2.232   14.549  1.00 91.65  ? 15  TYR A O     1 
ATOM 105  C CB    . TYR A 1 15  ? 63.690 5.474   14.779  1.00 91.55  ? 15  TYR A CB    1 
ATOM 106  C CG    . TYR A 1 15  ? 64.826 4.980   15.639  1.00 96.12  ? 15  TYR A CG    1 
ATOM 107  C CD1   . TYR A 1 15  ? 65.750 4.060   15.162  1.00 107.70 ? 15  TYR A CD1   1 
ATOM 108  C CD2   . TYR A 1 15  ? 64.983 5.455   16.936  1.00 120.88 ? 15  TYR A CD2   1 
ATOM 109  C CE1   . TYR A 1 15  ? 66.792 3.618   15.963  1.00 152.29 ? 15  TYR A CE1   1 
ATOM 110  C CE2   . TYR A 1 15  ? 66.017 5.022   17.739  1.00 142.49 ? 15  TYR A CE2   1 
ATOM 111  C CZ    . TYR A 1 15  ? 66.919 4.105   17.250  1.00 155.32 ? 15  TYR A CZ    1 
ATOM 112  O OH    . TYR A 1 15  ? 67.948 3.678   18.057  1.00 151.39 ? 15  TYR A OH    1 
ATOM 113  N N     . ALA A 1 16  ? 62.512 3.363   12.658  1.00 138.82 ? 16  ALA A N     1 
ATOM 114  C CA    . ALA A 1 16  ? 62.761 2.273   11.724  1.00 121.21 ? 16  ALA A CA    1 
ATOM 115  C C     . ALA A 1 16  ? 63.790 2.734   10.701  1.00 96.49  ? 16  ALA A C     1 
ATOM 116  O O     . ALA A 1 16  ? 63.662 3.824   10.131  1.00 118.70 ? 16  ALA A O     1 
ATOM 117  C CB    . ALA A 1 16  ? 61.473 1.828   11.024  1.00 93.56  ? 16  ALA A CB    1 
ATOM 118  N N     . ILE A 1 17  ? 64.807 1.904   10.485  1.00 94.77  ? 17  ILE A N     1 
ATOM 119  C CA    . ILE A 1 17  ? 65.916 2.187   9.582   1.00 102.14 ? 17  ILE A CA    1 
ATOM 120  C C     . ILE A 1 17  ? 65.838 1.216   8.416   1.00 90.84  ? 17  ILE A C     1 
ATOM 121  O O     . ILE A 1 17  ? 65.967 -0.003  8.605   1.00 93.06  ? 17  ILE A O     1 
ATOM 122  C CB    . ILE A 1 17  ? 67.269 2.071   10.296  1.00 88.61  ? 17  ILE A CB    1 
ATOM 123  C CG1   . ILE A 1 17  ? 67.233 2.820   11.626  1.00 101.41 ? 17  ILE A CG1   1 
ATOM 124  C CG2   . ILE A 1 17  ? 68.384 2.595   9.408   1.00 100.35 ? 17  ILE A CG2   1 
ATOM 125  C CD1   . ILE A 1 17  ? 67.104 4.309   11.467  1.00 99.40  ? 17  ILE A CD1   1 
ATOM 126  N N     . PHE A 1 18  ? 65.613 1.764   7.222   1.00 91.13  ? 18  PHE A N     1 
ATOM 127  C CA    . PHE A 1 18  ? 65.550 1.035   5.966   1.00 94.18  ? 18  PHE A CA    1 
ATOM 128  C C     . PHE A 1 18  ? 66.700 1.432   5.048   1.00 107.48 ? 18  PHE A C     1 
ATOM 129  O O     . PHE A 1 18  ? 67.352 2.465   5.235   1.00 93.85  ? 18  PHE A O     1 
ATOM 130  C CB    . PHE A 1 18  ? 64.242 1.299   5.212   1.00 105.69 ? 18  PHE A CB    1 
ATOM 131  C CG    . PHE A 1 18  ? 63.001 1.104   6.023   1.00 95.59  ? 18  PHE A CG    1 
ATOM 132  C CD1   . PHE A 1 18  ? 62.473 2.146   6.761   1.00 99.99  ? 18  PHE A CD1   1 
ATOM 133  C CD2   . PHE A 1 18  ? 62.330 -0.106  6.002   1.00 98.61  ? 18  PHE A CD2   1 
ATOM 134  C CE1   . PHE A 1 18  ? 61.317 1.977   7.484   1.00 120.19 ? 18  PHE A CE1   1 
ATOM 135  C CE2   . PHE A 1 18  ? 61.174 -0.281  6.727   1.00 105.17 ? 18  PHE A CE2   1 
ATOM 136  C CZ    . PHE A 1 18  ? 60.667 0.760   7.470   1.00 123.22 ? 18  PHE A CZ    1 
ATOM 137  N N     . ASN A 1 19  ? 66.912 0.604   4.026   1.00 99.29  ? 19  ASN A N     1 
ATOM 138  C CA    . ASN A 1 19  ? 67.775 0.932   2.897   1.00 119.98 ? 19  ASN A CA    1 
ATOM 139  C C     . ASN A 1 19  ? 66.940 0.858   1.625   1.00 119.71 ? 19  ASN A C     1 
ATOM 140  O O     . ASN A 1 19  ? 66.377 -0.196  1.311   1.00 125.59 ? 19  ASN A O     1 
ATOM 141  C CB    . ASN A 1 19  ? 68.968 -0.019  2.801   1.00 134.81 ? 19  ASN A CB    1 
ATOM 142  C CG    . ASN A 1 19  ? 69.879 0.307   1.625   1.00 128.93 ? 19  ASN A CG    1 
ATOM 143  O OD1   . ASN A 1 19  ? 70.222 1.467   1.395   1.00 107.65 ? 19  ASN A OD1   1 
ATOM 144  N ND2   . ASN A 1 19  ? 70.249 -0.716  0.860   1.00 134.35 ? 19  ASN A ND2   1 
ATOM 145  N N     . TYR A 1 20  ? 66.852 1.973   0.904   1.00 113.19 ? 20  TYR A N     1 
ATOM 146  C CA    . TYR A 1 20  ? 66.072 2.064   -0.325  1.00 109.27 ? 20  TYR A CA    1 
ATOM 147  C C     . TYR A 1 20  ? 67.022 2.161   -1.513  1.00 113.76 ? 20  TYR A C     1 
ATOM 148  O O     . TYR A 1 20  ? 67.811 3.106   -1.605  1.00 113.37 ? 20  TYR A O     1 
ATOM 149  C CB    . TYR A 1 20  ? 65.124 3.264   -0.290  1.00 138.26 ? 20  TYR A CB    1 
ATOM 150  C CG    . TYR A 1 20  ? 64.323 3.443   -1.561  1.00 111.25 ? 20  TYR A CG    1 
ATOM 151  C CD1   . TYR A 1 20  ? 63.246 2.617   -1.843  1.00 113.23 ? 20  TYR A CD1   1 
ATOM 152  C CD2   . TYR A 1 20  ? 64.647 4.433   -2.477  1.00 161.67 ? 20  TYR A CD2   1 
ATOM 153  C CE1   . TYR A 1 20  ? 62.513 2.770   -3.001  1.00 150.44 ? 20  TYR A CE1   1 
ATOM 154  C CE2   . TYR A 1 20  ? 63.920 4.594   -3.640  1.00 146.64 ? 20  TYR A CE2   1 
ATOM 155  C CZ    . TYR A 1 20  ? 62.854 3.760   -3.895  1.00 155.86 ? 20  TYR A CZ    1 
ATOM 156  O OH    . TYR A 1 20  ? 62.125 3.915   -5.051  1.00 170.43 ? 20  TYR A OH    1 
ATOM 157  N N     . ASP A 1 21  ? 66.953 1.178   -2.407  1.00 121.51 ? 21  ASP A N     1 
ATOM 158  C CA    . ASP A 1 21  ? 67.771 1.181   -3.616  1.00 136.25 ? 21  ASP A CA    1 
ATOM 159  C C     . ASP A 1 21  ? 67.234 2.197   -4.620  1.00 141.92 ? 21  ASP A C     1 
ATOM 160  O O     . ASP A 1 21  ? 66.069 2.127   -5.025  1.00 147.09 ? 21  ASP A O     1 
ATOM 161  C CB    . ASP A 1 21  ? 67.805 -0.215  -4.233  1.00 139.94 ? 21  ASP A CB    1 
ATOM 162  C CG    . ASP A 1 21  ? 68.966 -0.401  -5.192  1.00 149.80 ? 21  ASP A CG    1 
ATOM 163  O OD1   . ASP A 1 21  ? 69.436 0.602   -5.771  1.00 149.52 ? 21  ASP A OD1   1 
ATOM 164  O OD2   . ASP A 1 21  ? 69.409 -1.555  -5.368  1.00 162.93 ? 21  ASP A OD2   1 
ATOM 165  N N     . ASN A 1 22  ? 68.089 3.143   -5.017  1.00 164.40 ? 22  ASN A N     1 
ATOM 166  C CA    . ASN A 1 22  ? 67.656 4.232   -5.888  1.00 190.03 ? 22  ASN A CA    1 
ATOM 167  C C     . ASN A 1 22  ? 67.327 3.751   -7.297  1.00 193.99 ? 22  ASN A C     1 
ATOM 168  O O     . ASN A 1 22  ? 66.371 4.237   -7.911  1.00 189.39 ? 22  ASN A O     1 
ATOM 169  C CB    . ASN A 1 22  ? 68.727 5.320   -5.937  1.00 203.38 ? 22  ASN A CB    1 
ATOM 170  C CG    . ASN A 1 22  ? 68.899 6.015   -4.612  1.00 185.57 ? 22  ASN A CG    1 
ATOM 171  O OD1   . ASN A 1 22  ? 67.919 6.314   -3.939  1.00 180.15 ? 22  ASN A OD1   1 
ATOM 172  N ND2   . ASN A 1 22  ? 70.143 6.267   -4.222  1.00 197.37 ? 22  ASN A ND2   1 
ATOM 173  N N     . THR A 1 23  ? 68.104 2.810   -7.836  1.00 202.95 ? 23  THR A N     1 
ATOM 174  C CA    . THR A 1 23  ? 67.843 2.324   -9.185  1.00 211.66 ? 23  THR A CA    1 
ATOM 175  C C     . THR A 1 23  ? 67.062 1.017   -9.227  1.00 205.44 ? 23  THR A C     1 
ATOM 176  O O     . THR A 1 23  ? 66.665 0.592   -10.317 1.00 222.82 ? 23  THR A O     1 
ATOM 177  C CB    . THR A 1 23  ? 69.162 2.135   -9.948  1.00 208.62 ? 23  THR A CB    1 
ATOM 178  O OG1   . THR A 1 23  ? 69.874 1.015   -9.407  1.00 204.67 ? 23  THR A OG1   1 
ATOM 179  C CG2   . THR A 1 23  ? 70.027 3.381   -9.834  1.00 212.18 ? 23  THR A CG2   1 
ATOM 180  N N     . SER A 1 24  ? 66.824 0.374   -8.084  1.00 162.41 ? 24  SER A N     1 
ATOM 181  C CA    . SER A 1 24  ? 66.024 -0.840  -8.054  1.00 159.18 ? 24  SER A CA    1 
ATOM 182  C C     . SER A 1 24  ? 64.677 -0.669  -7.372  1.00 166.44 ? 24  SER A C     1 
ATOM 183  O O     . SER A 1 24  ? 63.803 -1.522  -7.555  1.00 174.14 ? 24  SER A O     1 
ATOM 184  C CB    . SER A 1 24  ? 66.790 -1.971  -7.351  1.00 171.33 ? 24  SER A CB    1 
ATOM 185  O OG    . SER A 1 24  ? 68.034 -2.212  -7.985  1.00 210.95 ? 24  SER A OG    1 
ATOM 186  N N     . ASN A 1 25  ? 64.488 0.408   -6.605  1.00 181.61 ? 25  ASN A N     1 
ATOM 187  C CA    . ASN A 1 25  ? 63.243 0.657   -5.878  1.00 181.24 ? 25  ASN A CA    1 
ATOM 188  C C     . ASN A 1 25  ? 62.892 -0.526  -4.978  1.00 177.69 ? 25  ASN A C     1 
ATOM 189  O O     . ASN A 1 25  ? 61.738 -0.953  -4.899  1.00 203.33 ? 25  ASN A O     1 
ATOM 190  C CB    . ASN A 1 25  ? 62.096 0.983   -6.837  1.00 197.30 ? 25  ASN A CB    1 
ATOM 191  C CG    . ASN A 1 25  ? 62.372 2.221   -7.671  1.00 228.62 ? 25  ASN A CG    1 
ATOM 192  O OD1   . ASN A 1 25  ? 63.106 3.115   -7.250  1.00 237.65 ? 25  ASN A OD1   1 
ATOM 193  N ND2   . ASN A 1 25  ? 61.784 2.278   -8.860  1.00 236.87 ? 25  ASN A ND2   1 
ATOM 194  N N     . THR A 1 26  ? 63.900 -1.059  -4.293  1.00 156.90 ? 26  THR A N     1 
ATOM 195  C CA    . THR A 1 26  ? 63.752 -2.212  -3.416  1.00 127.70 ? 26  THR A CA    1 
ATOM 196  C C     . THR A 1 26  ? 63.906 -1.776  -1.967  1.00 157.03 ? 26  THR A C     1 
ATOM 197  O O     . THR A 1 26  ? 64.817 -1.009  -1.638  1.00 160.33 ? 26  THR A O     1 
ATOM 198  C CB    . THR A 1 26  ? 64.777 -3.297  -3.751  1.00 161.39 ? 26  THR A CB    1 
ATOM 199  O OG1   . THR A 1 26  ? 64.687 -3.624  -5.143  1.00 173.78 ? 26  THR A OG1   1 
ATOM 200  C CG2   . THR A 1 26  ? 64.517 -4.549  -2.925  1.00 161.77 ? 26  THR A CG2   1 
ATOM 201  N N     . ILE A 1 27  ? 63.011 -2.259  -1.111  1.00 182.57 ? 27  ILE A N     1 
ATOM 202  C CA    . ILE A 1 27  ? 63.007 -1.916  0.306   1.00 112.96 ? 27  ILE A CA    1 
ATOM 203  C C     . ILE A 1 27  ? 63.835 -2.944  1.061   1.00 116.44 ? 27  ILE A C     1 
ATOM 204  O O     . ILE A 1 27  ? 63.755 -4.148  0.789   1.00 164.64 ? 27  ILE A O     1 
ATOM 205  C CB    . ILE A 1 27  ? 61.568 -1.871  0.852   1.00 111.21 ? 27  ILE A CB    1 
ATOM 206  C CG1   . ILE A 1 27  ? 60.657 -1.067  -0.076  1.00 174.53 ? 27  ILE A CG1   1 
ATOM 207  C CG2   . ILE A 1 27  ? 61.551 -1.293  2.254   1.00 106.15 ? 27  ILE A CG2   1 
ATOM 208  C CD1   . ILE A 1 27  ? 61.133 0.321   -0.350  1.00 111.23 ? 27  ILE A CD1   1 
ATOM 209  N N     . LYS A 1 28  ? 64.633 -2.473  2.015   1.00 120.89 ? 28  LYS A N     1 
ATOM 210  C CA    . LYS A 1 28  ? 65.363 -3.351  2.924   1.00 114.78 ? 28  LYS A CA    1 
ATOM 211  C C     . LYS A 1 28  ? 65.233 -2.793  4.330   1.00 133.97 ? 28  LYS A C     1 
ATOM 212  O O     . LYS A 1 28  ? 65.717 -1.690  4.600   1.00 109.57 ? 28  LYS A O     1 
ATOM 213  C CB    . LYS A 1 28  ? 66.838 -3.468  2.531   1.00 112.85 ? 28  LYS A CB    1 
ATOM 214  C CG    . LYS A 1 28  ? 67.717 -4.130  3.588   1.00 112.09 ? 28  LYS A CG    1 
ATOM 215  C CD    . LYS A 1 28  ? 67.271 -5.556  3.879   1.00 166.04 ? 28  LYS A CD    1 
ATOM 216  C CE    . LYS A 1 28  ? 68.198 -6.238  4.873   1.00 168.10 ? 28  LYS A CE    1 
ATOM 217  N NZ    . LYS A 1 28  ? 67.762 -7.629  5.183   1.00 163.84 ? 28  LYS A NZ    1 
ATOM 218  N N     . LEU A 1 29  ? 64.586 -3.544  5.219   1.00 146.77 ? 29  LEU A N     1 
ATOM 219  C CA    . LEU A 1 29  ? 64.478 -3.134  6.614   1.00 134.49 ? 29  LEU A CA    1 
ATOM 220  C C     . LEU A 1 29  ? 65.765 -3.513  7.334   1.00 105.28 ? 29  LEU A C     1 
ATOM 221  O O     . LEU A 1 29  ? 66.111 -4.694  7.421   1.00 106.93 ? 29  LEU A O     1 
ATOM 222  C CB    . LEU A 1 29  ? 63.266 -3.787  7.277   1.00 102.51 ? 29  LEU A CB    1 
ATOM 223  C CG    . LEU A 1 29  ? 62.932 -3.451  8.734   1.00 100.38 ? 29  LEU A CG    1 
ATOM 224  C CD1   . LEU A 1 29  ? 63.598 -4.413  9.705   1.00 166.66 ? 29  LEU A CD1   1 
ATOM 225  C CD2   . LEU A 1 29  ? 63.312 -2.015  9.056   1.00 96.68  ? 29  LEU A CD2   1 
ATOM 226  N N     . ILE A 1 30  ? 66.480 -2.510  7.830   1.00 100.65 ? 30  ILE A N     1 
ATOM 227  C CA    . ILE A 1 30  ? 67.712 -2.744  8.572   1.00 109.90 ? 30  ILE A CA    1 
ATOM 228  C C     . ILE A 1 30  ? 67.437 -2.964  10.052  1.00 123.18 ? 30  ILE A C     1 
ATOM 229  O O     . ILE A 1 30  ? 67.853 -3.968  10.634  1.00 113.66 ? 30  ILE A O     1 
ATOM 230  C CB    . ILE A 1 30  ? 68.686 -1.569  8.349   1.00 100.68 ? 30  ILE A CB    1 
ATOM 231  C CG1   . ILE A 1 30  ? 69.067 -1.476  6.872   1.00 120.33 ? 30  ILE A CG1   1 
ATOM 232  C CG2   . ILE A 1 30  ? 69.922 -1.730  9.219   1.00 99.48  ? 30  ILE A CG2   1 
ATOM 233  C CD1   . ILE A 1 30  ? 69.996 -0.333  6.552   1.00 118.91 ? 30  ILE A CD1   1 
ATOM 234  N N     . ALA A 1 31  ? 66.711 -2.047  10.684  1.00 145.09 ? 31  ALA A N     1 
ATOM 235  C CA    . ALA A 1 31  ? 66.536 -2.159  12.127  1.00 97.26  ? 31  ALA A CA    1 
ATOM 236  C C     . ALA A 1 31  ? 65.261 -1.455  12.557  1.00 95.23  ? 31  ALA A C     1 
ATOM 237  O O     . ALA A 1 31  ? 64.727 -0.609  11.844  1.00 93.02  ? 31  ALA A O     1 
ATOM 238  C CB    . ALA A 1 31  ? 67.742 -1.586  12.876  1.00 97.21  ? 31  ALA A CB    1 
ATOM 239  N N     . ILE A 1 32  ? 64.793 -1.804  13.754  1.00 132.25 ? 32  ILE A N     1 
ATOM 240  C CA    . ILE A 1 32  ? 63.642 -1.162  14.382  1.00 111.98 ? 32  ILE A CA    1 
ATOM 241  C C     . ILE A 1 32  ? 63.934 -1.076  15.873  1.00 106.08 ? 32  ILE A C     1 
ATOM 242  O O     . ILE A 1 32  ? 64.227 -2.097  16.505  1.00 120.13 ? 32  ILE A O     1 
ATOM 243  C CB    . ILE A 1 32  ? 62.332 -1.934  14.142  1.00 124.80 ? 32  ILE A CB    1 
ATOM 244  C CG1   . ILE A 1 32  ? 62.037 -2.069  12.644  1.00 99.05  ? 32  ILE A CG1   1 
ATOM 245  C CG2   . ILE A 1 32  ? 61.181 -1.244  14.843  1.00 147.97 ? 32  ILE A CG2   1 
ATOM 246  C CD1   . ILE A 1 32  ? 60.685 -2.665  12.331  1.00 103.24 ? 32  ILE A CD1   1 
ATOM 247  N N     . GLU A 1 33  ? 63.859 0.132   16.439  1.00 95.48  ? 33  GLU A N     1 
ATOM 248  C CA    . GLU A 1 33  ? 64.281 0.339   17.819  1.00 108.39 ? 33  GLU A CA    1 
ATOM 249  C C     . GLU A 1 33  ? 63.381 1.326   18.551  1.00 109.40 ? 33  GLU A C     1 
ATOM 250  O O     . GLU A 1 33  ? 62.955 2.338   17.987  1.00 100.14 ? 33  GLU A O     1 
ATOM 251  C CB    . GLU A 1 33  ? 65.731 0.847   17.883  1.00 101.07 ? 33  GLU A CB    1 
ATOM 252  C CG    . GLU A 1 33  ? 66.774 -0.131  17.360  1.00 140.14 ? 33  GLU A CG    1 
ATOM 253  C CD    . GLU A 1 33  ? 66.872 -1.397  18.199  1.00 194.46 ? 33  GLU A CD    1 
ATOM 254  O OE1   . GLU A 1 33  ? 66.547 -1.347  19.404  1.00 197.46 ? 33  GLU A OE1   1 
ATOM 255  O OE2   . GLU A 1 33  ? 67.273 -2.445  17.650  1.00 187.92 ? 33  GLU A OE2   1 
ATOM 256  N N     . LYS A 1 34  ? 63.110 1.022   19.820  1.00 123.09 ? 34  LYS A N     1 
ATOM 257  C CA    . LYS A 1 34  ? 62.551 1.980   20.762  1.00 101.93 ? 34  LYS A CA    1 
ATOM 258  C C     . LYS A 1 34  ? 63.677 2.742   21.451  1.00 102.01 ? 34  LYS A C     1 
ATOM 259  O O     . LYS A 1 34  ? 64.836 2.322   21.447  1.00 105.29 ? 34  LYS A O     1 
ATOM 260  C CB    . LYS A 1 34  ? 61.688 1.285   21.818  1.00 106.96 ? 34  LYS A CB    1 
ATOM 261  C CG    . LYS A 1 34  ? 60.251 1.001   21.413  1.00 110.55 ? 34  LYS A CG    1 
ATOM 262  C CD    . LYS A 1 34  ? 59.477 0.428   22.591  1.00 143.20 ? 34  LYS A CD    1 
ATOM 263  C CE    . LYS A 1 34  ? 58.139 -0.152  22.165  1.00 173.62 ? 34  LYS A CE    1 
ATOM 264  N NZ    . LYS A 1 34  ? 57.398 -0.725  23.324  1.00 210.66 ? 34  LYS A NZ    1 
ATOM 265  N N     . SER A 1 35  ? 63.324 3.874   22.054  1.00 102.26 ? 35  SER A N     1 
ATOM 266  C CA    . SER A 1 35  ? 64.290 4.650   22.817  1.00 103.11 ? 35  SER A CA    1 
ATOM 267  C C     . SER A 1 35  ? 63.560 5.422   23.908  1.00 119.69 ? 35  SER A C     1 
ATOM 268  O O     . SER A 1 35  ? 62.349 5.280   24.097  1.00 130.67 ? 35  SER A O     1 
ATOM 269  C CB    . SER A 1 35  ? 65.084 5.590   21.909  1.00 102.28 ? 35  SER A CB    1 
ATOM 270  O OG    . SER A 1 35  ? 66.066 6.291   22.650  1.00 122.39 ? 35  SER A OG    1 
ATOM 271  N N     . ASP A 1 36  ? 64.318 6.232   24.646  1.00 145.00 ? 36  ASP A N     1 
ATOM 272  C CA    . ASP A 1 36  ? 63.777 7.075   25.702  1.00 147.11 ? 36  ASP A CA    1 
ATOM 273  C C     . ASP A 1 36  ? 64.348 8.479   25.575  1.00 132.33 ? 36  ASP A C     1 
ATOM 274  O O     . ASP A 1 36  ? 65.570 8.653   25.540  1.00 125.04 ? 36  ASP A O     1 
ATOM 275  C CB    . ASP A 1 36  ? 64.092 6.498   27.084  1.00 163.36 ? 36  ASP A CB    1 
ATOM 276  C CG    . ASP A 1 36  ? 63.601 7.386   28.206  1.00 181.92 ? 36  ASP A CG    1 
ATOM 277  O OD1   . ASP A 1 36  ? 62.376 7.414   28.444  1.00 189.25 ? 36  ASP A OD1   1 
ATOM 278  O OD2   . ASP A 1 36  ? 64.437 8.059   28.845  1.00 187.74 ? 36  ASP A OD2   1 
ATOM 279  N N     . TRP A 1 37  ? 63.467 9.477   25.495  1.00 110.92 ? 37  TRP A N     1 
ATOM 280  C CA    . TRP A 1 37  ? 63.874 10.878  25.457  1.00 110.51 ? 37  TRP A CA    1 
ATOM 281  C C     . TRP A 1 37  ? 63.347 11.658  26.654  1.00 132.88 ? 37  TRP A C     1 
ATOM 282  O O     . TRP A 1 37  ? 63.288 12.891  26.607  1.00 129.04 ? 37  TRP A O     1 
ATOM 283  C CB    . TRP A 1 37  ? 63.417 11.553  24.161  1.00 143.48 ? 37  TRP A CB    1 
ATOM 284  C CG    . TRP A 1 37  ? 64.002 10.978  22.912  1.00 118.64 ? 37  TRP A CG    1 
ATOM 285  C CD1   . TRP A 1 37  ? 65.097 10.172  22.814  1.00 109.38 ? 37  TRP A CD1   1 
ATOM 286  C CD2   . TRP A 1 37  ? 63.545 11.199  21.573  1.00 107.12 ? 37  TRP A CD2   1 
ATOM 287  N NE1   . TRP A 1 37  ? 65.340 9.863   21.500  1.00 93.80  ? 37  TRP A NE1   1 
ATOM 288  C CE2   . TRP A 1 37  ? 64.402 10.483  20.716  1.00 128.99 ? 37  TRP A CE2   1 
ATOM 289  C CE3   . TRP A 1 37  ? 62.489 11.926  21.016  1.00 136.67 ? 37  TRP A CE3   1 
ATOM 290  C CZ2   . TRP A 1 37  ? 64.238 10.473  19.329  1.00 104.40 ? 37  TRP A CZ2   1 
ATOM 291  C CZ3   . TRP A 1 37  ? 62.327 11.915  19.637  1.00 130.04 ? 37  TRP A CZ3   1 
ATOM 292  C CH2   . TRP A 1 37  ? 63.197 11.193  18.812  1.00 97.52  ? 37  TRP A CH2   1 
ATOM 293  N N     . THR A 1 38  ? 62.970 10.964  27.730  1.00 161.96 ? 38  THR A N     1 
ATOM 294  C CA    . THR A 1 38  ? 62.428 11.632  28.908  1.00 139.38 ? 38  THR A CA    1 
ATOM 295  C C     . THR A 1 38  ? 63.447 12.510  29.622  1.00 130.40 ? 38  THR A C     1 
ATOM 296  O O     . THR A 1 38  ? 63.049 13.370  30.414  1.00 152.58 ? 38  THR A O     1 
ATOM 297  C CB    . THR A 1 38  ? 61.869 10.598  29.884  1.00 148.23 ? 38  THR A CB    1 
ATOM 298  O OG1   . THR A 1 38  ? 62.861 9.595   30.137  1.00 175.18 ? 38  THR A OG1   1 
ATOM 299  C CG2   . THR A 1 38  ? 60.617 9.945   29.312  1.00 142.07 ? 38  THR A CG2   1 
ATOM 300  N N     . LYS A 1 39  ? 64.740 12.323  29.372  1.00 149.16 ? 39  LYS A N     1 
ATOM 301  C CA    . LYS A 1 39  ? 65.773 13.112  30.029  1.00 159.99 ? 39  LYS A CA    1 
ATOM 302  C C     . LYS A 1 39  ? 66.787 13.595  29.002  1.00 177.46 ? 39  LYS A C     1 
ATOM 303  O O     . LYS A 1 39  ? 67.342 12.790  28.246  1.00 178.80 ? 39  LYS A O     1 
ATOM 304  C CB    . LYS A 1 39  ? 66.462 12.301  31.132  1.00 167.82 ? 39  LYS A CB    1 
ATOM 305  C CG    . LYS A 1 39  ? 65.641 12.203  32.413  1.00 196.35 ? 39  LYS A CG    1 
ATOM 306  C CD    . LYS A 1 39  ? 66.152 11.109  33.338  1.00 193.91 ? 39  LYS A CD    1 
ATOM 307  C CE    . LYS A 1 39  ? 65.670 9.738   32.890  1.00 187.76 ? 39  LYS A CE    1 
ATOM 308  N NZ    . LYS A 1 39  ? 64.183 9.638   32.926  1.00 178.68 ? 39  LYS A NZ    1 
ATOM 309  N N     . ASN A 1 40  ? 67.024 14.910  28.984  1.00 182.51 ? 40  ASN A N     1 
ATOM 310  C CA    . ASN A 1 40  ? 67.951 15.556  28.052  1.00 161.66 ? 40  ASN A CA    1 
ATOM 311  C C     . ASN A 1 40  ? 67.593 15.205  26.607  1.00 139.12 ? 40  ASN A C     1 
ATOM 312  O O     . ASN A 1 40  ? 68.357 14.561  25.885  1.00 143.70 ? 40  ASN A O     1 
ATOM 313  C CB    . ASN A 1 40  ? 69.400 15.176  28.373  1.00 178.93 ? 40  ASN A CB    1 
ATOM 314  C CG    . ASN A 1 40  ? 69.728 15.324  29.846  1.00 211.78 ? 40  ASN A CG    1 
ATOM 315  O OD1   . ASN A 1 40  ? 70.195 16.374  30.287  1.00 226.80 ? 40  ASN A OD1   1 
ATOM 316  N ND2   . ASN A 1 40  ? 69.485 14.269  30.616  1.00 208.56 ? 40  ASN A ND2   1 
ATOM 317  N N     . TRP A 1 41  ? 66.397 15.642  26.201  1.00 148.43 ? 41  TRP A N     1 
ATOM 318  C CA    . TRP A 1 41  ? 65.823 15.178  24.941  1.00 118.02 ? 41  TRP A CA    1 
ATOM 319  C C     . TRP A 1 41  ? 66.632 15.620  23.726  1.00 105.56 ? 41  TRP A C     1 
ATOM 320  O O     . TRP A 1 41  ? 66.708 14.875  22.743  1.00 106.90 ? 41  TRP A O     1 
ATOM 321  C CB    . TRP A 1 41  ? 64.368 15.637  24.825  1.00 106.06 ? 41  TRP A CB    1 
ATOM 322  C CG    . TRP A 1 41  ? 64.168 17.116  24.743  1.00 107.16 ? 41  TRP A CG    1 
ATOM 323  C CD1   . TRP A 1 41  ? 63.974 17.980  25.781  1.00 122.62 ? 41  TRP A CD1   1 
ATOM 324  C CD2   . TRP A 1 41  ? 64.077 17.900  23.547  1.00 130.22 ? 41  TRP A CD2   1 
ATOM 325  N NE1   . TRP A 1 41  ? 63.802 19.258  25.308  1.00 128.67 ? 41  TRP A NE1   1 
ATOM 326  C CE2   . TRP A 1 41  ? 63.857 19.234  23.939  1.00 142.24 ? 41  TRP A CE2   1 
ATOM 327  C CE3   . TRP A 1 41  ? 64.176 17.603  22.183  1.00 115.02 ? 41  TRP A CE3   1 
ATOM 328  C CZ2   . TRP A 1 41  ? 63.734 20.271  23.015  1.00 116.17 ? 41  TRP A CZ2   1 
ATOM 329  C CZ3   . TRP A 1 41  ? 64.053 18.631  21.271  1.00 119.98 ? 41  TRP A CZ3   1 
ATOM 330  C CH2   . TRP A 1 41  ? 63.834 19.950  21.691  1.00 127.54 ? 41  TRP A CH2   1 
ATOM 331  N N     . GLU A 1 42  ? 67.257 16.803  23.764  1.00 103.50 ? 42  GLU A N     1 
ATOM 332  C CA    . GLU A 1 42  ? 68.060 17.229  22.618  1.00 111.01 ? 42  GLU A CA    1 
ATOM 333  C C     . GLU A 1 42  ? 69.287 16.340  22.450  1.00 110.88 ? 42  GLU A C     1 
ATOM 334  O O     . GLU A 1 42  ? 69.596 15.892  21.338  1.00 120.46 ? 42  GLU A O     1 
ATOM 335  C CB    . GLU A 1 42  ? 68.470 18.697  22.747  1.00 101.08 ? 42  GLU A CB    1 
ATOM 336  C CG    . GLU A 1 42  ? 67.308 19.674  22.786  1.00 104.70 ? 42  GLU A CG    1 
ATOM 337  C CD    . GLU A 1 42  ? 67.761 21.116  22.941  1.00 128.34 ? 42  GLU A CD    1 
ATOM 338  O OE1   . GLU A 1 42  ? 68.976 21.377  22.807  1.00 114.81 ? 42  GLU A OE1   1 
ATOM 339  O OE2   . GLU A 1 42  ? 66.901 21.989  23.188  1.00 124.65 ? 42  GLU A OE2   1 
ATOM 340  N N     . ARG A 1 43  ? 69.995 16.070  23.547  1.00 149.05 ? 43  ARG A N     1 
ATOM 341  C CA    . ARG A 1 43  ? 71.121 15.146  23.499  1.00 125.02 ? 43  ARG A CA    1 
ATOM 342  C C     . ARG A 1 43  ? 70.671 13.775  23.017  1.00 109.16 ? 43  ARG A C     1 
ATOM 343  O O     . ARG A 1 43  ? 71.309 13.165  22.152  1.00 108.48 ? 43  ARG A O     1 
ATOM 344  C CB    . ARG A 1 43  ? 71.761 15.037  24.885  1.00 138.02 ? 43  ARG A CB    1 
ATOM 345  C CG    . ARG A 1 43  ? 72.507 16.276  25.345  1.00 176.36 ? 43  ARG A CG    1 
ATOM 346  C CD    . ARG A 1 43  ? 72.764 16.230  26.846  1.00 208.15 ? 43  ARG A CD    1 
ATOM 347  N NE    . ARG A 1 43  ? 73.145 14.899  27.312  1.00 205.62 ? 43  ARG A NE    1 
ATOM 348  C CZ    . ARG A 1 43  ? 74.359 14.577  27.747  1.00 192.43 ? 43  ARG A CZ    1 
ATOM 349  N NH1   . ARG A 1 43  ? 75.318 15.491  27.780  1.00 179.67 ? 43  ARG A NH1   1 
ATOM 350  N NH2   . ARG A 1 43  ? 74.612 13.341  28.154  1.00 204.35 ? 43  ARG A NH2   1 
ATOM 351  N N     . SER A 1 44  ? 69.557 13.280  23.566  1.00 114.67 ? 44  SER A N     1 
ATOM 352  C CA    . SER A 1 44  ? 69.066 11.957  23.201  1.00 97.23  ? 44  SER A CA    1 
ATOM 353  C C     . SER A 1 44  ? 68.647 11.904  21.739  1.00 101.13 ? 44  SER A C     1 
ATOM 354  O O     . SER A 1 44  ? 68.912 10.914  21.047  1.00 109.89 ? 44  SER A O     1 
ATOM 355  C CB    . SER A 1 44  ? 67.903 11.562  24.110  1.00 100.85 ? 44  SER A CB    1 
ATOM 356  O OG    . SER A 1 44  ? 68.263 11.674  25.475  1.00 126.67 ? 44  SER A OG    1 
ATOM 357  N N     . VAL A 1 45  ? 67.982 12.954  21.252  1.00 98.26  ? 45  VAL A N     1 
ATOM 358  C CA    . VAL A 1 45  ? 67.583 12.986  19.847  1.00 106.03 ? 45  VAL A CA    1 
ATOM 359  C C     . VAL A 1 45  ? 68.814 12.984  18.952  1.00 114.44 ? 45  VAL A C     1 
ATOM 360  O O     . VAL A 1 45  ? 68.916 12.194  18.005  1.00 113.24 ? 45  VAL A O     1 
ATOM 361  C CB    . VAL A 1 45  ? 66.683 14.203  19.568  1.00 102.99 ? 45  VAL A CB    1 
ATOM 362  C CG1   . VAL A 1 45  ? 66.660 14.517  18.084  1.00 92.44  ? 45  VAL A CG1   1 
ATOM 363  C CG2   . VAL A 1 45  ? 65.276 13.943  20.067  1.00 126.69 ? 45  VAL A CG2   1 
ATOM 364  N N     . ALA A 1 46  ? 69.772 13.870  19.246  1.00 115.01 ? 46  ALA A N     1 
ATOM 365  C CA    . ALA A 1 46  ? 70.983 13.951  18.439  1.00 88.56  ? 46  ALA A CA    1 
ATOM 366  C C     . ALA A 1 46  ? 71.761 12.642  18.452  1.00 94.06  ? 46  ALA A C     1 
ATOM 367  O O     . ALA A 1 46  ? 72.386 12.282  17.450  1.00 130.71 ? 46  ALA A O     1 
ATOM 368  C CB    . ALA A 1 46  ? 71.859 15.102  18.927  1.00 90.84  ? 46  ALA A CB    1 
ATOM 369  N N     . ARG A 1 47  ? 71.733 11.915  19.569  1.00 113.20 ? 47  ARG A N     1 
ATOM 370  C CA    . ARG A 1 47  ? 72.418 10.628  19.625  1.00 131.44 ? 47  ARG A CA    1 
ATOM 371  C C     . ARG A 1 47  ? 71.680 9.574   18.811  1.00 114.25 ? 47  ARG A C     1 
ATOM 372  O O     . ARG A 1 47  ? 72.283 8.872   17.990  1.00 110.65 ? 47  ARG A O     1 
ATOM 373  C CB    . ARG A 1 47  ? 72.571 10.178  21.080  1.00 148.57 ? 47  ARG A CB    1 
ATOM 374  C CG    . ARG A 1 47  ? 73.763 10.787  21.797  1.00 172.22 ? 47  ARG A CG    1 
ATOM 375  C CD    . ARG A 1 47  ? 75.072 10.304  21.189  1.00 212.18 ? 47  ARG A CD    1 
ATOM 376  N NE    . ARG A 1 47  ? 76.238 10.794  21.919  1.00 246.51 ? 47  ARG A NE    1 
ATOM 377  C CZ    . ARG A 1 47  ? 77.496 10.488  21.611  1.00 254.42 ? 47  ARG A CZ    1 
ATOM 378  N NH1   . ARG A 1 47  ? 77.754 9.690   20.583  1.00 245.27 ? 47  ARG A NH1   1 
ATOM 379  N NH2   . ARG A 1 47  ? 78.496 10.979  22.330  1.00 252.19 ? 47  ARG A NH2   1 
ATOM 380  N N     . ASP A 1 48  ? 70.366 9.453   19.019  1.00 121.58 ? 48  ASP A N     1 
ATOM 381  C CA    . ASP A 1 48  ? 69.616 8.361   18.410  1.00 103.49 ? 48  ASP A CA    1 
ATOM 382  C C     . ASP A 1 48  ? 69.456 8.543   16.910  1.00 98.05  ? 48  ASP A C     1 
ATOM 383  O O     . ASP A 1 48  ? 69.418 7.553   16.172  1.00 102.18 ? 48  ASP A O     1 
ATOM 384  C CB    . ASP A 1 48  ? 68.238 8.241   19.056  1.00 101.17 ? 48  ASP A CB    1 
ATOM 385  C CG    . ASP A 1 48  ? 68.304 7.739   20.474  1.00 119.34 ? 48  ASP A CG    1 
ATOM 386  O OD1   . ASP A 1 48  ? 69.239 6.975   20.789  1.00 153.53 ? 48  ASP A OD1   1 
ATOM 387  O OD2   . ASP A 1 48  ? 67.418 8.107   21.272  1.00 141.36 ? 48  ASP A OD2   1 
ATOM 388  N N     . LEU A 1 49  ? 69.378 9.787   16.438  1.00 114.12 ? 49  LEU A N     1 
ATOM 389  C CA    . LEU A 1 49  ? 69.130 10.010  15.019  1.00 136.89 ? 49  LEU A CA    1 
ATOM 390  C C     . LEU A 1 49  ? 70.403 9.915   14.191  1.00 142.47 ? 49  LEU A C     1 
ATOM 391  O O     . LEU A 1 49  ? 70.344 9.530   13.018  1.00 100.69 ? 49  LEU A O     1 
ATOM 392  C CB    . LEU A 1 49  ? 68.451 11.365  14.814  1.00 127.72 ? 49  LEU A CB    1 
ATOM 393  C CG    . LEU A 1 49  ? 67.032 11.431  15.388  1.00 104.89 ? 49  LEU A CG    1 
ATOM 394  C CD1   . LEU A 1 49  ? 66.325 12.710  14.969  1.00 93.42  ? 49  LEU A CD1   1 
ATOM 395  C CD2   . LEU A 1 49  ? 66.222 10.203  14.989  1.00 112.40 ? 49  LEU A CD2   1 
ATOM 396  N N     . THR A 1 50  ? 71.552 10.246  14.775  1.00 86.65  ? 50  THR A N     1 
ATOM 397  C CA    . THR A 1 50  ? 72.826 10.112  14.085  1.00 111.59 ? 50  THR A CA    1 
ATOM 398  C C     . THR A 1 50  ? 73.445 8.733   14.273  1.00 90.84  ? 50  THR A C     1 
ATOM 399  O O     . THR A 1 50  ? 74.520 8.474   13.723  1.00 92.80  ? 50  THR A O     1 
ATOM 400  C CB    . THR A 1 50  ? 73.808 11.176  14.582  1.00 89.42  ? 50  THR A CB    1 
ATOM 401  O OG1   . THR A 1 50  ? 73.977 11.043  15.998  1.00 174.49 ? 50  THR A OG1   1 
ATOM 402  C CG2   . THR A 1 50  ? 73.266 12.560  14.299  1.00 87.80  ? 50  THR A CG2   1 
ATOM 403  N N     . ARG A 1 51  ? 72.777 7.849   15.023  1.00 112.16 ? 51  ARG A N     1 
ATOM 404  C CA    . ARG A 1 51  ? 73.312 6.519   15.305  1.00 121.80 ? 51  ARG A CA    1 
ATOM 405  C C     . ARG A 1 51  ? 73.638 5.761   14.024  1.00 107.92 ? 51  ARG A C     1 
ATOM 406  O O     . ARG A 1 51  ? 74.755 5.258   13.853  1.00 117.51 ? 51  ARG A O     1 
ATOM 407  C CB    . ARG A 1 51  ? 72.322 5.734   16.166  1.00 123.96 ? 51  ARG A CB    1 
ATOM 408  C CG    . ARG A 1 51  ? 72.820 4.360   16.577  1.00 164.98 ? 51  ARG A CG    1 
ATOM 409  C CD    . ARG A 1 51  ? 71.909 3.730   17.613  1.00 155.06 ? 51  ARG A CD    1 
ATOM 410  N NE    . ARG A 1 51  ? 71.783 4.575   18.794  1.00 152.22 ? 51  ARG A NE    1 
ATOM 411  C CZ    . ARG A 1 51  ? 72.634 4.556   19.813  1.00 163.30 ? 51  ARG A CZ    1 
ATOM 412  N NH1   . ARG A 1 51  ? 72.449 5.359   20.852  1.00 180.78 ? 51  ARG A NH1   1 
ATOM 413  N NH2   . ARG A 1 51  ? 73.674 3.734   19.791  1.00 191.22 ? 51  ARG A NH2   1 
ATOM 414  N N     . TYR A 1 52  ? 72.669 5.651   13.123  1.00 115.63 ? 52  TYR A N     1 
ATOM 415  C CA    . TYR A 1 52  ? 72.873 5.019   11.825  1.00 126.67 ? 52  TYR A CA    1 
ATOM 416  C C     . TYR A 1 52  ? 72.738 6.146   10.812  1.00 123.13 ? 52  TYR A C     1 
ATOM 417  O O     . TYR A 1 52  ? 71.696 6.295   10.177  1.00 172.22 ? 52  TYR A O     1 
ATOM 418  C CB    . TYR A 1 52  ? 71.849 3.943   11.570  1.00 143.11 ? 52  TYR A CB    1 
ATOM 419  C CG    . TYR A 1 52  ? 71.407 3.221   12.812  1.00 141.47 ? 52  TYR A CG    1 
ATOM 420  C CD1   . TYR A 1 52  ? 72.163 2.201   13.356  1.00 173.61 ? 52  TYR A CD1   1 
ATOM 421  C CD2   . TYR A 1 52  ? 70.206 3.548   13.426  1.00 127.10 ? 52  TYR A CD2   1 
ATOM 422  C CE1   . TYR A 1 52  ? 71.752 1.550   14.493  1.00 181.09 ? 52  TYR A CE1   1 
ATOM 423  C CE2   . TYR A 1 52  ? 69.781 2.891   14.556  1.00 155.57 ? 52  TYR A CE2   1 
ATOM 424  C CZ    . TYR A 1 52  ? 70.555 1.886   15.085  1.00 164.54 ? 52  TYR A CZ    1 
ATOM 425  O OH    . TYR A 1 52  ? 70.142 1.222   16.217  1.00 160.86 ? 52  TYR A OH    1 
ATOM 426  N N     . ASN A 1 53  ? 73.814 6.939   10.661  1.00 94.04  ? 53  ASN A N     1 
ATOM 427  C CA    . ASN A 1 53  ? 73.807 8.176   9.882   1.00 91.25  ? 53  ASN A CA    1 
ATOM 428  C C     . ASN A 1 53  ? 72.984 8.019   8.610   1.00 139.16 ? 53  ASN A C     1 
ATOM 429  O O     . ASN A 1 53  ? 73.430 7.410   7.629   1.00 92.60  ? 53  ASN A O     1 
ATOM 430  C CB    . ASN A 1 53  ? 75.234 8.637   9.563   1.00 97.98  ? 53  ASN A CB    1 
ATOM 431  C CG    . ASN A 1 53  ? 76.181 7.487   9.314   1.00 109.65 ? 53  ASN A CG    1 
ATOM 432  O OD1   . ASN A 1 53  ? 75.831 6.511   8.655   1.00 145.29 ? 53  ASN A OD1   1 
ATOM 433  N ND2   . ASN A 1 53  ? 77.390 7.592   9.853   1.00 107.47 ? 53  ASN A ND2   1 
ATOM 434  N N     . PRO A 1 54  ? 71.766 8.546   8.610   1.00 108.63 ? 54  PRO A N     1 
ATOM 435  C CA    . PRO A 1 54  ? 70.834 8.306   7.512   1.00 108.64 ? 54  PRO A CA    1 
ATOM 436  C C     . PRO A 1 54  ? 71.006 9.348   6.416   1.00 88.72  ? 54  PRO A C     1 
ATOM 437  O O     . PRO A 1 54  ? 71.731 10.331  6.563   1.00 103.80 ? 54  PRO A O     1 
ATOM 438  C CB    . PRO A 1 54  ? 69.470 8.445   8.194   1.00 119.13 ? 54  PRO A CB    1 
ATOM 439  C CG    . PRO A 1 54  ? 69.710 9.477   9.248   1.00 84.68  ? 54  PRO A CG    1 
ATOM 440  C CD    . PRO A 1 54  ? 71.154 9.354   9.682   1.00 86.21  ? 54  PRO A CD    1 
ATOM 441  N N     . ASP A 1 55  ? 70.334 9.096   5.298   1.00 89.53  ? 55  ASP A N     1 
ATOM 442  C CA    . ASP A 1 55  ? 70.288 10.056  4.207   1.00 108.39 ? 55  ASP A CA    1 
ATOM 443  C C     . ASP A 1 55  ? 68.994 10.844  4.185   1.00 92.52  ? 55  ASP A C     1 
ATOM 444  O O     . ASP A 1 55  ? 68.987 12.001  3.753   1.00 97.86  ? 55  ASP A O     1 
ATOM 445  C CB    . ASP A 1 55  ? 70.473 9.341   2.867   1.00 108.89 ? 55  ASP A CB    1 
ATOM 446  C CG    . ASP A 1 55  ? 71.858 8.769   2.711   1.00 104.73 ? 55  ASP A CG    1 
ATOM 447  O OD1   . ASP A 1 55  ? 72.833 9.471   3.060   1.00 102.60 ? 55  ASP A OD1   1 
ATOM 448  O OD2   . ASP A 1 55  ? 71.970 7.614   2.253   1.00 159.02 ? 55  ASP A OD2   1 
ATOM 449  N N     . VAL A 1 56  ? 67.911 10.249  4.670   1.00 88.07  ? 56  VAL A N     1 
ATOM 450  C CA    . VAL A 1 56  ? 66.622 10.909  4.785   1.00 107.64 ? 56  VAL A CA    1 
ATOM 451  C C     . VAL A 1 56  ? 66.090 10.614  6.178   1.00 85.21  ? 56  VAL A C     1 
ATOM 452  O O     . VAL A 1 56  ? 66.258 9.504   6.694   1.00 123.72 ? 56  VAL A O     1 
ATOM 453  C CB    . VAL A 1 56  ? 65.630 10.418  3.703   1.00 108.19 ? 56  VAL A CB    1 
ATOM 454  C CG1   . VAL A 1 56  ? 64.247 11.033  3.902   1.00 88.42  ? 56  VAL A CG1   1 
ATOM 455  C CG2   . VAL A 1 56  ? 66.160 10.703  2.308   1.00 93.88  ? 56  VAL A CG2   1 
ATOM 456  N N     . VAL A 1 57  ? 65.467 11.611  6.794   1.00 83.85  ? 57  VAL A N     1 
ATOM 457  C CA    . VAL A 1 57  ? 64.789 11.444  8.070   1.00 82.27  ? 57  VAL A CA    1 
ATOM 458  C C     . VAL A 1 57  ? 63.338 11.840  7.860   1.00 82.60  ? 57  VAL A C     1 
ATOM 459  O O     . VAL A 1 57  ? 63.052 12.953  7.403   1.00 121.70 ? 57  VAL A O     1 
ATOM 460  C CB    . VAL A 1 57  ? 65.442 12.278  9.183   1.00 103.54 ? 57  VAL A CB    1 
ATOM 461  C CG1   . VAL A 1 57  ? 64.667 12.135  10.485  1.00 83.89  ? 57  VAL A CG1   1 
ATOM 462  C CG2   . VAL A 1 57  ? 66.885 11.850  9.377   1.00 106.83 ? 57  VAL A CG2   1 
ATOM 463  N N     . ILE A 1 58  ? 62.428 10.930  8.179   1.00 98.31  ? 58  ILE A N     1 
ATOM 464  C CA    . ILE A 1 58  ? 61.001 11.133  7.982   1.00 87.54  ? 58  ILE A CA    1 
ATOM 465  C C     . ILE A 1 58  ? 60.348 11.312  9.339   1.00 93.21  ? 58  ILE A C     1 
ATOM 466  O O     . ILE A 1 58  ? 60.519 10.475  10.235  1.00 122.83 ? 58  ILE A O     1 
ATOM 467  C CB    . ILE A 1 58  ? 60.362 9.957   7.231   1.00 100.54 ? 58  ILE A CB    1 
ATOM 468  C CG1   . ILE A 1 58  ? 61.117 9.683   5.940   1.00 88.13  ? 58  ILE A CG1   1 
ATOM 469  C CG2   . ILE A 1 58  ? 58.888 10.222  6.973   1.00 126.69 ? 58  ILE A CG2   1 
ATOM 470  C CD1   . ILE A 1 58  ? 60.765 8.371   5.372   1.00 97.94  ? 58  ILE A CD1   1 
ATOM 471  N N     . LEU A 1 59  ? 59.593 12.391  9.486   1.00 83.17  ? 59  LEU A N     1 
ATOM 472  C CA    . LEU A 1 59  ? 58.848 12.650  10.703  1.00 111.57 ? 59  LEU A CA    1 
ATOM 473  C C     . LEU A 1 59  ? 57.370 12.726  10.354  1.00 107.13 ? 59  LEU A C     1 
ATOM 474  O O     . LEU A 1 59  ? 56.987 12.981  9.210   1.00 124.21 ? 59  LEU A O     1 
ATOM 475  C CB    . LEU A 1 59  ? 59.300 13.944  11.406  1.00 135.82 ? 59  LEU A CB    1 
ATOM 476  C CG    . LEU A 1 59  ? 60.784 14.229  11.681  1.00 81.51  ? 59  LEU A CG    1 
ATOM 477  C CD1   . LEU A 1 59  ? 61.537 12.964  12.070  1.00 102.36 ? 59  LEU A CD1   1 
ATOM 478  C CD2   . LEU A 1 59  ? 61.458 14.927  10.515  1.00 125.92 ? 59  LEU A CD2   1 
ATOM 479  N N     . GLU A 1 60  ? 56.543 12.479  11.356  1.00 121.34 ? 60  GLU A N     1 
ATOM 480  C CA    . GLU A 1 60  ? 55.099 12.519  11.207  1.00 126.30 ? 60  GLU A CA    1 
ATOM 481  C C     . GLU A 1 60  ? 54.607 13.862  11.725  1.00 95.61  ? 60  GLU A C     1 
ATOM 482  O O     . GLU A 1 60  ? 54.996 14.295  12.814  1.00 95.18  ? 60  GLU A O     1 
ATOM 483  C CB    . GLU A 1 60  ? 54.459 11.340  11.942  1.00 161.66 ? 60  GLU A CB    1 
ATOM 484  C CG    . GLU A 1 60  ? 52.998 11.080  11.632  1.00 145.98 ? 60  GLU A CG    1 
ATOM 485  C CD    . GLU A 1 60  ? 52.351 10.180  12.668  1.00 171.94 ? 60  GLU A CD    1 
ATOM 486  O OE1   . GLU A 1 60  ? 53.067 9.701   13.574  1.00 172.54 ? 60  GLU A OE1   1 
ATOM 487  O OE2   . GLU A 1 60  ? 51.132 9.934   12.568  1.00 200.00 ? 60  GLU A OE2   1 
ATOM 488  N N     . LYS A 1 61  ? 53.781 14.528  10.926  1.00 91.31  ? 61  LYS A N     1 
ATOM 489  C CA    . LYS A 1 61  ? 53.357 15.884  11.244  1.00 99.21  ? 61  LYS A CA    1 
ATOM 490  C C     . LYS A 1 61  ? 52.581 15.894  12.554  1.00 100.41 ? 61  LYS A C     1 
ATOM 491  O O     . LYS A 1 61  ? 51.669 15.089  12.762  1.00 146.39 ? 61  LYS A O     1 
ATOM 492  C CB    . LYS A 1 61  ? 52.512 16.423  10.086  1.00 96.39  ? 61  LYS A CB    1 
ATOM 493  C CG    . LYS A 1 61  ? 51.993 17.840  10.204  1.00 110.63 ? 61  LYS A CG    1 
ATOM 494  C CD    . LYS A 1 61  ? 51.178 18.172  8.953   1.00 120.00 ? 61  LYS A CD    1 
ATOM 495  C CE    . LYS A 1 61  ? 50.334 19.427  9.101   1.00 119.34 ? 61  LYS A CE    1 
ATOM 496  N NZ    . LYS A 1 61  ? 48.947 19.093  9.525   1.00 166.81 ? 61  LYS A NZ    1 
ATOM 497  N N     . GLN A 1 62  ? 52.955 16.816  13.437  1.00 100.74 ? 62  GLN A N     1 
ATOM 498  C CA    . GLN A 1 62  ? 52.348 16.964  14.748  1.00 135.59 ? 62  GLN A CA    1 
ATOM 499  C C     . GLN A 1 62  ? 51.686 18.330  14.827  1.00 145.94 ? 62  GLN A C     1 
ATOM 500  O O     . GLN A 1 62  ? 52.045 19.254  14.092  1.00 181.28 ? 62  GLN A O     1 
ATOM 501  C CB    . GLN A 1 62  ? 53.398 16.838  15.866  1.00 127.05 ? 62  GLN A CB    1 
ATOM 502  C CG    . GLN A 1 62  ? 54.281 15.590  15.798  1.00 103.53 ? 62  GLN A CG    1 
ATOM 503  C CD    . GLN A 1 62  ? 53.599 14.337  16.295  1.00 123.26 ? 62  GLN A CD    1 
ATOM 504  O OE1   . GLN A 1 62  ? 52.524 14.395  16.891  1.00 174.90 ? 62  GLN A OE1   1 
ATOM 505  N NE2   . GLN A 1 62  ? 54.225 13.190  16.054  1.00 111.50 ? 62  GLN A NE2   1 
ATOM 506  N N     . GLY A 1 63  ? 50.719 18.465  15.729  1.00 125.59 ? 63  GLY A N     1 
ATOM 507  C CA    . GLY A 1 63  ? 50.116 19.764  15.919  1.00 118.20 ? 63  GLY A CA    1 
ATOM 508  C C     . GLY A 1 63  ? 51.039 20.694  16.676  1.00 155.43 ? 63  GLY A C     1 
ATOM 509  O O     . GLY A 1 63  ? 52.107 20.315  17.160  1.00 189.81 ? 63  GLY A O     1 
ATOM 510  N N     . PHE A 1 64  ? 50.598 21.942  16.805  1.00 161.73 ? 64  PHE A N     1 
ATOM 511  C CA    . PHE A 1 64  ? 51.414 22.940  17.482  1.00 188.85 ? 64  PHE A CA    1 
ATOM 512  C C     . PHE A 1 64  ? 51.288 22.854  18.997  1.00 194.64 ? 64  PHE A C     1 
ATOM 513  O O     . PHE A 1 64  ? 52.157 23.367  19.711  1.00 170.97 ? 64  PHE A O     1 
ATOM 514  C CB    . PHE A 1 64  ? 51.047 24.340  16.983  1.00 210.64 ? 64  PHE A CB    1 
ATOM 515  C CG    . PHE A 1 64  ? 51.999 25.413  17.427  1.00 216.44 ? 64  PHE A CG    1 
ATOM 516  C CD1   . PHE A 1 64  ? 53.349 25.323  17.124  1.00 205.47 ? 64  PHE A CD1   1 
ATOM 517  C CD2   . PHE A 1 64  ? 51.546 26.521  18.121  1.00 224.03 ? 64  PHE A CD2   1 
ATOM 518  C CE1   . PHE A 1 64  ? 54.232 26.307  17.521  1.00 185.32 ? 64  PHE A CE1   1 
ATOM 519  C CE2   . PHE A 1 64  ? 52.425 27.512  18.520  1.00 220.38 ? 64  PHE A CE2   1 
ATOM 520  C CZ    . PHE A 1 64  ? 53.770 27.403  18.219  1.00 206.47 ? 64  PHE A CZ    1 
ATOM 521  N N     . LYS A 1 65  ? 50.231 22.221  19.495  1.00 204.81 ? 65  LYS A N     1 
ATOM 522  C CA    . LYS A 1 65  ? 49.991 22.096  20.932  1.00 207.11 ? 65  LYS A CA    1 
ATOM 523  C C     . LYS A 1 65  ? 50.472 20.739  21.446  1.00 204.53 ? 65  LYS A C     1 
ATOM 524  O O     . LYS A 1 65  ? 49.700 19.917  21.942  1.00 232.55 ? 65  LYS A O     1 
ATOM 525  C CB    . LYS A 1 65  ? 48.510 22.315  21.235  1.00 233.89 ? 65  LYS A CB    1 
ATOM 526  C CG    . LYS A 1 65  ? 47.560 21.570  20.302  1.00 247.11 ? 65  LYS A CG    1 
ATOM 527  C CD    . LYS A 1 65  ? 46.105 21.856  20.650  1.00 266.65 ? 65  LYS A CD    1 
ATOM 528  C CE    . LYS A 1 65  ? 45.153 21.119  19.719  1.00 273.95 ? 65  LYS A CE    1 
ATOM 529  N NZ    . LYS A 1 65  ? 43.725 21.401  20.040  1.00 265.11 ? 65  LYS A NZ    1 
ATOM 530  N N     . SER A 1 66  ? 51.780 20.515  21.327  1.00 176.79 ? 66  SER A N     1 
ATOM 531  C CA    . SER A 1 66  ? 52.408 19.297  21.823  1.00 148.01 ? 66  SER A CA    1 
ATOM 532  C C     . SER A 1 66  ? 53.910 19.516  21.875  1.00 149.01 ? 66  SER A C     1 
ATOM 533  O O     . SER A 1 66  ? 54.438 20.327  21.106  1.00 154.64 ? 66  SER A O     1 
ATOM 534  C CB    . SER A 1 66  ? 52.069 18.092  20.930  1.00 132.94 ? 66  SER A CB    1 
ATOM 535  O OG    . SER A 1 66  ? 52.399 18.346  19.575  1.00 99.83  ? 66  SER A OG    1 
ATOM 536  N N     . PRO A 1 67  ? 54.624 18.827  22.770  1.00 185.13 ? 67  PRO A N     1 
ATOM 537  C CA    . PRO A 1 67  ? 56.095 18.932  22.770  1.00 201.88 ? 67  PRO A CA    1 
ATOM 538  C C     . PRO A 1 67  ? 56.742 18.278  21.560  1.00 181.27 ? 67  PRO A C     1 
ATOM 539  O O     . PRO A 1 67  ? 57.906 18.583  21.232  1.00 198.90 ? 67  PRO A O     1 
ATOM 540  C CB    . PRO A 1 67  ? 56.493 18.209  24.066  1.00 216.14 ? 67  PRO A CB    1 
ATOM 541  C CG    . PRO A 1 67  ? 55.233 18.154  24.895  1.00 203.03 ? 67  PRO A CG    1 
ATOM 542  C CD    . PRO A 1 67  ? 54.121 18.041  23.907  1.00 182.70 ? 67  PRO A CD    1 
ATOM 543  N N     . ASN A 1 68  ? 56.006 17.411  20.865  1.00 105.20 ? 68  ASN A N     1 
ATOM 544  C CA    . ASN A 1 68  ? 56.539 16.799  19.661  1.00 115.83 ? 68  ASN A CA    1 
ATOM 545  C C     . ASN A 1 68  ? 56.828 17.846  18.599  1.00 125.38 ? 68  ASN A C     1 
ATOM 546  O O     . ASN A 1 68  ? 57.705 17.644  17.758  1.00 126.42 ? 68  ASN A O     1 
ATOM 547  C CB    . ASN A 1 68  ? 55.568 15.742  19.139  1.00 126.98 ? 68  ASN A CB    1 
ATOM 548  C CG    . ASN A 1 68  ? 55.341 14.625  20.136  1.00 98.84  ? 68  ASN A CG    1 
ATOM 549  O OD1   . ASN A 1 68  ? 55.717 14.737  21.302  1.00 119.35 ? 68  ASN A OD1   1 
ATOM 550  N ND2   . ASN A 1 68  ? 54.725 13.540  19.683  1.00 105.27 ? 68  ASN A ND2   1 
ATOM 551  N N     . SER A 1 69  ? 56.121 18.979  18.633  1.00 103.80 ? 69  SER A N     1 
ATOM 552  C CA    . SER A 1 69  ? 56.415 20.041  17.678  1.00 128.50 ? 69  SER A CA    1 
ATOM 553  C C     . SER A 1 69  ? 57.785 20.653  17.936  1.00 114.62 ? 69  SER A C     1 
ATOM 554  O O     . SER A 1 69  ? 58.540 20.919  16.993  1.00 136.95 ? 69  SER A O     1 
ATOM 555  C CB    . SER A 1 69  ? 55.329 21.114  17.732  1.00 109.66 ? 69  SER A CB    1 
ATOM 556  O OG    . SER A 1 69  ? 55.288 21.726  19.008  1.00 144.35 ? 69  SER A OG    1 
ATOM 557  N N     . LYS A 1 70  ? 58.129 20.886  19.205  1.00 96.56  ? 70  LYS A N     1 
ATOM 558  C CA    . LYS A 1 70  ? 59.461 21.401  19.495  1.00 112.27 ? 70  LYS A CA    1 
ATOM 559  C C     . LYS A 1 70  ? 60.531 20.380  19.137  1.00 122.09 ? 70  LYS A C     1 
ATOM 560  O O     . LYS A 1 70  ? 61.615 20.759  18.678  1.00 88.87  ? 70  LYS A O     1 
ATOM 561  C CB    . LYS A 1 70  ? 59.570 21.849  20.956  1.00 135.23 ? 70  LYS A CB    1 
ATOM 562  C CG    . LYS A 1 70  ? 60.018 20.808  21.964  1.00 108.14 ? 70  LYS A CG    1 
ATOM 563  C CD    . LYS A 1 70  ? 59.878 21.371  23.369  1.00 119.16 ? 70  LYS A CD    1 
ATOM 564  C CE    . LYS A 1 70  ? 60.303 20.377  24.432  1.00 161.50 ? 70  LYS A CE    1 
ATOM 565  N NZ    . LYS A 1 70  ? 59.403 19.202  24.494  1.00 139.15 ? 70  LYS A NZ    1 
ATOM 566  N N     . ILE A 1 71  ? 60.241 19.084  19.295  1.00 91.02  ? 71  ILE A N     1 
ATOM 567  C CA    . ILE A 1 71  ? 61.214 18.093  18.836  1.00 86.00  ? 71  ILE A CA    1 
ATOM 568  C C     . ILE A 1 71  ? 61.336 18.132  17.315  1.00 93.82  ? 71  ILE A C     1 
ATOM 569  O O     . ILE A 1 71  ? 62.437 18.006  16.761  1.00 108.67 ? 71  ILE A O     1 
ATOM 570  C CB    . ILE A 1 71  ? 60.847 16.686  19.343  1.00 96.11  ? 71  ILE A CB    1 
ATOM 571  C CG1   . ILE A 1 71  ? 60.694 16.689  20.863  1.00 99.13  ? 71  ILE A CG1   1 
ATOM 572  C CG2   . ILE A 1 71  ? 61.905 15.679  18.931  1.00 84.35  ? 71  ILE A CG2   1 
ATOM 573  C CD1   . ILE A 1 71  ? 60.317 15.343  21.433  1.00 111.80 ? 71  ILE A CD1   1 
ATOM 574  N N     . ILE A 1 72  ? 60.213 18.325  16.619  1.00 115.09 ? 72  ILE A N     1 
ATOM 575  C CA    . ILE A 1 72  ? 60.228 18.419  15.161  1.00 115.96 ? 72  ILE A CA    1 
ATOM 576  C C     . ILE A 1 72  ? 61.120 19.565  14.715  1.00 103.66 ? 72  ILE A C     1 
ATOM 577  O O     . ILE A 1 72  ? 61.978 19.404  13.841  1.00 105.51 ? 72  ILE A O     1 
ATOM 578  C CB    . ILE A 1 72  ? 58.797 18.581  14.611  1.00 90.93  ? 72  ILE A CB    1 
ATOM 579  C CG1   . ILE A 1 72  ? 58.032 17.261  14.675  1.00 135.54 ? 72  ILE A CG1   1 
ATOM 580  C CG2   . ILE A 1 72  ? 58.812 19.135  13.196  1.00 87.54  ? 72  ILE A CG2   1 
ATOM 581  C CD1   . ILE A 1 72  ? 56.693 17.326  13.986  1.00 175.87 ? 72  ILE A CD1   1 
ATOM 582  N N     . TYR A 1 73  ? 60.925 20.743  15.305  1.00 103.32 ? 73  TYR A N     1 
ATOM 583  C CA    . TYR A 1 73  ? 61.698 21.903  14.879  1.00 89.76  ? 73  TYR A CA    1 
ATOM 584  C C     . TYR A 1 73  ? 63.161 21.791  15.297  1.00 88.87  ? 73  TYR A C     1 
ATOM 585  O O     . TYR A 1 73  ? 64.048 22.260  14.570  1.00 89.79  ? 73  TYR A O     1 
ATOM 586  C CB    . TYR A 1 73  ? 61.066 23.184  15.420  1.00 93.99  ? 73  TYR A CB    1 
ATOM 587  C CG    . TYR A 1 73  ? 59.730 23.510  14.785  1.00 111.04 ? 73  TYR A CG    1 
ATOM 588  C CD1   . TYR A 1 73  ? 59.651 23.937  13.465  1.00 133.73 ? 73  TYR A CD1   1 
ATOM 589  C CD2   . TYR A 1 73  ? 58.550 23.403  15.507  1.00 129.11 ? 73  TYR A CD2   1 
ATOM 590  C CE1   . TYR A 1 73  ? 58.429 24.236  12.879  1.00 121.94 ? 73  TYR A CE1   1 
ATOM 591  C CE2   . TYR A 1 73  ? 57.324 23.700  14.931  1.00 147.51 ? 73  TYR A CE2   1 
ATOM 592  C CZ    . TYR A 1 73  ? 57.271 24.117  13.619  1.00 140.39 ? 73  TYR A CZ    1 
ATOM 593  O OH    . TYR A 1 73  ? 56.055 24.414  13.047  1.00 168.74 ? 73  TYR A OH    1 
ATOM 594  N N     . PHE A 1 74  ? 63.446 21.153  16.437  1.00 154.39 ? 74  PHE A N     1 
ATOM 595  C CA    . PHE A 1 74  ? 64.839 20.887  16.776  1.00 132.31 ? 74  PHE A CA    1 
ATOM 596  C C     . PHE A 1 74  ? 65.492 20.001  15.726  1.00 94.82  ? 74  PHE A C     1 
ATOM 597  O O     . PHE A 1 74  ? 66.625 20.256  15.309  1.00 92.66  ? 74  PHE A O     1 
ATOM 598  C CB    . PHE A 1 74  ? 64.953 20.239  18.157  1.00 121.24 ? 74  PHE A CB    1 
ATOM 599  C CG    . PHE A 1 74  ? 66.368 19.893  18.538  1.00 111.04 ? 74  PHE A CG    1 
ATOM 600  C CD1   . PHE A 1 74  ? 67.183 20.829  19.149  1.00 101.05 ? 74  PHE A CD1   1 
ATOM 601  C CD2   . PHE A 1 74  ? 66.891 18.638  18.258  1.00 116.15 ? 74  PHE A CD2   1 
ATOM 602  C CE1   . PHE A 1 74  ? 68.485 20.518  19.484  1.00 99.17  ? 74  PHE A CE1   1 
ATOM 603  C CE2   . PHE A 1 74  ? 68.194 18.322  18.589  1.00 92.15  ? 74  PHE A CE2   1 
ATOM 604  C CZ    . PHE A 1 74  ? 68.991 19.262  19.203  1.00 104.76 ? 74  PHE A CZ    1 
ATOM 605  N N     . ILE A 1 75  ? 64.793 18.953  15.289  1.00 117.00 ? 75  ILE A N     1 
ATOM 606  C CA    . ILE A 1 75  ? 65.346 18.064  14.271  1.00 110.90 ? 75  ILE A CA    1 
ATOM 607  C C     . ILE A 1 75  ? 65.522 18.807  12.951  1.00 87.18  ? 75  ILE A C     1 
ATOM 608  O O     . ILE A 1 75  ? 66.530 18.630  12.250  1.00 84.45  ? 75  ILE A O     1 
ATOM 609  C CB    . ILE A 1 75  ? 64.450 16.821  14.125  1.00 113.70 ? 75  ILE A CB    1 
ATOM 610  C CG1   . ILE A 1 75  ? 64.487 16.006  15.424  1.00 94.76  ? 75  ILE A CG1   1 
ATOM 611  C CG2   . ILE A 1 75  ? 64.884 15.989  12.936  1.00 80.98  ? 75  ILE A CG2   1 
ATOM 612  C CD1   . ILE A 1 75  ? 63.465 14.894  15.492  1.00 114.44 ? 75  ILE A CD1   1 
ATOM 613  N N     . LYS A 1 76  ? 64.550 19.652  12.597  1.00 102.19 ? 76  LYS A N     1 
ATOM 614  C CA    . LYS A 1 76  ? 64.651 20.452  11.381  1.00 89.92  ? 76  LYS A CA    1 
ATOM 615  C C     . LYS A 1 76  ? 65.909 21.305  11.396  1.00 89.68  ? 76  LYS A C     1 
ATOM 616  O O     . LYS A 1 76  ? 66.665 21.332  10.420  1.00 90.95  ? 76  LYS A O     1 
ATOM 617  C CB    . LYS A 1 76  ? 63.418 21.346  11.222  1.00 96.38  ? 76  LYS A CB    1 
ATOM 618  C CG    . LYS A 1 76  ? 62.177 20.673  10.667  1.00 106.87 ? 76  LYS A CG    1 
ATOM 619  C CD    . LYS A 1 76  ? 61.047 21.688  10.539  1.00 119.90 ? 76  LYS A CD    1 
ATOM 620  C CE    . LYS A 1 76  ? 59.935 21.193  9.629   1.00 153.37 ? 76  LYS A CE    1 
ATOM 621  N NZ    . LYS A 1 76  ? 60.315 21.286  8.189   1.00 139.25 ? 76  LYS A NZ    1 
ATOM 622  N N     . GLY A 1 77  ? 66.156 22.004  12.504  1.00 125.72 ? 77  GLY A N     1 
ATOM 623  C CA    . GLY A 1 77  ? 67.372 22.795  12.599  1.00 124.30 ? 77  GLY A CA    1 
ATOM 624  C C     . GLY A 1 77  ? 68.623 21.938  12.605  1.00 116.32 ? 77  GLY A C     1 
ATOM 625  O O     . GLY A 1 77  ? 69.630 22.287  11.983  1.00 121.47 ? 77  GLY A O     1 
ATOM 626  N N     . PHE A 1 78  ? 68.565 20.790  13.280  1.00 96.96  ? 78  PHE A N     1 
ATOM 627  C CA    . PHE A 1 78  ? 69.741 19.942  13.435  1.00 111.49 ? 78  PHE A CA    1 
ATOM 628  C C     . PHE A 1 78  ? 70.229 19.409  12.096  1.00 98.20  ? 78  PHE A C     1 
ATOM 629  O O     . PHE A 1 78  ? 71.411 19.543  11.759  1.00 98.07  ? 78  PHE A O     1 
ATOM 630  C CB    . PHE A 1 78  ? 69.426 18.808  14.414  1.00 111.32 ? 78  PHE A CB    1 
ATOM 631  C CG    . PHE A 1 78  ? 70.594 17.916  14.716  1.00 109.25 ? 78  PHE A CG    1 
ATOM 632  C CD1   . PHE A 1 78  ? 71.630 18.353  15.526  1.00 91.36  ? 78  PHE A CD1   1 
ATOM 633  C CD2   . PHE A 1 78  ? 70.623 16.613  14.243  1.00 100.47 ? 78  PHE A CD2   1 
ATOM 634  C CE1   . PHE A 1 78  ? 72.699 17.522  15.815  1.00 119.74 ? 78  PHE A CE1   1 
ATOM 635  C CE2   . PHE A 1 78  ? 71.686 15.775  14.534  1.00 91.48  ? 78  PHE A CE2   1 
ATOM 636  C CZ    . PHE A 1 78  ? 72.725 16.228  15.318  1.00 87.77  ? 78  PHE A CZ    1 
ATOM 637  N N     . PHE A 1 79  ? 69.340 18.812  11.308  1.00 140.26 ? 79  PHE A N     1 
ATOM 638  C CA    . PHE A 1 79  ? 69.793 18.254  10.041  1.00 116.83 ? 79  PHE A CA    1 
ATOM 639  C C     . PHE A 1 79  ? 69.744 19.256  8.896   1.00 130.33 ? 79  PHE A C     1 
ATOM 640  O O     . PHE A 1 79  ? 70.057 18.884  7.759   1.00 118.05 ? 79  PHE A O     1 
ATOM 641  C CB    . PHE A 1 79  ? 68.973 17.015  9.673   1.00 113.38 ? 79  PHE A CB    1 
ATOM 642  C CG    . PHE A 1 79  ? 69.294 15.804  10.502  1.00 118.94 ? 79  PHE A CG    1 
ATOM 643  C CD1   . PHE A 1 79  ? 70.559 15.241  10.473  1.00 90.54  ? 79  PHE A CD1   1 
ATOM 644  C CD2   . PHE A 1 79  ? 68.322 15.211  11.289  1.00 128.33 ? 79  PHE A CD2   1 
ATOM 645  C CE1   . PHE A 1 79  ? 70.855 14.120  11.224  1.00 90.18  ? 79  PHE A CE1   1 
ATOM 646  C CE2   . PHE A 1 79  ? 68.611 14.089  12.044  1.00 126.54 ? 79  PHE A CE2   1 
ATOM 647  C CZ    . PHE A 1 79  ? 69.879 13.543  12.010  1.00 120.80 ? 79  PHE A CZ    1 
ATOM 648  N N     . TYR A 1 80  ? 69.371 20.521  9.161   1.00 140.16 ? 80  TYR A N     1 
ATOM 649  C CA    . TYR A 1 80  ? 69.348 21.532  8.101   1.00 145.75 ? 80  TYR A CA    1 
ATOM 650  C C     . TYR A 1 80  ? 70.749 21.923  7.657   1.00 131.19 ? 80  TYR A C     1 
ATOM 651  O O     . TYR A 1 80  ? 70.939 22.842  6.856   1.00 115.56 ? 80  TYR A O     1 
ATOM 652  C CB    . TYR A 1 80  ? 68.581 22.773  8.574   1.00 127.80 ? 80  TYR A CB    1 
ATOM 653  C CG    . TYR A 1 80  ? 68.140 23.718  7.468   1.00 145.36 ? 80  TYR A CG    1 
ATOM 654  C CD1   . TYR A 1 80  ? 66.978 23.470  6.749   1.00 176.27 ? 80  TYR A CD1   1 
ATOM 655  C CD2   . TYR A 1 80  ? 68.867 24.862  7.159   1.00 109.42 ? 80  TYR A CD2   1 
ATOM 656  C CE1   . TYR A 1 80  ? 66.561 24.320  5.745   1.00 148.70 ? 80  TYR A CE1   1 
ATOM 657  C CE2   . TYR A 1 80  ? 68.458 25.717  6.151   1.00 109.96 ? 80  TYR A CE2   1 
ATOM 658  C CZ    . TYR A 1 80  ? 67.303 25.441  5.450   1.00 126.78 ? 80  TYR A CZ    1 
ATOM 659  O OH    . TYR A 1 80  ? 66.883 26.285  4.449   1.00 157.50 ? 80  TYR A OH    1 
ATOM 660  N N     . ASN A 1 81  ? 71.774 21.212  8.120   1.00 185.22 ? 81  ASN A N     1 
ATOM 661  C CA    . ASN A 1 81  ? 73.147 21.582  7.806   1.00 195.73 ? 81  ASN A CA    1 
ATOM 662  C C     . ASN A 1 81  ? 73.608 20.955  6.496   1.00 202.82 ? 81  ASN A C     1 
ATOM 663  O O     . ASN A 1 81  ? 73.984 21.672  5.563   1.00 230.64 ? 81  ASN A O     1 
ATOM 664  C CB    . ASN A 1 81  ? 74.072 21.188  8.963   1.00 212.20 ? 81  ASN A CB    1 
ATOM 665  C CG    . ASN A 1 81  ? 75.040 22.292  9.331   1.00 237.26 ? 81  ASN A CG    1 
ATOM 666  O OD1   . ASN A 1 81  ? 75.614 22.943  8.459   1.00 243.18 ? 81  ASN A OD1   1 
ATOM 667  N ND2   . ASN A 1 81  ? 75.216 22.519  10.629  1.00 243.54 ? 81  ASN A ND2   1 
ATOM 668  N N     . SER A 1 82  ? 73.563 19.627  6.401   1.00 180.00 ? 82  SER A N     1 
ATOM 669  C CA    . SER A 1 82  ? 73.994 18.966  5.175   1.00 199.49 ? 82  SER A CA    1 
ATOM 670  C C     . SER A 1 82  ? 73.610 17.494  5.202   1.00 138.73 ? 82  SER A C     1 
ATOM 671  O O     . SER A 1 82  ? 73.392 16.904  6.265   1.00 118.41 ? 82  SER A O     1 
ATOM 672  C CB    . SER A 1 82  ? 75.508 19.105  4.968   1.00 252.75 ? 82  SER A CB    1 
ATOM 673  O OG    . SER A 1 82  ? 76.223 18.532  6.050   1.00 271.94 ? 82  SER A OG    1 
ATOM 674  N N     . ASN A 1 83  ? 73.490 16.928  3.997   1.00 148.10 ? 83  ASN A N     1 
ATOM 675  C CA    . ASN A 1 83  ? 73.565 15.495  3.723   1.00 151.74 ? 83  ASN A CA    1 
ATOM 676  C C     . ASN A 1 83  ? 72.353 14.705  4.194   1.00 134.13 ? 83  ASN A C     1 
ATOM 677  O O     . ASN A 1 83  ? 72.222 13.519  3.877   1.00 148.45 ? 83  ASN A O     1 
ATOM 678  C CB    . ASN A 1 83  ? 74.827 14.908  4.356   1.00 148.36 ? 83  ASN A CB    1 
ATOM 679  C CG    . ASN A 1 83  ? 76.089 15.545  3.824   1.00 179.98 ? 83  ASN A CG    1 
ATOM 680  O OD1   . ASN A 1 83  ? 76.136 15.987  2.675   1.00 163.67 ? 83  ASN A OD1   1 
ATOM 681  N ND2   . ASN A 1 83  ? 77.122 15.599  4.658   1.00 186.49 ? 83  ASN A ND2   1 
ATOM 682  N N     . THR A 1 84  ? 71.450 15.349  4.924   1.00 126.40 ? 84  THR A N     1 
ATOM 683  C CA    . THR A 1 84  ? 70.306 14.677  5.522   1.00 122.11 ? 84  THR A CA    1 
ATOM 684  C C     . THR A 1 84  ? 69.069 15.519  5.272   1.00 92.74  ? 84  THR A C     1 
ATOM 685  O O     . THR A 1 84  ? 68.966 16.640  5.778   1.00 110.23 ? 84  THR A O     1 
ATOM 686  C CB    . THR A 1 84  ? 70.515 14.473  7.020   1.00 130.26 ? 84  THR A CB    1 
ATOM 687  O OG1   . THR A 1 84  ? 71.093 15.661  7.573   1.00 140.76 ? 84  THR A OG1   1 
ATOM 688  C CG2   . THR A 1 84  ? 71.438 13.299  7.272   1.00 90.71  ? 84  THR A CG2   1 
ATOM 689  N N     . LYS A 1 85  ? 68.141 14.989  4.490   1.00 117.97 ? 85  LYS A N     1 
ATOM 690  C CA    . LYS A 1 85  ? 66.887 15.675  4.230   1.00 137.16 ? 85  LYS A CA    1 
ATOM 691  C C     . LYS A 1 85  ? 65.860 15.226  5.258   1.00 108.91 ? 85  LYS A C     1 
ATOM 692  O O     . LYS A 1 85  ? 65.574 14.030  5.376   1.00 139.55 ? 85  LYS A O     1 
ATOM 693  C CB    . LYS A 1 85  ? 66.395 15.403  2.808   1.00 106.45 ? 85  LYS A CB    1 
ATOM 694  C CG    . LYS A 1 85  ? 66.805 16.468  1.805   1.00 126.11 ? 85  LYS A CG    1 
ATOM 695  C CD    . LYS A 1 85  ? 66.324 17.849  2.236   1.00 178.60 ? 85  LYS A CD    1 
ATOM 696  C CE    . LYS A 1 85  ? 64.800 17.925  2.297   1.00 166.72 ? 85  LYS A CE    1 
ATOM 697  N NZ    . LYS A 1 85  ? 64.316 19.232  2.831   1.00 129.27 ? 85  LYS A NZ    1 
ATOM 698  N N     . VAL A 1 86  ? 65.329 16.174  6.015   1.00 90.26  ? 86  VAL A N     1 
ATOM 699  C CA    . VAL A 1 86  ? 64.177 15.917  6.866   1.00 107.20 ? 86  VAL A CA    1 
ATOM 700  C C     . VAL A 1 86  ? 62.922 16.233  6.066   1.00 108.61 ? 86  VAL A C     1 
ATOM 701  O O     . VAL A 1 86  ? 62.795 17.319  5.487   1.00 115.55 ? 86  VAL A O     1 
ATOM 702  C CB    . VAL A 1 86  ? 64.235 16.742  8.166   1.00 112.90 ? 86  VAL A CB    1 
ATOM 703  C CG1   . VAL A 1 86  ? 65.244 16.145  9.136   1.00 90.90  ? 86  VAL A CG1   1 
ATOM 704  C CG2   . VAL A 1 86  ? 64.577 18.197  7.877   1.00 169.75 ? 86  VAL A CG2   1 
ATOM 705  N N     . ILE A 1 87  ? 62.022 15.262  5.979   1.00 91.89  ? 87  ILE A N     1 
ATOM 706  C CA    . ILE A 1 87  ? 60.752 15.429  5.291   1.00 101.13 ? 87  ILE A CA    1 
ATOM 707  C C     . ILE A 1 87  ? 59.650 15.057  6.273   1.00 114.05 ? 87  ILE A C     1 
ATOM 708  O O     . ILE A 1 87  ? 59.766 14.062  6.997   1.00 99.45  ? 87  ILE A O     1 
ATOM 709  C CB    . ILE A 1 87  ? 60.673 14.595  3.993   1.00 93.56  ? 87  ILE A CB    1 
ATOM 710  C CG1   . ILE A 1 87  ? 60.815 13.106  4.279   1.00 166.72 ? 87  ILE A CG1   1 
ATOM 711  C CG2   . ILE A 1 87  ? 61.748 15.021  3.008   1.00 96.30  ? 87  ILE A CG2   1 
ATOM 712  C CD1   . ILE A 1 87  ? 59.510 12.389  4.251   1.00 184.92 ? 87  ILE A CD1   1 
ATOM 713  N N     . VAL A 1 88  ? 58.611 15.883  6.334   1.00 100.72 ? 88  VAL A N     1 
ATOM 714  C CA    . VAL A 1 88  ? 57.492 15.679  7.245   1.00 96.25  ? 88  VAL A CA    1 
ATOM 715  C C     . VAL A 1 88  ? 56.278 15.262  6.425   1.00 104.36 ? 88  VAL A C     1 
ATOM 716  O O     . VAL A 1 88  ? 55.748 16.048  5.630   1.00 108.07 ? 88  VAL A O     1 
ATOM 717  C CB    . VAL A 1 88  ? 57.201 16.927  8.086   1.00 82.72  ? 88  VAL A CB    1 
ATOM 718  C CG1   . VAL A 1 88  ? 56.075 16.649  9.052   1.00 141.17 ? 88  VAL A CG1   1 
ATOM 719  C CG2   . VAL A 1 88  ? 58.440 17.331  8.854   1.00 80.32  ? 88  VAL A CG2   1 
ATOM 720  N N     . ARG A 1 89  ? 55.846 14.020  6.616   1.00 104.70 ? 89  ARG A N     1 
ATOM 721  C CA    . ARG A 1 89  ? 54.704 13.457  5.917   1.00 112.40 ? 89  ARG A CA    1 
ATOM 722  C C     . ARG A 1 89  ? 53.453 13.626  6.764   1.00 115.37 ? 89  ARG A C     1 
ATOM 723  O O     . ARG A 1 89  ? 53.518 13.655  7.995   1.00 90.52  ? 89  ARG A O     1 
ATOM 724  C CB    . ARG A 1 89  ? 54.904 11.964  5.634   1.00 96.56  ? 89  ARG A CB    1 
ATOM 725  C CG    . ARG A 1 89  ? 56.157 11.584  4.873   1.00 106.13 ? 89  ARG A CG    1 
ATOM 726  C CD    . ARG A 1 89  ? 56.052 11.841  3.373   1.00 100.16 ? 89  ARG A CD    1 
ATOM 727  N NE    . ARG A 1 89  ? 54.740 11.514  2.820   1.00 163.72 ? 89  ARG A NE    1 
ATOM 728  C CZ    . ARG A 1 89  ? 54.279 10.280  2.641   1.00 150.02 ? 89  ARG A CZ    1 
ATOM 729  N NH1   . ARG A 1 89  ? 53.072 10.088  2.126   1.00 190.66 ? 89  ARG A NH1   1 
ATOM 730  N NH2   . ARG A 1 89  ? 55.012 9.238   2.994   1.00 125.80 ? 89  ARG A NH2   1 
ATOM 731  N N     . ASN A 1 90  ? 52.315 13.781  6.094   1.00 141.93 ? 90  ASN A N     1 
ATOM 732  C CA    . ASN A 1 90  ? 51.052 13.740  6.809   1.00 136.74 ? 90  ASN A CA    1 
ATOM 733  C C     . ASN A 1 90  ? 50.914 12.381  7.493   1.00 125.23 ? 90  ASN A C     1 
ATOM 734  O O     . ASN A 1 90  ? 51.503 11.392  7.043   1.00 124.04 ? 90  ASN A O     1 
ATOM 735  C CB    . ASN A 1 90  ? 49.877 13.967  5.860   1.00 147.31 ? 90  ASN A CB    1 
ATOM 736  C CG    . ASN A 1 90  ? 49.585 15.431  5.635   1.00 162.41 ? 90  ASN A CG    1 
ATOM 737  O OD1   . ASN A 1 90  ? 50.029 16.288  6.397   1.00 187.02 ? 90  ASN A OD1   1 
ATOM 738  N ND2   . ASN A 1 90  ? 48.815 15.727  4.595   1.00 165.07 ? 90  ASN A ND2   1 
ATOM 739  N N     . PRO A 1 91  ? 50.156 12.301  8.586   1.00 116.27 ? 91  PRO A N     1 
ATOM 740  C CA    . PRO A 1 91  ? 49.956 11.000  9.239   1.00 120.01 ? 91  PRO A CA    1 
ATOM 741  C C     . PRO A 1 91  ? 49.372 10.016  8.241   1.00 118.09 ? 91  PRO A C     1 
ATOM 742  O O     . PRO A 1 91  ? 48.294 10.236  7.684   1.00 137.37 ? 91  PRO A O     1 
ATOM 743  C CB    . PRO A 1 91  ? 48.985 11.317  10.383  1.00 129.67 ? 91  PRO A CB    1 
ATOM 744  C CG    . PRO A 1 91  ? 48.385 12.644  10.038  1.00 144.39 ? 91  PRO A CG    1 
ATOM 745  C CD    . PRO A 1 91  ? 49.441 13.382  9.282   1.00 136.27 ? 91  PRO A CD    1 
ATOM 746  N N     . THR A 1 92  ? 50.117 8.937   7.990   1.00 130.85 ? 92  THR A N     1 
ATOM 747  C CA    . THR A 1 92  ? 49.675 7.926   7.038   1.00 153.50 ? 92  THR A CA    1 
ATOM 748  C C     . THR A 1 92  ? 48.283 7.422   7.390   1.00 160.36 ? 92  THR A C     1 
ATOM 749  O O     . THR A 1 92  ? 47.330 7.592   6.623   1.00 186.18 ? 92  THR A O     1 
ATOM 750  C CB    . THR A 1 92  ? 50.675 6.768   7.017   1.00 168.02 ? 92  THR A CB    1 
ATOM 751  O OG1   . THR A 1 92  ? 50.704 6.138   8.304   1.00 159.63 ? 92  THR A OG1   1 
ATOM 752  C CG2   . THR A 1 92  ? 52.063 7.286   6.710   1.00 165.85 ? 92  THR A CG2   1 
ATOM 753  N N     . PHE A 1 93  ? 48.151 6.791   8.548   1.00 179.07 ? 93  PHE A N     1 
ATOM 754  C CA    . PHE A 1 93  ? 46.841 6.403   9.050   1.00 190.61 ? 93  PHE A CA    1 
ATOM 755  C C     . PHE A 1 93  ? 46.124 7.652   9.548   1.00 202.16 ? 93  PHE A C     1 
ATOM 756  O O     . PHE A 1 93  ? 46.536 8.259   10.542  1.00 202.56 ? 93  PHE A O     1 
ATOM 757  C CB    . PHE A 1 93  ? 47.010 5.343   10.130  1.00 175.91 ? 93  PHE A CB    1 
ATOM 758  C CG    . PHE A 1 93  ? 47.560 4.060   9.594   1.00 155.76 ? 93  PHE A CG    1 
ATOM 759  C CD1   . PHE A 1 93  ? 47.154 3.597   8.355   1.00 147.46 ? 93  PHE A CD1   1 
ATOM 760  C CD2   . PHE A 1 93  ? 48.529 3.354   10.282  1.00 168.86 ? 93  PHE A CD2   1 
ATOM 761  C CE1   . PHE A 1 93  ? 47.667 2.431   7.831   1.00 159.28 ? 93  PHE A CE1   1 
ATOM 762  C CE2   . PHE A 1 93  ? 49.050 2.189   9.757   1.00 156.22 ? 93  PHE A CE2   1 
ATOM 763  C CZ    . PHE A 1 93  ? 48.616 1.725   8.534   1.00 157.59 ? 93  PHE A CZ    1 
ATOM 764  N N     . LYS A 1 94  ? 45.054 8.043   8.860   1.00 203.44 ? 94  LYS A N     1 
ATOM 765  C CA    . LYS A 1 94  ? 44.330 9.260   9.191   1.00 206.59 ? 94  LYS A CA    1 
ATOM 766  C C     . LYS A 1 94  ? 42.836 8.997   9.095   1.00 209.13 ? 94  LYS A C     1 
ATOM 767  O O     . LYS A 1 94  ? 42.383 8.233   8.238   1.00 185.51 ? 94  LYS A O     1 
ATOM 768  C CB    . LYS A 1 94  ? 44.737 10.404  8.250   1.00 198.06 ? 94  LYS A CB    1 
ATOM 769  C CG    . LYS A 1 94  ? 44.444 11.810  8.752   1.00 193.81 ? 94  LYS A CG    1 
ATOM 770  C CD    . LYS A 1 94  ? 45.165 12.836  7.879   1.00 207.84 ? 94  LYS A CD    1 
ATOM 771  C CE    . LYS A 1 94  ? 45.102 14.243  8.456   1.00 220.09 ? 94  LYS A CE    1 
ATOM 772  N NZ    . LYS A 1 94  ? 45.751 15.253  7.572   1.00 205.26 ? 94  LYS A NZ    1 
ATOM 773  N N     . GLY A 1 95  ? 42.079 9.626   9.985   1.00 231.08 ? 95  GLY A N     1 
ATOM 774  C CA    . GLY A 1 95  ? 40.635 9.503   9.999   1.00 241.15 ? 95  GLY A CA    1 
ATOM 775  C C     . GLY A 1 95  ? 40.156 8.561   11.084  1.00 237.57 ? 95  GLY A C     1 
ATOM 776  O O     . GLY A 1 95  ? 40.935 7.916   11.794  1.00 232.01 ? 95  GLY A O     1 
ATOM 777  N N     . GLY A 1 96  ? 38.830 8.455   11.167  1.00 235.10 ? 96  GLY A N     1 
ATOM 778  C CA    . GLY A 1 96  ? 38.166 7.672   12.194  1.00 224.36 ? 96  GLY A CA    1 
ATOM 779  C C     . GLY A 1 96  ? 38.600 8.027   13.604  1.00 213.57 ? 96  GLY A C     1 
ATOM 780  O O     . GLY A 1 96  ? 39.208 9.078   13.825  1.00 212.74 ? 96  GLY A O     1 
ATOM 781  N N     . SER A 1 97  ? 38.275 7.177   14.575  1.00 210.69 ? 97  SER A N     1 
ATOM 782  C CA    . SER A 1 97  ? 38.649 7.467   15.949  1.00 181.95 ? 97  SER A CA    1 
ATOM 783  C C     . SER A 1 97  ? 40.162 7.359   16.111  1.00 168.86 ? 97  SER A C     1 
ATOM 784  O O     . SER A 1 97  ? 40.859 6.737   15.303  1.00 197.43 ? 97  SER A O     1 
ATOM 785  C CB    . SER A 1 97  ? 37.933 6.530   16.924  1.00 181.29 ? 97  SER A CB    1 
ATOM 786  O OG    . SER A 1 97  ? 38.343 5.186   16.755  1.00 176.57 ? 97  SER A OG    1 
ATOM 787  N N     . TYR A 1 98  ? 40.670 7.977   17.178  1.00 262.25 ? 98  TYR A N     1 
ATOM 788  C CA    . TYR A 1 98  ? 42.110 7.965   17.413  1.00 257.91 ? 98  TYR A CA    1 
ATOM 789  C C     . TYR A 1 98  ? 42.617 6.555   17.690  1.00 255.19 ? 98  TYR A C     1 
ATOM 790  O O     . TYR A 1 98  ? 43.716 6.187   17.260  1.00 255.74 ? 98  TYR A O     1 
ATOM 791  C CB    . TYR A 1 98  ? 42.461 8.900   18.569  1.00 254.75 ? 98  TYR A CB    1 
ATOM 792  C CG    . TYR A 1 98  ? 43.892 8.771   19.040  1.00 258.21 ? 98  TYR A CG    1 
ATOM 793  C CD1   . TYR A 1 98  ? 44.935 9.336   18.318  1.00 267.65 ? 98  TYR A CD1   1 
ATOM 794  C CD2   . TYR A 1 98  ? 44.198 8.086   20.208  1.00 254.18 ? 98  TYR A CD2   1 
ATOM 795  C CE1   . TYR A 1 98  ? 46.244 9.219   18.746  1.00 269.87 ? 98  TYR A CE1   1 
ATOM 796  C CE2   . TYR A 1 98  ? 45.502 7.964   20.643  1.00 255.13 ? 98  TYR A CE2   1 
ATOM 797  C CZ    . TYR A 1 98  ? 46.521 8.532   19.910  1.00 262.47 ? 98  TYR A CZ    1 
ATOM 798  O OH    . TYR A 1 98  ? 47.821 8.413   20.342  1.00 259.92 ? 98  TYR A OH    1 
ATOM 799  N N     . ARG A 1 99  ? 41.828 5.747   18.404  1.00 250.46 ? 99  ARG A N     1 
ATOM 800  C CA    . ARG A 1 99  ? 42.252 4.383   18.700  1.00 229.99 ? 99  ARG A CA    1 
ATOM 801  C C     . ARG A 1 99  ? 42.214 3.497   17.462  1.00 225.03 ? 99  ARG A C     1 
ATOM 802  O O     . ARG A 1 99  ? 42.972 2.524   17.381  1.00 224.45 ? 99  ARG A O     1 
ATOM 803  C CB    . ARG A 1 99  ? 41.384 3.786   19.807  1.00 234.10 ? 99  ARG A CB    1 
ATOM 804  C CG    . ARG A 1 99  ? 41.731 4.281   21.203  1.00 254.51 ? 99  ARG A CG    1 
ATOM 805  C CD    . ARG A 1 99  ? 43.004 3.634   21.738  1.00 262.88 ? 99  ARG A CD    1 
ATOM 806  N NE    . ARG A 1 99  ? 42.826 2.209   22.006  1.00 275.01 ? 99  ARG A NE    1 
ATOM 807  C CZ    . ARG A 1 99  ? 43.640 1.483   22.767  1.00 276.05 ? 99  ARG A CZ    1 
ATOM 808  N NH1   . ARG A 1 99  ? 44.691 2.049   23.346  1.00 273.15 ? 99  ARG A NH1   1 
ATOM 809  N NH2   . ARG A 1 99  ? 43.401 0.193   22.957  1.00 269.60 ? 99  ARG A NH2   1 
ATOM 810  N N     . ASN A 1 100 ? 41.345 3.806   16.495  1.00 211.79 ? 100 ASN A N     1 
ATOM 811  C CA    . ASN A 1 100 ? 41.332 3.039   15.254  1.00 211.22 ? 100 ASN A CA    1 
ATOM 812  C C     . ASN A 1 100 ? 42.641 3.163   14.490  1.00 219.29 ? 100 ASN A C     1 
ATOM 813  O O     . ASN A 1 100 ? 42.971 2.269   13.705  1.00 229.39 ? 100 ASN A O     1 
ATOM 814  C CB    . ASN A 1 100 ? 40.169 3.468   14.356  1.00 232.39 ? 100 ASN A CB    1 
ATOM 815  C CG    . ASN A 1 100 ? 38.824 3.007   14.881  1.00 232.00 ? 100 ASN A CG    1 
ATOM 816  O OD1   . ASN A 1 100 ? 37.911 3.810   15.074  1.00 220.86 ? 100 ASN A OD1   1 
ATOM 817  N ND2   . ASN A 1 100 ? 38.696 1.707   15.116  1.00 227.45 ? 100 ASN A ND2   1 
ATOM 818  N N     . ARG A 1 101 ? 43.393 4.244   14.695  1.00 235.29 ? 101 ARG A N     1 
ATOM 819  C CA    . ARG A 1 101 ? 44.710 4.338   14.077  1.00 240.12 ? 101 ARG A CA    1 
ATOM 820  C C     . ARG A 1 101 ? 45.676 3.341   14.703  1.00 232.64 ? 101 ARG A C     1 
ATOM 821  O O     . ARG A 1 101 ? 46.412 2.647   13.994  1.00 227.37 ? 101 ARG A O     1 
ATOM 822  C CB    . ARG A 1 101 ? 45.260 5.759   14.194  1.00 271.89 ? 101 ARG A CB    1 
ATOM 823  C CG    . ARG A 1 101 ? 46.663 5.897   13.618  1.00 290.67 ? 101 ARG A CG    1 
ATOM 824  C CD    . ARG A 1 101 ? 47.181 7.323   13.659  1.00 297.70 ? 101 ARG A CD    1 
ATOM 825  N NE    . ARG A 1 101 ? 48.342 7.491   12.788  1.00 286.30 ? 101 ARG A NE    1 
ATOM 826  C CZ    . ARG A 1 101 ? 49.595 7.234   13.149  1.00 285.06 ? 101 ARG A CZ    1 
ATOM 827  N NH1   . ARG A 1 101 ? 49.859 6.796   14.373  1.00 286.35 ? 101 ARG A NH1   1 
ATOM 828  N NH2   . ARG A 1 101 ? 50.586 7.415   12.287  1.00 284.21 ? 101 ARG A NH2   1 
ATOM 829  N N     . LYS A 1 102 ? 45.680 3.251   16.036  1.00 213.52 ? 102 LYS A N     1 
ATOM 830  C CA    . LYS A 1 102 ? 46.621 2.372   16.725  1.00 194.77 ? 102 LYS A CA    1 
ATOM 831  C C     . LYS A 1 102 ? 46.411 0.915   16.332  1.00 196.98 ? 102 LYS A C     1 
ATOM 832  O O     . LYS A 1 102 ? 47.364 0.215   15.965  1.00 207.95 ? 102 LYS A O     1 
ATOM 833  C CB    . LYS A 1 102 ? 46.488 2.545   18.239  1.00 187.72 ? 102 LYS A CB    1 
ATOM 834  C CG    . LYS A 1 102 ? 47.010 1.360   19.040  1.00 202.89 ? 102 LYS A CG    1 
ATOM 835  C CD    . LYS A 1 102 ? 47.112 1.678   20.522  1.00 207.46 ? 102 LYS A CD    1 
ATOM 836  C CE    . LYS A 1 102 ? 47.341 0.415   21.342  1.00 219.07 ? 102 LYS A CE    1 
ATOM 837  N NZ    . LYS A 1 102 ? 48.485 -0.397  20.838  1.00 208.09 ? 102 LYS A NZ    1 
ATOM 838  N N     . LYS A 1 103 ? 45.167 0.437   16.407  1.00 212.43 ? 103 LYS A N     1 
ATOM 839  C CA    . LYS A 1 103 ? 44.898 -0.960  16.084  1.00 208.84 ? 103 LYS A CA    1 
ATOM 840  C C     . LYS A 1 103 ? 45.180 -1.253  14.617  1.00 209.29 ? 103 LYS A C     1 
ATOM 841  O O     . LYS A 1 103 ? 45.786 -2.278  14.291  1.00 211.38 ? 103 LYS A O     1 
ATOM 842  C CB    . LYS A 1 103 ? 43.456 -1.315  16.443  1.00 214.30 ? 103 LYS A CB    1 
ATOM 843  C CG    . LYS A 1 103 ? 43.155 -1.215  17.931  1.00 243.25 ? 103 LYS A CG    1 
ATOM 844  C CD    . LYS A 1 103 ? 44.140 -2.042  18.746  1.00 251.09 ? 103 LYS A CD    1 
ATOM 845  C CE    . LYS A 1 103 ? 43.931 -1.847  20.240  1.00 253.82 ? 103 LYS A CE    1 
ATOM 846  N NZ    . LYS A 1 103 ? 44.936 -2.598  21.043  1.00 249.53 ? 103 LYS A NZ    1 
ATOM 847  N N     . GLN A 1 104 ? 44.765 -0.356  13.720  1.00 177.38 ? 104 GLN A N     1 
ATOM 848  C CA    . GLN A 1 104 ? 45.049 -0.539  12.299  1.00 175.74 ? 104 GLN A CA    1 
ATOM 849  C C     . GLN A 1 104 ? 46.550 -0.511  12.035  1.00 175.29 ? 104 GLN A C     1 
ATOM 850  O O     . GLN A 1 104 ? 47.066 -1.295  11.224  1.00 172.57 ? 104 GLN A O     1 
ATOM 851  C CB    . GLN A 1 104 ? 44.334 0.549   11.498  1.00 193.58 ? 104 GLN A CB    1 
ATOM 852  C CG    . GLN A 1 104 ? 44.400 0.420   9.992   1.00 205.80 ? 104 GLN A CG    1 
ATOM 853  C CD    . GLN A 1 104 ? 43.655 1.546   9.299   1.00 218.94 ? 104 GLN A CD    1 
ATOM 854  O OE1   . GLN A 1 104 ? 43.213 2.501   9.942   1.00 196.97 ? 104 GLN A OE1   1 
ATOM 855  N NE2   . GLN A 1 104 ? 43.503 1.437   7.983   1.00 218.90 ? 104 GLN A NE2   1 
ATOM 856  N N     . SER A 1 105 ? 47.268 0.376   12.729  1.00 192.61 ? 105 SER A N     1 
ATOM 857  C CA    . SER A 1 105 ? 48.717 0.458   12.578  1.00 178.54 ? 105 SER A CA    1 
ATOM 858  C C     . SER A 1 105 ? 49.380 -0.852  12.971  1.00 177.13 ? 105 SER A C     1 
ATOM 859  O O     . SER A 1 105 ? 50.142 -1.435  12.190  1.00 215.10 ? 105 SER A O     1 
ATOM 860  C CB    . SER A 1 105 ? 49.274 1.615   13.410  1.00 182.54 ? 105 SER A CB    1 
ATOM 861  O OG    . SER A 1 105 ? 50.663 1.787   13.188  1.00 183.58 ? 105 SER A OG    1 
ATOM 862  N N     . ILE A 1 106 ? 49.107 -1.325  14.190  1.00 173.89 ? 106 ILE A N     1 
ATOM 863  C CA    . ILE A 1 106 ? 49.750 -2.546  14.659  1.00 171.08 ? 106 ILE A CA    1 
ATOM 864  C C     . ILE A 1 106 ? 49.295 -3.747  13.840  1.00 167.33 ? 106 ILE A C     1 
ATOM 865  O O     . ILE A 1 106 ? 50.056 -4.701  13.663  1.00 165.26 ? 106 ILE A O     1 
ATOM 866  C CB    . ILE A 1 106 ? 49.498 -2.745  16.167  1.00 171.52 ? 106 ILE A CB    1 
ATOM 867  C CG1   . ILE A 1 106 ? 48.036 -3.100  16.438  1.00 201.24 ? 106 ILE A CG1   1 
ATOM 868  C CG2   . ILE A 1 106 ? 49.898 -1.500  16.944  1.00 175.34 ? 106 ILE A CG2   1 
ATOM 869  C CD1   . ILE A 1 106 ? 47.706 -3.248  17.909  1.00 217.10 ? 106 ILE A CD1   1 
ATOM 870  N N     . ASP A 1 107 ? 48.082 -3.710  13.282  1.00 167.10 ? 107 ASP A N     1 
ATOM 871  C CA    . ASP A 1 107 ? 47.619 -4.816  12.451  1.00 170.79 ? 107 ASP A CA    1 
ATOM 872  C C     . ASP A 1 107 ? 48.403 -4.891  11.146  1.00 162.56 ? 107 ASP A C     1 
ATOM 873  O O     . ASP A 1 107 ? 48.924 -5.955  10.783  1.00 179.28 ? 107 ASP A O     1 
ATOM 874  C CB    . ASP A 1 107 ? 46.122 -4.668  12.171  1.00 192.46 ? 107 ASP A CB    1 
ATOM 875  C CG    . ASP A 1 107 ? 45.537 -5.873  11.455  1.00 210.54 ? 107 ASP A CG    1 
ATOM 876  O OD1   . ASP A 1 107 ? 46.232 -6.906  11.342  1.00 219.29 ? 107 ASP A OD1   1 
ATOM 877  O OD2   . ASP A 1 107 ? 44.377 -5.785  11.000  1.00 224.59 ? 107 ASP A OD2   1 
ATOM 878  N N     . VAL A 1 108 ? 48.483 -3.774  10.417  1.00 165.27 ? 108 VAL A N     1 
ATOM 879  C CA    . VAL A 1 108 ? 49.229 -3.778  9.161   1.00 165.21 ? 108 VAL A CA    1 
ATOM 880  C C     . VAL A 1 108 ? 50.701 -4.079  9.422   1.00 165.38 ? 108 VAL A C     1 
ATOM 881  O O     . VAL A 1 108 ? 51.350 -4.794  8.649   1.00 211.30 ? 108 VAL A O     1 
ATOM 882  C CB    . VAL A 1 108 ? 49.026 -2.449  8.407   1.00 168.95 ? 108 VAL A CB    1 
ATOM 883  C CG1   . VAL A 1 108 ? 50.348 -1.738  8.161   1.00 181.15 ? 108 VAL A CG1   1 
ATOM 884  C CG2   . VAL A 1 108 ? 48.303 -2.697  7.091   1.00 167.84 ? 108 VAL A CG2   1 
ATOM 885  N N     . PHE A 1 109 ? 51.235 -3.580  10.539  1.00 167.46 ? 109 PHE A N     1 
ATOM 886  C CA    . PHE A 1 109 ? 52.606 -3.887  10.929  1.00 168.07 ? 109 PHE A CA    1 
ATOM 887  C C     . PHE A 1 109 ? 52.795 -5.389  11.106  1.00 164.59 ? 109 PHE A C     1 
ATOM 888  O O     . PHE A 1 109 ? 53.689 -5.993  10.503  1.00 164.04 ? 109 PHE A O     1 
ATOM 889  C CB    . PHE A 1 109 ? 52.957 -3.129  12.210  1.00 170.84 ? 109 PHE A CB    1 
ATOM 890  C CG    . PHE A 1 109 ? 54.320 -3.441  12.754  1.00 171.90 ? 109 PHE A CG    1 
ATOM 891  C CD1   . PHE A 1 109 ? 55.439 -2.786  12.267  1.00 180.69 ? 109 PHE A CD1   1 
ATOM 892  C CD2   . PHE A 1 109 ? 54.482 -4.374  13.766  1.00 170.35 ? 109 PHE A CD2   1 
ATOM 893  C CE1   . PHE A 1 109 ? 56.697 -3.060  12.772  1.00 176.54 ? 109 PHE A CE1   1 
ATOM 894  C CE2   . PHE A 1 109 ? 55.737 -4.656  14.273  1.00 178.08 ? 109 PHE A CE2   1 
ATOM 895  C CZ    . PHE A 1 109 ? 56.846 -3.998  13.776  1.00 183.24 ? 109 PHE A CZ    1 
ATOM 896  N N     . ILE A 1 110 ? 51.990 -5.996  11.982  1.00 177.61 ? 110 ILE A N     1 
ATOM 897  C CA    . ILE A 1 110 ? 52.106 -7.421  12.279  1.00 167.59 ? 110 ILE A CA    1 
ATOM 898  C C     . ILE A 1 110 ? 51.977 -8.251  11.010  1.00 161.84 ? 110 ILE A C     1 
ATOM 899  O O     . ILE A 1 110 ? 52.711 -9.228  10.813  1.00 166.24 ? 110 ILE A O     1 
ATOM 900  C CB    . ILE A 1 110 ? 51.050 -7.820  13.329  1.00 158.94 ? 110 ILE A CB    1 
ATOM 901  C CG1   . ILE A 1 110 ? 51.522 -7.450  14.737  1.00 161.31 ? 110 ILE A CG1   1 
ATOM 902  C CG2   . ILE A 1 110 ? 50.706 -9.299  13.228  1.00 173.18 ? 110 ILE A CG2   1 
ATOM 903  C CD1   . ILE A 1 110 ? 50.496 -7.723  15.817  1.00 161.09 ? 110 ILE A CD1   1 
ATOM 904  N N     . GLN A 1 111 ? 51.057 -7.875  10.121  1.00 166.79 ? 111 GLN A N     1 
ATOM 905  C CA    . GLN A 1 111 ? 50.838 -8.698  8.939   1.00 177.58 ? 111 GLN A CA    1 
ATOM 906  C C     . GLN A 1 111 ? 51.859 -8.451  7.835   1.00 181.85 ? 111 GLN A C     1 
ATOM 907  O O     . GLN A 1 111 ? 52.020 -9.313  6.965   1.00 196.94 ? 111 GLN A O     1 
ATOM 908  C CB    . GLN A 1 111 ? 49.425 -8.483  8.393   1.00 189.32 ? 111 GLN A CB    1 
ATOM 909  C CG    . GLN A 1 111 ? 49.220 -7.174  7.660   1.00 207.71 ? 111 GLN A CG    1 
ATOM 910  C CD    . GLN A 1 111 ? 47.794 -7.005  7.180   1.00 221.32 ? 111 GLN A CD    1 
ATOM 911  O OE1   . GLN A 1 111 ? 46.915 -7.796  7.521   1.00 207.96 ? 111 GLN A OE1   1 
ATOM 912  N NE2   . GLN A 1 111 ? 47.556 -5.970  6.382   1.00 238.67 ? 111 GLN A NE2   1 
ATOM 913  N N     . LYS A 1 112 ? 52.561 -7.316  7.847   1.00 202.63 ? 112 LYS A N     1 
ATOM 914  C CA    . LYS A 1 112 ? 53.491 -6.993  6.774   1.00 160.38 ? 112 LYS A CA    1 
ATOM 915  C C     . LYS A 1 112 ? 54.955 -7.062  7.181   1.00 162.59 ? 112 LYS A C     1 
ATOM 916  O O     . LYS A 1 112 ? 55.821 -6.857  6.327   1.00 196.25 ? 112 LYS A O     1 
ATOM 917  C CB    . LYS A 1 112 ? 53.190 -5.593  6.226   1.00 168.87 ? 112 LYS A CB    1 
ATOM 918  C CG    . LYS A 1 112 ? 51.982 -5.526  5.309   1.00 201.84 ? 112 LYS A CG    1 
ATOM 919  C CD    . LYS A 1 112 ? 51.808 -4.130  4.732   1.00 199.77 ? 112 LYS A CD    1 
ATOM 920  C CE    . LYS A 1 112 ? 53.050 -3.675  3.983   1.00 184.97 ? 112 LYS A CE    1 
ATOM 921  N NZ    . LYS A 1 112 ? 53.346 -4.536  2.805   1.00 180.98 ? 112 LYS A NZ    1 
ATOM 922  N N     . ILE A 1 113 ? 55.263 -7.353  8.447   1.00 120.85 ? 113 ILE A N     1 
ATOM 923  C CA    . ILE A 1 113 ? 56.671 -7.419  8.845   1.00 126.56 ? 113 ILE A CA    1 
ATOM 924  C C     . ILE A 1 113 ? 57.353 -8.664  8.299   1.00 127.02 ? 113 ILE A C     1 
ATOM 925  O O     . ILE A 1 113 ? 58.558 -8.640  8.021   1.00 128.11 ? 113 ILE A O     1 
ATOM 926  C CB    . ILE A 1 113 ? 56.831 -7.301  10.375  1.00 114.83 ? 113 ILE A CB    1 
ATOM 927  C CG1   . ILE A 1 113 ? 55.760 -8.100  11.129  1.00 168.76 ? 113 ILE A CG1   1 
ATOM 928  C CG2   . ILE A 1 113 ? 56.869 -5.845  10.793  1.00 135.06 ? 113 ILE A CG2   1 
ATOM 929  C CD1   . ILE A 1 113 ? 55.966 -9.571  11.173  1.00 205.38 ? 113 ILE A CD1   1 
ATOM 930  N N     . SER A 1 114 ? 56.613 -9.763  8.127   1.00 168.77 ? 114 SER A N     1 
ATOM 931  C CA    . SER A 1 114 ? 57.247 -11.039 7.814   1.00 154.86 ? 114 SER A CA    1 
ATOM 932  C C     . SER A 1 114 ? 58.012 -10.960 6.503   1.00 158.80 ? 114 SER A C     1 
ATOM 933  O O     . SER A 1 114 ? 59.028 -11.642 6.331   1.00 167.31 ? 114 SER A O     1 
ATOM 934  C CB    . SER A 1 114 ? 56.197 -12.146 7.756   1.00 164.88 ? 114 SER A CB    1 
ATOM 935  O OG    . SER A 1 114 ? 55.389 -12.133 8.919   1.00 172.29 ? 114 SER A OG    1 
ATOM 936  N N     . GLU A 1 115 ? 57.548 -10.125 5.577   1.00 164.87 ? 115 GLU A N     1 
ATOM 937  C CA    . GLU A 1 115 ? 58.154 -9.996  4.263   1.00 144.21 ? 115 GLU A CA    1 
ATOM 938  C C     . GLU A 1 115 ? 59.414 -9.144  4.287   1.00 125.50 ? 115 GLU A C     1 
ATOM 939  O O     . GLU A 1 115 ? 60.009 -8.920  3.228   1.00 127.32 ? 115 GLU A O     1 
ATOM 940  C CB    . GLU A 1 115 ? 57.145 -9.371  3.297   1.00 165.88 ? 115 GLU A CB    1 
ATOM 941  C CG    . GLU A 1 115 ? 55.740 -9.940  3.411   1.00 190.24 ? 115 GLU A CG    1 
ATOM 942  C CD    . GLU A 1 115 ? 54.704 -9.069  2.728   1.00 168.09 ? 115 GLU A CD    1 
ATOM 943  O OE1   . GLU A 1 115 ? 55.049 -7.938  2.325   1.00 152.86 ? 115 GLU A OE1   1 
ATOM 944  O OE2   . GLU A 1 115 ? 53.543 -9.512  2.600   1.00 177.81 ? 115 GLU A OE2   1 
ATOM 945  N N     . TYR A 1 116 ? 59.821 -8.652  5.461   1.00 129.07 ? 116 TYR A N     1 
ATOM 946  C CA    . TYR A 1 116 ? 60.914 -7.690  5.553   1.00 122.38 ? 116 TYR A CA    1 
ATOM 947  C C     . TYR A 1 116 ? 62.034 -8.102  6.505   1.00 131.96 ? 116 TYR A C     1 
ATOM 948  O O     . TYR A 1 116 ? 63.190 -7.722  6.295   1.00 131.77 ? 116 TYR A O     1 
ATOM 949  C CB    . TYR A 1 116 ? 60.377 -6.317  5.977   1.00 105.29 ? 116 TYR A CB    1 
ATOM 950  C CG    . TYR A 1 116 ? 59.475 -5.647  4.962   1.00 110.06 ? 116 TYR A CG    1 
ATOM 951  C CD1   . TYR A 1 116 ? 58.221 -6.160  4.660   1.00 117.88 ? 116 TYR A CD1   1 
ATOM 952  C CD2   . TYR A 1 116 ? 59.880 -4.487  4.313   1.00 104.41 ? 116 TYR A CD2   1 
ATOM 953  C CE1   . TYR A 1 116 ? 57.400 -5.547  3.732   1.00 140.02 ? 116 TYR A CE1   1 
ATOM 954  C CE2   . TYR A 1 116 ? 59.066 -3.866  3.386   1.00 130.32 ? 116 TYR A CE2   1 
ATOM 955  C CZ    . TYR A 1 116 ? 57.827 -4.399  3.099   1.00 131.38 ? 116 TYR A CZ    1 
ATOM 956  O OH    . TYR A 1 116 ? 57.014 -3.780  2.175   1.00 114.40 ? 116 TYR A OH    1 
ATOM 957  N N     . THR A 1 117 ? 61.719 -8.858  7.555   1.00 114.68 ? 117 THR A N     1 
ATOM 958  C CA    . THR A 1 117 ? 62.712 -9.098  8.598   1.00 118.96 ? 117 THR A CA    1 
ATOM 959  C C     . THR A 1 117 ? 63.144 -10.548 8.755   1.00 137.48 ? 117 THR A C     1 
ATOM 960  O O     . THR A 1 117 ? 64.313 -10.798 9.064   1.00 164.10 ? 117 THR A O     1 
ATOM 961  C CB    . THR A 1 117 ? 62.193 -8.589  9.952   1.00 125.86 ? 117 THR A CB    1 
ATOM 962  O OG1   . THR A 1 117 ? 63.059 -9.046  10.998  1.00 142.20 ? 117 THR A OG1   1 
ATOM 963  C CG2   . THR A 1 117 ? 60.787 -9.095  10.216  1.00 171.97 ? 117 THR A CG2   1 
ATOM 964  N N     . ASP A 1 118 ? 62.237 -11.510 8.582   1.00 126.53 ? 118 ASP A N     1 
ATOM 965  C CA    . ASP A 1 118 ? 62.476 -12.926 8.863   1.00 146.32 ? 118 ASP A CA    1 
ATOM 966  C C     . ASP A 1 118 ? 62.754 -13.187 10.341  1.00 132.43 ? 118 ASP A C     1 
ATOM 967  O O     . ASP A 1 118 ? 63.116 -14.311 10.711  1.00 128.67 ? 118 ASP A O     1 
ATOM 968  C CB    . ASP A 1 118 ? 63.614 -13.510 8.011   1.00 150.36 ? 118 ASP A CB    1 
ATOM 969  C CG    . ASP A 1 118 ? 63.396 -13.305 6.526   1.00 212.94 ? 118 ASP A CG    1 
ATOM 970  O OD1   . ASP A 1 118 ? 62.230 -13.133 6.113   1.00 236.42 ? 118 ASP A OD1   1 
ATOM 971  O OD2   . ASP A 1 118 ? 64.391 -13.328 5.770   1.00 231.37 ? 118 ASP A OD2   1 
ATOM 972  N N     . TYR A 1 119 ? 62.605 -12.173 11.189  1.00 135.12 ? 119 TYR A N     1 
ATOM 973  C CA    . TYR A 1 119 ? 62.715 -12.278 12.641  1.00 114.55 ? 119 TYR A CA    1 
ATOM 974  C C     . TYR A 1 119 ? 61.462 -11.702 13.281  1.00 150.98 ? 119 TYR A C     1 
ATOM 975  O O     . TYR A 1 119 ? 61.515 -10.893 14.210  1.00 109.89 ? 119 TYR A O     1 
ATOM 976  C CB    . TYR A 1 119 ? 63.950 -11.560 13.179  1.00 116.28 ? 119 TYR A CB    1 
ATOM 977  C CG    . TYR A 1 119 ? 65.272 -12.058 12.639  1.00 111.79 ? 119 TYR A CG    1 
ATOM 978  C CD1   . TYR A 1 119 ? 65.728 -13.333 12.929  1.00 117.20 ? 119 TYR A CD1   1 
ATOM 979  C CD2   . TYR A 1 119 ? 66.073 -11.239 11.855  1.00 108.37 ? 119 TYR A CD2   1 
ATOM 980  C CE1   . TYR A 1 119 ? 66.941 -13.785 12.440  1.00 119.11 ? 119 TYR A CE1   1 
ATOM 981  C CE2   . TYR A 1 119 ? 67.286 -11.680 11.364  1.00 149.08 ? 119 TYR A CE2   1 
ATOM 982  C CZ    . TYR A 1 119 ? 67.717 -12.954 11.659  1.00 115.60 ? 119 TYR A CZ    1 
ATOM 983  O OH    . TYR A 1 119 ? 68.926 -13.398 11.168  1.00 118.08 ? 119 TYR A OH    1 
ATOM 984  N N     . LYS A 1 120 ? 60.306 -12.106 12.747  1.00 159.94 ? 120 LYS A N     1 
ATOM 985  C CA    . LYS A 1 120 ? 59.024 -11.589 13.217  1.00 144.45 ? 120 LYS A CA    1 
ATOM 986  C C     . LYS A 1 120 ? 58.838 -11.818 14.713  1.00 168.67 ? 120 LYS A C     1 
ATOM 987  O O     . LYS A 1 120 ? 58.300 -10.957 15.419  1.00 140.67 ? 120 LYS A O     1 
ATOM 988  C CB    . LYS A 1 120 ? 57.895 -12.249 12.423  1.00 152.47 ? 120 LYS A CB    1 
ATOM 989  C CG    . LYS A 1 120 ? 56.559 -12.346 13.146  1.00 193.31 ? 120 LYS A CG    1 
ATOM 990  C CD    . LYS A 1 120 ? 55.501 -12.963 12.239  1.00 216.18 ? 120 LYS A CD    1 
ATOM 991  C CE    . LYS A 1 120 ? 54.094 -12.597 12.688  1.00 228.43 ? 120 LYS A CE    1 
ATOM 992  N NZ    . LYS A 1 120 ? 53.058 -13.088 11.735  1.00 229.10 ? 120 LYS A NZ    1 
ATOM 993  N N     . ASN A 1 121 ? 59.300 -12.962 15.218  1.00 184.66 ? 121 ASN A N     1 
ATOM 994  C CA    . ASN A 1 121 ? 59.018 -13.338 16.598  1.00 172.18 ? 121 ASN A CA    1 
ATOM 995  C C     . ASN A 1 121 ? 59.853 -12.540 17.592  1.00 165.00 ? 121 ASN A C     1 
ATOM 996  O O     . ASN A 1 121 ? 59.364 -12.186 18.670  1.00 193.21 ? 121 ASN A O     1 
ATOM 997  C CB    . ASN A 1 121 ? 59.248 -14.837 16.777  1.00 179.62 ? 121 ASN A CB    1 
ATOM 998  C CG    . ASN A 1 121 ? 58.450 -15.666 15.789  1.00 188.91 ? 121 ASN A CG    1 
ATOM 999  O OD1   . ASN A 1 121 ? 57.328 -15.310 15.427  1.00 177.12 ? 121 ASN A OD1   1 
ATOM 1000 N ND2   . ASN A 1 121 ? 59.029 -16.773 15.341  1.00 219.23 ? 121 ASN A ND2   1 
ATOM 1001 N N     . ASP A 1 122 ? 61.110 -12.248 17.252  1.00 126.09 ? 122 ASP A N     1 
ATOM 1002 C CA    . ASP A 1 122 ? 61.962 -11.482 18.156  1.00 132.04 ? 122 ASP A CA    1 
ATOM 1003 C C     . ASP A 1 122 ? 61.396 -10.094 18.423  1.00 136.06 ? 122 ASP A C     1 
ATOM 1004 O O     . ASP A 1 122 ? 61.606 -9.533  19.505  1.00 156.37 ? 122 ASP A O     1 
ATOM 1005 C CB    . ASP A 1 122 ? 63.376 -11.374 17.586  1.00 154.80 ? 122 ASP A CB    1 
ATOM 1006 C CG    . ASP A 1 122 ? 64.022 -12.727 17.366  1.00 184.92 ? 122 ASP A CG    1 
ATOM 1007 O OD1   . ASP A 1 122 ? 63.602 -13.704 18.022  1.00 197.21 ? 122 ASP A OD1   1 
ATOM 1008 O OD2   . ASP A 1 122 ? 64.954 -12.813 16.538  1.00 179.49 ? 122 ASP A OD2   1 
ATOM 1009 N N     . ILE A 1 123 ? 60.663 -9.534  17.461  1.00 163.18 ? 123 ILE A N     1 
ATOM 1010 C CA    . ILE A 1 123 ? 60.094 -8.203  17.635  1.00 149.13 ? 123 ILE A CA    1 
ATOM 1011 C C     . ILE A 1 123 ? 58.822 -8.259  18.469  1.00 177.73 ? 123 ILE A C     1 
ATOM 1012 O O     . ILE A 1 123 ? 58.541 -7.336  19.241  1.00 216.00 ? 123 ILE A O     1 
ATOM 1013 C CB    . ILE A 1 123 ? 59.838 -7.561  16.260  1.00 113.80 ? 123 ILE A CB    1 
ATOM 1014 C CG1   . ILE A 1 123 ? 61.118 -7.566  15.425  1.00 105.29 ? 123 ILE A CG1   1 
ATOM 1015 C CG2   . ILE A 1 123 ? 59.309 -6.148  16.413  1.00 125.93 ? 123 ILE A CG2   1 
ATOM 1016 C CD1   . ILE A 1 123 ? 60.920 -7.091  14.008  1.00 103.48 ? 123 ILE A CD1   1 
ATOM 1017 N N     . LEU A 1 124 ? 58.033 -9.324  18.332  1.00 150.08 ? 124 LEU A N     1 
ATOM 1018 C CA    . LEU A 1 124 ? 56.820 -9.441  19.133  1.00 147.44 ? 124 LEU A CA    1 
ATOM 1019 C C     . LEU A 1 124 ? 57.139 -9.683  20.603  1.00 160.50 ? 124 LEU A C     1 
ATOM 1020 O O     . LEU A 1 124 ? 56.394 -9.227  21.478  1.00 196.36 ? 124 LEU A O     1 
ATOM 1021 C CB    . LEU A 1 124 ? 55.925 -10.555 18.584  1.00 168.52 ? 124 LEU A CB    1 
ATOM 1022 C CG    . LEU A 1 124 ? 55.007 -10.280 17.384  1.00 146.90 ? 124 LEU A CG    1 
ATOM 1023 C CD1   . LEU A 1 124 ? 55.655 -9.420  16.308  1.00 119.52 ? 124 LEU A CD1   1 
ATOM 1024 C CD2   . LEU A 1 124 ? 54.514 -11.592 16.789  1.00 169.03 ? 124 LEU A CD2   1 
ATOM 1025 N N     . ASN A 1 125 ? 58.240 -10.378 20.897  1.00 151.65 ? 125 ASN A N     1 
ATOM 1026 C CA    . ASN A 1 125 ? 58.581 -10.687 22.283  1.00 165.23 ? 125 ASN A CA    1 
ATOM 1027 C C     . ASN A 1 125 ? 59.186 -9.476  22.987  1.00 176.18 ? 125 ASN A C     1 
ATOM 1028 O O     . ASN A 1 125 ? 58.630 -8.971  23.968  1.00 189.19 ? 125 ASN A O     1 
ATOM 1029 C CB    . ASN A 1 125 ? 59.548 -11.873 22.333  1.00 167.72 ? 125 ASN A CB    1 
ATOM 1030 C CG    . ASN A 1 125 ? 58.995 -13.106 21.648  1.00 182.73 ? 125 ASN A CG    1 
ATOM 1031 O OD1   . ASN A 1 125 ? 57.795 -13.374 21.698  1.00 191.31 ? 125 ASN A OD1   1 
ATOM 1032 N ND2   . ASN A 1 125 ? 59.872 -13.865 21.000  1.00 183.70 ? 125 ASN A ND2   1 
ATOM 1033 N N     . LYS A 1 126 ? 60.329 -9.002  22.500  1.00 163.59 ? 126 LYS A N     1 
ATOM 1034 C CA    . LYS A 1 126 ? 60.933 -7.797  23.049  1.00 172.73 ? 126 LYS A CA    1 
ATOM 1035 C C     . LYS A 1 126 ? 60.067 -6.592  22.709  1.00 197.93 ? 126 LYS A C     1 
ATOM 1036 O O     . LYS A 1 126 ? 59.529 -6.497  21.604  1.00 224.77 ? 126 LYS A O     1 
ATOM 1037 C CB    . LYS A 1 126 ? 62.342 -7.614  22.485  1.00 178.37 ? 126 LYS A CB    1 
ATOM 1038 C CG    . LYS A 1 126 ? 63.155 -6.505  23.131  1.00 169.73 ? 126 LYS A CG    1 
ATOM 1039 C CD    . LYS A 1 126 ? 64.438 -6.255  22.351  1.00 161.19 ? 126 LYS A CD    1 
ATOM 1040 C CE    . LYS A 1 126 ? 65.412 -5.391  23.134  1.00 168.88 ? 126 LYS A CE    1 
ATOM 1041 N NZ    . LYS A 1 126 ? 65.979 -6.115  24.308  1.00 161.05 ? 126 LYS A NZ    1 
ATOM 1042 N N     . TYR A 1 127 ? 59.921 -5.670  23.665  1.00 204.68 ? 127 TYR A N     1 
ATOM 1043 C CA    . TYR A 1 127 ? 59.099 -4.440  23.458  1.00 209.70 ? 127 TYR A CA    1 
ATOM 1044 C C     . TYR A 1 127 ? 57.673 -4.815  23.029  1.00 191.39 ? 127 TYR A C     1 
ATOM 1045 O O     . TYR A 1 127 ? 57.269 -4.489  21.897  1.00 196.43 ? 127 TYR A O     1 
ATOM 1046 C CB    . TYR A 1 127 ? 59.812 -3.303  22.708  1.00 202.26 ? 127 TYR A CB    1 
ATOM 1047 C CG    . TYR A 1 127 ? 60.502 -3.630  21.406  1.00 181.08 ? 127 TYR A CG    1 
ATOM 1048 C CD1   . TYR A 1 127 ? 59.782 -3.842  20.243  1.00 186.72 ? 127 TYR A CD1   1 
ATOM 1049 C CD2   . TYR A 1 127 ? 61.882 -3.719  21.339  1.00 184.97 ? 127 TYR A CD2   1 
ATOM 1050 C CE1   . TYR A 1 127 ? 60.415 -4.140  19.048  1.00 189.82 ? 127 TYR A CE1   1 
ATOM 1051 C CE2   . TYR A 1 127 ? 62.531 -4.015  20.153  1.00 186.59 ? 127 TYR A CE2   1 
ATOM 1052 C CZ    . TYR A 1 127 ? 61.794 -4.227  19.003  1.00 198.10 ? 127 TYR A CZ    1 
ATOM 1053 O OH    . TYR A 1 127 ? 62.429 -4.519  17.831  1.00 228.02 ? 127 TYR A OH    1 
ATOM 1054 N N     . THR A 1 128 ? 56.928 -5.453  23.937  1.00 176.46 ? 128 THR A N     1 
ATOM 1055 C CA    . THR A 1 128 ? 55.565 -5.969  23.639  1.00 179.30 ? 128 THR A CA    1 
ATOM 1056 C C     . THR A 1 128 ? 54.652 -4.846  23.133  1.00 193.00 ? 128 THR A C     1 
ATOM 1057 O O     . THR A 1 128 ? 53.868 -5.129  22.207  1.00 238.86 ? 128 THR A O     1 
ATOM 1058 C CB    . THR A 1 128 ? 54.951 -6.641  24.873  1.00 188.27 ? 128 THR A CB    1 
ATOM 1059 O OG1   . THR A 1 128 ? 53.534 -6.652  24.702  1.00 207.95 ? 128 THR A OG1   1 
ATOM 1060 C CG2   . THR A 1 128 ? 55.304 -5.934  26.162  1.00 179.26 ? 128 THR A CG2   1 
ATOM 1061 N N     . LYS A 1 129 ? 54.719 -3.637  23.700  1.00 165.39 ? 129 LYS A N     1 
ATOM 1062 C CA    . LYS A 1 129 ? 53.845 -2.569  23.143  1.00 149.30 ? 129 LYS A CA    1 
ATOM 1063 C C     . LYS A 1 129 ? 54.283 -2.368  21.689  1.00 133.02 ? 129 LYS A C     1 
ATOM 1064 O O     . LYS A 1 129 ? 55.473 -2.086  21.472  1.00 116.95 ? 129 LYS A O     1 
ATOM 1065 C CB    . LYS A 1 129 ? 53.989 -1.277  23.952  1.00 159.95 ? 129 LYS A CB    1 
ATOM 1066 C CG    . LYS A 1 129 ? 53.246 -0.073  23.389  1.00 148.35 ? 129 LYS A CG    1 
ATOM 1067 C CD    . LYS A 1 129 ? 51.745 -0.162  23.556  1.00 191.89 ? 129 LYS A CD    1 
ATOM 1068 C CE    . LYS A 1 129 ? 51.145 1.068   24.203  1.00 206.03 ? 129 LYS A CE    1 
ATOM 1069 N NZ    . LYS A 1 129 ? 49.677 0.945   24.362  1.00 178.67 ? 129 LYS A NZ    1 
ATOM 1070 N N     . LEU A 1 130 ? 53.364 -2.444  20.727  1.00 146.66 ? 130 LEU A N     1 
ATOM 1071 C CA    . LEU A 1 130 ? 53.750 -2.369  19.320  1.00 142.46 ? 130 LEU A CA    1 
ATOM 1072 C C     . LEU A 1 130 ? 53.295 -1.097  18.611  1.00 174.43 ? 130 LEU A C     1 
ATOM 1073 O O     . LEU A 1 130 ? 53.463 -1.002  17.392  1.00 170.89 ? 130 LEU A O     1 
ATOM 1074 C CB    . LEU A 1 130 ? 53.228 -3.588  18.554  1.00 142.17 ? 130 LEU A CB    1 
ATOM 1075 C CG    . LEU A 1 130 ? 53.648 -4.980  19.025  1.00 164.93 ? 130 LEU A CG    1 
ATOM 1076 C CD1   . LEU A 1 130 ? 52.962 -6.053  18.192  1.00 165.63 ? 130 LEU A CD1   1 
ATOM 1077 C CD2   . LEU A 1 130 ? 55.159 -5.132  18.953  1.00 142.11 ? 130 LEU A CD2   1 
ATOM 1078 N N     . ASP A 1 131 ? 52.733 -0.116  19.317  1.00 190.20 ? 131 ASP A N     1 
ATOM 1079 C CA    . ASP A 1 131 ? 52.042 0.972   18.635  1.00 165.71 ? 131 ASP A CA    1 
ATOM 1080 C C     . ASP A 1 131 ? 52.932 2.180   18.367  1.00 147.27 ? 131 ASP A C     1 
ATOM 1081 O O     . ASP A 1 131 ? 52.417 3.251   18.031  1.00 184.24 ? 131 ASP A O     1 
ATOM 1082 C CB    . ASP A 1 131 ? 50.826 1.417   19.450  1.00 184.81 ? 131 ASP A CB    1 
ATOM 1083 C CG    . ASP A 1 131 ? 51.208 2.027   20.790  1.00 204.12 ? 131 ASP A CG    1 
ATOM 1084 O OD1   . ASP A 1 131 ? 52.396 1.961   21.172  1.00 205.23 ? 131 ASP A OD1   1 
ATOM 1085 O OD2   . ASP A 1 131 ? 50.316 2.583   21.462  1.00 229.55 ? 131 ASP A OD2   1 
ATOM 1086 N N     . ASP A 1 132 ? 54.246 2.030   18.488  1.00 140.92 ? 132 ASP A N     1 
ATOM 1087 C CA    . ASP A 1 132 ? 55.209 3.043   18.076  1.00 133.21 ? 132 ASP A CA    1 
ATOM 1088 C C     . ASP A 1 132 ? 56.101 2.546   16.953  1.00 127.15 ? 132 ASP A C     1 
ATOM 1089 O O     . ASP A 1 132 ? 56.288 3.249   15.949  1.00 156.68 ? 132 ASP A O     1 
ATOM 1090 C CB    . ASP A 1 132 ? 56.052 3.507   19.275  1.00 146.28 ? 132 ASP A CB    1 
ATOM 1091 C CG    . ASP A 1 132 ? 56.494 2.362   20.156  1.00 162.67 ? 132 ASP A CG    1 
ATOM 1092 O OD1   . ASP A 1 132 ? 56.179 1.199   19.828  1.00 167.27 ? 132 ASP A OD1   1 
ATOM 1093 O OD2   . ASP A 1 132 ? 57.148 2.631   21.183  1.00 171.91 ? 132 ASP A OD2   1 
ATOM 1094 N N     . ILE A 1 133 ? 56.674 1.351   17.111  1.00 118.73 ? 133 ILE A N     1 
ATOM 1095 C CA    . ILE A 1 133 ? 57.449 0.750   16.033  1.00 139.45 ? 133 ILE A CA    1 
ATOM 1096 C C     . ILE A 1 133 ? 56.562 0.536   14.815  1.00 110.35 ? 133 ILE A C     1 
ATOM 1097 O O     . ILE A 1 133 ? 57.022 0.653   13.673  1.00 100.42 ? 133 ILE A O     1 
ATOM 1098 C CB    . ILE A 1 133 ? 58.104 -0.563  16.508  1.00 122.99 ? 133 ILE A CB    1 
ATOM 1099 C CG1   . ILE A 1 133 ? 57.041 -1.587  16.900  1.00 121.79 ? 133 ILE A CG1   1 
ATOM 1100 C CG2   . ILE A 1 133 ? 59.053 -0.301  17.678  1.00 89.10  ? 133 ILE A CG2   1 
ATOM 1101 C CD1   . ILE A 1 133 ? 57.613 -2.895  17.379  1.00 159.64 ? 133 ILE A CD1   1 
ATOM 1102 N N     . ALA A 1 134 ? 55.277 0.243   15.034  1.00 120.59 ? 134 ALA A N     1 
ATOM 1103 C CA    . ALA A 1 134 ? 54.339 0.154   13.921  1.00 107.17 ? 134 ALA A CA    1 
ATOM 1104 C C     . ALA A 1 134 ? 54.249 1.485   13.192  1.00 107.75 ? 134 ALA A C     1 
ATOM 1105 O O     . ALA A 1 134 ? 54.300 1.534   11.959  1.00 139.38 ? 134 ALA A O     1 
ATOM 1106 C CB    . ALA A 1 134 ? 52.961 -0.279  14.416  1.00 100.77 ? 134 ALA A CB    1 
ATOM 1107 N N     . ASN A 1 135 ? 54.110 2.578   13.946  1.00 116.21 ? 135 ASN A N     1 
ATOM 1108 C CA    . ASN A 1 135 ? 54.005 3.896   13.330  1.00 132.90 ? 135 ASN A CA    1 
ATOM 1109 C C     . ASN A 1 135 ? 55.254 4.225   12.525  1.00 119.19 ? 135 ASN A C     1 
ATOM 1110 O O     . ASN A 1 135 ? 55.161 4.701   11.389  1.00 170.30 ? 135 ASN A O     1 
ATOM 1111 C CB    . ASN A 1 135 ? 53.758 4.960   14.400  1.00 139.14 ? 135 ASN A CB    1 
ATOM 1112 C CG    . ASN A 1 135 ? 52.361 4.885   14.985  1.00 185.05 ? 135 ASN A CG    1 
ATOM 1113 O OD1   . ASN A 1 135 ? 51.434 4.384   14.349  1.00 198.80 ? 135 ASN A OD1   1 
ATOM 1114 N ND2   . ASN A 1 135 ? 52.203 5.394   16.202  1.00 194.09 ? 135 ASN A ND2   1 
ATOM 1115 N N     . SER A 1 136 ? 56.434 3.970   13.094  1.00 87.93  ? 136 SER A N     1 
ATOM 1116 C CA    . SER A 1 136 ? 57.673 4.288   12.382  1.00 115.59 ? 136 SER A CA    1 
ATOM 1117 C C     . SER A 1 136 ? 57.829 3.437   11.121  1.00 99.61  ? 136 SER A C     1 
ATOM 1118 O O     . SER A 1 136 ? 58.186 3.954   10.051  1.00 114.57 ? 136 SER A O     1 
ATOM 1119 C CB    . SER A 1 136 ? 58.876 4.120   13.313  1.00 104.63 ? 136 SER A CB    1 
ATOM 1120 O OG    . SER A 1 136 ? 59.057 2.772   13.700  1.00 104.08 ? 136 SER A OG    1 
ATOM 1121 N N     . PHE A 1 137 ? 57.565 2.132   11.226  1.00 87.10  ? 137 PHE A N     1 
ATOM 1122 C CA    . PHE A 1 137 ? 57.667 1.251   10.069  1.00 105.94 ? 137 PHE A CA    1 
ATOM 1123 C C     . PHE A 1 137 ? 56.699 1.667   8.971   1.00 108.26 ? 137 PHE A C     1 
ATOM 1124 O O     . PHE A 1 137 ? 57.074 1.733   7.792   1.00 101.74 ? 137 PHE A O     1 
ATOM 1125 C CB    . PHE A 1 137 ? 57.393 -0.188  10.512  1.00 101.91 ? 137 PHE A CB    1 
ATOM 1126 C CG    . PHE A 1 137 ? 57.414 -1.195  9.398   1.00 94.85  ? 137 PHE A CG    1 
ATOM 1127 C CD1   . PHE A 1 137 ? 58.598 -1.789  9.000   1.00 89.51  ? 137 PHE A CD1   1 
ATOM 1128 C CD2   . PHE A 1 137 ? 56.236 -1.571  8.769   1.00 108.44 ? 137 PHE A CD2   1 
ATOM 1129 C CE1   . PHE A 1 137 ? 58.610 -2.728  7.981   1.00 115.73 ? 137 PHE A CE1   1 
ATOM 1130 C CE2   . PHE A 1 137 ? 56.240 -2.506  7.752   1.00 111.07 ? 137 PHE A CE2   1 
ATOM 1131 C CZ    . PHE A 1 137 ? 57.429 -3.086  7.358   1.00 127.09 ? 137 PHE A CZ    1 
ATOM 1132 N N     . ASN A 1 138 ? 55.459 1.989   9.346   1.00 111.26 ? 138 ASN A N     1 
ATOM 1133 C CA    . ASN A 1 138 ? 54.460 2.382   8.362   1.00 124.63 ? 138 ASN A CA    1 
ATOM 1134 C C     . ASN A 1 138 ? 54.811 3.717   7.724   1.00 125.31 ? 138 ASN A C     1 
ATOM 1135 O O     . ASN A 1 138 ? 54.623 3.901   6.519   1.00 139.89 ? 138 ASN A O     1 
ATOM 1136 C CB    . ASN A 1 138 ? 53.085 2.430   9.020   1.00 127.41 ? 138 ASN A CB    1 
ATOM 1137 C CG    . ASN A 1 138 ? 52.611 1.061   9.458   1.00 134.72 ? 138 ASN A CG    1 
ATOM 1138 O OD1   . ASN A 1 138 ? 52.916 0.056   8.819   1.00 113.62 ? 138 ASN A OD1   1 
ATOM 1139 N ND2   . ASN A 1 138 ? 51.878 1.012   10.564  1.00 180.52 ? 138 ASN A ND2   1 
ATOM 1140 N N     . LEU A 1 139 ? 55.342 4.650   8.515   1.00 88.81  ? 139 LEU A N     1 
ATOM 1141 C CA    . LEU A 1 139 ? 55.775 5.939   7.986   1.00 124.72 ? 139 LEU A CA    1 
ATOM 1142 C C     . LEU A 1 139 ? 56.865 5.768   6.933   1.00 114.81 ? 139 LEU A C     1 
ATOM 1143 O O     . LEU A 1 139 ? 56.760 6.291   5.811   1.00 106.27 ? 139 LEU A O     1 
ATOM 1144 C CB    . LEU A 1 139 ? 56.272 6.796   9.151   1.00 85.83  ? 139 LEU A CB    1 
ATOM 1145 C CG    . LEU A 1 139 ? 56.554 8.285   9.014   1.00 86.58  ? 139 LEU A CG    1 
ATOM 1146 C CD1   . LEU A 1 139 ? 55.285 9.047   8.676   1.00 110.57 ? 139 LEU A CD1   1 
ATOM 1147 C CD2   . LEU A 1 139 ? 57.145 8.778   10.314  1.00 99.25  ? 139 LEU A CD2   1 
ATOM 1148 N N     . GLY A 1 140 ? 57.916 5.016   7.272   1.00 92.50  ? 140 GLY A N     1 
ATOM 1149 C CA    . GLY A 1 140 ? 58.995 4.808   6.318   1.00 91.00  ? 140 GLY A CA    1 
ATOM 1150 C C     . GLY A 1 140 ? 58.527 4.102   5.062   1.00 114.47 ? 140 GLY A C     1 
ATOM 1151 O O     . GLY A 1 140 ? 58.834 4.519   3.937   1.00 86.40  ? 140 GLY A O     1 
ATOM 1152 N N     . LEU A 1 141 ? 57.765 3.024   5.239   1.00 105.63 ? 141 LEU A N     1 
ATOM 1153 C CA    . LEU A 1 141 ? 57.312 2.256   4.091   1.00 90.12  ? 141 LEU A CA    1 
ATOM 1154 C C     . LEU A 1 141 ? 56.374 3.078   3.216   1.00 112.60 ? 141 LEU A C     1 
ATOM 1155 O O     . LEU A 1 141 ? 56.423 2.974   1.988   1.00 142.76 ? 141 LEU A O     1 
ATOM 1156 C CB    . LEU A 1 141 ? 56.644 0.970   4.576   1.00 92.69  ? 141 LEU A CB    1 
ATOM 1157 C CG    . LEU A 1 141 ? 56.543 -0.197  3.600   1.00 103.06 ? 141 LEU A CG    1 
ATOM 1158 C CD1   . LEU A 1 141 ? 57.919 -0.549  3.075   1.00 133.85 ? 141 LEU A CD1   1 
ATOM 1159 C CD2   . LEU A 1 141 ? 55.925 -1.392  4.302   1.00 104.34 ? 141 LEU A CD2   1 
ATOM 1160 N N     . SER A 1 142 ? 55.546 3.934   3.822   1.00 106.63 ? 142 SER A N     1 
ATOM 1161 C CA    . SER A 1 142 ? 54.660 4.784   3.036   1.00 110.80 ? 142 SER A CA    1 
ATOM 1162 C C     . SER A 1 142 ? 55.450 5.796   2.222   1.00 100.21 ? 142 SER A C     1 
ATOM 1163 O O     . SER A 1 142 ? 55.118 6.056   1.062   1.00 129.81 ? 142 SER A O     1 
ATOM 1164 C CB    . SER A 1 142 ? 53.665 5.499   3.947   1.00 126.33 ? 142 SER A CB    1 
ATOM 1165 O OG    . SER A 1 142 ? 54.303 6.534   4.674   1.00 160.61 ? 142 SER A OG    1 
ATOM 1166 N N     . TYR A 1 143 ? 56.497 6.378   2.811   1.00 90.77  ? 143 TYR A N     1 
ATOM 1167 C CA    . TYR A 1 143 ? 57.340 7.292   2.043   1.00 91.40  ? 143 TYR A CA    1 
ATOM 1168 C C     . TYR A 1 143 ? 57.995 6.594   0.863   1.00 106.25 ? 143 TYR A C     1 
ATOM 1169 O O     . TYR A 1 143 ? 58.010 7.126   -0.257  1.00 132.54 ? 143 TYR A O     1 
ATOM 1170 C CB    . TYR A 1 143 ? 58.409 7.893   2.946   1.00 93.68  ? 143 TYR A CB    1 
ATOM 1171 C CG    . TYR A 1 143 ? 59.435 8.744   2.233   1.00 90.42  ? 143 TYR A CG    1 
ATOM 1172 C CD1   . TYR A 1 143 ? 59.143 10.040  1.846   1.00 119.39 ? 143 TYR A CD1   1 
ATOM 1173 C CD2   . TYR A 1 143 ? 60.707 8.249   1.961   1.00 89.76  ? 143 TYR A CD2   1 
ATOM 1174 C CE1   . TYR A 1 143 ? 60.087 10.823  1.207   1.00 126.43 ? 143 TYR A CE1   1 
ATOM 1175 C CE2   . TYR A 1 143 ? 61.657 9.023   1.328   1.00 91.42  ? 143 TYR A CE2   1 
ATOM 1176 C CZ    . TYR A 1 143 ? 61.341 10.311  0.951   1.00 109.41 ? 143 TYR A CZ    1 
ATOM 1177 O OH    . TYR A 1 143 ? 62.277 11.092  0.315   1.00 96.28  ? 143 TYR A OH    1 
ATOM 1178 N N     . MET A 1 144 ? 58.517 5.390   1.085   1.00 118.13 ? 144 MET A N     1 
ATOM 1179 C CA    . MET A 1 144 ? 59.197 4.697   -0.004  1.00 109.67 ? 144 MET A CA    1 
ATOM 1180 C C     . MET A 1 144 ? 58.211 4.269   -1.084  1.00 121.18 ? 144 MET A C     1 
ATOM 1181 O O     . MET A 1 144 ? 58.537 4.293   -2.276  1.00 158.91 ? 144 MET A O     1 
ATOM 1182 C CB    . MET A 1 144 ? 59.972 3.510   0.541   1.00 117.14 ? 144 MET A CB    1 
ATOM 1183 C CG    . MET A 1 144 ? 60.951 3.911   1.614   1.00 120.91 ? 144 MET A CG    1 
ATOM 1184 S SD    . MET A 1 144 ? 61.984 2.544   2.133   1.00 106.06 ? 144 MET A SD    1 
ATOM 1185 C CE    . MET A 1 144 ? 61.054 2.050   3.571   1.00 151.52 ? 144 MET A CE    1 
ATOM 1186 N N     . GLU A 1 145 ? 56.999 3.877   -0.687  1.00 97.09  ? 145 GLU A N     1 
ATOM 1187 C CA    . GLU A 1 145 ? 55.969 3.563   -1.669  1.00 128.16 ? 145 GLU A CA    1 
ATOM 1188 C C     . GLU A 1 145 ? 55.562 4.807   -2.448  1.00 139.80 ? 145 GLU A C     1 
ATOM 1189 O O     . GLU A 1 145 ? 55.268 4.727   -3.647  1.00 170.29 ? 145 GLU A O     1 
ATOM 1190 C CB    . GLU A 1 145 ? 54.767 2.925   -0.971  1.00 167.77 ? 145 GLU A CB    1 
ATOM 1191 C CG    . GLU A 1 145 ? 55.086 1.578   -0.330  1.00 172.98 ? 145 GLU A CG    1 
ATOM 1192 C CD    . GLU A 1 145 ? 54.033 1.127   0.666   1.00 160.38 ? 145 GLU A CD    1 
ATOM 1193 O OE1   . GLU A 1 145 ? 53.094 1.905   0.940   1.00 160.17 ? 145 GLU A OE1   1 
ATOM 1194 O OE2   . GLU A 1 145 ? 54.150 -0.005  1.182   1.00 127.56 ? 145 GLU A OE2   1 
ATOM 1195 N N     . SER A 1 146 ? 55.539 5.965   -1.789  1.00 134.73 ? 146 SER A N     1 
ATOM 1196 C CA    . SER A 1 146 ? 55.263 7.221   -2.473  1.00 156.16 ? 146 SER A CA    1 
ATOM 1197 C C     . SER A 1 146 ? 56.452 7.728   -3.276  1.00 139.14 ? 146 SER A C     1 
ATOM 1198 O O     . SER A 1 146 ? 56.319 8.737   -3.976  1.00 145.99 ? 146 SER A O     1 
ATOM 1199 C CB    . SER A 1 146 ? 54.832 8.293   -1.465  1.00 165.60 ? 146 SER A CB    1 
ATOM 1200 O OG    . SER A 1 146 ? 55.911 8.683   -0.632  1.00 148.10 ? 146 SER A OG    1 
ATOM 1201 N N     . LEU A 1 147 ? 57.606 7.062   -3.195  1.00 141.65 ? 147 LEU A N     1 
ATOM 1202 C CA    . LEU A 1 147 ? 58.768 7.499   -3.963  1.00 150.27 ? 147 LEU A CA    1 
ATOM 1203 C C     . LEU A 1 147 ? 58.700 7.118   -5.437  1.00 143.35 ? 147 LEU A C     1 
ATOM 1204 O O     . LEU A 1 147 ? 59.417 7.717   -6.246  1.00 125.49 ? 147 LEU A O     1 
ATOM 1205 C CB    . LEU A 1 147 ? 60.057 6.924   -3.371  1.00 117.80 ? 147 LEU A CB    1 
ATOM 1206 C CG    . LEU A 1 147 ? 60.664 7.614   -2.153  1.00 119.25 ? 147 LEU A CG    1 
ATOM 1207 C CD1   . LEU A 1 147 ? 61.942 6.910   -1.748  1.00 119.81 ? 147 LEU A CD1   1 
ATOM 1208 C CD2   . LEU A 1 147 ? 60.936 9.076   -2.454  1.00 127.11 ? 147 LEU A CD2   1 
ATOM 1209 N N     . LEU A 1 148 ? 57.868 6.143   -5.808  1.00 160.24 ? 148 LEU A N     1 
ATOM 1210 C CA    . LEU A 1 148 ? 57.867 5.661   -7.187  1.00 159.25 ? 148 LEU A CA    1 
ATOM 1211 C C     . LEU A 1 148 ? 57.211 6.667   -8.125  1.00 203.51 ? 148 LEU A C     1 
ATOM 1212 O O     . LEU A 1 148 ? 57.855 7.191   -9.041  1.00 206.51 ? 148 LEU A O     1 
ATOM 1213 C CB    . LEU A 1 148 ? 57.160 4.308   -7.270  1.00 153.50 ? 148 LEU A CB    1 
ATOM 1214 C CG    . LEU A 1 148 ? 57.186 3.664   -8.656  1.00 168.65 ? 148 LEU A CG    1 
ATOM 1215 C CD1   . LEU A 1 148 ? 58.621 3.411   -9.091  1.00 158.23 ? 148 LEU A CD1   1 
ATOM 1216 C CD2   . LEU A 1 148 ? 56.376 2.376   -8.675  1.00 186.50 ? 148 LEU A CD2   1 
ATOM 1217 N N     . LYS A 1 149 ? 55.926 6.945   -7.909  1.00 233.10 ? 149 LYS A N     1 
ATOM 1218 C CA    . LYS A 1 149 ? 55.165 7.892   -8.726  1.00 243.53 ? 149 LYS A CA    1 
ATOM 1219 C C     . LYS A 1 149 ? 55.220 7.545   -10.212 1.00 236.57 ? 149 LYS A C     1 
ATOM 1220 O O     . LYS A 1 149 ? 55.162 6.375   -10.591 1.00 234.06 ? 149 LYS A O     1 
ATOM 1221 C CB    . LYS A 1 149 ? 55.671 9.319   -8.499  1.00 255.43 ? 149 LYS A CB    1 
ATOM 1222 C CG    . LYS A 1 149 ? 55.586 9.779   -7.052  1.00 253.11 ? 149 LYS A CG    1 
ATOM 1223 C CD    . LYS A 1 149 ? 56.267 11.122  -6.853  1.00 254.28 ? 149 LYS A CD    1 
ATOM 1224 C CE    . LYS A 1 149 ? 56.153 11.584  -5.409  1.00 256.38 ? 149 LYS A CE    1 
ATOM 1225 N NZ    . LYS A 1 149 ? 56.893 12.853  -5.166  1.00 273.29 ? 149 LYS A NZ    1 
ATOM 1226 N N     . MET B 1 1   ? 33.934 63.754  60.750  1.00 213.14 ? 1   MET B N     1 
ATOM 1227 C CA    . MET B 1 1   ? 34.075 62.612  59.852  1.00 208.66 ? 1   MET B CA    1 
ATOM 1228 C C     . MET B 1 1   ? 35.374 61.863  60.138  1.00 165.86 ? 1   MET B C     1 
ATOM 1229 O O     . MET B 1 1   ? 36.384 62.054  59.461  1.00 153.49 ? 1   MET B O     1 
ATOM 1230 C CB    . MET B 1 1   ? 34.026 63.070  58.394  1.00 199.32 ? 1   MET B CB    1 
ATOM 1231 C CG    . MET B 1 1   ? 34.094 61.952  57.364  1.00 211.33 ? 1   MET B CG    1 
ATOM 1232 S SD    . MET B 1 1   ? 32.757 60.753  57.510  1.00 203.43 ? 1   MET B SD    1 
ATOM 1233 C CE    . MET B 1 1   ? 32.890 59.916  55.932  1.00 162.69 ? 1   MET B CE    1 
ATOM 1234 N N     . ILE B 1 2   ? 35.332 61.015  61.159  1.00 134.48 ? 2   ILE B N     1 
ATOM 1235 C CA    . ILE B 1 2   ? 36.482 60.237  61.600  1.00 135.13 ? 2   ILE B CA    1 
ATOM 1236 C C     . ILE B 1 2   ? 36.376 58.849  60.985  1.00 152.31 ? 2   ILE B C     1 
ATOM 1237 O O     . ILE B 1 2   ? 35.371 58.153  61.176  1.00 139.83 ? 2   ILE B O     1 
ATOM 1238 C CB    . ILE B 1 2   ? 36.556 60.158  63.132  1.00 146.44 ? 2   ILE B CB    1 
ATOM 1239 C CG1   . ILE B 1 2   ? 36.532 61.562  63.739  1.00 130.74 ? 2   ILE B CG1   1 
ATOM 1240 C CG2   . ILE B 1 2   ? 37.802 59.393  63.568  1.00 100.81 ? 2   ILE B CG2   1 
ATOM 1241 C CD1   . ILE B 1 2   ? 37.652 62.455  63.258  1.00 101.80 ? 2   ILE B CD1   1 
ATOM 1242 N N     . ILE B 1 3   ? 37.400 58.448  60.238  1.00 144.96 ? 3   ILE B N     1 
ATOM 1243 C CA    . ILE B 1 3   ? 37.392 57.191  59.501  1.00 160.45 ? 3   ILE B CA    1 
ATOM 1244 C C     . ILE B 1 3   ? 38.309 56.211  60.217  1.00 163.67 ? 3   ILE B C     1 
ATOM 1245 O O     . ILE B 1 3   ? 39.437 56.560  60.580  1.00 166.52 ? 3   ILE B O     1 
ATOM 1246 C CB    . ILE B 1 3   ? 37.843 57.399  58.044  1.00 153.63 ? 3   ILE B CB    1 
ATOM 1247 C CG1   . ILE B 1 3   ? 36.883 58.336  57.311  1.00 160.33 ? 3   ILE B CG1   1 
ATOM 1248 C CG2   . ILE B 1 3   ? 37.966 56.074  57.330  1.00 150.84 ? 3   ILE B CG2   1 
ATOM 1249 C CD1   . ILE B 1 3   ? 35.518 57.736  57.082  1.00 170.06 ? 3   ILE B CD1   1 
ATOM 1250 N N     . CYS B 1 4   ? 37.827 54.985  60.414  1.00 115.61 ? 4   CYS B N     1 
ATOM 1251 C CA    . CYS B 1 4   ? 38.596 53.931  61.069  1.00 112.80 ? 4   CYS B CA    1 
ATOM 1252 C C     . CYS B 1 4   ? 38.565 52.701  60.172  1.00 129.18 ? 4   CYS B C     1 
ATOM 1253 O O     . CYS B 1 4   ? 37.544 52.011  60.093  1.00 139.40 ? 4   CYS B O     1 
ATOM 1254 C CB    . CYS B 1 4   ? 38.023 53.621  62.456  1.00 145.58 ? 4   CYS B CB    1 
ATOM 1255 S SG    . CYS B 1 4   ? 38.713 52.163  63.288  1.00 111.27 ? 4   CYS B SG    1 
ATOM 1256 N N     . SER B 1 5   ? 39.682 52.410  59.513  1.00 134.56 ? 5   SER B N     1 
ATOM 1257 C CA    . SER B 1 5   ? 39.781 51.257  58.628  1.00 161.84 ? 5   SER B CA    1 
ATOM 1258 C C     . SER B 1 5   ? 40.642 50.202  59.302  1.00 161.94 ? 5   SER B C     1 
ATOM 1259 O O     . SER B 1 5   ? 41.704 50.518  59.845  1.00 157.60 ? 5   SER B O     1 
ATOM 1260 C CB    . SER B 1 5   ? 40.359 51.643  57.264  1.00 146.49 ? 5   SER B CB    1 
ATOM 1261 O OG    . SER B 1 5   ? 41.670 52.163  57.378  1.00 151.63 ? 5   SER B OG    1 
ATOM 1262 N N     . VAL B 1 6   ? 40.191 48.953  59.263  1.00 164.60 ? 6   VAL B N     1 
ATOM 1263 C CA    . VAL B 1 6   ? 40.790 47.893  60.063  1.00 162.68 ? 6   VAL B CA    1 
ATOM 1264 C C     . VAL B 1 6   ? 41.175 46.737  59.154  1.00 141.00 ? 6   VAL B C     1 
ATOM 1265 O O     . VAL B 1 6   ? 40.345 46.239  58.385  1.00 169.89 ? 6   VAL B O     1 
ATOM 1266 C CB    . VAL B 1 6   ? 39.841 47.407  61.176  1.00 120.77 ? 6   VAL B CB    1 
ATOM 1267 C CG1   . VAL B 1 6   ? 40.543 46.391  62.057  1.00 119.21 ? 6   VAL B CG1   1 
ATOM 1268 C CG2   . VAL B 1 6   ? 39.347 48.577  62.004  1.00 115.87 ? 6   VAL B CG2   1 
ATOM 1269 N N     . ASP B 1 7   ? 42.435 46.321  59.242  1.00 142.80 ? 7   ASP B N     1 
ATOM 1270 C CA    . ASP B 1 7   ? 42.872 45.026  58.745  1.00 146.18 ? 7   ASP B CA    1 
ATOM 1271 C C     . ASP B 1 7   ? 42.679 44.010  59.865  1.00 150.11 ? 7   ASP B C     1 
ATOM 1272 O O     . ASP B 1 7   ? 43.326 44.105  60.917  1.00 164.35 ? 7   ASP B O     1 
ATOM 1273 C CB    . ASP B 1 7   ? 44.330 45.069  58.290  1.00 145.43 ? 7   ASP B CB    1 
ATOM 1274 C CG    . ASP B 1 7   ? 44.824 43.724  57.795  1.00 188.13 ? 7   ASP B CG    1 
ATOM 1275 O OD1   . ASP B 1 7   ? 44.300 43.237  56.772  1.00 209.27 ? 7   ASP B OD1   1 
ATOM 1276 O OD2   . ASP B 1 7   ? 45.735 43.152  58.430  1.00 206.78 ? 7   ASP B OD2   1 
ATOM 1277 N N     . ILE B 1 8   ? 41.786 43.052  59.635  1.00 148.52 ? 8   ILE B N     1 
ATOM 1278 C CA    . ILE B 1 8   ? 41.349 42.112  60.656  1.00 139.15 ? 8   ILE B CA    1 
ATOM 1279 C C     . ILE B 1 8   ? 42.319 40.938  60.718  1.00 146.00 ? 8   ILE B C     1 
ATOM 1280 O O     . ILE B 1 8   ? 43.043 40.635  59.766  1.00 172.73 ? 8   ILE B O     1 
ATOM 1281 C CB    . ILE B 1 8   ? 39.907 41.625  60.386  1.00 156.83 ? 8   ILE B CB    1 
ATOM 1282 C CG1   . ILE B 1 8   ? 39.021 42.782  59.926  1.00 151.32 ? 8   ILE B CG1   1 
ATOM 1283 C CG2   . ILE B 1 8   ? 39.297 40.992  61.632  1.00 152.73 ? 8   ILE B CG2   1 
ATOM 1284 C CD1   . ILE B 1 8   ? 38.480 43.617  61.061  1.00 149.21 ? 8   ILE B CD1   1 
ATOM 1285 N N     . GLY B 1 9   ? 42.327 40.271  61.867  1.00 140.86 ? 9   GLY B N     1 
ATOM 1286 C CA    . GLY B 1 9   ? 43.157 39.112  62.110  1.00 149.06 ? 9   GLY B CA    1 
ATOM 1287 C C     . GLY B 1 9   ? 43.333 38.908  63.598  1.00 160.21 ? 9   GLY B C     1 
ATOM 1288 O O     . GLY B 1 9   ? 43.507 39.872  64.349  1.00 156.64 ? 9   GLY B O     1 
ATOM 1289 N N     . ILE B 1 10  ? 43.274 37.652  64.042  1.00 157.03 ? 10  ILE B N     1 
ATOM 1290 C CA    . ILE B 1 10  ? 43.478 37.365  65.456  1.00 174.63 ? 10  ILE B CA    1 
ATOM 1291 C C     . ILE B 1 10  ? 44.930 37.601  65.854  1.00 204.11 ? 10  ILE B C     1 
ATOM 1292 O O     . ILE B 1 10  ? 45.209 38.045  66.975  1.00 195.01 ? 10  ILE B O     1 
ATOM 1293 C CB    . ILE B 1 10  ? 43.017 35.929  65.769  1.00 188.96 ? 10  ILE B CB    1 
ATOM 1294 C CG1   . ILE B 1 10  ? 41.529 35.771  65.446  1.00 201.19 ? 10  ILE B CG1   1 
ATOM 1295 C CG2   . ILE B 1 10  ? 43.279 35.574  67.223  1.00 192.62 ? 10  ILE B CG2   1 
ATOM 1296 C CD1   . ILE B 1 10  ? 40.970 34.405  65.782  1.00 221.57 ? 10  ILE B CD1   1 
ATOM 1297 N N     . LYS B 1 11  ? 45.874 37.340  64.947  1.00 218.15 ? 11  LYS B N     1 
ATOM 1298 C CA    . LYS B 1 11  ? 47.285 37.485  65.288  1.00 211.55 ? 11  LYS B CA    1 
ATOM 1299 C C     . LYS B 1 11  ? 47.732 38.942  65.231  1.00 190.85 ? 11  LYS B C     1 
ATOM 1300 O O     . LYS B 1 11  ? 48.181 39.502  66.237  1.00 195.44 ? 11  LYS B O     1 
ATOM 1301 C CB    . LYS B 1 11  ? 48.146 36.618  64.365  1.00 232.54 ? 11  LYS B CB    1 
ATOM 1302 C CG    . LYS B 1 11  ? 48.076 35.131  64.676  1.00 254.91 ? 11  LYS B CG    1 
ATOM 1303 C CD    . LYS B 1 11  ? 49.221 34.370  64.023  1.00 268.19 ? 11  LYS B CD    1 
ATOM 1304 C CE    . LYS B 1 11  ? 50.567 34.791  64.597  1.00 259.96 ? 11  LYS B CE    1 
ATOM 1305 N NZ    . LYS B 1 11  ? 50.672 34.500  66.054  1.00 253.21 ? 11  LYS B NZ    1 
ATOM 1306 N N     . ASN B 1 12  ? 47.617 39.579  64.066  1.00 178.39 ? 12  ASN B N     1 
ATOM 1307 C CA    . ASN B 1 12  ? 48.117 40.940  63.871  1.00 177.92 ? 12  ASN B CA    1 
ATOM 1308 C C     . ASN B 1 12  ? 47.043 41.848  63.282  1.00 162.59 ? 12  ASN B C     1 
ATOM 1309 O O     . ASN B 1 12  ? 47.074 42.176  62.087  1.00 149.06 ? 12  ASN B O     1 
ATOM 1310 C CB    . ASN B 1 12  ? 49.357 40.934  62.976  1.00 201.78 ? 12  ASN B CB    1 
ATOM 1311 C CG    . ASN B 1 12  ? 49.202 40.023  61.774  1.00 199.71 ? 12  ASN B CG    1 
ATOM 1312 O OD1   . ASN B 1 12  ? 48.115 39.509  61.505  1.00 188.33 ? 12  ASN B OD1   1 
ATOM 1313 N ND2   . ASN B 1 12  ? 50.289 39.823  61.039  1.00 212.02 ? 12  ASN B ND2   1 
ATOM 1314 N N     . PRO B 1 13  ? 46.078 42.273  64.091  1.00 142.99 ? 13  PRO B N     1 
ATOM 1315 C CA    . PRO B 1 13  ? 45.111 43.270  63.626  1.00 145.74 ? 13  PRO B CA    1 
ATOM 1316 C C     . PRO B 1 13  ? 45.729 44.658  63.607  1.00 138.22 ? 13  PRO B C     1 
ATOM 1317 O O     . PRO B 1 13  ? 46.594 44.990  64.420  1.00 149.75 ? 13  PRO B O     1 
ATOM 1318 C CB    . PRO B 1 13  ? 43.986 43.180  64.663  1.00 142.15 ? 13  PRO B CB    1 
ATOM 1319 C CG    . PRO B 1 13  ? 44.675 42.725  65.900  1.00 155.74 ? 13  PRO B CG    1 
ATOM 1320 C CD    . PRO B 1 13  ? 45.770 41.798  65.451  1.00 134.41 ? 13  PRO B CD    1 
ATOM 1321 N N     . ALA B 1 14  ? 45.271 45.480  62.665  1.00 137.12 ? 14  ALA B N     1 
ATOM 1322 C CA    . ALA B 1 14  ? 45.795 46.833  62.529  1.00 128.00 ? 14  ALA B CA    1 
ATOM 1323 C C     . ALA B 1 14  ? 44.659 47.783  62.189  1.00 121.46 ? 14  ALA B C     1 
ATOM 1324 O O     . ALA B 1 14  ? 43.649 47.373  61.616  1.00 130.27 ? 14  ALA B O     1 
ATOM 1325 C CB    . ALA B 1 14  ? 46.889 46.915  61.457  1.00 144.98 ? 14  ALA B CB    1 
ATOM 1326 N N     . TYR B 1 15  ? 44.826 49.060  62.537  1.00 153.45 ? 15  TYR B N     1 
ATOM 1327 C CA    . TYR B 1 15  ? 43.805 50.051  62.228  1.00 146.95 ? 15  TYR B CA    1 
ATOM 1328 C C     . TYR B 1 15  ? 44.450 51.388  61.896  1.00 143.17 ? 15  TYR B C     1 
ATOM 1329 O O     . TYR B 1 15  ? 45.466 51.782  62.479  1.00 149.53 ? 15  TYR B O     1 
ATOM 1330 C CB    . TYR B 1 15  ? 42.811 50.250  63.386  1.00 140.68 ? 15  TYR B CB    1 
ATOM 1331 C CG    . TYR B 1 15  ? 43.434 50.779  64.658  1.00 147.20 ? 15  TYR B CG    1 
ATOM 1332 C CD1   . TYR B 1 15  ? 44.003 49.923  65.592  1.00 152.20 ? 15  TYR B CD1   1 
ATOM 1333 C CD2   . TYR B 1 15  ? 43.445 52.142  64.927  1.00 151.81 ? 15  TYR B CD2   1 
ATOM 1334 C CE1   . TYR B 1 15  ? 44.571 50.414  66.754  1.00 166.58 ? 15  TYR B CE1   1 
ATOM 1335 C CE2   . TYR B 1 15  ? 44.009 52.640  66.081  1.00 162.24 ? 15  TYR B CE2   1 
ATOM 1336 C CZ    . TYR B 1 15  ? 44.570 51.775  66.992  1.00 178.11 ? 15  TYR B CZ    1 
ATOM 1337 O OH    . TYR B 1 15  ? 45.131 52.277  68.143  1.00 195.81 ? 15  TYR B OH    1 
ATOM 1338 N N     . ALA B 1 16  ? 43.812 52.102  60.976  1.00 136.31 ? 16  ALA B N     1 
ATOM 1339 C CA    . ALA B 1 16  ? 44.216 53.441  60.582  1.00 140.70 ? 16  ALA B CA    1 
ATOM 1340 C C     . ALA B 1 16  ? 43.043 54.384  60.806  1.00 140.00 ? 16  ALA B C     1 
ATOM 1341 O O     . ALA B 1 16  ? 41.919 54.101  60.374  1.00 140.67 ? 16  ALA B O     1 
ATOM 1342 C CB    . ALA B 1 16  ? 44.669 53.478  59.121  1.00 143.95 ? 16  ALA B CB    1 
ATOM 1343 N N     . ILE B 1 17  ? 43.313 55.497  61.479  1.00 141.29 ? 17  ILE B N     1 
ATOM 1344 C CA    . ILE B 1 17  ? 42.322 56.507  61.813  1.00 144.33 ? 17  ILE B CA    1 
ATOM 1345 C C     . ILE B 1 17  ? 42.677 57.754  61.021  1.00 157.47 ? 17  ILE B C     1 
ATOM 1346 O O     . ILE B 1 17  ? 43.741 58.351  61.234  1.00 163.32 ? 17  ILE B O     1 
ATOM 1347 C CB    . ILE B 1 17  ? 42.304 56.809  63.320  1.00 144.93 ? 17  ILE B CB    1 
ATOM 1348 C CG1   . ILE B 1 17  ? 42.318 55.514  64.128  1.00 140.07 ? 17  ILE B CG1   1 
ATOM 1349 C CG2   . ILE B 1 17  ? 41.089 57.653  63.678  1.00 147.80 ? 17  ILE B CG2   1 
ATOM 1350 C CD1   . ILE B 1 17  ? 41.070 54.695  63.984  1.00 148.56 ? 17  ILE B CD1   1 
ATOM 1351 N N     . PHE B 1 18  ? 41.792 58.139  60.111  1.00 152.48 ? 18  PHE B N     1 
ATOM 1352 C CA    . PHE B 1 18  ? 41.946 59.336  59.305  1.00 159.08 ? 18  PHE B CA    1 
ATOM 1353 C C     . PHE B 1 18  ? 40.891 60.359  59.696  1.00 163.53 ? 18  PHE B C     1 
ATOM 1354 O O     . PHE B 1 18  ? 39.863 60.034  60.300  1.00 161.34 ? 18  PHE B O     1 
ATOM 1355 C CB    . PHE B 1 18  ? 41.818 59.036  57.806  1.00 184.53 ? 18  PHE B CB    1 
ATOM 1356 C CG    . PHE B 1 18  ? 42.700 57.923  57.317  1.00 176.56 ? 18  PHE B CG    1 
ATOM 1357 C CD1   . PHE B 1 18  ? 43.945 57.697  57.874  1.00 166.68 ? 18  PHE B CD1   1 
ATOM 1358 C CD2   . PHE B 1 18  ? 42.279 57.106  56.280  1.00 190.75 ? 18  PHE B CD2   1 
ATOM 1359 C CE1   . PHE B 1 18  ? 44.745 56.670  57.412  1.00 177.11 ? 18  PHE B CE1   1 
ATOM 1360 C CE2   . PHE B 1 18  ? 43.077 56.081  55.815  1.00 192.65 ? 18  PHE B CE2   1 
ATOM 1361 C CZ    . PHE B 1 18  ? 44.312 55.863  56.382  1.00 188.44 ? 18  PHE B CZ    1 
ATOM 1362 N N     . ASN B 1 19  ? 41.141 61.601  59.295  1.00 170.52 ? 19  ASN B N     1 
ATOM 1363 C CA    . ASN B 1 19  ? 40.166 62.676  59.397  1.00 176.55 ? 19  ASN B CA    1 
ATOM 1364 C C     . ASN B 1 19  ? 39.884 63.191  57.996  1.00 182.40 ? 19  ASN B C     1 
ATOM 1365 O O     . ASN B 1 19  ? 40.789 63.688  57.317  1.00 199.86 ? 19  ASN B O     1 
ATOM 1366 C CB    . ASN B 1 19  ? 40.677 63.804  60.296  1.00 181.24 ? 19  ASN B CB    1 
ATOM 1367 C CG    . ASN B 1 19  ? 39.690 64.951  60.413  1.00 223.05 ? 19  ASN B CG    1 
ATOM 1368 O OD1   . ASN B 1 19  ? 38.490 64.740  60.592  1.00 227.56 ? 19  ASN B OD1   1 
ATOM 1369 N ND2   . ASN B 1 19  ? 40.194 66.176  60.317  1.00 225.49 ? 19  ASN B ND2   1 
ATOM 1370 N N     . TYR B 1 20  ? 38.634 63.075  57.573  1.00 196.21 ? 20  TYR B N     1 
ATOM 1371 C CA    . TYR B 1 20  ? 38.194 63.508  56.255  1.00 198.97 ? 20  TYR B CA    1 
ATOM 1372 C C     . TYR B 1 20  ? 37.374 64.768  56.488  1.00 224.28 ? 20  TYR B C     1 
ATOM 1373 O O     . TYR B 1 20  ? 36.317 64.718  57.124  1.00 222.48 ? 20  TYR B O     1 
ATOM 1374 C CB    . TYR B 1 20  ? 37.379 62.411  55.572  1.00 190.62 ? 20  TYR B CB    1 
ATOM 1375 C CG    . TYR B 1 20  ? 36.808 62.771  54.220  1.00 202.27 ? 20  TYR B CG    1 
ATOM 1376 C CD1   . TYR B 1 20  ? 37.616 62.814  53.095  1.00 197.93 ? 20  TYR B CD1   1 
ATOM 1377 C CD2   . TYR B 1 20  ? 35.455 63.041  54.063  1.00 235.95 ? 20  TYR B CD2   1 
ATOM 1378 C CE1   . TYR B 1 20  ? 37.101 63.130  51.853  1.00 225.81 ? 20  TYR B CE1   1 
ATOM 1379 C CE2   . TYR B 1 20  ? 34.929 63.359  52.824  1.00 250.16 ? 20  TYR B CE2   1 
ATOM 1380 C CZ    . TYR B 1 20  ? 35.757 63.402  51.723  1.00 246.45 ? 20  TYR B CZ    1 
ATOM 1381 O OH    . TYR B 1 20  ? 35.240 63.716  50.487  1.00 258.83 ? 20  TYR B OH    1 
ATOM 1382 N N     . ASP B 1 21  ? 37.859 65.894  55.980  1.00 206.58 ? 21  ASP B N     1 
ATOM 1383 C CA    . ASP B 1 21  ? 37.134 67.144  56.146  1.00 215.69 ? 21  ASP B CA    1 
ATOM 1384 C C     . ASP B 1 21  ? 35.914 67.150  55.237  1.00 249.77 ? 21  ASP B C     1 
ATOM 1385 O O     . ASP B 1 21  ? 36.040 67.046  54.012  1.00 224.24 ? 21  ASP B O     1 
ATOM 1386 C CB    . ASP B 1 21  ? 38.047 68.328  55.842  1.00 231.20 ? 21  ASP B CB    1 
ATOM 1387 C CG    . ASP B 1 21  ? 37.526 69.630  56.422  1.00 248.87 ? 21  ASP B CG    1 
ATOM 1388 O OD1   . ASP B 1 21  ? 36.477 69.605  57.099  1.00 254.15 ? 21  ASP B OD1   1 
ATOM 1389 O OD2   . ASP B 1 21  ? 38.168 70.679  56.204  1.00 254.00 ? 21  ASP B OD2   1 
ATOM 1390 N N     . ASN B 1 22  ? 34.733 67.265  55.840  1.00 268.03 ? 22  ASN B N     1 
ATOM 1391 C CA    . ASN B 1 22  ? 33.496 67.187  55.078  1.00 282.21 ? 22  ASN B CA    1 
ATOM 1392 C C     . ASN B 1 22  ? 33.381 68.412  54.183  1.00 283.48 ? 22  ASN B C     1 
ATOM 1393 O O     . ASN B 1 22  ? 33.626 69.539  54.624  1.00 288.84 ? 22  ASN B O     1 
ATOM 1394 C CB    . ASN B 1 22  ? 32.295 67.084  56.016  1.00 282.61 ? 22  ASN B CB    1 
ATOM 1395 C CG    . ASN B 1 22  ? 32.294 65.795  56.819  1.00 263.56 ? 22  ASN B CG    1 
ATOM 1396 O OD1   . ASN B 1 22  ? 32.336 65.816  58.049  1.00 257.71 ? 22  ASN B OD1   1 
ATOM 1397 N ND2   . ASN B 1 22  ? 32.245 64.664  56.123  1.00 243.44 ? 22  ASN B ND2   1 
ATOM 1398 N N     . THR B 1 23  ? 33.039 68.180  52.916  1.00 297.20 ? 23  THR B N     1 
ATOM 1399 C CA    . THR B 1 23  ? 32.886 69.184  51.867  1.00 321.83 ? 23  THR B CA    1 
ATOM 1400 C C     . THR B 1 23  ? 34.233 69.774  51.460  1.00 326.76 ? 23  THR B C     1 
ATOM 1401 O O     . THR B 1 23  ? 34.289 70.574  50.517  1.00 341.19 ? 23  THR B O     1 
ATOM 1402 C CB    . THR B 1 23  ? 31.922 70.316  52.265  1.00 328.56 ? 23  THR B CB    1 
ATOM 1403 O OG1   . THR B 1 23  ? 30.878 69.784  53.089  1.00 332.34 ? 23  THR B OG1   1 
ATOM 1404 C CG2   . THR B 1 23  ? 31.291 70.953  51.035  1.00 335.52 ? 23  THR B CG2   1 
ATOM 1405 N N     . SER B 1 24  ? 35.328 69.399  52.130  1.00 311.69 ? 24  SER B N     1 
ATOM 1406 C CA    . SER B 1 24  ? 36.656 69.862  51.760  1.00 293.32 ? 24  SER B CA    1 
ATOM 1407 C C     . SER B 1 24  ? 37.532 68.781  51.145  1.00 287.35 ? 24  SER B C     1 
ATOM 1408 O O     . SER B 1 24  ? 38.539 69.117  50.515  1.00 249.71 ? 24  SER B O     1 
ATOM 1409 C CB    . SER B 1 24  ? 37.379 70.445  52.984  1.00 280.41 ? 24  SER B CB    1 
ATOM 1410 O OG    . SER B 1 24  ? 36.632 71.496  53.569  1.00 276.00 ? 24  SER B OG    1 
ATOM 1411 N N     . ASN B 1 25  ? 37.176 67.505  51.310  1.00 298.77 ? 25  ASN B N     1 
ATOM 1412 C CA    . ASN B 1 25  ? 37.932 66.387  50.742  1.00 306.02 ? 25  ASN B CA    1 
ATOM 1413 C C     . ASN B 1 25  ? 39.401 66.439  51.164  1.00 287.69 ? 25  ASN B C     1 
ATOM 1414 O O     . ASN B 1 25  ? 40.315 66.250  50.359  1.00 300.53 ? 25  ASN B O     1 
ATOM 1415 C CB    . ASN B 1 25  ? 37.792 66.355  49.219  1.00 319.51 ? 25  ASN B CB    1 
ATOM 1416 C CG    . ASN B 1 25  ? 36.349 66.206  48.771  1.00 309.33 ? 25  ASN B CG    1 
ATOM 1417 O OD1   . ASN B 1 25  ? 35.518 65.646  49.486  1.00 299.92 ? 25  ASN B OD1   1 
ATOM 1418 N ND2   . ASN B 1 25  ? 36.044 66.708  47.580  1.00 317.84 ? 25  ASN B ND2   1 
ATOM 1419 N N     . THR B 1 26  ? 39.623 66.693  52.451  1.00 250.03 ? 26  THR B N     1 
ATOM 1420 C CA    . THR B 1 26  ? 40.962 66.855  53.011  1.00 221.22 ? 26  THR B CA    1 
ATOM 1421 C C     . THR B 1 26  ? 41.315 65.636  53.856  1.00 216.16 ? 26  THR B C     1 
ATOM 1422 O O     . THR B 1 26  ? 40.709 65.402  54.907  1.00 208.26 ? 26  THR B O     1 
ATOM 1423 C CB    . THR B 1 26  ? 41.049 68.132  53.843  1.00 231.74 ? 26  THR B CB    1 
ATOM 1424 O OG1   . THR B 1 26  ? 40.613 69.247  53.057  1.00 236.82 ? 26  THR B OG1   1 
ATOM 1425 C CG2   . THR B 1 26  ? 42.480 68.368  54.303  1.00 232.34 ? 26  THR B CG2   1 
ATOM 1426 N N     . ILE B 1 27  ? 42.296 64.866  53.395  1.00 208.39 ? 27  ILE B N     1 
ATOM 1427 C CA    . ILE B 1 27  ? 42.731 63.657  54.084  1.00 204.41 ? 27  ILE B CA    1 
ATOM 1428 C C     . ILE B 1 27  ? 43.849 64.038  55.045  1.00 218.58 ? 27  ILE B C     1 
ATOM 1429 O O     . ILE B 1 27  ? 44.913 64.500  54.619  1.00 240.32 ? 27  ILE B O     1 
ATOM 1430 C CB    . ILE B 1 27  ? 43.211 62.588  53.091  1.00 215.13 ? 27  ILE B CB    1 
ATOM 1431 C CG1   . ILE B 1 27  ? 42.200 62.397  51.961  1.00 226.85 ? 27  ILE B CG1   1 
ATOM 1432 C CG2   . ILE B 1 27  ? 43.463 61.271  53.812  1.00 190.36 ? 27  ILE B CG2   1 
ATOM 1433 C CD1   . ILE B 1 27  ? 40.825 62.045  52.434  1.00 201.11 ? 27  ILE B CD1   1 
ATOM 1434 N N     . LYS B 1 28  ? 43.610 63.852  56.340  1.00 213.74 ? 28  LYS B N     1 
ATOM 1435 C CA    . LYS B 1 28  ? 44.613 64.108  57.367  1.00 196.67 ? 28  LYS B CA    1 
ATOM 1436 C C     . LYS B 1 28  ? 44.702 62.888  58.271  1.00 197.10 ? 28  LYS B C     1 
ATOM 1437 O O     . LYS B 1 28  ? 43.730 62.547  58.954  1.00 216.40 ? 28  LYS B O     1 
ATOM 1438 C CB    . LYS B 1 28  ? 44.277 65.365  58.175  1.00 193.85 ? 28  LYS B CB    1 
ATOM 1439 C CG    . LYS B 1 28  ? 44.328 66.651  57.362  1.00 208.91 ? 28  LYS B CG    1 
ATOM 1440 C CD    . LYS B 1 28  ? 44.329 67.884  58.255  1.00 229.56 ? 28  LYS B CD    1 
ATOM 1441 C CE    . LYS B 1 28  ? 43.012 68.050  58.997  1.00 226.86 ? 28  LYS B CE    1 
ATOM 1442 N NZ    . LYS B 1 28  ? 41.879 68.335  58.074  1.00 219.10 ? 28  LYS B NZ    1 
ATOM 1443 N N     . LEU B 1 29  ? 45.862 62.233  58.268  1.00 197.01 ? 29  LEU B N     1 
ATOM 1444 C CA    . LEU B 1 29  ? 46.072 61.037  59.076  1.00 189.73 ? 29  LEU B CA    1 
ATOM 1445 C C     . LEU B 1 29  ? 46.026 61.386  60.556  1.00 196.12 ? 29  LEU B C     1 
ATOM 1446 O O     . LEU B 1 29  ? 46.830 62.194  61.030  1.00 211.17 ? 29  LEU B O     1 
ATOM 1447 C CB    . LEU B 1 29  ? 47.419 60.396  58.749  1.00 173.86 ? 29  LEU B CB    1 
ATOM 1448 C CG    . LEU B 1 29  ? 47.699 59.100  59.524  1.00 162.11 ? 29  LEU B CG    1 
ATOM 1449 C CD1   . LEU B 1 29  ? 47.590 57.887  58.622  1.00 157.90 ? 29  LEU B CD1   1 
ATOM 1450 C CD2   . LEU B 1 29  ? 49.031 59.109  60.256  1.00 169.57 ? 29  LEU B CD2   1 
ATOM 1451 N N     . ILE B 1 30  ? 45.091 60.783  61.289  1.00 178.65 ? 30  ILE B N     1 
ATOM 1452 C CA    . ILE B 1 30  ? 45.060 60.998  62.730  1.00 173.73 ? 30  ILE B CA    1 
ATOM 1453 C C     . ILE B 1 30  ? 46.044 60.063  63.418  1.00 161.70 ? 30  ILE B C     1 
ATOM 1454 O O     . ILE B 1 30  ? 46.901 60.498  64.195  1.00 174.95 ? 30  ILE B O     1 
ATOM 1455 C CB    . ILE B 1 30  ? 43.634 60.811  63.282  1.00 186.59 ? 30  ILE B CB    1 
ATOM 1456 C CG1   . ILE B 1 30  ? 42.683 61.852  62.693  1.00 200.14 ? 30  ILE B CG1   1 
ATOM 1457 C CG2   . ILE B 1 30  ? 43.639 60.895  64.801  1.00 174.15 ? 30  ILE B CG2   1 
ATOM 1458 C CD1   . ILE B 1 30  ? 41.259 61.716  63.194  1.00 187.61 ? 30  ILE B CD1   1 
ATOM 1459 N N     . ALA B 1 31  ? 45.936 58.767  63.139  1.00 169.63 ? 31  ALA B N     1 
ATOM 1460 C CA    . ALA B 1 31  ? 46.805 57.780  63.764  1.00 170.88 ? 31  ALA B CA    1 
ATOM 1461 C C     . ALA B 1 31  ? 46.836 56.532  62.896  1.00 161.96 ? 31  ALA B C     1 
ATOM 1462 O O     . ALA B 1 31  ? 45.958 56.315  62.061  1.00 163.59 ? 31  ALA B O     1 
ATOM 1463 C CB    . ALA B 1 31  ? 46.341 57.438  65.184  1.00 166.12 ? 31  ALA B CB    1 
ATOM 1464 N N     . ILE B 1 32  ? 47.874 55.725  63.082  1.00 150.95 ? 32  ILE B N     1 
ATOM 1465 C CA    . ILE B 1 32  ? 47.911 54.409  62.455  1.00 164.77 ? 32  ILE B CA    1 
ATOM 1466 C C     . ILE B 1 32  ? 48.667 53.471  63.385  1.00 170.37 ? 32  ILE B C     1 
ATOM 1467 O O     . ILE B 1 32  ? 49.818 53.736  63.751  1.00 175.95 ? 32  ILE B O     1 
ATOM 1468 C CB    . ILE B 1 32  ? 48.531 54.466  61.044  1.00 174.18 ? 32  ILE B CB    1 
ATOM 1469 C CG1   . ILE B 1 32  ? 48.628 53.065  60.437  1.00 145.21 ? 32  ILE B CG1   1 
ATOM 1470 C CG2   . ILE B 1 32  ? 49.884 55.174  61.056  1.00 179.03 ? 32  ILE B CG2   1 
ATOM 1471 C CD1   . ILE B 1 32  ? 48.842 53.075  58.941  1.00 144.65 ? 32  ILE B CD1   1 
ATOM 1472 N N     . GLU B 1 33  ? 48.026 52.378  63.794  1.00 190.85 ? 33  GLU B N     1 
ATOM 1473 C CA    . GLU B 1 33  ? 48.610 51.494  64.790  1.00 195.15 ? 33  GLU B CA    1 
ATOM 1474 C C     . GLU B 1 33  ? 48.245 50.054  64.469  1.00 195.10 ? 33  GLU B C     1 
ATOM 1475 O O     . GLU B 1 33  ? 47.440 49.771  63.579  1.00 207.99 ? 33  GLU B O     1 
ATOM 1476 C CB    . GLU B 1 33  ? 48.144 51.853  66.210  1.00 211.99 ? 33  GLU B CB    1 
ATOM 1477 C CG    . GLU B 1 33  ? 48.561 53.239  66.694  1.00 222.53 ? 33  GLU B CG    1 
ATOM 1478 C CD    . GLU B 1 33  ? 50.064 53.392  66.833  1.00 233.79 ? 33  GLU B CD    1 
ATOM 1479 O OE1   . GLU B 1 33  ? 50.753 52.373  67.053  1.00 232.84 ? 33  GLU B OE1   1 
ATOM 1480 O OE2   . GLU B 1 33  ? 50.557 54.534  66.716  1.00 226.04 ? 33  GLU B OE2   1 
ATOM 1481 N N     . LYS B 1 34  ? 48.853 49.138  65.215  1.00 190.72 ? 34  LYS B N     1 
ATOM 1482 C CA    . LYS B 1 34  ? 48.474 47.737  65.187  1.00 204.34 ? 34  LYS B CA    1 
ATOM 1483 C C     . LYS B 1 34  ? 48.401 47.217  66.616  1.00 177.23 ? 34  LYS B C     1 
ATOM 1484 O O     . LYS B 1 34  ? 49.156 47.646  67.493  1.00 167.78 ? 34  LYS B O     1 
ATOM 1485 C CB    . LYS B 1 34  ? 49.448 46.892  64.346  1.00 217.89 ? 34  LYS B CB    1 
ATOM 1486 C CG    . LYS B 1 34  ? 50.887 46.876  64.831  1.00 203.52 ? 34  LYS B CG    1 
ATOM 1487 C CD    . LYS B 1 34  ? 51.788 46.222  63.794  1.00 163.05 ? 34  LYS B CD    1 
ATOM 1488 C CE    . LYS B 1 34  ? 53.158 45.898  64.360  1.00 164.23 ? 34  LYS B CE    1 
ATOM 1489 N NZ    . LYS B 1 34  ? 54.108 45.471  63.294  1.00 157.09 ? 34  LYS B NZ    1 
ATOM 1490 N N     . SER B 1 35  ? 47.465 46.300  66.840  1.00 154.28 ? 35  SER B N     1 
ATOM 1491 C CA    . SER B 1 35  ? 47.214 45.747  68.162  1.00 147.08 ? 35  SER B CA    1 
ATOM 1492 C C     . SER B 1 35  ? 47.227 44.227  68.095  1.00 146.43 ? 35  SER B C     1 
ATOM 1493 O O     . SER B 1 35  ? 47.585 43.650  67.064  1.00 150.51 ? 35  SER B O     1 
ATOM 1494 C CB    . SER B 1 35  ? 45.882 46.252  68.718  1.00 143.29 ? 35  SER B CB    1 
ATOM 1495 O OG    . SER B 1 35  ? 44.799 45.809  67.923  1.00 158.46 ? 35  SER B OG    1 
ATOM 1496 N N     . ASP B 1 36  ? 46.875 43.573  69.196  1.00 143.81 ? 36  ASP B N     1 
ATOM 1497 C CA    . ASP B 1 36  ? 46.811 42.121  69.264  1.00 143.58 ? 36  ASP B CA    1 
ATOM 1498 C C     . ASP B 1 36  ? 45.482 41.717  69.882  1.00 157.11 ? 36  ASP B C     1 
ATOM 1499 O O     . ASP B 1 36  ? 45.122 42.206  70.958  1.00 158.40 ? 36  ASP B O     1 
ATOM 1500 C CB    . ASP B 1 36  ? 47.971 41.547  70.081  1.00 160.25 ? 36  ASP B CB    1 
ATOM 1501 C CG    . ASP B 1 36  ? 47.896 40.040  70.211  1.00 179.32 ? 36  ASP B CG    1 
ATOM 1502 O OD1   . ASP B 1 36  ? 47.297 39.397  69.324  1.00 186.91 ? 36  ASP B OD1   1 
ATOM 1503 O OD2   . ASP B 1 36  ? 48.427 39.500  71.203  1.00 197.49 ? 36  ASP B OD2   1 
ATOM 1504 N N     . TRP B 1 37  ? 44.759 40.830  69.205  1.00 160.50 ? 37  TRP B N     1 
ATOM 1505 C CA    . TRP B 1 37  ? 43.489 40.319  69.704  1.00 172.89 ? 37  TRP B CA    1 
ATOM 1506 C C     . TRP B 1 37  ? 43.639 38.827  69.983  1.00 190.16 ? 37  TRP B C     1 
ATOM 1507 O O     . TRP B 1 37  ? 43.118 37.977  69.260  1.00 192.11 ? 37  TRP B O     1 
ATOM 1508 C CB    . TRP B 1 37  ? 42.384 40.571  68.673  1.00 170.50 ? 37  TRP B CB    1 
ATOM 1509 C CG    . TRP B 1 37  ? 42.184 42.006  68.316  1.00 147.35 ? 37  TRP B CG    1 
ATOM 1510 C CD1   . TRP B 1 37  ? 42.591 43.096  69.024  1.00 149.44 ? 37  TRP B CD1   1 
ATOM 1511 C CD2   . TRP B 1 37  ? 41.562 42.508  67.128  1.00 139.68 ? 37  TRP B CD2   1 
ATOM 1512 N NE1   . TRP B 1 37  ? 42.241 44.247  68.363  1.00 157.53 ? 37  TRP B NE1   1 
ATOM 1513 C CE2   . TRP B 1 37  ? 41.611 43.913  67.193  1.00 140.57 ? 37  TRP B CE2   1 
ATOM 1514 C CE3   . TRP B 1 37  ? 40.964 41.904  66.018  1.00 133.59 ? 37  TRP B CE3   1 
ATOM 1515 C CZ2   . TRP B 1 37  ? 41.082 44.725  66.193  1.00 135.97 ? 37  TRP B CZ2   1 
ATOM 1516 C CZ3   . TRP B 1 37  ? 40.439 42.710  65.026  1.00 141.13 ? 37  TRP B CZ3   1 
ATOM 1517 C CH2   . TRP B 1 37  ? 40.502 44.106  65.120  1.00 139.53 ? 37  TRP B CH2   1 
ATOM 1518 N N     . THR B 1 38  ? 44.354 38.511  71.063  1.00 189.94 ? 38  THR B N     1 
ATOM 1519 C CA    . THR B 1 38  ? 44.576 37.128  71.473  1.00 176.48 ? 38  THR B CA    1 
ATOM 1520 C C     . THR B 1 38  ? 43.728 36.735  72.677  1.00 200.96 ? 38  THR B C     1 
ATOM 1521 O O     . THR B 1 38  ? 42.954 35.775  72.613  1.00 202.52 ? 38  THR B O     1 
ATOM 1522 C CB    . THR B 1 38  ? 46.062 36.908  71.774  1.00 177.04 ? 38  THR B CB    1 
ATOM 1523 O OG1   . THR B 1 38  ? 46.628 38.115  72.299  1.00 179.71 ? 38  THR B OG1   1 
ATOM 1524 C CG2   . THR B 1 38  ? 46.804 36.503  70.513  1.00 191.36 ? 38  THR B CG2   1 
ATOM 1525 N N     . LYS B 1 39  ? 43.863 37.465  73.781  1.00 227.36 ? 39  LYS B N     1 
ATOM 1526 C CA    . LYS B 1 39  ? 43.198 37.131  75.034  1.00 234.82 ? 39  LYS B CA    1 
ATOM 1527 C C     . LYS B 1 39  ? 41.937 37.973  75.169  1.00 220.79 ? 39  LYS B C     1 
ATOM 1528 O O     . LYS B 1 39  ? 42.013 39.206  75.210  1.00 219.31 ? 39  LYS B O     1 
ATOM 1529 C CB    . LYS B 1 39  ? 44.129 37.361  76.224  1.00 251.78 ? 39  LYS B CB    1 
ATOM 1530 C CG    . LYS B 1 39  ? 43.495 37.050  77.571  1.00 274.03 ? 39  LYS B CG    1 
ATOM 1531 C CD    . LYS B 1 39  ? 42.945 35.633  77.603  1.00 286.12 ? 39  LYS B CD    1 
ATOM 1532 C CE    . LYS B 1 39  ? 42.342 35.301  78.958  1.00 295.18 ? 39  LYS B CE    1 
ATOM 1533 N NZ    . LYS B 1 39  ? 43.358 35.348  80.046  1.00 305.95 ? 39  LYS B NZ    1 
ATOM 1534 N N     . ASN B 1 40  ? 40.788 37.304  75.246  1.00 184.19 ? 40  ASN B N     1 
ATOM 1535 C CA    . ASN B 1 40  ? 39.488 37.961  75.340  1.00 170.55 ? 40  ASN B CA    1 
ATOM 1536 C C     . ASN B 1 40  ? 39.336 38.999  74.225  1.00 169.92 ? 40  ASN B C     1 
ATOM 1537 O O     . ASN B 1 40  ? 39.263 40.207  74.451  1.00 205.42 ? 40  ASN B O     1 
ATOM 1538 C CB    . ASN B 1 40  ? 39.291 38.584  76.725  1.00 162.10 ? 40  ASN B CB    1 
ATOM 1539 C CG    . ASN B 1 40  ? 37.829 38.793  77.066  1.00 175.61 ? 40  ASN B CG    1 
ATOM 1540 O OD1   . ASN B 1 40  ? 37.016 39.114  76.199  1.00 167.55 ? 40  ASN B OD1   1 
ATOM 1541 N ND2   . ASN B 1 40  ? 37.484 38.598  78.334  1.00 182.74 ? 40  ASN B ND2   1 
ATOM 1542 N N     . TRP B 1 41  ? 39.303 38.471  72.998  1.00 144.17 ? 41  TRP B N     1 
ATOM 1543 C CA    . TRP B 1 41  ? 39.381 39.309  71.804  1.00 152.91 ? 41  TRP B CA    1 
ATOM 1544 C C     . TRP B 1 41  ? 38.242 40.319  71.720  1.00 158.90 ? 41  TRP B C     1 
ATOM 1545 O O     . TRP B 1 41  ? 38.400 41.371  71.089  1.00 139.22 ? 41  TRP B O     1 
ATOM 1546 C CB    . TRP B 1 41  ? 39.422 38.436  70.548  1.00 141.86 ? 41  TRP B CB    1 
ATOM 1547 C CG    . TRP B 1 41  ? 38.225 37.550  70.361  1.00 155.87 ? 41  TRP B CG    1 
ATOM 1548 C CD1   . TRP B 1 41  ? 38.105 36.248  70.753  1.00 162.01 ? 41  TRP B CD1   1 
ATOM 1549 C CD2   . TRP B 1 41  ? 36.971 37.906  69.765  1.00 147.96 ? 41  TRP B CD2   1 
ATOM 1550 N NE1   . TRP B 1 41  ? 36.863 35.765  70.419  1.00 160.31 ? 41  TRP B NE1   1 
ATOM 1551 C CE2   . TRP B 1 41  ? 36.146 36.764  69.815  1.00 144.13 ? 41  TRP B CE2   1 
ATOM 1552 C CE3   . TRP B 1 41  ? 36.466 39.077  69.193  1.00 141.10 ? 41  TRP B CE3   1 
ATOM 1553 C CZ2   . TRP B 1 41  ? 34.846 36.759  69.313  1.00 144.12 ? 41  TRP B CZ2   1 
ATOM 1554 C CZ3   . TRP B 1 41  ? 35.176 39.069  68.692  1.00 141.18 ? 41  TRP B CZ3   1 
ATOM 1555 C CH2   . TRP B 1 41  ? 34.381 37.918  68.757  1.00 142.64 ? 41  TRP B CH2   1 
ATOM 1556 N N     . GLU B 1 42  ? 37.089 40.023  72.327  1.00 163.46 ? 42  GLU B N     1 
ATOM 1557 C CA    . GLU B 1 42  ? 35.973 40.963  72.273  1.00 133.21 ? 42  GLU B CA    1 
ATOM 1558 C C     . GLU B 1 42  ? 36.318 42.277  72.965  1.00 138.69 ? 42  GLU B C     1 
ATOM 1559 O O     . GLU B 1 42  ? 36.023 43.358  72.436  1.00 158.19 ? 42  GLU B O     1 
ATOM 1560 C CB    . GLU B 1 42  ? 34.723 40.346  72.902  1.00 138.55 ? 42  GLU B CB    1 
ATOM 1561 C CG    . GLU B 1 42  ? 34.223 39.088  72.222  1.00 143.21 ? 42  GLU B CG    1 
ATOM 1562 C CD    . GLU B 1 42  ? 34.643 37.830  72.948  1.00 170.06 ? 42  GLU B CD    1 
ATOM 1563 O OE1   . GLU B 1 42  ? 35.535 37.914  73.819  1.00 191.56 ? 42  GLU B OE1   1 
ATOM 1564 O OE2   . GLU B 1 42  ? 34.075 36.757  72.653  1.00 181.73 ? 42  GLU B OE2   1 
ATOM 1565 N N     . ARG B 1 43  ? 36.935 42.208  74.149  1.00 141.94 ? 43  ARG B N     1 
ATOM 1566 C CA    . ARG B 1 43  ? 37.356 43.427  74.835  1.00 153.79 ? 43  ARG B CA    1 
ATOM 1567 C C     . ARG B 1 43  ? 38.307 44.242  73.971  1.00 163.79 ? 43  ARG B C     1 
ATOM 1568 O O     . ARG B 1 43  ? 38.158 45.464  73.843  1.00 193.68 ? 43  ARG B O     1 
ATOM 1569 C CB    . ARG B 1 43  ? 38.039 43.089  76.162  1.00 174.95 ? 43  ARG B CB    1 
ATOM 1570 C CG    . ARG B 1 43  ? 37.148 42.550  77.262  1.00 213.25 ? 43  ARG B CG    1 
ATOM 1571 C CD    . ARG B 1 43  ? 38.009 41.962  78.372  1.00 230.13 ? 43  ARG B CD    1 
ATOM 1572 N NE    . ARG B 1 43  ? 37.242 41.598  79.558  1.00 232.84 ? 43  ARG B NE    1 
ATOM 1573 C CZ    . ARG B 1 43  ? 37.785 41.125  80.676  1.00 236.38 ? 43  ARG B CZ    1 
ATOM 1574 N NH1   . ARG B 1 43  ? 39.098 40.962  80.757  1.00 232.77 ? 43  ARG B NH1   1 
ATOM 1575 N NH2   . ARG B 1 43  ? 37.018 40.817  81.712  1.00 252.35 ? 43  ARG B NH2   1 
ATOM 1576 N N     . SER B 1 44  ? 39.295 43.578  73.369  1.00 128.47 ? 44  SER B N     1 
ATOM 1577 C CA    . SER B 1 44  ? 40.284 44.288  72.566  1.00 139.91 ? 44  SER B CA    1 
ATOM 1578 C C     . SER B 1 44  ? 39.647 44.932  71.341  1.00 127.93 ? 44  SER B C     1 
ATOM 1579 O O     . SER B 1 44  ? 39.961 46.080  71.001  1.00 124.54 ? 44  SER B O     1 
ATOM 1580 C CB    . SER B 1 44  ? 41.402 43.330  72.157  1.00 146.17 ? 44  SER B CB    1 
ATOM 1581 O OG    . SER B 1 44  ? 41.943 42.670  73.289  1.00 173.27 ? 44  SER B OG    1 
ATOM 1582 N N     . VAL B 1 45  ? 38.736 44.219  70.677  1.00 133.13 ? 45  VAL B N     1 
ATOM 1583 C CA    . VAL B 1 45  ? 38.061 44.780  69.509  1.00 127.39 ? 45  VAL B CA    1 
ATOM 1584 C C     . VAL B 1 45  ? 37.247 46.002  69.909  1.00 144.70 ? 45  VAL B C     1 
ATOM 1585 O O     . VAL B 1 45  ? 37.336 47.065  69.279  1.00 163.42 ? 45  VAL B O     1 
ATOM 1586 C CB    . VAL B 1 45  ? 37.186 43.712  68.828  1.00 125.51 ? 45  VAL B CB    1 
ATOM 1587 C CG1   . VAL B 1 45  ? 36.144 44.366  67.935  1.00 148.05 ? 45  VAL B CG1   1 
ATOM 1588 C CG2   . VAL B 1 45  ? 38.046 42.758  68.023  1.00 124.09 ? 45  VAL B CG2   1 
ATOM 1589 N N     . ALA B 1 46  ? 36.456 45.876  70.979  1.00 142.15 ? 46  ALA B N     1 
ATOM 1590 C CA    . ALA B 1 46  ? 35.629 46.991  71.425  1.00 146.41 ? 46  ALA B CA    1 
ATOM 1591 C C     . ALA B 1 46  ? 36.480 48.209  71.762  1.00 151.31 ? 46  ALA B C     1 
ATOM 1592 O O     . ALA B 1 46  ? 36.183 49.329  71.325  1.00 181.58 ? 46  ALA B O     1 
ATOM 1593 C CB    . ALA B 1 46  ? 34.792 46.567  72.631  1.00 149.16 ? 46  ALA B CB    1 
ATOM 1594 N N     . ARG B 1 47  ? 37.560 48.006  72.518  1.00 142.51 ? 47  ARG B N     1 
ATOM 1595 C CA    . ARG B 1 47  ? 38.391 49.131  72.937  1.00 154.65 ? 47  ARG B CA    1 
ATOM 1596 C C     . ARG B 1 47  ? 39.090 49.781  71.747  1.00 146.85 ? 47  ARG B C     1 
ATOM 1597 O O     . ARG B 1 47  ? 39.062 51.010  71.595  1.00 147.34 ? 47  ARG B O     1 
ATOM 1598 C CB    . ARG B 1 47  ? 39.403 48.665  73.986  1.00 161.32 ? 47  ARG B CB    1 
ATOM 1599 C CG    . ARG B 1 47  ? 38.749 48.205  75.282  1.00 174.61 ? 47  ARG B CG    1 
ATOM 1600 C CD    . ARG B 1 47  ? 39.656 47.301  76.099  1.00 190.74 ? 47  ARG B CD    1 
ATOM 1601 N NE    . ARG B 1 47  ? 40.708 48.039  76.791  1.00 219.58 ? 47  ARG B NE    1 
ATOM 1602 C CZ    . ARG B 1 47  ? 41.516 47.505  77.701  1.00 248.33 ? 47  ARG B CZ    1 
ATOM 1603 N NH1   . ARG B 1 47  ? 41.392 46.226  78.032  1.00 255.59 ? 47  ARG B NH1   1 
ATOM 1604 N NH2   . ARG B 1 47  ? 42.446 48.249  78.284  1.00 255.15 ? 47  ARG B NH2   1 
ATOM 1605 N N     . ASP B 1 48  ? 39.713 48.974  70.882  1.00 153.80 ? 48  ASP B N     1 
ATOM 1606 C CA    . ASP B 1 48  ? 40.428 49.535  69.742  1.00 150.64 ? 48  ASP B CA    1 
ATOM 1607 C C     . ASP B 1 48  ? 39.490 50.249  68.779  1.00 169.97 ? 48  ASP B C     1 
ATOM 1608 O O     . ASP B 1 48  ? 39.899 51.213  68.120  1.00 169.62 ? 48  ASP B O     1 
ATOM 1609 C CB    . ASP B 1 48  ? 41.206 48.440  69.011  1.00 148.89 ? 48  ASP B CB    1 
ATOM 1610 C CG    . ASP B 1 48  ? 42.396 47.943  69.806  1.00 168.19 ? 48  ASP B CG    1 
ATOM 1611 O OD1   . ASP B 1 48  ? 42.966 48.740  70.580  1.00 193.62 ? 48  ASP B OD1   1 
ATOM 1612 O OD2   . ASP B 1 48  ? 42.765 46.760  69.653  1.00 183.83 ? 48  ASP B OD2   1 
ATOM 1613 N N     . LEU B 1 49  ? 38.236 49.800  68.673  1.00 125.09 ? 49  LEU B N     1 
ATOM 1614 C CA    . LEU B 1 49  ? 37.335 50.447  67.728  1.00 128.40 ? 49  LEU B CA    1 
ATOM 1615 C C     . LEU B 1 49  ? 36.668 51.685  68.317  1.00 129.25 ? 49  LEU B C     1 
ATOM 1616 O O     . LEU B 1 49  ? 36.380 52.633  67.579  1.00 131.30 ? 49  LEU B O     1 
ATOM 1617 C CB    . LEU B 1 49  ? 36.281 49.452  67.246  1.00 136.94 ? 49  LEU B CB    1 
ATOM 1618 C CG    . LEU B 1 49  ? 36.844 48.309  66.396  1.00 159.85 ? 49  LEU B CG    1 
ATOM 1619 C CD1   . LEU B 1 49  ? 35.719 47.503  65.777  1.00 189.09 ? 49  LEU B CD1   1 
ATOM 1620 C CD2   . LEU B 1 49  ? 37.808 48.818  65.334  1.00 138.20 ? 49  LEU B CD2   1 
ATOM 1621 N N     . THR B 1 50  ? 36.429 51.710  69.627  1.00 148.78 ? 50  THR B N     1 
ATOM 1622 C CA    . THR B 1 50  ? 35.845 52.872  70.283  1.00 135.75 ? 50  THR B CA    1 
ATOM 1623 C C     . THR B 1 50  ? 36.887 53.872  70.767  1.00 154.85 ? 50  THR B C     1 
ATOM 1624 O O     . THR B 1 50  ? 36.518 54.886  71.370  1.00 173.99 ? 50  THR B O     1 
ATOM 1625 C CB    . THR B 1 50  ? 34.974 52.424  71.457  1.00 136.88 ? 50  THR B CB    1 
ATOM 1626 O OG1   . THR B 1 50  ? 35.756 51.622  72.350  1.00 137.53 ? 50  THR B OG1   1 
ATOM 1627 C CG2   . THR B 1 50  ? 33.797 51.608  70.958  1.00 136.14 ? 50  THR B CG2   1 
ATOM 1628 N N     . ARG B 1 51  ? 38.171 53.603  70.519  1.00 154.70 ? 51  ARG B N     1 
ATOM 1629 C CA    . ARG B 1 51  ? 39.245 54.482  70.977  1.00 166.03 ? 51  ARG B CA    1 
ATOM 1630 C C     . ARG B 1 51  ? 39.049 55.935  70.544  1.00 157.77 ? 51  ARG B C     1 
ATOM 1631 O O     . ARG B 1 51  ? 39.136 56.852  71.368  1.00 132.33 ? 51  ARG B O     1 
ATOM 1632 C CB    . ARG B 1 51  ? 40.589 53.948  70.478  1.00 147.91 ? 51  ARG B CB    1 
ATOM 1633 C CG    . ARG B 1 51  ? 41.796 54.724  70.972  1.00 153.34 ? 51  ARG B CG    1 
ATOM 1634 C CD    . ARG B 1 51  ? 43.087 54.006  70.610  1.00 179.70 ? 51  ARG B CD    1 
ATOM 1635 N NE    . ARG B 1 51  ? 43.127 52.647  71.142  1.00 193.29 ? 51  ARG B NE    1 
ATOM 1636 C CZ    . ARG B 1 51  ? 43.548 52.335  72.364  1.00 199.17 ? 51  ARG B CZ    1 
ATOM 1637 N NH1   . ARG B 1 51  ? 43.550 51.071  72.765  1.00 205.46 ? 51  ARG B NH1   1 
ATOM 1638 N NH2   . ARG B 1 51  ? 43.972 53.287  73.184  1.00 193.91 ? 51  ARG B NH2   1 
ATOM 1639 N N     . TYR B 1 52  ? 38.785 56.172  69.257  1.00 131.98 ? 52  TYR B N     1 
ATOM 1640 C CA    . TYR B 1 52  ? 38.642 57.534  68.752  1.00 133.53 ? 52  TYR B CA    1 
ATOM 1641 C C     . TYR B 1 52  ? 37.215 57.914  68.368  1.00 152.77 ? 52  TYR B C     1 
ATOM 1642 O O     . TYR B 1 52  ? 37.023 58.926  67.684  1.00 139.35 ? 52  TYR B O     1 
ATOM 1643 C CB    . TYR B 1 52  ? 39.566 57.759  67.555  1.00 137.80 ? 52  TYR B CB    1 
ATOM 1644 C CG    . TYR B 1 52  ? 41.019 57.428  67.797  1.00 141.71 ? 52  TYR B CG    1 
ATOM 1645 C CD1   . TYR B 1 52  ? 41.863 58.356  68.390  1.00 151.92 ? 52  TYR B CD1   1 
ATOM 1646 C CD2   . TYR B 1 52  ? 41.550 56.202  67.428  1.00 165.86 ? 52  TYR B CD2   1 
ATOM 1647 C CE1   . TYR B 1 52  ? 43.193 58.075  68.611  1.00 148.64 ? 52  TYR B CE1   1 
ATOM 1648 C CE2   . TYR B 1 52  ? 42.884 55.910  67.645  1.00 178.94 ? 52  TYR B CE2   1 
ATOM 1649 C CZ    . TYR B 1 52  ? 43.700 56.852  68.239  1.00 151.22 ? 52  TYR B CZ    1 
ATOM 1650 O OH    . TYR B 1 52  ? 45.028 56.577  68.464  1.00 167.95 ? 52  TYR B OH    1 
ATOM 1651 N N     . ASN B 1 53  ? 36.211 57.152  68.814  1.00 151.36 ? 53  ASN B N     1 
ATOM 1652 C CA    . ASN B 1 53  ? 34.810 57.398  68.476  1.00 128.07 ? 53  ASN B CA    1 
ATOM 1653 C C     . ASN B 1 53  ? 34.631 57.737  67.002  1.00 127.72 ? 53  ASN B C     1 
ATOM 1654 O O     . ASN B 1 53  ? 34.400 58.906  66.667  1.00 180.18 ? 53  ASN B O     1 
ATOM 1655 C CB    . ASN B 1 53  ? 34.241 58.551  69.308  1.00 135.91 ? 53  ASN B CB    1 
ATOM 1656 C CG    . ASN B 1 53  ? 34.352 58.319  70.797  1.00 158.59 ? 53  ASN B CG    1 
ATOM 1657 O OD1   . ASN B 1 53  ? 34.785 57.259  71.250  1.00 208.24 ? 53  ASN B OD1   1 
ATOM 1658 N ND2   . ASN B 1 53  ? 33.962 59.322  71.571  1.00 125.67 ? 53  ASN B ND2   1 
ATOM 1659 N N     . PRO B 1 54  ? 34.706 56.773  66.098  1.00 128.36 ? 54  PRO B N     1 
ATOM 1660 C CA    . PRO B 1 54  ? 34.676 57.097  64.673  1.00 127.94 ? 54  PRO B CA    1 
ATOM 1661 C C     . PRO B 1 54  ? 33.243 57.179  64.160  1.00 140.98 ? 54  PRO B C     1 
ATOM 1662 O O     . PRO B 1 54  ? 32.285 56.798  64.834  1.00 164.20 ? 54  PRO B O     1 
ATOM 1663 C CB    . PRO B 1 54  ? 35.431 55.921  64.043  1.00 137.99 ? 54  PRO B CB    1 
ATOM 1664 C CG    . PRO B 1 54  ? 35.100 54.768  64.931  1.00 123.34 ? 54  PRO B CG    1 
ATOM 1665 C CD    . PRO B 1 54  ? 34.885 55.328  66.327  1.00 141.28 ? 54  PRO B CD    1 
ATOM 1666 N N     . ASP B 1 55  ? 33.117 57.690  62.939  1.00 140.16 ? 55  ASP B N     1 
ATOM 1667 C CA    . ASP B 1 55  ? 31.832 57.745  62.258  1.00 138.99 ? 55  ASP B CA    1 
ATOM 1668 C C     . ASP B 1 55  ? 31.652 56.619  61.257  1.00 130.66 ? 55  ASP B C     1 
ATOM 1669 O O     . ASP B 1 55  ? 30.517 56.205  61.003  1.00 148.84 ? 55  ASP B O     1 
ATOM 1670 C CB    . ASP B 1 55  ? 31.659 59.088  61.538  1.00 147.32 ? 55  ASP B CB    1 
ATOM 1671 C CG    . ASP B 1 55  ? 31.498 60.249  62.498  1.00 153.99 ? 55  ASP B CG    1 
ATOM 1672 O OD1   . ASP B 1 55  ? 30.749 60.099  63.484  1.00 181.94 ? 55  ASP B OD1   1 
ATOM 1673 O OD2   . ASP B 1 55  ? 32.112 61.312  62.264  1.00 150.33 ? 55  ASP B OD2   1 
ATOM 1674 N N     . VAL B 1 56  ? 32.740 56.106  60.697  1.00 124.35 ? 56  VAL B N     1 
ATOM 1675 C CA    . VAL B 1 56  ? 32.696 54.990  59.764  1.00 147.85 ? 56  VAL B CA    1 
ATOM 1676 C C     . VAL B 1 56  ? 33.754 53.984  60.188  1.00 138.51 ? 56  VAL B C     1 
ATOM 1677 O O     . VAL B 1 56  ? 34.845 54.365  60.627  1.00 130.96 ? 56  VAL B O     1 
ATOM 1678 C CB    . VAL B 1 56  ? 32.932 55.456  58.308  1.00 127.90 ? 56  VAL B CB    1 
ATOM 1679 C CG1   . VAL B 1 56  ? 33.019 54.270  57.359  1.00 127.85 ? 56  VAL B CG1   1 
ATOM 1680 C CG2   . VAL B 1 56  ? 31.839 56.416  57.861  1.00 127.42 ? 56  VAL B CG2   1 
ATOM 1681 N N     . VAL B 1 57  ? 33.423 52.702  60.070  1.00 128.31 ? 57  VAL B N     1 
ATOM 1682 C CA    . VAL B 1 57  ? 34.359 51.612  60.310  1.00 122.98 ? 57  VAL B CA    1 
ATOM 1683 C C     . VAL B 1 57  ? 34.440 50.802  59.028  1.00 153.95 ? 57  VAL B C     1 
ATOM 1684 O O     . VAL B 1 57  ? 33.414 50.344  58.509  1.00 184.23 ? 57  VAL B O     1 
ATOM 1685 C CB    . VAL B 1 57  ? 33.932 50.734  61.496  1.00 118.84 ? 57  VAL B CB    1 
ATOM 1686 C CG1   . VAL B 1 57  ? 34.892 49.569  61.661  1.00 120.60 ? 57  VAL B CG1   1 
ATOM 1687 C CG2   . VAL B 1 57  ? 33.874 51.565  62.769  1.00 118.04 ? 57  VAL B CG2   1 
ATOM 1688 N N     . ILE B 1 58  ? 35.653 50.634  58.513  1.00 148.51 ? 58  ILE B N     1 
ATOM 1689 C CA    . ILE B 1 58  ? 35.892 49.951  57.249  1.00 158.16 ? 58  ILE B CA    1 
ATOM 1690 C C     . ILE B 1 58  ? 36.558 48.615  57.535  1.00 151.25 ? 58  ILE B C     1 
ATOM 1691 O O     . ILE B 1 58  ? 37.578 48.560  58.233  1.00 170.25 ? 58  ILE B O     1 
ATOM 1692 C CB    . ILE B 1 58  ? 36.756 50.803  56.308  1.00 152.52 ? 58  ILE B CB    1 
ATOM 1693 C CG1   . ILE B 1 58  ? 36.168 52.203  56.185  1.00 143.13 ? 58  ILE B CG1   1 
ATOM 1694 C CG2   . ILE B 1 58  ? 36.832 50.160  54.939  1.00 171.54 ? 58  ILE B CG2   1 
ATOM 1695 C CD1   . ILE B 1 58  ? 37.122 53.177  55.584  1.00 154.43 ? 58  ILE B CD1   1 
ATOM 1696 N N     . LEU B 1 59  ? 35.985 47.545  56.999  1.00 147.12 ? 59  LEU B N     1 
ATOM 1697 C CA    . LEU B 1 59  ? 36.546 46.213  57.138  1.00 164.18 ? 59  LEU B CA    1 
ATOM 1698 C C     . LEU B 1 59  ? 36.798 45.639  55.751  1.00 183.85 ? 59  LEU B C     1 
ATOM 1699 O O     . LEU B 1 59  ? 36.149 46.028  54.775  1.00 177.20 ? 59  LEU B O     1 
ATOM 1700 C CB    . LEU B 1 59  ? 35.607 45.301  57.932  1.00 150.74 ? 59  LEU B CB    1 
ATOM 1701 C CG    . LEU B 1 59  ? 35.066 45.915  59.226  1.00 132.75 ? 59  LEU B CG    1 
ATOM 1702 C CD1   . LEU B 1 59  ? 34.063 44.986  59.889  1.00 116.30 ? 59  LEU B CD1   1 
ATOM 1703 C CD2   . LEU B 1 59  ? 36.197 46.270  60.179  1.00 124.72 ? 59  LEU B CD2   1 
ATOM 1704 N N     . GLU B 1 60  ? 37.749 44.715  55.665  1.00 194.86 ? 60  GLU B N     1 
ATOM 1705 C CA    . GLU B 1 60  ? 38.080 44.063  54.406  1.00 204.13 ? 60  GLU B CA    1 
ATOM 1706 C C     . GLU B 1 60  ? 37.473 42.665  54.376  1.00 191.61 ? 60  GLU B C     1 
ATOM 1707 O O     . GLU B 1 60  ? 37.651 41.882  55.314  1.00 211.77 ? 60  GLU B O     1 
ATOM 1708 C CB    . GLU B 1 60  ? 39.595 44.030  54.195  1.00 223.63 ? 60  GLU B CB    1 
ATOM 1709 C CG    . GLU B 1 60  ? 40.020 43.662  52.782  1.00 227.34 ? 60  GLU B CG    1 
ATOM 1710 C CD    . GLU B 1 60  ? 41.476 43.252  52.697  1.00 237.28 ? 60  GLU B CD    1 
ATOM 1711 O OE1   . GLU B 1 60  ? 42.180 43.333  53.726  1.00 248.98 ? 60  GLU B OE1   1 
ATOM 1712 O OE2   . GLU B 1 60  ? 41.923 42.871  51.595  1.00 236.86 ? 60  GLU B OE2   1 
ATOM 1713 N N     . LYS B 1 61  ? 36.746 42.372  53.302  1.00 167.08 ? 61  LYS B N     1 
ATOM 1714 C CA    . LYS B 1 61  ? 36.006 41.124  53.175  1.00 189.11 ? 61  LYS B CA    1 
ATOM 1715 C C     . LYS B 1 61  ? 36.918 39.905  53.075  1.00 210.24 ? 61  LYS B C     1 
ATOM 1716 O O     . LYS B 1 61  ? 37.925 39.913  52.361  1.00 171.79 ? 61  LYS B O     1 
ATOM 1717 C CB    . LYS B 1 61  ? 35.108 41.173  51.942  1.00 206.19 ? 61  LYS B CB    1 
ATOM 1718 C CG    . LYS B 1 61  ? 34.268 39.927  51.753  1.00 219.70 ? 61  LYS B CG    1 
ATOM 1719 C CD    . LYS B 1 61  ? 33.480 40.005  50.470  1.00 238.54 ? 61  LYS B CD    1 
ATOM 1720 C CE    . LYS B 1 61  ? 34.411 39.812  49.282  1.00 256.42 ? 61  LYS B CE    1 
ATOM 1721 N NZ    . LYS B 1 61  ? 35.058 38.468  49.289  1.00 227.54 ? 61  LYS B NZ    1 
ATOM 1722 N N     . GLN B 1 62  ? 36.551 38.852  53.801  1.00 237.74 ? 62  GLN B N     1 
ATOM 1723 C CA    . GLN B 1 62  ? 37.203 37.552  53.751  1.00 264.73 ? 62  GLN B CA    1 
ATOM 1724 C C     . GLN B 1 62  ? 36.194 36.526  53.253  1.00 281.75 ? 62  GLN B C     1 
ATOM 1725 O O     . GLN B 1 62  ? 34.983 36.760  53.272  1.00 294.38 ? 62  GLN B O     1 
ATOM 1726 C CB    . GLN B 1 62  ? 37.764 37.117  55.114  1.00 251.40 ? 62  GLN B CB    1 
ATOM 1727 C CG    . GLN B 1 62  ? 38.721 38.102  55.758  1.00 223.66 ? 62  GLN B CG    1 
ATOM 1728 C CD    . GLN B 1 62  ? 38.011 39.170  56.556  1.00 225.91 ? 62  GLN B CD    1 
ATOM 1729 O OE1   . GLN B 1 62  ? 36.782 39.215  56.599  1.00 231.66 ? 62  GLN B OE1   1 
ATOM 1730 N NE2   . GLN B 1 62  ? 38.784 40.038  57.197  1.00 232.87 ? 62  GLN B NE2   1 
ATOM 1731 N N     . GLY B 1 63  ? 36.696 35.384  52.796  1.00 274.01 ? 63  GLY B N     1 
ATOM 1732 C CA    . GLY B 1 63  ? 35.824 34.318  52.355  1.00 282.59 ? 63  GLY B CA    1 
ATOM 1733 C C     . GLY B 1 63  ? 35.101 33.660  53.518  1.00 302.87 ? 63  GLY B C     1 
ATOM 1734 O O     . GLY B 1 63  ? 35.239 34.036  54.682  1.00 286.79 ? 63  GLY B O     1 
ATOM 1735 N N     . PHE B 1 64  ? 34.314 32.637  53.185  1.00 318.75 ? 64  PHE B N     1 
ATOM 1736 C CA    . PHE B 1 64  ? 33.500 31.965  54.191  1.00 324.68 ? 64  PHE B CA    1 
ATOM 1737 C C     . PHE B 1 64  ? 34.297 31.009  55.065  1.00 325.57 ? 64  PHE B C     1 
ATOM 1738 O O     . PHE B 1 64  ? 33.703 30.328  55.907  1.00 335.83 ? 64  PHE B O     1 
ATOM 1739 C CB    . PHE B 1 64  ? 32.350 31.194  53.530  1.00 329.59 ? 64  PHE B CB    1 
ATOM 1740 C CG    . PHE B 1 64  ? 32.791 30.232  52.459  1.00 337.31 ? 64  PHE B CG    1 
ATOM 1741 C CD1   . PHE B 1 64  ? 33.017 30.660  51.161  1.00 335.60 ? 64  PHE B CD1   1 
ATOM 1742 C CD2   . PHE B 1 64  ? 32.968 28.890  52.757  1.00 347.92 ? 64  PHE B CD2   1 
ATOM 1743 C CE1   . PHE B 1 64  ? 33.419 29.767  50.183  1.00 347.38 ? 64  PHE B CE1   1 
ATOM 1744 C CE2   . PHE B 1 64  ? 33.369 27.994  51.785  1.00 349.29 ? 64  PHE B CE2   1 
ATOM 1745 C CZ    . PHE B 1 64  ? 33.595 28.432  50.497  1.00 350.59 ? 64  PHE B CZ    1 
ATOM 1746 N N     . LYS B 1 65  ? 35.619 30.939  54.893  1.00 314.19 ? 65  LYS B N     1 
ATOM 1747 C CA    . LYS B 1 65  ? 36.469 30.013  55.644  1.00 307.45 ? 65  LYS B CA    1 
ATOM 1748 C C     . LYS B 1 65  ? 37.639 30.796  56.242  1.00 287.20 ? 65  LYS B C     1 
ATOM 1749 O O     . LYS B 1 65  ? 38.736 30.823  55.679  1.00 300.27 ? 65  LYS B O     1 
ATOM 1750 C CB    . LYS B 1 65  ? 36.943 28.868  54.740  1.00 323.92 ? 65  LYS B CB    1 
ATOM 1751 C CG    . LYS B 1 65  ? 36.794 29.143  53.243  1.00 325.06 ? 65  LYS B CG    1 
ATOM 1752 C CD    . LYS B 1 65  ? 37.840 30.125  52.729  1.00 309.68 ? 65  LYS B CD    1 
ATOM 1753 C CE    . LYS B 1 65  ? 37.567 30.522  51.286  1.00 306.86 ? 65  LYS B CE    1 
ATOM 1754 N NZ    . LYS B 1 65  ? 36.265 31.230  51.140  1.00 306.32 ? 65  LYS B NZ    1 
ATOM 1755 N N     . SER B 1 66  ? 37.398 31.412  57.403  1.00 250.25 ? 66  SER B N     1 
ATOM 1756 C CA    . SER B 1 66  ? 38.420 32.113  58.172  1.00 203.16 ? 66  SER B CA    1 
ATOM 1757 C C     . SER B 1 66  ? 37.842 32.577  59.502  1.00 204.50 ? 66  SER B C     1 
ATOM 1758 O O     . SER B 1 66  ? 36.637 32.841  59.594  1.00 248.50 ? 66  SER B O     1 
ATOM 1759 C CB    . SER B 1 66  ? 38.958 33.317  57.394  1.00 212.54 ? 66  SER B CB    1 
ATOM 1760 O OG    . SER B 1 66  ? 37.902 34.178  57.000  1.00 187.90 ? 66  SER B OG    1 
ATOM 1761 N N     . PRO B 1 67  ? 38.657 32.687  60.556  1.00 166.16 ? 67  PRO B N     1 
ATOM 1762 C CA    . PRO B 1 67  ? 38.157 33.274  61.809  1.00 186.44 ? 67  PRO B CA    1 
ATOM 1763 C C     . PRO B 1 67  ? 37.914 34.772  61.723  1.00 198.70 ? 67  PRO B C     1 
ATOM 1764 O O     . PRO B 1 67  ? 37.253 35.322  62.613  1.00 204.16 ? 67  PRO B O     1 
ATOM 1765 C CB    . PRO B 1 67  ? 39.271 32.957  62.817  1.00 172.31 ? 67  PRO B CB    1 
ATOM 1766 C CG    . PRO B 1 67  ? 40.069 31.859  62.190  1.00 172.09 ? 67  PRO B CG    1 
ATOM 1767 C CD    . PRO B 1 67  ? 40.001 32.114  60.717  1.00 173.37 ? 67  PRO B CD    1 
ATOM 1768 N N     . ASN B 1 68  ? 38.434 35.445  60.692  1.00 183.77 ? 68  ASN B N     1 
ATOM 1769 C CA    . ASN B 1 68  ? 38.196 36.877  60.532  1.00 163.46 ? 68  ASN B CA    1 
ATOM 1770 C C     . ASN B 1 68  ? 36.724 37.189  60.296  1.00 166.23 ? 68  ASN B C     1 
ATOM 1771 O O     . ASN B 1 68  ? 36.273 38.303  60.585  1.00 171.72 ? 68  ASN B O     1 
ATOM 1772 C CB    . ASN B 1 68  ? 39.051 37.425  59.390  1.00 173.14 ? 68  ASN B CB    1 
ATOM 1773 C CG    . ASN B 1 68  ? 40.535 37.258  59.645  1.00 175.58 ? 68  ASN B CG    1 
ATOM 1774 O OD1   . ASN B 1 68  ? 40.943 36.532  60.553  1.00 185.08 ? 68  ASN B OD1   1 
ATOM 1775 N ND2   . ASN B 1 68  ? 41.353 37.936  58.848  1.00 158.49 ? 68  ASN B ND2   1 
ATOM 1776 N N     . SER B 1 69  ? 35.964 36.229  59.763  1.00 166.10 ? 69  SER B N     1 
ATOM 1777 C CA    . SER B 1 69  ? 34.533 36.438  59.560  1.00 169.51 ? 69  SER B CA    1 
ATOM 1778 C C     . SER B 1 69  ? 33.804 36.593  60.888  1.00 176.59 ? 69  SER B C     1 
ATOM 1779 O O     . SER B 1 69  ? 32.852 37.376  60.993  1.00 173.22 ? 69  SER B O     1 
ATOM 1780 C CB    . SER B 1 69  ? 33.940 35.281  58.755  1.00 176.63 ? 69  SER B CB    1 
ATOM 1781 O OG    . SER B 1 69  ? 34.067 34.055  59.453  1.00 176.96 ? 69  SER B OG    1 
ATOM 1782 N N     . LYS B 1 70  ? 34.232 35.846  61.908  1.00 182.29 ? 70  LYS B N     1 
ATOM 1783 C CA    . LYS B 1 70  ? 33.618 35.945  63.228  1.00 188.90 ? 70  LYS B CA    1 
ATOM 1784 C C     . LYS B 1 70  ? 33.780 37.336  63.835  1.00 174.10 ? 70  LYS B C     1 
ATOM 1785 O O     . LYS B 1 70  ? 32.881 37.816  64.535  1.00 180.12 ? 70  LYS B O     1 
ATOM 1786 C CB    . LYS B 1 70  ? 34.221 34.873  64.141  1.00 189.78 ? 70  LYS B CB    1 
ATOM 1787 C CG    . LYS B 1 70  ? 34.532 35.319  65.558  1.00 204.22 ? 70  LYS B CG    1 
ATOM 1788 C CD    . LYS B 1 70  ? 35.330 34.259  66.305  1.00 173.19 ? 70  LYS B CD    1 
ATOM 1789 C CE    . LYS B 1 70  ? 36.706 34.065  65.690  1.00 158.82 ? 70  LYS B CE    1 
ATOM 1790 N NZ    . LYS B 1 70  ? 37.509 33.061  66.441  1.00 179.47 ? 70  LYS B NZ    1 
ATOM 1791 N N     . ILE B 1 71  ? 34.908 37.999  63.573  1.00 166.70 ? 71  ILE B N     1 
ATOM 1792 C CA    . ILE B 1 71  ? 35.108 39.365  64.052  1.00 157.55 ? 71  ILE B CA    1 
ATOM 1793 C C     . ILE B 1 71  ? 34.178 40.335  63.330  1.00 162.32 ? 71  ILE B C     1 
ATOM 1794 O O     . ILE B 1 71  ? 33.673 41.298  63.925  1.00 163.23 ? 71  ILE B O     1 
ATOM 1795 C CB    . ILE B 1 71  ? 36.582 39.774  63.875  1.00 176.29 ? 71  ILE B CB    1 
ATOM 1796 C CG1   . ILE B 1 71  ? 37.515 38.729  64.487  1.00 194.45 ? 71  ILE B CG1   1 
ATOM 1797 C CG2   . ILE B 1 71  ? 36.836 41.131  64.512  1.00 152.54 ? 71  ILE B CG2   1 
ATOM 1798 C CD1   . ILE B 1 71  ? 37.319 38.515  65.954  1.00 192.08 ? 71  ILE B CD1   1 
ATOM 1799 N N     . ILE B 1 72  ? 33.942 40.096  62.037  1.00 161.74 ? 72  ILE B N     1 
ATOM 1800 C CA    . ILE B 1 72  ? 33.135 40.999  61.219  1.00 143.62 ? 72  ILE B CA    1 
ATOM 1801 C C     . ILE B 1 72  ? 31.746 41.178  61.820  1.00 134.07 ? 72  ILE B C     1 
ATOM 1802 O O     . ILE B 1 72  ? 31.276 42.304  62.025  1.00 137.42 ? 72  ILE B O     1 
ATOM 1803 C CB    . ILE B 1 72  ? 33.046 40.462  59.777  1.00 146.57 ? 72  ILE B CB    1 
ATOM 1804 C CG1   . ILE B 1 72  ? 34.391 40.596  59.054  1.00 156.83 ? 72  ILE B CG1   1 
ATOM 1805 C CG2   . ILE B 1 72  ? 31.939 41.169  59.006  1.00 152.41 ? 72  ILE B CG2   1 
ATOM 1806 C CD1   . ILE B 1 72  ? 34.525 41.830  58.195  1.00 167.00 ? 72  ILE B CD1   1 
ATOM 1807 N N     . TYR B 1 73  ? 31.071 40.068  62.117  1.00 145.87 ? 73  TYR B N     1 
ATOM 1808 C CA    . TYR B 1 73  ? 29.702 40.149  62.614  1.00 137.76 ? 73  TYR B CA    1 
ATOM 1809 C C     . TYR B 1 73  ? 29.649 40.651  64.048  1.00 137.47 ? 73  TYR B C     1 
ATOM 1810 O O     . TYR B 1 73  ? 28.679 41.312  64.434  1.00 150.86 ? 73  TYR B O     1 
ATOM 1811 C CB    . TYR B 1 73  ? 29.023 38.792  62.459  1.00 149.13 ? 73  TYR B CB    1 
ATOM 1812 C CG    . TYR B 1 73  ? 28.856 38.464  60.999  1.00 160.36 ? 73  TYR B CG    1 
ATOM 1813 C CD1   . TYR B 1 73  ? 27.941 39.152  60.216  1.00 160.78 ? 73  TYR B CD1   1 
ATOM 1814 C CD2   . TYR B 1 73  ? 29.654 37.507  60.389  1.00 152.17 ? 73  TYR B CD2   1 
ATOM 1815 C CE1   . TYR B 1 73  ? 27.805 38.875  58.873  1.00 173.35 ? 73  TYR B CE1   1 
ATOM 1816 C CE2   . TYR B 1 73  ? 29.524 37.222  59.049  1.00 143.48 ? 73  TYR B CE2   1 
ATOM 1817 C CZ    . TYR B 1 73  ? 28.598 37.909  58.297  1.00 147.25 ? 73  TYR B CZ    1 
ATOM 1818 O OH    . TYR B 1 73  ? 28.466 37.632  56.960  1.00 188.12 ? 73  TYR B OH    1 
ATOM 1819 N N     . PHE B 1 74  ? 30.678 40.362  64.847  1.00 133.49 ? 74  PHE B N     1 
ATOM 1820 C CA    . PHE B 1 74  ? 30.755 40.963  66.173  1.00 149.83 ? 74  PHE B CA    1 
ATOM 1821 C C     . PHE B 1 74  ? 30.807 42.480  66.073  1.00 152.06 ? 74  PHE B C     1 
ATOM 1822 O O     . PHE B 1 74  ? 30.096 43.181  66.799  1.00 147.71 ? 74  PHE B O     1 
ATOM 1823 C CB    . PHE B 1 74  ? 31.979 40.434  66.924  1.00 159.40 ? 74  PHE B CB    1 
ATOM 1824 C CG    . PHE B 1 74  ? 32.162 41.037  68.292  1.00 157.12 ? 74  PHE B CG    1 
ATOM 1825 C CD1   . PHE B 1 74  ? 31.551 40.474  69.400  1.00 138.19 ? 74  PHE B CD1   1 
ATOM 1826 C CD2   . PHE B 1 74  ? 32.952 42.164  68.471  1.00 150.61 ? 74  PHE B CD2   1 
ATOM 1827 C CE1   . PHE B 1 74  ? 31.716 41.027  70.658  1.00 134.54 ? 74  PHE B CE1   1 
ATOM 1828 C CE2   . PHE B 1 74  ? 33.120 42.721  69.726  1.00 140.77 ? 74  PHE B CE2   1 
ATOM 1829 C CZ    . PHE B 1 74  ? 32.501 42.151  70.821  1.00 129.89 ? 74  PHE B CZ    1 
ATOM 1830 N N     . ILE B 1 75  ? 31.623 43.005  65.156  1.00 157.48 ? 75  ILE B N     1 
ATOM 1831 C CA    . ILE B 1 75  ? 31.719 44.453  64.990  1.00 164.16 ? 75  ILE B CA    1 
ATOM 1832 C C     . ILE B 1 75  ? 30.405 45.025  64.471  1.00 146.34 ? 75  ILE B C     1 
ATOM 1833 O O     . ILE B 1 75  ? 29.942 46.079  64.929  1.00 148.82 ? 75  ILE B O     1 
ATOM 1834 C CB    . ILE B 1 75  ? 32.893 44.800  64.057  1.00 157.87 ? 75  ILE B CB    1 
ATOM 1835 C CG1   . ILE B 1 75  ? 34.221 44.392  64.696  1.00 149.12 ? 75  ILE B CG1   1 
ATOM 1836 C CG2   . ILE B 1 75  ? 32.890 46.283  63.719  1.00 147.57 ? 75  ILE B CG2   1 
ATOM 1837 C CD1   . ILE B 1 75  ? 35.400 44.485  63.756  1.00 141.55 ? 75  ILE B CD1   1 
ATOM 1838 N N     . LYS B 1 76  ? 29.789 44.342  63.502  1.00 135.29 ? 76  LYS B N     1 
ATOM 1839 C CA    . LYS B 1 76  ? 28.512 44.793  62.958  1.00 141.28 ? 76  LYS B CA    1 
ATOM 1840 C C     . LYS B 1 76  ? 27.447 44.881  64.047  1.00 146.32 ? 76  LYS B C     1 
ATOM 1841 O O     . LYS B 1 76  ? 26.724 45.879  64.145  1.00 150.08 ? 76  LYS B O     1 
ATOM 1842 C CB    . LYS B 1 76  ? 28.073 43.860  61.828  1.00 143.89 ? 76  LYS B CB    1 
ATOM 1843 C CG    . LYS B 1 76  ? 28.807 44.104  60.513  1.00 141.08 ? 76  LYS B CG    1 
ATOM 1844 C CD    . LYS B 1 76  ? 28.325 43.170  59.410  1.00 172.73 ? 76  LYS B CD    1 
ATOM 1845 C CE    . LYS B 1 76  ? 26.923 43.528  58.943  1.00 206.33 ? 76  LYS B CE    1 
ATOM 1846 N NZ    . LYS B 1 76  ? 26.846 44.916  58.406  1.00 209.60 ? 76  LYS B NZ    1 
ATOM 1847 N N     . GLY B 1 77  ? 27.341 43.844  64.880  1.00 146.90 ? 77  GLY B N     1 
ATOM 1848 C CA    . GLY B 1 77  ? 26.395 43.887  65.984  1.00 151.79 ? 77  GLY B CA    1 
ATOM 1849 C C     . GLY B 1 77  ? 26.746 44.953  67.002  1.00 150.46 ? 77  GLY B C     1 
ATOM 1850 O O     . GLY B 1 77  ? 25.863 45.602  67.568  1.00 155.36 ? 77  GLY B O     1 
ATOM 1851 N N     . PHE B 1 78  ? 28.043 45.146  67.250  1.00 144.24 ? 78  PHE B N     1 
ATOM 1852 C CA    . PHE B 1 78  ? 28.485 46.112  68.247  1.00 161.99 ? 78  PHE B CA    1 
ATOM 1853 C C     . PHE B 1 78  ? 28.078 47.525  67.850  1.00 167.00 ? 78  PHE B C     1 
ATOM 1854 O O     . PHE B 1 78  ? 27.483 48.260  68.647  1.00 148.58 ? 78  PHE B O     1 
ATOM 1855 C CB    . PHE B 1 78  ? 30.001 46.004  68.422  1.00 135.97 ? 78  PHE B CB    1 
ATOM 1856 C CG    . PHE B 1 78  ? 30.553 46.850  69.531  1.00 134.56 ? 78  PHE B CG    1 
ATOM 1857 C CD1   . PHE B 1 78  ? 30.411 46.460  70.852  1.00 136.78 ? 78  PHE B CD1   1 
ATOM 1858 C CD2   . PHE B 1 78  ? 31.229 48.025  69.255  1.00 131.33 ? 78  PHE B CD2   1 
ATOM 1859 C CE1   . PHE B 1 78  ? 30.926 47.232  71.876  1.00 136.00 ? 78  PHE B CE1   1 
ATOM 1860 C CE2   . PHE B 1 78  ? 31.744 48.800  70.274  1.00 130.33 ? 78  PHE B CE2   1 
ATOM 1861 C CZ    . PHE B 1 78  ? 31.593 48.403  71.585  1.00 132.75 ? 78  PHE B CZ    1 
ATOM 1862 N N     . PHE B 1 79  ? 28.371 47.916  66.611  1.00 168.13 ? 79  PHE B N     1 
ATOM 1863 C CA    . PHE B 1 79  ? 28.068 49.266  66.153  1.00 173.87 ? 79  PHE B CA    1 
ATOM 1864 C C     . PHE B 1 79  ? 26.661 49.410  65.590  1.00 198.68 ? 79  PHE B C     1 
ATOM 1865 O O     . PHE B 1 79  ? 26.327 50.483  65.076  1.00 188.35 ? 79  PHE B O     1 
ATOM 1866 C CB    . PHE B 1 79  ? 29.082 49.707  65.094  1.00 186.13 ? 79  PHE B CB    1 
ATOM 1867 C CG    . PHE B 1 79  ? 30.426 50.063  65.653  1.00 169.04 ? 79  PHE B CG    1 
ATOM 1868 C CD1   . PHE B 1 79  ? 30.567 51.144  66.507  1.00 167.95 ? 79  PHE B CD1   1 
ATOM 1869 C CD2   . PHE B 1 79  ? 31.548 49.319  65.332  1.00 165.94 ? 79  PHE B CD2   1 
ATOM 1870 C CE1   . PHE B 1 79  ? 31.801 51.480  67.024  1.00 161.70 ? 79  PHE B CE1   1 
ATOM 1871 C CE2   . PHE B 1 79  ? 32.785 49.649  65.849  1.00 162.51 ? 79  PHE B CE2   1 
ATOM 1872 C CZ    . PHE B 1 79  ? 32.911 50.731  66.697  1.00 155.61 ? 79  PHE B CZ    1 
ATOM 1873 N N     . TYR B 1 80  ? 25.837 48.370  65.657  1.00 194.62 ? 80  TYR B N     1 
ATOM 1874 C CA    . TYR B 1 80  ? 24.476 48.484  65.157  1.00 179.34 ? 80  TYR B CA    1 
ATOM 1875 C C     . TYR B 1 80  ? 23.688 49.438  66.050  1.00 173.03 ? 80  TYR B C     1 
ATOM 1876 O O     . TYR B 1 80  ? 23.970 49.580  67.243  1.00 198.54 ? 80  TYR B O     1 
ATOM 1877 C CB    . TYR B 1 80  ? 23.807 47.112  65.098  1.00 159.05 ? 80  TYR B CB    1 
ATOM 1878 C CG    . TYR B 1 80  ? 22.565 47.085  64.239  1.00 166.12 ? 80  TYR B CG    1 
ATOM 1879 C CD1   . TYR B 1 80  ? 22.660 46.939  62.861  1.00 208.25 ? 80  TYR B CD1   1 
ATOM 1880 C CD2   . TYR B 1 80  ? 21.304 47.206  64.798  1.00 180.35 ? 80  TYR B CD2   1 
ATOM 1881 C CE1   . TYR B 1 80  ? 21.533 46.915  62.063  1.00 212.44 ? 80  TYR B CE1   1 
ATOM 1882 C CE2   . TYR B 1 80  ? 20.167 47.184  64.009  1.00 205.63 ? 80  TYR B CE2   1 
ATOM 1883 C CZ    . TYR B 1 80  ? 20.289 47.037  62.642  1.00 219.16 ? 80  TYR B CZ    1 
ATOM 1884 O OH    . TYR B 1 80  ? 19.165 47.014  61.850  1.00 258.43 ? 80  TYR B OH    1 
ATOM 1885 N N     . ASN B 1 81  ? 22.695 50.104  65.459  1.00 190.85 ? 81  ASN B N     1 
ATOM 1886 C CA    . ASN B 1 81  ? 21.886 51.101  66.166  1.00 215.03 ? 81  ASN B CA    1 
ATOM 1887 C C     . ASN B 1 81  ? 22.750 52.224  66.741  1.00 195.17 ? 81  ASN B C     1 
ATOM 1888 O O     . ASN B 1 81  ? 22.503 52.715  67.844  1.00 197.35 ? 81  ASN B O     1 
ATOM 1889 C CB    . ASN B 1 81  ? 21.038 50.466  67.274  1.00 231.63 ? 81  ASN B CB    1 
ATOM 1890 C CG    . ASN B 1 81  ? 19.959 49.547  66.739  1.00 253.20 ? 81  ASN B CG    1 
ATOM 1891 O OD1   . ASN B 1 81  ? 19.846 48.395  67.159  1.00 247.97 ? 81  ASN B OD1   1 
ATOM 1892 N ND2   . ASN B 1 81  ? 19.153 50.055  65.813  1.00 258.40 ? 81  ASN B ND2   1 
ATOM 1893 N N     . SER B 1 82  ? 23.779 52.627  66.000  1.00 181.94 ? 82  SER B N     1 
ATOM 1894 C CA    . SER B 1 82  ? 24.652 53.711  66.425  1.00 156.55 ? 82  SER B CA    1 
ATOM 1895 C C     . SER B 1 82  ? 24.907 54.638  65.245  1.00 192.00 ? 82  SER B C     1 
ATOM 1896 O O     . SER B 1 82  ? 24.596 54.316  64.094  1.00 230.70 ? 82  SER B O     1 
ATOM 1897 C CB    . SER B 1 82  ? 25.978 53.187  66.989  1.00 156.15 ? 82  SER B CB    1 
ATOM 1898 O OG    . SER B 1 82  ? 26.681 52.434  66.018  1.00 159.95 ? 82  SER B OG    1 
ATOM 1899 N N     . ASN B 1 83  ? 25.479 55.801  65.540  1.00 211.11 ? 83  ASN B N     1 
ATOM 1900 C CA    . ASN B 1 83  ? 25.898 56.737  64.496  1.00 215.81 ? 83  ASN B CA    1 
ATOM 1901 C C     . ASN B 1 83  ? 27.330 56.444  64.058  1.00 172.83 ? 83  ASN B C     1 
ATOM 1902 O O     . ASN B 1 83  ? 28.184 57.324  63.952  1.00 171.59 ? 83  ASN B O     1 
ATOM 1903 C CB    . ASN B 1 83  ? 25.747 58.170  64.996  1.00 232.88 ? 83  ASN B CB    1 
ATOM 1904 C CG    . ASN B 1 83  ? 25.936 59.198  63.897  1.00 228.30 ? 83  ASN B CG    1 
ATOM 1905 O OD1   . ASN B 1 83  ? 25.822 58.886  62.711  1.00 236.43 ? 83  ASN B OD1   1 
ATOM 1906 N ND2   . ASN B 1 83  ? 26.232 60.432  64.288  1.00 216.32 ? 83  ASN B ND2   1 
ATOM 1907 N N     . THR B 1 84  ? 27.583 55.168  63.777  1.00 141.98 ? 84  THR B N     1 
ATOM 1908 C CA    . THR B 1 84  ? 28.896 54.698  63.341  1.00 144.57 ? 84  THR B CA    1 
ATOM 1909 C C     . THR B 1 84  ? 28.635 53.492  62.446  1.00 147.84 ? 84  THR B C     1 
ATOM 1910 O O     . THR B 1 84  ? 28.351 52.399  62.943  1.00 151.66 ? 84  THR B O     1 
ATOM 1911 C CB    . THR B 1 84  ? 29.791 54.340  64.520  1.00 129.17 ? 84  THR B CB    1 
ATOM 1912 O OG1   . THR B 1 84  ? 30.080 55.518  65.282  1.00 144.34 ? 84  THR B OG1   1 
ATOM 1913 C CG2   . THR B 1 84  ? 31.099 53.731  64.034  1.00 136.19 ? 84  THR B CG2   1 
ATOM 1914 N N     . LYS B 1 85  ? 28.712 53.702  61.137  1.00 158.33 ? 85  LYS B N     1 
ATOM 1915 C CA    . LYS B 1 85  ? 28.346 52.673  60.176  1.00 156.28 ? 85  LYS B CA    1 
ATOM 1916 C C     . LYS B 1 85  ? 29.561 51.809  59.870  1.00 155.67 ? 85  LYS B C     1 
ATOM 1917 O O     . LYS B 1 85  ? 30.590 52.314  59.407  1.00 156.07 ? 85  LYS B O     1 
ATOM 1918 C CB    . LYS B 1 85  ? 27.788 53.294  58.897  1.00 158.92 ? 85  LYS B CB    1 
ATOM 1919 C CG    . LYS B 1 85  ? 26.950 52.330  58.081  1.00 182.01 ? 85  LYS B CG    1 
ATOM 1920 C CD    . LYS B 1 85  ? 25.828 51.748  58.929  1.00 202.58 ? 85  LYS B CD    1 
ATOM 1921 C CE    . LYS B 1 85  ? 24.986 50.758  58.142  1.00 224.67 ? 85  LYS B CE    1 
ATOM 1922 N NZ    . LYS B 1 85  ? 23.873 50.209  58.965  1.00 237.72 ? 85  LYS B NZ    1 
ATOM 1923 N N     . VAL B 1 86  ? 29.442 50.516  60.141  1.00 164.42 ? 86  VAL B N     1 
ATOM 1924 C CA    . VAL B 1 86  ? 30.448 49.538  59.748  1.00 172.38 ? 86  VAL B CA    1 
ATOM 1925 C C     . VAL B 1 86  ? 30.123 49.063  58.338  1.00 144.05 ? 86  VAL B C     1 
ATOM 1926 O O     . VAL B 1 86  ? 29.005 48.611  58.063  1.00 148.23 ? 86  VAL B O     1 
ATOM 1927 C CB    . VAL B 1 86  ? 30.494 48.366  60.742  1.00 169.01 ? 86  VAL B CB    1 
ATOM 1928 C CG1   . VAL B 1 86  ? 29.108 48.095  61.306  1.00 184.98 ? 86  VAL B CG1   1 
ATOM 1929 C CG2   . VAL B 1 86  ? 31.059 47.119  60.075  1.00 145.71 ? 86  VAL B CG2   1 
ATOM 1930 N N     . ILE B 1 87  ? 31.099 49.175  57.443  1.00 164.59 ? 87  ILE B N     1 
ATOM 1931 C CA    . ILE B 1 87  ? 30.952 48.790  56.045  1.00 181.57 ? 87  ILE B CA    1 
ATOM 1932 C C     . ILE B 1 87  ? 32.036 47.779  55.699  1.00 184.27 ? 87  ILE B C     1 
ATOM 1933 O O     . ILE B 1 87  ? 33.193 47.929  56.106  1.00 190.62 ? 87  ILE B O     1 
ATOM 1934 C CB    . ILE B 1 87  ? 31.006 50.018  55.109  1.00 194.05 ? 87  ILE B CB    1 
ATOM 1935 C CG1   . ILE B 1 87  ? 32.333 50.767  55.253  1.00 195.76 ? 87  ILE B CG1   1 
ATOM 1936 C CG2   . ILE B 1 87  ? 29.836 50.953  55.385  1.00 195.02 ? 87  ILE B CG2   1 
ATOM 1937 C CD1   . ILE B 1 87  ? 33.314 50.494  54.136  1.00 218.17 ? 87  ILE B CD1   1 
ATOM 1938 N N     . VAL B 1 88  ? 31.653 46.737  54.967  1.00 180.00 ? 88  VAL B N     1 
ATOM 1939 C CA    . VAL B 1 88  ? 32.562 45.663  54.588  1.00 169.42 ? 88  VAL B CA    1 
ATOM 1940 C C     . VAL B 1 88  ? 32.882 45.837  53.110  1.00 192.88 ? 88  VAL B C     1 
ATOM 1941 O O     . VAL B 1 88  ? 32.026 45.615  52.244  1.00 202.97 ? 88  VAL B O     1 
ATOM 1942 C CB    . VAL B 1 88  ? 31.959 44.281  54.871  1.00 181.51 ? 88  VAL B CB    1 
ATOM 1943 C CG1   . VAL B 1 88  ? 32.964 43.186  54.549  1.00 194.09 ? 88  VAL B CG1   1 
ATOM 1944 C CG2   . VAL B 1 88  ? 31.503 44.192  56.321  1.00 150.78 ? 88  VAL B CG2   1 
ATOM 1945 N N     . ARG B 1 89  ? 34.118 46.231  52.825  1.00 197.63 ? 89  ARG B N     1 
ATOM 1946 C CA    . ARG B 1 89  ? 34.591 46.495  51.476  1.00 190.44 ? 89  ARG B CA    1 
ATOM 1947 C C     . ARG B 1 89  ? 35.336 45.290  50.909  1.00 185.45 ? 89  ARG B C     1 
ATOM 1948 O O     . ARG B 1 89  ? 35.985 44.533  51.638  1.00 173.56 ? 89  ARG B O     1 
ATOM 1949 C CB    . ARG B 1 89  ? 35.487 47.737  51.463  1.00 193.52 ? 89  ARG B CB    1 
ATOM 1950 C CG    . ARG B 1 89  ? 36.078 48.095  50.109  1.00 198.40 ? 89  ARG B CG    1 
ATOM 1951 C CD    . ARG B 1 89  ? 36.683 49.487  50.134  1.00 217.08 ? 89  ARG B CD    1 
ATOM 1952 N NE    . ARG B 1 89  ? 35.661 50.513  50.327  1.00 205.80 ? 89  ARG B NE    1 
ATOM 1953 C CZ    . ARG B 1 89  ? 35.032 51.135  49.336  1.00 199.58 ? 89  ARG B CZ    1 
ATOM 1954 N NH1   . ARG B 1 89  ? 34.114 52.053  49.601  1.00 197.47 ? 89  ARG B NH1   1 
ATOM 1955 N NH2   . ARG B 1 89  ? 35.322 50.841  48.076  1.00 221.11 ? 89  ARG B NH2   1 
ATOM 1956 N N     . ASN B 1 90  ? 35.221 45.117  49.591  1.00 267.23 ? 90  ASN B N     1 
ATOM 1957 C CA    . ASN B 1 90  ? 35.967 44.097  48.875  1.00 256.09 ? 90  ASN B CA    1 
ATOM 1958 C C     . ASN B 1 90  ? 37.471 44.310  49.052  1.00 253.35 ? 90  ASN B C     1 
ATOM 1959 O O     . ASN B 1 90  ? 37.921 45.424  49.337  1.00 251.27 ? 90  ASN B O     1 
ATOM 1960 C CB    . ASN B 1 90  ? 35.610 44.127  47.389  1.00 241.64 ? 90  ASN B CB    1 
ATOM 1961 C CG    . ASN B 1 90  ? 34.347 43.356  47.077  1.00 248.60 ? 90  ASN B CG    1 
ATOM 1962 O OD1   . ASN B 1 90  ? 33.884 42.548  47.879  1.00 251.61 ? 90  ASN B OD1   1 
ATOM 1963 N ND2   . ASN B 1 90  ? 33.784 43.597  45.900  1.00 260.70 ? 90  ASN B ND2   1 
ATOM 1964 N N     . PRO B 1 91  ? 38.265 43.246  48.911  1.00 246.22 ? 91  PRO B N     1 
ATOM 1965 C CA    . PRO B 1 91  ? 39.727 43.388  49.010  1.00 233.54 ? 91  PRO B CA    1 
ATOM 1966 C C     . PRO B 1 91  ? 40.238 44.400  47.996  1.00 232.67 ? 91  PRO B C     1 
ATOM 1967 O O     . PRO B 1 91  ? 40.040 44.248  46.789  1.00 222.71 ? 91  PRO B O     1 
ATOM 1968 C CB    . PRO B 1 91  ? 40.240 41.974  48.714  1.00 220.09 ? 91  PRO B CB    1 
ATOM 1969 C CG    . PRO B 1 91  ? 39.106 41.079  49.081  1.00 223.34 ? 91  PRO B CG    1 
ATOM 1970 C CD    . PRO B 1 91  ? 37.859 41.840  48.736  1.00 228.79 ? 91  PRO B CD    1 
ATOM 1971 N N     . THR B 1 92  ? 40.880 45.455  48.504  1.00 263.00 ? 92  THR B N     1 
ATOM 1972 C CA    . THR B 1 92  ? 41.422 46.496  47.636  1.00 269.72 ? 92  THR B CA    1 
ATOM 1973 C C     . THR B 1 92  ? 42.352 45.913  46.579  1.00 286.84 ? 92  THR B C     1 
ATOM 1974 O O     . THR B 1 92  ? 42.079 45.999  45.377  1.00 311.94 ? 92  THR B O     1 
ATOM 1975 C CB    . THR B 1 92  ? 42.160 47.537  48.481  1.00 282.28 ? 92  THR B CB    1 
ATOM 1976 O OG1   . THR B 1 92  ? 43.267 46.914  49.146  1.00 270.88 ? 92  THR B OG1   1 
ATOM 1977 C CG2   . THR B 1 92  ? 41.228 48.131  49.525  1.00 294.03 ? 92  THR B CG2   1 
ATOM 1978 N N     . PHE B 1 93  ? 43.462 45.320  47.009  1.00 295.09 ? 93  PHE B N     1 
ATOM 1979 C CA    . PHE B 1 93  ? 44.364 44.618  46.102  1.00 287.25 ? 93  PHE B CA    1 
ATOM 1980 C C     . PHE B 1 93  ? 43.868 43.185  45.951  1.00 269.61 ? 93  PHE B C     1 
ATOM 1981 O O     . PHE B 1 93  ? 43.917 42.399  46.902  1.00 272.04 ? 93  PHE B O     1 
ATOM 1982 C CB    . PHE B 1 93  ? 45.798 44.691  46.612  1.00 272.63 ? 93  PHE B CB    1 
ATOM 1983 C CG    . PHE B 1 93  ? 46.365 46.078  46.568  1.00 274.25 ? 93  PHE B CG    1 
ATOM 1984 C CD1   . PHE B 1 93  ? 46.055 46.923  45.514  1.00 282.63 ? 93  PHE B CD1   1 
ATOM 1985 C CD2   . PHE B 1 93  ? 47.176 46.552  47.582  1.00 265.33 ? 93  PHE B CD2   1 
ATOM 1986 C CE1   . PHE B 1 93  ? 46.556 48.205  45.462  1.00 280.35 ? 93  PHE B CE1   1 
ATOM 1987 C CE2   . PHE B 1 93  ? 47.679 47.837  47.534  1.00 264.27 ? 93  PHE B CE2   1 
ATOM 1988 C CZ    . PHE B 1 93  ? 47.369 48.663  46.472  1.00 269.50 ? 93  PHE B CZ    1 
ATOM 1989 N N     . LYS B 1 94  ? 43.396 42.842  44.752  1.00 248.96 ? 94  LYS B N     1 
ATOM 1990 C CA    . LYS B 1 94  ? 42.834 41.522  44.499  1.00 247.64 ? 94  LYS B CA    1 
ATOM 1991 C C     . LYS B 1 94  ? 43.479 40.887  43.270  1.00 256.01 ? 94  LYS B C     1 
ATOM 1992 O O     . LYS B 1 94  ? 42.868 40.054  42.595  1.00 267.52 ? 94  LYS B O     1 
ATOM 1993 C CB    . LYS B 1 94  ? 41.315 41.619  44.346  1.00 251.65 ? 94  LYS B CB    1 
ATOM 1994 C CG    . LYS B 1 94  ? 40.542 40.337  44.609  1.00 249.28 ? 94  LYS B CG    1 
ATOM 1995 C CD    . LYS B 1 94  ? 39.056 40.643  44.749  1.00 248.86 ? 94  LYS B CD    1 
ATOM 1996 C CE    . LYS B 1 94  ? 38.275 39.446  45.265  1.00 250.10 ? 94  LYS B CE    1 
ATOM 1997 N NZ    . LYS B 1 94  ? 36.814 39.732  45.338  1.00 227.42 ? 94  LYS B NZ    1 
ATOM 1998 N N     . GLY B 1 95  ? 44.719 41.271  42.973  1.00 261.14 ? 95  GLY B N     1 
ATOM 1999 C CA    . GLY B 1 95  ? 45.452 40.710  41.855  1.00 266.52 ? 95  GLY B CA    1 
ATOM 2000 C C     . GLY B 1 95  ? 46.319 39.538  42.262  1.00 282.46 ? 95  GLY B C     1 
ATOM 2001 O O     . GLY B 1 95  ? 45.800 38.473  42.610  1.00 264.52 ? 95  GLY B O     1 
ATOM 2002 N N     . GLY B 1 96  ? 47.640 39.719  42.210  1.00 309.97 ? 96  GLY B N     1 
ATOM 2003 C CA    . GLY B 1 96  ? 48.579 38.660  42.529  1.00 307.28 ? 96  GLY B CA    1 
ATOM 2004 C C     . GLY B 1 96  ? 48.313 38.038  43.884  1.00 305.48 ? 96  GLY B C     1 
ATOM 2005 O O     . GLY B 1 96  ? 47.928 38.737  44.826  1.00 313.40 ? 96  GLY B O     1 
ATOM 2006 N N     . SER B 1 97  ? 48.519 36.726  43.997  1.00 293.36 ? 97  SER B N     1 
ATOM 2007 C CA    . SER B 1 97  ? 48.194 36.013  45.227  1.00 278.64 ? 97  SER B CA    1 
ATOM 2008 C C     . SER B 1 97  ? 49.052 36.462  46.403  1.00 269.17 ? 97  SER B C     1 
ATOM 2009 O O     . SER B 1 97  ? 48.537 37.046  47.363  1.00 266.28 ? 97  SER B O     1 
ATOM 2010 C CB    . SER B 1 97  ? 48.347 34.505  45.015  1.00 271.55 ? 97  SER B CB    1 
ATOM 2011 O OG    . SER B 1 97  ? 49.696 34.161  44.757  1.00 265.22 ? 97  SER B OG    1 
ATOM 2012 N N     . TYR B 1 98  ? 50.358 36.206  46.340  1.00 264.06 ? 98  TYR B N     1 
ATOM 2013 C CA    . TYR B 1 98  ? 51.258 36.520  47.445  1.00 269.75 ? 98  TYR B CA    1 
ATOM 2014 C C     . TYR B 1 98  ? 52.301 37.561  47.069  1.00 279.59 ? 98  TYR B C     1 
ATOM 2015 O O     . TYR B 1 98  ? 52.396 38.600  47.730  1.00 256.45 ? 98  TYR B O     1 
ATOM 2016 C CB    . TYR B 1 98  ? 51.956 35.246  47.934  1.00 266.60 ? 98  TYR B CB    1 
ATOM 2017 C CG    . TYR B 1 98  ? 51.071 34.279  48.675  1.00 273.14 ? 98  TYR B CG    1 
ATOM 2018 C CD1   . TYR B 1 98  ? 50.182 34.722  49.645  1.00 274.01 ? 98  TYR B CD1   1 
ATOM 2019 C CD2   . TYR B 1 98  ? 51.131 32.919  48.409  1.00 273.78 ? 98  TYR B CD2   1 
ATOM 2020 C CE1   . TYR B 1 98  ? 49.376 33.833  50.327  1.00 274.67 ? 98  TYR B CE1   1 
ATOM 2021 C CE2   . TYR B 1 98  ? 50.330 32.025  49.084  1.00 277.08 ? 98  TYR B CE2   1 
ATOM 2022 C CZ    . TYR B 1 98  ? 49.455 32.486  50.041  1.00 275.30 ? 98  TYR B CZ    1 
ATOM 2023 O OH    . TYR B 1 98  ? 48.659 31.588  50.708  1.00 270.55 ? 98  TYR B OH    1 
ATOM 2024 N N     . ARG B 1 99  ? 53.091 37.307  46.023  1.00 307.86 ? 99  ARG B N     1 
ATOM 2025 C CA    . ARG B 1 99  ? 54.236 38.160  45.728  1.00 315.82 ? 99  ARG B CA    1 
ATOM 2026 C C     . ARG B 1 99  ? 53.807 39.567  45.342  1.00 307.03 ? 99  ARG B C     1 
ATOM 2027 O O     . ARG B 1 99  ? 54.536 40.531  45.605  1.00 315.80 ? 99  ARG B O     1 
ATOM 2028 C CB    . ARG B 1 99  ? 55.077 37.536  44.613  1.00 318.42 ? 99  ARG B CB    1 
ATOM 2029 C CG    . ARG B 1 99  ? 55.218 36.018  44.697  1.00 315.06 ? 99  ARG B CG    1 
ATOM 2030 C CD    . ARG B 1 99  ? 55.956 35.574  45.954  1.00 313.02 ? 99  ARG B CD    1 
ATOM 2031 N NE    . ARG B 1 99  ? 56.311 34.157  45.904  1.00 305.74 ? 99  ARG B NE    1 
ATOM 2032 C CZ    . ARG B 1 99  ? 55.605 33.183  46.471  1.00 305.12 ? 99  ARG B CZ    1 
ATOM 2033 N NH1   . ARG B 1 99  ? 54.500 33.464  47.144  1.00 307.70 ? 99  ARG B NH1   1 
ATOM 2034 N NH2   . ARG B 1 99  ? 56.009 31.924  46.370  1.00 302.71 ? 99  ARG B NH2   1 
ATOM 2035 N N     . ASN B 1 100 ? 52.634 39.708  44.729  1.00 289.52 ? 100 ASN B N     1 
ATOM 2036 C CA    . ASN B 1 100 ? 52.145 41.019  44.325  1.00 275.64 ? 100 ASN B CA    1 
ATOM 2037 C C     . ASN B 1 100 ? 51.293 41.685  45.394  1.00 285.48 ? 100 ASN B C     1 
ATOM 2038 O O     . ASN B 1 100 ? 51.339 42.911  45.529  1.00 300.24 ? 100 ASN B O     1 
ATOM 2039 C CB    . ASN B 1 100 ? 51.341 40.904  43.028  1.00 271.16 ? 100 ASN B CB    1 
ATOM 2040 C CG    . ASN B 1 100 ? 52.212 40.586  41.829  1.00 274.56 ? 100 ASN B CG    1 
ATOM 2041 O OD1   . ASN B 1 100 ? 51.977 39.609  41.118  1.00 269.34 ? 100 ASN B OD1   1 
ATOM 2042 N ND2   . ASN B 1 100 ? 53.226 41.412  41.599  1.00 282.65 ? 100 ASN B ND2   1 
ATOM 2043 N N     . ARG B 1 101 ? 50.533 40.910  46.166  1.00 351.89 ? 101 ARG B N     1 
ATOM 2044 C CA    . ARG B 1 101 ? 49.616 41.469  47.154  1.00 324.88 ? 101 ARG B CA    1 
ATOM 2045 C C     . ARG B 1 101 ? 50.347 42.268  48.229  1.00 302.88 ? 101 ARG B C     1 
ATOM 2046 O O     . ARG B 1 101 ? 50.197 43.493  48.309  1.00 303.20 ? 101 ARG B O     1 
ATOM 2047 C CB    . ARG B 1 101 ? 48.797 40.345  47.795  1.00 314.12 ? 101 ARG B CB    1 
ATOM 2048 C CG    . ARG B 1 101 ? 47.775 40.806  48.820  1.00 313.88 ? 101 ARG B CG    1 
ATOM 2049 C CD    . ARG B 1 101 ? 46.929 39.637  49.304  1.00 316.40 ? 101 ARG B CD    1 
ATOM 2050 N NE    . ARG B 1 101 ? 45.892 40.056  50.243  1.00 312.35 ? 101 ARG B NE    1 
ATOM 2051 C CZ    . ARG B 1 101 ? 46.011 39.994  51.566  1.00 298.98 ? 101 ARG B CZ    1 
ATOM 2052 N NH1   . ARG B 1 101 ? 47.124 39.526  52.113  1.00 299.25 ? 101 ARG B NH1   1 
ATOM 2053 N NH2   . ARG B 1 101 ? 45.015 40.398  52.342  1.00 288.90 ? 101 ARG B NH2   1 
ATOM 2054 N N     . LYS B 1 102 ? 51.160 41.583  49.040  1.00 261.99 ? 102 LYS B N     1 
ATOM 2055 C CA    . LYS B 1 102 ? 51.837 42.243  50.153  1.00 247.87 ? 102 LYS B CA    1 
ATOM 2056 C C     . LYS B 1 102 ? 52.811 43.307  49.664  1.00 255.44 ? 102 LYS B C     1 
ATOM 2057 O O     . LYS B 1 102 ? 52.868 44.413  50.221  1.00 264.20 ? 102 LYS B O     1 
ATOM 2058 C CB    . LYS B 1 102 ? 52.571 41.208  51.007  1.00 242.22 ? 102 LYS B CB    1 
ATOM 2059 C CG    . LYS B 1 102 ? 53.671 41.799  51.878  1.00 240.49 ? 102 LYS B CG    1 
ATOM 2060 C CD    . LYS B 1 102 ? 54.595 40.725  52.430  1.00 243.81 ? 102 LYS B CD    1 
ATOM 2061 C CE    . LYS B 1 102 ? 55.806 41.345  53.116  1.00 239.35 ? 102 LYS B CE    1 
ATOM 2062 N NZ    . LYS B 1 102 ? 56.738 40.316  53.654  1.00 238.26 ? 102 LYS B NZ    1 
ATOM 2063 N N     . LYS B 1 103 ? 53.596 42.987  48.633  1.00 276.22 ? 103 LYS B N     1 
ATOM 2064 C CA    . LYS B 1 103 ? 54.602 43.928  48.157  1.00 278.82 ? 103 LYS B CA    1 
ATOM 2065 C C     . LYS B 1 103 ? 53.955 45.169  47.556  1.00 282.70 ? 103 LYS B C     1 
ATOM 2066 O O     . LYS B 1 103 ? 54.386 46.292  47.836  1.00 286.13 ? 103 LYS B O     1 
ATOM 2067 C CB    . LYS B 1 103 ? 55.522 43.253  47.142  1.00 298.82 ? 103 LYS B CB    1 
ATOM 2068 C CG    . LYS B 1 103 ? 56.740 44.085  46.779  1.00 309.53 ? 103 LYS B CG    1 
ATOM 2069 C CD    . LYS B 1 103 ? 57.490 44.518  48.030  1.00 297.30 ? 103 LYS B CD    1 
ATOM 2070 C CE    . LYS B 1 103 ? 58.657 45.431  47.696  1.00 302.99 ? 103 LYS B CE    1 
ATOM 2071 N NZ    . LYS B 1 103 ? 59.339 45.923  48.925  1.00 290.98 ? 103 LYS B NZ    1 
ATOM 2072 N N     . GLN B 1 104 ? 52.918 44.990  46.734  1.00 285.43 ? 104 GLN B N     1 
ATOM 2073 C CA    . GLN B 1 104 ? 52.209 46.135  46.175  1.00 288.13 ? 104 GLN B CA    1 
ATOM 2074 C C     . GLN B 1 104 ? 51.567 46.969  47.275  1.00 276.14 ? 104 GLN B C     1 
ATOM 2075 O O     . GLN B 1 104 ? 51.579 48.206  47.215  1.00 279.86 ? 104 GLN B O     1 
ATOM 2076 C CB    . GLN B 1 104 ? 51.157 45.655  45.175  1.00 292.55 ? 104 GLN B CB    1 
ATOM 2077 C CG    . GLN B 1 104 ? 50.446 46.764  44.421  1.00 297.39 ? 104 GLN B CG    1 
ATOM 2078 C CD    . GLN B 1 104 ? 49.421 46.229  43.440  1.00 296.93 ? 104 GLN B CD    1 
ATOM 2079 O OE1   . GLN B 1 104 ? 49.136 45.031  43.415  1.00 294.12 ? 104 GLN B OE1   1 
ATOM 2080 N NE2   . GLN B 1 104 ? 48.861 47.115  42.626  1.00 301.41 ? 104 GLN B NE2   1 
ATOM 2081 N N     . SER B 1 105 ? 51.022 46.309  48.302  1.00 271.65 ? 105 SER B N     1 
ATOM 2082 C CA    . SER B 1 105 ? 50.417 47.029  49.416  1.00 267.70 ? 105 SER B CA    1 
ATOM 2083 C C     . SER B 1 105 ? 51.442 47.915  50.110  1.00 260.84 ? 105 SER B C     1 
ATOM 2084 O O     . SER B 1 105 ? 51.239 49.126  50.260  1.00 263.18 ? 105 SER B O     1 
ATOM 2085 C CB    . SER B 1 105 ? 49.795 46.039  50.403  1.00 257.56 ? 105 SER B CB    1 
ATOM 2086 O OG    . SER B 1 105 ? 49.100 46.715  51.436  1.00 244.68 ? 105 SER B OG    1 
ATOM 2087 N N     . ILE B 1 106 ? 52.556 47.322  50.548  1.00 259.59 ? 106 ILE B N     1 
ATOM 2088 C CA    . ILE B 1 106 ? 53.548 48.103  51.281  1.00 260.72 ? 106 ILE B CA    1 
ATOM 2089 C C     . ILE B 1 106 ? 54.205 49.147  50.383  1.00 271.58 ? 106 ILE B C     1 
ATOM 2090 O O     . ILE B 1 106 ? 54.594 50.219  50.860  1.00 274.07 ? 106 ILE B O     1 
ATOM 2091 C CB    . ILE B 1 106 ? 54.590 47.177  51.937  1.00 257.10 ? 106 ILE B CB    1 
ATOM 2092 C CG1   . ILE B 1 106 ? 55.327 46.348  50.885  1.00 282.21 ? 106 ILE B CG1   1 
ATOM 2093 C CG2   . ILE B 1 106 ? 53.926 46.273  52.966  1.00 246.50 ? 106 ILE B CG2   1 
ATOM 2094 C CD1   . ILE B 1 106 ? 56.324 45.370  51.469  1.00 278.84 ? 106 ILE B CD1   1 
ATOM 2095 N N     . ASP B 1 107 ? 54.305 48.888  49.075  1.00 279.21 ? 107 ASP B N     1 
ATOM 2096 C CA    . ASP B 1 107 ? 54.891 49.873  48.170  1.00 290.24 ? 107 ASP B CA    1 
ATOM 2097 C C     . ASP B 1 107 ? 53.989 51.092  48.018  1.00 292.21 ? 107 ASP B C     1 
ATOM 2098 O O     . ASP B 1 107 ? 54.442 52.235  48.174  1.00 297.35 ? 107 ASP B O     1 
ATOM 2099 C CB    . ASP B 1 107 ? 55.176 49.235  46.810  1.00 303.32 ? 107 ASP B CB    1 
ATOM 2100 C CG    . ASP B 1 107 ? 56.391 48.328  46.836  1.00 311.25 ? 107 ASP B CG    1 
ATOM 2101 O OD1   . ASP B 1 107 ? 57.271 48.538  47.698  1.00 307.68 ? 107 ASP B OD1   1 
ATOM 2102 O OD2   . ASP B 1 107 ? 56.468 47.408  45.994  1.00 314.76 ? 107 ASP B OD2   1 
ATOM 2103 N N     . VAL B 1 108 ? 52.709 50.872  47.698  1.00 288.82 ? 108 VAL B N     1 
ATOM 2104 C CA    . VAL B 1 108 ? 51.788 51.997  47.576  1.00 290.41 ? 108 VAL B CA    1 
ATOM 2105 C C     . VAL B 1 108 ? 51.669 52.725  48.909  1.00 298.52 ? 108 VAL B C     1 
ATOM 2106 O O     . VAL B 1 108 ? 51.517 53.951  48.942  1.00 294.08 ? 108 VAL B O     1 
ATOM 2107 C CB    . VAL B 1 108 ? 50.416 51.535  47.038  1.00 287.62 ? 108 VAL B CB    1 
ATOM 2108 C CG1   . VAL B 1 108 ? 49.675 50.699  48.061  1.00 291.12 ? 108 VAL B CG1   1 
ATOM 2109 C CG2   . VAL B 1 108 ? 49.579 52.735  46.615  1.00 291.69 ? 108 VAL B CG2   1 
ATOM 2110 N N     . PHE B 1 109 ? 51.747 51.993  50.023  1.00 276.09 ? 109 PHE B N     1 
ATOM 2111 C CA    . PHE B 1 109 ? 51.769 52.618  51.341  1.00 271.66 ? 109 PHE B CA    1 
ATOM 2112 C C     . PHE B 1 109 ? 52.954 53.568  51.472  1.00 278.86 ? 109 PHE B C     1 
ATOM 2113 O O     . PHE B 1 109 ? 52.791 54.762  51.751  1.00 282.30 ? 109 PHE B O     1 
ATOM 2114 C CB    . PHE B 1 109 ? 51.814 51.529  52.417  1.00 263.51 ? 109 PHE B CB    1 
ATOM 2115 C CG    . PHE B 1 109 ? 51.962 52.052  53.819  1.00 263.24 ? 109 PHE B CG    1 
ATOM 2116 C CD1   . PHE B 1 109 ? 50.850 52.420  54.558  1.00 260.72 ? 109 PHE B CD1   1 
ATOM 2117 C CD2   . PHE B 1 109 ? 53.214 52.151  54.406  1.00 259.33 ? 109 PHE B CD2   1 
ATOM 2118 C CE1   . PHE B 1 109 ? 50.985 52.890  55.852  1.00 250.37 ? 109 PHE B CE1   1 
ATOM 2119 C CE2   . PHE B 1 109 ? 53.355 52.623  55.696  1.00 256.27 ? 109 PHE B CE2   1 
ATOM 2120 C CZ    . PHE B 1 109 ? 52.240 52.992  56.421  1.00 251.90 ? 109 PHE B CZ    1 
ATOM 2121 N N     . ILE B 1 110 ? 54.169 53.036  51.309  1.00 294.05 ? 110 ILE B N     1 
ATOM 2122 C CA    . ILE B 1 110 ? 55.384 53.830  51.464  1.00 305.79 ? 110 ILE B CA    1 
ATOM 2123 C C     . ILE B 1 110 ? 55.391 55.022  50.517  1.00 315.83 ? 110 ILE B C     1 
ATOM 2124 O O     . ILE B 1 110 ? 56.006 56.055  50.812  1.00 327.41 ? 110 ILE B O     1 
ATOM 2125 C CB    . ILE B 1 110 ? 56.621 52.926  51.267  1.00 312.25 ? 110 ILE B CB    1 
ATOM 2126 C CG1   . ILE B 1 110 ? 57.489 52.922  52.526  1.00 304.89 ? 110 ILE B CG1   1 
ATOM 2127 C CG2   . ILE B 1 110 ? 57.434 53.345  50.043  1.00 326.18 ? 110 ILE B CG2   1 
ATOM 2128 C CD1   . ILE B 1 110 ? 58.682 51.995  52.445  1.00 306.93 ? 110 ILE B CD1   1 
ATOM 2129 N N     . GLN B 1 111 ? 54.702 54.918  49.380  1.00 312.58 ? 111 GLN B N     1 
ATOM 2130 C CA    . GLN B 1 111 ? 54.701 56.027  48.433  1.00 323.87 ? 111 GLN B CA    1 
ATOM 2131 C C     . GLN B 1 111 ? 53.617 57.063  48.715  1.00 312.34 ? 111 GLN B C     1 
ATOM 2132 O O     . GLN B 1 111 ? 53.835 58.254  48.467  1.00 320.67 ? 111 GLN B O     1 
ATOM 2133 C CB    . GLN B 1 111 ? 54.548 55.503  47.002  1.00 331.72 ? 111 GLN B CB    1 
ATOM 2134 C CG    . GLN B 1 111 ? 54.846 56.545  45.936  1.00 331.85 ? 111 GLN B CG    1 
ATOM 2135 C CD    . GLN B 1 111 ? 56.224 57.162  46.096  1.00 340.42 ? 111 GLN B CD    1 
ATOM 2136 O OE1   . GLN B 1 111 ? 57.201 56.466  46.376  1.00 340.06 ? 111 GLN B OE1   1 
ATOM 2137 N NE2   . GLN B 1 111 ? 56.307 58.476  45.926  1.00 358.32 ? 111 GLN B NE2   1 
ATOM 2138 N N     . LYS B 1 112 ? 52.462 56.650  49.237  1.00 302.90 ? 112 LYS B N     1 
ATOM 2139 C CA    . LYS B 1 112 ? 51.327 57.543  49.423  1.00 302.01 ? 112 LYS B CA    1 
ATOM 2140 C C     . LYS B 1 112 ? 51.178 58.044  50.855  1.00 349.83 ? 112 LYS B C     1 
ATOM 2141 O O     . LYS B 1 112 ? 50.273 58.839  51.127  1.00 328.13 ? 112 LYS B O     1 
ATOM 2142 C CB    . LYS B 1 112 ? 50.039 56.834  48.982  1.00 296.41 ? 112 LYS B CB    1 
ATOM 2143 C CG    . LYS B 1 112 ? 48.878 57.751  48.627  1.00 298.61 ? 112 LYS B CG    1 
ATOM 2144 C CD    . LYS B 1 112 ? 49.269 58.795  47.601  1.00 310.10 ? 112 LYS B CD    1 
ATOM 2145 C CE    . LYS B 1 112 ? 48.082 59.680  47.256  1.00 321.94 ? 112 LYS B CE    1 
ATOM 2146 N NZ    . LYS B 1 112 ? 48.444 60.755  46.292  1.00 328.09 ? 112 LYS B NZ    1 
ATOM 2147 N N     . ILE B 1 113 ? 52.047 57.618  51.775  1.00 269.24 ? 113 ILE B N     1 
ATOM 2148 C CA    . ILE B 1 113 ? 51.916 58.084  53.154  1.00 273.40 ? 113 ILE B CA    1 
ATOM 2149 C C     . ILE B 1 113 ? 52.331 59.543  53.298  1.00 271.77 ? 113 ILE B C     1 
ATOM 2150 O O     . ILE B 1 113 ? 51.789 60.263  54.144  1.00 281.01 ? 113 ILE B O     1 
ATOM 2151 C CB    . ILE B 1 113 ? 52.721 57.194  54.119  1.00 283.47 ? 113 ILE B CB    1 
ATOM 2152 C CG1   . ILE B 1 113 ? 54.118 56.910  53.557  1.00 290.57 ? 113 ILE B CG1   1 
ATOM 2153 C CG2   . ILE B 1 113 ? 51.949 55.930  54.456  1.00 288.67 ? 113 ILE B CG2   1 
ATOM 2154 C CD1   . ILE B 1 113 ? 54.948 55.997  54.428  1.00 301.14 ? 113 ILE B CD1   1 
ATOM 2155 N N     . SER B 1 114 ? 53.275 60.010  52.476  1.00 265.27 ? 114 SER B N     1 
ATOM 2156 C CA    . SER B 1 114 ? 53.925 61.292  52.742  1.00 261.13 ? 114 SER B CA    1 
ATOM 2157 C C     . SER B 1 114 ? 52.943 62.458  52.747  1.00 258.41 ? 114 SER B C     1 
ATOM 2158 O O     . SER B 1 114 ? 53.136 63.423  53.495  1.00 232.54 ? 114 SER B O     1 
ATOM 2159 C CB    . SER B 1 114 ? 55.023 61.541  51.707  1.00 263.22 ? 114 SER B CB    1 
ATOM 2160 O OG    . SER B 1 114 ? 55.888 60.425  51.598  1.00 262.01 ? 114 SER B OG    1 
ATOM 2161 N N     . GLU B 1 115 ? 51.894 62.396  51.932  1.00 279.47 ? 115 GLU B N     1 
ATOM 2162 C CA    . GLU B 1 115 ? 50.977 63.523  51.810  1.00 291.61 ? 115 GLU B CA    1 
ATOM 2163 C C     . GLU B 1 115 ? 49.949 63.599  52.934  1.00 276.60 ? 115 GLU B C     1 
ATOM 2164 O O     . GLU B 1 115 ? 49.098 64.494  52.903  1.00 278.98 ? 115 GLU B O     1 
ATOM 2165 C CB    . GLU B 1 115 ? 50.241 63.458  50.469  1.00 303.32 ? 115 GLU B CB    1 
ATOM 2166 C CG    . GLU B 1 115 ? 51.120 63.125  49.279  1.00 307.12 ? 115 GLU B CG    1 
ATOM 2167 C CD    . GLU B 1 115 ? 50.309 62.747  48.057  1.00 306.76 ? 115 GLU B CD    1 
ATOM 2168 O OE1   . GLU B 1 115 ? 49.078 62.578  48.191  1.00 299.25 ? 115 GLU B OE1   1 
ATOM 2169 O OE2   . GLU B 1 115 ? 50.899 62.615  46.964  1.00 308.77 ? 115 GLU B OE2   1 
ATOM 2170 N N     . TYR B 1 116 ? 49.995 62.704  53.919  1.00 247.71 ? 116 TYR B N     1 
ATOM 2171 C CA    . TYR B 1 116 ? 48.907 62.605  54.882  1.00 235.53 ? 116 TYR B CA    1 
ATOM 2172 C C     . TYR B 1 116 ? 49.317 62.741  56.342  1.00 260.58 ? 116 TYR B C     1 
ATOM 2173 O O     . TYR B 1 116 ? 48.501 63.197  57.145  1.00 273.14 ? 116 TYR B O     1 
ATOM 2174 C CB    . TYR B 1 116 ? 48.174 61.265  54.706  1.00 213.59 ? 116 TYR B CB    1 
ATOM 2175 C CG    . TYR B 1 116 ? 47.515 61.107  53.355  1.00 224.34 ? 116 TYR B CG    1 
ATOM 2176 C CD1   . TYR B 1 116 ? 46.986 62.201  52.683  1.00 244.01 ? 116 TYR B CD1   1 
ATOM 2177 C CD2   . TYR B 1 116 ? 47.435 59.864  52.744  1.00 232.18 ? 116 TYR B CD2   1 
ATOM 2178 C CE1   . TYR B 1 116 ? 46.390 62.060  51.444  1.00 253.26 ? 116 TYR B CE1   1 
ATOM 2179 C CE2   . TYR B 1 116 ? 46.840 59.712  51.507  1.00 239.37 ? 116 TYR B CE2   1 
ATOM 2180 C CZ    . TYR B 1 116 ? 46.319 60.812  50.861  1.00 255.79 ? 116 TYR B CZ    1 
ATOM 2181 O OH    . TYR B 1 116 ? 45.725 60.665  49.628  1.00 265.38 ? 116 TYR B OH    1 
ATOM 2182 N N     . THR B 1 117 ? 50.539 62.367  56.716  1.00 277.42 ? 117 THR B N     1 
ATOM 2183 C CA    . THR B 1 117 ? 50.903 62.283  58.128  1.00 298.55 ? 117 THR B CA    1 
ATOM 2184 C C     . THR B 1 117 ? 51.945 63.295  58.574  1.00 293.38 ? 117 THR B C     1 
ATOM 2185 O O     . THR B 1 117 ? 51.878 63.767  59.711  1.00 299.32 ? 117 THR B O     1 
ATOM 2186 C CB    . THR B 1 117 ? 51.426 60.881  58.463  1.00 318.64 ? 117 THR B CB    1 
ATOM 2187 O OG1   . THR B 1 117 ? 52.503 60.985  59.403  1.00 331.59 ? 117 THR B OG1   1 
ATOM 2188 C CG2   . THR B 1 117 ? 51.925 60.180  57.219  1.00 315.86 ? 117 THR B CG2   1 
ATOM 2189 N N     . ASP B 1 118 ? 52.914 63.621  57.721  1.00 289.28 ? 118 ASP B N     1 
ATOM 2190 C CA    . ASP B 1 118 ? 54.058 64.468  58.054  1.00 302.53 ? 118 ASP B CA    1 
ATOM 2191 C C     . ASP B 1 118 ? 54.965 63.840  59.109  1.00 301.94 ? 118 ASP B C     1 
ATOM 2192 O O     . ASP B 1 118 ? 55.890 64.500  59.597  1.00 308.69 ? 118 ASP B O     1 
ATOM 2193 C CB    . ASP B 1 118 ? 53.615 65.866  58.511  1.00 318.10 ? 118 ASP B CB    1 
ATOM 2194 C CG    . ASP B 1 118 ? 52.691 66.537  57.514  1.00 325.73 ? 118 ASP B CG    1 
ATOM 2195 O OD1   . ASP B 1 118 ? 52.735 66.172  56.321  1.00 330.14 ? 118 ASP B OD1   1 
ATOM 2196 O OD2   . ASP B 1 118 ? 51.916 67.426  57.926  1.00 328.21 ? 118 ASP B OD2   1 
ATOM 2197 N N     . TYR B 1 119 ? 54.722 62.583  59.474  1.00 299.64 ? 119 TYR B N     1 
ATOM 2198 C CA    . TYR B 1 119 ? 55.559 61.813  60.392  1.00 306.29 ? 119 TYR B CA    1 
ATOM 2199 C C     . TYR B 1 119 ? 55.957 60.494  59.744  1.00 302.92 ? 119 TYR B C     1 
ATOM 2200 O O     . TYR B 1 119 ? 55.894 59.424  60.353  1.00 310.93 ? 119 TYR B O     1 
ATOM 2201 C CB    . TYR B 1 119 ? 54.843 61.549  61.716  1.00 312.59 ? 119 TYR B CB    1 
ATOM 2202 C CG    . TYR B 1 119 ? 54.440 62.789  62.481  1.00 311.89 ? 119 TYR B CG    1 
ATOM 2203 C CD1   . TYR B 1 119 ? 55.396 63.637  63.025  1.00 307.52 ? 119 TYR B CD1   1 
ATOM 2204 C CD2   . TYR B 1 119 ? 53.101 63.105  62.672  1.00 311.87 ? 119 TYR B CD2   1 
ATOM 2205 C CE1   . TYR B 1 119 ? 55.029 64.767  63.731  1.00 306.09 ? 119 TYR B CE1   1 
ATOM 2206 C CE2   . TYR B 1 119 ? 52.724 64.232  63.375  1.00 304.37 ? 119 TYR B CE2   1 
ATOM 2207 C CZ    . TYR B 1 119 ? 53.692 65.060  63.902  1.00 302.91 ? 119 TYR B CZ    1 
ATOM 2208 O OH    . TYR B 1 119 ? 53.322 66.184  64.603  1.00 306.52 ? 119 TYR B OH    1 
ATOM 2209 N N     . LYS B 1 120 ? 56.379 60.566  58.479  1.00 290.93 ? 120 LYS B N     1 
ATOM 2210 C CA    . LYS B 1 120 ? 56.601 59.357  57.690  1.00 273.12 ? 120 LYS B CA    1 
ATOM 2211 C C     . LYS B 1 120 ? 57.745 58.520  58.251  1.00 263.90 ? 120 LYS B C     1 
ATOM 2212 O O     . LYS B 1 120 ? 57.618 57.299  58.398  1.00 274.13 ? 120 LYS B O     1 
ATOM 2213 C CB    . LYS B 1 120 ? 56.874 59.730  56.233  1.00 272.52 ? 120 LYS B CB    1 
ATOM 2214 C CG    . LYS B 1 120 ? 57.302 58.558  55.367  1.00 266.66 ? 120 LYS B CG    1 
ATOM 2215 C CD    . LYS B 1 120 ? 57.537 58.987  53.929  1.00 277.44 ? 120 LYS B CD    1 
ATOM 2216 C CE    . LYS B 1 120 ? 58.616 60.056  53.839  1.00 278.56 ? 120 LYS B CE    1 
ATOM 2217 N NZ    . LYS B 1 120 ? 58.866 60.479  52.432  1.00 270.18 ? 120 LYS B NZ    1 
ATOM 2218 N N     . ASN B 1 121 ? 58.874 59.158  58.567  1.00 240.95 ? 121 ASN B N     1 
ATOM 2219 C CA    . ASN B 1 121 ? 60.045 58.404  59.002  1.00 236.57 ? 121 ASN B CA    1 
ATOM 2220 C C     . ASN B 1 121 ? 59.809 57.738  60.353  1.00 252.75 ? 121 ASN B C     1 
ATOM 2221 O O     . ASN B 1 121 ? 60.265 56.611  60.583  1.00 268.96 ? 121 ASN B O     1 
ATOM 2222 C CB    . ASN B 1 121 ? 61.267 59.320  59.059  1.00 237.39 ? 121 ASN B CB    1 
ATOM 2223 C CG    . ASN B 1 121 ? 62.576 58.557  58.964  1.00 256.22 ? 121 ASN B CG    1 
ATOM 2224 O OD1   . ASN B 1 121 ? 62.659 57.390  59.348  1.00 242.73 ? 121 ASN B OD1   1 
ATOM 2225 N ND2   . ASN B 1 121 ? 63.608 59.215  58.447  1.00 255.37 ? 121 ASN B ND2   1 
ATOM 2226 N N     . ASP B 1 122 ? 59.087 58.410  61.254  1.00 248.77 ? 122 ASP B N     1 
ATOM 2227 C CA    . ASP B 1 122 ? 58.881 57.859  62.589  1.00 234.54 ? 122 ASP B CA    1 
ATOM 2228 C C     . ASP B 1 122 ? 58.003 56.615  62.565  1.00 223.32 ? 122 ASP B C     1 
ATOM 2229 O O     . ASP B 1 122 ? 58.172 55.725  63.406  1.00 228.44 ? 122 ASP B O     1 
ATOM 2230 C CB    . ASP B 1 122 ? 58.269 58.917  63.508  1.00 240.73 ? 122 ASP B CB    1 
ATOM 2231 C CG    . ASP B 1 122 ? 59.137 60.153  63.632  1.00 259.30 ? 122 ASP B CG    1 
ATOM 2232 O OD1   . ASP B 1 122 ? 60.358 60.051  63.387  1.00 263.82 ? 122 ASP B OD1   1 
ATOM 2233 O OD2   . ASP B 1 122 ? 58.599 61.225  63.979  1.00 264.61 ? 122 ASP B OD2   1 
ATOM 2234 N N     . ILE B 1 123 ? 57.070 56.527  61.616  1.00 221.54 ? 123 ILE B N     1 
ATOM 2235 C CA    . ILE B 1 123 ? 56.208 55.353  61.545  1.00 235.39 ? 123 ILE B CA    1 
ATOM 2236 C C     . ILE B 1 123 ? 56.907 54.214  60.813  1.00 225.09 ? 123 ILE B C     1 
ATOM 2237 O O     . ILE B 1 123 ? 56.763 53.042  61.181  1.00 210.38 ? 123 ILE B O     1 
ATOM 2238 C CB    . ILE B 1 123 ? 54.872 55.723  60.873  1.00 224.79 ? 123 ILE B CB    1 
ATOM 2239 C CG1   . ILE B 1 123 ? 54.228 56.913  61.587  1.00 219.65 ? 123 ILE B CG1   1 
ATOM 2240 C CG2   . ILE B 1 123 ? 53.925 54.532  60.864  1.00 221.07 ? 123 ILE B CG2   1 
ATOM 2241 C CD1   . ILE B 1 123 ? 53.889 56.648  63.038  1.00 220.77 ? 123 ILE B CD1   1 
ATOM 2242 N N     . LEU B 1 124 ? 57.682 54.540  59.778  1.00 218.60 ? 124 LEU B N     1 
ATOM 2243 C CA    . LEU B 1 124 ? 58.399 53.518  59.025  1.00 214.04 ? 124 LEU B CA    1 
ATOM 2244 C C     . LEU B 1 124 ? 59.548 52.921  59.829  1.00 215.21 ? 124 LEU B C     1 
ATOM 2245 O O     . LEU B 1 124 ? 59.876 51.742  59.657  1.00 228.49 ? 124 LEU B O     1 
ATOM 2246 C CB    . LEU B 1 124 ? 58.917 54.106  57.713  1.00 222.30 ? 124 LEU B CB    1 
ATOM 2247 C CG    . LEU B 1 124 ? 57.885 54.246  56.592  1.00 202.65 ? 124 LEU B CG    1 
ATOM 2248 C CD1   . LEU B 1 124 ? 58.490 54.955  55.392  1.00 211.80 ? 124 LEU B CD1   1 
ATOM 2249 C CD2   . LEU B 1 124 ? 57.335 52.888  56.194  1.00 202.10 ? 124 LEU B CD2   1 
ATOM 2250 N N     . ASN B 1 125 ? 60.163 53.711  60.708  1.00 202.35 ? 125 ASN B N     1 
ATOM 2251 C CA    . ASN B 1 125 ? 61.322 53.267  61.469  1.00 218.68 ? 125 ASN B CA    1 
ATOM 2252 C C     . ASN B 1 125 ? 60.970 52.351  62.634  1.00 235.72 ? 125 ASN B C     1 
ATOM 2253 O O     . ASN B 1 125 ? 61.866 51.692  63.173  1.00 224.56 ? 125 ASN B O     1 
ATOM 2254 C CB    . ASN B 1 125 ? 62.082 54.488  61.994  1.00 227.09 ? 125 ASN B CB    1 
ATOM 2255 C CG    . ASN B 1 125 ? 63.565 54.233  62.147  1.00 225.89 ? 125 ASN B CG    1 
ATOM 2256 O OD1   . ASN B 1 125 ? 64.019 53.091  62.101  1.00 231.13 ? 125 ASN B OD1   1 
ATOM 2257 N ND2   . ASN B 1 125 ? 64.331 55.302  62.335  1.00 230.47 ? 125 ASN B ND2   1 
ATOM 2258 N N     . LYS B 1 126 ? 59.702 52.281  63.034  1.00 242.87 ? 126 LYS B N     1 
ATOM 2259 C CA    . LYS B 1 126 ? 59.328 51.471  64.187  1.00 244.90 ? 126 LYS B CA    1 
ATOM 2260 C C     . LYS B 1 126 ? 59.075 50.012  63.819  1.00 251.28 ? 126 LYS B C     1 
ATOM 2261 O O     . LYS B 1 126 ? 59.638 49.104  64.440  1.00 254.37 ? 126 LYS B O     1 
ATOM 2262 C CB    . LYS B 1 126 ? 58.083 52.063  64.862  1.00 239.06 ? 126 LYS B CB    1 
ATOM 2263 C CG    . LYS B 1 126 ? 57.225 51.053  65.630  1.00 250.04 ? 126 LYS B CG    1 
ATOM 2264 C CD    . LYS B 1 126 ? 57.961 50.447  66.819  1.00 262.84 ? 126 LYS B CD    1 
ATOM 2265 C CE    . LYS B 1 126 ? 57.464 49.040  67.117  1.00 248.53 ? 126 LYS B CE    1 
ATOM 2266 N NZ    . LYS B 1 126 ? 58.343 48.333  68.091  1.00 241.20 ? 126 LYS B NZ    1 
ATOM 2267 N N     . TYR B 1 127 ? 58.243 49.774  62.810  1.00 248.49 ? 127 TYR B N     1 
ATOM 2268 C CA    . TYR B 1 127 ? 57.542 48.501  62.705  1.00 249.29 ? 127 TYR B CA    1 
ATOM 2269 C C     . TYR B 1 127 ? 58.339 47.476  61.901  1.00 268.84 ? 127 TYR B C     1 
ATOM 2270 O O     . TYR B 1 127 ? 58.655 46.394  62.406  1.00 273.67 ? 127 TYR B O     1 
ATOM 2271 C CB    . TYR B 1 127 ? 56.166 48.749  62.080  1.00 234.85 ? 127 TYR B CB    1 
ATOM 2272 C CG    . TYR B 1 127 ? 55.223 49.471  63.018  1.00 252.23 ? 127 TYR B CG    1 
ATOM 2273 C CD1   . TYR B 1 127 ? 54.753 48.870  64.177  1.00 266.46 ? 127 TYR B CD1   1 
ATOM 2274 C CD2   . TYR B 1 127 ? 54.829 50.776  62.751  1.00 257.15 ? 127 TYR B CD2   1 
ATOM 2275 C CE1   . TYR B 1 127 ? 53.898 49.545  65.037  1.00 268.86 ? 127 TYR B CE1   1 
ATOM 2276 C CE2   . TYR B 1 127 ? 53.978 51.457  63.602  1.00 251.66 ? 127 TYR B CE2   1 
ATOM 2277 C CZ    . TYR B 1 127 ? 53.516 50.838  64.743  1.00 259.53 ? 127 TYR B CZ    1 
ATOM 2278 O OH    . TYR B 1 127 ? 52.669 51.518  65.589  1.00 264.75 ? 127 TYR B OH    1 
ATOM 2279 N N     . THR B 1 128 ? 58.634 47.797  60.636  1.00 273.52 ? 128 THR B N     1 
ATOM 2280 C CA    . THR B 1 128 ? 59.386 46.953  59.709  1.00 277.21 ? 128 THR B CA    1 
ATOM 2281 C C     . THR B 1 128 ? 58.585 45.708  59.329  1.00 268.16 ? 128 THR B C     1 
ATOM 2282 O O     . THR B 1 128 ? 58.989 44.939  58.450  1.00 268.81 ? 128 THR B O     1 
ATOM 2283 C CB    . THR B 1 128 ? 60.749 46.574  60.304  1.00 281.93 ? 128 THR B CB    1 
ATOM 2284 O OG1   . THR B 1 128 ? 61.326 47.725  60.934  1.00 281.19 ? 128 THR B OG1   1 
ATOM 2285 C CG2   . THR B 1 128 ? 61.704 46.089  59.220  1.00 276.99 ? 128 THR B CG2   1 
ATOM 2286 N N     . LYS B 1 129 ? 57.432 45.517  59.963  1.00 244.69 ? 129 LYS B N     1 
ATOM 2287 C CA    . LYS B 1 129 ? 56.435 44.541  59.535  1.00 209.53 ? 129 LYS B CA    1 
ATOM 2288 C C     . LYS B 1 129 ? 55.207 45.376  59.202  1.00 196.22 ? 129 LYS B C     1 
ATOM 2289 O O     . LYS B 1 129 ? 54.310 45.559  60.029  1.00 218.71 ? 129 LYS B O     1 
ATOM 2290 C CB    . LYS B 1 129 ? 56.157 43.487  60.596  1.00 218.82 ? 129 LYS B CB    1 
ATOM 2291 C CG    . LYS B 1 129 ? 55.817 42.123  60.010  1.00 228.55 ? 129 LYS B CG    1 
ATOM 2292 C CD    . LYS B 1 129 ? 56.902 41.661  59.044  1.00 225.16 ? 129 LYS B CD    1 
ATOM 2293 C CE    . LYS B 1 129 ? 56.552 40.329  58.397  1.00 216.88 ? 129 LYS B CE    1 
ATOM 2294 N NZ    . LYS B 1 129 ? 57.583 39.897  57.409  1.00 211.76 ? 129 LYS B NZ    1 
ATOM 2295 N N     . LEU B 1 130 ? 55.181 45.874  57.971  1.00 172.69 ? 130 LEU B N     1 
ATOM 2296 C CA    . LEU B 1 130 ? 54.249 46.903  57.540  1.00 181.25 ? 130 LEU B CA    1 
ATOM 2297 C C     . LEU B 1 130 ? 52.955 46.345  56.972  1.00 185.07 ? 130 LEU B C     1 
ATOM 2298 O O     . LEU B 1 130 ? 51.966 47.081  56.893  1.00 182.08 ? 130 LEU B O     1 
ATOM 2299 C CB    . LEU B 1 130 ? 54.919 47.811  56.506  1.00 181.52 ? 130 LEU B CB    1 
ATOM 2300 C CG    . LEU B 1 130 ? 56.223 48.443  57.000  1.00 191.21 ? 130 LEU B CG    1 
ATOM 2301 C CD1   . LEU B 1 130 ? 56.874 49.276  55.908  1.00 195.87 ? 130 LEU B CD1   1 
ATOM 2302 C CD2   . LEU B 1 130 ? 55.990 49.270  58.258  1.00 193.08 ? 130 LEU B CD2   1 
ATOM 2303 N N     . ASP B 1 131 ? 52.932 45.077  56.582  1.00 195.97 ? 131 ASP B N     1 
ATOM 2304 C CA    . ASP B 1 131 ? 51.876 44.539  55.730  1.00 189.26 ? 131 ASP B CA    1 
ATOM 2305 C C     . ASP B 1 131 ? 50.530 44.373  56.442  1.00 203.88 ? 131 ASP B C     1 
ATOM 2306 O O     . ASP B 1 131 ? 49.657 43.666  55.922  1.00 231.07 ? 131 ASP B O     1 
ATOM 2307 C CB    . ASP B 1 131 ? 52.334 43.197  55.156  1.00 205.91 ? 131 ASP B CB    1 
ATOM 2308 C CG    . ASP B 1 131 ? 53.342 42.495  56.049  1.00 223.52 ? 131 ASP B CG    1 
ATOM 2309 O OD1   . ASP B 1 131 ? 54.201 43.185  56.642  1.00 232.26 ? 131 ASP B OD1   1 
ATOM 2310 O OD2   . ASP B 1 131 ? 53.279 41.254  56.158  1.00 225.71 ? 131 ASP B OD2   1 
ATOM 2311 N N     . ASP B 1 132 ? 50.342 45.000  57.601  1.00 209.59 ? 132 ASP B N     1 
ATOM 2312 C CA    . ASP B 1 132 ? 49.038 45.129  58.237  1.00 216.56 ? 132 ASP B CA    1 
ATOM 2313 C C     . ASP B 1 132 ? 48.589 46.581  58.292  1.00 196.62 ? 132 ASP B C     1 
ATOM 2314 O O     . ASP B 1 132 ? 47.466 46.904  57.882  1.00 196.34 ? 132 ASP B O     1 
ATOM 2315 C CB    . ASP B 1 132 ? 49.049 44.513  59.647  1.00 225.24 ? 132 ASP B CB    1 
ATOM 2316 C CG    . ASP B 1 132 ? 50.295 44.862  60.432  1.00 221.99 ? 132 ASP B CG    1 
ATOM 2317 O OD1   . ASP B 1 132 ? 51.144 45.615  59.911  1.00 222.77 ? 132 ASP B OD1   1 
ATOM 2318 O OD2   . ASP B 1 132 ? 50.426 44.373  61.573  1.00 215.20 ? 132 ASP B OD2   1 
ATOM 2319 N N     . ILE B 1 133 ? 49.450 47.474  58.789  1.00 181.25 ? 133 ILE B N     1 
ATOM 2320 C CA    . ILE B 1 133 ? 49.140 48.899  58.748  1.00 176.20 ? 133 ILE B CA    1 
ATOM 2321 C C     . ILE B 1 133 ? 49.025 49.363  57.304  1.00 184.99 ? 133 ILE B C     1 
ATOM 2322 O O     . ILE B 1 133 ? 48.209 50.236  56.988  1.00 211.75 ? 133 ILE B O     1 
ATOM 2323 C CB    . ILE B 1 133 ? 50.198 49.716  59.517  1.00 186.58 ? 133 ILE B CB    1 
ATOM 2324 C CG1   . ILE B 1 133 ? 51.577 49.575  58.866  1.00 153.44 ? 133 ILE B CG1   1 
ATOM 2325 C CG2   . ILE B 1 133 ? 50.250 49.284  60.972  1.00 131.93 ? 133 ILE B CG2   1 
ATOM 2326 C CD1   . ILE B 1 133 ? 52.668 50.349  59.562  1.00 166.11 ? 133 ILE B CD1   1 
ATOM 2327 N N     . ALA B 1 134 ? 49.825 48.782  56.406  1.00 164.42 ? 134 ALA B N     1 
ATOM 2328 C CA    . ALA B 1 134 ? 49.707 49.092  54.985  1.00 170.01 ? 134 ALA B CA    1 
ATOM 2329 C C     . ALA B 1 134 ? 48.331 48.710  54.459  1.00 197.92 ? 134 ALA B C     1 
ATOM 2330 O O     . ALA B 1 134 ? 47.692 49.484  53.738  1.00 203.37 ? 134 ALA B O     1 
ATOM 2331 C CB    . ALA B 1 134 ? 50.807 48.381  54.195  1.00 151.17 ? 134 ALA B CB    1 
ATOM 2332 N N     . ASN B 1 135 ? 47.869 47.502  54.793  1.00 209.66 ? 135 ASN B N     1 
ATOM 2333 C CA    . ASN B 1 135 ? 46.553 47.062  54.343  1.00 221.12 ? 135 ASN B CA    1 
ATOM 2334 C C     . ASN B 1 135 ? 45.456 47.969  54.887  1.00 198.29 ? 135 ASN B C     1 
ATOM 2335 O O     . ASN B 1 135 ? 44.524 48.328  54.160  1.00 200.49 ? 135 ASN B O     1 
ATOM 2336 C CB    . ASN B 1 135 ? 46.309 45.610  54.751  1.00 245.28 ? 135 ASN B CB    1 
ATOM 2337 C CG    . ASN B 1 135 ? 45.115 45.001  54.040  1.00 268.54 ? 135 ASN B CG    1 
ATOM 2338 O OD1   . ASN B 1 135 ? 44.667 45.508  53.011  1.00 271.25 ? 135 ASN B OD1   1 
ATOM 2339 N ND2   . ASN B 1 135 ? 44.597 43.905  54.582  1.00 281.72 ? 135 ASN B ND2   1 
ATOM 2340 N N     . SER B 1 136 ? 45.541 48.337  56.169  1.00 196.60 ? 136 SER B N     1 
ATOM 2341 C CA    . SER B 1 136 ? 44.524 49.212  56.750  1.00 190.29 ? 136 SER B CA    1 
ATOM 2342 C C     . SER B 1 136 ? 44.529 50.577  56.072  1.00 184.90 ? 136 SER B C     1 
ATOM 2343 O O     . SER B 1 136 ? 43.466 51.129  55.754  1.00 189.97 ? 136 SER B O     1 
ATOM 2344 C CB    . SER B 1 136 ? 44.748 49.361  58.255  1.00 157.16 ? 136 SER B CB    1 
ATOM 2345 O OG    . SER B 1 136 ? 45.959 50.044  58.525  1.00 141.35 ? 136 SER B OG    1 
ATOM 2346 N N     . PHE B 1 137 ? 45.720 51.140  55.853  1.00 182.96 ? 137 PHE B N     1 
ATOM 2347 C CA    . PHE B 1 137 ? 45.838 52.430  55.186  1.00 183.48 ? 137 PHE B CA    1 
ATOM 2348 C C     . PHE B 1 137 ? 45.263 52.374  53.778  1.00 210.39 ? 137 PHE B C     1 
ATOM 2349 O O     . PHE B 1 137 ? 44.541 53.285  53.359  1.00 216.70 ? 137 PHE B O     1 
ATOM 2350 C CB    . PHE B 1 137 ? 47.312 52.846  55.154  1.00 178.52 ? 137 PHE B CB    1 
ATOM 2351 C CG    . PHE B 1 137 ? 47.577 54.148  54.446  1.00 183.05 ? 137 PHE B CG    1 
ATOM 2352 C CD1   . PHE B 1 137 ? 47.582 55.345  55.140  1.00 189.69 ? 137 PHE B CD1   1 
ATOM 2353 C CD2   . PHE B 1 137 ? 47.854 54.167  53.087  1.00 206.58 ? 137 PHE B CD2   1 
ATOM 2354 C CE1   . PHE B 1 137 ? 47.838 56.539  54.487  1.00 177.96 ? 137 PHE B CE1   1 
ATOM 2355 C CE2   . PHE B 1 137 ? 48.108 55.356  52.430  1.00 194.99 ? 137 PHE B CE2   1 
ATOM 2356 C CZ    . PHE B 1 137 ? 48.102 56.543  53.131  1.00 178.00 ? 137 PHE B CZ    1 
ATOM 2357 N N     . ASN B 1 138 ? 45.556 51.300  53.039  1.00 215.40 ? 138 ASN B N     1 
ATOM 2358 C CA    . ASN B 1 138 ? 45.044 51.176  51.679  1.00 180.23 ? 138 ASN B CA    1 
ATOM 2359 C C     . ASN B 1 138 ? 43.533 50.993  51.669  1.00 171.95 ? 138 ASN B C     1 
ATOM 2360 O O     . ASN B 1 138 ? 42.846 51.550  50.810  1.00 173.41 ? 138 ASN B O     1 
ATOM 2361 C CB    . ASN B 1 138 ? 45.737 50.023  50.955  1.00 176.24 ? 138 ASN B CB    1 
ATOM 2362 C CG    . ASN B 1 138 ? 47.205 50.297  50.700  1.00 205.79 ? 138 ASN B CG    1 
ATOM 2363 O OD1   . ASN B 1 138 ? 47.605 51.442  50.488  1.00 206.16 ? 138 ASN B OD1   1 
ATOM 2364 N ND2   . ASN B 1 138 ? 48.017 49.246  50.711  1.00 222.41 ? 138 ASN B ND2   1 
ATOM 2365 N N     . LEU B 1 139 ? 42.997 50.224  52.618  1.00 177.82 ? 139 LEU B N     1 
ATOM 2366 C CA    . LEU B 1 139 ? 41.550 50.062  52.722  1.00 184.01 ? 139 LEU B CA    1 
ATOM 2367 C C     . LEU B 1 139 ? 40.868 51.401  52.981  1.00 194.82 ? 139 LEU B C     1 
ATOM 2368 O O     . LEU B 1 139 ? 39.899 51.768  52.298  1.00 201.91 ? 139 LEU B O     1 
ATOM 2369 C CB    . LEU B 1 139 ? 41.231 49.061  53.834  1.00 171.83 ? 139 LEU B CB    1 
ATOM 2370 C CG    . LEU B 1 139 ? 39.807 48.522  53.962  1.00 163.51 ? 139 LEU B CG    1 
ATOM 2371 C CD1   . LEU B 1 139 ? 39.409 47.730  52.728  1.00 194.89 ? 139 LEU B CD1   1 
ATOM 2372 C CD2   . LEU B 1 139 ? 39.681 47.667  55.212  1.00 157.21 ? 139 LEU B CD2   1 
ATOM 2373 N N     . GLY B 1 140 ? 41.369 52.149  53.967  1.00 194.69 ? 140 GLY B N     1 
ATOM 2374 C CA    . GLY B 1 140 ? 40.791 53.451  54.261  1.00 190.38 ? 140 GLY B CA    1 
ATOM 2375 C C     . GLY B 1 140 ? 40.888 54.405  53.087  1.00 175.75 ? 140 GLY B C     1 
ATOM 2376 O O     . GLY B 1 140 ? 39.917 55.080  52.733  1.00 188.65 ? 140 GLY B O     1 
ATOM 2377 N N     . LEU B 1 141 ? 42.067 54.474  52.466  1.00 164.49 ? 141 LEU B N     1 
ATOM 2378 C CA    . LEU B 1 141 ? 42.259 55.387  51.348  1.00 186.31 ? 141 LEU B CA    1 
ATOM 2379 C C     . LEU B 1 141 ? 41.396 54.994  50.157  1.00 204.58 ? 141 LEU B C     1 
ATOM 2380 O O     . LEU B 1 141 ? 40.902 55.863  49.436  1.00 220.40 ? 141 LEU B O     1 
ATOM 2381 C CB    . LEU B 1 141 ? 43.735 55.432  50.956  1.00 179.20 ? 141 LEU B CB    1 
ATOM 2382 C CG    . LEU B 1 141 ? 44.153 56.677  50.178  1.00 207.08 ? 141 LEU B CG    1 
ATOM 2383 C CD1   . LEU B 1 141 ? 43.810 57.927  50.971  1.00 202.13 ? 141 LEU B CD1   1 
ATOM 2384 C CD2   . LEU B 1 141 ? 45.634 56.632  49.859  1.00 239.40 ? 141 LEU B CD2   1 
ATOM 2385 N N     . SER B 1 142 ? 41.193 53.692  49.935  1.00 216.83 ? 142 SER B N     1 
ATOM 2386 C CA    . SER B 1 142 ? 40.316 53.253  48.855  1.00 224.89 ? 142 SER B CA    1 
ATOM 2387 C C     . SER B 1 142 ? 38.872 53.646  49.129  1.00 218.60 ? 142 SER B C     1 
ATOM 2388 O O     . SER B 1 142 ? 38.155 54.079  48.216  1.00 243.40 ? 142 SER B O     1 
ATOM 2389 C CB    . SER B 1 142 ? 40.432 51.741  48.664  1.00 230.15 ? 142 SER B CB    1 
ATOM 2390 O OG    . SER B 1 142 ? 39.791 51.043  49.717  1.00 230.41 ? 142 SER B OG    1 
ATOM 2391 N N     . TYR B 1 143 ? 38.427 53.507  50.380  1.00 219.14 ? 143 TYR B N     1 
ATOM 2392 C CA    . TYR B 1 143 ? 37.087 53.972  50.723  1.00 221.31 ? 143 TYR B CA    1 
ATOM 2393 C C     . TYR B 1 143 ? 36.957 55.470  50.478  1.00 227.50 ? 143 TYR B C     1 
ATOM 2394 O O     . TYR B 1 143 ? 35.928 55.939  49.978  1.00 208.37 ? 143 TYR B O     1 
ATOM 2395 C CB    . TYR B 1 143 ? 36.762 53.636  52.176  1.00 179.09 ? 143 TYR B CB    1 
ATOM 2396 C CG    . TYR B 1 143 ? 35.420 54.160  52.635  1.00 166.56 ? 143 TYR B CG    1 
ATOM 2397 C CD1   . TYR B 1 143 ? 34.262 53.424  52.428  1.00 188.44 ? 143 TYR B CD1   1 
ATOM 2398 C CD2   . TYR B 1 143 ? 35.308 55.389  53.272  1.00 159.28 ? 143 TYR B CD2   1 
ATOM 2399 C CE1   . TYR B 1 143 ? 33.029 53.894  52.841  1.00 195.60 ? 143 TYR B CE1   1 
ATOM 2400 C CE2   . TYR B 1 143 ? 34.077 55.869  53.689  1.00 172.85 ? 143 TYR B CE2   1 
ATOM 2401 C CZ    . TYR B 1 143 ? 32.942 55.115  53.471  1.00 172.03 ? 143 TYR B CZ    1 
ATOM 2402 O OH    . TYR B 1 143 ? 31.715 55.581  53.881  1.00 165.17 ? 143 TYR B OH    1 
ATOM 2403 N N     . MET B 1 144 ? 37.993 56.236  50.828  1.00 240.87 ? 144 MET B N     1 
ATOM 2404 C CA    . MET B 1 144 ? 37.949 57.681  50.617  1.00 240.02 ? 144 MET B CA    1 
ATOM 2405 C C     . MET B 1 144 ? 37.967 58.030  49.133  1.00 234.77 ? 144 MET B C     1 
ATOM 2406 O O     . MET B 1 144 ? 37.341 59.014  48.721  1.00 238.16 ? 144 MET B O     1 
ATOM 2407 C CB    . MET B 1 144 ? 39.103 58.356  51.355  1.00 240.97 ? 144 MET B CB    1 
ATOM 2408 C CG    . MET B 1 144 ? 39.086 58.087  52.850  1.00 245.28 ? 144 MET B CG    1 
ATOM 2409 S SD    . MET B 1 144 ? 40.461 58.825  53.744  1.00 247.14 ? 144 MET B SD    1 
ATOM 2410 C CE    . MET B 1 144 ? 39.585 59.554  55.123  1.00 233.10 ? 144 MET B CE    1 
ATOM 2411 N N     . GLU B 1 145 ? 38.686 57.251  48.324  1.00 232.41 ? 145 GLU B N     1 
ATOM 2412 C CA    . GLU B 1 145 ? 38.660 57.452  46.880  1.00 221.24 ? 145 GLU B CA    1 
ATOM 2413 C C     . GLU B 1 145 ? 37.274 57.161  46.324  1.00 222.62 ? 145 GLU B C     1 
ATOM 2414 O O     . GLU B 1 145 ? 36.823 57.821  45.381  1.00 255.07 ? 145 GLU B O     1 
ATOM 2415 C CB    . GLU B 1 145 ? 39.703 56.564  46.197  1.00 221.81 ? 145 GLU B CB    1 
ATOM 2416 C CG    . GLU B 1 145 ? 41.145 56.859  46.579  1.00 228.95 ? 145 GLU B CG    1 
ATOM 2417 C CD    . GLU B 1 145 ? 41.621 58.219  46.113  1.00 267.96 ? 145 GLU B CD    1 
ATOM 2418 O OE1   . GLU B 1 145 ? 41.044 58.760  45.146  1.00 294.87 ? 145 GLU B OE1   1 
ATOM 2419 O OE2   . GLU B 1 145 ? 42.575 58.750  46.719  1.00 269.00 ? 145 GLU B OE2   1 
ATOM 2420 N N     . SER B 1 146 ? 36.584 56.174  46.898  1.00 223.17 ? 146 SER B N     1 
ATOM 2421 C CA    . SER B 1 146 ? 35.212 55.880  46.505  1.00 229.44 ? 146 SER B CA    1 
ATOM 2422 C C     . SER B 1 146 ? 34.213 56.898  47.040  1.00 232.23 ? 146 SER B C     1 
ATOM 2423 O O     . SER B 1 146 ? 33.025 56.798  46.714  1.00 247.34 ? 146 SER B O     1 
ATOM 2424 C CB    . SER B 1 146 ? 34.823 54.479  46.980  1.00 243.56 ? 146 SER B CB    1 
ATOM 2425 O OG    . SER B 1 146 ? 33.437 54.243  46.805  1.00 252.91 ? 146 SER B OG    1 
ATOM 2426 N N     . LEU B 1 147 ? 34.655 57.866  47.845  1.00 225.81 ? 147 LEU B N     1 
ATOM 2427 C CA    . LEU B 1 147 ? 33.737 58.863  48.387  1.00 219.21 ? 147 LEU B CA    1 
ATOM 2428 C C     . LEU B 1 147 ? 33.398 59.937  47.361  1.00 220.11 ? 147 LEU B C     1 
ATOM 2429 O O     . LEU B 1 147 ? 32.241 60.361  47.262  1.00 228.81 ? 147 LEU B O     1 
ATOM 2430 C CB    . LEU B 1 147 ? 34.334 59.500  49.643  1.00 217.99 ? 147 LEU B CB    1 
ATOM 2431 C CG    . LEU B 1 147 ? 34.234 58.681  50.931  1.00 201.20 ? 147 LEU B CG    1 
ATOM 2432 C CD1   . LEU B 1 147 ? 34.840 59.443  52.101  1.00 196.68 ? 147 LEU B CD1   1 
ATOM 2433 C CD2   . LEU B 1 147 ? 32.789 58.308  51.218  1.00 202.98 ? 147 LEU B CD2   1 
ATOM 2434 N N     . LEU B 1 148 ? 34.386 60.390  46.596  1.00 224.49 ? 148 LEU B N     1 
ATOM 2435 C CA    . LEU B 1 148 ? 34.167 61.438  45.605  1.00 225.64 ? 148 LEU B CA    1 
ATOM 2436 C C     . LEU B 1 148 ? 33.449 60.889  44.376  1.00 220.86 ? 148 LEU B C     1 
ATOM 2437 O O     . LEU B 1 148 ? 32.439 61.440  43.939  1.00 214.99 ? 148 LEU B O     1 
ATOM 2438 C CB    . LEU B 1 148 ? 35.494 62.084  45.194  1.00 216.00 ? 148 LEU B CB    1 
ATOM 2439 C CG    . LEU B 1 148 ? 36.179 63.026  46.191  1.00 220.42 ? 148 LEU B CG    1 
ATOM 2440 C CD1   . LEU B 1 148 ? 36.882 62.261  47.307  1.00 223.98 ? 148 LEU B CD1   1 
ATOM 2441 C CD2   . LEU B 1 148 ? 37.154 63.950  45.474  1.00 208.05 ? 148 LEU B CD2   1 
ATOM 2442 N N     . MET C 1 1   ? 85.161 38.040  20.129  1.00 181.58 ? 1   MET C N     1 
ATOM 2443 C CA    . MET C 1 1   ? 84.104 37.163  19.640  1.00 171.52 ? 1   MET C CA    1 
ATOM 2444 C C     . MET C 1 1   ? 83.012 37.964  18.935  1.00 149.34 ? 1   MET C C     1 
ATOM 2445 O O     . MET C 1 1   ? 82.817 39.145  19.221  1.00 142.23 ? 1   MET C O     1 
ATOM 2446 C CB    . MET C 1 1   ? 83.510 36.349  20.794  1.00 159.71 ? 1   MET C CB    1 
ATOM 2447 C CG    . MET C 1 1   ? 82.894 37.190  21.899  1.00 180.06 ? 1   MET C CG    1 
ATOM 2448 S SD    . MET C 1 1   ? 82.555 36.237  23.392  1.00 211.49 ? 1   MET C SD    1 
ATOM 2449 C CE    . MET C 1 1   ? 81.652 34.848  22.711  1.00 212.21 ? 1   MET C CE    1 
ATOM 2450 N N     . ILE C 1 2   ? 82.310 37.322  18.006  1.00 138.47 ? 2   ILE C N     1 
ATOM 2451 C CA    . ILE C 1 2   ? 81.226 37.955  17.263  1.00 136.81 ? 2   ILE C CA    1 
ATOM 2452 C C     . ILE C 1 2   ? 79.911 37.526  17.896  1.00 151.26 ? 2   ILE C C     1 
ATOM 2453 O O     . ILE C 1 2   ? 79.600 36.330  17.948  1.00 192.64 ? 2   ILE C O     1 
ATOM 2454 C CB    . ILE C 1 2   ? 81.268 37.584  15.771  1.00 136.02 ? 2   ILE C CB    1 
ATOM 2455 C CG1   . ILE C 1 2   ? 82.469 38.235  15.080  1.00 150.66 ? 2   ILE C CG1   1 
ATOM 2456 C CG2   . ILE C 1 2   ? 79.973 37.996  15.084  1.00 140.74 ? 2   ILE C CG2   1 
ATOM 2457 C CD1   . ILE C 1 2   ? 83.743 37.417  15.148  1.00 186.25 ? 2   ILE C CD1   1 
ATOM 2458 N N     . ILE C 1 3   ? 79.141 38.494  18.384  1.00 133.63 ? 3   ILE C N     1 
ATOM 2459 C CA    . ILE C 1 3   ? 77.908 38.225  19.116  1.00 120.40 ? 3   ILE C CA    1 
ATOM 2460 C C     . ILE C 1 3   ? 76.728 38.634  18.248  1.00 119.38 ? 3   ILE C C     1 
ATOM 2461 O O     . ILE C 1 3   ? 76.741 39.708  17.637  1.00 117.75 ? 3   ILE C O     1 
ATOM 2462 C CB    . ILE C 1 3   ? 77.901 38.939  20.478  1.00 126.04 ? 3   ILE C CB    1 
ATOM 2463 C CG1   . ILE C 1 3   ? 79.078 38.422  21.310  1.00 144.66 ? 3   ILE C CG1   1 
ATOM 2464 C CG2   . ILE C 1 3   ? 76.580 38.725  21.198  1.00 120.78 ? 3   ILE C CG2   1 
ATOM 2465 C CD1   . ILE C 1 3   ? 79.056 38.815  22.759  1.00 160.74 ? 3   ILE C CD1   1 
ATOM 2466 N N     . CYS C 1 4   ? 75.706 37.779  18.196  1.00 144.76 ? 4   CYS C N     1 
ATOM 2467 C CA    . CYS C 1 4   ? 74.524 38.001  17.367  1.00 146.69 ? 4   CYS C CA    1 
ATOM 2468 C C     . CYS C 1 4   ? 73.276 37.897  18.234  1.00 151.14 ? 4   CYS C C     1 
ATOM 2469 O O     . CYS C 1 4   ? 72.925 36.807  18.696  1.00 151.84 ? 4   CYS C O     1 
ATOM 2470 C CB    . CYS C 1 4   ? 74.474 36.992  16.217  1.00 137.27 ? 4   CYS C CB    1 
ATOM 2471 S SG    . CYS C 1 4   ? 72.935 36.981  15.270  1.00 136.48 ? 4   CYS C SG    1 
ATOM 2472 N N     . SER C 1 5   ? 72.609 39.027  18.453  1.00 145.77 ? 5   SER C N     1 
ATOM 2473 C CA    . SER C 1 5   ? 71.397 39.087  19.259  1.00 157.23 ? 5   SER C CA    1 
ATOM 2474 C C     . SER C 1 5   ? 70.186 39.282  18.356  1.00 124.87 ? 5   SER C C     1 
ATOM 2475 O O     . SER C 1 5   ? 70.224 40.081  17.417  1.00 138.88 ? 5   SER C O     1 
ATOM 2476 C CB    . SER C 1 5   ? 71.477 40.217  20.290  1.00 173.99 ? 5   SER C CB    1 
ATOM 2477 O OG    . SER C 1 5   ? 71.618 41.480  19.663  1.00 166.16 ? 5   SER C OG    1 
ATOM 2478 N N     . VAL C 1 6   ? 69.118 38.536  18.625  1.00 132.01 ? 6   VAL C N     1 
ATOM 2479 C CA    . VAL C 1 6   ? 67.969 38.468  17.730  1.00 159.93 ? 6   VAL C CA    1 
ATOM 2480 C C     . VAL C 1 6   ? 66.695 38.781  18.504  1.00 172.21 ? 6   VAL C C     1 
ATOM 2481 O O     . VAL C 1 6   ? 66.422 38.165  19.541  1.00 154.63 ? 6   VAL C O     1 
ATOM 2482 C CB    . VAL C 1 6   ? 67.848 37.089  17.052  1.00 128.36 ? 6   VAL C CB    1 
ATOM 2483 C CG1   . VAL C 1 6   ? 66.696 37.087  16.055  1.00 125.16 ? 6   VAL C CG1   1 
ATOM 2484 C CG2   . VAL C 1 6   ? 69.150 36.714  16.367  1.00 120.21 ? 6   VAL C CG2   1 
ATOM 2485 N N     . ASP C 1 7   ? 65.921 39.741  18.001  1.00 149.75 ? 7   ASP C N     1 
ATOM 2486 C CA    . ASP C 1 7   ? 64.516 39.879  18.363  1.00 146.05 ? 7   ASP C CA    1 
ATOM 2487 C C     . ASP C 1 7   ? 63.733 39.012  17.386  1.00 176.04 ? 7   ASP C C     1 
ATOM 2488 O O     . ASP C 1 7   ? 63.685 39.307  16.184  1.00 204.57 ? 7   ASP C O     1 
ATOM 2489 C CB    . ASP C 1 7   ? 64.067 41.336  18.302  1.00 148.11 ? 7   ASP C CB    1 
ATOM 2490 C CG    . ASP C 1 7   ? 62.596 41.509  18.632  1.00 174.09 ? 7   ASP C CG    1 
ATOM 2491 O OD1   . ASP C 1 7   ? 62.017 40.608  19.274  1.00 195.33 ? 7   ASP C OD1   1 
ATOM 2492 O OD2   . ASP C 1 7   ? 62.017 42.547  18.247  1.00 195.31 ? 7   ASP C OD2   1 
ATOM 2493 N N     . ILE C 1 8   ? 63.126 37.943  17.902  1.00 156.49 ? 8   ILE C N     1 
ATOM 2494 C CA    . ILE C 1 8   ? 62.498 36.916  17.082  1.00 149.52 ? 8   ILE C CA    1 
ATOM 2495 C C     . ILE C 1 8   ? 61.059 37.310  16.786  1.00 180.48 ? 8   ILE C C     1 
ATOM 2496 O O     . ILE C 1 8   ? 60.420 38.054  17.538  1.00 207.96 ? 8   ILE C O     1 
ATOM 2497 C CB    . ILE C 1 8   ? 62.567 35.536  17.776  1.00 152.82 ? 8   ILE C CB    1 
ATOM 2498 C CG1   . ILE C 1 8   ? 63.929 35.317  18.436  1.00 176.94 ? 8   ILE C CG1   1 
ATOM 2499 C CG2   . ILE C 1 8   ? 62.308 34.413  16.787  1.00 143.70 ? 8   ILE C CG2   1 
ATOM 2500 C CD1   . ILE C 1 8   ? 63.944 35.589  19.925  1.00 216.10 ? 8   ILE C CD1   1 
ATOM 2501 N N     . GLY C 1 9   ? 60.550 36.805  15.666  1.00 198.06 ? 9   GLY C N     1 
ATOM 2502 C CA    . GLY C 1 9   ? 59.177 37.030  15.270  1.00 220.54 ? 9   GLY C CA    1 
ATOM 2503 C C     . GLY C 1 9   ? 58.988 36.924  13.773  1.00 227.15 ? 9   GLY C C     1 
ATOM 2504 O O     . GLY C 1 9   ? 59.829 37.399  13.006  1.00 198.81 ? 9   GLY C O     1 
ATOM 2505 N N     . ILE C 1 10  ? 57.900 36.286  13.339  1.00 253.20 ? 10  ILE C N     1 
ATOM 2506 C CA    . ILE C 1 10  ? 57.591 36.267  11.913  1.00 262.40 ? 10  ILE C CA    1 
ATOM 2507 C C     . ILE C 1 10  ? 57.147 37.654  11.465  1.00 260.67 ? 10  ILE C C     1 
ATOM 2508 O O     . ILE C 1 10  ? 57.297 38.019  10.291  1.00 255.85 ? 10  ILE C O     1 
ATOM 2509 C CB    . ILE C 1 10  ? 56.532 35.187  11.617  1.00 263.88 ? 10  ILE C CB    1 
ATOM 2510 C CG1   . ILE C 1 10  ? 57.064 33.805  12.004  1.00 245.56 ? 10  ILE C CG1   1 
ATOM 2511 C CG2   . ILE C 1 10  ? 56.122 35.198  10.152  1.00 264.04 ? 10  ILE C CG2   1 
ATOM 2512 C CD1   . ILE C 1 10  ? 56.112 32.671  11.687  1.00 243.09 ? 10  ILE C CD1   1 
ATOM 2513 N N     . LYS C 1 11  ? 56.624 38.452  12.398  1.00 264.40 ? 11  LYS C N     1 
ATOM 2514 C CA    . LYS C 1 11  ? 56.157 39.800  12.094  1.00 272.34 ? 11  LYS C CA    1 
ATOM 2515 C C     . LYS C 1 11  ? 57.268 40.653  11.489  1.00 253.99 ? 11  LYS C C     1 
ATOM 2516 O O     . LYS C 1 11  ? 57.191 41.070  10.327  1.00 259.05 ? 11  LYS C O     1 
ATOM 2517 C CB    . LYS C 1 11  ? 55.615 40.443  13.374  1.00 294.28 ? 11  LYS C CB    1 
ATOM 2518 C CG    . LYS C 1 11  ? 56.444 40.105  14.617  1.00 291.98 ? 11  LYS C CG    1 
ATOM 2519 C CD    . LYS C 1 11  ? 56.064 40.946  15.823  1.00 299.02 ? 11  LYS C CD    1 
ATOM 2520 C CE    . LYS C 1 11  ? 57.241 41.087  16.783  1.00 278.06 ? 11  LYS C CE    1 
ATOM 2521 N NZ    . LYS C 1 11  ? 57.886 39.781  17.098  1.00 261.27 ? 11  LYS C NZ    1 
ATOM 2522 N N     . ASN C 1 12  ? 58.314 40.913  12.264  1.00 225.59 ? 12  ASN C N     1 
ATOM 2523 C CA    . ASN C 1 12  ? 59.430 41.756  11.861  1.00 208.13 ? 12  ASN C CA    1 
ATOM 2524 C C     . ASN C 1 12  ? 60.646 41.376  12.696  1.00 167.31 ? 12  ASN C C     1 
ATOM 2525 O O     . ASN C 1 12  ? 60.970 42.055  13.679  1.00 183.12 ? 12  ASN C O     1 
ATOM 2526 C CB    . ASN C 1 12  ? 59.088 43.241  12.013  1.00 246.57 ? 12  ASN C CB    1 
ATOM 2527 C CG    . ASN C 1 12  ? 58.373 43.552  13.315  1.00 243.39 ? 12  ASN C CG    1 
ATOM 2528 O OD1   . ASN C 1 12  ? 58.266 42.702  14.198  1.00 252.31 ? 12  ASN C OD1   1 
ATOM 2529 N ND2   . ASN C 1 12  ? 57.878 44.778  13.439  1.00 222.58 ? 12  ASN C ND2   1 
ATOM 2530 N N     . PRO C 1 13  ? 61.342 40.304  12.335  1.00 166.36 ? 13  PRO C N     1 
ATOM 2531 C CA    . PRO C 1 13  ? 62.525 39.904  13.098  1.00 164.33 ? 13  PRO C CA    1 
ATOM 2532 C C     . PRO C 1 13  ? 63.668 40.876  12.880  1.00 166.09 ? 13  PRO C C     1 
ATOM 2533 O O     . PRO C 1 13  ? 63.801 41.489  11.820  1.00 166.23 ? 13  PRO C O     1 
ATOM 2534 C CB    . PRO C 1 13  ? 62.861 38.524  12.526  1.00 141.56 ? 13  PRO C CB    1 
ATOM 2535 C CG    . PRO C 1 13  ? 62.372 38.601  11.116  1.00 144.40 ? 13  PRO C CG    1 
ATOM 2536 C CD    . PRO C 1 13  ? 61.136 39.458  11.146  1.00 191.36 ? 13  PRO C CD    1 
ATOM 2537 N N     . ALA C 1 14  ? 64.502 41.017  13.905  1.00 146.01 ? 14  ALA C N     1 
ATOM 2538 C CA    . ALA C 1 14  ? 65.615 41.951  13.833  1.00 137.62 ? 14  ALA C CA    1 
ATOM 2539 C C     . ALA C 1 14  ? 66.843 41.322  14.467  1.00 155.40 ? 14  ALA C C     1 
ATOM 2540 O O     . ALA C 1 14  ? 66.732 40.451  15.332  1.00 167.31 ? 14  ALA C O     1 
ATOM 2541 C CB    . ALA C 1 14  ? 65.285 43.276  14.529  1.00 147.22 ? 14  ALA C CB    1 
ATOM 2542 N N     . TYR C 1 15  ? 68.021 41.774  14.037  1.00 172.26 ? 15  TYR C N     1 
ATOM 2543 C CA    . TYR C 1 15  ? 69.255 41.250  14.600  1.00 177.66 ? 15  TYR C CA    1 
ATOM 2544 C C     . TYR C 1 15  ? 70.309 42.343  14.692  1.00 179.56 ? 15  TYR C C     1 
ATOM 2545 O O     . TYR C 1 15  ? 70.354 43.275  13.881  1.00 171.24 ? 15  TYR C O     1 
ATOM 2546 C CB    . TYR C 1 15  ? 69.817 40.060  13.798  1.00 152.40 ? 15  TYR C CB    1 
ATOM 2547 C CG    . TYR C 1 15  ? 70.206 40.346  12.363  1.00 153.90 ? 15  TYR C CG    1 
ATOM 2548 C CD1   . TYR C 1 15  ? 71.488 40.781  12.049  1.00 169.98 ? 15  TYR C CD1   1 
ATOM 2549 C CD2   . TYR C 1 15  ? 69.311 40.143  11.321  1.00 158.60 ? 15  TYR C CD2   1 
ATOM 2550 C CE1   . TYR C 1 15  ? 71.861 41.031  10.744  1.00 188.77 ? 15  TYR C CE1   1 
ATOM 2551 C CE2   . TYR C 1 15  ? 69.676 40.389  10.009  1.00 183.73 ? 15  TYR C CE2   1 
ATOM 2552 C CZ    . TYR C 1 15  ? 70.954 40.830  9.727   1.00 196.90 ? 15  TYR C CZ    1 
ATOM 2553 O OH    . TYR C 1 15  ? 71.325 41.081  8.425   1.00 206.38 ? 15  TYR C OH    1 
ATOM 2554 N N     . ALA C 1 16  ? 71.139 42.219  15.724  1.00 173.04 ? 16  ALA C N     1 
ATOM 2555 C CA    . ALA C 1 16  ? 72.281 43.087  15.964  1.00 144.43 ? 16  ALA C CA    1 
ATOM 2556 C C     . ALA C 1 16  ? 73.532 42.226  16.044  1.00 159.96 ? 16  ALA C C     1 
ATOM 2557 O O     . ALA C 1 16  ? 73.551 41.212  16.753  1.00 142.83 ? 16  ALA C O     1 
ATOM 2558 C CB    . ALA C 1 16  ? 72.107 43.890  17.255  1.00 155.01 ? 16  ALA C CB    1 
ATOM 2559 N N     . ILE C 1 17  ? 74.563 42.623  15.305  1.00 187.95 ? 17  ILE C N     1 
ATOM 2560 C CA    . ILE C 1 17  ? 75.835 41.917  15.247  1.00 173.26 ? 17  ILE C CA    1 
ATOM 2561 C C     . ILE C 1 17  ? 76.890 42.829  15.852  1.00 143.14 ? 17  ILE C C     1 
ATOM 2562 O O     . ILE C 1 17  ? 77.190 43.892  15.290  1.00 153.78 ? 17  ILE C O     1 
ATOM 2563 C CB    . ILE C 1 17  ? 76.206 41.540  13.805  1.00 153.21 ? 17  ILE C CB    1 
ATOM 2564 C CG1   . ILE C 1 17  ? 74.995 40.955  13.079  1.00 149.54 ? 17  ILE C CG1   1 
ATOM 2565 C CG2   . ILE C 1 17  ? 77.362 40.548  13.794  1.00 137.13 ? 17  ILE C CG2   1 
ATOM 2566 C CD1   . ILE C 1 17  ? 74.539 39.634  13.626  1.00 180.91 ? 17  ILE C CD1   1 
ATOM 2567 N N     . PHE C 1 18  ? 77.466 42.404  16.976  1.00 149.48 ? 18  PHE C N     1 
ATOM 2568 C CA    . PHE C 1 18  ? 78.538 43.118  17.649  1.00 150.17 ? 18  PHE C CA    1 
ATOM 2569 C C     . PHE C 1 18  ? 79.842 42.350  17.505  1.00 152.63 ? 18  PHE C C     1 
ATOM 2570 O O     . PHE C 1 18  ? 79.858 41.132  17.297  1.00 161.82 ? 18  PHE C O     1 
ATOM 2571 C CB    . PHE C 1 18  ? 78.267 43.303  19.151  1.00 182.96 ? 18  PHE C CB    1 
ATOM 2572 C CG    . PHE C 1 18  ? 76.950 43.937  19.483  1.00 178.87 ? 18  PHE C CG    1 
ATOM 2573 C CD1   . PHE C 1 18  ? 75.808 43.168  19.631  1.00 202.75 ? 18  PHE C CD1   1 
ATOM 2574 C CD2   . PHE C 1 18  ? 76.869 45.300  19.713  1.00 160.35 ? 18  PHE C CD2   1 
ATOM 2575 C CE1   . PHE C 1 18  ? 74.600 43.754  19.959  1.00 197.62 ? 18  PHE C CE1   1 
ATOM 2576 C CE2   . PHE C 1 18  ? 75.667 45.891  20.044  1.00 162.82 ? 18  PHE C CE2   1 
ATOM 2577 C CZ    . PHE C 1 18  ? 74.531 45.117  20.167  1.00 193.27 ? 18  PHE C CZ    1 
ATOM 2578 N N     . ASN C 1 19  ? 80.936 43.078  17.702  1.00 160.20 ? 19  ASN C N     1 
ATOM 2579 C CA    . ASN C 1 19  ? 82.273 42.515  17.800  1.00 164.33 ? 19  ASN C CA    1 
ATOM 2580 C C     . ASN C 1 19  ? 82.854 42.897  19.152  1.00 176.61 ? 19  ASN C C     1 
ATOM 2581 O O     . ASN C 1 19  ? 82.983 44.086  19.462  1.00 174.73 ? 19  ASN C O     1 
ATOM 2582 C CB    . ASN C 1 19  ? 83.170 43.015  16.666  1.00 169.94 ? 19  ASN C CB    1 
ATOM 2583 C CG    . ASN C 1 19  ? 84.577 42.457  16.745  1.00 202.34 ? 19  ASN C CG    1 
ATOM 2584 O OD1   . ASN C 1 19  ? 84.775 41.265  16.985  1.00 172.42 ? 19  ASN C OD1   1 
ATOM 2585 N ND2   . ASN C 1 19  ? 85.566 43.320  16.542  1.00 212.09 ? 19  ASN C ND2   1 
ATOM 2586 N N     . TYR C 1 20  ? 83.199 41.894  19.949  1.00 192.81 ? 20  TYR C N     1 
ATOM 2587 C CA    . TYR C 1 20  ? 83.757 42.093  21.279  1.00 174.26 ? 20  TYR C CA    1 
ATOM 2588 C C     . TYR C 1 20  ? 85.239 41.763  21.210  1.00 185.98 ? 20  TYR C C     1 
ATOM 2589 O O     . TYR C 1 20  ? 85.615 40.610  20.971  1.00 195.20 ? 20  TYR C O     1 
ATOM 2590 C CB    . TYR C 1 20  ? 83.045 41.214  22.305  1.00 179.42 ? 20  TYR C CB    1 
ATOM 2591 C CG    . TYR C 1 20  ? 83.647 41.257  23.693  1.00 209.11 ? 20  TYR C CG    1 
ATOM 2592 C CD1   . TYR C 1 20  ? 83.449 42.347  24.529  1.00 213.10 ? 20  TYR C CD1   1 
ATOM 2593 C CD2   . TYR C 1 20  ? 84.411 40.198  24.168  1.00 225.55 ? 20  TYR C CD2   1 
ATOM 2594 C CE1   . TYR C 1 20  ? 83.995 42.382  25.799  1.00 209.54 ? 20  TYR C CE1   1 
ATOM 2595 C CE2   . TYR C 1 20  ? 84.963 40.225  25.434  1.00 236.89 ? 20  TYR C CE2   1 
ATOM 2596 C CZ    . TYR C 1 20  ? 84.753 41.320  26.245  1.00 235.69 ? 20  TYR C CZ    1 
ATOM 2597 O OH    . TYR C 1 20  ? 85.301 41.349  27.507  1.00 254.17 ? 20  TYR C OH    1 
ATOM 2598 N N     . ASP C 1 21  ? 86.077 42.771  21.427  1.00 214.50 ? 21  ASP C N     1 
ATOM 2599 C CA    . ASP C 1 21  ? 87.513 42.547  21.450  1.00 223.89 ? 21  ASP C CA    1 
ATOM 2600 C C     . ASP C 1 21  ? 87.872 41.838  22.747  1.00 240.89 ? 21  ASP C C     1 
ATOM 2601 O O     . ASP C 1 21  ? 87.631 42.363  23.840  1.00 230.99 ? 21  ASP C O     1 
ATOM 2602 C CB    . ASP C 1 21  ? 88.261 43.869  21.316  1.00 235.38 ? 21  ASP C CB    1 
ATOM 2603 C CG    . ASP C 1 21  ? 89.700 43.682  20.881  1.00 266.19 ? 21  ASP C CG    1 
ATOM 2604 O OD1   . ASP C 1 21  ? 89.924 43.327  19.705  1.00 268.08 ? 21  ASP C OD1   1 
ATOM 2605 O OD2   . ASP C 1 21  ? 90.608 43.890  21.714  1.00 280.43 ? 21  ASP C OD2   1 
ATOM 2606 N N     . ASN C 1 22  ? 88.443 40.646  22.623  1.00 255.68 ? 22  ASN C N     1 
ATOM 2607 C CA    . ASN C 1 22  ? 88.687 39.806  23.785  1.00 256.53 ? 22  ASN C CA    1 
ATOM 2608 C C     . ASN C 1 22  ? 89.767 40.407  24.675  1.00 252.36 ? 22  ASN C C     1 
ATOM 2609 O O     . ASN C 1 22  ? 90.769 40.942  24.192  1.00 244.27 ? 22  ASN C O     1 
ATOM 2610 C CB    . ASN C 1 22  ? 89.084 38.401  23.336  1.00 267.36 ? 22  ASN C CB    1 
ATOM 2611 C CG    . ASN C 1 22  ? 87.967 37.696  22.585  1.00 237.92 ? 22  ASN C CG    1 
ATOM 2612 O OD1   . ASN C 1 22  ? 86.798 37.787  22.958  1.00 208.27 ? 22  ASN C OD1   1 
ATOM 2613 N ND2   . ASN C 1 22  ? 88.324 36.995  21.514  1.00 236.39 ? 22  ASN C ND2   1 
ATOM 2614 N N     . THR C 1 23  ? 89.538 40.332  25.987  1.00 261.46 ? 23  THR C N     1 
ATOM 2615 C CA    . THR C 1 23  ? 90.416 40.784  27.065  1.00 288.64 ? 23  THR C CA    1 
ATOM 2616 C C     . THR C 1 23  ? 90.554 42.301  27.137  1.00 290.67 ? 23  THR C C     1 
ATOM 2617 O O     . THR C 1 23  ? 91.210 42.803  28.058  1.00 305.39 ? 23  THR C O     1 
ATOM 2618 C CB    . THR C 1 23  ? 91.820 40.165  26.981  1.00 304.27 ? 23  THR C CB    1 
ATOM 2619 O OG1   . THR C 1 23  ? 92.483 40.627  25.797  1.00 306.32 ? 23  THR C OG1   1 
ATOM 2620 C CG2   . THR C 1 23  ? 91.729 38.644  26.943  1.00 290.17 ? 23  THR C CG2   1 
ATOM 2621 N N     . SER C 1 24  ? 89.967 43.051  26.204  1.00 274.89 ? 24  SER C N     1 
ATOM 2622 C CA    . SER C 1 24  ? 90.000 44.506  26.245  1.00 256.80 ? 24  SER C CA    1 
ATOM 2623 C C     . SER C 1 24  ? 88.652 45.128  26.580  1.00 290.31 ? 24  SER C C     1 
ATOM 2624 O O     . SER C 1 24  ? 88.602 46.329  26.871  1.00 230.43 ? 24  SER C O     1 
ATOM 2625 C CB    . SER C 1 24  ? 90.503 45.073  24.909  1.00 247.35 ? 24  SER C CB    1 
ATOM 2626 O OG    . SER C 1 24  ? 89.494 45.016  23.920  1.00 260.01 ? 24  SER C OG    1 
ATOM 2627 N N     . ASN C 1 25  ? 87.567 44.350  26.542  1.00 313.30 ? 25  ASN C N     1 
ATOM 2628 C CA    . ASN C 1 25  ? 86.216 44.840  26.827  1.00 317.48 ? 25  ASN C CA    1 
ATOM 2629 C C     . ASN C 1 25  ? 85.830 45.988  25.893  1.00 308.35 ? 25  ASN C C     1 
ATOM 2630 O O     . ASN C 1 25  ? 85.285 47.010  26.315  1.00 308.80 ? 25  ASN C O     1 
ATOM 2631 C CB    . ASN C 1 25  ? 86.074 45.250  28.295  1.00 328.61 ? 25  ASN C CB    1 
ATOM 2632 C CG    . ASN C 1 25  ? 86.330 44.098  29.250  1.00 334.65 ? 25  ASN C CG    1 
ATOM 2633 O OD1   . ASN C 1 25  ? 86.121 42.935  28.906  1.00 340.76 ? 25  ASN C OD1   1 
ATOM 2634 N ND2   . ASN C 1 25  ? 86.782 44.418  30.456  1.00 338.64 ? 25  ASN C ND2   1 
ATOM 2635 N N     . THR C 1 26  ? 86.119 45.808  24.605  1.00 267.19 ? 26  THR C N     1 
ATOM 2636 C CA    . THR C 1 26  ? 85.837 46.807  23.579  1.00 236.55 ? 26  THR C CA    1 
ATOM 2637 C C     . THR C 1 26  ? 84.687 46.306  22.712  1.00 223.06 ? 26  THR C C     1 
ATOM 2638 O O     . THR C 1 26  ? 84.846 45.345  21.953  1.00 223.58 ? 26  THR C O     1 
ATOM 2639 C CB    . THR C 1 26  ? 87.075 47.085  22.730  1.00 213.92 ? 26  THR C CB    1 
ATOM 2640 O OG1   . THR C 1 26  ? 88.173 47.437  23.583  1.00 238.52 ? 26  THR C OG1   1 
ATOM 2641 C CG2   . THR C 1 26  ? 86.807 48.223  21.757  1.00 215.36 ? 26  THR C CG2   1 
ATOM 2642 N N     . ILE C 1 27  ? 83.534 46.957  22.831  1.00 228.16 ? 27  ILE C N     1 
ATOM 2643 C CA    . ILE C 1 27  ? 82.338 46.584  22.083  1.00 212.51 ? 27  ILE C CA    1 
ATOM 2644 C C     . ILE C 1 27  ? 82.287 47.409  20.803  1.00 227.64 ? 27  ILE C C     1 
ATOM 2645 O O     . ILE C 1 27  ? 82.239 48.643  20.853  1.00 253.74 ? 27  ILE C O     1 
ATOM 2646 C CB    . ILE C 1 27  ? 81.068 46.796  22.921  1.00 208.18 ? 27  ILE C CB    1 
ATOM 2647 C CG1   . ILE C 1 27  ? 81.218 46.165  24.307  1.00 221.79 ? 27  ILE C CG1   1 
ATOM 2648 C CG2   . ILE C 1 27  ? 79.855 46.226  22.200  1.00 215.52 ? 27  ILE C CG2   1 
ATOM 2649 C CD1   . ILE C 1 27  ? 81.589 47.149  25.401  1.00 255.71 ? 27  ILE C CD1   1 
ATOM 2650 N N     . LYS C 1 28  ? 82.289 46.733  19.657  1.00 222.02 ? 28  LYS C N     1 
ATOM 2651 C CA    . LYS C 1 28  ? 82.154 47.385  18.359  1.00 222.52 ? 28  LYS C CA    1 
ATOM 2652 C C     . LYS C 1 28  ? 80.955 46.791  17.636  1.00 227.12 ? 28  LYS C C     1 
ATOM 2653 O O     . LYS C 1 28  ? 80.915 45.582  17.381  1.00 237.32 ? 28  LYS C O     1 
ATOM 2654 C CB    . LYS C 1 28  ? 83.423 47.228  17.518  1.00 231.56 ? 28  LYS C CB    1 
ATOM 2655 C CG    . LYS C 1 28  ? 84.621 48.005  18.043  1.00 254.54 ? 28  LYS C CG    1 
ATOM 2656 C CD    . LYS C 1 28  ? 85.567 48.395  16.914  1.00 264.01 ? 28  LYS C CD    1 
ATOM 2657 C CE    . LYS C 1 28  ? 86.145 47.176  16.213  1.00 261.61 ? 28  LYS C CE    1 
ATOM 2658 N NZ    . LYS C 1 28  ? 87.073 46.413  17.092  1.00 251.79 ? 28  LYS C NZ    1 
ATOM 2659 N N     . LEU C 1 29  ? 79.982 47.638  17.308  1.00 222.21 ? 29  LEU C N     1 
ATOM 2660 C CA    . LEU C 1 29  ? 78.795 47.202  16.584  1.00 203.20 ? 29  LEU C CA    1 
ATOM 2661 C C     . LEU C 1 29  ? 79.137 47.007  15.112  1.00 203.79 ? 29  LEU C C     1 
ATOM 2662 O O     . LEU C 1 29  ? 79.547 47.954  14.433  1.00 223.54 ? 29  LEU C O     1 
ATOM 2663 C CB    . LEU C 1 29  ? 77.663 48.214  16.742  1.00 184.32 ? 29  LEU C CB    1 
ATOM 2664 C CG    . LEU C 1 29  ? 76.348 47.850  16.045  1.00 185.49 ? 29  LEU C CG    1 
ATOM 2665 C CD1   . LEU C 1 29  ? 75.816 46.520  16.544  1.00 171.71 ? 29  LEU C CD1   1 
ATOM 2666 C CD2   . LEU C 1 29  ? 75.306 48.938  16.235  1.00 207.02 ? 29  LEU C CD2   1 
ATOM 2667 N N     . ILE C 1 30  ? 78.966 45.781  14.621  1.00 162.65 ? 30  ILE C N     1 
ATOM 2668 C CA    . ILE C 1 30  ? 79.221 45.505  13.211  1.00 163.31 ? 30  ILE C CA    1 
ATOM 2669 C C     . ILE C 1 30  ? 78.010 45.870  12.364  1.00 163.22 ? 30  ILE C C     1 
ATOM 2670 O O     . ILE C 1 30  ? 78.132 46.578  11.358  1.00 180.44 ? 30  ILE C O     1 
ATOM 2671 C CB    . ILE C 1 30  ? 79.631 44.035  13.007  1.00 176.38 ? 30  ILE C CB    1 
ATOM 2672 C CG1   . ILE C 1 30  ? 80.955 43.741  13.715  1.00 188.67 ? 30  ILE C CG1   1 
ATOM 2673 C CG2   . ILE C 1 30  ? 79.740 43.713  11.526  1.00 173.92 ? 30  ILE C CG2   1 
ATOM 2674 C CD1   . ILE C 1 30  ? 81.422 42.307  13.561  1.00 159.00 ? 30  ILE C CD1   1 
ATOM 2675 N N     . ALA C 1 31  ? 76.826 45.399  12.748  1.00 155.15 ? 31  ALA C N     1 
ATOM 2676 C CA    . ALA C 1 31  ? 75.658 45.651  11.911  1.00 153.89 ? 31  ALA C CA    1 
ATOM 2677 C C     . ALA C 1 31  ? 74.386 45.604  12.744  1.00 149.41 ? 31  ALA C C     1 
ATOM 2678 O O     . ALA C 1 31  ? 74.364 45.070  13.853  1.00 152.02 ? 31  ALA C O     1 
ATOM 2679 C CB    . ALA C 1 31  ? 75.572 44.647  10.756  1.00 150.80 ? 31  ALA C CB    1 
ATOM 2680 N N     . ILE C 1 32  ? 73.329 46.193  12.190  1.00 184.58 ? 32  ILE C N     1 
ATOM 2681 C CA    . ILE C 1 32  ? 71.985 46.117  12.759  1.00 192.45 ? 32  ILE C CA    1 
ATOM 2682 C C     . ILE C 1 32  ? 71.001 46.093  11.596  1.00 197.42 ? 32  ILE C C     1 
ATOM 2683 O O     . ILE C 1 32  ? 71.092 46.914  10.677  1.00 210.67 ? 32  ILE C O     1 
ATOM 2684 C CB    . ILE C 1 32  ? 71.697 47.273  13.746  1.00 184.24 ? 32  ILE C CB    1 
ATOM 2685 C CG1   . ILE C 1 32  ? 71.381 46.711  15.132  1.00 186.98 ? 32  ILE C CG1   1 
ATOM 2686 C CG2   . ILE C 1 32  ? 70.528 48.138  13.293  1.00 175.03 ? 32  ILE C CG2   1 
ATOM 2687 C CD1   . ILE C 1 32  ? 70.872 47.741  16.118  1.00 169.46 ? 32  ILE C CD1   1 
ATOM 2688 N N     . GLU C 1 33  ? 70.114 45.098  11.585  1.00 192.14 ? 33  GLU C N     1 
ATOM 2689 C CA    . GLU C 1 33  ? 69.210 44.918  10.459  1.00 176.13 ? 33  GLU C CA    1 
ATOM 2690 C C     . GLU C 1 33  ? 67.844 44.461  10.946  1.00 164.56 ? 33  GLU C C     1 
ATOM 2691 O O     . GLU C 1 33  ? 67.714 43.850  12.011  1.00 170.77 ? 33  GLU C O     1 
ATOM 2692 C CB    . GLU C 1 33  ? 69.749 43.901  9.439   1.00 166.81 ? 33  GLU C CB    1 
ATOM 2693 C CG    . GLU C 1 33  ? 71.044 44.300  8.743   1.00 169.54 ? 33  GLU C CG    1 
ATOM 2694 C CD    . GLU C 1 33  ? 70.886 45.525  7.861   1.00 197.78 ? 33  GLU C CD    1 
ATOM 2695 O OE1   . GLU C 1 33  ? 69.761 45.779  7.381   1.00 190.06 ? 33  GLU C OE1   1 
ATOM 2696 O OE2   . GLU C 1 33  ? 71.891 46.236  7.647   1.00 207.80 ? 33  GLU C OE2   1 
ATOM 2697 N N     . LYS C 1 34  ? 66.826 44.777  10.151  1.00 181.31 ? 34  LYS C N     1 
ATOM 2698 C CA    . LYS C 1 34  ? 65.466 44.280  10.335  1.00 192.10 ? 34  LYS C CA    1 
ATOM 2699 C C     . LYS C 1 34  ? 65.166 43.370  9.149   1.00 224.97 ? 34  LYS C C     1 
ATOM 2700 O O     . LYS C 1 34  ? 64.900 43.847  8.042   1.00 238.42 ? 34  LYS C O     1 
ATOM 2701 C CB    . LYS C 1 34  ? 64.463 45.427  10.426  1.00 199.83 ? 34  LYS C CB    1 
ATOM 2702 C CG    . LYS C 1 34  ? 63.009 44.976  10.393  1.00 209.71 ? 34  LYS C CG    1 
ATOM 2703 C CD    . LYS C 1 34  ? 62.082 46.105  9.972   1.00 214.42 ? 34  LYS C CD    1 
ATOM 2704 C CE    . LYS C 1 34  ? 60.656 45.606  9.799   1.00 207.42 ? 34  LYS C CE    1 
ATOM 2705 N NZ    . LYS C 1 34  ? 60.588 44.444  8.868   1.00 189.45 ? 34  LYS C NZ    1 
ATOM 2706 N N     . SER C 1 35  ? 65.213 42.061  9.378   1.00 225.72 ? 35  SER C N     1 
ATOM 2707 C CA    . SER C 1 35  ? 64.999 41.111  8.303   1.00 225.27 ? 35  SER C CA    1 
ATOM 2708 C C     . SER C 1 35  ? 63.516 40.765  8.193   1.00 220.21 ? 35  SER C C     1 
ATOM 2709 O O     . SER C 1 35  ? 62.670 41.287  8.923   1.00 244.23 ? 35  SER C O     1 
ATOM 2710 C CB    . SER C 1 35  ? 65.842 39.857  8.528   1.00 223.74 ? 35  SER C CB    1 
ATOM 2711 O OG    . SER C 1 35  ? 65.699 38.948  7.452   1.00 234.87 ? 35  SER C OG    1 
ATOM 2712 N N     . ASP C 1 36  ? 63.197 39.867  7.266   1.00 161.83 ? 36  ASP C N     1 
ATOM 2713 C CA    . ASP C 1 36  ? 61.834 39.405  7.049   1.00 145.30 ? 36  ASP C CA    1 
ATOM 2714 C C     . ASP C 1 36  ? 61.833 37.889  6.944   1.00 161.65 ? 36  ASP C C     1 
ATOM 2715 O O     . ASP C 1 36  ? 62.562 37.323  6.123   1.00 143.13 ? 36  ASP C O     1 
ATOM 2716 C CB    . ASP C 1 36  ? 61.236 40.027  5.784   1.00 143.55 ? 36  ASP C CB    1 
ATOM 2717 C CG    . ASP C 1 36  ? 59.846 39.509  5.482   1.00 173.78 ? 36  ASP C CG    1 
ATOM 2718 O OD1   . ASP C 1 36  ? 58.894 39.911  6.185   1.00 208.42 ? 36  ASP C OD1   1 
ATOM 2719 O OD2   . ASP C 1 36  ? 59.705 38.702  4.540   1.00 188.91 ? 36  ASP C OD2   1 
ATOM 2720 N N     . TRP C 1 37  ? 61.021 37.234  7.765   1.00 178.94 ? 37  TRP C N     1 
ATOM 2721 C CA    . TRP C 1 37  ? 60.872 35.782  7.729   1.00 165.92 ? 37  TRP C CA    1 
ATOM 2722 C C     . TRP C 1 37  ? 59.429 35.461  7.347   1.00 176.04 ? 37  TRP C C     1 
ATOM 2723 O O     . TRP C 1 37  ? 58.633 35.025  8.183   1.00 191.46 ? 37  TRP C O     1 
ATOM 2724 C CB    . TRP C 1 37  ? 61.248 35.166  9.095   1.00 128.40 ? 37  TRP C CB    1 
ATOM 2725 C CG    . TRP C 1 37  ? 62.661 35.446  9.515   1.00 125.76 ? 37  TRP C CG    1 
ATOM 2726 C CD1   . TRP C 1 37  ? 63.688 35.851  8.715   1.00 130.02 ? 37  TRP C CD1   1 
ATOM 2727 C CD2   . TRP C 1 37  ? 63.197 35.361  10.843  1.00 131.87 ? 37  TRP C CD2   1 
ATOM 2728 N NE1   . TRP C 1 37  ? 64.832 36.015  9.458   1.00 139.17 ? 37  TRP C NE1   1 
ATOM 2729 C CE2   . TRP C 1 37  ? 64.557 35.723  10.768  1.00 130.45 ? 37  TRP C CE2   1 
ATOM 2730 C CE3   . TRP C 1 37  ? 62.660 35.013  12.086  1.00 160.36 ? 37  TRP C CE3   1 
ATOM 2731 C CZ2   . TRP C 1 37  ? 65.388 35.746  11.887  1.00 120.18 ? 37  TRP C CZ2   1 
ATOM 2732 C CZ3   . TRP C 1 37  ? 63.488 35.035  13.196  1.00 138.25 ? 37  TRP C CZ3   1 
ATOM 2733 C CH2   . TRP C 1 37  ? 64.836 35.400  13.088  1.00 119.49 ? 37  TRP C CH2   1 
ATOM 2734 N N     . THR C 1 38  ? 59.096 35.675  6.074   1.00 164.75 ? 38  THR C N     1 
ATOM 2735 C CA    . THR C 1 38  ? 57.762 35.391  5.559   1.00 182.75 ? 38  THR C CA    1 
ATOM 2736 C C     . THR C 1 38  ? 57.732 34.123  4.714   1.00 203.49 ? 38  THR C C     1 
ATOM 2737 O O     . THR C 1 38  ? 56.984 33.190  5.018   1.00 222.92 ? 38  THR C O     1 
ATOM 2738 C CB    . THR C 1 38  ? 57.245 36.585  4.744   1.00 203.82 ? 38  THR C CB    1 
ATOM 2739 O OG1   . THR C 1 38  ? 57.187 37.746  5.581   1.00 195.72 ? 38  THR C OG1   1 
ATOM 2740 C CG2   . THR C 1 38  ? 55.858 36.294  4.191   1.00 226.94 ? 38  THR C CG2   1 
ATOM 2741 N N     . LYS C 1 39  ? 58.537 34.066  3.658   1.00 204.69 ? 39  LYS C N     1 
ATOM 2742 C CA    . LYS C 1 39  ? 58.563 32.932  2.744   1.00 213.10 ? 39  LYS C CA    1 
ATOM 2743 C C     . LYS C 1 39  ? 59.768 32.063  3.075   1.00 210.46 ? 39  LYS C C     1 
ATOM 2744 O O     . LYS C 1 39  ? 60.908 32.540  3.041   1.00 210.63 ? 39  LYS C O     1 
ATOM 2745 C CB    . LYS C 1 39  ? 58.624 33.401  1.290   1.00 240.38 ? 39  LYS C CB    1 
ATOM 2746 C CG    . LYS C 1 39  ? 58.880 32.284  0.290   1.00 264.10 ? 39  LYS C CG    1 
ATOM 2747 C CD    . LYS C 1 39  ? 59.141 32.835  -1.104  1.00 273.12 ? 39  LYS C CD    1 
ATOM 2748 C CE    . LYS C 1 39  ? 59.538 31.730  -2.073  1.00 262.72 ? 39  LYS C CE    1 
ATOM 2749 N NZ    . LYS C 1 39  ? 58.448 30.731  -2.255  1.00 254.75 ? 39  LYS C NZ    1 
ATOM 2750 N N     . ASN C 1 40  ? 59.512 30.792  3.391   1.00 195.76 ? 40  ASN C N     1 
ATOM 2751 C CA    . ASN C 1 40  ? 60.559 29.828  3.726   1.00 162.29 ? 40  ASN C CA    1 
ATOM 2752 C C     . ASN C 1 40  ? 61.413 30.341  4.889   1.00 146.48 ? 40  ASN C C     1 
ATOM 2753 O O     . ASN C 1 40  ? 62.597 30.652  4.748   1.00 129.52 ? 40  ASN C O     1 
ATOM 2754 C CB    . ASN C 1 40  ? 61.424 29.504  2.503   1.00 142.78 ? 40  ASN C CB    1 
ATOM 2755 C CG    . ASN C 1 40  ? 62.161 28.189  2.648   1.00 179.60 ? 40  ASN C CG    1 
ATOM 2756 O OD1   . ASN C 1 40  ? 62.591 27.822  3.743   1.00 139.27 ? 40  ASN C OD1   1 
ATOM 2757 N ND2   . ASN C 1 40  ? 62.310 27.469  1.542   1.00 216.27 ? 40  ASN C ND2   1 
ATOM 2758 N N     . TRP C 1 41  ? 60.756 30.441  6.049   1.00 164.07 ? 41  TRP C N     1 
ATOM 2759 C CA    . TRP C 1 41  ? 61.373 31.086  7.204   1.00 143.62 ? 41  TRP C CA    1 
ATOM 2760 C C     . TRP C 1 41  ? 62.647 30.372  7.634   1.00 133.69 ? 41  TRP C C     1 
ATOM 2761 O O     . TRP C 1 41  ? 63.556 31.006  8.175   1.00 132.37 ? 41  TRP C O     1 
ATOM 2762 C CB    . TRP C 1 41  ? 60.385 31.147  8.372   1.00 142.00 ? 41  TRP C CB    1 
ATOM 2763 C CG    . TRP C 1 41  ? 59.972 29.803  8.903   1.00 151.51 ? 41  TRP C CG    1 
ATOM 2764 C CD1   . TRP C 1 41  ? 58.889 29.067  8.519   1.00 169.38 ? 41  TRP C CD1   1 
ATOM 2765 C CD2   . TRP C 1 41  ? 60.632 29.042  9.924   1.00 144.84 ? 41  TRP C CD2   1 
ATOM 2766 N NE1   . TRP C 1 41  ? 58.837 27.893  9.233   1.00 149.88 ? 41  TRP C NE1   1 
ATOM 2767 C CE2   . TRP C 1 41  ? 59.896 27.854  10.101  1.00 141.80 ? 41  TRP C CE2   1 
ATOM 2768 C CE3   . TRP C 1 41  ? 61.776 29.249  10.701  1.00 155.58 ? 41  TRP C CE3   1 
ATOM 2769 C CZ2   . TRP C 1 41  ? 60.266 26.877  11.024  1.00 128.25 ? 41  TRP C CZ2   1 
ATOM 2770 C CZ3   . TRP C 1 41  ? 62.141 28.278  11.616  1.00 123.45 ? 41  TRP C CZ3   1 
ATOM 2771 C CH2   . TRP C 1 41  ? 61.388 27.107  11.769  1.00 122.94 ? 41  TRP C CH2   1 
ATOM 2772 N N     . GLU C 1 42  ? 62.735 29.061  7.401   1.00 134.87 ? 42  GLU C N     1 
ATOM 2773 C CA    . GLU C 1 42  ? 63.926 28.312  7.788   1.00 119.34 ? 42  GLU C CA    1 
ATOM 2774 C C     . GLU C 1 42  ? 65.150 28.765  6.997   1.00 116.42 ? 42  GLU C C     1 
ATOM 2775 O O     . GLU C 1 42  ? 66.217 29.021  7.570   1.00 113.67 ? 42  GLU C O     1 
ATOM 2776 C CB    . GLU C 1 42  ? 63.674 26.820  7.572   1.00 121.81 ? 42  GLU C CB    1 
ATOM 2777 C CG    . GLU C 1 42  ? 62.498 26.266  8.359   1.00 133.06 ? 42  GLU C CG    1 
ATOM 2778 C CD    . GLU C 1 42  ? 62.220 24.808  8.048   1.00 175.09 ? 42  GLU C CD    1 
ATOM 2779 O OE1   . GLU C 1 42  ? 63.061 24.169  7.381   1.00 183.29 ? 42  GLU C OE1   1 
ATOM 2780 O OE2   . GLU C 1 42  ? 61.154 24.303  8.462   1.00 187.77 ? 42  GLU C OE2   1 
ATOM 2781 N N     . ARG C 1 43  ? 65.008 28.876  5.673   1.00 146.12 ? 43  ARG C N     1 
ATOM 2782 C CA    . ARG C 1 43  ? 66.098 29.359  4.830   1.00 142.70 ? 43  ARG C CA    1 
ATOM 2783 C C     . ARG C 1 43  ? 66.512 30.776  5.209   1.00 136.91 ? 43  ARG C C     1 
ATOM 2784 O O     . ARG C 1 43  ? 67.706 31.079  5.322   1.00 135.03 ? 43  ARG C O     1 
ATOM 2785 C CB    . ARG C 1 43  ? 65.679 29.288  3.361   1.00 153.75 ? 43  ARG C CB    1 
ATOM 2786 C CG    . ARG C 1 43  ? 66.753 29.702  2.375   1.00 187.47 ? 43  ARG C CG    1 
ATOM 2787 C CD    . ARG C 1 43  ? 66.258 29.543  0.946   1.00 184.37 ? 43  ARG C CD    1 
ATOM 2788 N NE    . ARG C 1 43  ? 65.867 28.165  0.666   1.00 194.99 ? 43  ARG C NE    1 
ATOM 2789 C CZ    . ARG C 1 43  ? 65.376 27.745  -0.495  1.00 223.68 ? 43  ARG C CZ    1 
ATOM 2790 N NH1   . ARG C 1 43  ? 65.213 28.599  -1.497  1.00 220.17 ? 43  ARG C NH1   1 
ATOM 2791 N NH2   . ARG C 1 43  ? 65.048 26.470  -0.656  1.00 245.01 ? 43  ARG C NH2   1 
ATOM 2792 N N     . SER C 1 44  ? 65.531 31.661  5.406   1.00 128.11 ? 44  SER C N     1 
ATOM 2793 C CA    . SER C 1 44  ? 65.836 33.047  5.746   1.00 129.49 ? 44  SER C CA    1 
ATOM 2794 C C     . SER C 1 44  ? 66.546 33.133  7.088   1.00 130.15 ? 44  SER C C     1 
ATOM 2795 O O     . SER C 1 44  ? 67.496 33.909  7.252   1.00 141.72 ? 44  SER C O     1 
ATOM 2796 C CB    . SER C 1 44  ? 64.550 33.871  5.768   1.00 152.85 ? 44  SER C CB    1 
ATOM 2797 O OG    . SER C 1 44  ? 63.824 33.720  4.561   1.00 185.47 ? 44  SER C OG    1 
ATOM 2798 N N     . VAL C 1 45  ? 66.100 32.332  8.056   1.00 121.76 ? 45  VAL C N     1 
ATOM 2799 C CA    . VAL C 1 45  ? 66.725 32.304  9.373   1.00 114.29 ? 45  VAL C CA    1 
ATOM 2800 C C     . VAL C 1 45  ? 68.170 31.835  9.269   1.00 131.39 ? 45  VAL C C     1 
ATOM 2801 O O     . VAL C 1 45  ? 69.084 32.451  9.833   1.00 124.83 ? 45  VAL C O     1 
ATOM 2802 C CB    . VAL C 1 45  ? 65.909 31.412  10.324  1.00 123.97 ? 45  VAL C CB    1 
ATOM 2803 C CG1   . VAL C 1 45  ? 66.762 30.971  11.465  1.00 107.08 ? 45  VAL C CG1   1 
ATOM 2804 C CG2   . VAL C 1 45  ? 64.696 32.161  10.848  1.00 157.48 ? 45  VAL C CG2   1 
ATOM 2805 N N     . ALA C 1 46  ? 68.396 30.725  8.560   1.00 127.67 ? 46  ALA C N     1 
ATOM 2806 C CA    . ALA C 1 46  ? 69.754 30.209  8.419   1.00 114.51 ? 46  ALA C CA    1 
ATOM 2807 C C     . ALA C 1 46  ? 70.661 31.228  7.745   1.00 119.18 ? 46  ALA C C     1 
ATOM 2808 O O     . ALA C 1 46  ? 71.801 31.438  8.178   1.00 136.17 ? 46  ALA C O     1 
ATOM 2809 C CB    . ALA C 1 46  ? 69.740 28.898  7.635   1.00 114.96 ? 46  ALA C CB    1 
ATOM 2810 N N     . ARG C 1 47  ? 70.166 31.883  6.691   1.00 115.98 ? 47  ARG C N     1 
ATOM 2811 C CA    . ARG C 1 47  ? 70.958 32.904  6.012   1.00 125.54 ? 47  ARG C CA    1 
ATOM 2812 C C     . ARG C 1 47  ? 71.307 34.048  6.954   1.00 133.29 ? 47  ARG C C     1 
ATOM 2813 O O     . ARG C 1 47  ? 72.468 34.465  7.039   1.00 147.00 ? 47  ARG C O     1 
ATOM 2814 C CB    . ARG C 1 47  ? 70.203 33.435  4.796   1.00 146.06 ? 47  ARG C CB    1 
ATOM 2815 C CG    . ARG C 1 47  ? 70.155 32.496  3.607   1.00 167.54 ? 47  ARG C CG    1 
ATOM 2816 C CD    . ARG C 1 47  ? 69.460 33.154  2.419   1.00 163.09 ? 47  ARG C CD    1 
ATOM 2817 N NE    . ARG C 1 47  ? 70.168 34.344  1.950   1.00 188.50 ? 47  ARG C NE    1 
ATOM 2818 C CZ    . ARG C 1 47  ? 69.849 35.592  2.284   1.00 220.20 ? 47  ARG C CZ    1 
ATOM 2819 N NH1   . ARG C 1 47  ? 68.828 35.824  3.098   1.00 223.09 ? 47  ARG C NH1   1 
ATOM 2820 N NH2   . ARG C 1 47  ? 70.554 36.609  1.806   1.00 215.29 ? 47  ARG C NH2   1 
ATOM 2821 N N     . ASP C 1 48  ? 70.309 34.572  7.670   1.00 152.91 ? 48  ASP C N     1 
ATOM 2822 C CA    . ASP C 1 48  ? 70.553 35.718  8.538   1.00 154.16 ? 48  ASP C CA    1 
ATOM 2823 C C     . ASP C 1 48  ? 71.489 35.370  9.685   1.00 139.71 ? 48  ASP C C     1 
ATOM 2824 O O     . ASP C 1 48  ? 72.241 36.234  10.151  1.00 167.56 ? 48  ASP C O     1 
ATOM 2825 C CB    . ASP C 1 48  ? 69.229 36.260  9.074   1.00 177.11 ? 48  ASP C CB    1 
ATOM 2826 C CG    . ASP C 1 48  ? 68.400 36.934  8.000   1.00 198.40 ? 48  ASP C CG    1 
ATOM 2827 O OD1   . ASP C 1 48  ? 68.992 37.493  7.053   1.00 209.30 ? 48  ASP C OD1   1 
ATOM 2828 O OD2   . ASP C 1 48  ? 67.156 36.901  8.099   1.00 205.94 ? 48  ASP C OD2   1 
ATOM 2829 N N     . LEU C 1 49  ? 71.465 34.120  10.155  1.00 129.44 ? 49  LEU C N     1 
ATOM 2830 C CA    . LEU C 1 49  ? 72.317 33.763  11.284  1.00 125.42 ? 49  LEU C CA    1 
ATOM 2831 C C     . LEU C 1 49  ? 73.732 33.403  10.856  1.00 140.58 ? 49  LEU C C     1 
ATOM 2832 O O     . LEU C 1 49  ? 74.676 33.631  11.619  1.00 157.21 ? 49  LEU C O     1 
ATOM 2833 C CB    . LEU C 1 49  ? 71.706 32.605  12.069  1.00 129.62 ? 49  LEU C CB    1 
ATOM 2834 C CG    . LEU C 1 49  ? 70.419 32.919  12.829  1.00 141.88 ? 49  LEU C CG    1 
ATOM 2835 C CD1   . LEU C 1 49  ? 70.070 31.751  13.714  1.00 152.60 ? 49  LEU C CD1   1 
ATOM 2836 C CD2   . LEU C 1 49  ? 70.565 34.189  13.652  1.00 130.83 ? 49  LEU C CD2   1 
ATOM 2837 N N     . THR C 1 50  ? 73.907 32.845  9.660   1.00 154.00 ? 50  THR C N     1 
ATOM 2838 C CA    . THR C 1 50  ? 75.242 32.535  9.167   1.00 149.03 ? 50  THR C CA    1 
ATOM 2839 C C     . THR C 1 50  ? 75.871 33.687  8.393   1.00 141.89 ? 50  THR C C     1 
ATOM 2840 O O     . THR C 1 50  ? 77.000 33.543  7.913   1.00 144.60 ? 50  THR C O     1 
ATOM 2841 C CB    . THR C 1 50  ? 75.212 31.280  8.290   1.00 157.85 ? 50  THR C CB    1 
ATOM 2842 O OG1   . THR C 1 50  ? 74.273 31.457  7.221   1.00 187.17 ? 50  THR C OG1   1 
ATOM 2843 C CG2   . THR C 1 50  ? 74.819 30.067  9.118   1.00 139.24 ? 50  THR C CG2   1 
ATOM 2844 N N     . ARG C 1 51  ? 75.166 34.816  8.259   1.00 133.35 ? 51  ARG C N     1 
ATOM 2845 C CA    . ARG C 1 51  ? 75.704 35.960  7.527   1.00 133.02 ? 51  ARG C CA    1 
ATOM 2846 C C     . ARG C 1 51  ? 77.049 36.380  8.098   1.00 136.86 ? 51  ARG C C     1 
ATOM 2847 O O     . ARG C 1 51  ? 78.047 36.482  7.374   1.00 132.58 ? 51  ARG C O     1 
ATOM 2848 C CB    . ARG C 1 51  ? 74.710 37.120  7.575   1.00 151.90 ? 51  ARG C CB    1 
ATOM 2849 C CG    . ARG C 1 51  ? 75.121 38.334  6.764   1.00 142.92 ? 51  ARG C CG    1 
ATOM 2850 C CD    . ARG C 1 51  ? 73.989 39.346  6.701   1.00 146.85 ? 51  ARG C CD    1 
ATOM 2851 N NE    . ARG C 1 51  ? 72.769 38.753  6.160   1.00 166.63 ? 51  ARG C NE    1 
ATOM 2852 C CZ    . ARG C 1 51  ? 72.494 38.660  4.864   1.00 196.47 ? 51  ARG C CZ    1 
ATOM 2853 N NH1   . ARG C 1 51  ? 71.358 38.104  4.464   1.00 201.85 ? 51  ARG C NH1   1 
ATOM 2854 N NH2   . ARG C 1 51  ? 73.355 39.120  3.967   1.00 214.42 ? 51  ARG C NH2   1 
ATOM 2855 N N     . TYR C 1 52  ? 77.088 36.638  9.399   1.00 149.22 ? 52  TYR C N     1 
ATOM 2856 C CA    . TYR C 1 52  ? 78.311 36.935  10.128  1.00 158.52 ? 52  TYR C CA    1 
ATOM 2857 C C     . TYR C 1 52  ? 78.524 35.762  11.071  1.00 157.27 ? 52  TYR C C     1 
ATOM 2858 O O     . TYR C 1 52  ? 77.703 35.536  11.963  1.00 161.89 ? 52  TYR C O     1 
ATOM 2859 C CB    . TYR C 1 52  ? 78.199 38.247  10.904  1.00 154.92 ? 52  TYR C CB    1 
ATOM 2860 C CG    . TYR C 1 52  ? 77.676 39.409  10.088  1.00 165.32 ? 52  TYR C CG    1 
ATOM 2861 C CD1   . TYR C 1 52  ? 78.522 40.161  9.285   1.00 171.29 ? 52  TYR C CD1   1 
ATOM 2862 C CD2   . TYR C 1 52  ? 76.329 39.744  10.112  1.00 185.63 ? 52  TYR C CD2   1 
ATOM 2863 C CE1   . TYR C 1 52  ? 78.042 41.223  8.538   1.00 178.66 ? 52  TYR C CE1   1 
ATOM 2864 C CE2   . TYR C 1 52  ? 75.839 40.800  9.369   1.00 194.46 ? 52  TYR C CE2   1 
ATOM 2865 C CZ    . TYR C 1 52  ? 76.699 41.536  8.583   1.00 189.23 ? 52  TYR C CZ    1 
ATOM 2866 O OH    . TYR C 1 52  ? 76.213 42.588  7.841   1.00 194.92 ? 52  TYR C OH    1 
ATOM 2867 N N     . ASN C 1 53  ? 79.614 35.021  10.869  1.00 151.58 ? 53  ASN C N     1 
ATOM 2868 C CA    . ASN C 1 53  ? 79.881 33.779  11.587  1.00 121.08 ? 53  ASN C CA    1 
ATOM 2869 C C     . ASN C 1 53  ? 80.061 34.038  13.077  1.00 120.66 ? 53  ASN C C     1 
ATOM 2870 O O     . ASN C 1 53  ? 81.140 34.469  13.506  1.00 126.25 ? 53  ASN C O     1 
ATOM 2871 C CB    . ASN C 1 53  ? 81.131 33.110  11.015  1.00 159.14 ? 53  ASN C CB    1 
ATOM 2872 C CG    . ASN C 1 53  ? 81.023 32.847  9.528   1.00 144.70 ? 53  ASN C CG    1 
ATOM 2873 O OD1   . ASN C 1 53  ? 79.973 33.061  8.918   1.00 171.99 ? 53  ASN C OD1   1 
ATOM 2874 N ND2   . ASN C 1 53  ? 82.119 32.399  8.930   1.00 148.38 ? 53  ASN C ND2   1 
ATOM 2875 N N     . PRO C 1 54  ? 79.045 33.781  13.897  1.00 117.07 ? 54  PRO C N     1 
ATOM 2876 C CA    . PRO C 1 54  ? 79.094 34.184  15.301  1.00 117.40 ? 54  PRO C CA    1 
ATOM 2877 C C     . PRO C 1 54  ? 79.688 33.105  16.201  1.00 115.88 ? 54  PRO C C     1 
ATOM 2878 O O     . PRO C 1 54  ? 79.844 31.944  15.818  1.00 124.05 ? 54  PRO C O     1 
ATOM 2879 C CB    . PRO C 1 54  ? 77.614 34.398  15.632  1.00 115.03 ? 54  PRO C CB    1 
ATOM 2880 C CG    . PRO C 1 54  ? 76.932 33.335  14.820  1.00 123.54 ? 54  PRO C CG    1 
ATOM 2881 C CD    . PRO C 1 54  ? 77.773 33.107  13.576  1.00 154.96 ? 54  PRO C CD    1 
ATOM 2882 N N     . ASP C 1 55  ? 80.002 33.519  17.425  1.00 117.47 ? 55  ASP C N     1 
ATOM 2883 C CA    . ASP C 1 55  ? 80.428 32.609  18.478  1.00 131.86 ? 55  ASP C CA    1 
ATOM 2884 C C     . ASP C 1 55  ? 79.330 32.336  19.495  1.00 113.94 ? 55  ASP C C     1 
ATOM 2885 O O     . ASP C 1 55  ? 79.303 31.253  20.088  1.00 123.92 ? 55  ASP C O     1 
ATOM 2886 C CB    . ASP C 1 55  ? 81.660 33.174  19.189  1.00 152.21 ? 55  ASP C CB    1 
ATOM 2887 C CG    . ASP C 1 55  ? 82.886 33.176  18.303  1.00 130.64 ? 55  ASP C CG    1 
ATOM 2888 O OD1   . ASP C 1 55  ? 83.124 32.155  17.629  1.00 135.72 ? 55  ASP C OD1   1 
ATOM 2889 O OD2   . ASP C 1 55  ? 83.594 34.202  18.258  1.00 138.81 ? 55  ASP C OD2   1 
ATOM 2890 N N     . VAL C 1 56  ? 78.445 33.306  19.722  1.00 121.81 ? 56  VAL C N     1 
ATOM 2891 C CA    . VAL C 1 56  ? 77.280 33.149  20.583  1.00 157.16 ? 56  VAL C CA    1 
ATOM 2892 C C     . VAL C 1 56  ? 76.089 33.803  19.897  1.00 153.46 ? 56  VAL C C     1 
ATOM 2893 O O     . VAL C 1 56  ? 76.232 34.804  19.186  1.00 126.50 ? 56  VAL C O     1 
ATOM 2894 C CB    . VAL C 1 56  ? 77.492 33.744  21.995  1.00 128.88 ? 56  VAL C CB    1 
ATOM 2895 C CG1   . VAL C 1 56  ? 78.463 32.891  22.798  1.00 134.28 ? 56  VAL C CG1   1 
ATOM 2896 C CG2   . VAL C 1 56  ? 77.988 35.165  21.899  1.00 129.57 ? 56  VAL C CG2   1 
ATOM 2897 N N     . VAL C 1 57  ? 74.913 33.206  20.079  1.00 140.29 ? 57  VAL C N     1 
ATOM 2898 C CA    . VAL C 1 57  ? 73.652 33.769  19.606  1.00 110.04 ? 57  VAL C CA    1 
ATOM 2899 C C     . VAL C 1 57  ? 72.727 33.939  20.804  1.00 133.06 ? 57  VAL C C     1 
ATOM 2900 O O     . VAL C 1 57  ? 72.495 32.985  21.555  1.00 139.06 ? 57  VAL C O     1 
ATOM 2901 C CB    . VAL C 1 57  ? 72.998 32.888  18.529  1.00 106.04 ? 57  VAL C CB    1 
ATOM 2902 C CG1   . VAL C 1 57  ? 71.661 33.475  18.113  1.00 107.32 ? 57  VAL C CG1   1 
ATOM 2903 C CG2   . VAL C 1 57  ? 73.919 32.749  17.326  1.00 138.74 ? 57  VAL C CG2   1 
ATOM 2904 N N     . ILE C 1 58  ? 72.204 35.151  20.983  1.00 134.32 ? 58  ILE C N     1 
ATOM 2905 C CA    . ILE C 1 58  ? 71.359 35.489  22.123  1.00 122.52 ? 58  ILE C CA    1 
ATOM 2906 C C     . ILE C 1 58  ? 69.922 35.646  21.645  1.00 137.97 ? 58  ILE C C     1 
ATOM 2907 O O     . ILE C 1 58  ? 69.646 36.425  20.724  1.00 128.07 ? 58  ILE C O     1 
ATOM 2908 C CB    . ILE C 1 58  ? 71.848 36.768  22.822  1.00 128.97 ? 58  ILE C CB    1 
ATOM 2909 C CG1   . ILE C 1 58  ? 73.336 36.648  23.152  1.00 151.32 ? 58  ILE C CG1   1 
ATOM 2910 C CG2   . ILE C 1 58  ? 71.040 37.029  24.083  1.00 132.19 ? 58  ILE C CG2   1 
ATOM 2911 C CD1   . ILE C 1 58  ? 73.655 35.518  24.109  1.00 183.04 ? 58  ILE C CD1   1 
ATOM 2912 N N     . LEU C 1 59  ? 69.011 34.909  22.275  1.00 163.70 ? 59  LEU C N     1 
ATOM 2913 C CA    . LEU C 1 59  ? 67.588 34.968  21.984  1.00 164.55 ? 59  LEU C CA    1 
ATOM 2914 C C     . LEU C 1 59  ? 66.815 35.287  23.256  1.00 164.00 ? 59  LEU C C     1 
ATOM 2915 O O     . LEU C 1 59  ? 67.280 35.033  24.371  1.00 153.79 ? 59  LEU C O     1 
ATOM 2916 C CB    . LEU C 1 59  ? 67.087 33.645  21.393  1.00 146.20 ? 59  LEU C CB    1 
ATOM 2917 C CG    . LEU C 1 59  ? 67.907 33.051  20.249  1.00 142.66 ? 59  LEU C CG    1 
ATOM 2918 C CD1   . LEU C 1 59  ? 67.363 31.688  19.859  1.00 137.81 ? 59  LEU C CD1   1 
ATOM 2919 C CD2   . LEU C 1 59  ? 67.906 33.991  19.057  1.00 147.35 ? 59  LEU C CD2   1 
ATOM 2920 N N     . GLU C 1 60  ? 65.620 35.845  23.081  1.00 161.81 ? 60  GLU C N     1 
ATOM 2921 C CA    . GLU C 1 60  ? 64.733 36.139  24.197  1.00 167.75 ? 60  GLU C CA    1 
ATOM 2922 C C     . GLU C 1 60  ? 63.665 35.056  24.288  1.00 159.28 ? 60  GLU C C     1 
ATOM 2923 O O     . GLU C 1 60  ? 62.988 34.755  23.298  1.00 168.07 ? 60  GLU C O     1 
ATOM 2924 C CB    . GLU C 1 60  ? 64.096 37.523  24.056  1.00 195.71 ? 60  GLU C CB    1 
ATOM 2925 C CG    . GLU C 1 60  ? 63.431 37.796  22.720  1.00 216.19 ? 60  GLU C CG    1 
ATOM 2926 C CD    . GLU C 1 60  ? 62.779 39.162  22.670  1.00 246.31 ? 60  GLU C CD    1 
ATOM 2927 O OE1   . GLU C 1 60  ? 63.089 40.004  23.540  1.00 250.31 ? 60  GLU C OE1   1 
ATOM 2928 O OE2   . GLU C 1 60  ? 61.952 39.393  21.764  1.00 255.98 ? 60  GLU C OE2   1 
ATOM 2929 N N     . LYS C 1 61  ? 63.525 34.469  25.474  1.00 179.34 ? 61  LYS C N     1 
ATOM 2930 C CA    . LYS C 1 61  ? 62.596 33.364  25.662  1.00 169.99 ? 61  LYS C CA    1 
ATOM 2931 C C     . LYS C 1 61  ? 61.162 33.841  25.483  1.00 169.54 ? 61  LYS C C     1 
ATOM 2932 O O     . LYS C 1 61  ? 60.773 34.901  25.982  1.00 172.12 ? 61  LYS C O     1 
ATOM 2933 C CB    . LYS C 1 61  ? 62.789 32.731  27.040  1.00 174.82 ? 61  LYS C CB    1 
ATOM 2934 C CG    . LYS C 1 61  ? 61.890 31.534  27.303  1.00 173.36 ? 61  LYS C CG    1 
ATOM 2935 C CD    . LYS C 1 61  ? 62.144 30.962  28.684  1.00 178.30 ? 61  LYS C CD    1 
ATOM 2936 C CE    . LYS C 1 61  ? 63.572 30.446  28.797  1.00 205.65 ? 61  LYS C CE    1 
ATOM 2937 N NZ    . LYS C 1 61  ? 63.820 29.260  27.930  1.00 220.52 ? 61  LYS C NZ    1 
ATOM 2938 N N     . GLN C 1 62  ? 60.375 33.050  24.759  1.00 192.98 ? 62  GLN C N     1 
ATOM 2939 C CA    . GLN C 1 62  ? 58.985 33.365  24.481  1.00 218.23 ? 62  GLN C CA    1 
ATOM 2940 C C     . GLN C 1 62  ? 58.077 32.326  25.122  1.00 231.86 ? 62  GLN C C     1 
ATOM 2941 O O     . GLN C 1 62  ? 58.490 31.197  25.402  1.00 208.08 ? 62  GLN C O     1 
ATOM 2942 C CB    . GLN C 1 62  ? 58.728 33.382  22.967  1.00 215.16 ? 62  GLN C CB    1 
ATOM 2943 C CG    . GLN C 1 62  ? 59.681 34.253  22.166  1.00 183.62 ? 62  GLN C CG    1 
ATOM 2944 C CD    . GLN C 1 62  ? 59.343 35.723  22.251  1.00 222.00 ? 62  GLN C CD    1 
ATOM 2945 O OE1   . GLN C 1 62  ? 58.279 36.102  22.741  1.00 227.89 ? 62  GLN C OE1   1 
ATOM 2946 N NE2   . GLN C 1 62  ? 60.249 36.565  21.767  1.00 218.32 ? 62  GLN C NE2   1 
ATOM 2947 N N     . GLY C 1 63  ? 56.825 32.722  25.366  1.00 163.55 ? 63  GLY C N     1 
ATOM 2948 C CA    . GLY C 1 63  ? 55.843 31.767  25.824  1.00 211.59 ? 63  GLY C CA    1 
ATOM 2949 C C     . GLY C 1 63  ? 55.369 30.879  24.691  1.00 232.67 ? 63  GLY C C     1 
ATOM 2950 O O     . GLY C 1 63  ? 55.458 31.234  23.515  1.00 227.06 ? 63  GLY C O     1 
ATOM 2951 N N     . PHE C 1 64  ? 54.830 29.710  25.046  1.00 240.22 ? 64  PHE C N     1 
ATOM 2952 C CA    . PHE C 1 64  ? 54.366 28.760  24.032  1.00 237.59 ? 64  PHE C CA    1 
ATOM 2953 C C     . PHE C 1 64  ? 53.018 29.233  23.491  1.00 218.61 ? 64  PHE C C     1 
ATOM 2954 O O     . PHE C 1 64  ? 51.963 28.627  23.686  1.00 182.62 ? 64  PHE C O     1 
ATOM 2955 C CB    . PHE C 1 64  ? 54.330 27.333  24.575  1.00 245.70 ? 64  PHE C CB    1 
ATOM 2956 C CG    . PHE C 1 64  ? 53.651 27.183  25.910  1.00 218.40 ? 64  PHE C CG    1 
ATOM 2957 C CD1   . PHE C 1 64  ? 54.346 27.435  27.082  1.00 207.72 ? 64  PHE C CD1   1 
ATOM 2958 C CD2   . PHE C 1 64  ? 52.349 26.727  25.998  1.00 214.88 ? 64  PHE C CD2   1 
ATOM 2959 C CE1   . PHE C 1 64  ? 53.745 27.279  28.311  1.00 205.61 ? 64  PHE C CE1   1 
ATOM 2960 C CE2   . PHE C 1 64  ? 51.739 26.568  27.227  1.00 243.55 ? 64  PHE C CE2   1 
ATOM 2961 C CZ    . PHE C 1 64  ? 52.439 26.843  28.385  1.00 244.93 ? 64  PHE C CZ    1 
ATOM 2962 N N     . LYS C 1 65  ? 53.088 30.359  22.781  1.00 282.28 ? 65  LYS C N     1 
ATOM 2963 C CA    . LYS C 1 65  ? 51.936 31.006  22.181  1.00 307.24 ? 65  LYS C CA    1 
ATOM 2964 C C     . LYS C 1 65  ? 52.195 31.472  20.759  1.00 288.91 ? 65  LYS C C     1 
ATOM 2965 O O     . LYS C 1 65  ? 51.259 31.943  20.104  1.00 317.15 ? 65  LYS C O     1 
ATOM 2966 C CB    . LYS C 1 65  ? 51.508 32.216  23.027  1.00 327.27 ? 65  LYS C CB    1 
ATOM 2967 C CG    . LYS C 1 65  ? 52.551 33.329  23.044  1.00 326.37 ? 65  LYS C CG    1 
ATOM 2968 C CD    . LYS C 1 65  ? 52.314 34.339  24.158  1.00 326.43 ? 65  LYS C CD    1 
ATOM 2969 C CE    . LYS C 1 65  ? 52.865 33.843  25.487  1.00 328.53 ? 65  LYS C CE    1 
ATOM 2970 N NZ    . LYS C 1 65  ? 52.971 34.942  26.488  1.00 330.35 ? 65  LYS C NZ    1 
ATOM 2971 N N     . SER C 1 66  ? 53.421 31.351  20.261  1.00 189.33 ? 66  SER C N     1 
ATOM 2972 C CA    . SER C 1 66  ? 53.833 31.978  19.017  1.00 178.65 ? 66  SER C CA    1 
ATOM 2973 C C     . SER C 1 66  ? 54.833 31.069  18.325  1.00 210.89 ? 66  SER C C     1 
ATOM 2974 O O     . SER C 1 66  ? 55.503 30.263  18.982  1.00 213.12 ? 66  SER C O     1 
ATOM 2975 C CB    . SER C 1 66  ? 54.454 33.358  19.266  1.00 210.88 ? 66  SER C CB    1 
ATOM 2976 O OG    . SER C 1 66  ? 55.526 33.270  20.190  1.00 196.33 ? 66  SER C OG    1 
ATOM 2977 N N     . PRO C 1 67  ? 54.961 31.172  16.999  1.00 222.48 ? 67  PRO C N     1 
ATOM 2978 C CA    . PRO C 1 67  ? 56.004 30.408  16.296  1.00 228.24 ? 67  PRO C CA    1 
ATOM 2979 C C     . PRO C 1 67  ? 57.418 30.831  16.662  1.00 239.67 ? 67  PRO C C     1 
ATOM 2980 O O     . PRO C 1 67  ? 58.375 30.166  16.241  1.00 265.64 ? 67  PRO C O     1 
ATOM 2981 C CB    . PRO C 1 67  ? 55.707 30.684  14.814  1.00 225.77 ? 67  PRO C CB    1 
ATOM 2982 C CG    . PRO C 1 67  ? 54.288 31.165  14.784  1.00 236.67 ? 67  PRO C CG    1 
ATOM 2983 C CD    . PRO C 1 67  ? 54.092 31.906  16.065  1.00 224.77 ? 67  PRO C CD    1 
ATOM 2984 N N     . ASN C 1 68  ? 57.591 31.921  17.412  1.00 186.17 ? 68  ASN C N     1 
ATOM 2985 C CA    . ASN C 1 68  ? 58.937 32.307  17.815  1.00 196.24 ? 68  ASN C CA    1 
ATOM 2986 C C     . ASN C 1 68  ? 59.603 31.203  18.624  1.00 180.58 ? 68  ASN C C     1 
ATOM 2987 O O     . ASN C 1 68  ? 60.830 31.059  18.588  1.00 181.95 ? 68  ASN C O     1 
ATOM 2988 C CB    . ASN C 1 68  ? 58.883 33.606  18.617  1.00 213.25 ? 68  ASN C CB    1 
ATOM 2989 C CG    . ASN C 1 68  ? 58.289 34.752  17.824  1.00 202.03 ? 68  ASN C CG    1 
ATOM 2990 O OD1   . ASN C 1 68  ? 57.707 34.547  16.759  1.00 191.97 ? 68  ASN C OD1   1 
ATOM 2991 N ND2   . ASN C 1 68  ? 58.422 35.966  18.346  1.00 208.85 ? 68  ASN C ND2   1 
ATOM 2992 N N     . SER C 1 69  ? 58.812 30.384  19.322  1.00 148.07 ? 69  SER C N     1 
ATOM 2993 C CA    . SER C 1 69  ? 59.380 29.237  20.023  1.00 149.43 ? 69  SER C CA    1 
ATOM 2994 C C     . SER C 1 69  ? 59.907 28.198  19.037  1.00 158.97 ? 69  SER C C     1 
ATOM 2995 O O     . SER C 1 69  ? 60.969 27.597  19.261  1.00 161.50 ? 69  SER C O     1 
ATOM 2996 C CB    . SER C 1 69  ? 58.335 28.628  20.957  1.00 141.60 ? 69  SER C CB    1 
ATOM 2997 O OG    . SER C 1 69  ? 57.216 28.154  20.230  1.00 167.51 ? 69  SER C OG    1 
ATOM 2998 N N     . LYS C 1 70  ? 59.176 27.970  17.940  1.00 153.42 ? 70  LYS C N     1 
ATOM 2999 C CA    . LYS C 1 70  ? 59.664 27.047  16.922  1.00 137.49 ? 70  LYS C CA    1 
ATOM 3000 C C     . LYS C 1 70  ? 60.942 27.576  16.294  1.00 132.73 ? 70  LYS C C     1 
ATOM 3001 O O     . LYS C 1 70  ? 61.847 26.797  15.979  1.00 164.96 ? 70  LYS C O     1 
ATOM 3002 C CB    . LYS C 1 70  ? 58.594 26.803  15.851  1.00 166.85 ? 70  LYS C CB    1 
ATOM 3003 C CG    . LYS C 1 70  ? 58.644 27.736  14.643  1.00 152.43 ? 70  LYS C CG    1 
ATOM 3004 C CD    . LYS C 1 70  ? 57.427 27.598  13.747  1.00 169.75 ? 70  LYS C CD    1 
ATOM 3005 C CE    . LYS C 1 70  ? 57.508 28.562  12.573  1.00 151.29 ? 70  LYS C CE    1 
ATOM 3006 N NZ    . LYS C 1 70  ? 56.253 28.583  11.772  1.00 185.47 ? 70  LYS C NZ    1 
ATOM 3007 N N     . ILE C 1 71  ? 61.055 28.900  16.153  1.00 124.29 ? 71  ILE C N     1 
ATOM 3008 C CA    . ILE C 1 71  ? 62.294 29.479  15.646  1.00 100.32 ? 71  ILE C CA    1 
ATOM 3009 C C     . ILE C 1 71  ? 63.426 29.282  16.650  1.00 139.13 ? 71  ILE C C     1 
ATOM 3010 O O     . ILE C 1 71  ? 64.568 29.005  16.269  1.00 97.32  ? 71  ILE C O     1 
ATOM 3011 C CB    . ILE C 1 71  ? 62.086 30.964  15.300  1.00 99.44  ? 71  ILE C CB    1 
ATOM 3012 C CG1   . ILE C 1 71  ? 60.899 31.121  14.348  1.00 147.59 ? 71  ILE C CG1   1 
ATOM 3013 C CG2   . ILE C 1 71  ? 63.341 31.550  14.677  1.00 96.47  ? 71  ILE C CG2   1 
ATOM 3014 C CD1   . ILE C 1 71  ? 60.594 32.560  13.976  1.00 135.09 ? 71  ILE C CD1   1 
ATOM 3015 N N     . ILE C 1 72  ? 63.127 29.416  17.945  1.00 151.84 ? 72  ILE C N     1 
ATOM 3016 C CA    . ILE C 1 72  ? 64.139 29.204  18.981  1.00 101.37 ? 72  ILE C CA    1 
ATOM 3017 C C     . ILE C 1 72  ? 64.694 27.787  18.899  1.00 101.76 ? 72  ILE C C     1 
ATOM 3018 O O     . ILE C 1 72  ? 65.915 27.572  18.915  1.00 103.99 ? 72  ILE C O     1 
ATOM 3019 C CB    . ILE C 1 72  ? 63.556 29.503  20.375  1.00 145.39 ? 72  ILE C CB    1 
ATOM 3020 C CG1   . ILE C 1 72  ? 63.375 31.011  20.562  1.00 149.32 ? 72  ILE C CG1   1 
ATOM 3021 C CG2   . ILE C 1 72  ? 64.441 28.923  21.473  1.00 105.52 ? 72  ILE C CG2   1 
ATOM 3022 C CD1   . ILE C 1 72  ? 62.960 31.407  21.960  1.00 133.40 ? 72  ILE C CD1   1 
ATOM 3023 N N     . TYR C 1 73  ? 63.802 26.795  18.822  1.00 147.69 ? 73  TYR C N     1 
ATOM 3024 C CA    . TYR C 1 73  ? 64.264 25.409  18.765  1.00 105.69 ? 73  TYR C CA    1 
ATOM 3025 C C     . TYR C 1 73  ? 64.948 25.098  17.441  1.00 125.83 ? 73  TYR C C     1 
ATOM 3026 O O     . TYR C 1 73  ? 65.888 24.290  17.403  1.00 116.56 ? 73  TYR C O     1 
ATOM 3027 C CB    . TYR C 1 73  ? 63.107 24.444  19.020  1.00 109.95 ? 73  TYR C CB    1 
ATOM 3028 C CG    . TYR C 1 73  ? 62.663 24.424  20.463  1.00 126.95 ? 73  TYR C CG    1 
ATOM 3029 C CD1   . TYR C 1 73  ? 63.456 23.829  21.436  1.00 127.96 ? 73  TYR C CD1   1 
ATOM 3030 C CD2   . TYR C 1 73  ? 61.470 25.010  20.858  1.00 120.34 ? 73  TYR C CD2   1 
ATOM 3031 C CE1   . TYR C 1 73  ? 63.068 23.804  22.756  1.00 155.87 ? 73  TYR C CE1   1 
ATOM 3032 C CE2   . TYR C 1 73  ? 61.073 24.993  22.181  1.00 137.55 ? 73  TYR C CE2   1 
ATOM 3033 C CZ    . TYR C 1 73  ? 61.877 24.388  23.125  1.00 151.84 ? 73  TYR C CZ    1 
ATOM 3034 O OH    . TYR C 1 73  ? 61.493 24.363  24.444  1.00 135.56 ? 73  TYR C OH    1 
ATOM 3035 N N     . PHE C 1 74  ? 64.519 25.747  16.356  1.00 123.08 ? 74  PHE C N     1 
ATOM 3036 C CA    . PHE C 1 74  ? 65.248 25.635  15.101  1.00 117.22 ? 74  PHE C CA    1 
ATOM 3037 C C     . PHE C 1 74  ? 66.672 26.151  15.257  1.00 121.22 ? 74  PHE C C     1 
ATOM 3038 O O     . PHE C 1 74  ? 67.616 25.546  14.742  1.00 120.96 ? 74  PHE C O     1 
ATOM 3039 C CB    . PHE C 1 74  ? 64.518 26.395  13.994  1.00 118.44 ? 74  PHE C CB    1 
ATOM 3040 C CG    . PHE C 1 74  ? 65.225 26.357  12.670  1.00 141.78 ? 74  PHE C CG    1 
ATOM 3041 C CD1   . PHE C 1 74  ? 65.040 25.293  11.803  1.00 118.59 ? 74  PHE C CD1   1 
ATOM 3042 C CD2   . PHE C 1 74  ? 66.078 27.383  12.291  1.00 128.14 ? 74  PHE C CD2   1 
ATOM 3043 C CE1   . PHE C 1 74  ? 65.691 25.252  10.586  1.00 109.18 ? 74  PHE C CE1   1 
ATOM 3044 C CE2   . PHE C 1 74  ? 66.732 27.347  11.077  1.00 99.49  ? 74  PHE C CE2   1 
ATOM 3045 C CZ    . PHE C 1 74  ? 66.538 26.281  10.223  1.00 97.88  ? 74  PHE C CZ    1 
ATOM 3046 N N     . ILE C 1 75  ? 66.845 27.268  15.968  1.00 112.45 ? 75  ILE C N     1 
ATOM 3047 C CA    . ILE C 1 75  ? 68.181 27.831  16.163  1.00 105.28 ? 75  ILE C CA    1 
ATOM 3048 C C     . ILE C 1 75  ? 69.036 26.880  16.989  1.00 96.82  ? 75  ILE C C     1 
ATOM 3049 O O     . ILE C 1 75  ? 70.223 26.663  16.699  1.00 92.00  ? 75  ILE C O     1 
ATOM 3050 C CB    . ILE C 1 75  ? 68.097 29.209  16.852  1.00 106.86 ? 75  ILE C CB    1 
ATOM 3051 C CG1   . ILE C 1 75  ? 67.343 30.242  16.014  1.00 102.36 ? 75  ILE C CG1   1 
ATOM 3052 C CG2   . ILE C 1 75  ? 69.491 29.738  17.132  1.00 107.23 ? 75  ILE C CG2   1 
ATOM 3053 C CD1   . ILE C 1 75  ? 67.270 29.934  14.574  1.00 119.05 ? 75  ILE C CD1   1 
ATOM 3054 N N     . LYS C 1 76  ? 68.446 26.318  18.047  1.00 96.49  ? 76  LYS C N     1 
ATOM 3055 C CA    . LYS C 1 76  ? 69.168 25.371  18.891  1.00 134.16 ? 76  LYS C CA    1 
ATOM 3056 C C     . LYS C 1 76  ? 69.650 24.175  18.082  1.00 122.78 ? 76  LYS C C     1 
ATOM 3057 O O     . LYS C 1 76  ? 70.828 23.800  18.145  1.00 97.55  ? 76  LYS C O     1 
ATOM 3058 C CB    . LYS C 1 76  ? 68.277 24.914  20.048  1.00 102.08 ? 76  LYS C CB    1 
ATOM 3059 C CG    . LYS C 1 76  ? 68.155 25.912  21.182  1.00 125.89 ? 76  LYS C CG    1 
ATOM 3060 C CD    . LYS C 1 76  ? 67.277 25.354  22.292  1.00 145.97 ? 76  LYS C CD    1 
ATOM 3061 C CE    . LYS C 1 76  ? 67.440 26.135  23.583  1.00 143.93 ? 76  LYS C CE    1 
ATOM 3062 N NZ    . LYS C 1 76  ? 66.632 25.540  24.683  1.00 177.61 ? 76  LYS C NZ    1 
ATOM 3063 N N     . GLY C 1 77  ? 68.759 23.586  17.282  1.00 118.30 ? 77  GLY C N     1 
ATOM 3064 C CA    . GLY C 1 77  ? 69.168 22.468  16.449  1.00 109.60 ? 77  GLY C CA    1 
ATOM 3065 C C     . GLY C 1 77  ? 70.196 22.874  15.412  1.00 107.90 ? 77  GLY C C     1 
ATOM 3066 O O     . GLY C 1 77  ? 71.137 22.128  15.127  1.00 117.62 ? 77  GLY C O     1 
ATOM 3067 N N     . PHE C 1 78  ? 70.048 24.078  14.859  1.00 102.58 ? 78  PHE C N     1 
ATOM 3068 C CA    . PHE C 1 78  ? 70.931 24.541  13.798  1.00 113.17 ? 78  PHE C CA    1 
ATOM 3069 C C     . PHE C 1 78  ? 72.366 24.655  14.294  1.00 97.36  ? 78  PHE C C     1 
ATOM 3070 O O     . PHE C 1 78  ? 73.294 24.119  13.677  1.00 132.19 ? 78  PHE C O     1 
ATOM 3071 C CB    . PHE C 1 78  ? 70.423 25.884  13.272  1.00 97.91  ? 78  PHE C CB    1 
ATOM 3072 C CG    . PHE C 1 78  ? 71.161 26.390  12.072  1.00 110.93 ? 78  PHE C CG    1 
ATOM 3073 C CD1   . PHE C 1 78  ? 70.918 25.854  10.819  1.00 106.95 ? 78  PHE C CD1   1 
ATOM 3074 C CD2   . PHE C 1 78  ? 72.089 27.409  12.192  1.00 129.36 ? 78  PHE C CD2   1 
ATOM 3075 C CE1   . PHE C 1 78  ? 71.587 26.322  9.710   1.00 111.14 ? 78  PHE C CE1   1 
ATOM 3076 C CE2   . PHE C 1 78  ? 72.764 27.881  11.087  1.00 137.97 ? 78  PHE C CE2   1 
ATOM 3077 C CZ    . PHE C 1 78  ? 72.513 27.336  9.843   1.00 124.81 ? 78  PHE C CZ    1 
ATOM 3078 N N     . PHE C 1 79  ? 72.568 25.348  15.411  1.00 105.36 ? 79  PHE C N     1 
ATOM 3079 C CA    . PHE C 1 79  ? 73.911 25.544  15.941  1.00 100.52 ? 79  PHE C CA    1 
ATOM 3080 C C     . PHE C 1 79  ? 74.336 24.447  16.913  1.00 117.77 ? 79  PHE C C     1 
ATOM 3081 O O     . PHE C 1 79  ? 75.420 24.548  17.497  1.00 113.89 ? 79  PHE C O     1 
ATOM 3082 C CB    . PHE C 1 79  ? 74.017 26.901  16.639  1.00 95.51  ? 79  PHE C CB    1 
ATOM 3083 C CG    . PHE C 1 79  ? 74.008 28.069  15.700  1.00 111.78 ? 79  PHE C CG    1 
ATOM 3084 C CD1   . PHE C 1 79  ? 75.013 28.231  14.762  1.00 120.28 ? 79  PHE C CD1   1 
ATOM 3085 C CD2   . PHE C 1 79  ? 73.004 29.021  15.771  1.00 99.24  ? 79  PHE C CD2   1 
ATOM 3086 C CE1   . PHE C 1 79  ? 75.009 29.310  13.900  1.00 126.96 ? 79  PHE C CE1   1 
ATOM 3087 C CE2   . PHE C 1 79  ? 72.995 30.103  14.913  1.00 136.46 ? 79  PHE C CE2   1 
ATOM 3088 C CZ    . PHE C 1 79  ? 73.999 30.248  13.976  1.00 149.58 ? 79  PHE C CZ    1 
ATOM 3089 N N     . TYR C 1 80  ? 73.524 23.397  17.084  1.00 136.37 ? 80  TYR C N     1 
ATOM 3090 C CA    . TYR C 1 80  ? 73.855 22.353  18.052  1.00 96.84  ? 80  TYR C CA    1 
ATOM 3091 C C     . TYR C 1 80  ? 75.132 21.618  17.674  1.00 167.72 ? 80  TYR C C     1 
ATOM 3092 O O     . TYR C 1 80  ? 75.919 21.245  18.553  1.00 98.04  ? 80  TYR C O     1 
ATOM 3093 C CB    . TYR C 1 80  ? 72.694 21.366  18.181  1.00 101.28 ? 80  TYR C CB    1 
ATOM 3094 C CG    . TYR C 1 80  ? 72.810 20.421  19.362  1.00 117.65 ? 80  TYR C CG    1 
ATOM 3095 C CD1   . TYR C 1 80  ? 73.482 19.209  19.242  1.00 106.76 ? 80  TYR C CD1   1 
ATOM 3096 C CD2   . TYR C 1 80  ? 72.248 20.738  20.592  1.00 121.61 ? 80  TYR C CD2   1 
ATOM 3097 C CE1   . TYR C 1 80  ? 73.593 18.344  20.311  1.00 111.03 ? 80  TYR C CE1   1 
ATOM 3098 C CE2   . TYR C 1 80  ? 72.354 19.875  21.670  1.00 115.87 ? 80  TYR C CE2   1 
ATOM 3099 C CZ    . TYR C 1 80  ? 73.027 18.680  21.523  1.00 138.46 ? 80  TYR C CZ    1 
ATOM 3100 O OH    . TYR C 1 80  ? 73.136 17.818  22.590  1.00 118.02 ? 80  TYR C OH    1 
ATOM 3101 N N     . ASN C 1 81  ? 75.328 21.367  16.377  1.00 214.66 ? 81  ASN C N     1 
ATOM 3102 C CA    . ASN C 1 81  ? 76.490 20.641  15.877  1.00 236.58 ? 81  ASN C CA    1 
ATOM 3103 C C     . ASN C 1 81  ? 77.777 21.031  16.601  1.00 226.08 ? 81  ASN C C     1 
ATOM 3104 O O     . ASN C 1 81  ? 78.404 20.202  17.270  1.00 240.09 ? 81  ASN C O     1 
ATOM 3105 C CB    . ASN C 1 81  ? 76.623 20.878  14.369  1.00 246.22 ? 81  ASN C CB    1 
ATOM 3106 C CG    . ASN C 1 81  ? 75.461 20.291  13.581  1.00 253.49 ? 81  ASN C CG    1 
ATOM 3107 O OD1   . ASN C 1 81  ? 74.821 20.985  12.791  1.00 247.02 ? 81  ASN C OD1   1 
ATOM 3108 N ND2   . ASN C 1 81  ? 75.183 19.009  13.797  1.00 257.22 ? 81  ASN C ND2   1 
ATOM 3109 N N     . SER C 1 82  ? 78.159 22.308  16.502  1.00 201.82 ? 82  SER C N     1 
ATOM 3110 C CA    . SER C 1 82  ? 79.362 22.813  17.158  1.00 201.36 ? 82  SER C CA    1 
ATOM 3111 C C     . SER C 1 82  ? 79.524 24.317  16.977  1.00 206.52 ? 82  SER C C     1 
ATOM 3112 O O     . SER C 1 82  ? 78.676 24.974  16.363  1.00 110.53 ? 82  SER C O     1 
ATOM 3113 C CB    . SER C 1 82  ? 80.611 22.101  16.627  1.00 225.02 ? 82  SER C CB    1 
ATOM 3114 O OG    . SER C 1 82  ? 80.749 22.284  15.229  1.00 236.84 ? 82  SER C OG    1 
ATOM 3115 N N     . ASN C 1 83  ? 80.596 24.863  17.560  1.00 217.85 ? 83  ASN C N     1 
ATOM 3116 C CA    . ASN C 1 83  ? 81.158 26.169  17.220  1.00 210.30 ? 83  ASN C CA    1 
ATOM 3117 C C     . ASN C 1 83  ? 80.332 27.347  17.727  1.00 188.84 ? 83  ASN C C     1 
ATOM 3118 O O     . ASN C 1 83  ? 80.757 28.501  17.604  1.00 188.23 ? 83  ASN C O     1 
ATOM 3119 C CB    . ASN C 1 83  ? 81.340 26.282  15.700  1.00 224.37 ? 83  ASN C CB    1 
ATOM 3120 C CG    . ASN C 1 83  ? 82.193 27.475  15.295  1.00 241.11 ? 83  ASN C CG    1 
ATOM 3121 O OD1   . ASN C 1 83  ? 83.110 27.869  16.017  1.00 252.42 ? 83  ASN C OD1   1 
ATOM 3122 N ND2   . ASN C 1 83  ? 81.885 28.063  14.141  1.00 229.07 ? 83  ASN C ND2   1 
ATOM 3123 N N     . THR C 1 84  ? 79.164 27.091  18.304  1.00 152.78 ? 84  THR C N     1 
ATOM 3124 C CA    . THR C 1 84  ? 78.292 28.193  18.668  1.00 142.44 ? 84  THR C CA    1 
ATOM 3125 C C     . THR C 1 84  ? 77.611 27.877  19.990  1.00 152.86 ? 84  THR C C     1 
ATOM 3126 O O     . THR C 1 84  ? 77.289 26.722  20.282  1.00 168.32 ? 84  THR C O     1 
ATOM 3127 C CB    . THR C 1 84  ? 77.240 28.445  17.588  1.00 149.15 ? 84  THR C CB    1 
ATOM 3128 O OG1   . THR C 1 84  ? 77.502 27.594  16.468  1.00 175.86 ? 84  THR C OG1   1 
ATOM 3129 C CG2   . THR C 1 84  ? 77.361 29.875  17.092  1.00 113.93 ? 84  THR C CG2   1 
ATOM 3130 N N     . LYS C 1 85  ? 77.389 28.917  20.786  1.00 118.18 ? 85  LYS C N     1 
ATOM 3131 C CA    . LYS C 1 85  ? 76.686 28.795  22.059  1.00 162.25 ? 85  LYS C CA    1 
ATOM 3132 C C     . LYS C 1 85  ? 75.407 29.614  21.951  1.00 163.33 ? 85  LYS C C     1 
ATOM 3133 O O     . LYS C 1 85  ? 75.427 30.835  22.133  1.00 180.41 ? 85  LYS C O     1 
ATOM 3134 C CB    . LYS C 1 85  ? 77.557 29.262  23.225  1.00 191.83 ? 85  LYS C CB    1 
ATOM 3135 C CG    . LYS C 1 85  ? 78.881 28.523  23.350  1.00 208.92 ? 85  LYS C CG    1 
ATOM 3136 C CD    . LYS C 1 85  ? 78.672 27.024  23.514  1.00 210.65 ? 85  LYS C CD    1 
ATOM 3137 C CE    . LYS C 1 85  ? 79.995 26.271  23.486  1.00 200.56 ? 85  LYS C CE    1 
ATOM 3138 N NZ    . LYS C 1 85  ? 80.694 26.412  22.176  1.00 198.19 ? 85  LYS C NZ    1 
ATOM 3139 N N     . VAL C 1 86  ? 74.301 28.947  21.638  1.00 167.75 ? 86  VAL C N     1 
ATOM 3140 C CA    . VAL C 1 86  ? 72.995 29.594  21.647  1.00 130.67 ? 86  VAL C CA    1 
ATOM 3141 C C     . VAL C 1 86  ? 72.540 29.720  23.095  1.00 117.48 ? 86  VAL C C     1 
ATOM 3142 O O     . VAL C 1 86  ? 72.496 28.729  23.831  1.00 140.75 ? 86  VAL C O     1 
ATOM 3143 C CB    . VAL C 1 86  ? 71.978 28.809  20.807  1.00 131.73 ? 86  VAL C CB    1 
ATOM 3144 C CG1   . VAL C 1 86  ? 72.239 29.033  19.336  1.00 107.39 ? 86  VAL C CG1   1 
ATOM 3145 C CG2   . VAL C 1 86  ? 72.055 27.322  21.121  1.00 194.86 ? 86  VAL C CG2   1 
ATOM 3146 N N     . ILE C 1 87  ? 72.215 30.942  23.512  1.00 121.15 ? 87  ILE C N     1 
ATOM 3147 C CA    . ILE C 1 87  ? 71.753 31.214  24.868  1.00 161.31 ? 87  ILE C CA    1 
ATOM 3148 C C     . ILE C 1 87  ? 70.400 31.897  24.773  1.00 177.75 ? 87  ILE C C     1 
ATOM 3149 O O     . ILE C 1 87  ? 70.247 32.879  24.037  1.00 170.92 ? 87  ILE C O     1 
ATOM 3150 C CB    . ILE C 1 87  ? 72.747 32.099  25.641  1.00 129.53 ? 87  ILE C CB    1 
ATOM 3151 C CG1   . ILE C 1 87  ? 74.172 31.569  25.484  1.00 125.99 ? 87  ILE C CG1   1 
ATOM 3152 C CG2   . ILE C 1 87  ? 72.363 32.168  27.109  1.00 183.40 ? 87  ILE C CG2   1 
ATOM 3153 C CD1   . ILE C 1 87  ? 75.231 32.527  25.969  1.00 128.49 ? 87  ILE C CD1   1 
ATOM 3154 N N     . VAL C 1 88  ? 69.428 31.393  25.525  1.00 119.34 ? 88  VAL C N     1 
ATOM 3155 C CA    . VAL C 1 88  ? 68.080 31.941  25.516  1.00 130.98 ? 88  VAL C CA    1 
ATOM 3156 C C     . VAL C 1 88  ? 67.859 32.618  26.860  1.00 174.57 ? 88  VAL C C     1 
ATOM 3157 O O     . VAL C 1 88  ? 67.677 31.949  27.886  1.00 141.17 ? 88  VAL C O     1 
ATOM 3158 C CB    . VAL C 1 88  ? 67.027 30.855  25.255  1.00 153.66 ? 88  VAL C CB    1 
ATOM 3159 C CG1   . VAL C 1 88  ? 65.646 31.471  25.138  1.00 145.72 ? 88  VAL C CG1   1 
ATOM 3160 C CG2   . VAL C 1 88  ? 67.375 30.063  24.007  1.00 113.98 ? 88  VAL C CG2   1 
ATOM 3161 N N     . ARG C 1 89  ? 67.868 33.944  26.859  1.00 178.86 ? 89  ARG C N     1 
ATOM 3162 C CA    . ARG C 1 89  ? 67.664 34.720  28.069  1.00 165.35 ? 89  ARG C CA    1 
ATOM 3163 C C     . ARG C 1 89  ? 66.226 35.215  28.122  1.00 168.16 ? 89  ARG C C     1 
ATOM 3164 O O     . ARG C 1 89  ? 65.634 35.543  27.091  1.00 167.17 ? 89  ARG C O     1 
ATOM 3165 C CB    . ARG C 1 89  ? 68.650 35.889  28.125  1.00 186.54 ? 89  ARG C CB    1 
ATOM 3166 C CG    . ARG C 1 89  ? 70.102 35.432  28.020  1.00 202.51 ? 89  ARG C CG    1 
ATOM 3167 C CD    . ARG C 1 89  ? 71.072 36.575  27.754  1.00 194.76 ? 89  ARG C CD    1 
ATOM 3168 N NE    . ARG C 1 89  ? 71.398 37.329  28.960  1.00 196.37 ? 89  ARG C NE    1 
ATOM 3169 C CZ    . ARG C 1 89  ? 70.906 38.529  29.246  1.00 206.32 ? 89  ARG C CZ    1 
ATOM 3170 N NH1   . ARG C 1 89  ? 71.259 39.143  30.368  1.00 200.08 ? 89  ARG C NH1   1 
ATOM 3171 N NH2   . ARG C 1 89  ? 70.064 39.119  28.409  1.00 208.48 ? 89  ARG C NH2   1 
ATOM 3172 N N     . ASN C 1 90  ? 65.667 35.261  29.328  1.00 248.96 ? 90  ASN C N     1 
ATOM 3173 C CA    . ASN C 1 90  ? 64.355 35.852  29.522  1.00 246.70 ? 90  ASN C CA    1 
ATOM 3174 C C     . ASN C 1 90  ? 64.385 37.328  29.125  1.00 256.71 ? 90  ASN C C     1 
ATOM 3175 O O     . ASN C 1 90  ? 65.448 37.954  29.122  1.00 261.00 ? 90  ASN C O     1 
ATOM 3176 C CB    . ASN C 1 90  ? 63.913 35.688  30.976  1.00 246.40 ? 90  ASN C CB    1 
ATOM 3177 C CG    . ASN C 1 90  ? 65.074 35.727  31.947  1.00 274.48 ? 90  ASN C CG    1 
ATOM 3178 O OD1   . ASN C 1 90  ? 66.230 35.563  31.557  1.00 275.91 ? 90  ASN C OD1   1 
ATOM 3179 N ND2   . ASN C 1 90  ? 64.772 35.940  33.223  1.00 287.14 ? 90  ASN C ND2   1 
ATOM 3180 N N     . PRO C 1 91  ? 63.234 37.898  28.760  1.00 263.63 ? 91  PRO C N     1 
ATOM 3181 C CA    . PRO C 1 91  ? 63.196 39.332  28.426  1.00 270.12 ? 91  PRO C CA    1 
ATOM 3182 C C     . PRO C 1 91  ? 63.745 40.151  29.583  1.00 284.06 ? 91  PRO C C     1 
ATOM 3183 O O     . PRO C 1 91  ? 63.252 40.080  30.711  1.00 297.27 ? 91  PRO C O     1 
ATOM 3184 C CB    . PRO C 1 91  ? 61.708 39.602  28.164  1.00 276.13 ? 91  PRO C CB    1 
ATOM 3185 C CG    . PRO C 1 91  ? 60.982 38.438  28.750  1.00 275.93 ? 91  PRO C CG    1 
ATOM 3186 C CD    . PRO C 1 91  ? 61.909 37.272  28.624  1.00 267.77 ? 91  PRO C CD    1 
ATOM 3187 N N     . THR C 1 92  ? 64.795 40.922  29.284  1.00 296.69 ? 92  THR C N     1 
ATOM 3188 C CA    . THR C 1 92  ? 65.564 41.633  30.302  1.00 317.88 ? 92  THR C CA    1 
ATOM 3189 C C     . THR C 1 92  ? 64.685 42.457  31.237  1.00 326.97 ? 92  THR C C     1 
ATOM 3190 O O     . THR C 1 92  ? 64.664 42.225  32.450  1.00 336.88 ? 92  THR C O     1 
ATOM 3191 C CB    . THR C 1 92  ? 66.597 42.532  29.617  1.00 317.36 ? 92  THR C CB    1 
ATOM 3192 O OG1   . THR C 1 92  ? 65.923 43.512  28.817  1.00 307.71 ? 92  THR C OG1   1 
ATOM 3193 C CG2   . THR C 1 92  ? 67.511 41.707  28.725  1.00 309.92 ? 92  THR C CG2   1 
ATOM 3194 N N     . PHE C 1 93  ? 63.951 43.427  30.698  1.00 323.66 ? 93  PHE C N     1 
ATOM 3195 C CA    . PHE C 1 93  ? 63.056 44.231  31.530  1.00 327.07 ? 93  PHE C CA    1 
ATOM 3196 C C     . PHE C 1 93  ? 61.848 43.419  31.992  1.00 331.78 ? 93  PHE C C     1 
ATOM 3197 O O     . PHE C 1 93  ? 60.774 43.437  31.386  1.00 327.58 ? 93  PHE C O     1 
ATOM 3198 C CB    . PHE C 1 93  ? 62.621 45.486  30.786  1.00 318.70 ? 93  PHE C CB    1 
ATOM 3199 C CG    . PHE C 1 93  ? 63.722 46.482  30.598  1.00 318.40 ? 93  PHE C CG    1 
ATOM 3200 C CD1   . PHE C 1 93  ? 64.617 46.734  31.623  1.00 322.90 ? 93  PHE C CD1   1 
ATOM 3201 C CD2   . PHE C 1 93  ? 63.865 47.166  29.405  1.00 310.83 ? 93  PHE C CD2   1 
ATOM 3202 C CE1   . PHE C 1 93  ? 65.634 47.649  31.464  1.00 321.14 ? 93  PHE C CE1   1 
ATOM 3203 C CE2   . PHE C 1 93  ? 64.883 48.083  29.240  1.00 312.56 ? 93  PHE C CE2   1 
ATOM 3204 C CZ    . PHE C 1 93  ? 65.769 48.325  30.271  1.00 315.95 ? 93  PHE C CZ    1 
ATOM 3205 N N     . LYS C 1 94  ? 62.033 42.684  33.090  1.00 339.07 ? 94  LYS C N     1 
ATOM 3206 C CA    . LYS C 1 94  ? 60.933 41.943  33.703  1.00 330.39 ? 94  LYS C CA    1 
ATOM 3207 C C     . LYS C 1 94  ? 60.422 42.741  34.899  1.00 328.94 ? 94  LYS C C     1 
ATOM 3208 O O     . LYS C 1 94  ? 60.591 42.374  36.063  1.00 337.20 ? 94  LYS C O     1 
ATOM 3209 C CB    . LYS C 1 94  ? 61.391 40.547  34.116  1.00 324.21 ? 94  LYS C CB    1 
ATOM 3210 C CG    . LYS C 1 94  ? 60.250 39.580  34.381  1.00 311.36 ? 94  LYS C CG    1 
ATOM 3211 C CD    . LYS C 1 94  ? 59.540 39.177  33.108  1.00 287.58 ? 94  LYS C CD    1 
ATOM 3212 C CE    . LYS C 1 94  ? 60.475 38.404  32.206  1.00 291.36 ? 94  LYS C CE    1 
ATOM 3213 N NZ    . LYS C 1 94  ? 61.051 37.209  32.883  1.00 299.94 ? 94  LYS C NZ    1 
ATOM 3214 N N     . GLY C 1 95  ? 59.800 43.869  34.583  1.00 291.05 ? 95  GLY C N     1 
ATOM 3215 C CA    . GLY C 1 95  ? 59.206 44.699  35.613  1.00 282.28 ? 95  GLY C CA    1 
ATOM 3216 C C     . GLY C 1 95  ? 58.376 45.805  35.001  1.00 303.28 ? 95  GLY C C     1 
ATOM 3217 O O     . GLY C 1 95  ? 58.305 45.962  33.779  1.00 255.66 ? 95  GLY C O     1 
ATOM 3218 N N     . GLY C 1 96  ? 57.777 46.599  35.886  1.00 355.33 ? 96  GLY C N     1 
ATOM 3219 C CA    . GLY C 1 96  ? 56.947 47.729  35.510  1.00 363.08 ? 96  GLY C CA    1 
ATOM 3220 C C     . GLY C 1 96  ? 55.836 47.472  34.508  1.00 358.53 ? 96  GLY C C     1 
ATOM 3221 O O     . GLY C 1 96  ? 55.437 46.329  34.260  1.00 361.64 ? 96  GLY C O     1 
ATOM 3222 N N     . SER C 1 97  ? 55.309 48.557  33.949  1.00 342.17 ? 97  SER C N     1 
ATOM 3223 C CA    . SER C 1 97  ? 54.222 48.481  32.989  1.00 321.11 ? 97  SER C CA    1 
ATOM 3224 C C     . SER C 1 97  ? 54.698 47.850  31.682  1.00 313.86 ? 97  SER C C     1 
ATOM 3225 O O     . SER C 1 97  ? 55.891 47.833  31.361  1.00 310.21 ? 97  SER C O     1 
ATOM 3226 C CB    . SER C 1 97  ? 53.651 49.873  32.720  1.00 314.19 ? 97  SER C CB    1 
ATOM 3227 O OG    . SER C 1 97  ? 52.571 49.808  31.811  1.00 308.15 ? 97  SER C OG    1 
ATOM 3228 N N     . TYR C 1 98  ? 53.735 47.331  30.921  1.00 304.34 ? 98  TYR C N     1 
ATOM 3229 C CA    . TYR C 1 98  ? 54.033 46.827  29.586  1.00 294.15 ? 98  TYR C CA    1 
ATOM 3230 C C     . TYR C 1 98  ? 54.248 47.976  28.608  1.00 298.85 ? 98  TYR C C     1 
ATOM 3231 O O     . TYR C 1 98  ? 55.092 47.883  27.710  1.00 298.47 ? 98  TYR C O     1 
ATOM 3232 C CB    . TYR C 1 98  ? 52.902 45.910  29.112  1.00 290.47 ? 98  TYR C CB    1 
ATOM 3233 C CG    . TYR C 1 98  ? 53.308 44.844  28.109  1.00 286.84 ? 98  TYR C CG    1 
ATOM 3234 C CD1   . TYR C 1 98  ? 54.270 45.093  27.137  1.00 283.41 ? 98  TYR C CD1   1 
ATOM 3235 C CD2   . TYR C 1 98  ? 52.723 43.585  28.137  1.00 282.86 ? 98  TYR C CD2   1 
ATOM 3236 C CE1   . TYR C 1 98  ? 54.636 44.123  26.224  1.00 278.32 ? 98  TYR C CE1   1 
ATOM 3237 C CE2   . TYR C 1 98  ? 53.083 42.607  27.228  1.00 279.27 ? 98  TYR C CE2   1 
ATOM 3238 C CZ    . TYR C 1 98  ? 54.040 42.882  26.274  1.00 275.54 ? 98  TYR C CZ    1 
ATOM 3239 O OH    . TYR C 1 98  ? 54.401 41.913  25.368  1.00 265.89 ? 98  TYR C OH    1 
ATOM 3240 N N     . ARG C 1 99  ? 53.507 49.073  28.773  1.00 301.91 ? 99  ARG C N     1 
ATOM 3241 C CA    . ARG C 1 99  ? 53.718 50.227  27.908  1.00 310.01 ? 99  ARG C CA    1 
ATOM 3242 C C     . ARG C 1 99  ? 55.066 50.884  28.178  1.00 322.65 ? 99  ARG C C     1 
ATOM 3243 O O     . ARG C 1 99  ? 55.687 51.423  27.255  1.00 325.32 ? 99  ARG C O     1 
ATOM 3244 C CB    . ARG C 1 99  ? 52.584 51.237  28.082  1.00 315.50 ? 99  ARG C CB    1 
ATOM 3245 C CG    . ARG C 1 99  ? 52.556 52.298  26.997  1.00 320.81 ? 99  ARG C CG    1 
ATOM 3246 C CD    . ARG C 1 99  ? 52.645 51.651  25.625  1.00 316.20 ? 99  ARG C CD    1 
ATOM 3247 N NE    . ARG C 1 99  ? 52.880 52.623  24.563  1.00 315.93 ? 99  ARG C NE    1 
ATOM 3248 C CZ    . ARG C 1 99  ? 53.178 52.297  23.310  1.00 304.45 ? 99  ARG C CZ    1 
ATOM 3249 N NH1   . ARG C 1 99  ? 53.281 51.021  22.962  1.00 291.16 ? 99  ARG C NH1   1 
ATOM 3250 N NH2   . ARG C 1 99  ? 53.377 53.245  22.404  1.00 305.49 ? 99  ARG C NH2   1 
ATOM 3251 N N     . ASN C 1 100 ? 55.533 50.845  29.426  1.00 329.37 ? 100 ASN C N     1 
ATOM 3252 C CA    . ASN C 1 100 ? 56.861 51.341  29.760  1.00 334.57 ? 100 ASN C CA    1 
ATOM 3253 C C     . ASN C 1 100 ? 57.964 50.350  29.414  1.00 338.44 ? 100 ASN C C     1 
ATOM 3254 O O     . ASN C 1 100 ? 59.141 50.724  29.456  1.00 345.26 ? 100 ASN C O     1 
ATOM 3255 C CB    . ASN C 1 100 ? 56.934 51.694  31.247  1.00 329.89 ? 100 ASN C CB    1 
ATOM 3256 C CG    . ASN C 1 100 ? 56.124 52.927  31.593  1.00 338.97 ? 100 ASN C CG    1 
ATOM 3257 O OD1   . ASN C 1 100 ? 55.258 52.890  32.467  1.00 346.50 ? 100 ASN C OD1   1 
ATOM 3258 N ND2   . ASN C 1 100 ? 56.401 54.029  30.906  1.00 342.02 ? 100 ASN C ND2   1 
ATOM 3259 N N     . ARG C 1 101 ? 57.613 49.104  29.083  1.00 323.21 ? 101 ARG C N     1 
ATOM 3260 C CA    . ARG C 1 101 ? 58.614 48.135  28.646  1.00 305.06 ? 101 ARG C CA    1 
ATOM 3261 C C     . ARG C 1 101 ? 59.350 48.628  27.407  1.00 301.47 ? 101 ARG C C     1 
ATOM 3262 O O     . ARG C 1 101 ? 60.559 48.411  27.264  1.00 312.05 ? 101 ARG C O     1 
ATOM 3263 C CB    . ARG C 1 101 ? 57.947 46.784  28.381  1.00 300.46 ? 101 ARG C CB    1 
ATOM 3264 C CG    . ARG C 1 101 ? 58.798 45.772  27.626  1.00 303.95 ? 101 ARG C CG    1 
ATOM 3265 C CD    . ARG C 1 101 ? 59.903 45.201  28.495  1.00 303.68 ? 101 ARG C CD    1 
ATOM 3266 N NE    . ARG C 1 101 ? 60.516 44.021  27.889  1.00 293.11 ? 101 ARG C NE    1 
ATOM 3267 C CZ    . ARG C 1 101 ? 61.572 44.055  27.082  1.00 280.57 ? 101 ARG C CZ    1 
ATOM 3268 N NH1   . ARG C 1 101 ? 62.142 45.214  26.779  1.00 290.77 ? 101 ARG C NH1   1 
ATOM 3269 N NH2   . ARG C 1 101 ? 62.058 42.930  26.577  1.00 256.51 ? 101 ARG C NH2   1 
ATOM 3270 N N     . LYS C 1 102 ? 58.637 49.302  26.503  1.00 295.61 ? 102 LYS C N     1 
ATOM 3271 C CA    . LYS C 1 102 ? 59.280 49.901  25.339  1.00 293.08 ? 102 LYS C CA    1 
ATOM 3272 C C     . LYS C 1 102 ? 59.984 51.205  25.688  1.00 319.75 ? 102 LYS C C     1 
ATOM 3273 O O     . LYS C 1 102 ? 61.035 51.509  25.112  1.00 309.65 ? 102 LYS C O     1 
ATOM 3274 C CB    . LYS C 1 102 ? 58.248 50.146  24.236  1.00 272.39 ? 102 LYS C CB    1 
ATOM 3275 C CG    . LYS C 1 102 ? 58.819 50.775  22.975  1.00 245.68 ? 102 LYS C CG    1 
ATOM 3276 C CD    . LYS C 1 102 ? 57.716 51.291  22.066  1.00 246.85 ? 102 LYS C CD    1 
ATOM 3277 C CE    . LYS C 1 102 ? 56.913 52.388  22.746  1.00 277.22 ? 102 LYS C CE    1 
ATOM 3278 N NZ    . LYS C 1 102 ? 57.765 53.550  23.124  1.00 288.68 ? 102 LYS C NZ    1 
ATOM 3279 N N     . LYS C 1 103 ? 59.429 51.976  26.626  1.00 355.24 ? 103 LYS C N     1 
ATOM 3280 C CA    . LYS C 1 103 ? 59.985 53.285  26.955  1.00 364.19 ? 103 LYS C CA    1 
ATOM 3281 C C     . LYS C 1 103 ? 61.402 53.163  27.504  1.00 368.32 ? 103 LYS C C     1 
ATOM 3282 O O     . LYS C 1 103 ? 62.342 53.759  26.969  1.00 377.73 ? 103 LYS C O     1 
ATOM 3283 C CB    . LYS C 1 103 ? 59.073 54.000  27.954  1.00 368.79 ? 103 LYS C CB    1 
ATOM 3284 C CG    . LYS C 1 103 ? 59.582 55.359  28.402  1.00 374.75 ? 103 LYS C CG    1 
ATOM 3285 C CD    . LYS C 1 103 ? 58.587 56.039  29.329  1.00 383.10 ? 103 LYS C CD    1 
ATOM 3286 C CE    . LYS C 1 103 ? 59.132 57.356  29.856  1.00 392.89 ? 103 LYS C CE    1 
ATOM 3287 N NZ    . LYS C 1 103 ? 60.368 57.159  30.662  1.00 393.93 ? 103 LYS C NZ    1 
ATOM 3288 N N     . GLN C 1 104 ? 61.573 52.391  28.581  1.00 362.34 ? 104 GLN C N     1 
ATOM 3289 C CA    . GLN C 1 104 ? 62.901 52.215  29.164  1.00 353.10 ? 104 GLN C CA    1 
ATOM 3290 C C     . GLN C 1 104 ? 63.849 51.529  28.187  1.00 351.70 ? 104 GLN C C     1 
ATOM 3291 O O     . GLN C 1 104 ? 65.050 51.830  28.160  1.00 341.92 ? 104 GLN C O     1 
ATOM 3292 C CB    . GLN C 1 104 ? 62.804 51.438  30.479  1.00 344.35 ? 104 GLN C CB    1 
ATOM 3293 C CG    . GLN C 1 104 ? 62.086 50.104  30.385  1.00 328.58 ? 104 GLN C CG    1 
ATOM 3294 C CD    . GLN C 1 104 ? 61.685 49.568  31.746  1.00 323.67 ? 104 GLN C CD    1 
ATOM 3295 O OE1   . GLN C 1 104 ? 61.789 50.266  32.755  1.00 331.08 ? 104 GLN C OE1   1 
ATOM 3296 N NE2   . GLN C 1 104 ? 61.222 48.325  31.781  1.00 312.23 ? 104 GLN C NE2   1 
ATOM 3297 N N     . SER C 1 105 ? 63.332 50.594  27.386  1.00 358.73 ? 105 SER C N     1 
ATOM 3298 C CA    . SER C 1 105 ? 64.161 49.912  26.397  1.00 352.64 ? 105 SER C CA    1 
ATOM 3299 C C     . SER C 1 105 ? 64.764 50.909  25.415  1.00 341.75 ? 105 SER C C     1 
ATOM 3300 O O     . SER C 1 105 ? 65.989 50.984  25.254  1.00 350.47 ? 105 SER C O     1 
ATOM 3301 C CB    . SER C 1 105 ? 63.332 48.857  25.660  1.00 351.10 ? 105 SER C CB    1 
ATOM 3302 O OG    . SER C 1 105 ? 62.843 47.872  26.554  1.00 348.95 ? 105 SER C OG    1 
ATOM 3303 N N     . ILE C 1 106 ? 63.911 51.695  24.752  1.00 318.11 ? 106 ILE C N     1 
ATOM 3304 C CA    . ILE C 1 106 ? 64.406 52.662  23.778  1.00 289.25 ? 106 ILE C CA    1 
ATOM 3305 C C     . ILE C 1 106 ? 65.213 53.749  24.474  1.00 289.45 ? 106 ILE C C     1 
ATOM 3306 O O     . ILE C 1 106 ? 66.085 54.370  23.857  1.00 288.61 ? 106 ILE C O     1 
ATOM 3307 C CB    . ILE C 1 106 ? 63.253 53.249  22.943  1.00 272.67 ? 106 ILE C CB    1 
ATOM 3308 C CG1   . ILE C 1 106 ? 62.320 54.093  23.812  1.00 284.28 ? 106 ILE C CG1   1 
ATOM 3309 C CG2   . ILE C 1 106 ? 62.490 52.139  22.233  1.00 229.42 ? 106 ILE C CG2   1 
ATOM 3310 C CD1   . ILE C 1 106 ? 61.128 54.651  23.065  1.00 283.72 ? 106 ILE C CD1   1 
ATOM 3311 N N     . ASP C 1 107 ? 64.950 53.999  25.760  1.00 291.61 ? 107 ASP C N     1 
ATOM 3312 C CA    . ASP C 1 107 ? 65.732 54.985  26.498  1.00 299.05 ? 107 ASP C CA    1 
ATOM 3313 C C     . ASP C 1 107 ? 67.173 54.516  26.658  1.00 317.40 ? 107 ASP C C     1 
ATOM 3314 O O     . ASP C 1 107 ? 68.115 55.255  26.350  1.00 312.48 ? 107 ASP C O     1 
ATOM 3315 C CB    . ASP C 1 107 ? 65.088 55.242  27.861  1.00 294.34 ? 107 ASP C CB    1 
ATOM 3316 C CG    . ASP C 1 107 ? 65.740 56.385  28.611  1.00 300.16 ? 107 ASP C CG    1 
ATOM 3317 O OD1   . ASP C 1 107 ? 66.558 57.111  28.007  1.00 297.70 ? 107 ASP C OD1   1 
ATOM 3318 O OD2   . ASP C 1 107 ? 65.433 56.558  29.809  1.00 306.93 ? 107 ASP C OD2   1 
ATOM 3319 N N     . VAL C 1 108 ? 67.362 53.287  27.141  1.00 332.57 ? 108 VAL C N     1 
ATOM 3320 C CA    . VAL C 1 108 ? 68.708 52.731  27.268  1.00 336.39 ? 108 VAL C CA    1 
ATOM 3321 C C     . VAL C 1 108 ? 69.365 52.638  25.894  1.00 327.81 ? 108 VAL C C     1 
ATOM 3322 O O     . VAL C 1 108 ? 70.573 52.885  25.738  1.00 336.00 ? 108 VAL C O     1 
ATOM 3323 C CB    . VAL C 1 108 ? 68.645 51.361  27.969  1.00 338.48 ? 108 VAL C CB    1 
ATOM 3324 C CG1   . VAL C 1 108 ? 69.996 50.674  27.939  1.00 343.74 ? 108 VAL C CG1   1 
ATOM 3325 C CG2   . VAL C 1 108 ? 68.155 51.522  29.401  1.00 346.91 ? 108 VAL C CG2   1 
ATOM 3326 N N     . PHE C 1 109 ? 68.564 52.329  24.871  1.00 287.16 ? 109 PHE C N     1 
ATOM 3327 C CA    . PHE C 1 109 ? 69.062 52.300  23.501  1.00 261.38 ? 109 PHE C CA    1 
ATOM 3328 C C     . PHE C 1 109 ? 69.654 53.651  23.117  1.00 283.44 ? 109 PHE C C     1 
ATOM 3329 O O     . PHE C 1 109 ? 70.875 53.792  22.992  1.00 272.61 ? 109 PHE C O     1 
ATOM 3330 C CB    . PHE C 1 109 ? 67.905 51.908  22.575  1.00 254.56 ? 109 PHE C CB    1 
ATOM 3331 C CG    . PHE C 1 109 ? 68.230 51.949  21.109  1.00 263.43 ? 109 PHE C CG    1 
ATOM 3332 C CD1   . PHE C 1 109 ? 68.767 50.842  20.473  1.00 254.14 ? 109 PHE C CD1   1 
ATOM 3333 C CD2   . PHE C 1 109 ? 67.948 53.078  20.356  1.00 265.76 ? 109 PHE C CD2   1 
ATOM 3334 C CE1   . PHE C 1 109 ? 69.045 50.871  19.118  1.00 235.21 ? 109 PHE C CE1   1 
ATOM 3335 C CE2   . PHE C 1 109 ? 68.225 53.114  19.003  1.00 258.32 ? 109 PHE C CE2   1 
ATOM 3336 C CZ    . PHE C 1 109 ? 68.773 52.009  18.382  1.00 239.99 ? 109 PHE C CZ    1 
ATOM 3337 N N     . ILE C 1 110 ? 68.812 54.688  23.072  1.00 318.68 ? 110 ILE C N     1 
ATOM 3338 C CA    . ILE C 1 110 ? 69.250 56.026  22.692  1.00 326.44 ? 110 ILE C CA    1 
ATOM 3339 C C     . ILE C 1 110 ? 70.342 56.546  23.618  1.00 329.50 ? 110 ILE C C     1 
ATOM 3340 O O     . ILE C 1 110 ? 71.089 57.457  23.246  1.00 342.38 ? 110 ILE C O     1 
ATOM 3341 C CB    . ILE C 1 110 ? 68.041 56.987  22.651  1.00 335.84 ? 110 ILE C CB    1 
ATOM 3342 C CG1   . ILE C 1 110 ? 68.356 58.213  21.792  1.00 346.61 ? 110 ILE C CG1   1 
ATOM 3343 C CG2   . ILE C 1 110 ? 67.637 57.412  24.054  1.00 339.07 ? 110 ILE C CG2   1 
ATOM 3344 C CD1   . ILE C 1 110 ? 67.196 59.174  21.657  1.00 351.53 ? 110 ILE C CD1   1 
ATOM 3345 N N     . GLN C 1 111 ? 70.461 55.979  24.821  1.00 318.22 ? 111 GLN C N     1 
ATOM 3346 C CA    . GLN C 1 111 ? 71.527 56.384  25.729  1.00 300.57 ? 111 GLN C CA    1 
ATOM 3347 C C     . GLN C 1 111 ? 72.875 55.821  25.295  1.00 307.26 ? 111 GLN C C     1 
ATOM 3348 O O     . GLN C 1 111 ? 73.894 56.518  25.367  1.00 296.36 ? 111 GLN C O     1 
ATOM 3349 C CB    . GLN C 1 111 ? 71.188 55.935  27.152  1.00 292.99 ? 111 GLN C CB    1 
ATOM 3350 C CG    . GLN C 1 111 ? 72.267 56.215  28.183  1.00 300.20 ? 111 GLN C CG    1 
ATOM 3351 C CD    . GLN C 1 111 ? 71.905 55.681  29.557  1.00 297.40 ? 111 GLN C CD    1 
ATOM 3352 O OE1   . GLN C 1 111 ? 70.831 55.111  29.750  1.00 294.50 ? 111 GLN C OE1   1 
ATOM 3353 N NE2   . GLN C 1 111 ? 72.803 55.863  30.518  1.00 306.97 ? 111 GLN C NE2   1 
ATOM 3354 N N     . LYS C 1 112 ? 72.907 54.567  24.841  1.00 307.77 ? 112 LYS C N     1 
ATOM 3355 C CA    . LYS C 1 112 ? 74.177 53.901  24.561  1.00 304.52 ? 112 LYS C CA    1 
ATOM 3356 C C     . LYS C 1 112 ? 74.470 53.652  23.082  1.00 306.03 ? 112 LYS C C     1 
ATOM 3357 O O     . LYS C 1 112 ? 75.487 53.020  22.775  1.00 303.21 ? 112 LYS C O     1 
ATOM 3358 C CB    . LYS C 1 112 ? 74.267 52.577  25.333  1.00 295.71 ? 112 LYS C CB    1 
ATOM 3359 C CG    . LYS C 1 112 ? 74.624 52.762  26.803  1.00 289.87 ? 112 LYS C CG    1 
ATOM 3360 C CD    . LYS C 1 112 ? 74.841 51.433  27.509  1.00 283.79 ? 112 LYS C CD    1 
ATOM 3361 C CE    . LYS C 1 112 ? 73.541 50.858  28.032  1.00 278.21 ? 112 LYS C CE    1 
ATOM 3362 N NZ    . LYS C 1 112 ? 72.943 51.725  29.086  1.00 279.27 ? 112 LYS C NZ    1 
ATOM 3363 N N     . ILE C 1 113 ? 73.626 54.116  22.157  1.00 224.90 ? 113 ILE C N     1 
ATOM 3364 C CA    . ILE C 1 113 ? 73.870 53.814  20.747  1.00 227.71 ? 113 ILE C CA    1 
ATOM 3365 C C     . ILE C 1 113 ? 75.079 54.575  20.211  1.00 232.81 ? 113 ILE C C     1 
ATOM 3366 O O     . ILE C 1 113 ? 75.839 54.049  19.388  1.00 226.05 ? 113 ILE C O     1 
ATOM 3367 C CB    . ILE C 1 113 ? 72.620 54.134  19.908  1.00 248.75 ? 113 ILE C CB    1 
ATOM 3368 C CG1   . ILE C 1 113 ? 72.057 55.509  20.288  1.00 274.25 ? 113 ILE C CG1   1 
ATOM 3369 C CG2   . ILE C 1 113 ? 71.584 53.049  20.072  1.00 240.32 ? 113 ILE C CG2   1 
ATOM 3370 C CD1   . ILE C 1 113 ? 70.808 55.893  19.527  1.00 294.43 ? 113 ILE C CD1   1 
ATOM 3371 N N     . SER C 1 114 ? 75.278 55.817  20.656  1.00 244.33 ? 114 SER C N     1 
ATOM 3372 C CA    . SER C 1 114 ? 76.265 56.683  20.015  1.00 245.79 ? 114 SER C CA    1 
ATOM 3373 C C     . SER C 1 114 ? 77.697 56.196  20.216  1.00 222.59 ? 114 SER C C     1 
ATOM 3374 O O     . SER C 1 114 ? 78.540 56.373  19.330  1.00 210.11 ? 114 SER C O     1 
ATOM 3375 C CB    . SER C 1 114 ? 76.116 58.113  20.532  1.00 268.36 ? 114 SER C CB    1 
ATOM 3376 O OG    . SER C 1 114 ? 74.770 58.547  20.436  1.00 273.60 ? 114 SER C OG    1 
ATOM 3377 N N     . GLU C 1 115 ? 77.985 55.580  21.358  1.00 225.11 ? 115 GLU C N     1 
ATOM 3378 C CA    . GLU C 1 115 ? 79.339 55.217  21.763  1.00 235.22 ? 115 GLU C CA    1 
ATOM 3379 C C     . GLU C 1 115 ? 79.873 53.947  21.103  1.00 230.56 ? 115 GLU C C     1 
ATOM 3380 O O     . GLU C 1 115 ? 80.965 53.503  21.473  1.00 236.20 ? 115 GLU C O     1 
ATOM 3381 C CB    . GLU C 1 115 ? 79.396 55.065  23.285  1.00 245.65 ? 115 GLU C CB    1 
ATOM 3382 C CG    . GLU C 1 115 ? 78.356 54.111  23.847  1.00 253.51 ? 115 GLU C CG    1 
ATOM 3383 C CD    . GLU C 1 115 ? 78.410 54.011  25.358  1.00 256.29 ? 115 GLU C CD    1 
ATOM 3384 O OE1   . GLU C 1 115 ? 79.106 54.836  25.986  1.00 261.58 ? 115 GLU C OE1   1 
ATOM 3385 O OE2   . GLU C 1 115 ? 77.756 53.106  25.918  1.00 243.57 ? 115 GLU C OE2   1 
ATOM 3386 N N     . TYR C 1 116 ? 79.161 53.351  20.144  1.00 222.30 ? 116 TYR C N     1 
ATOM 3387 C CA    . TYR C 1 116 ? 79.522 52.027  19.651  1.00 225.53 ? 116 TYR C CA    1 
ATOM 3388 C C     . TYR C 1 116 ? 79.840 51.932  18.165  1.00 230.76 ? 116 TYR C C     1 
ATOM 3389 O O     . TYR C 1 116 ? 80.566 51.009  17.781  1.00 252.58 ? 116 TYR C O     1 
ATOM 3390 C CB    . TYR C 1 116 ? 78.420 51.005  19.979  1.00 232.13 ? 116 TYR C CB    1 
ATOM 3391 C CG    . TYR C 1 116 ? 78.257 50.728  21.458  1.00 224.10 ? 116 TYR C CG    1 
ATOM 3392 C CD1   . TYR C 1 116 ? 79.312 50.926  22.341  1.00 225.64 ? 116 TYR C CD1   1 
ATOM 3393 C CD2   . TYR C 1 116 ? 77.060 50.245  21.968  1.00 224.53 ? 116 TYR C CD2   1 
ATOM 3394 C CE1   . TYR C 1 116 ? 79.175 50.666  23.691  1.00 225.33 ? 116 TYR C CE1   1 
ATOM 3395 C CE2   . TYR C 1 116 ? 76.914 49.982  23.318  1.00 220.62 ? 116 TYR C CE2   1 
ATOM 3396 C CZ    . TYR C 1 116 ? 77.974 50.195  24.174  1.00 224.26 ? 116 TYR C CZ    1 
ATOM 3397 O OH    . TYR C 1 116 ? 77.833 49.934  25.518  1.00 227.71 ? 116 TYR C OH    1 
ATOM 3398 N N     . THR C 1 117 ? 79.338 52.828  17.317  1.00 228.37 ? 117 THR C N     1 
ATOM 3399 C CA    . THR C 1 117 ? 79.491 52.622  15.879  1.00 243.81 ? 117 THR C CA    1 
ATOM 3400 C C     . THR C 1 117 ? 80.452 53.592  15.211  1.00 254.24 ? 117 THR C C     1 
ATOM 3401 O O     . THR C 1 117 ? 81.195 53.185  14.314  1.00 259.42 ? 117 THR C O     1 
ATOM 3402 C CB    . THR C 1 117 ? 78.127 52.736  15.188  1.00 257.44 ? 117 THR C CB    1 
ATOM 3403 O OG1   . THR C 1 117 ? 77.796 54.119  15.007  1.00 256.50 ? 117 THR C OG1   1 
ATOM 3404 C CG2   . THR C 1 117 ? 77.050 52.082  16.032  1.00 260.87 ? 117 THR C CG2   1 
ATOM 3405 N N     . ASP C 1 118 ? 80.442 54.867  15.605  1.00 251.84 ? 118 ASP C N     1 
ATOM 3406 C CA    . ASP C 1 118 ? 81.274 55.911  15.009  1.00 270.44 ? 118 ASP C CA    1 
ATOM 3407 C C     . ASP C 1 118 ? 80.988 56.121  13.523  1.00 281.23 ? 118 ASP C C     1 
ATOM 3408 O O     . ASP C 1 118 ? 81.656 56.924  12.865  1.00 285.31 ? 118 ASP C O     1 
ATOM 3409 C CB    . ASP C 1 118 ? 82.758 55.598  15.224  1.00 287.50 ? 118 ASP C CB    1 
ATOM 3410 C CG    . ASP C 1 118 ? 83.096 55.364  16.684  1.00 293.78 ? 118 ASP C CG    1 
ATOM 3411 O OD1   . ASP C 1 118 ? 82.350 55.862  17.554  1.00 301.44 ? 118 ASP C OD1   1 
ATOM 3412 O OD2   . ASP C 1 118 ? 84.104 54.681  16.961  1.00 287.23 ? 118 ASP C OD2   1 
ATOM 3413 N N     . TYR C 1 119 ? 80.002 55.405  12.990  1.00 293.40 ? 119 TYR C N     1 
ATOM 3414 C CA    . TYR C 1 119 ? 79.492 55.571  11.633  1.00 299.13 ? 119 TYR C CA    1 
ATOM 3415 C C     . TYR C 1 119 ? 77.981 55.711  11.667  1.00 299.26 ? 119 TYR C C     1 
ATOM 3416 O O     . TYR C 1 119 ? 77.256 55.104  10.872  1.00 295.93 ? 119 TYR C O     1 
ATOM 3417 C CB    . TYR C 1 119 ? 79.920 54.424  10.719  1.00 286.45 ? 119 TYR C CB    1 
ATOM 3418 C CG    . TYR C 1 119 ? 81.415 54.319  10.501  1.00 281.70 ? 119 TYR C CG    1 
ATOM 3419 C CD1   . TYR C 1 119 ? 82.098 55.310  9.807   1.00 286.10 ? 119 TYR C CD1   1 
ATOM 3420 C CD2   . TYR C 1 119 ? 82.138 53.230  10.968  1.00 272.00 ? 119 TYR C CD2   1 
ATOM 3421 C CE1   . TYR C 1 119 ? 83.460 55.227  9.593   1.00 289.41 ? 119 TYR C CE1   1 
ATOM 3422 C CE2   . TYR C 1 119 ? 83.506 53.138  10.759  1.00 270.78 ? 119 TYR C CE2   1 
ATOM 3423 C CZ    . TYR C 1 119 ? 84.160 54.140  10.070  1.00 286.42 ? 119 TYR C CZ    1 
ATOM 3424 O OH    . TYR C 1 119 ? 85.517 54.058  9.857   1.00 286.26 ? 119 TYR C OH    1 
ATOM 3425 N N     . LYS C 1 120 ? 77.491 56.520  12.600  1.00 305.62 ? 120 LYS C N     1 
ATOM 3426 C CA    . LYS C 1 120 ? 76.068 56.683  12.854  1.00 297.49 ? 120 LYS C CA    1 
ATOM 3427 C C     . LYS C 1 120 ? 75.390 57.624  11.864  1.00 306.60 ? 120 LYS C C     1 
ATOM 3428 O O     . LYS C 1 120 ? 74.258 58.041  12.111  1.00 294.21 ? 120 LYS C O     1 
ATOM 3429 C CB    . LYS C 1 120 ? 75.859 57.186  14.286  1.00 283.99 ? 120 LYS C CB    1 
ATOM 3430 C CG    . LYS C 1 120 ? 74.548 56.768  14.931  1.00 275.37 ? 120 LYS C CG    1 
ATOM 3431 C CD    . LYS C 1 120 ? 74.459 57.290  16.356  1.00 253.35 ? 120 LYS C CD    1 
ATOM 3432 C CE    . LYS C 1 120 ? 73.106 56.992  16.971  1.00 215.24 ? 120 LYS C CE    1 
ATOM 3433 N NZ    . LYS C 1 120 ? 71.997 57.611  16.193  1.00 224.55 ? 120 LYS C NZ    1 
ATOM 3434 N N     . ASN C 1 121 ? 76.040 57.958  10.748  1.00 326.05 ? 121 ASN C N     1 
ATOM 3435 C CA    . ASN C 1 121 ? 75.416 58.831  9.758   1.00 347.17 ? 121 ASN C CA    1 
ATOM 3436 C C     . ASN C 1 121 ? 74.305 58.103  9.010   1.00 383.41 ? 121 ASN C C     1 
ATOM 3437 O O     . ASN C 1 121 ? 73.132 58.501  9.061   1.00 380.44 ? 121 ASN C O     1 
ATOM 3438 C CB    . ASN C 1 121 ? 76.478 59.348  8.785   1.00 337.19 ? 121 ASN C CB    1 
ATOM 3439 C CG    . ASN C 1 121 ? 75.881 60.091  7.607   1.00 345.34 ? 121 ASN C CG    1 
ATOM 3440 O OD1   . ASN C 1 121 ? 74.858 60.764  7.733   1.00 352.89 ? 121 ASN C OD1   1 
ATOM 3441 N ND2   . ASN C 1 121 ? 76.518 59.968  6.448   1.00 346.75 ? 121 ASN C ND2   1 
ATOM 3442 N N     . ASP C 1 122 ? 74.665 57.031  8.298   1.00 420.63 ? 122 ASP C N     1 
ATOM 3443 C CA    . ASP C 1 122 ? 73.672 56.233  7.588   1.00 442.59 ? 122 ASP C CA    1 
ATOM 3444 C C     . ASP C 1 122 ? 72.668 55.610  8.546   1.00 441.60 ? 122 ASP C C     1 
ATOM 3445 O O     . ASP C 1 122 ? 71.509 55.397  8.178   1.00 456.93 ? 122 ASP C O     1 
ATOM 3446 C CB    . ASP C 1 122 ? 74.359 55.146  6.759   1.00 449.64 ? 122 ASP C CB    1 
ATOM 3447 C CG    . ASP C 1 122 ? 75.327 55.714  5.740   1.00 459.63 ? 122 ASP C CG    1 
ATOM 3448 O OD1   . ASP C 1 122 ? 75.175 56.896  5.367   1.00 466.65 ? 122 ASP C OD1   1 
ATOM 3449 O OD2   . ASP C 1 122 ? 76.237 54.976  5.307   1.00 458.60 ? 122 ASP C OD2   1 
ATOM 3450 N N     . ILE C 1 123 ? 73.079 55.347  9.787   1.00 417.82 ? 123 ILE C N     1 
ATOM 3451 C CA    . ILE C 1 123 ? 72.171 54.728  10.745  1.00 395.27 ? 123 ILE C CA    1 
ATOM 3452 C C     . ILE C 1 123 ? 71.209 55.759  11.321  1.00 392.98 ? 123 ILE C C     1 
ATOM 3453 O O     . ILE C 1 123 ? 70.039 55.454  11.578  1.00 387.62 ? 123 ILE C O     1 
ATOM 3454 C CB    . ILE C 1 123 ? 72.983 54.023  11.845  1.00 375.69 ? 123 ILE C CB    1 
ATOM 3455 C CG1   . ILE C 1 123 ? 73.984 53.049  11.219  1.00 374.15 ? 123 ILE C CG1   1 
ATOM 3456 C CG2   . ILE C 1 123 ? 72.062 53.291  12.807  1.00 361.12 ? 123 ILE C CG2   1 
ATOM 3457 C CD1   . ILE C 1 123 ? 74.935 52.423  12.213  1.00 360.81 ? 123 ILE C CD1   1 
ATOM 3458 N N     . LEU C 1 124 ? 71.673 56.993  11.532  1.00 397.00 ? 124 LEU C N     1 
ATOM 3459 C CA    . LEU C 1 124 ? 70.779 58.032  12.026  1.00 406.18 ? 124 LEU C CA    1 
ATOM 3460 C C     . LEU C 1 124 ? 69.788 58.440  10.944  1.00 445.82 ? 124 LEU C C     1 
ATOM 3461 O O     . LEU C 1 124 ? 68.619 58.717  11.236  1.00 446.51 ? 124 LEU C O     1 
ATOM 3462 C CB    . LEU C 1 124 ? 71.597 59.234  12.507  1.00 392.69 ? 124 LEU C CB    1 
ATOM 3463 C CG    . LEU C 1 124 ? 70.956 60.318  13.380  1.00 389.05 ? 124 LEU C CG    1 
ATOM 3464 C CD1   . LEU C 1 124 ? 72.030 61.030  14.186  1.00 384.74 ? 124 LEU C CD1   1 
ATOM 3465 C CD2   . LEU C 1 124 ? 70.173 61.326  12.550  1.00 396.68 ? 124 LEU C CD2   1 
ATOM 3466 N N     . ASN C 1 125 ? 70.239 58.482  9.689   1.00 448.15 ? 125 ASN C N     1 
ATOM 3467 C CA    . ASN C 1 125 ? 69.358 58.816  8.578   1.00 469.60 ? 125 ASN C CA    1 
ATOM 3468 C C     . ASN C 1 125 ? 68.555 57.618  8.087   1.00 466.96 ? 125 ASN C C     1 
ATOM 3469 O O     . ASN C 1 125 ? 67.667 57.789  7.244   1.00 490.20 ? 125 ASN C O     1 
ATOM 3470 C CB    . ASN C 1 125 ? 70.165 59.408  7.420   1.00 490.09 ? 125 ASN C CB    1 
ATOM 3471 C CG    . ASN C 1 125 ? 70.946 60.641  7.827   1.00 497.53 ? 125 ASN C CG    1 
ATOM 3472 O OD1   . ASN C 1 125 ? 70.485 61.441  8.641   1.00 499.65 ? 125 ASN C OD1   1 
ATOM 3473 N ND2   . ASN C 1 125 ? 72.136 60.802  7.261   1.00 499.62 ? 125 ASN C ND2   1 
ATOM 3474 N N     . LYS C 1 126 ? 68.843 56.421  8.599   1.00 399.68 ? 126 LYS C N     1 
ATOM 3475 C CA    . LYS C 1 126 ? 68.335 55.195  7.994   1.00 340.02 ? 126 LYS C CA    1 
ATOM 3476 C C     . LYS C 1 126 ? 66.854 54.992  8.290   1.00 336.61 ? 126 LYS C C     1 
ATOM 3477 O O     . LYS C 1 126 ? 66.029 54.927  7.371   1.00 330.77 ? 126 LYS C O     1 
ATOM 3478 C CB    . LYS C 1 126 ? 69.152 54.002  8.495   1.00 305.61 ? 126 LYS C CB    1 
ATOM 3479 C CG    . LYS C 1 126 ? 69.047 52.748  7.644   1.00 290.77 ? 126 LYS C CG    1 
ATOM 3480 C CD    . LYS C 1 126 ? 70.293 52.559  6.794   1.00 289.32 ? 126 LYS C CD    1 
ATOM 3481 C CE    . LYS C 1 126 ? 70.445 51.114  6.347   1.00 286.27 ? 126 LYS C CE    1 
ATOM 3482 N NZ    . LYS C 1 126 ? 71.723 50.890  5.616   1.00 278.90 ? 126 LYS C NZ    1 
ATOM 3483 N N     . TYR C 1 127 ? 66.495 54.887  9.567   1.00 328.89 ? 127 TYR C N     1 
ATOM 3484 C CA    . TYR C 1 127 ? 65.180 54.398  9.950   1.00 319.58 ? 127 TYR C CA    1 
ATOM 3485 C C     . TYR C 1 127 ? 64.553 55.305  10.998  1.00 304.92 ? 127 TYR C C     1 
ATOM 3486 O O     . TYR C 1 127 ? 65.243 55.869  11.852  1.00 302.26 ? 127 TYR C O     1 
ATOM 3487 C CB    . TYR C 1 127 ? 65.265 52.973  10.510  1.00 310.50 ? 127 TYR C CB    1 
ATOM 3488 C CG    . TYR C 1 127 ? 65.456 51.908  9.457   1.00 318.03 ? 127 TYR C CG    1 
ATOM 3489 C CD1   . TYR C 1 127 ? 64.521 51.716  8.450   1.00 321.93 ? 127 TYR C CD1   1 
ATOM 3490 C CD2   . TYR C 1 127 ? 66.578 51.090  9.474   1.00 314.93 ? 127 TYR C CD2   1 
ATOM 3491 C CE1   . TYR C 1 127 ? 64.702 50.739  7.486   1.00 330.70 ? 127 TYR C CE1   1 
ATOM 3492 C CE2   . TYR C 1 127 ? 66.767 50.114  8.518   1.00 315.87 ? 127 TYR C CE2   1 
ATOM 3493 C CZ    . TYR C 1 127 ? 65.827 49.942  7.527   1.00 329.99 ? 127 TYR C CZ    1 
ATOM 3494 O OH    . TYR C 1 127 ? 66.013 48.969  6.573   1.00 335.11 ? 127 TYR C OH    1 
ATOM 3495 N N     . THR C 1 128 ? 63.231 55.432  10.924  1.00 299.01 ? 128 THR C N     1 
ATOM 3496 C CA    . THR C 1 128 ? 62.459 56.219  11.874  1.00 290.76 ? 128 THR C CA    1 
ATOM 3497 C C     . THR C 1 128 ? 61.768 55.333  12.906  1.00 272.81 ? 128 THR C C     1 
ATOM 3498 O O     . THR C 1 128 ? 61.127 55.848  13.827  1.00 263.13 ? 128 THR C O     1 
ATOM 3499 C CB    . THR C 1 128 ? 61.428 57.083  11.129  1.00 293.05 ? 128 THR C CB    1 
ATOM 3500 O OG1   . THR C 1 128 ? 62.039 57.654  9.965   1.00 289.88 ? 128 THR C OG1   1 
ATOM 3501 C CG2   . THR C 1 128 ? 60.930 58.227  12.008  1.00 292.47 ? 128 THR C CG2   1 
ATOM 3502 N N     . LYS C 1 129 ? 61.898 54.014  12.782  1.00 263.69 ? 129 LYS C N     1 
ATOM 3503 C CA    . LYS C 1 129 ? 61.282 53.065  13.696  1.00 243.75 ? 129 LYS C CA    1 
ATOM 3504 C C     . LYS C 1 129 ? 62.349 52.307  14.476  1.00 251.50 ? 129 LYS C C     1 
ATOM 3505 O O     . LYS C 1 129 ? 63.461 52.082  13.989  1.00 243.19 ? 129 LYS C O     1 
ATOM 3506 C CB    . LYS C 1 129 ? 60.381 52.080  12.948  1.00 228.32 ? 129 LYS C CB    1 
ATOM 3507 C CG    . LYS C 1 129 ? 58.919 52.492  12.938  1.00 251.22 ? 129 LYS C CG    1 
ATOM 3508 C CD    . LYS C 1 129 ? 58.731 53.840  12.264  1.00 250.57 ? 129 LYS C CD    1 
ATOM 3509 C CE    . LYS C 1 129 ? 57.690 54.675  12.985  1.00 248.49 ? 129 LYS C CE    1 
ATOM 3510 N NZ    . LYS C 1 129 ? 57.666 56.074  12.482  1.00 258.29 ? 129 LYS C NZ    1 
ATOM 3511 N N     . LEU C 1 130 ? 61.992 51.916  15.700  1.00 281.00 ? 130 LEU C N     1 
ATOM 3512 C CA    . LEU C 1 130 ? 62.943 51.347  16.646  1.00 282.17 ? 130 LEU C CA    1 
ATOM 3513 C C     . LEU C 1 130 ? 62.458 50.107  17.382  1.00 279.15 ? 130 LEU C C     1 
ATOM 3514 O O     . LEU C 1 130 ? 63.303 49.334  17.845  1.00 285.87 ? 130 LEU C O     1 
ATOM 3515 C CB    . LEU C 1 130 ? 63.361 52.391  17.696  1.00 287.89 ? 130 LEU C CB    1 
ATOM 3516 C CG    . LEU C 1 130 ? 63.991 53.721  17.267  1.00 288.12 ? 130 LEU C CG    1 
ATOM 3517 C CD1   . LEU C 1 130 ? 62.946 54.749  16.859  1.00 308.09 ? 130 LEU C CD1   1 
ATOM 3518 C CD2   . LEU C 1 130 ? 64.870 54.263  18.386  1.00 264.74 ? 130 LEU C CD2   1 
ATOM 3519 N N     . ASP C 1 131 ? 61.148 49.861  17.480  1.00 279.11 ? 131 ASP C N     1 
ATOM 3520 C CA    . ASP C 1 131 ? 60.700 48.919  18.511  1.00 280.24 ? 131 ASP C CA    1 
ATOM 3521 C C     . ASP C 1 131 ? 61.010 47.449  18.207  1.00 280.53 ? 131 ASP C C     1 
ATOM 3522 O O     . ASP C 1 131 ? 60.430 46.585  18.878  1.00 277.20 ? 131 ASP C O     1 
ATOM 3523 C CB    . ASP C 1 131 ? 59.194 49.083  18.724  1.00 295.71 ? 131 ASP C CB    1 
ATOM 3524 C CG    . ASP C 1 131 ? 58.755 50.533  18.692  1.00 307.61 ? 131 ASP C CG    1 
ATOM 3525 O OD1   . ASP C 1 131 ? 59.630 51.424  18.684  1.00 312.13 ? 131 ASP C OD1   1 
ATOM 3526 O OD2   . ASP C 1 131 ? 57.532 50.783  18.664  1.00 306.18 ? 131 ASP C OD2   1 
ATOM 3527 N N     . ASP C 1 132 ? 61.871 47.124  17.246  1.00 284.83 ? 132 ASP C N     1 
ATOM 3528 C CA    . ASP C 1 132 ? 62.405 45.777  17.087  1.00 274.75 ? 132 ASP C CA    1 
ATOM 3529 C C     . ASP C 1 132 ? 63.916 45.746  17.253  1.00 250.67 ? 132 ASP C C     1 
ATOM 3530 O O     . ASP C 1 132 ? 64.446 44.969  18.068  1.00 247.77 ? 132 ASP C O     1 
ATOM 3531 C CB    . ASP C 1 132 ? 61.998 45.204  15.719  1.00 290.76 ? 132 ASP C CB    1 
ATOM 3532 C CG    . ASP C 1 132 ? 62.135 46.215  14.598  1.00 305.09 ? 132 ASP C CG    1 
ATOM 3533 O OD1   . ASP C 1 132 ? 62.605 47.342  14.863  1.00 307.04 ? 132 ASP C OD1   1 
ATOM 3534 O OD2   . ASP C 1 132 ? 61.766 45.885  13.452  1.00 315.36 ? 132 ASP C OD2   1 
ATOM 3535 N N     . ILE C 1 133 ? 64.624 46.599  16.509  1.00 239.96 ? 133 ILE C N     1 
ATOM 3536 C CA    . ILE C 1 133 ? 66.072 46.708  16.643  1.00 226.17 ? 133 ILE C CA    1 
ATOM 3537 C C     . ILE C 1 133 ? 66.452 47.193  18.033  1.00 235.24 ? 133 ILE C C     1 
ATOM 3538 O O     . ILE C 1 133 ? 67.501 46.810  18.560  1.00 231.17 ? 133 ILE C O     1 
ATOM 3539 C CB    . ILE C 1 133 ? 66.648 47.619  15.540  1.00 198.43 ? 133 ILE C CB    1 
ATOM 3540 C CG1   . ILE C 1 133 ? 66.099 49.041  15.659  1.00 205.00 ? 133 ILE C CG1   1 
ATOM 3541 C CG2   . ILE C 1 133 ? 66.331 47.048  14.167  1.00 209.77 ? 133 ILE C CG2   1 
ATOM 3542 C CD1   . ILE C 1 133 ? 66.622 49.985  14.598  1.00 202.08 ? 133 ILE C CD1   1 
ATOM 3543 N N     . ALA C 1 134 ? 65.622 48.040  18.649  1.00 237.80 ? 134 ALA C N     1 
ATOM 3544 C CA    . ALA C 1 134 ? 65.881 48.455  20.025  1.00 220.26 ? 134 ALA C CA    1 
ATOM 3545 C C     . ALA C 1 134 ? 65.877 47.254  20.961  1.00 240.57 ? 134 ALA C C     1 
ATOM 3546 O O     . ALA C 1 134 ? 66.765 47.111  21.808  1.00 241.15 ? 134 ALA C O     1 
ATOM 3547 C CB    . ALA C 1 134 ? 64.853 49.493  20.476  1.00 239.01 ? 134 ALA C CB    1 
ATOM 3548 N N     . ASN C 1 135 ? 64.869 46.387  20.832  1.00 251.54 ? 135 ASN C N     1 
ATOM 3549 C CA    . ASN C 1 135 ? 64.797 45.196  21.674  1.00 248.49 ? 135 ASN C CA    1 
ATOM 3550 C C     . ASN C 1 135 ? 66.004 44.294  21.450  1.00 215.18 ? 135 ASN C C     1 
ATOM 3551 O O     . ASN C 1 135 ? 66.606 43.795  22.412  1.00 214.90 ? 135 ASN C O     1 
ATOM 3552 C CB    . ASN C 1 135 ? 63.499 44.438  21.398  1.00 236.98 ? 135 ASN C CB    1 
ATOM 3553 C CG    . ASN C 1 135 ? 63.207 43.379  22.443  1.00 244.52 ? 135 ASN C CG    1 
ATOM 3554 O OD1   . ASN C 1 135 ? 63.755 43.409  23.545  1.00 250.81 ? 135 ASN C OD1   1 
ATOM 3555 N ND2   . ASN C 1 135 ? 62.335 42.437  22.103  1.00 252.72 ? 135 ASN C ND2   1 
ATOM 3556 N N     . SER C 1 136 ? 66.379 44.079  20.185  1.00 207.58 ? 136 SER C N     1 
ATOM 3557 C CA    . SER C 1 136 ? 67.526 43.218  19.904  1.00 215.90 ? 136 SER C CA    1 
ATOM 3558 C C     . SER C 1 136 ? 68.813 43.810  20.473  1.00 197.34 ? 136 SER C C     1 
ATOM 3559 O O     . SER C 1 136 ? 69.621 43.095  21.081  1.00 200.88 ? 136 SER C O     1 
ATOM 3560 C CB    . SER C 1 136 ? 67.657 42.986  18.398  1.00 192.52 ? 136 SER C CB    1 
ATOM 3561 O OG    . SER C 1 136 ? 67.962 44.189  17.716  1.00 190.99 ? 136 SER C OG    1 
ATOM 3562 N N     . PHE C 1 137 ? 69.021 45.115  20.277  1.00 196.65 ? 137 PHE C N     1 
ATOM 3563 C CA    . PHE C 1 137 ? 70.206 45.787  20.799  1.00 198.66 ? 137 PHE C CA    1 
ATOM 3564 C C     . PHE C 1 137 ? 70.254 45.731  22.320  1.00 214.82 ? 137 PHE C C     1 
ATOM 3565 O O     . PHE C 1 137 ? 71.326 45.545  22.906  1.00 198.45 ? 137 PHE C O     1 
ATOM 3566 C CB    . PHE C 1 137 ? 70.229 47.236  20.311  1.00 208.64 ? 137 PHE C CB    1 
ATOM 3567 C CG    . PHE C 1 137 ? 71.402 48.031  20.808  1.00 208.15 ? 137 PHE C CG    1 
ATOM 3568 C CD1   . PHE C 1 137 ? 72.627 47.961  20.167  1.00 208.86 ? 137 PHE C CD1   1 
ATOM 3569 C CD2   . PHE C 1 137 ? 71.275 48.864  21.906  1.00 209.03 ? 137 PHE C CD2   1 
ATOM 3570 C CE1   . PHE C 1 137 ? 73.707 48.698  20.620  1.00 197.73 ? 137 PHE C CE1   1 
ATOM 3571 C CE2   . PHE C 1 137 ? 72.348 49.603  22.362  1.00 216.49 ? 137 PHE C CE2   1 
ATOM 3572 C CZ    . PHE C 1 137 ? 73.566 49.519  21.718  1.00 199.49 ? 137 PHE C CZ    1 
ATOM 3573 N N     . ASN C 1 138 ? 69.107 45.911  22.981  1.00 227.71 ? 138 ASN C N     1 
ATOM 3574 C CA    . ASN C 1 138 ? 69.085 45.866  24.439  1.00 224.02 ? 138 ASN C CA    1 
ATOM 3575 C C     . ASN C 1 138 ? 69.399 44.466  24.948  1.00 228.21 ? 138 ASN C C     1 
ATOM 3576 O O     . ASN C 1 138 ? 70.133 44.310  25.930  1.00 240.80 ? 138 ASN C O     1 
ATOM 3577 C CB    . ASN C 1 138 ? 67.727 46.336  24.956  1.00 228.00 ? 138 ASN C CB    1 
ATOM 3578 C CG    . ASN C 1 138 ? 67.477 47.803  24.680  1.00 232.59 ? 138 ASN C CG    1 
ATOM 3579 O OD1   . ASN C 1 138 ? 68.402 48.614  24.685  1.00 235.64 ? 138 ASN C OD1   1 
ATOM 3580 N ND2   . ASN C 1 138 ? 66.224 48.149  24.418  1.00 238.78 ? 138 ASN C ND2   1 
ATOM 3581 N N     . LEU C 1 139 ? 68.871 43.437  24.279  1.00 224.70 ? 139 LEU C N     1 
ATOM 3582 C CA    . LEU C 1 139 ? 69.208 42.063  24.647  1.00 207.25 ? 139 LEU C CA    1 
ATOM 3583 C C     . LEU C 1 139 ? 70.705 41.814  24.497  1.00 198.34 ? 139 LEU C C     1 
ATOM 3584 O O     . LEU C 1 139 ? 71.359 41.272  25.403  1.00 198.15 ? 139 LEU C O     1 
ATOM 3585 C CB    . LEU C 1 139 ? 68.405 41.085  23.788  1.00 205.63 ? 139 LEU C CB    1 
ATOM 3586 C CG    . LEU C 1 139 ? 68.417 39.613  24.201  1.00 204.95 ? 139 LEU C CG    1 
ATOM 3587 C CD1   . LEU C 1 139 ? 67.782 39.432  25.571  1.00 239.93 ? 139 LEU C CD1   1 
ATOM 3588 C CD2   . LEU C 1 139 ? 67.709 38.761  23.159  1.00 203.54 ? 139 LEU C CD2   1 
ATOM 3589 N N     . GLY C 1 140 ? 71.264 42.211  23.351  1.00 198.08 ? 140 GLY C N     1 
ATOM 3590 C CA    . GLY C 1 140 ? 72.688 42.024  23.127  1.00 183.61 ? 140 GLY C CA    1 
ATOM 3591 C C     . GLY C 1 140 ? 73.535 42.742  24.158  1.00 204.09 ? 140 GLY C C     1 
ATOM 3592 O O     . GLY C 1 140 ? 74.472 42.168  24.713  1.00 197.54 ? 140 GLY C O     1 
ATOM 3593 N N     . LEU C 1 141 ? 73.211 44.009  24.434  1.00 213.71 ? 141 LEU C N     1 
ATOM 3594 C CA    . LEU C 1 141 ? 73.980 44.782  25.404  1.00 210.17 ? 141 LEU C CA    1 
ATOM 3595 C C     . LEU C 1 141 ? 73.848 44.217  26.811  1.00 210.90 ? 141 LEU C C     1 
ATOM 3596 O O     . LEU C 1 141 ? 74.807 44.270  27.590  1.00 210.57 ? 141 LEU C O     1 
ATOM 3597 C CB    . LEU C 1 141 ? 73.544 46.246  25.384  1.00 223.40 ? 141 LEU C CB    1 
ATOM 3598 C CG    . LEU C 1 141 ? 74.516 47.225  24.725  1.00 232.28 ? 141 LEU C CG    1 
ATOM 3599 C CD1   . LEU C 1 141 ? 74.194 48.644  25.156  1.00 245.63 ? 141 LEU C CD1   1 
ATOM 3600 C CD2   . LEU C 1 141 ? 75.958 46.871  25.059  1.00 220.83 ? 141 LEU C CD2   1 
ATOM 3601 N N     . SER C 1 142 ? 72.678 43.677  27.162  1.00 229.69 ? 142 SER C N     1 
ATOM 3602 C CA    . SER C 1 142 ? 72.539 43.048  28.468  1.00 238.37 ? 142 SER C CA    1 
ATOM 3603 C C     . SER C 1 142 ? 73.436 41.823  28.563  1.00 226.38 ? 142 SER C C     1 
ATOM 3604 O O     . SER C 1 142 ? 74.089 41.598  29.591  1.00 247.14 ? 142 SER C O     1 
ATOM 3605 C CB    . SER C 1 142 ? 71.080 42.673  28.721  1.00 250.72 ? 142 SER C CB    1 
ATOM 3606 O OG    . SER C 1 142 ? 70.932 42.008  29.963  1.00 253.69 ? 142 SER C OG    1 
ATOM 3607 N N     . TYR C 1 143 ? 73.501 41.030  27.490  1.00 219.52 ? 143 TYR C N     1 
ATOM 3608 C CA    . TYR C 1 143 ? 74.444 39.915  27.492  1.00 225.60 ? 143 TYR C CA    1 
ATOM 3609 C C     . TYR C 1 143 ? 75.881 40.417  27.598  1.00 232.04 ? 143 TYR C C     1 
ATOM 3610 O O     . TYR C 1 143 ? 76.719 39.788  28.254  1.00 232.35 ? 143 TYR C O     1 
ATOM 3611 C CB    . TYR C 1 143 ? 74.283 39.034  26.258  1.00 218.26 ? 143 TYR C CB    1 
ATOM 3612 C CG    . TYR C 1 143 ? 75.282 37.899  26.272  1.00 199.81 ? 143 TYR C CG    1 
ATOM 3613 C CD1   . TYR C 1 143 ? 75.112 36.824  27.136  1.00 218.76 ? 143 TYR C CD1   1 
ATOM 3614 C CD2   . TYR C 1 143 ? 76.405 37.912  25.456  1.00 181.82 ? 143 TYR C CD2   1 
ATOM 3615 C CE1   . TYR C 1 143 ? 76.018 35.785  27.175  1.00 220.38 ? 143 TYR C CE1   1 
ATOM 3616 C CE2   . TYR C 1 143 ? 77.321 36.872  25.488  1.00 198.37 ? 143 TYR C CE2   1 
ATOM 3617 C CZ    . TYR C 1 143 ? 77.120 35.811  26.350  1.00 203.86 ? 143 TYR C CZ    1 
ATOM 3618 O OH    . TYR C 1 143 ? 78.020 34.770  26.393  1.00 180.35 ? 143 TYR C OH    1 
ATOM 3619 N N     . MET C 1 144 ? 76.190 41.539  26.939  1.00 224.58 ? 144 MET C N     1 
ATOM 3620 C CA    . MET C 1 144 ? 77.554 42.062  26.974  1.00 217.77 ? 144 MET C CA    1 
ATOM 3621 C C     . MET C 1 144 ? 77.934 42.494  28.382  1.00 239.76 ? 144 MET C C     1 
ATOM 3622 O O     . MET C 1 144 ? 79.076 42.299  28.814  1.00 248.04 ? 144 MET C O     1 
ATOM 3623 C CB    . MET C 1 144 ? 77.698 43.257  26.028  1.00 219.60 ? 144 MET C CB    1 
ATOM 3624 C CG    . MET C 1 144 ? 77.352 43.008  24.577  1.00 220.62 ? 144 MET C CG    1 
ATOM 3625 S SD    . MET C 1 144 ? 78.569 42.008  23.724  1.00 220.14 ? 144 MET C SD    1 
ATOM 3626 C CE    . MET C 1 144 ? 80.077 42.825  24.210  1.00 206.81 ? 144 MET C CE    1 
ATOM 3627 N N     . GLU C 1 145 ? 76.988 43.089  29.108  1.00 238.92 ? 145 GLU C N     1 
ATOM 3628 C CA    . GLU C 1 145 ? 77.239 43.439  30.502  1.00 226.63 ? 145 GLU C CA    1 
ATOM 3629 C C     . GLU C 1 145 ? 77.381 42.190  31.361  1.00 232.31 ? 145 GLU C C     1 
ATOM 3630 O O     . GLU C 1 145 ? 78.209 42.150  32.278  1.00 246.09 ? 145 GLU C O     1 
ATOM 3631 C CB    . GLU C 1 145 ? 76.118 44.333  31.030  1.00 238.46 ? 145 GLU C CB    1 
ATOM 3632 C CG    . GLU C 1 145 ? 76.012 45.674  30.326  1.00 254.63 ? 145 GLU C CG    1 
ATOM 3633 C CD    . GLU C 1 145 ? 74.707 46.384  30.625  1.00 286.58 ? 145 GLU C CD    1 
ATOM 3634 O OE1   . GLU C 1 145 ? 73.847 45.788  31.306  1.00 297.86 ? 145 GLU C OE1   1 
ATOM 3635 O OE2   . GLU C 1 145 ? 74.540 47.538  30.177  1.00 296.33 ? 145 GLU C OE2   1 
ATOM 3636 N N     . SER C 1 146 ? 76.590 41.157  31.072  1.00 235.23 ? 146 SER C N     1 
ATOM 3637 C CA    . SER C 1 146 ? 76.694 39.884  31.777  1.00 240.39 ? 146 SER C CA    1 
ATOM 3638 C C     . SER C 1 146 ? 77.892 39.052  31.336  1.00 228.57 ? 146 SER C C     1 
ATOM 3639 O O     . SER C 1 146 ? 78.106 37.966  31.885  1.00 250.89 ? 146 SER C O     1 
ATOM 3640 C CB    . SER C 1 146 ? 75.412 39.071  31.590  1.00 259.07 ? 146 SER C CB    1 
ATOM 3641 O OG    . SER C 1 146 ? 75.285 38.623  30.253  1.00 271.68 ? 146 SER C OG    1 
ATOM 3642 N N     . LEU C 1 147 ? 78.669 39.522  30.360  1.00 217.78 ? 147 LEU C N     1 
ATOM 3643 C CA    . LEU C 1 147 ? 79.806 38.745  29.878  1.00 225.95 ? 147 LEU C CA    1 
ATOM 3644 C C     . LEU C 1 147 ? 80.985 38.800  30.842  1.00 244.38 ? 147 LEU C C     1 
ATOM 3645 O O     . LEU C 1 147 ? 81.624 37.774  31.100  1.00 231.06 ? 147 LEU C O     1 
ATOM 3646 C CB    . LEU C 1 147 ? 80.228 39.242  28.496  1.00 190.89 ? 147 LEU C CB    1 
ATOM 3647 C CG    . LEU C 1 147 ? 81.363 38.463  27.831  1.00 175.98 ? 147 LEU C CG    1 
ATOM 3648 C CD1   . LEU C 1 147 ? 81.067 36.973  27.854  1.00 171.34 ? 147 LEU C CD1   1 
ATOM 3649 C CD2   . LEU C 1 147 ? 81.584 38.947  26.406  1.00 220.17 ? 147 LEU C CD2   1 
ATOM 3650 N N     . LEU C 1 148 ? 81.292 39.975  31.380  1.00 284.58 ? 148 LEU C N     1 
ATOM 3651 C CA    . LEU C 1 148 ? 82.403 40.104  32.314  1.00 305.44 ? 148 LEU C CA    1 
ATOM 3652 C C     . LEU C 1 148 ? 81.940 39.865  33.748  1.00 330.55 ? 148 LEU C C     1 
ATOM 3653 O O     . LEU C 1 148 ? 82.568 39.119  34.499  1.00 332.21 ? 148 LEU C O     1 
ATOM 3654 C CB    . LEU C 1 148 ? 83.054 41.482  32.194  1.00 315.47 ? 148 LEU C CB    1 
ATOM 3655 C CG    . LEU C 1 148 ? 84.364 41.655  32.966  1.00 317.01 ? 148 LEU C CG    1 
ATOM 3656 C CD1   . LEU C 1 148 ? 85.458 40.786  32.361  1.00 304.21 ? 148 LEU C CD1   1 
ATOM 3657 C CD2   . LEU C 1 148 ? 84.788 43.115  33.003  1.00 317.02 ? 148 LEU C CD2   1 
ATOM 3658 N N     . ILE D 1 2   ? 14.696 38.423  83.490  1.00 164.21 ? 2   ILE D N     1 
ATOM 3659 C CA    . ILE D 1 2   ? 13.993 38.028  82.275  1.00 183.09 ? 2   ILE D CA    1 
ATOM 3660 C C     . ILE D 1 2   ? 14.939 37.242  81.364  1.00 207.79 ? 2   ILE D C     1 
ATOM 3661 O O     . ILE D 1 2   ? 16.006 37.722  80.980  1.00 188.96 ? 2   ILE D O     1 
ATOM 3662 C CB    . ILE D 1 2   ? 13.376 39.251  81.558  1.00 177.78 ? 2   ILE D CB    1 
ATOM 3663 C CG1   . ILE D 1 2   ? 12.774 38.844  80.212  1.00 173.59 ? 2   ILE D CG1   1 
ATOM 3664 C CG2   . ILE D 1 2   ? 14.396 40.370  81.398  1.00 198.49 ? 2   ILE D CG2   1 
ATOM 3665 C CD1   . ILE D 1 2   ? 12.132 39.995  79.468  1.00 164.94 ? 2   ILE D CD1   1 
ATOM 3666 N N     . ILE D 1 3   ? 14.533 36.018  81.040  1.00 222.51 ? 3   ILE D N     1 
ATOM 3667 C CA    . ILE D 1 3   ? 15.349 35.057  80.310  1.00 231.50 ? 3   ILE D CA    1 
ATOM 3668 C C     . ILE D 1 3   ? 14.818 34.938  78.888  1.00 223.34 ? 3   ILE D C     1 
ATOM 3669 O O     . ILE D 1 3   ? 13.603 34.880  78.671  1.00 227.65 ? 3   ILE D O     1 
ATOM 3670 C CB    . ILE D 1 3   ? 15.340 33.688  81.019  1.00 239.61 ? 3   ILE D CB    1 
ATOM 3671 C CG1   . ILE D 1 3   ? 15.895 33.822  82.439  1.00 244.73 ? 3   ILE D CG1   1 
ATOM 3672 C CG2   . ILE D 1 3   ? 16.133 32.661  80.222  1.00 230.56 ? 3   ILE D CG2   1 
ATOM 3673 C CD1   . ILE D 1 3   ? 16.139 32.502  83.132  1.00 262.27 ? 3   ILE D CD1   1 
ATOM 3674 N N     . CYS D 1 4   ? 15.729 34.925  77.917  1.00 212.45 ? 4   CYS D N     1 
ATOM 3675 C CA    . CYS D 1 4   ? 15.378 34.813  76.504  1.00 201.21 ? 4   CYS D CA    1 
ATOM 3676 C C     . CYS D 1 4   ? 16.185 33.677  75.889  1.00 201.43 ? 4   CYS D C     1 
ATOM 3677 O O     . CYS D 1 4   ? 17.404 33.792  75.739  1.00 229.35 ? 4   CYS D O     1 
ATOM 3678 C CB    . CYS D 1 4   ? 15.638 36.127  75.767  1.00 199.47 ? 4   CYS D CB    1 
ATOM 3679 S SG    . CYS D 1 4   ? 15.474 36.019  73.971  1.00 217.01 ? 4   CYS D SG    1 
ATOM 3680 N N     . SER D 1 5   ? 15.517 32.583  75.532  1.00 170.82 ? 5   SER D N     1 
ATOM 3681 C CA    . SER D 1 5   ? 16.184 31.432  74.935  1.00 174.90 ? 5   SER D CA    1 
ATOM 3682 C C     . SER D 1 5   ? 15.868 31.373  73.448  1.00 200.96 ? 5   SER D C     1 
ATOM 3683 O O     . SER D 1 5   ? 14.706 31.500  73.051  1.00 231.36 ? 5   SER D O     1 
ATOM 3684 C CB    . SER D 1 5   ? 15.754 30.132  75.615  1.00 178.98 ? 5   SER D CB    1 
ATOM 3685 O OG    . SER D 1 5   ? 14.363 29.911  75.466  1.00 213.69 ? 5   SER D OG    1 
ATOM 3686 N N     . VAL D 1 6   ? 16.898 31.164  72.631  1.00 193.64 ? 6   VAL D N     1 
ATOM 3687 C CA    . VAL D 1 6   ? 16.791 31.281  71.181  1.00 189.65 ? 6   VAL D CA    1 
ATOM 3688 C C     . VAL D 1 6   ? 17.322 30.009  70.536  1.00 219.13 ? 6   VAL D C     1 
ATOM 3689 O O     . VAL D 1 6   ? 18.452 29.592  70.813  1.00 232.71 ? 6   VAL D O     1 
ATOM 3690 C CB    . VAL D 1 6   ? 17.556 32.509  70.648  1.00 171.58 ? 6   VAL D CB    1 
ATOM 3691 C CG1   . VAL D 1 6   ? 17.342 32.657  69.150  1.00 201.85 ? 6   VAL D CG1   1 
ATOM 3692 C CG2   . VAL D 1 6   ? 17.125 33.770  71.380  1.00 164.91 ? 6   VAL D CG2   1 
ATOM 3693 N N     . ASP D 1 7   ? 16.507 29.392  69.684  1.00 228.43 ? 7   ASP D N     1 
ATOM 3694 C CA    . ASP D 1 7   ? 16.990 28.405  68.725  1.00 241.56 ? 7   ASP D CA    1 
ATOM 3695 C C     . ASP D 1 7   ? 17.359 29.128  67.437  1.00 242.43 ? 7   ASP D C     1 
ATOM 3696 O O     . ASP D 1 7   ? 16.486 29.683  66.756  1.00 246.47 ? 7   ASP D O     1 
ATOM 3697 C CB    . ASP D 1 7   ? 15.945 27.329  68.450  1.00 272.67 ? 7   ASP D CB    1 
ATOM 3698 C CG    . ASP D 1 7   ? 16.417 26.317  67.420  1.00 292.56 ? 7   ASP D CG    1 
ATOM 3699 O OD1   . ASP D 1 7   ? 17.645 26.190  67.221  1.00 289.99 ? 7   ASP D OD1   1 
ATOM 3700 O OD2   . ASP D 1 7   ? 15.563 25.656  66.798  1.00 304.68 ? 7   ASP D OD2   1 
ATOM 3701 N N     . ILE D 1 8   ? 18.654 29.130  67.116  1.00 248.56 ? 8   ILE D N     1 
ATOM 3702 C CA    . ILE D 1 8   ? 19.197 29.856  65.976  1.00 255.55 ? 8   ILE D CA    1 
ATOM 3703 C C     . ILE D 1 8   ? 19.161 28.942  64.761  1.00 280.22 ? 8   ILE D C     1 
ATOM 3704 O O     . ILE D 1 8   ? 19.203 27.712  64.880  1.00 280.87 ? 8   ILE D O     1 
ATOM 3705 C CB    . ILE D 1 8   ? 20.633 30.344  66.262  1.00 254.07 ? 8   ILE D CB    1 
ATOM 3706 C CG1   . ILE D 1 8   ? 20.757 30.857  67.697  1.00 246.59 ? 8   ILE D CG1   1 
ATOM 3707 C CG2   . ILE D 1 8   ? 21.033 31.440  65.289  1.00 256.33 ? 8   ILE D CG2   1 
ATOM 3708 C CD1   . ILE D 1 8   ? 21.350 29.840  68.651  1.00 237.77 ? 8   ILE D CD1   1 
ATOM 3709 N N     . GLY D 1 9   ? 19.082 29.540  63.576  1.00 289.56 ? 9   GLY D N     1 
ATOM 3710 C CA    . GLY D 1 9   ? 19.108 28.757  62.360  1.00 307.37 ? 9   GLY D CA    1 
ATOM 3711 C C     . GLY D 1 9   ? 18.397 29.411  61.196  1.00 314.81 ? 9   GLY D C     1 
ATOM 3712 O O     . GLY D 1 9   ? 17.332 30.007  61.377  1.00 318.13 ? 9   GLY D O     1 
ATOM 3713 N N     . ILE D 1 10  ? 18.969 29.312  59.994  1.00 317.41 ? 10  ILE D N     1 
ATOM 3714 C CA    . ILE D 1 10  ? 18.268 29.789  58.809  1.00 307.51 ? 10  ILE D CA    1 
ATOM 3715 C C     . ILE D 1 10  ? 17.074 28.910  58.485  1.00 297.05 ? 10  ILE D C     1 
ATOM 3716 O O     . ILE D 1 10  ? 16.217 29.299  57.682  1.00 296.22 ? 10  ILE D O     1 
ATOM 3717 C CB    . ILE D 1 10  ? 19.215 29.854  57.593  1.00 302.57 ? 10  ILE D CB    1 
ATOM 3718 C CG1   . ILE D 1 10  ? 19.683 28.449  57.208  1.00 310.35 ? 10  ILE D CG1   1 
ATOM 3719 C CG2   . ILE D 1 10  ? 20.401 30.755  57.893  1.00 288.11 ? 10  ILE D CG2   1 
ATOM 3720 C CD1   . ILE D 1 10  ? 20.661 28.425  56.054  1.00 313.04 ? 10  ILE D CD1   1 
ATOM 3721 N N     . LYS D 1 11  ? 17.009 27.728  59.096  1.00 281.99 ? 11  LYS D N     1 
ATOM 3722 C CA    . LYS D 1 11  ? 15.894 26.803  58.963  1.00 305.22 ? 11  LYS D CA    1 
ATOM 3723 C C     . LYS D 1 11  ? 14.598 27.399  59.501  1.00 306.30 ? 11  LYS D C     1 
ATOM 3724 O O     . LYS D 1 11  ? 13.651 27.636  58.744  1.00 318.48 ? 11  LYS D O     1 
ATOM 3725 C CB    . LYS D 1 11  ? 16.232 25.504  59.701  1.00 319.28 ? 11  LYS D CB    1 
ATOM 3726 C CG    . LYS D 1 11  ? 17.077 25.732  60.960  1.00 307.85 ? 11  LYS D CG    1 
ATOM 3727 C CD    . LYS D 1 11  ? 17.346 24.448  61.728  1.00 306.66 ? 11  LYS D CD    1 
ATOM 3728 C CE    . LYS D 1 11  ? 17.974 24.742  63.086  1.00 279.21 ? 11  LYS D CE    1 
ATOM 3729 N NZ    . LYS D 1 11  ? 19.256 25.492  62.971  1.00 251.67 ? 11  LYS D NZ    1 
ATOM 3730 N N     . ASN D 1 12  ? 14.554 27.647  60.808  1.00 295.58 ? 12  ASN D N     1 
ATOM 3731 C CA    . ASN D 1 12  ? 13.364 28.105  61.515  1.00 284.31 ? 12  ASN D CA    1 
ATOM 3732 C C     . ASN D 1 12  ? 13.775 28.671  62.869  1.00 264.37 ? 12  ASN D C     1 
ATOM 3733 O O     . ASN D 1 12  ? 13.670 27.976  63.887  1.00 260.01 ? 12  ASN D O     1 
ATOM 3734 C CB    . ASN D 1 12  ? 12.354 26.966  61.679  1.00 282.39 ? 12  ASN D CB    1 
ATOM 3735 C CG    . ASN D 1 12  ? 13.006 25.660  62.099  1.00 291.80 ? 12  ASN D CG    1 
ATOM 3736 O OD1   . ASN D 1 12  ? 14.191 25.620  62.430  1.00 297.88 ? 12  ASN D OD1   1 
ATOM 3737 N ND2   . ASN D 1 12  ? 12.230 24.582  62.088  1.00 307.65 ? 12  ASN D ND2   1 
ATOM 3738 N N     . PRO D 1 13  ? 14.245 29.914  62.931  1.00 244.15 ? 13  PRO D N     1 
ATOM 3739 C CA    . PRO D 1 13  ? 14.650 30.469  64.226  1.00 238.59 ? 13  PRO D CA    1 
ATOM 3740 C C     . PRO D 1 13  ? 13.453 30.744  65.120  1.00 250.49 ? 13  PRO D C     1 
ATOM 3741 O O     . PRO D 1 13  ? 12.376 31.141  64.665  1.00 285.49 ? 13  PRO D O     1 
ATOM 3742 C CB    . PRO D 1 13  ? 15.362 31.769  63.841  1.00 207.40 ? 13  PRO D CB    1 
ATOM 3743 C CG    . PRO D 1 13  ? 14.698 32.177  62.565  1.00 209.59 ? 13  PRO D CG    1 
ATOM 3744 C CD    . PRO D 1 13  ? 14.367 30.897  61.841  1.00 214.03 ? 13  PRO D CD    1 
ATOM 3745 N N     . ALA D 1 14  ? 13.663 30.541  66.419  1.00 355.75 ? 14  ALA D N     1 
ATOM 3746 C CA    . ALA D 1 14  ? 12.599 30.710  67.399  1.00 322.97 ? 14  ALA D CA    1 
ATOM 3747 C C     . ALA D 1 14  ? 13.156 31.311  68.680  1.00 302.32 ? 14  ALA D C     1 
ATOM 3748 O O     . ALA D 1 14  ? 14.340 31.160  68.986  1.00 306.04 ? 14  ALA D O     1 
ATOM 3749 C CB    . ALA D 1 14  ? 11.904 29.377  67.708  1.00 323.71 ? 14  ALA D CB    1 
ATOM 3750 N N     . TYR D 1 15  ? 12.289 31.983  69.437  1.00 299.31 ? 15  TYR D N     1 
ATOM 3751 C CA    . TYR D 1 15  ? 12.695 32.555  70.713  1.00 298.29 ? 15  TYR D CA    1 
ATOM 3752 C C     . TYR D 1 15  ? 11.557 32.479  71.722  1.00 305.31 ? 15  TYR D C     1 
ATOM 3753 O O     . TYR D 1 15  ? 10.383 32.639  71.372  1.00 300.26 ? 15  TYR D O     1 
ATOM 3754 C CB    . TYR D 1 15  ? 13.165 34.011  70.555  1.00 298.28 ? 15  TYR D CB    1 
ATOM 3755 C CG    . TYR D 1 15  ? 12.131 34.965  69.997  1.00 295.07 ? 15  TYR D CG    1 
ATOM 3756 C CD1   . TYR D 1 15  ? 12.010 35.167  68.628  1.00 295.54 ? 15  TYR D CD1   1 
ATOM 3757 C CD2   . TYR D 1 15  ? 11.290 35.681  70.840  1.00 306.46 ? 15  TYR D CD2   1 
ATOM 3758 C CE1   . TYR D 1 15  ? 11.071 36.045  68.114  1.00 297.03 ? 15  TYR D CE1   1 
ATOM 3759 C CE2   . TYR D 1 15  ? 10.348 36.559  70.336  1.00 303.89 ? 15  TYR D CE2   1 
ATOM 3760 C CZ    . TYR D 1 15  ? 10.243 36.738  68.974  1.00 302.53 ? 15  TYR D CZ    1 
ATOM 3761 O OH    . TYR D 1 15  ? 9.307  37.612  68.470  1.00 288.14 ? 15  TYR D OH    1 
ATOM 3762 N N     . ALA D 1 16  ? 11.927 32.241  72.980  1.00 300.01 ? 16  ALA D N     1 
ATOM 3763 C CA    . ALA D 1 16  ? 11.005 32.196  74.107  1.00 292.58 ? 16  ALA D CA    1 
ATOM 3764 C C     . ALA D 1 16  ? 11.473 33.164  75.185  1.00 295.72 ? 16  ALA D C     1 
ATOM 3765 O O     . ALA D 1 16  ? 12.652 33.161  75.557  1.00 296.28 ? 16  ALA D O     1 
ATOM 3766 C CB    . ALA D 1 16  ? 10.896 30.778  74.675  1.00 293.33 ? 16  ALA D CB    1 
ATOM 3767 N N     . ILE D 1 17  ? 10.550 33.982  75.684  1.00 289.88 ? 17  ILE D N     1 
ATOM 3768 C CA    . ILE D 1 17  ? 10.826 34.982  76.712  1.00 290.10 ? 17  ILE D CA    1 
ATOM 3769 C C     . ILE D 1 17  ? 10.071 34.586  77.976  1.00 288.57 ? 17  ILE D C     1 
ATOM 3770 O O     . ILE D 1 17  ? 8.833  34.534  77.973  1.00 301.72 ? 17  ILE D O     1 
ATOM 3771 C CB    . ILE D 1 17  ? 10.428 36.392  76.251  1.00 288.40 ? 17  ILE D CB    1 
ATOM 3772 C CG1   . ILE D 1 17  ? 10.945 36.660  74.835  1.00 289.52 ? 17  ILE D CG1   1 
ATOM 3773 C CG2   . ILE D 1 17  ? 10.953 37.437  77.218  1.00 289.40 ? 17  ILE D CG2   1 
ATOM 3774 C CD1   . ILE D 1 17  ? 10.615 38.043  74.314  1.00 288.30 ? 17  ILE D CD1   1 
ATOM 3775 N N     . PHE D 1 18  ? 10.822 34.267  79.034  1.00 308.15 ? 18  PHE D N     1 
ATOM 3776 C CA    . PHE D 1 18  ? 10.310 33.919  80.353  1.00 318.56 ? 18  PHE D CA    1 
ATOM 3777 C C     . PHE D 1 18  ? 10.768 34.957  81.375  1.00 340.63 ? 18  PHE D C     1 
ATOM 3778 O O     . PHE D 1 18  ? 11.688 35.735  81.121  1.00 315.81 ? 18  PHE D O     1 
ATOM 3779 C CB    . PHE D 1 18  ? 10.825 32.545  80.814  1.00 317.87 ? 18  PHE D CB    1 
ATOM 3780 C CG    . PHE D 1 18  ? 10.685 31.450  79.792  1.00 292.86 ? 18  PHE D CG    1 
ATOM 3781 C CD1   . PHE D 1 18  ? 9.630  31.424  78.899  1.00 296.81 ? 18  PHE D CD1   1 
ATOM 3782 C CD2   . PHE D 1 18  ? 11.632 30.439  79.730  1.00 296.61 ? 18  PHE D CD2   1 
ATOM 3783 C CE1   . PHE D 1 18  ? 9.526  30.411  77.963  1.00 298.88 ? 18  PHE D CE1   1 
ATOM 3784 C CE2   . PHE D 1 18  ? 11.529 29.425  78.801  1.00 296.96 ? 18  PHE D CE2   1 
ATOM 3785 C CZ    . PHE D 1 18  ? 10.475 29.410  77.918  1.00 293.36 ? 18  PHE D CZ    1 
ATOM 3786 N N     . ASN D 1 19  ? 10.115 34.975  82.540  1.00 398.14 ? 19  ASN D N     1 
ATOM 3787 C CA    . ASN D 1 19  ? 10.647 35.654  83.722  1.00 414.87 ? 19  ASN D CA    1 
ATOM 3788 C C     . ASN D 1 19  ? 10.708 34.637  84.854  1.00 437.33 ? 19  ASN D C     1 
ATOM 3789 O O     . ASN D 1 19  ? 9.667  34.138  85.297  1.00 435.72 ? 19  ASN D O     1 
ATOM 3790 C CB    . ASN D 1 19  ? 9.803  36.864  84.127  1.00 410.83 ? 19  ASN D CB    1 
ATOM 3791 C CG    . ASN D 1 19  ? 8.613  37.077  83.226  1.00 408.97 ? 19  ASN D CG    1 
ATOM 3792 O OD1   . ASN D 1 19  ? 7.904  36.134  82.884  1.00 409.24 ? 19  ASN D OD1   1 
ATOM 3793 N ND2   . ASN D 1 19  ? 8.382  38.326  82.838  1.00 408.57 ? 19  ASN D ND2   1 
ATOM 3794 N N     . TYR D 1 20  ? 11.917 34.331  85.321  1.00 454.53 ? 20  TYR D N     1 
ATOM 3795 C CA    . TYR D 1 20  ? 12.128 33.331  86.363  1.00 467.95 ? 20  TYR D CA    1 
ATOM 3796 C C     . TYR D 1 20  ? 12.666 33.953  87.646  1.00 467.76 ? 20  TYR D C     1 
ATOM 3797 O O     . TYR D 1 20  ? 13.753 34.542  87.645  1.00 475.13 ? 20  TYR D O     1 
ATOM 3798 C CB    . TYR D 1 20  ? 13.079 32.237  85.885  1.00 479.34 ? 20  TYR D CB    1 
ATOM 3799 C CG    . TYR D 1 20  ? 13.390 31.211  86.950  1.00 487.76 ? 20  TYR D CG    1 
ATOM 3800 C CD1   . TYR D 1 20  ? 12.453 30.251  87.306  1.00 487.66 ? 20  TYR D CD1   1 
ATOM 3801 C CD2   . TYR D 1 20  ? 14.618 31.200  87.596  1.00 492.56 ? 20  TYR D CD2   1 
ATOM 3802 C CE1   . TYR D 1 20  ? 12.728 29.310  88.280  1.00 491.84 ? 20  TYR D CE1   1 
ATOM 3803 C CE2   . TYR D 1 20  ? 14.904 30.261  88.570  1.00 496.09 ? 20  TYR D CE2   1 
ATOM 3804 C CZ    . TYR D 1 20  ? 13.955 29.320  88.908  1.00 496.52 ? 20  TYR D CZ    1 
ATOM 3805 O OH    . TYR D 1 20  ? 14.235 28.384  89.878  1.00 499.29 ? 20  TYR D OH    1 
ATOM 3806 N N     . ASP D 1 21  ? 11.908 33.825  88.734  1.00 437.70 ? 21  ASP D N     1 
ATOM 3807 C CA    . ASP D 1 21  ? 12.398 34.212  90.051  1.00 404.68 ? 21  ASP D CA    1 
ATOM 3808 C C     . ASP D 1 21  ? 13.382 33.146  90.524  1.00 420.49 ? 21  ASP D C     1 
ATOM 3809 O O     . ASP D 1 21  ? 13.024 31.967  90.626  1.00 404.61 ? 21  ASP D O     1 
ATOM 3810 C CB    . ASP D 1 21  ? 11.246 34.373  91.040  1.00 382.03 ? 21  ASP D CB    1 
ATOM 3811 C CG    . ASP D 1 21  ? 10.420 35.617  90.775  1.00 361.99 ? 21  ASP D CG    1 
ATOM 3812 O OD1   . ASP D 1 21  ? 10.941 36.553  90.133  1.00 354.24 ? 21  ASP D OD1   1 
ATOM 3813 O OD2   . ASP D 1 21  ? 9.252  35.661  91.214  1.00 356.48 ? 21  ASP D OD2   1 
ATOM 3814 N N     . ASN D 1 22  ? 14.617 33.554  90.807  1.00 432.89 ? 22  ASN D N     1 
ATOM 3815 C CA    . ASN D 1 22  ? 15.682 32.603  91.103  1.00 437.30 ? 22  ASN D CA    1 
ATOM 3816 C C     . ASN D 1 22  ? 15.452 31.891  92.432  1.00 429.60 ? 22  ASN D C     1 
ATOM 3817 O O     . ASN D 1 22  ? 15.127 32.527  93.440  1.00 439.05 ? 22  ASN D O     1 
ATOM 3818 C CB    . ASN D 1 22  ? 17.029 33.323  91.133  1.00 445.96 ? 22  ASN D CB    1 
ATOM 3819 C CG    . ASN D 1 22  ? 17.406 33.915  89.791  1.00 448.86 ? 22  ASN D CG    1 
ATOM 3820 O OD1   . ASN D 1 22  ? 17.196 33.300  88.748  1.00 449.92 ? 22  ASN D OD1   1 
ATOM 3821 N ND2   . ASN D 1 22  ? 17.970 35.116  89.813  1.00 451.43 ? 22  ASN D ND2   1 
ATOM 3822 N N     . THR D 1 23  ? 15.603 30.560  92.422  1.00 403.47 ? 23  THR D N     1 
ATOM 3823 C CA    . THR D 1 23  ? 15.531 29.726  93.623  1.00 371.72 ? 23  THR D CA    1 
ATOM 3824 C C     . THR D 1 23  ? 14.160 29.753  94.297  1.00 357.88 ? 23  THR D C     1 
ATOM 3825 O O     . THR D 1 23  ? 13.959 29.107  95.331  1.00 354.59 ? 23  THR D O     1 
ATOM 3826 C CB    . THR D 1 23  ? 16.624 30.133  94.620  1.00 366.50 ? 23  THR D CB    1 
ATOM 3827 O OG1   . THR D 1 23  ? 17.771 30.608  93.904  1.00 353.11 ? 23  THR D OG1   1 
ATOM 3828 C CG2   . THR D 1 23  ? 17.047 28.939  95.467  1.00 363.75 ? 23  THR D CG2   1 
ATOM 3829 N N     . SER D 1 24  ? 13.206 30.480  93.719  1.00 352.41 ? 24  SER D N     1 
ATOM 3830 C CA    . SER D 1 24  ? 11.866 30.595  94.279  1.00 353.09 ? 24  SER D CA    1 
ATOM 3831 C C     . SER D 1 24  ? 10.833 29.747  93.551  1.00 353.41 ? 24  SER D C     1 
ATOM 3832 O O     . SER D 1 24  ? 9.707  29.617  94.044  1.00 346.46 ? 24  SER D O     1 
ATOM 3833 C CB    . SER D 1 24  ? 11.415 32.062  94.268  1.00 346.04 ? 24  SER D CB    1 
ATOM 3834 O OG    . SER D 1 24  ? 10.079 32.188  94.721  1.00 342.37 ? 24  SER D OG    1 
ATOM 3835 N N     . ASN D 1 25  ? 11.186 29.181  92.396  1.00 356.51 ? 25  ASN D N     1 
ATOM 3836 C CA    . ASN D 1 25  ? 10.278 28.362  91.592  1.00 355.93 ? 25  ASN D CA    1 
ATOM 3837 C C     . ASN D 1 25  ? 9.028  29.143  91.196  1.00 350.78 ? 25  ASN D C     1 
ATOM 3838 O O     . ASN D 1 25  ? 7.911  28.621  91.222  1.00 349.21 ? 25  ASN D O     1 
ATOM 3839 C CB    . ASN D 1 25  ? 9.896  27.070  92.321  1.00 356.18 ? 25  ASN D CB    1 
ATOM 3840 C CG    . ASN D 1 25  ? 11.095 26.205  92.647  1.00 356.75 ? 25  ASN D CG    1 
ATOM 3841 O OD1   . ASN D 1 25  ? 12.111 26.243  91.953  1.00 353.86 ? 25  ASN D OD1   1 
ATOM 3842 N ND2   . ASN D 1 25  ? 10.984 25.416  93.710  1.00 357.82 ? 25  ASN D ND2   1 
ATOM 3843 N N     . THR D 1 26  ? 9.218  30.407  90.830  1.00 328.17 ? 26  THR D N     1 
ATOM 3844 C CA    . THR D 1 26  ? 8.135  31.269  90.369  1.00 325.25 ? 26  THR D CA    1 
ATOM 3845 C C     . THR D 1 26  ? 8.396  31.501  88.884  1.00 356.78 ? 26  THR D C     1 
ATOM 3846 O O     . THR D 1 26  ? 9.006  32.493  88.481  1.00 311.08 ? 26  THR D O     1 
ATOM 3847 C CB    . THR D 1 26  ? 8.077  32.579  91.160  1.00 295.56 ? 26  THR D CB    1 
ATOM 3848 O OG1   . THR D 1 26  ? 8.019  32.289  92.562  1.00 285.75 ? 26  THR D OG1   1 
ATOM 3849 C CG2   . THR D 1 26  ? 6.844  33.380  90.770  1.00 282.13 ? 26  THR D CG2   1 
ATOM 3850 N N     . ILE D 1 27  ? 7.931  30.565  88.068  1.00 414.55 ? 27  ILE D N     1 
ATOM 3851 C CA    . ILE D 1 27  ? 8.146  30.609  86.628  1.00 422.90 ? 27  ILE D CA    1 
ATOM 3852 C C     . ILE D 1 27  ? 6.966  31.289  85.953  1.00 430.33 ? 27  ILE D C     1 
ATOM 3853 O O     . ILE D 1 27  ? 5.804  30.981  86.244  1.00 449.03 ? 27  ILE D O     1 
ATOM 3854 C CB    . ILE D 1 27  ? 8.366  29.197  86.064  1.00 436.74 ? 27  ILE D CB    1 
ATOM 3855 C CG1   . ILE D 1 27  ? 9.453  28.470  86.863  1.00 439.76 ? 27  ILE D CG1   1 
ATOM 3856 C CG2   . ILE D 1 27  ? 8.671  29.260  84.580  1.00 430.48 ? 27  ILE D CG2   1 
ATOM 3857 C CD1   . ILE D 1 27  ? 9.932  27.182  86.232  1.00 442.43 ? 27  ILE D CD1   1 
ATOM 3858 N N     . LYS D 1 28  ? 7.267  32.217  85.047  1.00 396.36 ? 28  LYS D N     1 
ATOM 3859 C CA    . LYS D 1 28  ? 6.263  32.901  84.244  1.00 371.49 ? 28  LYS D CA    1 
ATOM 3860 C C     . LYS D 1 28  ? 6.737  32.901  82.799  1.00 344.79 ? 28  LYS D C     1 
ATOM 3861 O O     . LYS D 1 28  ? 7.814  33.425  82.499  1.00 327.73 ? 28  LYS D O     1 
ATOM 3862 C CB    . LYS D 1 28  ? 6.036  34.334  84.737  1.00 363.95 ? 28  LYS D CB    1 
ATOM 3863 C CG    . LYS D 1 28  ? 5.978  34.480  86.250  1.00 359.86 ? 28  LYS D CG    1 
ATOM 3864 C CD    . LYS D 1 28  ? 5.838  35.935  86.661  1.00 345.62 ? 28  LYS D CD    1 
ATOM 3865 C CE    . LYS D 1 28  ? 6.055  36.110  88.156  1.00 343.48 ? 28  LYS D CE    1 
ATOM 3866 N NZ    . LYS D 1 28  ? 7.450  35.771  88.554  1.00 337.40 ? 28  LYS D NZ    1 
ATOM 3867 N N     . LEU D 1 29  ? 5.950  32.300  81.912  1.00 337.57 ? 29  LEU D N     1 
ATOM 3868 C CA    . LEU D 1 29  ? 6.254  32.300  80.487  1.00 314.54 ? 29  LEU D CA    1 
ATOM 3869 C C     . LEU D 1 29  ? 5.561  33.497  79.849  1.00 319.67 ? 29  LEU D C     1 
ATOM 3870 O O     . LEU D 1 29  ? 4.328  33.588  79.868  1.00 351.68 ? 29  LEU D O     1 
ATOM 3871 C CB    . LEU D 1 29  ? 5.807  30.987  79.840  1.00 309.73 ? 29  LEU D CB    1 
ATOM 3872 C CG    . LEU D 1 29  ? 6.077  30.731  78.352  1.00 288.25 ? 29  LEU D CG    1 
ATOM 3873 C CD1   . LEU D 1 29  ? 6.256  29.240  78.112  1.00 291.56 ? 29  LEU D CD1   1 
ATOM 3874 C CD2   . LEU D 1 29  ? 4.966  31.269  77.464  1.00 303.84 ? 29  LEU D CD2   1 
ATOM 3875 N N     . ILE D 1 30  ? 6.349  34.413  79.285  1.00 290.95 ? 30  ILE D N     1 
ATOM 3876 C CA    . ILE D 1 30  ? 5.770  35.581  78.629  1.00 284.35 ? 30  ILE D CA    1 
ATOM 3877 C C     . ILE D 1 30  ? 5.385  35.261  77.193  1.00 292.88 ? 30  ILE D C     1 
ATOM 3878 O O     . ILE D 1 30  ? 4.246  35.500  76.775  1.00 325.60 ? 30  ILE D O     1 
ATOM 3879 C CB    . ILE D 1 30  ? 6.736  36.778  78.694  1.00 268.72 ? 30  ILE D CB    1 
ATOM 3880 C CG1   . ILE D 1 30  ? 6.961  37.203  80.141  1.00 271.02 ? 30  ILE D CG1   1 
ATOM 3881 C CG2   . ILE D 1 30  ? 6.200  37.940  77.874  1.00 266.47 ? 30  ILE D CG2   1 
ATOM 3882 C CD1   . ILE D 1 30  ? 5.691  37.587  80.868  1.00 282.68 ? 30  ILE D CD1   1 
ATOM 3883 N N     . ALA D 1 31  ? 6.316  34.715  76.414  1.00 262.46 ? 31  ALA D N     1 
ATOM 3884 C CA    . ALA D 1 31  ? 6.009  34.482  75.009  1.00 251.95 ? 31  ALA D CA    1 
ATOM 3885 C C     . ALA D 1 31  ? 6.874  33.363  74.452  1.00 276.39 ? 31  ALA D C     1 
ATOM 3886 O O     . ALA D 1 31  ? 7.933  33.039  74.992  1.00 275.62 ? 31  ALA D O     1 
ATOM 3887 C CB    . ALA D 1 31  ? 6.203  35.757  74.180  1.00 242.72 ? 31  ALA D CB    1 
ATOM 3888 N N     . ILE D 1 32  ? 6.396  32.782  73.353  1.00 290.02 ? 32  ILE D N     1 
ATOM 3889 C CA    . ILE D 1 32  ? 7.143  31.804  72.570  1.00 286.91 ? 32  ILE D CA    1 
ATOM 3890 C C     . ILE D 1 32  ? 6.746  31.982  71.111  1.00 278.63 ? 32  ILE D C     1 
ATOM 3891 O O     . ILE D 1 32  ? 5.559  31.925  70.770  1.00 283.28 ? 32  ILE D O     1 
ATOM 3892 C CB    . ILE D 1 32  ? 6.883  30.367  73.060  1.00 281.07 ? 32  ILE D CB    1 
ATOM 3893 C CG1   . ILE D 1 32  ? 7.332  29.347  72.009  1.00 282.64 ? 32  ILE D CG1   1 
ATOM 3894 C CG2   . ILE D 1 32  ? 5.416  30.177  73.424  1.00 277.44 ? 32  ILE D CG2   1 
ATOM 3895 C CD1   . ILE D 1 32  ? 8.828  29.324  71.771  1.00 268.41 ? 32  ILE D CD1   1 
ATOM 3896 N N     . GLU D 1 33  ? 7.727  32.205  70.237  1.00 263.34 ? 33  GLU D N     1 
ATOM 3897 C CA    . GLU D 1 33  ? 7.444  32.517  68.845  1.00 262.81 ? 33  GLU D CA    1 
ATOM 3898 C C     . GLU D 1 33  ? 8.481  31.865  67.945  1.00 272.77 ? 33  GLU D C     1 
ATOM 3899 O O     . GLU D 1 33  ? 9.619  31.624  68.354  1.00 249.76 ? 33  GLU D O     1 
ATOM 3900 C CB    . GLU D 1 33  ? 7.429  34.036  68.592  1.00 241.11 ? 33  GLU D CB    1 
ATOM 3901 C CG    . GLU D 1 33  ? 6.331  34.797  69.324  1.00 254.04 ? 33  GLU D CG    1 
ATOM 3902 C CD    . GLU D 1 33  ? 4.939  34.423  68.850  1.00 281.63 ? 33  GLU D CD    1 
ATOM 3903 O OE1   . GLU D 1 33  ? 4.800  34.000  67.684  1.00 292.19 ? 33  GLU D OE1   1 
ATOM 3904 O OE2   . GLU D 1 33  ? 3.983  34.549  69.644  1.00 294.42 ? 33  GLU D OE2   1 
ATOM 3905 N N     . LYS D 1 34  ? 8.065  31.569  66.715  1.00 310.90 ? 34  LYS D N     1 
ATOM 3906 C CA    . LYS D 1 34  ? 8.963  31.153  65.643  1.00 318.50 ? 34  LYS D CA    1 
ATOM 3907 C C     . LYS D 1 34  ? 8.993  32.275  64.615  1.00 328.18 ? 34  LYS D C     1 
ATOM 3908 O O     . LYS D 1 34  ? 8.013  32.489  63.894  1.00 335.98 ? 34  LYS D O     1 
ATOM 3909 C CB    . LYS D 1 34  ? 8.511  29.844  65.000  1.00 327.69 ? 34  LYS D CB    1 
ATOM 3910 C CG    . LYS D 1 34  ? 9.328  29.471  63.768  1.00 319.67 ? 34  LYS D CG    1 
ATOM 3911 C CD    . LYS D 1 34  ? 8.591  28.483  62.878  1.00 328.32 ? 34  LYS D CD    1 
ATOM 3912 C CE    . LYS D 1 34  ? 7.291  29.071  62.361  1.00 332.14 ? 34  LYS D CE    1 
ATOM 3913 N NZ    . LYS D 1 34  ? 7.526  30.313  61.576  1.00 328.95 ? 34  LYS D NZ    1 
ATOM 3914 N N     . SER D 1 35  ? 10.112 32.984  64.546  1.00 328.09 ? 35  SER D N     1 
ATOM 3915 C CA    . SER D 1 35  ? 10.232 34.130  63.663  1.00 331.55 ? 35  SER D CA    1 
ATOM 3916 C C     . SER D 1 35  ? 10.878 33.703  62.349  1.00 323.84 ? 35  SER D C     1 
ATOM 3917 O O     . SER D 1 35  ? 11.137 32.523  62.104  1.00 331.17 ? 35  SER D O     1 
ATOM 3918 C CB    . SER D 1 35  ? 11.030 35.248  64.338  1.00 333.56 ? 35  SER D CB    1 
ATOM 3919 O OG    . SER D 1 35  ? 11.088 36.398  63.513  1.00 337.78 ? 35  SER D OG    1 
ATOM 3920 N N     . ASP D 1 36  ? 11.141 34.685  61.492  1.00 283.95 ? 36  ASP D N     1 
ATOM 3921 C CA    . ASP D 1 36  ? 11.791 34.450  60.211  1.00 255.31 ? 36  ASP D CA    1 
ATOM 3922 C C     . ASP D 1 36  ? 12.945 35.428  60.079  1.00 234.97 ? 36  ASP D C     1 
ATOM 3923 O O     . ASP D 1 36  ? 12.740 36.644  60.133  1.00 214.22 ? 36  ASP D O     1 
ATOM 3924 C CB    . ASP D 1 36  ? 10.801 34.623  59.055  1.00 263.42 ? 36  ASP D CB    1 
ATOM 3925 C CG    . ASP D 1 36  ? 11.458 34.484  57.699  1.00 268.35 ? 36  ASP D CG    1 
ATOM 3926 O OD1   . ASP D 1 36  ? 11.784 33.344  57.308  1.00 277.62 ? 36  ASP D OD1   1 
ATOM 3927 O OD2   . ASP D 1 36  ? 11.651 35.517  57.024  1.00 262.95 ? 36  ASP D OD2   1 
ATOM 3928 N N     . TRP D 1 37  ? 14.154 34.897  59.901  1.00 240.93 ? 37  TRP D N     1 
ATOM 3929 C CA    . TRP D 1 37  ? 15.354 35.706  59.701  1.00 227.40 ? 37  TRP D CA    1 
ATOM 3930 C C     . TRP D 1 37  ? 15.947 35.375  58.336  1.00 229.21 ? 37  TRP D C     1 
ATOM 3931 O O     . TRP D 1 37  ? 16.956 34.674  58.227  1.00 231.69 ? 37  TRP D O     1 
ATOM 3932 C CB    . TRP D 1 37  ? 16.362 35.471  60.843  1.00 204.57 ? 37  TRP D CB    1 
ATOM 3933 C CG    . TRP D 1 37  ? 15.832 35.868  62.192  1.00 200.80 ? 37  TRP D CG    1 
ATOM 3934 C CD1   . TRP D 1 37  ? 14.775 36.693  62.445  1.00 207.48 ? 37  TRP D CD1   1 
ATOM 3935 C CD2   . TRP D 1 37  ? 16.326 35.448  63.470  1.00 203.94 ? 37  TRP D CD2   1 
ATOM 3936 N NE1   . TRP D 1 37  ? 14.585 36.819  63.799  1.00 204.54 ? 37  TRP D NE1   1 
ATOM 3937 C CE2   . TRP D 1 37  ? 15.523 36.064  64.451  1.00 199.89 ? 37  TRP D CE2   1 
ATOM 3938 C CE3   . TRP D 1 37  ? 17.371 34.615  63.880  1.00 224.82 ? 37  TRP D CE3   1 
ATOM 3939 C CZ2   . TRP D 1 37  ? 15.731 35.873  65.816  1.00 218.97 ? 37  TRP D CZ2   1 
ATOM 3940 C CZ3   . TRP D 1 37  ? 17.576 34.425  65.236  1.00 229.72 ? 37  TRP D CZ3   1 
ATOM 3941 C CH2   . TRP D 1 37  ? 16.761 35.051  66.187  1.00 224.57 ? 37  TRP D CH2   1 
ATOM 3942 N N     . THR D 1 38  ? 15.307 35.881  57.298  1.00 220.37 ? 38  THR D N     1 
ATOM 3943 C CA    . THR D 1 38  ? 15.735 35.770  55.908  1.00 236.90 ? 38  THR D CA    1 
ATOM 3944 C C     . THR D 1 38  ? 15.725 37.121  55.214  1.00 263.67 ? 38  THR D C     1 
ATOM 3945 O O     . THR D 1 38  ? 16.590 37.389  54.376  1.00 263.75 ? 38  THR D O     1 
ATOM 3946 C CB    . THR D 1 38  ? 14.847 34.778  55.136  1.00 255.70 ? 38  THR D CB    1 
ATOM 3947 O OG1   . THR D 1 38  ? 13.923 34.158  56.037  1.00 259.67 ? 38  THR D OG1   1 
ATOM 3948 C CG2   . THR D 1 38  ? 15.697 33.707  54.473  1.00 254.91 ? 38  THR D CG2   1 
ATOM 3949 N N     . LYS D 1 39  ? 14.764 37.977  55.547  1.00 274.36 ? 39  LYS D N     1 
ATOM 3950 C CA    . LYS D 1 39  ? 14.699 39.344  55.052  1.00 284.08 ? 39  LYS D CA    1 
ATOM 3951 C C     . LYS D 1 39  ? 15.305 40.262  56.107  1.00 275.26 ? 39  LYS D C     1 
ATOM 3952 O O     . LYS D 1 39  ? 14.854 40.267  57.258  1.00 290.67 ? 39  LYS D O     1 
ATOM 3953 C CB    . LYS D 1 39  ? 13.252 39.732  54.740  1.00 289.87 ? 39  LYS D CB    1 
ATOM 3954 C CG    . LYS D 1 39  ? 12.267 39.446  55.872  1.00 281.58 ? 39  LYS D CG    1 
ATOM 3955 C CD    . LYS D 1 39  ? 10.830 39.382  55.382  1.00 288.97 ? 39  LYS D CD    1 
ATOM 3956 C CE    . LYS D 1 39  ? 10.570 38.101  54.608  1.00 294.91 ? 39  LYS D CE    1 
ATOM 3957 N NZ    . LYS D 1 39  ? 9.132  37.946  54.257  1.00 302.07 ? 39  LYS D NZ    1 
ATOM 3958 N N     . ASN D 1 40  ? 16.328 41.023  55.714  1.00 254.14 ? 40  ASN D N     1 
ATOM 3959 C CA    . ASN D 1 40  ? 17.090 41.905  56.606  1.00 230.07 ? 40  ASN D CA    1 
ATOM 3960 C C     . ASN D 1 40  ? 17.335 41.229  57.955  1.00 203.22 ? 40  ASN D C     1 
ATOM 3961 O O     . ASN D 1 40  ? 16.870 41.670  59.006  1.00 180.15 ? 40  ASN D O     1 
ATOM 3962 C CB    . ASN D 1 40  ? 16.410 43.271  56.769  1.00 253.11 ? 40  ASN D CB    1 
ATOM 3963 C CG    . ASN D 1 40  ? 14.950 43.173  57.192  1.00 261.60 ? 40  ASN D CG    1 
ATOM 3964 O OD1   . ASN D 1 40  ? 14.634 43.163  58.383  1.00 268.02 ? 40  ASN D OD1   1 
ATOM 3965 N ND2   . ASN D 1 40  ? 14.053 43.113  56.214  1.00 251.52 ? 40  ASN D ND2   1 
ATOM 3966 N N     . TRP D 1 41  ? 18.088 40.126  57.898  1.00 212.27 ? 41  TRP D N     1 
ATOM 3967 C CA    . TRP D 1 41  ? 18.188 39.238  59.052  1.00 230.51 ? 41  TRP D CA    1 
ATOM 3968 C C     . TRP D 1 41  ? 18.820 39.926  60.257  1.00 224.25 ? 41  TRP D C     1 
ATOM 3969 O O     . TRP D 1 41  ? 18.416 39.675  61.397  1.00 227.42 ? 41  TRP D O     1 
ATOM 3970 C CB    . TRP D 1 41  ? 18.981 37.987  58.675  1.00 225.97 ? 41  TRP D CB    1 
ATOM 3971 C CG    . TRP D 1 41  ? 20.399 38.277  58.293  1.00 213.04 ? 41  TRP D CG    1 
ATOM 3972 C CD1   . TRP D 1 41  ? 20.879 38.520  57.039  1.00 196.09 ? 41  TRP D CD1   1 
ATOM 3973 C CD2   . TRP D 1 41  ? 21.526 38.353  59.175  1.00 216.74 ? 41  TRP D CD2   1 
ATOM 3974 N NE1   . TRP D 1 41  ? 22.233 38.745  57.086  1.00 196.32 ? 41  TRP D NE1   1 
ATOM 3975 C CE2   . TRP D 1 41  ? 22.655 38.647  58.385  1.00 198.08 ? 41  TRP D CE2   1 
ATOM 3976 C CE3   . TRP D 1 41  ? 21.689 38.201  60.556  1.00 197.34 ? 41  TRP D CE3   1 
ATOM 3977 C CZ2   . TRP D 1 41  ? 23.929 38.793  58.930  1.00 183.12 ? 41  TRP D CZ2   1 
ATOM 3978 C CZ3   . TRP D 1 41  ? 22.954 38.347  61.095  1.00 168.54 ? 41  TRP D CZ3   1 
ATOM 3979 C CH2   . TRP D 1 41  ? 24.057 38.639  60.284  1.00 179.86 ? 41  TRP D CH2   1 
ATOM 3980 N N     . GLU D 1 42  ? 19.802 40.804  60.037  1.00 211.80 ? 42  GLU D N     1 
ATOM 3981 C CA    . GLU D 1 42  ? 20.395 41.507  61.172  1.00 196.44 ? 42  GLU D CA    1 
ATOM 3982 C C     . GLU D 1 42  ? 19.404 42.500  61.769  1.00 217.58 ? 42  GLU D C     1 
ATOM 3983 O O     . GLU D 1 42  ? 19.250 42.578  62.994  1.00 216.50 ? 42  GLU D O     1 
ATOM 3984 C CB    . GLU D 1 42  ? 21.708 42.186  60.775  1.00 197.42 ? 42  GLU D CB    1 
ATOM 3985 C CG    . GLU D 1 42  ? 21.663 43.077  59.553  1.00 246.96 ? 42  GLU D CG    1 
ATOM 3986 C CD    . GLU D 1 42  ? 23.006 43.734  59.290  1.00 235.99 ? 42  GLU D CD    1 
ATOM 3987 O OE1   . GLU D 1 42  ? 23.891 43.647  60.170  1.00 190.92 ? 42  GLU D OE1   1 
ATOM 3988 O OE2   . GLU D 1 42  ? 23.178 44.332  58.207  1.00 240.27 ? 42  GLU D OE2   1 
ATOM 3989 N N     . ARG D 1 43  ? 18.732 43.279  60.916  1.00 228.44 ? 43  ARG D N     1 
ATOM 3990 C CA    . ARG D 1 43  ? 17.673 44.159  61.400  1.00 230.65 ? 43  ARG D CA    1 
ATOM 3991 C C     . ARG D 1 43  ? 16.575 43.353  62.079  1.00 226.56 ? 43  ARG D C     1 
ATOM 3992 O O     . ARG D 1 43  ? 16.082 43.733  63.147  1.00 229.10 ? 43  ARG D O     1 
ATOM 3993 C CB    . ARG D 1 43  ? 17.096 44.987  60.252  1.00 238.31 ? 43  ARG D CB    1 
ATOM 3994 C CG    . ARG D 1 43  ? 16.032 45.985  60.692  1.00 228.21 ? 43  ARG D CG    1 
ATOM 3995 C CD    . ARG D 1 43  ? 15.513 46.812  59.527  1.00 233.01 ? 43  ARG D CD    1 
ATOM 3996 N NE    . ARG D 1 43  ? 14.694 47.935  59.976  1.00 265.84 ? 43  ARG D NE    1 
ATOM 3997 C CZ    . ARG D 1 43  ? 13.388 47.863  60.220  1.00 279.88 ? 43  ARG D CZ    1 
ATOM 3998 N NH1   . ARG D 1 43  ? 12.743 46.715  60.061  1.00 296.23 ? 43  ARG D NH1   1 
ATOM 3999 N NH2   . ARG D 1 43  ? 12.726 48.939  60.625  1.00 256.74 ? 43  ARG D NH2   1 
ATOM 4000 N N     . SER D 1 44  ? 16.176 42.238  61.463  1.00 192.81 ? 44  SER D N     1 
ATOM 4001 C CA    . SER D 1 44  ? 15.124 41.405  62.034  1.00 193.91 ? 44  SER D CA    1 
ATOM 4002 C C     . SER D 1 44  ? 15.551 40.820  63.376  1.00 200.47 ? 44  SER D C     1 
ATOM 4003 O O     . SER D 1 44  ? 14.749 40.752  64.315  1.00 208.42 ? 44  SER D O     1 
ATOM 4004 C CB    . SER D 1 44  ? 14.750 40.293  61.054  1.00 189.21 ? 44  SER D CB    1 
ATOM 4005 O OG    . SER D 1 44  ? 13.614 39.576  61.502  1.00 216.41 ? 44  SER D OG    1 
ATOM 4006 N N     . VAL D 1 45  ? 16.814 40.398  63.488  1.00 172.52 ? 45  VAL D N     1 
ATOM 4007 C CA    . VAL D 1 45  ? 17.307 39.853  64.751  1.00 193.47 ? 45  VAL D CA    1 
ATOM 4008 C C     . VAL D 1 45  ? 17.249 40.910  65.846  1.00 217.67 ? 45  VAL D C     1 
ATOM 4009 O O     . VAL D 1 45  ? 16.756 40.656  66.950  1.00 223.03 ? 45  VAL D O     1 
ATOM 4010 C CB    . VAL D 1 45  ? 18.732 39.295  64.582  1.00 182.32 ? 45  VAL D CB    1 
ATOM 4011 C CG1   . VAL D 1 45  ? 19.425 39.190  65.931  1.00 156.74 ? 45  VAL D CG1   1 
ATOM 4012 C CG2   . VAL D 1 45  ? 18.691 37.932  63.918  1.00 196.11 ? 45  VAL D CG2   1 
ATOM 4013 N N     . ALA D 1 46  ? 17.768 42.108  65.562  1.00 222.06 ? 46  ALA D N     1 
ATOM 4014 C CA    . ALA D 1 46  ? 17.742 43.177  66.556  1.00 227.82 ? 46  ALA D CA    1 
ATOM 4015 C C     . ALA D 1 46  ? 16.313 43.535  66.944  1.00 223.03 ? 46  ALA D C     1 
ATOM 4016 O O     . ALA D 1 46  ? 16.014 43.748  68.127  1.00 223.51 ? 46  ALA D O     1 
ATOM 4017 C CB    . ALA D 1 46  ? 18.481 44.405  66.024  1.00 226.94 ? 46  ALA D CB    1 
ATOM 4018 N N     . ARG D 1 47  ? 15.414 43.598  65.958  1.00 199.56 ? 47  ARG D N     1 
ATOM 4019 C CA    . ARG D 1 47  ? 14.020 43.921  66.238  1.00 198.09 ? 47  ARG D CA    1 
ATOM 4020 C C     . ARG D 1 47  ? 13.377 42.869  67.131  1.00 226.45 ? 47  ARG D C     1 
ATOM 4021 O O     . ARG D 1 47  ? 12.641 43.205  68.065  1.00 242.77 ? 47  ARG D O     1 
ATOM 4022 C CB    . ARG D 1 47  ? 13.245 44.060  64.928  1.00 196.67 ? 47  ARG D CB    1 
ATOM 4023 C CG    . ARG D 1 47  ? 11.776 44.406  65.100  1.00 195.21 ? 47  ARG D CG    1 
ATOM 4024 C CD    . ARG D 1 47  ? 11.050 44.438  63.763  1.00 206.79 ? 47  ARG D CD    1 
ATOM 4025 N NE    . ARG D 1 47  ? 11.036 43.130  63.112  1.00 233.07 ? 47  ARG D NE    1 
ATOM 4026 C CZ    . ARG D 1 47  ? 11.823 42.789  62.096  1.00 221.81 ? 47  ARG D CZ    1 
ATOM 4027 N NH1   . ARG D 1 47  ? 12.689 43.664  61.604  1.00 203.82 ? 47  ARG D NH1   1 
ATOM 4028 N NH2   . ARG D 1 47  ? 11.740 41.575  61.570  1.00 217.29 ? 47  ARG D NH2   1 
ATOM 4029 N N     . ASP D 1 48  ? 13.648 41.588  66.863  1.00 220.07 ? 48  ASP D N     1 
ATOM 4030 C CA    . ASP D 1 48  ? 13.068 40.521  67.672  1.00 216.68 ? 48  ASP D CA    1 
ATOM 4031 C C     . ASP D 1 48  ? 13.686 40.461  69.062  1.00 190.60 ? 48  ASP D C     1 
ATOM 4032 O O     . ASP D 1 48  ? 13.016 40.056  70.019  1.00 196.49 ? 48  ASP D O     1 
ATOM 4033 C CB    . ASP D 1 48  ? 13.229 39.178  66.961  1.00 220.83 ? 48  ASP D CB    1 
ATOM 4034 C CG    . ASP D 1 48  ? 12.350 39.059  65.733  1.00 235.07 ? 48  ASP D CG    1 
ATOM 4035 O OD1   . ASP D 1 48  ? 11.262 39.674  65.718  1.00 235.31 ? 48  ASP D OD1   1 
ATOM 4036 O OD2   . ASP D 1 48  ? 12.744 38.351  64.784  1.00 247.27 ? 48  ASP D OD2   1 
ATOM 4037 N N     . LEU D 1 49  ? 14.953 40.855  69.195  1.00 176.52 ? 49  LEU D N     1 
ATOM 4038 C CA    . LEU D 1 49  ? 15.630 40.769  70.484  1.00 202.08 ? 49  LEU D CA    1 
ATOM 4039 C C     . LEU D 1 49  ? 15.317 41.957  71.383  1.00 207.18 ? 49  LEU D C     1 
ATOM 4040 O O     . LEU D 1 49  ? 15.361 41.824  72.611  1.00 212.82 ? 49  LEU D O     1 
ATOM 4041 C CB    . LEU D 1 49  ? 17.141 40.642  70.279  1.00 184.61 ? 49  LEU D CB    1 
ATOM 4042 C CG    . LEU D 1 49  ? 17.617 39.322  69.666  1.00 175.31 ? 49  LEU D CG    1 
ATOM 4043 C CD1   . LEU D 1 49  ? 19.131 39.227  69.675  1.00 155.98 ? 49  LEU D CD1   1 
ATOM 4044 C CD2   . LEU D 1 49  ? 17.006 38.140  70.405  1.00 168.73 ? 49  LEU D CD2   1 
ATOM 4045 N N     . THR D 1 50  ? 15.005 43.114  70.807  1.00 214.24 ? 50  THR D N     1 
ATOM 4046 C CA    . THR D 1 50  ? 14.665 44.283  71.607  1.00 223.01 ? 50  THR D CA    1 
ATOM 4047 C C     . THR D 1 50  ? 13.182 44.376  71.958  1.00 219.41 ? 50  THR D C     1 
ATOM 4048 O O     . THR D 1 50  ? 12.784 45.352  72.604  1.00 212.80 ? 50  THR D O     1 
ATOM 4049 C CB    . THR D 1 50  ? 15.101 45.565  70.885  1.00 217.16 ? 50  THR D CB    1 
ATOM 4050 O OG1   . THR D 1 50  ? 14.514 45.608  69.577  1.00 236.80 ? 50  THR D OG1   1 
ATOM 4051 C CG2   . THR D 1 50  ? 16.616 45.623  70.765  1.00 193.84 ? 50  THR D CG2   1 
ATOM 4052 N N     . ARG D 1 51  ? 12.354 43.410  71.543  1.00 231.66 ? 51  ARG D N     1 
ATOM 4053 C CA    . ARG D 1 51  ? 10.927 43.476  71.855  1.00 243.73 ? 51  ARG D CA    1 
ATOM 4054 C C     . ARG D 1 51  ? 10.701 43.564  73.361  1.00 251.19 ? 51  ARG D C     1 
ATOM 4055 O O     . ARG D 1 51  ? 10.127 44.536  73.865  1.00 270.08 ? 51  ARG D O     1 
ATOM 4056 C CB    . ARG D 1 51  ? 10.208 42.250  71.284  1.00 246.63 ? 51  ARG D CB    1 
ATOM 4057 C CG    . ARG D 1 51  ? 10.389 42.033  69.793  1.00 246.75 ? 51  ARG D CG    1 
ATOM 4058 C CD    . ARG D 1 51  ? 9.401  42.849  68.976  1.00 261.37 ? 51  ARG D CD    1 
ATOM 4059 N NE    . ARG D 1 51  ? 8.050  42.301  69.055  1.00 280.52 ? 51  ARG D NE    1 
ATOM 4060 C CZ    . ARG D 1 51  ? 7.557  41.405  68.206  1.00 281.82 ? 51  ARG D CZ    1 
ATOM 4061 N NH1   . ARG D 1 51  ? 6.316  40.960  68.354  1.00 283.29 ? 51  ARG D NH1   1 
ATOM 4062 N NH2   . ARG D 1 51  ? 8.303  40.954  67.207  1.00 276.37 ? 51  ARG D NH2   1 
ATOM 4063 N N     . TYR D 1 52  ? 11.152 42.550  74.095  1.00 241.22 ? 52  TYR D N     1 
ATOM 4064 C CA    . TYR D 1 52  ? 11.136 42.505  75.558  1.00 246.36 ? 52  TYR D CA    1 
ATOM 4065 C C     . TYR D 1 52  ? 12.574 42.423  76.052  1.00 253.28 ? 52  TYR D C     1 
ATOM 4066 O O     . TYR D 1 52  ? 13.072 41.333  76.342  1.00 271.50 ? 52  TYR D O     1 
ATOM 4067 C CB    . TYR D 1 52  ? 10.272 41.350  76.111  1.00 270.16 ? 52  TYR D CB    1 
ATOM 4068 C CG    . TYR D 1 52  ? 8.811  41.429  75.733  1.00 301.23 ? 52  TYR D CG    1 
ATOM 4069 C CD1   . TYR D 1 52  ? 8.186  42.661  75.585  1.00 312.62 ? 52  TYR D CD1   1 
ATOM 4070 C CD2   . TYR D 1 52  ? 8.044  40.283  75.573  1.00 314.46 ? 52  TYR D CD2   1 
ATOM 4071 C CE1   . TYR D 1 52  ? 6.848  42.751  75.262  1.00 319.33 ? 52  TYR D CE1   1 
ATOM 4072 C CE2   . TYR D 1 52  ? 6.701  40.363  75.248  1.00 323.41 ? 52  TYR D CE2   1 
ATOM 4073 C CZ    . TYR D 1 52  ? 6.109  41.601  75.094  1.00 324.33 ? 52  TYR D CZ    1 
ATOM 4074 O OH    . TYR D 1 52  ? 4.775  41.692  74.772  1.00 330.88 ? 52  TYR D OH    1 
ATOM 4075 N N     . ASN D 1 53  ? 13.242 43.584  76.110  1.00 249.13 ? 53  ASN D N     1 
ATOM 4076 C CA    . ASN D 1 53  ? 14.647 43.750  76.478  1.00 253.70 ? 53  ASN D CA    1 
ATOM 4077 C C     . ASN D 1 53  ? 15.059 42.746  77.549  1.00 250.76 ? 53  ASN D C     1 
ATOM 4078 O O     . ASN D 1 53  ? 14.678 42.889  78.719  1.00 252.72 ? 53  ASN D O     1 
ATOM 4079 C CB    . ASN D 1 53  ? 14.895 45.179  76.964  1.00 253.87 ? 53  ASN D CB    1 
ATOM 4080 C CG    . ASN D 1 53  ? 16.358 45.458  77.241  1.00 267.86 ? 53  ASN D CG    1 
ATOM 4081 O OD1   . ASN D 1 53  ? 17.243 44.766  76.736  1.00 271.22 ? 53  ASN D OD1   1 
ATOM 4082 N ND2   . ASN D 1 53  ? 16.622 46.481  78.045  1.00 267.41 ? 53  ASN D ND2   1 
ATOM 4083 N N     . PRO D 1 54  ? 15.826 41.723  77.190  1.00 234.38 ? 54  PRO D N     1 
ATOM 4084 C CA    . PRO D 1 54  ? 16.120 40.633  78.122  1.00 215.83 ? 54  PRO D CA    1 
ATOM 4085 C C     . PRO D 1 54  ? 17.357 40.913  78.969  1.00 215.16 ? 54  PRO D C     1 
ATOM 4086 O O     . PRO D 1 54  ? 18.108 41.861  78.736  1.00 210.62 ? 54  PRO D O     1 
ATOM 4087 C CB    . PRO D 1 54  ? 16.362 39.448  77.180  1.00 201.80 ? 54  PRO D CB    1 
ATOM 4088 C CG    . PRO D 1 54  ? 16.980 40.081  75.967  1.00 194.41 ? 54  PRO D CG    1 
ATOM 4089 C CD    . PRO D 1 54  ? 16.414 41.484  75.859  1.00 205.15 ? 54  PRO D CD    1 
ATOM 4090 N N     . ASP D 1 55  ? 17.543 40.065  79.980  1.00 220.47 ? 55  ASP D N     1 
ATOM 4091 C CA    . ASP D 1 55  ? 18.741 40.103  80.809  1.00 216.21 ? 55  ASP D CA    1 
ATOM 4092 C C     . ASP D 1 55  ? 19.743 39.013  80.460  1.00 211.57 ? 55  ASP D C     1 
ATOM 4093 O O     . ASP D 1 55  ? 20.947 39.212  80.649  1.00 219.36 ? 55  ASP D O     1 
ATOM 4094 C CB    . ASP D 1 55  ? 18.367 39.987  82.291  1.00 215.02 ? 55  ASP D CB    1 
ATOM 4095 C CG    . ASP D 1 55  ? 17.625 41.207  82.801  1.00 229.25 ? 55  ASP D CG    1 
ATOM 4096 O OD1   . ASP D 1 55  ? 18.033 42.337  82.461  1.00 221.20 ? 55  ASP D OD1   1 
ATOM 4097 O OD2   . ASP D 1 55  ? 16.640 41.036  83.549  1.00 247.67 ? 55  ASP D OD2   1 
ATOM 4098 N N     . VAL D 1 56  ? 19.278 37.866  79.973  1.00 201.05 ? 56  VAL D N     1 
ATOM 4099 C CA    . VAL D 1 56  ? 20.148 36.787  79.518  1.00 189.62 ? 56  VAL D CA    1 
ATOM 4100 C C     . VAL D 1 56  ? 19.590 36.244  78.208  1.00 203.54 ? 56  VAL D C     1 
ATOM 4101 O O     . VAL D 1 56  ? 18.371 36.182  78.019  1.00 239.26 ? 56  VAL D O     1 
ATOM 4102 C CB    . VAL D 1 56  ? 20.284 35.677  80.583  1.00 177.45 ? 56  VAL D CB    1 
ATOM 4103 C CG1   . VAL D 1 56  ? 18.927 35.096  80.933  1.00 190.35 ? 56  VAL D CG1   1 
ATOM 4104 C CG2   . VAL D 1 56  ? 21.237 34.588  80.110  1.00 173.90 ? 56  VAL D CG2   1 
ATOM 4105 N N     . VAL D 1 57  ? 20.484 35.868  77.296  1.00 182.57 ? 57  VAL D N     1 
ATOM 4106 C CA    . VAL D 1 57  ? 20.116 35.240  76.032  1.00 160.64 ? 57  VAL D CA    1 
ATOM 4107 C C     . VAL D 1 57  ? 20.792 33.878  75.959  1.00 160.07 ? 57  VAL D C     1 
ATOM 4108 O O     . VAL D 1 57  ? 22.012 33.775  76.134  1.00 207.86 ? 57  VAL D O     1 
ATOM 4109 C CB    . VAL D 1 57  ? 20.502 36.116  74.825  1.00 155.73 ? 57  VAL D CB    1 
ATOM 4110 C CG1   . VAL D 1 57  ? 20.156 35.411  73.522  1.00 157.80 ? 57  VAL D CG1   1 
ATOM 4111 C CG2   . VAL D 1 57  ? 19.808 37.464  74.902  1.00 156.97 ? 57  VAL D CG2   1 
ATOM 4112 N N     . ILE D 1 58  ? 20.002 32.836  75.702  1.00 166.42 ? 58  ILE D N     1 
ATOM 4113 C CA    . ILE D 1 58  ? 20.485 31.460  75.662  1.00 167.56 ? 58  ILE D CA    1 
ATOM 4114 C C     . ILE D 1 58  ? 20.530 31.015  74.208  1.00 167.23 ? 58  ILE D C     1 
ATOM 4115 O O     . ILE D 1 58  ? 19.523 31.096  73.494  1.00 204.58 ? 58  ILE D O     1 
ATOM 4116 C CB    . ILE D 1 58  ? 19.585 30.521  76.484  1.00 176.22 ? 58  ILE D CB    1 
ATOM 4117 C CG1   . ILE D 1 58  ? 19.367 31.069  77.895  1.00 209.97 ? 58  ILE D CG1   1 
ATOM 4118 C CG2   . ILE D 1 58  ? 20.187 29.123  76.541  1.00 177.53 ? 58  ILE D CG2   1 
ATOM 4119 C CD1   . ILE D 1 58  ? 20.621 31.177  78.711  1.00 172.00 ? 58  ILE D CD1   1 
ATOM 4120 N N     . LEU D 1 59  ? 21.697 30.547  73.772  1.00 162.02 ? 59  LEU D N     1 
ATOM 4121 C CA    . LEU D 1 59  ? 21.898 30.063  72.415  1.00 183.25 ? 59  LEU D CA    1 
ATOM 4122 C C     . LEU D 1 59  ? 22.453 28.645  72.435  1.00 203.10 ? 59  LEU D C     1 
ATOM 4123 O O     . LEU D 1 59  ? 23.022 28.193  73.432  1.00 212.16 ? 59  LEU D O     1 
ATOM 4124 C CB    . LEU D 1 59  ? 22.845 30.985  71.636  1.00 183.83 ? 59  LEU D CB    1 
ATOM 4125 C CG    . LEU D 1 59  ? 22.536 32.481  71.704  1.00 185.97 ? 59  LEU D CG    1 
ATOM 4126 C CD1   . LEU D 1 59  ? 23.614 33.288  70.998  1.00 192.86 ? 59  LEU D CD1   1 
ATOM 4127 C CD2   . LEU D 1 59  ? 21.171 32.767  71.103  1.00 171.89 ? 59  LEU D CD2   1 
ATOM 4128 N N     . GLU D 1 60  ? 22.268 27.938  71.321  1.00 222.37 ? 60  GLU D N     1 
ATOM 4129 C CA    . GLU D 1 60  ? 22.835 26.608  71.137  1.00 243.47 ? 60  GLU D CA    1 
ATOM 4130 C C     . GLU D 1 60  ? 24.101 26.718  70.299  1.00 265.54 ? 60  GLU D C     1 
ATOM 4131 O O     . GLU D 1 60  ? 24.064 27.251  69.184  1.00 273.48 ? 60  GLU D O     1 
ATOM 4132 C CB    . GLU D 1 60  ? 21.870 25.667  70.423  1.00 249.05 ? 60  GLU D CB    1 
ATOM 4133 C CG    . GLU D 1 60  ? 22.364 24.234  70.440  1.00 255.61 ? 60  GLU D CG    1 
ATOM 4134 C CD    . GLU D 1 60  ? 21.839 23.422  69.279  1.00 277.02 ? 60  GLU D CD    1 
ATOM 4135 O OE1   . GLU D 1 60  ? 21.034 23.958  68.488  1.00 287.11 ? 60  GLU D OE1   1 
ATOM 4136 O OE2   . GLU D 1 60  ? 22.258 22.256  69.139  1.00 283.46 ? 60  GLU D OE2   1 
ATOM 4137 N N     . LYS D 1 61  ? 25.210 26.210  70.826  1.00 270.76 ? 61  LYS D N     1 
ATOM 4138 C CA    . LYS D 1 61  ? 26.470 26.274  70.099  1.00 264.07 ? 61  LYS D CA    1 
ATOM 4139 C C     . LYS D 1 61  ? 26.450 25.308  68.920  1.00 280.57 ? 61  LYS D C     1 
ATOM 4140 O O     . LYS D 1 61  ? 26.144 24.122  69.084  1.00 298.11 ? 61  LYS D O     1 
ATOM 4141 C CB    . LYS D 1 61  ? 27.628 25.942  71.039  1.00 252.03 ? 61  LYS D CB    1 
ATOM 4142 C CG    . LYS D 1 61  ? 29.003 25.992  70.399  1.00 245.35 ? 61  LYS D CG    1 
ATOM 4143 C CD    . LYS D 1 61  ? 29.354 27.388  69.924  1.00 246.75 ? 61  LYS D CD    1 
ATOM 4144 C CE    . LYS D 1 61  ? 30.823 27.475  69.545  1.00 242.42 ? 61  LYS D CE    1 
ATOM 4145 N NZ    . LYS D 1 61  ? 31.210 26.413  68.575  1.00 250.72 ? 61  LYS D NZ    1 
ATOM 4146 N N     . GLN D 1 62  ? 26.768 25.808  67.728  1.00 277.91 ? 62  GLN D N     1 
ATOM 4147 C CA    . GLN D 1 62  ? 26.915 24.963  66.553  1.00 279.31 ? 62  GLN D CA    1 
ATOM 4148 C C     . GLN D 1 62  ? 28.287 25.172  65.927  1.00 291.28 ? 62  GLN D C     1 
ATOM 4149 O O     . GLN D 1 62  ? 28.904 26.230  66.081  1.00 282.74 ? 62  GLN D O     1 
ATOM 4150 C CB    . GLN D 1 62  ? 25.820 25.229  65.510  1.00 269.62 ? 62  GLN D CB    1 
ATOM 4151 C CG    . GLN D 1 62  ? 24.404 25.100  66.041  1.00 274.45 ? 62  GLN D CG    1 
ATOM 4152 C CD    . GLN D 1 62  ? 23.424 24.661  64.970  1.00 284.97 ? 62  GLN D CD    1 
ATOM 4153 O OE1   . GLN D 1 62  ? 23.754 24.635  63.784  1.00 281.51 ? 62  GLN D OE1   1 
ATOM 4154 N NE2   . GLN D 1 62  ? 22.212 24.306  65.383  1.00 295.23 ? 62  GLN D NE2   1 
ATOM 4155 N N     . GLY D 1 63  ? 28.758 24.150  65.218  1.00 305.16 ? 63  GLY D N     1 
ATOM 4156 C CA    . GLY D 1 63  ? 29.976 24.253  64.440  1.00 315.91 ? 63  GLY D CA    1 
ATOM 4157 C C     . GLY D 1 63  ? 29.751 24.972  63.125  1.00 327.46 ? 63  GLY D C     1 
ATOM 4158 O O     . GLY D 1 63  ? 28.954 25.912  63.044  1.00 325.38 ? 63  GLY D O     1 
ATOM 4159 N N     . PHE D 1 64  ? 30.456 24.531  62.085  1.00 335.27 ? 64  PHE D N     1 
ATOM 4160 C CA    . PHE D 1 64  ? 30.324 25.076  60.739  1.00 342.74 ? 64  PHE D CA    1 
ATOM 4161 C C     . PHE D 1 64  ? 29.090 24.541  60.018  1.00 349.91 ? 64  PHE D C     1 
ATOM 4162 O O     . PHE D 1 64  ? 28.901 24.828  58.830  1.00 362.62 ? 64  PHE D O     1 
ATOM 4163 C CB    . PHE D 1 64  ? 31.591 24.766  59.929  1.00 340.57 ? 64  PHE D CB    1 
ATOM 4164 C CG    . PHE D 1 64  ? 31.626 25.417  58.573  1.00 339.21 ? 64  PHE D CG    1 
ATOM 4165 C CD1   . PHE D 1 64  ? 31.525 26.791  58.438  1.00 335.42 ? 64  PHE D CD1   1 
ATOM 4166 C CD2   . PHE D 1 64  ? 31.749 24.643  57.430  1.00 337.77 ? 64  PHE D CD2   1 
ATOM 4167 C CE1   . PHE D 1 64  ? 31.551 27.381  57.186  1.00 330.65 ? 64  PHE D CE1   1 
ATOM 4168 C CE2   . PHE D 1 64  ? 31.776 25.225  56.178  1.00 335.39 ? 64  PHE D CE2   1 
ATOM 4169 C CZ    . PHE D 1 64  ? 31.678 26.596  56.056  1.00 331.53 ? 64  PHE D CZ    1 
ATOM 4170 N N     . LYS D 1 65  ? 28.240 23.789  60.724  1.00 345.06 ? 65  LYS D N     1 
ATOM 4171 C CA    . LYS D 1 65  ? 27.110 23.118  60.088  1.00 336.69 ? 65  LYS D CA    1 
ATOM 4172 C C     . LYS D 1 65  ? 26.197 24.095  59.359  1.00 344.22 ? 65  LYS D C     1 
ATOM 4173 O O     . LYS D 1 65  ? 25.612 23.743  58.327  1.00 342.96 ? 65  LYS D O     1 
ATOM 4174 C CB    . LYS D 1 65  ? 26.308 22.344  61.135  1.00 327.41 ? 65  LYS D CB    1 
ATOM 4175 C CG    . LYS D 1 65  ? 27.154 21.580  62.141  1.00 305.48 ? 65  LYS D CG    1 
ATOM 4176 C CD    . LYS D 1 65  ? 26.280 20.955  63.217  1.00 294.95 ? 65  LYS D CD    1 
ATOM 4177 C CE    . LYS D 1 65  ? 27.113 20.257  64.278  1.00 283.14 ? 65  LYS D CE    1 
ATOM 4178 N NZ    . LYS D 1 65  ? 26.256 19.647  65.332  1.00 287.87 ? 65  LYS D NZ    1 
ATOM 4179 N N     . SER D 1 66  ? 26.065 25.315  59.864  1.00 338.10 ? 66  SER D N     1 
ATOM 4180 C CA    . SER D 1 66  ? 25.088 26.258  59.341  1.00 339.82 ? 66  SER D CA    1 
ATOM 4181 C C     . SER D 1 66  ? 25.619 27.666  59.518  1.00 323.53 ? 66  SER D C     1 
ATOM 4182 O O     . SER D 1 66  ? 26.450 27.921  60.401  1.00 316.11 ? 66  SER D O     1 
ATOM 4183 C CB    . SER D 1 66  ? 23.732 26.102  60.042  1.00 352.02 ? 66  SER D CB    1 
ATOM 4184 O OG    . SER D 1 66  ? 23.205 24.800  59.855  1.00 361.98 ? 66  SER D OG    1 
ATOM 4185 N N     . PRO D 1 67  ? 25.167 28.618  58.691  1.00 294.60 ? 67  PRO D N     1 
ATOM 4186 C CA    . PRO D 1 67  ? 25.536 30.027  58.885  1.00 268.71 ? 67  PRO D CA    1 
ATOM 4187 C C     . PRO D 1 67  ? 24.991 30.641  60.166  1.00 273.36 ? 67  PRO D C     1 
ATOM 4188 O O     . PRO D 1 67  ? 25.316 31.796  60.461  1.00 279.68 ? 67  PRO D O     1 
ATOM 4189 C CB    . PRO D 1 67  ? 24.945 30.719  57.645  1.00 264.37 ? 67  PRO D CB    1 
ATOM 4190 C CG    . PRO D 1 67  ? 23.872 29.804  57.173  1.00 286.78 ? 67  PRO D CG    1 
ATOM 4191 C CD    . PRO D 1 67  ? 24.356 28.421  57.476  1.00 290.97 ? 67  PRO D CD    1 
ATOM 4192 N N     . ASN D 1 68  ? 24.169 29.911  60.926  1.00 270.82 ? 68  ASN D N     1 
ATOM 4193 C CA    . ASN D 1 68  ? 23.601 30.418  62.172  1.00 266.37 ? 68  ASN D CA    1 
ATOM 4194 C C     . ASN D 1 68  ? 24.659 30.885  63.167  1.00 249.87 ? 68  ASN D C     1 
ATOM 4195 O O     . ASN D 1 68  ? 24.333 31.651  64.081  1.00 248.64 ? 68  ASN D O     1 
ATOM 4196 C CB    . ASN D 1 68  ? 22.718 29.345  62.815  1.00 281.60 ? 68  ASN D CB    1 
ATOM 4197 C CG    . ASN D 1 68  ? 23.404 27.994  62.903  1.00 288.94 ? 68  ASN D CG    1 
ATOM 4198 O OD1   . ASN D 1 68  ? 24.630 27.897  62.841  1.00 276.23 ? 68  ASN D OD1   1 
ATOM 4199 N ND2   . ASN D 1 68  ? 22.610 26.939  63.047  1.00 303.18 ? 68  ASN D ND2   1 
ATOM 4200 N N     . SER D 1 69  ? 25.909 30.436  63.025  1.00 241.26 ? 69  SER D N     1 
ATOM 4201 C CA    . SER D 1 69  ? 26.973 30.907  63.908  1.00 224.15 ? 69  SER D CA    1 
ATOM 4202 C C     . SER D 1 69  ? 27.192 32.410  63.759  1.00 192.21 ? 69  SER D C     1 
ATOM 4203 O O     . SER D 1 69  ? 27.498 33.104  64.740  1.00 206.21 ? 69  SER D O     1 
ATOM 4204 C CB    . SER D 1 69  ? 28.266 30.145  63.620  1.00 228.28 ? 69  SER D CB    1 
ATOM 4205 O OG    . SER D 1 69  ? 28.707 30.374  62.292  1.00 223.01 ? 69  SER D OG    1 
ATOM 4206 N N     . LYS D 1 70  ? 27.049 32.930  62.537  1.00 170.92 ? 70  LYS D N     1 
ATOM 4207 C CA    . LYS D 1 70  ? 27.180 34.369  62.334  1.00 168.87 ? 70  LYS D CA    1 
ATOM 4208 C C     . LYS D 1 70  ? 26.135 35.131  63.138  1.00 183.88 ? 70  LYS D C     1 
ATOM 4209 O O     . LYS D 1 70  ? 26.420 36.218  63.655  1.00 165.60 ? 70  LYS D O     1 
ATOM 4210 C CB    . LYS D 1 70  ? 27.072 34.701  60.841  1.00 159.54 ? 70  LYS D CB    1 
ATOM 4211 C CG    . LYS D 1 70  ? 25.653 34.954  60.339  1.00 174.70 ? 70  LYS D CG    1 
ATOM 4212 C CD    . LYS D 1 70  ? 25.595 35.056  58.826  1.00 201.43 ? 70  LYS D CD    1 
ATOM 4213 C CE    . LYS D 1 70  ? 24.169 35.283  58.335  1.00 185.42 ? 70  LYS D CE    1 
ATOM 4214 N NZ    . LYS D 1 70  ? 23.284 34.114  58.600  1.00 177.23 ? 70  LYS D NZ    1 
ATOM 4215 N N     . ILE D 1 71  ? 24.940 34.556  63.299  1.00 204.84 ? 71  ILE D N     1 
ATOM 4216 C CA    . ILE D 1 71  ? 23.932 35.176  64.150  1.00 210.24 ? 71  ILE D CA    1 
ATOM 4217 C C     . ILE D 1 71  ? 24.385 35.146  65.602  1.00 195.12 ? 71  ILE D C     1 
ATOM 4218 O O     . ILE D 1 71  ? 24.154 36.096  66.357  1.00 192.93 ? 71  ILE D O     1 
ATOM 4219 C CB    . ILE D 1 71  ? 22.572 34.481  63.961  1.00 218.05 ? 71  ILE D CB    1 
ATOM 4220 C CG1   . ILE D 1 71  ? 22.190 34.451  62.479  1.00 227.25 ? 71  ILE D CG1   1 
ATOM 4221 C CG2   . ILE D 1 71  ? 21.495 35.178  64.776  1.00 213.62 ? 71  ILE D CG2   1 
ATOM 4222 C CD1   . ILE D 1 71  ? 20.875 33.755  62.201  1.00 243.78 ? 71  ILE D CD1   1 
ATOM 4223 N N     . ILE D 1 72  ? 25.039 34.057  66.014  1.00 180.31 ? 72  ILE D N     1 
ATOM 4224 C CA    . ILE D 1 72  ? 25.546 33.958  67.381  1.00 152.81 ? 72  ILE D CA    1 
ATOM 4225 C C     . ILE D 1 72  ? 26.524 35.090  67.662  1.00 141.60 ? 72  ILE D C     1 
ATOM 4226 O O     . ILE D 1 72  ? 26.423 35.789  68.680  1.00 149.63 ? 72  ILE D O     1 
ATOM 4227 C CB    . ILE D 1 72  ? 26.196 32.582  67.616  1.00 135.18 ? 72  ILE D CB    1 
ATOM 4228 C CG1   . ILE D 1 72  ? 25.128 31.489  67.703  1.00 166.46 ? 72  ILE D CG1   1 
ATOM 4229 C CG2   . ILE D 1 72  ? 27.057 32.605  68.871  1.00 128.84 ? 72  ILE D CG2   1 
ATOM 4230 C CD1   . ILE D 1 72  ? 25.673 30.130  68.092  1.00 158.58 ? 72  ILE D CD1   1 
ATOM 4231 N N     . TYR D 1 73  ? 27.486 35.291  66.760  1.00 146.86 ? 73  TYR D N     1 
ATOM 4232 C CA    . TYR D 1 73  ? 28.485 36.329  67.000  1.00 168.00 ? 73  TYR D CA    1 
ATOM 4233 C C     . TYR D 1 73  ? 27.898 37.730  66.862  1.00 159.03 ? 73  TYR D C     1 
ATOM 4234 O O     . TYR D 1 73  ? 28.310 38.645  67.587  1.00 152.22 ? 73  TYR D O     1 
ATOM 4235 C CB    . TYR D 1 73  ? 29.676 36.140  66.059  1.00 173.64 ? 73  TYR D CB    1 
ATOM 4236 C CG    . TYR D 1 73  ? 30.494 34.909  66.382  1.00 171.21 ? 73  TYR D CG    1 
ATOM 4237 C CD1   . TYR D 1 73  ? 31.288 34.860  67.521  1.00 166.92 ? 73  TYR D CD1   1 
ATOM 4238 C CD2   . TYR D 1 73  ? 30.464 33.793  65.557  1.00 184.80 ? 73  TYR D CD2   1 
ATOM 4239 C CE1   . TYR D 1 73  ? 32.032 33.736  67.827  1.00 160.62 ? 73  TYR D CE1   1 
ATOM 4240 C CE2   . TYR D 1 73  ? 31.206 32.663  65.855  1.00 192.18 ? 73  TYR D CE2   1 
ATOM 4241 C CZ    . TYR D 1 73  ? 31.988 32.642  66.990  1.00 177.17 ? 73  TYR D CZ    1 
ATOM 4242 O OH    . TYR D 1 73  ? 32.729 31.522  67.292  1.00 194.88 ? 73  TYR D OH    1 
ATOM 4243 N N     . PHE D 1 74  ? 26.918 37.916  65.971  1.00 177.57 ? 74  PHE D N     1 
ATOM 4244 C CA    . PHE D 1 74  ? 26.224 39.198  65.899  1.00 169.49 ? 74  PHE D CA    1 
ATOM 4245 C C     . PHE D 1 74  ? 25.498 39.509  67.204  1.00 159.18 ? 74  PHE D C     1 
ATOM 4246 O O     . PHE D 1 74  ? 25.548 40.642  67.695  1.00 130.35 ? 74  PHE D O     1 
ATOM 4247 C CB    . PHE D 1 74  ? 25.250 39.199  64.720  1.00 149.22 ? 74  PHE D CB    1 
ATOM 4248 C CG    . PHE D 1 74  ? 24.480 40.483  64.563  1.00 149.00 ? 74  PHE D CG    1 
ATOM 4249 C CD1   . PHE D 1 74  ? 23.267 40.670  65.208  1.00 155.03 ? 74  PHE D CD1   1 
ATOM 4250 C CD2   . PHE D 1 74  ? 24.966 41.498  63.757  1.00 164.65 ? 74  PHE D CD2   1 
ATOM 4251 C CE1   . PHE D 1 74  ? 22.560 41.849  65.060  1.00 158.67 ? 74  PHE D CE1   1 
ATOM 4252 C CE2   . PHE D 1 74  ? 24.261 42.678  63.600  1.00 188.91 ? 74  PHE D CE2   1 
ATOM 4253 C CZ    . PHE D 1 74  ? 23.058 42.854  64.255  1.00 181.83 ? 74  PHE D CZ    1 
ATOM 4254 N N     . ILE D 1 75  ? 24.815 38.515  67.778  1.00 158.28 ? 75  ILE D N     1 
ATOM 4255 C CA    . ILE D 1 75  ? 24.108 38.727  69.038  1.00 153.56 ? 75  ILE D CA    1 
ATOM 4256 C C     . ILE D 1 75  ? 25.096 39.022  70.157  1.00 153.70 ? 75  ILE D C     1 
ATOM 4257 O O     . ILE D 1 75  ? 24.851 39.887  71.007  1.00 148.77 ? 75  ILE D O     1 
ATOM 4258 C CB    . ILE D 1 75  ? 23.220 37.514  69.369  1.00 160.19 ? 75  ILE D CB    1 
ATOM 4259 C CG1   . ILE D 1 75  ? 22.095 37.380  68.341  1.00 171.00 ? 75  ILE D CG1   1 
ATOM 4260 C CG2   . ILE D 1 75  ? 22.651 37.631  70.775  1.00 159.68 ? 75  ILE D CG2   1 
ATOM 4261 C CD1   . ILE D 1 75  ? 21.315 36.091  68.457  1.00 183.35 ? 75  ILE D CD1   1 
ATOM 4262 N N     . LYS D 1 76  ? 26.219 38.300  70.184  1.00 169.65 ? 76  LYS D N     1 
ATOM 4263 C CA    . LYS D 1 76  ? 27.247 38.578  71.182  1.00 161.06 ? 76  LYS D CA    1 
ATOM 4264 C C     . LYS D 1 76  ? 27.740 40.016  71.074  1.00 156.96 ? 76  LYS D C     1 
ATOM 4265 O O     . LYS D 1 76  ? 27.897 40.704  72.089  1.00 158.89 ? 76  LYS D O     1 
ATOM 4266 C CB    . LYS D 1 76  ? 28.408 37.594  71.041  1.00 157.42 ? 76  LYS D CB    1 
ATOM 4267 C CG    . LYS D 1 76  ? 28.123 36.222  71.633  1.00 179.50 ? 76  LYS D CG    1 
ATOM 4268 C CD    . LYS D 1 76  ? 29.322 35.297  71.510  1.00 187.63 ? 76  LYS D CD    1 
ATOM 4269 C CE    . LYS D 1 76  ? 30.441 35.717  72.451  1.00 186.17 ? 76  LYS D CE    1 
ATOM 4270 N NZ    . LYS D 1 76  ? 30.007 35.698  73.876  1.00 172.88 ? 76  LYS D NZ    1 
ATOM 4271 N N     . GLY D 1 77  ? 28.002 40.483  69.852  1.00 151.32 ? 77  GLY D N     1 
ATOM 4272 C CA    . GLY D 1 77  ? 28.442 41.859  69.679  1.00 149.95 ? 77  GLY D CA    1 
ATOM 4273 C C     . GLY D 1 77  ? 27.388 42.887  70.050  1.00 163.03 ? 77  GLY D C     1 
ATOM 4274 O O     . GLY D 1 77  ? 27.705 43.927  70.633  1.00 165.21 ? 77  GLY D O     1 
ATOM 4275 N N     . PHE D 1 78  ? 26.124 42.612  69.720  1.00 171.07 ? 78  PHE D N     1 
ATOM 4276 C CA    . PHE D 1 78  ? 25.060 43.587  69.949  1.00 175.31 ? 78  PHE D CA    1 
ATOM 4277 C C     . PHE D 1 78  ? 24.859 43.859  71.436  1.00 179.67 ? 78  PHE D C     1 
ATOM 4278 O O     . PHE D 1 78  ? 24.861 45.014  71.877  1.00 193.54 ? 78  PHE D O     1 
ATOM 4279 C CB    . PHE D 1 78  ? 23.761 43.089  69.312  1.00 180.99 ? 78  PHE D CB    1 
ATOM 4280 C CG    . PHE D 1 78  ? 22.628 44.076  69.377  1.00 202.48 ? 78  PHE D CG    1 
ATOM 4281 C CD1   . PHE D 1 78  ? 22.587 45.163  68.520  1.00 208.14 ? 78  PHE D CD1   1 
ATOM 4282 C CD2   . PHE D 1 78  ? 21.598 43.910  70.291  1.00 208.34 ? 78  PHE D CD2   1 
ATOM 4283 C CE1   . PHE D 1 78  ? 21.542 46.071  68.576  1.00 199.35 ? 78  PHE D CE1   1 
ATOM 4284 C CE2   . PHE D 1 78  ? 20.552 44.814  70.351  1.00 204.94 ? 78  PHE D CE2   1 
ATOM 4285 C CZ    . PHE D 1 78  ? 20.525 45.895  69.492  1.00 190.97 ? 78  PHE D CZ    1 
ATOM 4286 N N     . PHE D 1 79  ? 24.684 42.802  72.221  1.00 145.60 ? 79  PHE D N     1 
ATOM 4287 C CA    . PHE D 1 79  ? 24.403 42.882  73.649  1.00 149.36 ? 79  PHE D CA    1 
ATOM 4288 C C     . PHE D 1 79  ? 25.654 42.898  74.520  1.00 155.54 ? 79  PHE D C     1 
ATOM 4289 O O     . PHE D 1 79  ? 25.539 42.720  75.737  1.00 152.44 ? 79  PHE D O     1 
ATOM 4290 C CB    . PHE D 1 79  ? 23.487 41.731  74.065  1.00 167.84 ? 79  PHE D CB    1 
ATOM 4291 C CG    . PHE D 1 79  ? 22.066 41.898  73.608  1.00 208.58 ? 79  PHE D CG    1 
ATOM 4292 C CD1   . PHE D 1 79  ? 21.296 42.951  74.074  1.00 212.53 ? 79  PHE D CD1   1 
ATOM 4293 C CD2   . PHE D 1 79  ? 21.501 41.010  72.710  1.00 212.65 ? 79  PHE D CD2   1 
ATOM 4294 C CE1   . PHE D 1 79  ? 19.989 43.113  73.659  1.00 214.87 ? 79  PHE D CE1   1 
ATOM 4295 C CE2   . PHE D 1 79  ? 20.194 41.169  72.290  1.00 211.26 ? 79  PHE D CE2   1 
ATOM 4296 C CZ    . PHE D 1 79  ? 19.437 42.221  72.764  1.00 217.07 ? 79  PHE D CZ    1 
ATOM 4297 N N     . TYR D 1 80  ? 26.834 43.112  73.936  1.00 179.15 ? 80  TYR D N     1 
ATOM 4298 C CA    . TYR D 1 80  ? 28.090 43.033  74.677  1.00 182.67 ? 80  TYR D CA    1 
ATOM 4299 C C     . TYR D 1 80  ? 28.175 44.005  75.848  1.00 207.90 ? 80  TYR D C     1 
ATOM 4300 O O     . TYR D 1 80  ? 28.226 43.575  77.005  1.00 218.14 ? 80  TYR D O     1 
ATOM 4301 C CB    . TYR D 1 80  ? 29.264 43.290  73.730  1.00 169.74 ? 80  TYR D CB    1 
ATOM 4302 C CG    . TYR D 1 80  ? 30.612 42.969  74.328  1.00 170.55 ? 80  TYR D CG    1 
ATOM 4303 C CD1   . TYR D 1 80  ? 30.959 41.665  74.656  1.00 187.86 ? 80  TYR D CD1   1 
ATOM 4304 C CD2   . TYR D 1 80  ? 31.538 43.976  74.574  1.00 162.23 ? 80  TYR D CD2   1 
ATOM 4305 C CE1   . TYR D 1 80  ? 32.193 41.373  75.207  1.00 171.49 ? 80  TYR D CE1   1 
ATOM 4306 C CE2   . TYR D 1 80  ? 32.772 43.694  75.123  1.00 157.95 ? 80  TYR D CE2   1 
ATOM 4307 C CZ    . TYR D 1 80  ? 33.094 42.391  75.438  1.00 156.53 ? 80  TYR D CZ    1 
ATOM 4308 O OH    . TYR D 1 80  ? 34.320 42.103  75.984  1.00 152.91 ? 80  TYR D OH    1 
ATOM 4309 N N     . ASN D 1 81  ? 28.193 45.309  75.575  1.00 209.50 ? 81  ASN D N     1 
ATOM 4310 C CA    . ASN D 1 81  ? 28.307 46.267  76.669  1.00 206.77 ? 81  ASN D CA    1 
ATOM 4311 C C     . ASN D 1 81  ? 26.985 46.449  77.402  1.00 215.86 ? 81  ASN D C     1 
ATOM 4312 O O     . ASN D 1 81  ? 26.982 46.837  78.575  1.00 229.60 ? 81  ASN D O     1 
ATOM 4313 C CB    . ASN D 1 81  ? 28.826 47.612  76.155  1.00 207.42 ? 81  ASN D CB    1 
ATOM 4314 C CG    . ASN D 1 81  ? 28.096 48.088  74.918  1.00 219.92 ? 81  ASN D CG    1 
ATOM 4315 O OD1   . ASN D 1 81  ? 27.062 47.537  74.539  1.00 238.32 ? 81  ASN D OD1   1 
ATOM 4316 N ND2   . ASN D 1 81  ? 28.631 49.122  74.281  1.00 213.23 ? 81  ASN D ND2   1 
ATOM 4317 N N     . SER D 1 82  ? 25.866 46.183  76.730  1.00 209.88 ? 82  SER D N     1 
ATOM 4318 C CA    . SER D 1 82  ? 24.552 46.318  77.342  1.00 215.40 ? 82  SER D CA    1 
ATOM 4319 C C     . SER D 1 82  ? 24.430 45.433  78.582  1.00 193.36 ? 82  SER D C     1 
ATOM 4320 O O     . SER D 1 82  ? 25.219 44.510  78.807  1.00 184.75 ? 82  SER D O     1 
ATOM 4321 C CB    . SER D 1 82  ? 23.457 45.965  76.335  1.00 213.51 ? 82  SER D CB    1 
ATOM 4322 O OG    . SER D 1 82  ? 23.500 46.830  75.213  1.00 198.68 ? 82  SER D OG    1 
ATOM 4323 N N     . ASN D 1 83  ? 23.408 45.729  79.390  1.00 202.77 ? 83  ASN D N     1 
ATOM 4324 C CA    . ASN D 1 83  ? 23.239 45.055  80.675  1.00 228.69 ? 83  ASN D CA    1 
ATOM 4325 C C     . ASN D 1 83  ? 23.066 43.550  80.516  1.00 222.27 ? 83  ASN D C     1 
ATOM 4326 O O     . ASN D 1 83  ? 23.380 42.790  81.440  1.00 198.02 ? 83  ASN D O     1 
ATOM 4327 C CB    . ASN D 1 83  ? 22.038 45.645  81.413  1.00 260.89 ? 83  ASN D CB    1 
ATOM 4328 C CG    . ASN D 1 83  ? 20.751 45.527  80.616  1.00 272.63 ? 83  ASN D CG    1 
ATOM 4329 O OD1   . ASN D 1 83  ? 20.764 45.565  79.385  1.00 263.18 ? 83  ASN D OD1   1 
ATOM 4330 N ND2   . ASN D 1 83  ? 19.633 45.381  81.316  1.00 276.17 ? 83  ASN D ND2   1 
ATOM 4331 N N     . THR D 1 84  ? 22.575 43.102  79.366  1.00 243.34 ? 84  THR D N     1 
ATOM 4332 C CA    . THR D 1 84  ? 22.319 41.686  79.164  1.00 247.48 ? 84  THR D CA    1 
ATOM 4333 C C     . THR D 1 84  ? 23.629 40.917  79.003  1.00 239.39 ? 84  THR D C     1 
ATOM 4334 O O     . THR D 1 84  ? 24.675 41.477  78.663  1.00 240.33 ? 84  THR D O     1 
ATOM 4335 C CB    . THR D 1 84  ? 21.432 41.470  77.939  1.00 256.89 ? 84  THR D CB    1 
ATOM 4336 O OG1   . THR D 1 84  ? 22.215 40.927  76.870  1.00 268.98 ? 84  THR D OG1   1 
ATOM 4337 C CG2   . THR D 1 84  ? 20.825 42.791  77.489  1.00 246.96 ? 84  THR D CG2   1 
ATOM 4338 N N     . LYS D 1 85  ? 23.557 39.611  79.255  1.00 220.44 ? 85  LYS D N     1 
ATOM 4339 C CA    . LYS D 1 85  ? 24.710 38.724  79.161  1.00 200.18 ? 85  LYS D CA    1 
ATOM 4340 C C     . LYS D 1 85  ? 24.332 37.520  78.314  1.00 205.49 ? 85  LYS D C     1 
ATOM 4341 O O     . LYS D 1 85  ? 23.433 36.757  78.682  1.00 203.89 ? 85  LYS D O     1 
ATOM 4342 C CB    . LYS D 1 85  ? 25.184 38.282  80.548  1.00 198.76 ? 85  LYS D CB    1 
ATOM 4343 C CG    . LYS D 1 85  ? 25.597 39.427  81.458  1.00 201.61 ? 85  LYS D CG    1 
ATOM 4344 C CD    . LYS D 1 85  ? 26.162 38.915  82.771  1.00 214.34 ? 85  LYS D CD    1 
ATOM 4345 C CE    . LYS D 1 85  ? 27.441 38.123  82.550  1.00 228.31 ? 85  LYS D CE    1 
ATOM 4346 N NZ    . LYS D 1 85  ? 28.508 38.953  81.924  1.00 217.23 ? 85  LYS D NZ    1 
ATOM 4347 N N     . VAL D 1 86  ? 25.019 37.350  77.189  1.00 209.40 ? 86  VAL D N     1 
ATOM 4348 C CA    . VAL D 1 86  ? 24.741 36.265  76.255  1.00 178.47 ? 86  VAL D CA    1 
ATOM 4349 C C     . VAL D 1 86  ? 25.628 35.076  76.594  1.00 177.54 ? 86  VAL D C     1 
ATOM 4350 O O     . VAL D 1 86  ? 26.855 35.207  76.673  1.00 185.43 ? 86  VAL D O     1 
ATOM 4351 C CB    . VAL D 1 86  ? 24.967 36.719  74.804  1.00 144.58 ? 86  VAL D CB    1 
ATOM 4352 C CG1   . VAL D 1 86  ? 24.711 35.566  73.844  1.00 145.75 ? 86  VAL D CG1   1 
ATOM 4353 C CG2   . VAL D 1 86  ? 24.080 37.911  74.479  1.00 155.48 ? 86  VAL D CG2   1 
ATOM 4354 N N     . ILE D 1 87  ? 25.010 33.915  76.796  1.00 187.08 ? 87  ILE D N     1 
ATOM 4355 C CA    . ILE D 1 87  ? 25.723 32.682  77.107  1.00 177.49 ? 87  ILE D CA    1 
ATOM 4356 C C     . ILE D 1 87  ? 25.328 31.621  76.087  1.00 200.09 ? 87  ILE D C     1 
ATOM 4357 O O     . ILE D 1 87  ? 24.141 31.454  75.780  1.00 193.05 ? 87  ILE D O     1 
ATOM 4358 C CB    . ILE D 1 87  ? 25.446 32.210  78.548  1.00 149.41 ? 87  ILE D CB    1 
ATOM 4359 C CG1   . ILE D 1 87  ? 26.013 30.806  78.777  1.00 167.90 ? 87  ILE D CG1   1 
ATOM 4360 C CG2   . ILE D 1 87  ? 23.965 32.276  78.864  1.00 152.84 ? 87  ILE D CG2   1 
ATOM 4361 C CD1   . ILE D 1 87  ? 27.522 30.726  78.642  1.00 166.10 ? 87  ILE D CD1   1 
ATOM 4362 N N     . VAL D 1 88  ? 26.328 30.919  75.561  1.00 192.24 ? 88  VAL D N     1 
ATOM 4363 C CA    . VAL D 1 88  ? 26.160 29.889  74.541  1.00 175.03 ? 88  VAL D CA    1 
ATOM 4364 C C     . VAL D 1 88  ? 26.408 28.534  75.187  1.00 178.27 ? 88  VAL D C     1 
ATOM 4365 O O     . VAL D 1 88  ? 27.527 28.249  75.632  1.00 185.14 ? 88  VAL D O     1 
ATOM 4366 C CB    . VAL D 1 88  ? 27.104 30.114  73.351  1.00 167.54 ? 88  VAL D CB    1 
ATOM 4367 C CG1   . VAL D 1 88  ? 26.401 30.893  72.256  1.00 187.83 ? 88  VAL D CG1   1 
ATOM 4368 C CG2   . VAL D 1 88  ? 28.344 30.858  73.809  1.00 170.87 ? 88  VAL D CG2   1 
ATOM 4369 N N     . ARG D 1 89  ? 25.373 27.699  75.237  1.00 180.85 ? 89  ARG D N     1 
ATOM 4370 C CA    . ARG D 1 89  ? 25.478 26.389  75.864  1.00 186.23 ? 89  ARG D CA    1 
ATOM 4371 C C     . ARG D 1 89  ? 25.880 25.353  74.823  1.00 187.87 ? 89  ARG D C     1 
ATOM 4372 O O     . ARG D 1 89  ? 25.465 25.428  73.663  1.00 199.70 ? 89  ARG D O     1 
ATOM 4373 C CB    . ARG D 1 89  ? 24.145 25.999  76.507  1.00 197.92 ? 89  ARG D CB    1 
ATOM 4374 C CG    . ARG D 1 89  ? 24.121 24.614  77.136  1.00 228.29 ? 89  ARG D CG    1 
ATOM 4375 C CD    . ARG D 1 89  ? 22.879 24.410  77.987  1.00 252.14 ? 89  ARG D CD    1 
ATOM 4376 N NE    . ARG D 1 89  ? 22.868 25.283  79.156  1.00 262.30 ? 89  ARG D NE    1 
ATOM 4377 C CZ    . ARG D 1 89  ? 21.894 25.310  80.061  1.00 272.10 ? 89  ARG D CZ    1 
ATOM 4378 N NH1   . ARG D 1 89  ? 21.971 26.137  81.093  1.00 273.85 ? 89  ARG D NH1   1 
ATOM 4379 N NH2   . ARG D 1 89  ? 20.844 24.510  79.933  1.00 270.43 ? 89  ARG D NH2   1 
ATOM 4380 N N     . ASN D 1 90  ? 26.698 24.387  75.245  1.00 234.96 ? 90  ASN D N     1 
ATOM 4381 C CA    . ASN D 1 90  ? 27.082 23.302  74.358  1.00 235.53 ? 90  ASN D CA    1 
ATOM 4382 C C     . ASN D 1 90  ? 25.849 22.511  73.925  1.00 264.23 ? 90  ASN D C     1 
ATOM 4383 O O     . ASN D 1 90  ? 24.876 22.399  74.678  1.00 231.39 ? 90  ASN D O     1 
ATOM 4384 C CB    . ASN D 1 90  ? 28.081 22.379  75.052  1.00 236.81 ? 90  ASN D CB    1 
ATOM 4385 C CG    . ASN D 1 90  ? 29.376 22.237  74.279  1.00 242.31 ? 90  ASN D CG    1 
ATOM 4386 O OD1   . ASN D 1 90  ? 29.623 22.968  73.319  1.00 246.80 ? 90  ASN D OD1   1 
ATOM 4387 N ND2   . ASN D 1 90  ? 30.215 21.298  74.698  1.00 254.18 ? 90  ASN D ND2   1 
ATOM 4388 N N     . PRO D 1 91  ? 25.860 21.951  72.714  1.00 279.98 ? 91  PRO D N     1 
ATOM 4389 C CA    . PRO D 1 91  ? 24.704 21.164  72.269  1.00 290.36 ? 91  PRO D CA    1 
ATOM 4390 C C     . PRO D 1 91  ? 24.490 19.871  73.041  1.00 307.83 ? 91  PRO D C     1 
ATOM 4391 O O     . PRO D 1 91  ? 25.262 18.917  72.900  1.00 311.97 ? 91  PRO D O     1 
ATOM 4392 C CB    . PRO D 1 91  ? 25.023 20.872  70.795  1.00 287.42 ? 91  PRO D CB    1 
ATOM 4393 C CG    . PRO D 1 91  ? 26.494 21.101  70.655  1.00 288.25 ? 91  PRO D CG    1 
ATOM 4394 C CD    . PRO D 1 91  ? 26.834 22.173  71.633  1.00 288.48 ? 91  PRO D CD    1 
ATOM 4395 N N     . THR D 1 92  ? 23.443 19.835  73.864  1.00 311.17 ? 92  THR D N     1 
ATOM 4396 C CA    . THR D 1 92  ? 22.819 18.568  74.227  1.00 320.01 ? 92  THR D CA    1 
ATOM 4397 C C     . THR D 1 92  ? 22.246 17.895  72.987  1.00 373.54 ? 92  THR D C     1 
ATOM 4398 O O     . THR D 1 92  ? 22.540 16.729  72.696  1.00 350.92 ? 92  THR D O     1 
ATOM 4399 C CB    . THR D 1 92  ? 21.737 18.788  75.284  1.00 295.85 ? 92  THR D CB    1 
ATOM 4400 O OG1   . THR D 1 92  ? 20.713 19.639  74.755  1.00 284.99 ? 92  THR D OG1   1 
ATOM 4401 C CG2   . THR D 1 92  ? 22.335 19.426  76.530  1.00 292.68 ? 92  THR D CG2   1 
ATOM 4402 N N     . PHE D 1 93  ? 21.392 18.629  72.268  1.00 431.41 ? 93  PHE D N     1 
ATOM 4403 C CA    . PHE D 1 93  ? 20.768 18.212  71.017  1.00 437.70 ? 93  PHE D CA    1 
ATOM 4404 C C     . PHE D 1 93  ? 21.725 17.451  70.109  1.00 438.99 ? 93  PHE D C     1 
ATOM 4405 O O     . PHE D 1 93  ? 22.911 17.775  70.008  1.00 449.89 ? 93  PHE D O     1 
ATOM 4406 C CB    . PHE D 1 93  ? 20.229 19.455  70.298  1.00 445.95 ? 93  PHE D CB    1 
ATOM 4407 C CG    . PHE D 1 93  ? 20.053 19.286  68.814  1.00 453.44 ? 93  PHE D CG    1 
ATOM 4408 C CD1   . PHE D 1 93  ? 18.921 18.676  68.302  1.00 455.05 ? 93  PHE D CD1   1 
ATOM 4409 C CD2   . PHE D 1 93  ? 21.008 19.765  67.930  1.00 457.73 ? 93  PHE D CD2   1 
ATOM 4410 C CE1   . PHE D 1 93  ? 18.754 18.529  66.938  1.00 457.08 ? 93  PHE D CE1   1 
ATOM 4411 C CE2   . PHE D 1 93  ? 20.846 19.621  66.566  1.00 460.41 ? 93  PHE D CE2   1 
ATOM 4412 C CZ    . PHE D 1 93  ? 19.718 19.003  66.070  1.00 459.83 ? 93  PHE D CZ    1 
ATOM 4413 N N     . LYS D 1 94  ? 21.177 16.428  69.449  1.00 394.18 ? 94  LYS D N     1 
ATOM 4414 C CA    . LYS D 1 94  ? 21.896 15.530  68.547  1.00 346.91 ? 94  LYS D CA    1 
ATOM 4415 C C     . LYS D 1 94  ? 23.031 14.808  69.282  1.00 313.04 ? 94  LYS D C     1 
ATOM 4416 O O     . LYS D 1 94  ? 24.221 15.044  69.067  1.00 309.31 ? 94  LYS D O     1 
ATOM 4417 C CB    . LYS D 1 94  ? 22.418 16.282  67.316  1.00 338.51 ? 94  LYS D CB    1 
ATOM 4418 C CG    . LYS D 1 94  ? 22.751 15.372  66.142  1.00 328.31 ? 94  LYS D CG    1 
ATOM 4419 C CD    . LYS D 1 94  ? 22.960 16.164  64.862  1.00 325.29 ? 94  LYS D CD    1 
ATOM 4420 C CE    . LYS D 1 94  ? 23.062 15.243  63.657  1.00 321.34 ? 94  LYS D CE    1 
ATOM 4421 N NZ    . LYS D 1 94  ? 24.206 14.296  63.774  1.00 312.71 ? 94  LYS D NZ    1 
ATOM 4422 N N     . GLY D 1 95  ? 22.607 13.908  70.165  1.00 287.40 ? 95  GLY D N     1 
ATOM 4423 C CA    . GLY D 1 95  ? 23.514 13.047  70.893  1.00 272.55 ? 95  GLY D CA    1 
ATOM 4424 C C     . GLY D 1 95  ? 23.218 11.608  70.532  1.00 283.23 ? 95  GLY D C     1 
ATOM 4425 O O     . GLY D 1 95  ? 22.184 11.065  70.935  1.00 284.62 ? 95  GLY D O     1 
ATOM 4426 N N     . GLY D 1 96  ? 24.113 10.975  69.780  1.00 291.22 ? 96  GLY D N     1 
ATOM 4427 C CA    . GLY D 1 96  ? 23.854 9.634   69.295  1.00 290.49 ? 96  GLY D CA    1 
ATOM 4428 C C     . GLY D 1 96  ? 22.787 9.648   68.219  1.00 287.64 ? 96  GLY D C     1 
ATOM 4429 O O     . GLY D 1 96  ? 22.990 10.228  67.148  1.00 281.83 ? 96  GLY D O     1 
ATOM 4430 N N     . SER D 1 97  ? 21.648 9.015   68.489  1.00 292.86 ? 97  SER D N     1 
ATOM 4431 C CA    . SER D 1 97  ? 20.576 8.944   67.507  1.00 297.40 ? 97  SER D CA    1 
ATOM 4432 C C     . SER D 1 97  ? 19.965 10.324  67.273  1.00 300.62 ? 97  SER D C     1 
ATOM 4433 O O     . SER D 1 97  ? 20.162 11.264  68.049  1.00 286.69 ? 97  SER D O     1 
ATOM 4434 C CB    . SER D 1 97  ? 19.496 7.962   67.960  1.00 294.30 ? 97  SER D CB    1 
ATOM 4435 O OG    . SER D 1 97  ? 18.851 8.418   69.135  1.00 285.75 ? 97  SER D OG    1 
ATOM 4436 N N     . TYR D 1 98  ? 19.207 10.436  66.182  1.00 318.52 ? 98  TYR D N     1 
ATOM 4437 C CA    . TYR D 1 98  ? 18.546 11.684  65.816  1.00 320.93 ? 98  TYR D CA    1 
ATOM 4438 C C     . TYR D 1 98  ? 17.026 11.559  65.820  1.00 319.55 ? 98  TYR D C     1 
ATOM 4439 O O     . TYR D 1 98  ? 16.335 12.502  65.420  1.00 325.27 ? 98  TYR D O     1 
ATOM 4440 C CB    . TYR D 1 98  ? 19.038 12.158  64.443  1.00 328.18 ? 98  TYR D CB    1 
ATOM 4441 C CG    . TYR D 1 98  ? 18.781 13.623  64.160  1.00 337.96 ? 98  TYR D CG    1 
ATOM 4442 C CD1   . TYR D 1 98  ? 19.484 14.613  64.833  1.00 342.42 ? 98  TYR D CD1   1 
ATOM 4443 C CD2   . TYR D 1 98  ? 17.842 14.015  63.213  1.00 342.61 ? 98  TYR D CD2   1 
ATOM 4444 C CE1   . TYR D 1 98  ? 19.254 15.952  64.578  1.00 344.90 ? 98  TYR D CE1   1 
ATOM 4445 C CE2   . TYR D 1 98  ? 17.606 15.353  62.952  1.00 345.60 ? 98  TYR D CE2   1 
ATOM 4446 C CZ    . TYR D 1 98  ? 18.315 16.316  63.637  1.00 346.51 ? 98  TYR D CZ    1 
ATOM 4447 O OH    . TYR D 1 98  ? 18.085 17.649  63.381  1.00 348.53 ? 98  TYR D OH    1 
ATOM 4448 N N     . ARG D 1 99  ? 16.488 10.429  66.272  1.00 315.22 ? 99  ARG D N     1 
ATOM 4449 C CA    . ARG D 1 99  ? 15.051 10.175  66.280  1.00 304.14 ? 99  ARG D CA    1 
ATOM 4450 C C     . ARG D 1 99  ? 14.472 10.244  67.692  1.00 292.07 ? 99  ARG D C     1 
ATOM 4451 O O     . ARG D 1 99  ? 13.586 9.466   68.053  1.00 291.20 ? 99  ARG D O     1 
ATOM 4452 C CB    . ARG D 1 99  ? 14.739 8.820   65.650  1.00 298.57 ? 99  ARG D CB    1 
ATOM 4453 C CG    . ARG D 1 99  ? 15.171 8.681   64.198  1.00 294.95 ? 99  ARG D CG    1 
ATOM 4454 C CD    . ARG D 1 99  ? 14.780 7.318   63.645  1.00 299.47 ? 99  ARG D CD    1 
ATOM 4455 N NE    . ARG D 1 99  ? 15.104 7.180   62.228  1.00 307.47 ? 99  ARG D NE    1 
ATOM 4456 C CZ    . ARG D 1 99  ? 16.232 6.652   61.765  1.00 319.38 ? 99  ARG D CZ    1 
ATOM 4457 N NH1   . ARG D 1 99  ? 17.155 6.208   62.608  1.00 319.98 ? 99  ARG D NH1   1 
ATOM 4458 N NH2   . ARG D 1 99  ? 16.439 6.568   60.458  1.00 325.40 ? 99  ARG D NH2   1 
ATOM 4459 N N     . ASN D 1 100 ? 14.962 11.177  68.507  1.00 282.22 ? 100 ASN D N     1 
ATOM 4460 C CA    . ASN D 1 100 ? 14.556 11.275  69.904  1.00 277.38 ? 100 ASN D CA    1 
ATOM 4461 C C     . ASN D 1 100 ? 13.810 12.564  70.226  1.00 291.77 ? 100 ASN D C     1 
ATOM 4462 O O     . ASN D 1 100 ? 13.602 12.862  71.406  1.00 285.99 ? 100 ASN D O     1 
ATOM 4463 C CB    . ASN D 1 100 ? 15.776 11.144  70.818  1.00 270.47 ? 100 ASN D CB    1 
ATOM 4464 C CG    . ASN D 1 100 ? 16.340 9.739   70.838  1.00 278.85 ? 100 ASN D CG    1 
ATOM 4465 O OD1   . ASN D 1 100 ? 17.522 9.529   70.571  1.00 282.89 ? 100 ASN D OD1   1 
ATOM 4466 N ND2   . ASN D 1 100 ? 15.494 8.766   71.158  1.00 278.71 ? 100 ASN D ND2   1 
ATOM 4467 N N     . ARG D 1 101 ? 13.399 13.332  69.215  1.00 300.31 ? 101 ARG D N     1 
ATOM 4468 C CA    . ARG D 1 101 ? 12.695 14.587  69.468  1.00 307.43 ? 101 ARG D CA    1 
ATOM 4469 C C     . ARG D 1 101 ? 11.383 14.345  70.207  1.00 312.49 ? 101 ARG D C     1 
ATOM 4470 O O     . ARG D 1 101 ? 11.202 14.801  71.346  1.00 316.79 ? 101 ARG D O     1 
ATOM 4471 C CB    . ARG D 1 101 ? 12.435 15.318  68.150  1.00 314.19 ? 101 ARG D CB    1 
ATOM 4472 C CG    . ARG D 1 101 ? 13.679 15.744  67.391  1.00 317.50 ? 101 ARG D CG    1 
ATOM 4473 C CD    . ARG D 1 101 ? 13.293 16.436  66.093  1.00 325.15 ? 101 ARG D CD    1 
ATOM 4474 N NE    . ARG D 1 101 ? 14.452 16.906  65.341  1.00 333.07 ? 101 ARG D NE    1 
ATOM 4475 C CZ    . ARG D 1 101 ? 14.377 17.517  64.163  1.00 342.32 ? 101 ARG D CZ    1 
ATOM 4476 N NH1   . ARG D 1 101 ? 13.195 17.734  63.601  1.00 343.24 ? 101 ARG D NH1   1 
ATOM 4477 N NH2   . ARG D 1 101 ? 15.482 17.914  63.547  1.00 346.96 ? 101 ARG D NH2   1 
ATOM 4478 N N     . LYS D 1 102 ? 10.476 13.587  69.575  1.00 297.39 ? 102 LYS D N     1 
ATOM 4479 C CA    . LYS D 1 102 ? 9.094  13.427  70.028  1.00 270.83 ? 102 LYS D CA    1 
ATOM 4480 C C     . LYS D 1 102 ? 8.961  13.300  71.538  1.00 292.75 ? 102 LYS D C     1 
ATOM 4481 O O     . LYS D 1 102 ? 8.215  14.055  72.171  1.00 281.86 ? 102 LYS D O     1 
ATOM 4482 C CB    . LYS D 1 102 ? 8.469  12.197  69.362  1.00 247.06 ? 102 LYS D CB    1 
ATOM 4483 C CG    . LYS D 1 102 ? 8.282  12.290  67.860  1.00 236.86 ? 102 LYS D CG    1 
ATOM 4484 C CD    . LYS D 1 102 ? 7.446  11.117  67.363  1.00 241.46 ? 102 LYS D CD    1 
ATOM 4485 C CE    . LYS D 1 102 ? 7.328  11.105  65.849  1.00 257.69 ? 102 LYS D CE    1 
ATOM 4486 N NZ    . LYS D 1 102 ? 8.628  10.801  65.191  1.00 269.39 ? 102 LYS D NZ    1 
ATOM 4487 N N     . LYS D 1 103 ? 9.693  12.355  72.131  1.00 312.16 ? 103 LYS D N     1 
ATOM 4488 C CA    . LYS D 1 103 ? 9.542  12.040  73.545  1.00 320.99 ? 103 LYS D CA    1 
ATOM 4489 C C     . LYS D 1 103 ? 9.703  13.286  74.401  1.00 326.96 ? 103 LYS D C     1 
ATOM 4490 O O     . LYS D 1 103 ? 8.737  13.751  75.017  1.00 334.86 ? 103 LYS D O     1 
ATOM 4491 C CB    . LYS D 1 103 ? 10.565 10.986  73.975  1.00 313.60 ? 103 LYS D CB    1 
ATOM 4492 C CG    . LYS D 1 103 ? 10.413 9.639   73.295  1.00 312.70 ? 103 LYS D CG    1 
ATOM 4493 C CD    . LYS D 1 103 ? 11.522 8.692   73.722  1.00 314.48 ? 103 LYS D CD    1 
ATOM 4494 C CE    . LYS D 1 103 ? 11.303 7.299   73.159  1.00 320.02 ? 103 LYS D CE    1 
ATOM 4495 N NZ    . LYS D 1 103 ? 11.166 7.319   71.677  1.00 318.94 ? 103 LYS D NZ    1 
ATOM 4496 N N     . GLN D 1 104 ? 10.908 13.857  74.402  1.00 321.66 ? 104 GLN D N     1 
ATOM 4497 C CA    . GLN D 1 104 ? 11.179 14.983  75.286  1.00 317.16 ? 104 GLN D CA    1 
ATOM 4498 C C     . GLN D 1 104 ? 10.369 16.209  74.888  1.00 318.71 ? 104 GLN D C     1 
ATOM 4499 O O     . GLN D 1 104 ? 9.842  16.910  75.759  1.00 322.17 ? 104 GLN D O     1 
ATOM 4500 C CB    . GLN D 1 104 ? 12.676 15.300  75.298  1.00 311.36 ? 104 GLN D CB    1 
ATOM 4501 C CG    . GLN D 1 104 ? 13.258 15.702  73.952  1.00 306.09 ? 104 GLN D CG    1 
ATOM 4502 C CD    . GLN D 1 104 ? 14.356 14.767  73.490  1.00 297.31 ? 104 GLN D CD    1 
ATOM 4503 O OE1   . GLN D 1 104 ? 14.600 13.728  74.102  1.00 293.56 ? 104 GLN D OE1   1 
ATOM 4504 N NE2   . GLN D 1 104 ? 15.020 15.129  72.398  1.00 290.93 ? 104 GLN D NE2   1 
ATOM 4505 N N     . SER D 1 105 ? 10.205 16.454  73.584  1.00 296.77 ? 105 SER D N     1 
ATOM 4506 C CA    . SER D 1 105 ? 9.467  17.635  73.151  1.00 280.71 ? 105 SER D CA    1 
ATOM 4507 C C     . SER D 1 105 ? 8.029  17.610  73.655  1.00 304.22 ? 105 SER D C     1 
ATOM 4508 O O     . SER D 1 105 ? 7.615  18.483  74.430  1.00 279.89 ? 105 SER D O     1 
ATOM 4509 C CB    . SER D 1 105 ? 9.503  17.738  71.625  1.00 257.27 ? 105 SER D CB    1 
ATOM 4510 O OG    . SER D 1 105 ? 10.832 17.868  71.154  1.00 241.26 ? 105 SER D OG    1 
ATOM 4511 N N     . ILE D 1 106 ? 7.259  16.590  73.260  1.00 340.13 ? 106 ILE D N     1 
ATOM 4512 C CA    . ILE D 1 106 ? 5.852  16.574  73.642  1.00 372.57 ? 106 ILE D CA    1 
ATOM 4513 C C     . ILE D 1 106 ? 5.688  16.350  75.139  1.00 409.14 ? 106 ILE D C     1 
ATOM 4514 O O     . ILE D 1 106 ? 4.757  16.893  75.747  1.00 412.08 ? 106 ILE D O     1 
ATOM 4515 C CB    . ILE D 1 106 ? 5.068  15.528  72.823  1.00 366.68 ? 106 ILE D CB    1 
ATOM 4516 C CG1   . ILE D 1 106 ? 3.566  15.810  72.904  1.00 368.35 ? 106 ILE D CG1   1 
ATOM 4517 C CG2   . ILE D 1 106 ? 5.339  14.118  73.320  1.00 360.75 ? 106 ILE D CG2   1 
ATOM 4518 C CD1   . ILE D 1 106 ? 3.173  17.193  72.431  1.00 370.58 ? 106 ILE D CD1   1 
ATOM 4519 N N     . ASP D 1 107 ? 6.612  15.626  75.780  1.00 437.45 ? 107 ASP D N     1 
ATOM 4520 C CA    . ASP D 1 107 ? 6.475  15.391  77.210  1.00 443.11 ? 107 ASP D CA    1 
ATOM 4521 C C     . ASP D 1 107 ? 6.670  16.677  77.998  1.00 427.55 ? 107 ASP D C     1 
ATOM 4522 O O     . ASP D 1 107 ? 5.807  17.062  78.795  1.00 438.23 ? 107 ASP D O     1 
ATOM 4523 C CB    . ASP D 1 107 ? 7.472  14.322  77.659  1.00 459.89 ? 107 ASP D CB    1 
ATOM 4524 C CG    . ASP D 1 107 ? 7.253  13.884  79.093  1.00 475.02 ? 107 ASP D CG    1 
ATOM 4525 O OD1   . ASP D 1 107 ? 6.173  14.176  79.647  1.00 482.07 ? 107 ASP D OD1   1 
ATOM 4526 O OD2   . ASP D 1 107 ? 8.162  13.247  79.667  1.00 478.55 ? 107 ASP D OD2   1 
ATOM 4527 N N     . VAL D 1 108 ? 7.789  17.371  77.771  1.00 387.32 ? 108 VAL D N     1 
ATOM 4528 C CA    . VAL D 1 108 ? 8.042  18.609  78.496  1.00 346.24 ? 108 VAL D CA    1 
ATOM 4529 C C     . VAL D 1 108 ? 6.988  19.658  78.159  1.00 368.40 ? 108 VAL D C     1 
ATOM 4530 O O     . VAL D 1 108 ? 6.527  20.391  79.044  1.00 327.65 ? 108 VAL D O     1 
ATOM 4531 C CB    . VAL D 1 108 ? 9.476  19.104  78.219  1.00 311.05 ? 108 VAL D CB    1 
ATOM 4532 C CG1   . VAL D 1 108 ? 9.483  20.489  77.598  1.00 301.10 ? 108 VAL D CG1   1 
ATOM 4533 C CG2   . VAL D 1 108 ? 10.296 19.091  79.502  1.00 297.03 ? 108 VAL D CG2   1 
ATOM 4534 N N     . PHE D 1 109 ? 6.542  19.714  76.897  1.00 415.87 ? 109 PHE D N     1 
ATOM 4535 C CA    . PHE D 1 109 ? 5.489  20.664  76.558  1.00 399.39 ? 109 PHE D CA    1 
ATOM 4536 C C     . PHE D 1 109 ? 4.216  20.377  77.344  1.00 391.36 ? 109 PHE D C     1 
ATOM 4537 O O     . PHE D 1 109 ? 3.846  21.152  78.235  1.00 394.41 ? 109 PHE D O     1 
ATOM 4538 C CB    . PHE D 1 109 ? 5.189  20.634  75.056  1.00 392.57 ? 109 PHE D CB    1 
ATOM 4539 C CG    . PHE D 1 109 ? 6.314  21.141  74.193  1.00 383.14 ? 109 PHE D CG    1 
ATOM 4540 C CD1   . PHE D 1 109 ? 7.336  21.906  74.731  1.00 378.97 ? 109 PHE D CD1   1 
ATOM 4541 C CD2   . PHE D 1 109 ? 6.343  20.853  72.837  1.00 378.75 ? 109 PHE D CD2   1 
ATOM 4542 C CE1   . PHE D 1 109 ? 8.368  22.369  73.932  1.00 371.91 ? 109 PHE D CE1   1 
ATOM 4543 C CE2   . PHE D 1 109 ? 7.371  21.314  72.036  1.00 371.13 ? 109 PHE D CE2   1 
ATOM 4544 C CZ    . PHE D 1 109 ? 8.384  22.073  72.584  1.00 366.41 ? 109 PHE D CZ    1 
ATOM 4545 N N     . ILE D 1 110 ? 3.603  19.216  77.086  1.00 366.39 ? 110 ILE D N     1 
ATOM 4546 C CA    . ILE D 1 110 ? 2.330  18.864  77.703  1.00 341.09 ? 110 ILE D CA    1 
ATOM 4547 C C     . ILE D 1 110 ? 2.410  18.858  79.221  1.00 341.03 ? 110 ILE D C     1 
ATOM 4548 O O     . ILE D 1 110 ? 1.387  19.028  79.894  1.00 343.98 ? 110 ILE D O     1 
ATOM 4549 C CB    . ILE D 1 110 ? 1.848  17.502  77.149  1.00 316.71 ? 110 ILE D CB    1 
ATOM 4550 C CG1   . ILE D 1 110 ? 0.486  17.656  76.465  1.00 312.65 ? 110 ILE D CG1   1 
ATOM 4551 C CG2   . ILE D 1 110 ? 1.806  16.432  78.239  1.00 305.41 ? 110 ILE D CG2   1 
ATOM 4552 C CD1   . ILE D 1 110 ? -0.025 16.386  75.823  1.00 301.26 ? 110 ILE D CD1   1 
ATOM 4553 N N     . GLN D 1 111 ? 3.608  18.699  79.788  1.00 334.52 ? 111 GLN D N     1 
ATOM 4554 C CA    . GLN D 1 111 ? 3.712  18.702  81.239  1.00 335.88 ? 111 GLN D CA    1 
ATOM 4555 C C     . GLN D 1 111 ? 3.820  20.111  81.804  1.00 337.67 ? 111 GLN D C     1 
ATOM 4556 O O     . GLN D 1 111 ? 3.161  20.426  82.801  1.00 334.60 ? 111 GLN D O     1 
ATOM 4557 C CB    . GLN D 1 111 ? 4.912  17.865  81.685  1.00 330.93 ? 111 GLN D CB    1 
ATOM 4558 C CG    . GLN D 1 111 ? 4.661  16.368  81.688  1.00 332.27 ? 111 GLN D CG    1 
ATOM 4559 C CD    . GLN D 1 111 ? 5.812  15.592  82.296  1.00 334.28 ? 111 GLN D CD    1 
ATOM 4560 O OE1   . GLN D 1 111 ? 6.774  16.176  82.794  1.00 334.71 ? 111 GLN D OE1   1 
ATOM 4561 N NE2   . GLN D 1 111 ? 5.721  14.268  82.255  1.00 334.38 ? 111 GLN D NE2   1 
ATOM 4562 N N     . LYS D 1 112 ? 4.628  20.982  81.194  1.00 339.07 ? 112 LYS D N     1 
ATOM 4563 C CA    . LYS D 1 112 ? 5.061  22.172  81.904  1.00 342.32 ? 112 LYS D CA    1 
ATOM 4564 C C     . LYS D 1 112 ? 4.715  23.498  81.231  1.00 345.00 ? 112 LYS D C     1 
ATOM 4565 O O     . LYS D 1 112 ? 5.015  24.550  81.808  1.00 349.15 ? 112 LYS D O     1 
ATOM 4566 C CB    . LYS D 1 112 ? 6.578  22.089  82.144  1.00 337.06 ? 112 LYS D CB    1 
ATOM 4567 C CG    . LYS D 1 112 ? 7.089  22.913  83.315  1.00 333.89 ? 112 LYS D CG    1 
ATOM 4568 C CD    . LYS D 1 112 ? 8.481  22.480  83.750  1.00 320.89 ? 112 LYS D CD    1 
ATOM 4569 C CE    . LYS D 1 112 ? 8.454  21.105  84.400  1.00 309.22 ? 112 LYS D CE    1 
ATOM 4570 N NZ    . LYS D 1 112 ? 9.786  20.721  84.946  1.00 298.14 ? 112 LYS D NZ    1 
ATOM 4571 N N     . ILE D 1 113 ? 4.088  23.508  80.050  1.00 310.67 ? 113 ILE D N     1 
ATOM 4572 C CA    . ILE D 1 113 ? 3.789  24.824  79.484  1.00 297.61 ? 113 ILE D CA    1 
ATOM 4573 C C     . ILE D 1 113 ? 2.599  25.469  80.195  1.00 301.38 ? 113 ILE D C     1 
ATOM 4574 O O     . ILE D 1 113 ? 2.560  26.694  80.360  1.00 304.28 ? 113 ILE D O     1 
ATOM 4575 C CB    . ILE D 1 113 ? 3.540  24.762  77.967  1.00 300.12 ? 113 ILE D CB    1 
ATOM 4576 C CG1   . ILE D 1 113 ? 2.539  23.667  77.609  1.00 299.19 ? 113 ILE D CG1   1 
ATOM 4577 C CG2   . ILE D 1 113 ? 4.849  24.539  77.225  1.00 308.70 ? 113 ILE D CG2   1 
ATOM 4578 C CD1   . ILE D 1 113 ? 2.310  23.523  76.121  1.00 302.30 ? 113 ILE D CD1   1 
ATOM 4579 N N     . SER D 1 114 ? 1.621  24.664  80.625  1.00 302.37 ? 114 SER D N     1 
ATOM 4580 C CA    . SER D 1 114 ? 0.335  25.194  81.073  1.00 293.04 ? 114 SER D CA    1 
ATOM 4581 C C     . SER D 1 114 ? 0.430  26.015  82.355  1.00 310.50 ? 114 SER D C     1 
ATOM 4582 O O     . SER D 1 114 ? -0.315 26.989  82.515  1.00 289.96 ? 114 SER D O     1 
ATOM 4583 C CB    . SER D 1 114 ? -0.655 24.048  81.271  1.00 281.85 ? 114 SER D CB    1 
ATOM 4584 O OG    . SER D 1 114 ? -0.696 23.212  80.131  1.00 256.15 ? 114 SER D OG    1 
ATOM 4585 N N     . GLU D 1 115 ? 1.325  25.655  83.274  1.00 342.42 ? 115 GLU D N     1 
ATOM 4586 C CA    . GLU D 1 115 ? 1.340  26.299  84.584  1.00 352.80 ? 115 GLU D CA    1 
ATOM 4587 C C     . GLU D 1 115 ? 2.011  27.665  84.588  1.00 358.19 ? 115 GLU D C     1 
ATOM 4588 O O     . GLU D 1 115 ? 2.134  28.267  85.660  1.00 356.93 ? 115 GLU D O     1 
ATOM 4589 C CB    . GLU D 1 115 ? 2.034  25.405  85.616  1.00 350.81 ? 115 GLU D CB    1 
ATOM 4590 C CG    . GLU D 1 115 ? 1.633  23.946  85.563  1.00 356.40 ? 115 GLU D CG    1 
ATOM 4591 C CD    . GLU D 1 115 ? 2.701  23.089  84.926  1.00 355.54 ? 115 GLU D CD    1 
ATOM 4592 O OE1   . GLU D 1 115 ? 3.575  23.654  84.237  1.00 351.52 ? 115 GLU D OE1   1 
ATOM 4593 O OE2   . GLU D 1 115 ? 2.675  21.857  85.124  1.00 355.66 ? 115 GLU D OE2   1 
ATOM 4594 N N     . TYR D 1 116 ? 2.438  28.176  83.438  1.00 364.10 ? 116 TYR D N     1 
ATOM 4595 C CA    . TYR D 1 116 ? 3.244  29.386  83.402  1.00 363.58 ? 116 TYR D CA    1 
ATOM 4596 C C     . TYR D 1 116 ? 2.610  30.495  82.584  1.00 359.71 ? 116 TYR D C     1 
ATOM 4597 O O     . TYR D 1 116 ? 2.824  31.672  82.885  1.00 359.84 ? 116 TYR D O     1 
ATOM 4598 C CB    . TYR D 1 116 ? 4.627  29.078  82.808  1.00 369.15 ? 116 TYR D CB    1 
ATOM 4599 C CG    . TYR D 1 116 ? 5.411  28.044  83.581  1.00 370.91 ? 116 TYR D CG    1 
ATOM 4600 C CD1   . TYR D 1 116 ? 5.195  27.841  84.938  1.00 375.22 ? 116 TYR D CD1   1 
ATOM 4601 C CD2   . TYR D 1 116 ? 6.346  27.243  82.941  1.00 371.45 ? 116 TYR D CD2   1 
ATOM 4602 C CE1   . TYR D 1 116 ? 5.897  26.880  85.637  1.00 375.58 ? 116 TYR D CE1   1 
ATOM 4603 C CE2   . TYR D 1 116 ? 7.057  26.287  83.632  1.00 371.31 ? 116 TYR D CE2   1 
ATOM 4604 C CZ    . TYR D 1 116 ? 6.830  26.108  84.980  1.00 376.45 ? 116 TYR D CZ    1 
ATOM 4605 O OH    . TYR D 1 116 ? 7.535  25.151  85.673  1.00 377.85 ? 116 TYR D OH    1 
ATOM 4606 N N     . THR D 1 117 ? 1.835  30.147  81.564  1.00 335.75 ? 117 THR D N     1 
ATOM 4607 C CA    . THR D 1 117 ? 1.253  31.088  80.622  1.00 308.67 ? 117 THR D CA    1 
ATOM 4608 C C     . THR D 1 117 ? -0.266 31.129  80.673  1.00 308.64 ? 117 THR D C     1 
ATOM 4609 O O     . THR D 1 117 ? -0.844 32.184  80.406  1.00 308.09 ? 117 THR D O     1 
ATOM 4610 C CB    . THR D 1 117 ? 1.698  30.768  79.185  1.00 287.26 ? 117 THR D CB    1 
ATOM 4611 O OG1   . THR D 1 117 ? 0.997  31.615  78.266  1.00 295.69 ? 117 THR D OG1   1 
ATOM 4612 C CG2   . THR D 1 117 ? 1.422  29.313  78.842  1.00 281.58 ? 117 THR D CG2   1 
ATOM 4613 N N     . ASP D 1 118 ? -0.919 30.008  80.996  1.00 297.56 ? 118 ASP D N     1 
ATOM 4614 C CA    . ASP D 1 118 ? -2.367 29.821  80.946  1.00 289.84 ? 118 ASP D CA    1 
ATOM 4615 C C     . ASP D 1 118 ? -2.905 29.861  79.523  1.00 294.90 ? 118 ASP D C     1 
ATOM 4616 O O     . ASP D 1 118 ? -4.126 29.916  79.330  1.00 302.18 ? 118 ASP D O     1 
ATOM 4617 C CB    . ASP D 1 118 ? -3.122 30.844  81.806  1.00 281.38 ? 118 ASP D CB    1 
ATOM 4618 C CG    . ASP D 1 118 ? -2.637 30.871  83.242  1.00 264.01 ? 118 ASP D CG    1 
ATOM 4619 O OD1   . ASP D 1 118 ? -2.070 29.857  83.700  1.00 257.74 ? 118 ASP D OD1   1 
ATOM 4620 O OD2   . ASP D 1 118 ? -2.826 31.906  83.915  1.00 258.77 ? 118 ASP D OD2   1 
ATOM 4621 N N     . TYR D 1 119 ? -2.030 29.834  78.520  1.00 302.98 ? 119 TYR D N     1 
ATOM 4622 C CA    . TYR D 1 119 ? -2.422 29.809  77.115  1.00 325.38 ? 119 TYR D CA    1 
ATOM 4623 C C     . TYR D 1 119 ? -1.771 28.626  76.407  1.00 348.22 ? 119 TYR D C     1 
ATOM 4624 O O     . TYR D 1 119 ? -1.164 28.766  75.343  1.00 350.39 ? 119 TYR D O     1 
ATOM 4625 C CB    . TYR D 1 119 ? -2.034 31.113  76.427  1.00 319.56 ? 119 TYR D CB    1 
ATOM 4626 C CG    . TYR D 1 119 ? -2.614 32.347  77.077  1.00 321.34 ? 119 TYR D CG    1 
ATOM 4627 C CD1   . TYR D 1 119 ? -3.982 32.581  77.086  1.00 333.14 ? 119 TYR D CD1   1 
ATOM 4628 C CD2   . TYR D 1 119 ? -1.785 33.285  77.677  1.00 317.97 ? 119 TYR D CD2   1 
ATOM 4629 C CE1   . TYR D 1 119 ? -4.508 33.712  77.684  1.00 336.23 ? 119 TYR D CE1   1 
ATOM 4630 C CE2   . TYR D 1 119 ? -2.299 34.417  78.274  1.00 321.30 ? 119 TYR D CE2   1 
ATOM 4631 C CZ    . TYR D 1 119 ? -3.660 34.627  78.275  1.00 331.01 ? 119 TYR D CZ    1 
ATOM 4632 O OH    . TYR D 1 119 ? -4.173 35.756  78.871  1.00 336.73 ? 119 TYR D OH    1 
ATOM 4633 N N     . LYS D 1 120 ? -1.879 27.437  77.008  1.00 354.87 ? 120 LYS D N     1 
ATOM 4634 C CA    . LYS D 1 120 ? -1.264 26.244  76.431  1.00 359.75 ? 120 LYS D CA    1 
ATOM 4635 C C     . LYS D 1 120 ? -1.786 25.978  75.024  1.00 390.65 ? 120 LYS D C     1 
ATOM 4636 O O     . LYS D 1 120 ? -1.030 26.010  74.047  1.00 389.03 ? 120 LYS D O     1 
ATOM 4637 C CB    . LYS D 1 120 ? -1.518 25.028  77.323  1.00 339.78 ? 120 LYS D CB    1 
ATOM 4638 C CG    . LYS D 1 120 ? -1.188 23.707  76.633  1.00 330.78 ? 120 LYS D CG    1 
ATOM 4639 C CD    . LYS D 1 120 ? -1.809 22.510  77.328  1.00 329.46 ? 120 LYS D CD    1 
ATOM 4640 C CE    . LYS D 1 120 ? -1.483 21.221  76.589  1.00 325.54 ? 120 LYS D CE    1 
ATOM 4641 N NZ    . LYS D 1 120 ? -0.015 21.029  76.425  1.00 309.71 ? 120 LYS D NZ    1 
ATOM 4642 N N     . ASN D 1 121 ? -3.086 25.709  74.904  1.00 416.60 ? 121 ASN D N     1 
ATOM 4643 C CA    . ASN D 1 121 ? -3.660 25.349  73.615  1.00 423.93 ? 121 ASN D CA    1 
ATOM 4644 C C     . ASN D 1 121 ? -3.824 26.544  72.687  1.00 426.91 ? 121 ASN D C     1 
ATOM 4645 O O     . ASN D 1 121 ? -3.987 26.348  71.477  1.00 440.53 ? 121 ASN D O     1 
ATOM 4646 C CB    . ASN D 1 121 ? -5.008 24.655  73.820  1.00 434.15 ? 121 ASN D CB    1 
ATOM 4647 C CG    . ASN D 1 121 ? -4.875 23.331  74.549  1.00 428.44 ? 121 ASN D CG    1 
ATOM 4648 O OD1   . ASN D 1 121 ? -3.872 22.630  74.408  1.00 419.11 ? 121 ASN D OD1   1 
ATOM 4649 N ND2   . ASN D 1 121 ? -5.886 22.983  75.336  1.00 432.43 ? 121 ASN D ND2   1 
ATOM 4650 N N     . ASP D 1 122 ? -3.774 27.771  73.219  1.00 390.44 ? 122 ASP D N     1 
ATOM 4651 C CA    . ASP D 1 122 ? -3.872 28.948  72.362  1.00 361.31 ? 122 ASP D CA    1 
ATOM 4652 C C     . ASP D 1 122 ? -2.732 28.991  71.353  1.00 365.86 ? 122 ASP D C     1 
ATOM 4653 O O     . ASP D 1 122 ? -2.914 29.465  70.226  1.00 345.48 ? 122 ASP D O     1 
ATOM 4654 C CB    . ASP D 1 122 ? -3.875 30.212  73.224  1.00 340.06 ? 122 ASP D CB    1 
ATOM 4655 C CG    . ASP D 1 122 ? -4.172 31.468  72.427  1.00 328.50 ? 122 ASP D CG    1 
ATOM 4656 O OD1   . ASP D 1 122 ? -4.709 31.355  71.306  1.00 337.54 ? 122 ASP D OD1   1 
ATOM 4657 O OD2   . ASP D 1 122 ? -3.864 32.572  72.926  1.00 310.30 ? 122 ASP D OD2   1 
ATOM 4658 N N     . ILE D 1 123 ? -1.553 28.515  71.744  1.00 377.33 ? 123 ILE D N     1 
ATOM 4659 C CA    . ILE D 1 123 ? -0.425 28.416  70.827  1.00 386.85 ? 123 ILE D CA    1 
ATOM 4660 C C     . ILE D 1 123 ? -0.446 27.091  70.065  1.00 385.89 ? 123 ILE D C     1 
ATOM 4661 O O     . ILE D 1 123 ? -0.048 27.041  68.896  1.00 393.85 ? 123 ILE D O     1 
ATOM 4662 C CB    . ILE D 1 123 ? 0.901  28.603  71.583  1.00 384.04 ? 123 ILE D CB    1 
ATOM 4663 C CG1   . ILE D 1 123 ? 0.880  29.917  72.366  1.00 383.62 ? 123 ILE D CG1   1 
ATOM 4664 C CG2   . ILE D 1 123 ? 2.078  28.589  70.620  1.00 384.40 ? 123 ILE D CG2   1 
ATOM 4665 C CD1   . ILE D 1 123 ? 0.729  31.144  71.490  1.00 390.73 ? 123 ILE D CD1   1 
ATOM 4666 N N     . LEU D 1 124 ? -0.924 26.022  70.706  1.00 372.20 ? 124 LEU D N     1 
ATOM 4667 C CA    . LEU D 1 124 ? -0.932 24.697  70.094  1.00 350.24 ? 124 LEU D CA    1 
ATOM 4668 C C     . LEU D 1 124 ? -1.883 24.610  68.907  1.00 381.98 ? 124 LEU D C     1 
ATOM 4669 O O     . LEU D 1 124 ? -1.624 23.847  67.969  1.00 371.54 ? 124 LEU D O     1 
ATOM 4670 C CB    . LEU D 1 124 ? -1.302 23.648  71.143  1.00 322.49 ? 124 LEU D CB    1 
ATOM 4671 C CG    . LEU D 1 124 ? -0.358 22.459  71.337  1.00 299.07 ? 124 LEU D CG    1 
ATOM 4672 C CD1   . LEU D 1 124 ? -0.787 21.633  72.541  1.00 289.59 ? 124 LEU D CD1   1 
ATOM 4673 C CD2   . LEU D 1 124 ? -0.308 21.597  70.087  1.00 299.47 ? 124 LEU D CD2   1 
ATOM 4674 N N     . ASN D 1 125 ? -2.981 25.367  68.919  1.00 409.18 ? 125 ASN D N     1 
ATOM 4675 C CA    . ASN D 1 125 ? -3.942 25.266  67.827  1.00 416.89 ? 125 ASN D CA    1 
ATOM 4676 C C     . ASN D 1 125 ? -3.501 25.990  66.559  1.00 401.73 ? 125 ASN D C     1 
ATOM 4677 O O     . ASN D 1 125 ? -4.156 25.831  65.523  1.00 404.17 ? 125 ASN D O     1 
ATOM 4678 C CB    . ASN D 1 125 ? -5.312 25.793  68.275  1.00 433.78 ? 125 ASN D CB    1 
ATOM 4679 C CG    . ASN D 1 125 ? -5.255 27.217  68.805  1.00 440.93 ? 125 ASN D CG    1 
ATOM 4680 O OD1   . ASN D 1 125 ? -4.389 28.005  68.426  1.00 437.80 ? 125 ASN D OD1   1 
ATOM 4681 N ND2   . ASN D 1 125 ? -6.188 27.552  69.689  1.00 448.18 ? 125 ASN D ND2   1 
ATOM 4682 N N     . LYS D 1 126 ? -2.416 26.774  66.604  1.00 383.92 ? 126 LYS D N     1 
ATOM 4683 C CA    . LYS D 1 126 ? -1.969 27.490  65.414  1.00 363.06 ? 126 LYS D CA    1 
ATOM 4684 C C     . LYS D 1 126 ? -0.454 27.481  65.223  1.00 353.77 ? 126 LYS D C     1 
ATOM 4685 O O     . LYS D 1 126 ? 0.045  28.211  64.357  1.00 333.12 ? 126 LYS D O     1 
ATOM 4686 C CB    . LYS D 1 126 ? -2.479 28.939  65.437  1.00 360.06 ? 126 LYS D CB    1 
ATOM 4687 C CG    . LYS D 1 126 ? -3.978 29.067  65.192  1.00 365.24 ? 126 LYS D CG    1 
ATOM 4688 C CD    . LYS D 1 126 ? -4.421 30.519  65.112  1.00 364.93 ? 126 LYS D CD    1 
ATOM 4689 C CE    . LYS D 1 126 ? -5.911 30.620  64.821  1.00 363.14 ? 126 LYS D CE    1 
ATOM 4690 N NZ    . LYS D 1 126 ? -6.370 32.032  64.710  1.00 357.97 ? 126 LYS D NZ    1 
ATOM 4691 N N     . TYR D 1 127 ? 0.293  26.692  65.993  1.00 360.46 ? 127 TYR D N     1 
ATOM 4692 C CA    . TYR D 1 127 ? 1.722  26.490  65.776  1.00 353.72 ? 127 TYR D CA    1 
ATOM 4693 C C     . TYR D 1 127 ? 2.040  25.021  65.550  1.00 350.60 ? 127 TYR D C     1 
ATOM 4694 O O     . TYR D 1 127 ? 1.581  24.153  66.302  1.00 346.26 ? 127 TYR D O     1 
ATOM 4695 C CB    . TYR D 1 127 ? 2.567  27.023  66.940  1.00 346.95 ? 127 TYR D CB    1 
ATOM 4696 C CG    . TYR D 1 127 ? 2.990  28.465  66.794  1.00 340.32 ? 127 TYR D CG    1 
ATOM 4697 C CD1   . TYR D 1 127 ? 2.123  29.514  67.068  1.00 344.47 ? 127 TYR D CD1   1 
ATOM 4698 C CD2   . TYR D 1 127 ? 4.278  28.772  66.373  1.00 327.81 ? 127 TYR D CD2   1 
ATOM 4699 C CE1   . TYR D 1 127 ? 2.535  30.830  66.924  1.00 338.42 ? 127 TYR D CE1   1 
ATOM 4700 C CE2   . TYR D 1 127 ? 4.695  30.073  66.228  1.00 321.60 ? 127 TYR D CE2   1 
ATOM 4701 C CZ    . TYR D 1 127 ? 3.823  31.100  66.504  1.00 324.70 ? 127 TYR D CZ    1 
ATOM 4702 O OH    . TYR D 1 127 ? 4.248  32.398  66.355  1.00 309.08 ? 127 TYR D OH    1 
ATOM 4703 N N     . THR D 1 128 ? 2.831  24.755  64.511  1.00 347.45 ? 128 THR D N     1 
ATOM 4704 C CA    . THR D 1 128 ? 3.262  23.401  64.168  1.00 348.27 ? 128 THR D CA    1 
ATOM 4705 C C     . THR D 1 128 ? 4.544  23.530  63.358  1.00 335.12 ? 128 THR D C     1 
ATOM 4706 O O     . THR D 1 128 ? 4.514  24.042  62.234  1.00 325.52 ? 128 THR D O     1 
ATOM 4707 C CB    . THR D 1 128 ? 2.190  22.649  63.383  1.00 353.80 ? 128 THR D CB    1 
ATOM 4708 O OG1   . THR D 1 128 ? 0.906  22.851  63.985  1.00 352.33 ? 128 THR D OG1   1 
ATOM 4709 C CG2   . THR D 1 128 ? 2.505  21.159  63.356  1.00 353.99 ? 128 THR D CG2   1 
ATOM 4710 N N     . LYS D 1 129 ? 5.659  23.078  63.927  1.00 335.60 ? 129 LYS D N     1 
ATOM 4711 C CA    . LYS D 1 129 ? 6.945  23.127  63.247  1.00 324.56 ? 129 LYS D CA    1 
ATOM 4712 C C     . LYS D 1 129 ? 7.825  22.021  63.816  1.00 334.60 ? 129 LYS D C     1 
ATOM 4713 O O     . LYS D 1 129 ? 7.492  21.392  64.824  1.00 337.09 ? 129 LYS D O     1 
ATOM 4714 C CB    . LYS D 1 129 ? 7.593  24.510  63.384  1.00 302.44 ? 129 LYS D CB    1 
ATOM 4715 C CG    . LYS D 1 129 ? 8.622  24.840  62.307  1.00 283.73 ? 129 LYS D CG    1 
ATOM 4716 C CD    . LYS D 1 129 ? 7.994  24.871  60.923  1.00 282.26 ? 129 LYS D CD    1 
ATOM 4717 C CE    . LYS D 1 129 ? 9.011  25.268  59.865  1.00 275.53 ? 129 LYS D CE    1 
ATOM 4718 N NZ    . LYS D 1 129 ? 10.151 24.314  59.801  1.00 282.03 ? 129 LYS D NZ    1 
ATOM 4719 N N     . LEU D 1 130 ? 8.960  21.786  63.157  1.00 331.43 ? 130 LEU D N     1 
ATOM 4720 C CA    . LEU D 1 130 ? 9.728  20.565  63.408  1.00 324.30 ? 130 LEU D CA    1 
ATOM 4721 C C     . LEU D 1 130 ? 10.626 20.676  64.639  1.00 335.99 ? 130 LEU D C     1 
ATOM 4722 O O     . LEU D 1 130 ? 10.430 19.967  65.631  1.00 295.38 ? 130 LEU D O     1 
ATOM 4723 C CB    . LEU D 1 130 ? 10.556 20.219  62.165  1.00 298.02 ? 130 LEU D CB    1 
ATOM 4724 C CG    . LEU D 1 130 ? 9.784  20.059  60.853  1.00 274.86 ? 130 LEU D CG    1 
ATOM 4725 C CD1   . LEU D 1 130 ? 10.736 19.795  59.697  1.00 257.87 ? 130 LEU D CD1   1 
ATOM 4726 C CD2   . LEU D 1 130 ? 8.751  18.950  60.966  1.00 259.73 ? 130 LEU D CD2   1 
ATOM 4727 N N     . ASP D 1 131 ? 11.616 21.567  64.594  1.00 389.57 ? 131 ASP D N     1 
ATOM 4728 C CA    . ASP D 1 131 ? 12.725 21.548  65.548  1.00 413.38 ? 131 ASP D CA    1 
ATOM 4729 C C     . ASP D 1 131 ? 13.114 22.958  65.970  1.00 420.44 ? 131 ASP D C     1 
ATOM 4730 O O     . ASP D 1 131 ? 14.298 23.264  66.148  1.00 428.50 ? 131 ASP D O     1 
ATOM 4731 C CB    . ASP D 1 131 ? 13.934 20.809  64.974  1.00 425.67 ? 131 ASP D CB    1 
ATOM 4732 C CG    . ASP D 1 131 ? 14.523 21.503  63.762  1.00 435.87 ? 131 ASP D CG    1 
ATOM 4733 O OD1   . ASP D 1 131 ? 13.744 21.992  62.918  1.00 441.08 ? 131 ASP D OD1   1 
ATOM 4734 O OD2   . ASP D 1 131 ? 15.767 21.562  63.656  1.00 435.90 ? 131 ASP D OD2   1 
ATOM 4735 N N     . ASP D 1 132 ? 12.131 23.837  66.152  1.00 420.30 ? 132 ASP D N     1 
ATOM 4736 C CA    . ASP D 1 132 ? 12.395 25.183  66.645  1.00 408.44 ? 132 ASP D CA    1 
ATOM 4737 C C     . ASP D 1 132 ? 11.872 25.422  68.051  1.00 399.95 ? 132 ASP D C     1 
ATOM 4738 O O     . ASP D 1 132 ? 12.638 25.815  68.943  1.00 410.28 ? 132 ASP D O     1 
ATOM 4739 C CB    . ASP D 1 132 ? 11.741 26.193  65.698  1.00 404.05 ? 132 ASP D CB    1 
ATOM 4740 C CG    . ASP D 1 132 ? 10.336 25.779  65.314  1.00 397.67 ? 132 ASP D CG    1 
ATOM 4741 O OD1   . ASP D 1 132 ? 10.119 24.565  65.129  1.00 394.78 ? 132 ASP D OD1   1 
ATOM 4742 O OD2   . ASP D 1 132 ? 9.447  26.650  65.237  1.00 396.08 ? 132 ASP D OD2   1 
ATOM 4743 N N     . ILE D 1 133 ? 10.580 25.176  68.278  1.00 347.26 ? 133 ILE D N     1 
ATOM 4744 C CA    . ILE D 1 133 ? 10.031 25.321  69.619  1.00 327.54 ? 133 ILE D CA    1 
ATOM 4745 C C     . ILE D 1 133 ? 10.673 24.318  70.564  1.00 315.92 ? 133 ILE D C     1 
ATOM 4746 O O     . ILE D 1 133 ? 10.963 24.637  71.721  1.00 309.83 ? 133 ILE D O     1 
ATOM 4747 C CB    . ILE D 1 133 ? 8.497  25.183  69.587  1.00 278.39 ? 133 ILE D CB    1 
ATOM 4748 C CG1   . ILE D 1 133 ? 8.084  23.799  69.078  1.00 264.71 ? 133 ILE D CG1   1 
ATOM 4749 C CG2   . ILE D 1 133 ? 7.886  26.280  68.729  1.00 267.65 ? 133 ILE D CG2   1 
ATOM 4750 C CD1   . ILE D 1 133 ? 6.587  23.592  69.005  1.00 245.31 ? 133 ILE D CD1   1 
ATOM 4751 N N     . ALA D 1 134 ? 10.978 23.118  70.065  1.00 319.47 ? 134 ALA D N     1 
ATOM 4752 C CA    . ALA D 1 134 ? 11.638 22.124  70.901  1.00 324.72 ? 134 ALA D CA    1 
ATOM 4753 C C     . ALA D 1 134 ? 13.002 22.612  71.368  1.00 340.74 ? 134 ALA D C     1 
ATOM 4754 O O     . ALA D 1 134 ? 13.271 22.664  72.572  1.00 336.89 ? 134 ALA D O     1 
ATOM 4755 C CB    . ALA D 1 134 ? 11.770 20.805  70.138  1.00 319.10 ? 134 ALA D CB    1 
ATOM 4756 N N     . ASN D 1 135 ? 13.852 23.044  70.435  1.00 356.49 ? 135 ASN D N     1 
ATOM 4757 C CA    . ASN D 1 135 ? 15.191 23.484  70.816  1.00 364.84 ? 135 ASN D CA    1 
ATOM 4758 C C     . ASN D 1 135 ? 15.144 24.707  71.724  1.00 367.48 ? 135 ASN D C     1 
ATOM 4759 O O     . ASN D 1 135 ? 15.786 24.730  72.781  1.00 375.08 ? 135 ASN D O     1 
ATOM 4760 C CB    . ASN D 1 135 ? 16.027 23.777  69.569  1.00 369.30 ? 135 ASN D CB    1 
ATOM 4761 C CG    . ASN D 1 135 ? 16.441 22.520  68.832  1.00 374.50 ? 135 ASN D CG    1 
ATOM 4762 O OD1   . ASN D 1 135 ? 16.524 21.441  69.418  1.00 379.37 ? 135 ASN D OD1   1 
ATOM 4763 N ND2   . ASN D 1 135 ? 16.712 22.655  67.538  1.00 374.18 ? 135 ASN D ND2   1 
ATOM 4764 N N     . SER D 1 136 ? 14.356 25.720  71.351  1.00 335.34 ? 136 SER D N     1 
ATOM 4765 C CA    . SER D 1 136 ? 14.342 26.951  72.136  1.00 295.30 ? 136 SER D CA    1 
ATOM 4766 C C     . SER D 1 136 ? 13.763 26.732  73.530  1.00 279.38 ? 136 SER D C     1 
ATOM 4767 O O     . SER D 1 136 ? 14.377 27.117  74.538  1.00 276.40 ? 136 SER D O     1 
ATOM 4768 C CB    . SER D 1 136 ? 13.558 28.033  71.392  1.00 275.83 ? 136 SER D CB    1 
ATOM 4769 O OG    . SER D 1 136 ? 12.189 27.683  71.279  1.00 273.51 ? 136 SER D OG    1 
ATOM 4770 N N     . PHE D 1 137 ? 12.585 26.104  73.614  1.00 266.68 ? 137 PHE D N     1 
ATOM 4771 C CA    . PHE D 1 137 ? 11.965 25.889  74.913  1.00 273.31 ? 137 PHE D CA    1 
ATOM 4772 C C     . PHE D 1 137 ? 12.800 24.952  75.775  1.00 291.47 ? 137 PHE D C     1 
ATOM 4773 O O     . PHE D 1 137 ? 12.908 25.161  76.985  1.00 285.87 ? 137 PHE D O     1 
ATOM 4774 C CB    . PHE D 1 137 ? 10.540 25.363  74.749  1.00 277.70 ? 137 PHE D CB    1 
ATOM 4775 C CG    . PHE D 1 137 ? 9.803  25.214  76.050  1.00 267.74 ? 137 PHE D CG    1 
ATOM 4776 C CD1   . PHE D 1 137 ? 9.277  26.330  76.682  1.00 267.79 ? 137 PHE D CD1   1 
ATOM 4777 C CD2   . PHE D 1 137 ? 9.634  23.977  76.642  1.00 274.91 ? 137 PHE D CD2   1 
ATOM 4778 C CE1   . PHE D 1 137 ? 8.598  26.217  77.878  1.00 275.01 ? 137 PHE D CE1   1 
ATOM 4779 C CE2   . PHE D 1 137 ? 8.951  23.858  77.840  1.00 294.03 ? 137 PHE D CE2   1 
ATOM 4780 C CZ    . PHE D 1 137 ? 8.434  24.979  78.458  1.00 288.84 ? 137 PHE D CZ    1 
ATOM 4781 N N     . ASN D 1 138 ? 13.380 23.898  75.185  1.00 302.73 ? 138 ASN D N     1 
ATOM 4782 C CA    . ASN D 1 138 ? 14.184 22.977  75.978  1.00 317.34 ? 138 ASN D CA    1 
ATOM 4783 C C     . ASN D 1 138 ? 15.449 23.646  76.497  1.00 318.73 ? 138 ASN D C     1 
ATOM 4784 O O     . ASN D 1 138 ? 15.828 23.434  77.651  1.00 323.90 ? 138 ASN D O     1 
ATOM 4785 C CB    . ASN D 1 138 ? 14.530 21.732  75.161  1.00 324.05 ? 138 ASN D CB    1 
ATOM 4786 C CG    . ASN D 1 138 ? 13.317 20.873  74.864  1.00 334.17 ? 138 ASN D CG    1 
ATOM 4787 O OD1   . ASN D 1 138 ? 12.387 20.793  75.666  1.00 337.48 ? 138 ASN D OD1   1 
ATOM 4788 N ND2   . ASN D 1 138 ? 13.319 20.227  73.704  1.00 337.72 ? 138 ASN D ND2   1 
ATOM 4789 N N     . LEU D 1 139 ? 16.105 24.475  75.678  1.00 315.56 ? 139 LEU D N     1 
ATOM 4790 C CA    . LEU D 1 139 ? 17.269 25.207  76.167  1.00 295.59 ? 139 LEU D CA    1 
ATOM 4791 C C     . LEU D 1 139 ? 16.889 26.120  77.326  1.00 292.20 ? 139 LEU D C     1 
ATOM 4792 O O     . LEU D 1 139 ? 17.537 26.109  78.383  1.00 281.14 ? 139 LEU D O     1 
ATOM 4793 C CB    . LEU D 1 139 ? 17.904 26.014  75.034  1.00 281.23 ? 139 LEU D CB    1 
ATOM 4794 C CG    . LEU D 1 139 ? 18.784 25.262  74.035  1.00 265.70 ? 139 LEU D CG    1 
ATOM 4795 C CD1   . LEU D 1 139 ? 19.307 26.216  72.975  1.00 264.00 ? 139 LEU D CD1   1 
ATOM 4796 C CD2   . LEU D 1 139 ? 19.934 24.569  74.749  1.00 250.46 ? 139 LEU D CD2   1 
ATOM 4797 N N     . GLY D 1 140 ? 15.828 26.912  77.148  1.00 291.05 ? 140 GLY D N     1 
ATOM 4798 C CA    . GLY D 1 140 ? 15.412 27.811  78.213  1.00 283.86 ? 140 GLY D CA    1 
ATOM 4799 C C     . GLY D 1 140 ? 15.027 27.078  79.484  1.00 272.20 ? 140 GLY D C     1 
ATOM 4800 O O     . GLY D 1 140 ? 15.478 27.425  80.578  1.00 262.31 ? 140 GLY D O     1 
ATOM 4801 N N     . LEU D 1 141 ? 14.198 26.041  79.353  1.00 274.01 ? 141 LEU D N     1 
ATOM 4802 C CA    . LEU D 1 141 ? 13.735 25.305  80.521  1.00 281.39 ? 141 LEU D CA    1 
ATOM 4803 C C     . LEU D 1 141 ? 14.877 24.565  81.205  1.00 275.50 ? 141 LEU D C     1 
ATOM 4804 O O     . LEU D 1 141 ? 14.896 24.460  82.432  1.00 282.37 ? 141 LEU D O     1 
ATOM 4805 C CB    . LEU D 1 141 ? 12.625 24.332  80.125  1.00 292.69 ? 141 LEU D CB    1 
ATOM 4806 C CG    . LEU D 1 141 ? 11.714 23.871  81.265  1.00 298.78 ? 141 LEU D CG    1 
ATOM 4807 C CD1   . LEU D 1 141 ? 11.072 25.066  81.958  1.00 297.64 ? 141 LEU D CD1   1 
ATOM 4808 C CD2   . LEU D 1 141 ? 10.655 22.903  80.763  1.00 300.09 ? 141 LEU D CD2   1 
ATOM 4809 N N     . SER D 1 142 ? 15.839 24.046  80.438  1.00 265.19 ? 142 SER D N     1 
ATOM 4810 C CA    . SER D 1 142 ? 16.985 23.383  81.050  1.00 237.33 ? 142 SER D CA    1 
ATOM 4811 C C     . SER D 1 142 ? 17.844 24.375  81.820  1.00 237.15 ? 142 SER D C     1 
ATOM 4812 O O     . SER D 1 142 ? 18.302 24.076  82.931  1.00 227.21 ? 142 SER D O     1 
ATOM 4813 C CB    . SER D 1 142 ? 17.811 22.671  79.981  1.00 237.22 ? 142 SER D CB    1 
ATOM 4814 O OG    . SER D 1 142 ? 18.962 22.067  80.545  1.00 237.13 ? 142 SER D OG    1 
ATOM 4815 N N     . TYR D 1 143 ? 18.061 25.565  81.253  1.00 238.38 ? 143 TYR D N     1 
ATOM 4816 C CA    . TYR D 1 143 ? 18.795 26.598  81.977  1.00 222.26 ? 143 TYR D CA    1 
ATOM 4817 C C     . TYR D 1 143 ? 18.077 26.989  83.263  1.00 251.97 ? 143 TYR D C     1 
ATOM 4818 O O     . TYR D 1 143 ? 18.714 27.179  84.306  1.00 217.39 ? 143 TYR D O     1 
ATOM 4819 C CB    . TYR D 1 143 ? 18.992 27.819  81.078  1.00 197.89 ? 143 TYR D CB    1 
ATOM 4820 C CG    . TYR D 1 143 ? 19.639 29.005  81.760  1.00 206.32 ? 143 TYR D CG    1 
ATOM 4821 C CD1   . TYR D 1 143 ? 21.014 29.066  81.943  1.00 208.83 ? 143 TYR D CD1   1 
ATOM 4822 C CD2   . TYR D 1 143 ? 18.872 30.074  82.207  1.00 221.24 ? 143 TYR D CD2   1 
ATOM 4823 C CE1   . TYR D 1 143 ? 21.606 30.154  82.561  1.00 209.09 ? 143 TYR D CE1   1 
ATOM 4824 C CE2   . TYR D 1 143 ? 19.454 31.165  82.826  1.00 210.94 ? 143 TYR D CE2   1 
ATOM 4825 C CZ    . TYR D 1 143 ? 20.821 31.200  83.000  1.00 208.61 ? 143 TYR D CZ    1 
ATOM 4826 O OH    . TYR D 1 143 ? 21.401 32.285  83.616  1.00 164.83 ? 143 TYR D OH    1 
ATOM 4827 N N     . MET D 1 144 ? 16.751 27.122  83.205  1.00 323.67 ? 144 MET D N     1 
ATOM 4828 C CA    . MET D 1 144 ? 15.998 27.537  84.385  1.00 341.72 ? 144 MET D CA    1 
ATOM 4829 C C     . MET D 1 144 ? 15.932 26.437  85.444  1.00 350.03 ? 144 MET D C     1 
ATOM 4830 O O     . MET D 1 144 ? 16.015 26.723  86.645  1.00 359.46 ? 144 MET D O     1 
ATOM 4831 C CB    . MET D 1 144 ? 14.597 27.974  83.966  1.00 352.78 ? 144 MET D CB    1 
ATOM 4832 C CG    . MET D 1 144 ? 14.606 29.089  82.931  1.00 348.07 ? 144 MET D CG    1 
ATOM 4833 S SD    . MET D 1 144 ? 13.268 30.265  83.131  1.00 351.73 ? 144 MET D SD    1 
ATOM 4834 C CE    . MET D 1 144 ? 12.010 29.172  83.768  1.00 360.28 ? 144 MET D CE    1 
ATOM 4835 N N     . GLU D 1 145 ? 15.777 25.175  85.027  1.00 334.68 ? 145 GLU D N     1 
ATOM 4836 C CA    . GLU D 1 145 ? 15.757 24.071  85.983  1.00 317.67 ? 145 GLU D CA    1 
ATOM 4837 C C     . GLU D 1 145 ? 17.123 23.860  86.623  1.00 311.50 ? 145 GLU D C     1 
ATOM 4838 O O     . GLU D 1 145 ? 17.213 23.564  87.820  1.00 310.27 ? 145 GLU D O     1 
ATOM 4839 C CB    . GLU D 1 145 ? 15.286 22.783  85.301  1.00 311.73 ? 145 GLU D CB    1 
ATOM 4840 C CG    . GLU D 1 145 ? 13.853 22.809  84.774  1.00 307.96 ? 145 GLU D CG    1 
ATOM 4841 C CD    . GLU D 1 145 ? 12.809 22.896  85.871  1.00 305.63 ? 145 GLU D CD    1 
ATOM 4842 O OE1   . GLU D 1 145 ? 13.110 22.504  87.018  1.00 310.25 ? 145 GLU D OE1   1 
ATOM 4843 O OE2   . GLU D 1 145 ? 11.683 23.353  85.583  1.00 303.11 ? 145 GLU D OE2   1 
ATOM 4844 N N     . SER D 1 146 ? 18.197 24.004  85.847  1.00 297.03 ? 146 SER D N     1 
ATOM 4845 C CA    . SER D 1 146 ? 19.539 23.909  86.404  1.00 284.55 ? 146 SER D CA    1 
ATOM 4846 C C     . SER D 1 146 ? 19.947 25.164  87.161  1.00 273.72 ? 146 SER D C     1 
ATOM 4847 O O     . SER D 1 146 ? 21.027 25.184  87.763  1.00 260.02 ? 146 SER D O     1 
ATOM 4848 C CB    . SER D 1 146 ? 20.551 23.623  85.292  1.00 284.71 ? 146 SER D CB    1 
ATOM 4849 O OG    . SER D 1 146 ? 20.689 24.739  84.430  1.00 284.23 ? 146 SER D OG    1 
ATOM 4850 N N     . LEU D 1 147 ? 19.116 26.199  87.145  1.00 274.41 ? 147 LEU D N     1 
ATOM 4851 C CA    . LEU D 1 147 ? 19.411 27.449  87.828  1.00 270.21 ? 147 LEU D CA    1 
ATOM 4852 C C     . LEU D 1 147 ? 19.134 27.341  89.324  1.00 277.40 ? 147 LEU D C     1 
ATOM 4853 O O     . LEU D 1 147 ? 19.871 27.888  90.143  1.00 280.57 ? 147 LEU D O     1 
ATOM 4854 C CB    . LEU D 1 147 ? 18.594 28.584  87.209  1.00 256.83 ? 147 LEU D CB    1 
ATOM 4855 C CG    . LEU D 1 147 ? 18.829 30.003  87.716  1.00 242.52 ? 147 LEU D CG    1 
ATOM 4856 C CD1   . LEU D 1 147 ? 20.312 30.326  87.718  1.00 221.28 ? 147 LEU D CD1   1 
ATOM 4857 C CD2   . LEU D 1 147 ? 18.077 30.975  86.828  1.00 247.91 ? 147 LEU D CD2   1 
ATOM 4858 O "O5'" . DA  E 2 1   ? 42.102 32.562  12.550  1.00 250.94 ? 1   DA  E "O5'" 1 
ATOM 4859 C "C5'" . DA  E 2 1   ? 41.154 32.645  13.608  1.00 239.57 ? 1   DA  E "C5'" 1 
ATOM 4860 C "C4'" . DA  E 2 1   ? 39.825 32.045  13.187  1.00 216.83 ? 1   DA  E "C4'" 1 
ATOM 4861 O "O4'" . DA  E 2 1   ? 39.990 30.623  12.943  1.00 206.57 ? 1   DA  E "O4'" 1 
ATOM 4862 C "C3'" . DA  E 2 1   ? 38.720 32.137  14.222  1.00 183.11 ? 1   DA  E "C3'" 1 
ATOM 4863 O "O3'" . DA  E 2 1   ? 37.456 32.095  13.561  1.00 182.19 ? 1   DA  E "O3'" 1 
ATOM 4864 C "C2'" . DA  E 2 1   ? 38.976 30.884  15.054  1.00 191.18 ? 1   DA  E "C2'" 1 
ATOM 4865 C "C1'" . DA  E 2 1   ? 39.360 29.879  13.973  1.00 186.62 ? 1   DA  E "C1'" 1 
ATOM 4866 N N9    . DA  E 2 1   ? 40.293 28.850  14.429  1.00 189.14 ? 1   DA  E N9    1 
ATOM 4867 C C8    . DA  E 2 1   ? 41.577 29.041  14.855  1.00 190.12 ? 1   DA  E C8    1 
ATOM 4868 N N7    . DA  E 2 1   ? 42.193 27.934  15.198  1.00 195.23 ? 1   DA  E N7    1 
ATOM 4869 C C5    . DA  E 2 1   ? 41.250 26.945  14.979  1.00 193.76 ? 1   DA  E C5    1 
ATOM 4870 C C6    . DA  E 2 1   ? 41.287 25.546  15.151  1.00 196.92 ? 1   DA  E C6    1 
ATOM 4871 N N6    . DA  E 2 1   ? 42.361 24.890  15.604  1.00 199.81 ? 1   DA  E N6    1 
ATOM 4872 N N1    . DA  E 2 1   ? 40.177 24.848  14.841  1.00 197.31 ? 1   DA  E N1    1 
ATOM 4873 C C2    . DA  E 2 1   ? 39.102 25.511  14.388  1.00 194.54 ? 1   DA  E C2    1 
ATOM 4874 N N3    . DA  E 2 1   ? 38.948 26.822  14.184  1.00 191.56 ? 1   DA  E N3    1 
ATOM 4875 C C4    . DA  E 2 1   ? 40.070 27.489  14.502  1.00 191.40 ? 1   DA  E C4    1 
ATOM 4876 P P     . DT  E 2 2   ? 36.113 31.716  14.357  1.00 181.48 ? 2   DT  E P     1 
ATOM 4877 O OP1   . DT  E 2 2   ? 34.974 32.151  13.522  1.00 180.26 ? 2   DT  E OP1   1 
ATOM 4878 O OP2   . DT  E 2 2   ? 36.234 32.221  15.742  1.00 197.14 ? 2   DT  E OP2   1 
ATOM 4879 O "O5'" . DT  E 2 2   ? 36.132 30.118  14.394  1.00 183.37 ? 2   DT  E "O5'" 1 
ATOM 4880 C "C5'" . DT  E 2 2   ? 35.040 29.377  13.884  1.00 183.51 ? 2   DT  E "C5'" 1 
ATOM 4881 C "C4'" . DT  E 2 2   ? 34.493 28.438  14.942  1.00 195.60 ? 2   DT  E "C4'" 1 
ATOM 4882 O "O4'" . DT  E 2 2   ? 35.531 27.506  15.357  1.00 203.47 ? 2   DT  E "O4'" 1 
ATOM 4883 C "C3'" . DT  E 2 2   ? 34.013 29.119  16.226  1.00 183.74 ? 2   DT  E "C3'" 1 
ATOM 4884 O "O3'" . DT  E 2 2   ? 32.858 28.460  16.703  1.00 184.32 ? 2   DT  E "O3'" 1 
ATOM 4885 C "C2'" . DT  E 2 2   ? 35.187 28.902  17.171  1.00 185.25 ? 2   DT  E "C2'" 1 
ATOM 4886 C "C1'" . DT  E 2 2   ? 35.589 27.501  16.763  1.00 187.63 ? 2   DT  E "C1'" 1 
ATOM 4887 N N1    . DT  E 2 2   ? 36.953 27.105  17.200  1.00 189.59 ? 2   DT  E N1    1 
ATOM 4888 C C2    . DT  E 2 2   ? 37.209 25.782  17.443  1.00 192.62 ? 2   DT  E C2    1 
ATOM 4889 O O2    . DT  E 2 2   ? 36.376 24.905  17.306  1.00 193.82 ? 2   DT  E O2    1 
ATOM 4890 N N3    . DT  E 2 2   ? 38.484 25.511  17.849  1.00 194.52 ? 2   DT  E N3    1 
ATOM 4891 C C4    . DT  E 2 2   ? 39.510 26.413  18.040  1.00 193.53 ? 2   DT  E C4    1 
ATOM 4892 O O4    . DT  E 2 2   ? 40.627 26.064  18.410  1.00 195.50 ? 2   DT  E O4    1 
ATOM 4893 C C5    . DT  E 2 2   ? 39.174 27.793  17.773  1.00 190.34 ? 2   DT  E C5    1 
ATOM 4894 C C7    . DT  E 2 2   ? 40.205 28.868  17.945  1.00 189.35 ? 2   DT  E C7    1 
ATOM 4895 C C6    . DT  E 2 2   ? 37.924 28.070  17.373  1.00 188.64 ? 2   DT  E C6    1 
ATOM 4896 P P     . DC  E 2 3   ? 31.521 29.286  17.019  1.00 182.76 ? 3   DC  E P     1 
ATOM 4897 O OP1   . DC  E 2 3   ? 30.769 29.381  15.748  1.00 181.48 ? 3   DC  E OP1   1 
ATOM 4898 O OP2   . DC  E 2 3   ? 31.900 30.516  17.752  1.00 182.01 ? 3   DC  E OP2   1 
ATOM 4899 O "O5'" . DC  E 2 3   ? 30.720 28.334  18.026  1.00 197.54 ? 3   DC  E "O5'" 1 
ATOM 4900 C "C5'" . DC  E 2 3   ? 30.251 27.068  17.576  1.00 195.80 ? 3   DC  E "C5'" 1 
ATOM 4901 C "C4'" . DC  E 2 3   ? 30.615 25.968  18.559  1.00 189.06 ? 3   DC  E "C4'" 1 
ATOM 4902 O "O4'" . DC  E 2 3   ? 32.051 25.842  18.644  1.00 213.93 ? 3   DC  E "O4'" 1 
ATOM 4903 C "C3'" . DC  E 2 3   ? 30.121 26.182  19.994  1.00 190.21 ? 3   DC  E "C3'" 1 
ATOM 4904 O "O3'" . DC  E 2 3   ? 29.180 25.167  20.334  1.00 192.37 ? 3   DC  E "O3'" 1 
ATOM 4905 C "C2'" . DC  E 2 3   ? 31.392 26.096  20.857  1.00 191.89 ? 3   DC  E "C2'" 1 
ATOM 4906 C "C1'" . DC  E 2 3   ? 32.381 25.403  19.932  1.00 192.43 ? 3   DC  E "C1'" 1 
ATOM 4907 N N1    . DC  E 2 3   ? 33.804 25.757  20.204  1.00 192.67 ? 3   DC  E N1    1 
ATOM 4908 C C2    . DC  E 2 3   ? 34.703 24.758  20.591  1.00 195.73 ? 3   DC  E C2    1 
ATOM 4909 O O2    . DC  E 2 3   ? 34.294 23.598  20.701  1.00 198.39 ? 3   DC  E O2    1 
ATOM 4910 N N3    . DC  E 2 3   ? 35.993 25.096  20.834  1.00 195.97 ? 3   DC  E N3    1 
ATOM 4911 C C4    . DC  E 2 3   ? 36.386 26.364  20.702  1.00 193.33 ? 3   DC  E C4    1 
ATOM 4912 N N4    . DC  E 2 3   ? 37.667 26.655  20.951  1.00 193.76 ? 3   DC  E N4    1 
ATOM 4913 C C5    . DC  E 2 3   ? 35.483 27.393  20.310  1.00 190.45 ? 3   DC  E C5    1 
ATOM 4914 C C6    . DC  E 2 3   ? 34.215 27.048  20.073  1.00 190.21 ? 3   DC  E C6    1 
ATOM 4915 P P     . DG  E 2 4   ? 28.547 25.099  21.809  1.00 194.71 ? 4   DG  E P     1 
ATOM 4916 O OP1   . DG  E 2 4   ? 27.226 24.444  21.695  1.00 195.71 ? 4   DG  E OP1   1 
ATOM 4917 O OP2   . DG  E 2 4   ? 28.646 26.440  22.426  1.00 193.33 ? 4   DG  E OP2   1 
ATOM 4918 O "O5'" . DG  E 2 4   ? 29.513 24.095  22.591  1.00 249.74 ? 4   DG  E "O5'" 1 
ATOM 4919 C "C5'" . DG  E 2 4   ? 29.720 22.775  22.097  1.00 217.56 ? 4   DG  E "C5'" 1 
ATOM 4920 C "C4'" . DG  E 2 4   ? 30.527 21.954  23.086  1.00 206.68 ? 4   DG  E "C4'" 1 
ATOM 4921 O "O4'" . DG  E 2 4   ? 31.920 22.358  23.030  1.00 203.85 ? 4   DG  E "O4'" 1 
ATOM 4922 C "C3'" . DG  E 2 4   ? 30.093 22.103  24.545  1.00 206.93 ? 4   DG  E "C3'" 1 
ATOM 4923 O "O3'" . DG  E 2 4   ? 30.068 20.835  25.182  1.00 211.72 ? 4   DG  E "O3'" 1 
ATOM 4924 C "C2'" . DG  E 2 4   ? 31.161 23.014  25.144  1.00 206.04 ? 4   DG  E "C2'" 1 
ATOM 4925 C "C1'" . DG  E 2 4   ? 32.388 22.644  24.327  1.00 205.60 ? 4   DG  E "C1'" 1 
ATOM 4926 N N9    . DG  E 2 4   ? 33.357 23.728  24.235  1.00 203.00 ? 4   DG  E N9    1 
ATOM 4927 C C8    . DG  E 2 4   ? 33.103 25.029  23.876  1.00 199.30 ? 4   DG  E C8    1 
ATOM 4928 N N7    . DG  E 2 4   ? 34.162 25.786  23.885  1.00 198.00 ? 4   DG  E N7    1 
ATOM 4929 C C5    . DG  E 2 4   ? 35.185 24.934  24.275  1.00 200.83 ? 4   DG  E C5    1 
ATOM 4930 C C6    . DG  E 2 4   ? 36.560 25.195  24.459  1.00 201.07 ? 4   DG  E C6    1 
ATOM 4931 O O6    . DG  E 2 4   ? 37.158 26.267  24.308  1.00 198.73 ? 4   DG  E O6    1 
ATOM 4932 N N1    . DG  E 2 4   ? 37.254 24.057  24.861  1.00 204.77 ? 4   DG  E N1    1 
ATOM 4933 C C2    . DG  E 2 4   ? 36.687 22.819  25.059  1.00 208.09 ? 4   DG  E C2    1 
ATOM 4934 N N2    . DG  E 2 4   ? 37.515 21.836  25.448  1.00 211.97 ? 4   DG  E N2    1 
ATOM 4935 N N3    . DG  E 2 4   ? 35.395 22.561  24.889  1.00 207.91 ? 4   DG  E N3    1 
ATOM 4936 C C4    . DG  E 2 4   ? 34.708 23.663  24.497  1.00 204.07 ? 4   DG  E C4    1 
ATOM 4937 P P     . DT  E 2 5   ? 29.573 20.712  26.705  1.00 235.98 ? 5   DT  E P     1 
ATOM 4938 O OP1   . DT  E 2 5   ? 29.010 19.356  26.885  1.00 225.68 ? 5   DT  E OP1   1 
ATOM 4939 O OP2   . DT  E 2 5   ? 28.736 21.898  26.996  1.00 233.82 ? 5   DT  E OP2   1 
ATOM 4940 O "O5'" . DT  E 2 5   ? 30.923 20.833  27.557  1.00 239.56 ? 5   DT  E "O5'" 1 
ATOM 4941 C "C5'" . DT  E 2 5   ? 31.992 19.926  27.314  1.00 219.65 ? 5   DT  E "C5'" 1 
ATOM 4942 C "C4'" . DT  E 2 5   ? 33.210 20.274  28.154  1.00 220.86 ? 5   DT  E "C4'" 1 
ATOM 4943 O "O4'" . DT  E 2 5   ? 33.861 21.442  27.618  1.00 216.24 ? 5   DT  E "O4'" 1 
ATOM 4944 C "C3'" . DT  E 2 5   ? 32.923 20.593  29.624  1.00 228.45 ? 5   DT  E "C3'" 1 
ATOM 4945 O "O3'" . DT  E 2 5   ? 33.446 19.555  30.450  1.00 237.27 ? 5   DT  E "O3'" 1 
ATOM 4946 C "C2'" . DT  E 2 5   ? 33.635 21.937  29.873  1.00 243.49 ? 5   DT  E "C2'" 1 
ATOM 4947 C "C1'" . DT  E 2 5   ? 34.547 22.069  28.662  1.00 217.12 ? 5   DT  E "C1'" 1 
ATOM 4948 N N1    . DT  E 2 5   ? 34.820 23.480  28.271  1.00 212.46 ? 5   DT  E N1    1 
ATOM 4949 C C2    . DT  E 2 5   ? 36.110 23.958  28.325  1.00 211.62 ? 5   DT  E C2    1 
ATOM 4950 O O2    . DT  E 2 5   ? 37.058 23.283  28.677  1.00 214.39 ? 5   DT  E O2    1 
ATOM 4951 N N3    . DT  E 2 5   ? 36.251 25.264  27.946  1.00 207.67 ? 5   DT  E N3    1 
ATOM 4952 C C4    . DT  E 2 5   ? 35.252 26.124  27.528  1.00 204.74 ? 5   DT  E C4    1 
ATOM 4953 O O4    . DT  E 2 5   ? 35.477 27.284  27.207  1.00 201.79 ? 5   DT  E O4    1 
ATOM 4954 C C5    . DT  E 2 5   ? 33.924 25.559  27.496  1.00 205.72 ? 5   DT  E C5    1 
ATOM 4955 C C7    . DT  E 2 5   ? 32.760 26.397  27.059  1.00 203.00 ? 5   DT  E C7    1 
ATOM 4956 C C6    . DT  E 2 5   ? 33.774 24.280  27.865  1.00 209.42 ? 5   DT  E C6    1 
ATOM 4957 P P     . DC  E 2 6   ? 33.425 19.691  32.051  1.00 233.60 ? 6   DC  E P     1 
ATOM 4958 O OP1   . DC  E 2 6   ? 33.467 18.320  32.606  1.00 243.74 ? 6   DC  E OP1   1 
ATOM 4959 O OP2   . DC  E 2 6   ? 32.315 20.596  32.424  1.00 232.06 ? 6   DC  E OP2   1 
ATOM 4960 O "O5'" . DC  E 2 6   ? 34.818 20.400  32.392  1.00 232.43 ? 6   DC  E "O5'" 1 
ATOM 4961 C "C5'" . DC  E 2 6   ? 36.018 19.937  31.781  1.00 232.18 ? 6   DC  E "C5'" 1 
ATOM 4962 C "C4'" . DC  E 2 6   ? 37.227 20.657  32.350  1.00 231.72 ? 6   DC  E "C4'" 1 
ATOM 4963 O "O4'" . DC  E 2 6   ? 37.401 21.934  31.681  1.00 225.95 ? 6   DC  E "O4'" 1 
ATOM 4964 C "C3'" . DC  E 2 6   ? 37.148 20.956  33.843  1.00 248.02 ? 6   DC  E "C3'" 1 
ATOM 4965 O "O3'" . DC  E 2 6   ? 38.371 20.604  34.470  1.00 268.59 ? 6   DC  E "O3'" 1 
ATOM 4966 C "C2'" . DC  E 2 6   ? 36.891 22.463  33.897  1.00 261.55 ? 6   DC  E "C2'" 1 
ATOM 4967 C "C1'" . DC  E 2 6   ? 37.578 22.957  32.633  1.00 225.81 ? 6   DC  E "C1'" 1 
ATOM 4968 N N1    . DC  E 2 6   ? 36.970 24.207  32.085  1.00 220.92 ? 6   DC  E N1    1 
ATOM 4969 C C2    . DC  E 2 6   ? 37.776 25.324  31.791  1.00 217.42 ? 6   DC  E C2    1 
ATOM 4970 O O2    . DC  E 2 6   ? 38.997 25.267  31.992  1.00 218.19 ? 6   DC  E O2    1 
ATOM 4971 N N3    . DC  E 2 6   ? 37.184 26.442  31.290  1.00 213.58 ? 6   DC  E N3    1 
ATOM 4972 C C4    . DC  E 2 6   ? 35.863 26.463  31.087  1.00 213.03 ? 6   DC  E C4    1 
ATOM 4973 N N4    . DC  E 2 6   ? 35.318 27.579  30.595  1.00 209.59 ? 6   DC  E N4    1 
ATOM 4974 C C5    . DC  E 2 6   ? 35.038 25.340  31.382  1.00 216.30 ? 6   DC  E C5    1 
ATOM 4975 C C6    . DC  E 2 6   ? 35.626 24.248  31.872  1.00 220.21 ? 6   DC  E C6    1 
ATOM 4976 P P     . DG  E 2 7   ? 38.443 20.414  36.063  1.00 244.48 ? 7   DG  E P     1 
ATOM 4977 O OP1   . DG  E 2 7   ? 38.906 19.034  36.331  1.00 250.11 ? 7   DG  E OP1   1 
ATOM 4978 O OP2   . DG  E 2 7   ? 37.166 20.884  36.641  1.00 245.09 ? 7   DG  E OP2   1 
ATOM 4979 O "O5'" . DG  E 2 7   ? 39.588 21.436  36.504  1.00 242.76 ? 7   DG  E "O5'" 1 
ATOM 4980 C "C5'" . DG  E 2 7   ? 40.802 21.491  35.767  1.00 242.22 ? 7   DG  E "C5'" 1 
ATOM 4981 C "C4'" . DG  E 2 7   ? 41.497 22.823  35.975  1.00 236.90 ? 7   DG  E "C4'" 1 
ATOM 4982 O "O4'" . DG  E 2 7   ? 40.825 23.849  35.201  1.00 231.46 ? 7   DG  E "O4'" 1 
ATOM 4983 C "C3'" . DG  E 2 7   ? 41.524 23.308  37.421  1.00 245.65 ? 7   DG  E "C3'" 1 
ATOM 4984 O "O3'" . DG  E 2 7   ? 42.842 23.684  37.781  1.00 240.59 ? 7   DG  E "O3'" 1 
ATOM 4985 C "C2'" . DG  E 2 7   ? 40.561 24.498  37.440  1.00 260.01 ? 7   DG  E "C2'" 1 
ATOM 4986 C "C1'" . DG  E 2 7   ? 40.587 24.986  35.998  1.00 231.09 ? 7   DG  E "C1'" 1 
ATOM 4987 N N9    . DG  E 2 7   ? 39.318 25.572  35.573  1.00 228.36 ? 7   DG  E N9    1 
ATOM 4988 C C8    . DG  E 2 7   ? 38.082 24.980  35.642  1.00 230.16 ? 7   DG  E C8    1 
ATOM 4989 N N7    . DG  E 2 7   ? 37.118 25.728  35.188  1.00 227.08 ? 7   DG  E N7    1 
ATOM 4990 C C5    . DG  E 2 7   ? 37.752 26.896  34.792  1.00 223.15 ? 7   DG  E C5    1 
ATOM 4991 C C6    . DG  E 2 7   ? 37.212 28.071  34.221  1.00 235.32 ? 7   DG  E C6    1 
ATOM 4992 O O6    . DG  E 2 7   ? 36.027 28.312  33.949  1.00 227.25 ? 7   DG  E O6    1 
ATOM 4993 N N1    . DG  E 2 7   ? 38.197 29.021  33.968  1.00 233.35 ? 7   DG  E N1    1 
ATOM 4994 C C2    . DG  E 2 7   ? 39.538 28.855  34.232  1.00 221.56 ? 7   DG  E C2    1 
ATOM 4995 N N2    . DG  E 2 7   ? 40.341 29.883  33.919  1.00 219.93 ? 7   DG  E N2    1 
ATOM 4996 N N3    . DG  E 2 7   ? 40.059 27.755  34.768  1.00 221.00 ? 7   DG  E N3    1 
ATOM 4997 C C4    . DG  E 2 7   ? 39.109 26.820  35.020  1.00 223.82 ? 7   DG  E C4    1 
ATOM 4998 P P     . DG  E 2 8   ? 43.197 24.017  39.311  1.00 247.60 ? 8   DG  E P     1 
ATOM 4999 O OP1   . DG  E 2 8   ? 44.501 23.387  39.612  1.00 276.90 ? 8   DG  E OP1   1 
ATOM 5000 O OP2   . DG  E 2 8   ? 42.016 23.691  40.141  1.00 249.35 ? 8   DG  E OP2   1 
ATOM 5001 O "O5'" . DG  E 2 8   ? 43.384 25.602  39.309  1.00 240.96 ? 8   DG  E "O5'" 1 
ATOM 5002 C "C5'" . DG  E 2 8   ? 44.201 26.207  38.320  1.00 235.88 ? 8   DG  E "C5'" 1 
ATOM 5003 C "C4'" . DG  E 2 8   ? 43.938 27.698  38.242  1.00 232.24 ? 8   DG  E "C4'" 1 
ATOM 5004 O "O4'" . DG  E 2 8   ? 42.643 27.936  37.642  1.00 274.92 ? 8   DG  E "O4'" 1 
ATOM 5005 C "C3'" . DG  E 2 8   ? 43.935 28.421  39.588  1.00 235.59 ? 8   DG  E "C3'" 1 
ATOM 5006 O "O3'" . DG  E 2 8   ? 44.845 29.505  39.545  1.00 233.19 ? 8   DG  E "O3'" 1 
ATOM 5007 C "C2'" . DG  E 2 8   ? 42.485 28.891  39.762  1.00 235.72 ? 8   DG  E "C2'" 1 
ATOM 5008 C "C1'" . DG  E 2 8   ? 41.993 28.976  38.327  1.00 230.37 ? 8   DG  E "C1'" 1 
ATOM 5009 N N9    . DG  E 2 8   ? 40.556 28.770  38.188  1.00 230.65 ? 8   DG  E N9    1 
ATOM 5010 C C8    . DG  E 2 8   ? 39.849 27.647  38.540  1.00 234.31 ? 8   DG  E C8    1 
ATOM 5011 N N7    . DG  E 2 8   ? 38.574 27.734  38.290  1.00 233.66 ? 8   DG  E N7    1 
ATOM 5012 C C5    . DG  E 2 8   ? 38.422 28.996  37.729  1.00 234.39 ? 8   DG  E C5    1 
ATOM 5013 C C6    . DG  E 2 8   ? 37.258 29.646  37.258  1.00 240.05 ? 8   DG  E C6    1 
ATOM 5014 O O6    . DG  E 2 8   ? 36.096 29.219  37.247  1.00 251.12 ? 8   DG  E O6    1 
ATOM 5015 N N1    . DG  E 2 8   ? 37.539 30.920  36.768  1.00 236.82 ? 8   DG  E N1    1 
ATOM 5016 C C2    . DG  E 2 8   ? 38.791 31.491  36.733  1.00 237.12 ? 8   DG  E C2    1 
ATOM 5017 N N2    . DG  E 2 8   ? 38.870 32.729  36.223  1.00 239.20 ? 8   DG  E N2    1 
ATOM 5018 N N3    . DG  E 2 8   ? 39.893 30.889  37.172  1.00 223.88 ? 8   DG  E N3    1 
ATOM 5019 C C4    . DG  E 2 8   ? 39.633 29.647  37.654  1.00 227.54 ? 8   DG  E C4    1 
ATOM 5020 P P     . DG  E 2 9   ? 46.410 29.219  39.323  1.00 232.73 ? 9   DG  E P     1 
ATOM 5021 O OP1   . DG  E 2 9   ? 46.688 29.290  37.873  1.00 232.43 ? 9   DG  E OP1   1 
ATOM 5022 O OP2   . DG  E 2 9   ? 46.751 27.995  40.079  1.00 237.92 ? 9   DG  E OP2   1 
ATOM 5023 O "O5'" . DG  E 2 9   ? 47.129 30.468  40.007  1.00 232.78 ? 9   DG  E "O5'" 1 
ATOM 5024 C "C5'" . DG  E 2 9   ? 46.863 30.785  41.364  1.00 237.31 ? 9   DG  E "C5'" 1 
ATOM 5025 C "C4'" . DG  E 2 9   ? 48.158 30.948  42.133  1.00 239.70 ? 9   DG  E "C4'" 1 
ATOM 5026 O "O4'" . DG  E 2 9   ? 48.433 29.745  42.862  1.00 244.67 ? 9   DG  E "O4'" 1 
ATOM 5027 C "C3'" . DG  E 2 9   ? 49.389 31.143  41.267  1.00 246.75 ? 9   DG  E "C3'" 1 
ATOM 5028 O "O3'" . DG  E 2 9   ? 49.595 32.520  41.007  1.00 249.81 ? 9   DG  E "O3'" 1 
ATOM 5029 C "C2'" . DG  E 2 9   ? 50.525 30.562  42.118  1.00 240.00 ? 9   DG  E "C2'" 1 
ATOM 5030 C "C1'" . DG  E 2 9   ? 49.805 29.722  43.170  1.00 245.71 ? 9   DG  E "C1'" 1 
ATOM 5031 N N9    . DG  E 2 9   ? 50.253 28.335  43.235  1.00 248.87 ? 9   DG  E N9    1 
ATOM 5032 C C8    . DG  E 2 9   ? 49.547 27.216  42.870  1.00 250.10 ? 9   DG  E C8    1 
ATOM 5033 N N7    . DG  E 2 9   ? 50.203 26.105  43.060  1.00 253.69 ? 9   DG  E N7    1 
ATOM 5034 C C5    . DG  E 2 9   ? 51.422 26.516  43.584  1.00 254.70 ? 9   DG  E C5    1 
ATOM 5035 C C6    . DG  E 2 9   ? 52.542 25.755  43.990  1.00 258.48 ? 9   DG  E C6    1 
ATOM 5036 O O6    . DG  E 2 9   ? 52.683 24.526  43.961  1.00 280.31 ? 9   DG  E O6    1 
ATOM 5037 N N1    . DG  E 2 9   ? 53.570 26.564  44.466  1.00 258.24 ? 9   DG  E N1    1 
ATOM 5038 C C2    . DG  E 2 9   ? 53.520 27.936  44.543  1.00 254.98 ? 9   DG  E C2    1 
ATOM 5039 N N2    . DG  E 2 9   ? 54.607 28.551  45.029  1.00 255.48 ? 9   DG  E N2    1 
ATOM 5040 N N3    . DG  E 2 9   ? 52.475 28.659  44.168  1.00 251.74 ? 9   DG  E N3    1 
ATOM 5041 C C4    . DG  E 2 9   ? 51.468 27.885  43.697  1.00 251.70 ? 9   DG  E C4    1 
ATOM 5042 P P     . DG  E 2 10  ? 50.597 32.967  39.834  1.00 281.48 ? 10  DG  E P     1 
ATOM 5043 O OP1   . DG  E 2 10  ? 50.323 34.386  39.518  1.00 273.88 ? 10  DG  E OP1   1 
ATOM 5044 O OP2   . DG  E 2 10  ? 50.517 31.940  38.771  1.00 226.09 ? 10  DG  E OP2   1 
ATOM 5045 O "O5'" . DG  E 2 10  ? 52.048 32.852  40.498  1.00 230.41 ? 10  DG  E "O5'" 1 
ATOM 5046 C "C5'" . DG  E 2 10  ? 52.344 33.566  41.690  1.00 233.50 ? 10  DG  E "C5'" 1 
ATOM 5047 C "C4'" . DG  E 2 10  ? 53.822 33.464  42.027  1.00 241.15 ? 10  DG  E "C4'" 1 
ATOM 5048 O "O4'" . DG  E 2 10  ? 54.132 32.127  42.497  1.00 255.32 ? 10  DG  E "O4'" 1 
ATOM 5049 C "C3'" . DG  E 2 10  ? 54.766 33.734  40.865  1.00 235.18 ? 10  DG  E "C3'" 1 
ATOM 5050 O "O3'" . DG  E 2 10  ? 55.899 34.447  41.328  1.00 249.89 ? 10  DG  E "O3'" 1 
ATOM 5051 C "C2'" . DG  E 2 10  ? 55.133 32.334  40.372  1.00 246.78 ? 10  DG  E "C2'" 1 
ATOM 5052 C "C1'" . DG  E 2 10  ? 55.086 31.511  41.653  1.00 236.87 ? 10  DG  E "C1'" 1 
ATOM 5053 N N9    . DG  E 2 10  ? 54.662 30.130  41.442  1.00 238.80 ? 10  DG  E N9    1 
ATOM 5054 C C8    . DG  E 2 10  ? 53.441 29.711  40.980  1.00 237.86 ? 10  DG  E C8    1 
ATOM 5055 N N7    . DG  E 2 10  ? 53.326 28.418  40.904  1.00 240.48 ? 10  DG  E N7    1 
ATOM 5056 C C5    . DG  E 2 10  ? 54.550 27.943  41.344  1.00 243.47 ? 10  DG  E C5    1 
ATOM 5057 C C6    . DG  E 2 10  ? 55.010 26.616  41.477  1.00 247.57 ? 10  DG  E C6    1 
ATOM 5058 O O6    . DG  E 2 10  ? 54.401 25.570  41.221  1.00 249.45 ? 10  DG  E O6    1 
ATOM 5059 N N1    . DG  E 2 10  ? 56.314 26.566  41.959  1.00 249.85 ? 10  DG  E N1    1 
ATOM 5060 C C2    . DG  E 2 10  ? 57.078 27.666  42.273  1.00 248.22 ? 10  DG  E C2    1 
ATOM 5061 N N2    . DG  E 2 10  ? 58.318 27.423  42.725  1.00 250.94 ? 10  DG  E N2    1 
ATOM 5062 N N3    . DG  E 2 10  ? 56.657 28.921  42.153  1.00 244.48 ? 10  DG  E N3    1 
ATOM 5063 C C4    . DG  E 2 10  ? 55.387 28.983  41.684  1.00 242.35 ? 10  DG  E C4    1 
ATOM 5064 P P     . DA  E 2 11  ? 57.039 34.910  40.298  1.00 291.79 ? 11  DA  E P     1 
ATOM 5065 O OP1   . DA  E 2 11  ? 57.627 36.165  40.815  1.00 298.44 ? 11  DA  E OP1   1 
ATOM 5066 O OP2   . DA  E 2 11  ? 56.471 34.872  38.931  1.00 261.52 ? 11  DA  E OP2   1 
ATOM 5067 O "O5'" . DA  E 2 11  ? 58.125 33.747  40.404  1.00 268.28 ? 11  DA  E "O5'" 1 
ATOM 5068 C "C5'" . DA  E 2 11  ? 58.572 33.313  41.680  1.00 270.92 ? 11  DA  E "C5'" 1 
ATOM 5069 C "C4'" . DA  E 2 11  ? 59.980 32.757  41.596  1.00 276.53 ? 11  DA  E "C4'" 1 
ATOM 5070 O "O4'" . DA  E 2 11  ? 59.931 31.314  41.488  1.00 266.84 ? 11  DA  E "O4'" 1 
ATOM 5071 C "C3'" . DA  E 2 11  ? 60.790 33.233  40.403  1.00 277.84 ? 11  DA  E "C3'" 1 
ATOM 5072 O "O3'" . DA  E 2 11  ? 62.164 33.293  40.751  1.00 293.22 ? 11  DA  E "O3'" 1 
ATOM 5073 C "C2'" . DA  E 2 11  ? 60.513 32.161  39.348  1.00 264.73 ? 11  DA  E "C2'" 1 
ATOM 5074 C "C1'" . DA  E 2 11  ? 60.314 30.901  40.189  1.00 259.41 ? 11  DA  E "C1'" 1 
ATOM 5075 N N9    . DA  E 2 11  ? 59.271 30.017  39.676  1.00 244.27 ? 11  DA  E N9    1 
ATOM 5076 C C8    . DA  E 2 11  ? 58.051 30.383  39.180  1.00 235.40 ? 11  DA  E C8    1 
ATOM 5077 N N7    . DA  E 2 11  ? 57.308 29.370  38.802  1.00 222.86 ? 11  DA  E N7    1 
ATOM 5078 C C5    . DA  E 2 11  ? 58.092 28.263  39.075  1.00 223.43 ? 11  DA  E C5    1 
ATOM 5079 C C6    . DA  E 2 11  ? 57.878 26.881  38.903  1.00 213.78 ? 11  DA  E C6    1 
ATOM 5080 N N6    . DA  E 2 11  ? 56.754 26.369  38.392  1.00 201.30 ? 11  DA  E N6    1 
ATOM 5081 N N1    . DA  E 2 11  ? 58.867 26.044  39.278  1.00 217.86 ? 11  DA  E N1    1 
ATOM 5082 C C2    . DA  E 2 11  ? 59.990 26.561  39.789  1.00 237.34 ? 11  DA  E C2    1 
ATOM 5083 N N3    . DA  E 2 11  ? 60.306 27.837  39.999  1.00 250.24 ? 11  DA  E N3    1 
ATOM 5084 C C4    . DA  E 2 11  ? 59.305 28.644  39.617  1.00 236.52 ? 11  DA  E C4    1 
ATOM 5085 P P     . DA  E 2 12  ? 63.249 33.852  39.706  1.00 299.32 ? 12  DA  E P     1 
ATOM 5086 O OP1   . DA  E 2 12  ? 64.150 34.758  40.453  1.00 312.47 ? 12  DA  E OP1   1 
ATOM 5087 O OP2   . DA  E 2 12  ? 62.543 34.355  38.506  1.00 287.85 ? 12  DA  E OP2   1 
ATOM 5088 O "O5'" . DA  E 2 12  ? 64.070 32.545  39.295  1.00 294.04 ? 12  DA  E "O5'" 1 
ATOM 5089 C "C5'" . DA  E 2 12  ? 64.633 31.730  40.311  1.00 296.86 ? 12  DA  E "C5'" 1 
ATOM 5090 C "C4'" . DA  E 2 12  ? 65.015 30.366  39.769  1.00 288.75 ? 12  DA  E "C4'" 1 
ATOM 5091 O "O4'" . DA  E 2 12  ? 63.821 29.607  39.445  1.00 273.35 ? 12  DA  E "O4'" 1 
ATOM 5092 C "C3'" . DA  E 2 12  ? 65.868 30.380  38.499  1.00 288.55 ? 12  DA  E "C3'" 1 
ATOM 5093 O "O3'" . DA  E 2 12  ? 66.895 29.411  38.627  1.00 292.13 ? 12  DA  E "O3'" 1 
ATOM 5094 C "C2'" . DA  E 2 12  ? 64.864 29.992  37.410  1.00 272.84 ? 12  DA  E "C2'" 1 
ATOM 5095 C "C1'" . DA  E 2 12  ? 63.984 29.024  38.174  1.00 264.43 ? 12  DA  E "C1'" 1 
ATOM 5096 N N9    . DA  E 2 12  ? 62.664 28.818  37.589  1.00 250.23 ? 12  DA  E N9    1 
ATOM 5097 C C8    . DA  E 2 12  ? 61.732 29.772  37.296  1.00 246.99 ? 12  DA  E C8    1 
ATOM 5098 N N7    . DA  E 2 12  ? 60.622 29.290  36.789  1.00 233.74 ? 12  DA  E N7    1 
ATOM 5099 C C5    . DA  E 2 12  ? 60.842 27.924  36.750  1.00 227.92 ? 12  DA  E C5    1 
ATOM 5100 C C6    . DA  E 2 12  ? 60.046 26.846  36.317  1.00 214.66 ? 12  DA  E C6    1 
ATOM 5101 N N6    . DA  E 2 12  ? 58.816 26.994  35.816  1.00 204.52 ? 12  DA  E N6    1 
ATOM 5102 N N1    . DA  E 2 12  ? 60.567 25.606  36.414  1.00 212.61 ? 12  DA  E N1    1 
ATOM 5103 C C2    . DA  E 2 12  ? 61.797 25.460  36.921  1.00 223.11 ? 12  DA  E C2    1 
ATOM 5104 N N3    . DA  E 2 12  ? 62.640 26.395  37.354  1.00 236.13 ? 12  DA  E N3    1 
ATOM 5105 C C4    . DA  E 2 12  ? 62.094 27.616  37.243  1.00 237.87 ? 12  DA  E C4    1 
ATOM 5106 P P     . DG  E 2 13  ? 68.180 29.425  37.663  1.00 297.80 ? 13  DG  E P     1 
ATOM 5107 O OP1   . DG  E 2 13  ? 69.264 30.135  38.376  1.00 321.30 ? 13  DG  E OP1   1 
ATOM 5108 O OP2   . DG  E 2 13  ? 67.766 29.879  36.317  1.00 290.63 ? 13  DG  E OP2   1 
ATOM 5109 O "O5'" . DG  E 2 13  ? 68.578 27.881  37.584  1.00 292.34 ? 13  DG  E "O5'" 1 
ATOM 5110 C "C5'" . DG  E 2 13  ? 67.605 26.899  37.913  1.00 280.56 ? 13  DG  E "C5'" 1 
ATOM 5111 C "C4'" . DG  E 2 13  ? 68.026 25.527  37.430  1.00 274.53 ? 13  DG  E "C4'" 1 
ATOM 5112 O "O4'" . DG  E 2 13  ? 66.890 24.857  36.841  1.00 264.50 ? 13  DG  E "O4'" 1 
ATOM 5113 C "C3'" . DG  E 2 13  ? 69.056 25.521  36.326  1.00 286.72 ? 13  DG  E "C3'" 1 
ATOM 5114 O "O3'" . DG  E 2 13  ? 69.638 24.224  36.268  1.00 301.37 ? 13  DG  E "O3'" 1 
ATOM 5115 C "C2'" . DG  E 2 13  ? 68.185 25.816  35.101  1.00 277.58 ? 13  DG  E "C2'" 1 
ATOM 5116 C "C1'" . DG  E 2 13  ? 66.893 25.066  35.436  1.00 259.68 ? 13  DG  E "C1'" 1 
ATOM 5117 N N9    . DG  E 2 13  ? 65.674 25.793  35.097  1.00 245.41 ? 13  DG  E N9    1 
ATOM 5118 C C8    . DG  E 2 13  ? 65.411 27.121  35.325  1.00 251.00 ? 13  DG  E C8    1 
ATOM 5119 N N7    . DG  E 2 13  ? 64.220 27.489  34.943  1.00 243.37 ? 13  DG  E N7    1 
ATOM 5120 C C5    . DG  E 2 13  ? 63.653 26.327  34.436  1.00 229.11 ? 13  DG  E C5    1 
ATOM 5121 C C6    . DG  E 2 13  ? 62.370 26.107  33.880  1.00 215.81 ? 13  DG  E C6    1 
ATOM 5122 O O6    . DG  E 2 13  ? 61.457 26.925  33.715  1.00 212.27 ? 13  DG  E O6    1 
ATOM 5123 N N1    . DG  E 2 13  ? 62.196 24.782  33.492  1.00 206.57 ? 13  DG  E N1    1 
ATOM 5124 C C2    . DG  E 2 13  ? 63.140 23.792  33.631  1.00 209.70 ? 13  DG  E C2    1 
ATOM 5125 N N2    . DG  E 2 13  ? 62.798 22.571  33.196  1.00 199.85 ? 13  DG  E N2    1 
ATOM 5126 N N3    . DG  E 2 13  ? 64.347 23.986  34.150  1.00 222.07 ? 13  DG  E N3    1 
ATOM 5127 C C4    . DG  E 2 13  ? 64.531 25.272  34.532  1.00 231.25 ? 13  DG  E C4    1 
ATOM 5128 P P     . DT  E 2 14  ? 70.809 23.863  35.229  1.00 343.48 ? 14  DT  E P     1 
ATOM 5129 O OP1   . DT  E 2 14  ? 71.992 23.489  36.036  1.00 366.66 ? 14  DT  E OP1   1 
ATOM 5130 O OP2   . DT  E 2 14  ? 70.939 24.932  34.215  1.00 351.92 ? 14  DT  E OP2   1 
ATOM 5131 O "O5'" . DT  E 2 14  ? 70.263 22.530  34.536  1.00 333.80 ? 14  DT  E "O5'" 1 
ATOM 5132 C "C5'" . DT  E 2 14  ? 68.897 22.161  34.715  1.00 313.82 ? 14  DT  E "C5'" 1 
ATOM 5133 C "C4'" . DT  E 2 14  ? 68.664 20.708  34.348  1.00 301.02 ? 14  DT  E "C4'" 1 
ATOM 5134 O "O4'" . DT  E 2 14  ? 68.257 19.976  35.533  1.00 293.39 ? 14  DT  E "O4'" 1 
ATOM 5135 C "C3'" . DT  E 2 14  ? 67.567 20.481  33.304  1.00 285.47 ? 14  DT  E "C3'" 1 
ATOM 5136 O "O3'" . DT  E 2 14  ? 68.158 20.182  32.041  1.00 279.42 ? 14  DT  E "O3'" 1 
ATOM 5137 C "C2'" . DT  E 2 14  ? 66.786 19.288  33.855  1.00 272.95 ? 14  DT  E "C2'" 1 
ATOM 5138 C "C1'" . DT  E 2 14  ? 66.958 19.466  35.354  1.00 278.84 ? 14  DT  E "C1'" 1 
ATOM 5139 P P     . DT  E 2 15  ? 67.239 19.909  30.751  1.00 241.52 ? 15  DT  E P     1 
ATOM 5140 O OP1   . DT  E 2 15  ? 66.735 18.519  30.819  1.00 222.80 ? 15  DT  E OP1   1 
ATOM 5141 O OP2   . DT  E 2 15  ? 68.009 20.350  29.567  1.00 260.14 ? 15  DT  E OP2   1 
ATOM 5142 O "O5'" . DT  E 2 15  ? 65.999 20.900  30.940  1.00 241.11 ? 15  DT  E "O5'" 1 
ATOM 5143 C "C5'" . DT  E 2 15  ? 65.981 22.150  30.262  1.00 243.51 ? 15  DT  E "C5'" 1 
ATOM 5144 C "C4'" . DT  E 2 15  ? 64.572 22.708  30.206  1.00 201.63 ? 15  DT  E "C4'" 1 
ATOM 5145 O "O4'" . DT  E 2 15  ? 64.477 23.860  31.079  1.00 209.27 ? 15  DT  E "O4'" 1 
ATOM 5146 C "C3'" . DT  E 2 15  ? 64.122 23.191  28.827  1.00 198.73 ? 15  DT  E "C3'" 1 
ATOM 5147 O "O3'" . DT  E 2 15  ? 62.759 22.860  28.625  1.00 182.19 ? 15  DT  E "O3'" 1 
ATOM 5148 C "C2'" . DT  E 2 15  ? 64.326 24.702  28.911  1.00 203.06 ? 15  DT  E "C2'" 1 
ATOM 5149 C "C1'" . DT  E 2 15  ? 63.961 24.956  30.360  1.00 206.98 ? 15  DT  E "C1'" 1 
ATOM 5150 N N1    . DT  E 2 15  ? 64.532 26.219  30.931  1.00 246.09 ? 15  DT  E N1    1 
ATOM 5151 C C2    . DT  E 2 15  ? 65.893 26.329  31.134  1.00 245.85 ? 15  DT  E C2    1 
ATOM 5152 O O2    . DT  E 2 15  ? 66.691 25.448  30.859  1.00 233.06 ? 15  DT  E O2    1 
ATOM 5153 N N3    . DT  E 2 15  ? 66.294 27.525  31.672  1.00 245.74 ? 15  DT  E N3    1 
ATOM 5154 C C4    . DT  E 2 15  ? 65.491 28.596  32.025  1.00 253.01 ? 15  DT  E C4    1 
ATOM 5155 O O4    . DT  E 2 15  ? 65.948 29.629  32.502  1.00 254.28 ? 15  DT  E O4    1 
ATOM 5156 C C5    . DT  E 2 15  ? 64.078 28.411  31.792  1.00 253.10 ? 15  DT  E C5    1 
ATOM 5157 C C7    . DT  E 2 15  ? 63.107 29.502  32.139  1.00 248.68 ? 15  DT  E C7    1 
ATOM 5158 C C6    . DT  E 2 15  ? 63.674 27.249  31.261  1.00 242.56 ? 15  DT  E C6    1 
ATOM 5159 P P     . DT  E 2 16  ? 62.170 22.743  27.135  1.00 170.89 ? 16  DT  E P     1 
ATOM 5160 O OP1   . DT  E 2 16  ? 62.683 21.494  26.529  1.00 171.67 ? 16  DT  E OP1   1 
ATOM 5161 O OP2   . DT  E 2 16  ? 62.406 24.033  26.453  1.00 196.21 ? 16  DT  E OP2   1 
ATOM 5162 O "O5'" . DT  E 2 16  ? 60.601 22.602  27.367  1.00 171.32 ? 16  DT  E "O5'" 1 
ATOM 5163 C "C5'" . DT  E 2 16  ? 60.001 23.250  28.466  1.00 171.68 ? 16  DT  E "C5'" 1 
ATOM 5164 C "C4'" . DT  E 2 16  ? 58.854 24.129  28.015  1.00 171.06 ? 16  DT  E "C4'" 1 
ATOM 5165 O "O4'" . DT  E 2 16  ? 59.350 25.417  27.638  1.00 170.11 ? 16  DT  E "O4'" 1 
ATOM 5166 C "C3'" . DT  E 2 16  ? 58.102 23.634  26.790  1.00 170.94 ? 16  DT  E "C3'" 1 
ATOM 5167 O "O3'" . DT  E 2 16  ? 56.991 22.854  27.193  1.00 172.09 ? 16  DT  E "O3'" 1 
ATOM 5168 C "C2'" . DT  E 2 16  ? 57.656 24.928  26.082  1.00 170.19 ? 16  DT  E "C2'" 1 
ATOM 5169 C "C1'" . DT  E 2 16  ? 58.360 26.040  26.870  1.00 169.84 ? 16  DT  E "C1'" 1 
ATOM 5170 N N1    . DT  E 2 16  ? 59.001 27.073  26.011  1.00 168.89 ? 16  DT  E N1    1 
ATOM 5171 C C2    . DT  E 2 16  ? 58.233 28.088  25.500  1.00 169.07 ? 16  DT  E C2    1 
ATOM 5172 O O2    . DT  E 2 16  ? 57.045 28.189  25.711  1.00 169.98 ? 16  DT  E O2    1 
ATOM 5173 N N3    . DT  E 2 16  ? 58.909 28.990  24.727  1.00 168.38 ? 16  DT  E N3    1 
ATOM 5174 C C4    . DT  E 2 16  ? 60.254 28.979  24.420  1.00 217.06 ? 16  DT  E C4    1 
ATOM 5175 O O4    . DT  E 2 16  ? 60.769 29.839  23.713  1.00 212.54 ? 16  DT  E O4    1 
ATOM 5176 C C5    . DT  E 2 16  ? 61.009 27.886  24.992  1.00 192.33 ? 16  DT  E C5    1 
ATOM 5177 C C7    . DT  E 2 16  ? 62.481 27.766  24.731  1.00 166.48 ? 16  DT  E C7    1 
ATOM 5178 C C6    . DT  E 2 16  ? 60.353 26.997  25.753  1.00 168.12 ? 16  DT  E C6    1 
ATOM 5179 P P     . DC  E 2 17  ? 56.324 21.808  26.174  1.00 172.97 ? 17  DC  E P     1 
ATOM 5180 O OP1   . DC  E 2 17  ? 57.189 21.729  24.980  1.00 207.19 ? 17  DC  E OP1   1 
ATOM 5181 O OP2   . DC  E 2 17  ? 54.900 22.171  26.018  1.00 173.52 ? 17  DC  E OP2   1 
ATOM 5182 O "O5'" . DC  E 2 17  ? 56.422 20.410  26.937  1.00 174.46 ? 17  DC  E "O5'" 1 
ATOM 5183 C "C5'" . DC  E 2 17  ? 55.881 20.272  28.244  1.00 193.53 ? 17  DC  E "C5'" 1 
ATOM 5184 C "C4'" . DC  E 2 17  ? 56.957 19.845  29.225  1.00 183.51 ? 17  DC  E "C4'" 1 
ATOM 5185 O "O4'" . DC  E 2 17  ? 57.830 20.970  29.512  1.00 193.97 ? 17  DC  E "O4'" 1 
ATOM 5186 C "C3'" . DC  E 2 17  ? 56.441 19.349  30.578  1.00 177.08 ? 17  DC  E "C3'" 1 
ATOM 5187 O "O3'" . DC  E 2 17  ? 57.130 18.161  30.951  1.00 215.41 ? 17  DC  E "O3'" 1 
ATOM 5188 C "C2'" . DC  E 2 17  ? 56.761 20.504  31.523  1.00 179.45 ? 17  DC  E "C2'" 1 
ATOM 5189 C "C1'" . DC  E 2 17  ? 58.027 21.063  30.902  1.00 175.43 ? 17  DC  E "C1'" 1 
ATOM 5190 N N1    . DC  E 2 17  ? 58.282 22.488  31.252  1.00 174.58 ? 17  DC  E N1    1 
ATOM 5191 C C2    . DC  E 2 17  ? 59.509 22.853  31.815  1.00 174.95 ? 17  DC  E C2    1 
ATOM 5192 O O2    . DC  E 2 17  ? 60.364 21.980  32.006  1.00 175.94 ? 17  DC  E O2    1 
ATOM 5193 N N3    . DC  E 2 17  ? 59.726 24.155  32.127  1.00 174.62 ? 17  DC  E N3    1 
ATOM 5194 C C4    . DC  E 2 17  ? 58.775 25.062  31.902  1.00 174.00 ? 17  DC  E C4    1 
ATOM 5195 N N4    . DC  E 2 17  ? 59.030 26.333  32.225  1.00 174.18 ? 17  DC  E N4    1 
ATOM 5196 C C5    . DC  E 2 17  ? 57.517 24.707  31.333  1.00 173.62 ? 17  DC  E C5    1 
ATOM 5197 C C6    . DC  E 2 17  ? 57.314 23.422  31.029  1.00 173.90 ? 17  DC  E C6    1 
ATOM 5198 P P     . DT  E 2 18  ? 56.812 17.437  32.351  1.00 209.78 ? 18  DT  E P     1 
ATOM 5199 O OP1   . DT  E 2 18  ? 57.067 15.991  32.170  1.00 211.25 ? 18  DT  E OP1   1 
ATOM 5200 O OP2   . DT  E 2 18  ? 55.485 17.894  32.820  1.00 220.09 ? 18  DT  E OP2   1 
ATOM 5201 O "O5'" . DT  E 2 18  ? 57.920 18.022  33.342  1.00 180.93 ? 18  DT  E "O5'" 1 
ATOM 5202 C "C5'" . DT  E 2 18  ? 59.290 17.976  32.971  1.00 181.07 ? 18  DT  E "C5'" 1 
ATOM 5203 C "C4'" . DT  E 2 18  ? 60.193 17.954  34.195  1.00 207.32 ? 18  DT  E "C4'" 1 
ATOM 5204 O "O4'" . DT  E 2 18  ? 60.540 19.307  34.577  1.00 215.67 ? 18  DT  E "O4'" 1 
ATOM 5205 C "C3'" . DT  E 2 18  ? 59.602 17.306  35.438  1.00 202.24 ? 18  DT  E "C3'" 1 
ATOM 5206 O "O3'" . DT  E 2 18  ? 60.639 16.661  36.170  1.00 219.28 ? 18  DT  E "O3'" 1 
ATOM 5207 C "C2'" . DT  E 2 18  ? 59.013 18.496  36.201  1.00 184.01 ? 18  DT  E "C2'" 1 
ATOM 5208 C "C1'" . DT  E 2 18  ? 59.953 19.638  35.821  1.00 182.73 ? 18  DT  E "C1'" 1 
ATOM 5209 N N1    . DT  E 2 18  ? 59.263 20.951  35.662  1.00 180.90 ? 18  DT  E N1    1 
ATOM 5210 C C2    . DT  E 2 18  ? 59.951 22.106  35.940  1.00 180.78 ? 18  DT  E C2    1 
ATOM 5211 O O2    . DT  E 2 18  ? 61.106 22.119  36.327  1.00 182.03 ? 18  DT  E O2    1 
ATOM 5212 N N3    . DT  E 2 18  ? 59.236 23.257  35.753  1.00 179.54 ? 18  DT  E N3    1 
ATOM 5213 C C4    . DT  E 2 18  ? 57.928 23.368  35.320  1.00 178.46 ? 18  DT  E C4    1 
ATOM 5214 O O4    . DT  E 2 18  ? 57.373 24.452  35.183  1.00 177.83 ? 18  DT  E O4    1 
ATOM 5215 C C5    . DT  E 2 18  ? 57.263 22.118  35.041  1.00 178.57 ? 18  DT  E C5    1 
ATOM 5216 C C7    . DT  E 2 18  ? 55.841 22.112  34.566  1.00 177.83 ? 18  DT  E C7    1 
ATOM 5217 C C6    . DT  E 2 18  ? 57.956 20.982  35.220  1.00 179.78 ? 18  DT  E C6    1 
ATOM 5218 P P     . DT  E 2 19  ? 60.329 15.894  37.548  1.00 244.32 ? 19  DT  E P     1 
ATOM 5219 O OP1   . DT  E 2 19  ? 61.156 14.666  37.559  1.00 193.50 ? 19  DT  E OP1   1 
ATOM 5220 O OP2   . DT  E 2 19  ? 58.863 15.786  37.719  1.00 243.88 ? 19  DT  E OP2   1 
ATOM 5221 O "O5'" . DT  E 2 19  ? 60.893 16.895  38.658  1.00 191.29 ? 19  DT  E "O5'" 1 
ATOM 5222 C "C5'" . DT  E 2 19  ? 62.172 17.489  38.478  1.00 194.30 ? 19  DT  E "C5'" 1 
ATOM 5223 C "C4'" . DT  E 2 19  ? 62.358 18.668  39.411  1.00 191.79 ? 19  DT  E "C4'" 1 
ATOM 5224 O "O4'" . DT  E 2 19  ? 61.589 19.805  38.932  1.00 189.94 ? 19  DT  E "O4'" 1 
ATOM 5225 C "C3'" . DT  E 2 19  ? 61.904 18.424  40.855  1.00 206.87 ? 19  DT  E "C3'" 1 
ATOM 5226 O "O3'" . DT  E 2 19  ? 62.923 18.836  41.763  1.00 232.60 ? 19  DT  E "O3'" 1 
ATOM 5227 C "C2'" . DT  E 2 19  ? 60.652 19.294  40.980  1.00 217.54 ? 19  DT  E "C2'" 1 
ATOM 5228 C "C1'" . DT  E 2 19  ? 60.998 20.431  40.040  1.00 189.81 ? 19  DT  E "C1'" 1 
ATOM 5229 N N1    . DT  E 2 19  ? 59.817 21.231  39.592  1.00 187.30 ? 19  DT  E N1    1 
ATOM 5230 C C2    . DT  E 2 19  ? 59.895 22.604  39.613  1.00 186.61 ? 19  DT  E C2    1 
ATOM 5231 O O2    . DT  E 2 19  ? 60.889 23.210  39.967  1.00 187.87 ? 19  DT  E O2    1 
ATOM 5232 N N3    . DT  E 2 19  ? 58.763 23.249  39.196  1.00 184.79 ? 19  DT  E N3    1 
ATOM 5233 C C4    . DT  E 2 19  ? 57.581 22.673  38.773  1.00 183.58 ? 19  DT  E C4    1 
ATOM 5234 O O4    . DT  E 2 19  ? 56.616 23.342  38.418  1.00 182.34 ? 19  DT  E O4    1 
ATOM 5235 C C5    . DT  E 2 19  ? 57.561 21.228  38.780  1.00 184.33 ? 19  DT  E C5    1 
ATOM 5236 C C7    . DT  E 2 19  ? 56.331 20.490  38.341  1.00 183.54 ? 19  DT  E C7    1 
ATOM 5237 C C6    . DT  E 2 19  ? 58.668 20.583  39.187  1.00 186.17 ? 19  DT  E C6    1 
ATOM 5238 P P     . DC  E 2 20  ? 63.052 18.140  43.206  1.00 201.43 ? 20  DC  E P     1 
ATOM 5239 O OP1   . DC  E 2 20  ? 64.153 18.810  43.934  1.00 204.13 ? 20  DC  E OP1   1 
ATOM 5240 O OP2   . DC  E 2 20  ? 63.108 16.676  42.998  1.00 202.95 ? 20  DC  E OP2   1 
ATOM 5241 O "O5'" . DC  E 2 20  ? 61.654 18.468  43.912  1.00 200.71 ? 20  DC  E "O5'" 1 
ATOM 5242 C "C5'" . DC  E 2 20  ? 61.605 19.319  45.049  1.00 225.72 ? 20  DC  E "C5'" 1 
ATOM 5243 C "C4'" . DC  E 2 20  ? 61.791 20.775  44.655  1.00 206.28 ? 20  DC  E "C4'" 1 
ATOM 5244 O "O4'" . DC  E 2 20  ? 61.000 21.068  43.493  1.00 196.67 ? 20  DC  E "O4'" 1 
ATOM 5245 C "C3'" . DC  E 2 20  ? 61.329 21.769  45.698  1.00 202.12 ? 20  DC  E "C3'" 1 
ATOM 5246 O "O3'" . DC  E 2 20  ? 62.395 22.044  46.590  1.00 205.97 ? 20  DC  E "O3'" 1 
ATOM 5247 C "C2'" . DC  E 2 20  ? 60.956 23.004  44.871  1.00 200.23 ? 20  DC  E "C2'" 1 
ATOM 5248 C "C1'" . DC  E 2 20  ? 60.678 22.442  43.473  1.00 195.53 ? 20  DC  E "C1'" 1 
ATOM 5249 N N1    . DC  E 2 20  ? 59.258 22.579  43.013  1.00 192.90 ? 20  DC  E N1    1 
ATOM 5250 C C2    . DC  E 2 20  ? 58.699 23.850  42.795  1.00 191.60 ? 20  DC  E C2    1 
ATOM 5251 O O2    . DC  E 2 20  ? 59.383 24.861  43.008  1.00 192.66 ? 20  DC  E O2    1 
ATOM 5252 N N3    . DC  E 2 20  ? 57.413 23.931  42.362  1.00 189.60 ? 20  DC  E N3    1 
ATOM 5253 C C4    . DC  E 2 20  ? 56.710 22.817  42.142  1.00 188.83 ? 20  DC  E C4    1 
ATOM 5254 N N4    . DC  E 2 20  ? 55.449 22.940  41.716  1.00 187.18 ? 20  DC  E N4    1 
ATOM 5255 C C5    . DC  E 2 20  ? 57.267 21.524  42.350  1.00 190.13 ? 20  DC  E C5    1 
ATOM 5256 C C6    . DC  E 2 20  ? 58.529 21.453  42.777  1.00 192.16 ? 20  DC  E C6    1 
ATOM 5257 P P     . DC  E 2 21  ? 62.105 22.250  48.154  1.00 209.87 ? 21  DC  E P     1 
ATOM 5258 O OP1   . DC  E 2 21  ? 63.395 22.142  48.870  1.00 227.96 ? 21  DC  E OP1   1 
ATOM 5259 O OP2   . DC  E 2 21  ? 60.981 21.359  48.518  1.00 209.41 ? 21  DC  E OP2   1 
ATOM 5260 O "O5'" . DC  E 2 21  ? 61.593 23.759  48.243  1.00 209.01 ? 21  DC  E "O5'" 1 
ATOM 5261 C "C5'" . DC  E 2 21  ? 62.326 24.790  47.602  1.00 208.28 ? 21  DC  E "C5'" 1 
ATOM 5262 C "C4'" . DC  E 2 21  ? 61.448 26.002  47.365  1.00 206.49 ? 21  DC  E "C4'" 1 
ATOM 5263 O "O4'" . DC  E 2 21  ? 60.368 25.652  46.463  1.00 202.41 ? 21  DC  E "O4'" 1 
ATOM 5264 C "C3'" . DC  E 2 21  ? 60.790 26.566  48.623  1.00 230.44 ? 21  DC  E "C3'" 1 
ATOM 5265 O "O3'" . DC  E 2 21  ? 61.012 27.958  48.699  1.00 237.24 ? 21  DC  E "O3'" 1 
ATOM 5266 C "C2'" . DC  E 2 21  ? 59.306 26.241  48.443  1.00 236.36 ? 21  DC  E "C2'" 1 
ATOM 5267 C "C1'" . DC  E 2 21  ? 59.171 26.213  46.933  1.00 202.35 ? 21  DC  E "C1'" 1 
ATOM 5268 N N1    . DC  E 2 21  ? 58.036 25.375  46.463  1.00 199.54 ? 21  DC  E N1    1 
ATOM 5269 C C2    . DC  E 2 21  ? 56.879 25.989  45.978  1.00 197.35 ? 21  DC  E C2    1 
ATOM 5270 O O2    . DC  E 2 21  ? 56.827 27.224  45.942  1.00 197.82 ? 21  DC  E O2    1 
ATOM 5271 N N3    . DC  E 2 21  ? 55.850 25.211  45.560  1.00 195.18 ? 21  DC  E N3    1 
ATOM 5272 C C4    . DC  E 2 21  ? 55.953 23.882  45.617  1.00 195.18 ? 21  DC  E C4    1 
ATOM 5273 N N4    . DC  E 2 21  ? 54.916 23.152  45.196  1.00 193.36 ? 21  DC  E N4    1 
ATOM 5274 C C5    . DC  E 2 21  ? 57.125 23.240  46.110  1.00 197.48 ? 21  DC  E C5    1 
ATOM 5275 C C6    . DC  E 2 21  ? 58.130 24.017  46.520  1.00 199.59 ? 21  DC  E C6    1 
ATOM 5276 P P     . DT  E 2 22  ? 60.983 28.694  50.125  1.00 215.73 ? 22  DT  E P     1 
ATOM 5277 O OP1   . DT  E 2 22  ? 61.376 30.104  49.910  1.00 216.95 ? 22  DT  E OP1   1 
ATOM 5278 O OP2   . DT  E 2 22  ? 61.737 27.845  51.074  1.00 223.99 ? 22  DT  E OP2   1 
ATOM 5279 O "O5'" . DT  E 2 22  ? 59.446 28.632  50.551  1.00 214.74 ? 22  DT  E "O5'" 1 
ATOM 5280 C "C5'" . DT  E 2 22  ? 58.814 29.777  51.084  1.00 219.49 ? 22  DT  E "C5'" 1 
ATOM 5281 C "C4'" . DT  E 2 22  ? 57.717 30.260  50.158  1.00 212.90 ? 22  DT  E "C4'" 1 
ATOM 5282 O "O4'" . DT  E 2 22  ? 57.197 29.149  49.421  1.00 208.89 ? 22  DT  E "O4'" 1 
ATOM 5283 C "C3'" . DT  E 2 22  ? 56.512 30.857  50.864  1.00 252.01 ? 22  DT  E "C3'" 1 
ATOM 5284 O "O3'" . DT  E 2 22  ? 56.634 32.268  50.908  1.00 246.77 ? 22  DT  E "O3'" 1 
ATOM 5285 C "C2'" . DT  E 2 22  ? 55.305 30.416  50.015  1.00 209.94 ? 22  DT  E "C2'" 1 
ATOM 5286 C "C1'" . DT  E 2 22  ? 55.903 29.469  48.985  1.00 206.59 ? 22  DT  E "C1'" 1 
ATOM 5287 N N1    . DT  E 2 22  ? 55.157 28.194  48.779  1.00 204.04 ? 22  DT  E N1    1 
ATOM 5288 C C2    . DT  E 2 22  ? 53.876 28.214  48.267  1.00 201.58 ? 22  DT  E C2    1 
ATOM 5289 O O2    . DT  E 2 22  ? 53.271 29.237  48.004  1.00 201.49 ? 22  DT  E O2    1 
ATOM 5290 N N3    . DT  E 2 22  ? 53.319 26.974  48.089  1.00 199.67 ? 22  DT  E N3    1 
ATOM 5291 C C4    . DT  E 2 22  ? 53.906 25.748  48.349  1.00 200.05 ? 22  DT  E C4    1 
ATOM 5292 O O4    . DT  E 2 22  ? 53.327 24.686  48.157  1.00 206.32 ? 22  DT  E O4    1 
ATOM 5293 C C5    . DT  E 2 22  ? 55.247 25.804  48.866  1.00 202.70 ? 22  DT  E C5    1 
ATOM 5294 C C7    . DT  E 2 22  ? 55.982 24.538  49.188  1.00 203.88 ? 22  DT  E C7    1 
ATOM 5295 C C6    . DT  E 2 22  ? 55.802 27.007  49.047  1.00 204.48 ? 22  DT  E C6    1 
ATOM 5296 P P     . DG  E 2 23  ? 56.571 33.028  52.319  1.00 222.28 ? 23  DG  E P     1 
ATOM 5297 O OP1   . DG  E 2 23  ? 57.630 34.062  52.330  1.00 225.53 ? 23  DG  E OP1   1 
ATOM 5298 O OP2   . DG  E 2 23  ? 56.542 31.985  53.366  1.00 223.90 ? 23  DG  E OP2   1 
ATOM 5299 O "O5'" . DG  E 2 23  ? 55.151 33.760  52.292  1.00 221.88 ? 23  DG  E "O5'" 1 
ATOM 5300 C "C5'" . DG  E 2 23  ? 54.351 33.711  51.120  1.00 230.32 ? 23  DG  E "C5'" 1 
ATOM 5301 C "C4'" . DG  E 2 23  ? 52.957 33.206  51.444  1.00 224.32 ? 23  DG  E "C4'" 1 
ATOM 5302 O "O4'" . DG  E 2 23  ? 52.837 31.803  51.080  1.00 227.80 ? 23  DG  E "O4'" 1 
ATOM 5303 C "C3'" . DG  E 2 23  ? 52.564 33.289  52.919  1.00 220.20 ? 23  DG  E "C3'" 1 
ATOM 5304 O "O3'" . DG  E 2 23  ? 51.214 33.692  53.018  1.00 220.05 ? 23  DG  E "O3'" 1 
ATOM 5305 C "C2'" . DG  E 2 23  ? 52.749 31.851  53.396  1.00 219.48 ? 23  DG  E "C2'" 1 
ATOM 5306 C "C1'" . DG  E 2 23  ? 52.290 31.096  52.167  1.00 213.93 ? 23  DG  E "C1'" 1 
ATOM 5307 N N9    . DG  E 2 23  ? 52.736 29.704  52.118  1.00 212.24 ? 23  DG  E N9    1 
ATOM 5308 C C8    . DG  E 2 23  ? 53.917 29.187  52.597  1.00 214.26 ? 23  DG  E C8    1 
ATOM 5309 N N7    . DG  E 2 23  ? 54.034 27.901  52.411  1.00 212.45 ? 23  DG  E N7    1 
ATOM 5310 C C5    . DG  E 2 23  ? 52.847 27.540  51.785  1.00 215.86 ? 23  DG  E C5    1 
ATOM 5311 C C6    . DG  E 2 23  ? 52.397 26.273  51.342  1.00 224.24 ? 23  DG  E C6    1 
ATOM 5312 O O6    . DG  E 2 23  ? 52.978 25.183  51.418  1.00 230.86 ? 23  DG  E O6    1 
ATOM 5313 N N1    . DG  E 2 23  ? 51.132 26.350  50.760  1.00 212.25 ? 23  DG  E N1    1 
ATOM 5314 C C2    . DG  E 2 23  ? 50.398 27.505  50.624  1.00 203.72 ? 23  DG  E C2    1 
ATOM 5315 N N2    . DG  E 2 23  ? 49.198 27.390  50.039  1.00 201.39 ? 23  DG  E N2    1 
ATOM 5316 N N3    . DG  E 2 23  ? 50.810 28.696  51.035  1.00 206.34 ? 23  DG  E N3    1 
ATOM 5317 C C4    . DG  E 2 23  ? 52.037 28.638  51.603  1.00 216.10 ? 23  DG  E C4    1 
ATOM 5318 P P     . DA  E 2 24  ? 50.650 34.317  54.384  1.00 224.89 ? 24  DA  E P     1 
ATOM 5319 O OP1   . DA  E 2 24  ? 50.571 35.780  54.190  1.00 227.65 ? 24  DA  E OP1   1 
ATOM 5320 O OP2   . DA  E 2 24  ? 51.443 33.773  55.509  1.00 232.87 ? 24  DA  E OP2   1 
ATOM 5321 O "O5'" . DA  E 2 24  ? 49.165 33.731  54.476  1.00 223.76 ? 24  DA  E "O5'" 1 
ATOM 5322 C "C5'" . DA  E 2 24  ? 48.153 34.244  53.623  1.00 220.60 ? 24  DA  E "C5'" 1 
ATOM 5323 C "C4'" . DA  E 2 24  ? 47.220 33.143  53.153  1.00 216.40 ? 24  DA  E "C4'" 1 
ATOM 5324 O "O4'" . DA  E 2 24  ? 47.984 31.947  52.838  1.00 213.71 ? 24  DA  E "O4'" 1 
ATOM 5325 C "C3'" . DA  E 2 24  ? 46.161 32.706  54.163  1.00 217.45 ? 24  DA  E "C3'" 1 
ATOM 5326 O "O3'" . DA  E 2 24  ? 44.951 32.435  53.479  1.00 214.56 ? 24  DA  E "O3'" 1 
ATOM 5327 C "C2'" . DA  E 2 24  ? 46.764 31.430  54.745  1.00 219.14 ? 24  DA  E "C2'" 1 
ATOM 5328 C "C1'" . DA  E 2 24  ? 47.413 30.844  53.506  1.00 213.06 ? 24  DA  E "C1'" 1 
ATOM 5329 N N9    . DA  E 2 24  ? 48.470 29.873  53.782  1.00 213.01 ? 24  DA  E N9    1 
ATOM 5330 C C8    . DA  E 2 24  ? 49.716 30.136  54.275  1.00 215.86 ? 24  DA  E C8    1 
ATOM 5331 N N7    . DA  E 2 24  ? 50.467 29.070  54.413  1.00 215.46 ? 24  DA  E N7    1 
ATOM 5332 C C5    . DA  E 2 24  ? 49.660 28.035  53.975  1.00 212.11 ? 24  DA  E C5    1 
ATOM 5333 C C6    . DA  E 2 24  ? 49.875 26.649  53.870  1.00 210.57 ? 24  DA  E C6    1 
ATOM 5334 N N6    . DA  E 2 24  ? 51.021 26.060  54.220  1.00 212.26 ? 24  DA  E N6    1 
ATOM 5335 N N1    . DA  E 2 24  ? 48.866 25.892  53.393  1.00 207.65 ? 24  DA  E N1    1 
ATOM 5336 C C2    . DA  E 2 24  ? 47.720 26.490  53.043  1.00 206.33 ? 24  DA  E C2    1 
ATOM 5337 N N3    . DA  E 2 24  ? 47.400 27.784  53.098  1.00 207.60 ? 24  DA  E N3    1 
ATOM 5338 C C4    . DA  E 2 24  ? 48.426 28.510  53.577  1.00 210.52 ? 24  DA  E C4    1 
ATOM 5339 P P     . DG  E 2 25  ? 43.536 32.639  54.209  1.00 216.11 ? 25  DG  E P     1 
ATOM 5340 O OP1   . DG  E 2 25  ? 42.487 32.602  53.165  1.00 213.34 ? 25  DG  E OP1   1 
ATOM 5341 O OP2   . DG  E 2 25  ? 43.653 33.820  55.092  1.00 286.24 ? 25  DG  E OP2   1 
ATOM 5342 O "O5'" . DG  E 2 25  ? 43.396 31.342  55.133  1.00 222.75 ? 25  DG  E "O5'" 1 
ATOM 5343 C "C5'" . DG  E 2 25  ? 42.113 30.796  55.407  1.00 214.54 ? 25  DG  E "C5'" 1 
ATOM 5344 C "C4'" . DG  E 2 25  ? 41.866 29.558  54.564  1.00 210.31 ? 25  DG  E "C4'" 1 
ATOM 5345 O "O4'" . DG  E 2 25  ? 43.136 28.928  54.242  1.00 209.15 ? 25  DG  E "O4'" 1 
ATOM 5346 C "C3'" . DG  E 2 25  ? 41.052 28.472  55.245  1.00 209.66 ? 25  DG  E "C3'" 1 
ATOM 5347 O "O3'" . DG  E 2 25  ? 40.398 27.676  54.257  1.00 206.21 ? 25  DG  E "O3'" 1 
ATOM 5348 C "C2'" . DG  E 2 25  ? 42.140 27.691  55.973  1.00 225.69 ? 25  DG  E "C2'" 1 
ATOM 5349 C "C1'" . DG  E 2 25  ? 43.243 27.688  54.924  1.00 208.92 ? 25  DG  E "C1'" 1 
ATOM 5350 N N9    . DG  E 2 25  ? 44.608 27.575  55.453  1.00 210.91 ? 25  DG  E N9    1 
ATOM 5351 C C8    . DG  E 2 25  ? 45.426 28.609  55.832  1.00 213.92 ? 25  DG  E C8    1 
ATOM 5352 N N7    . DG  E 2 25  ? 46.604 28.226  56.238  1.00 215.46 ? 25  DG  E N7    1 
ATOM 5353 C C5    . DG  E 2 25  ? 46.576 26.845  56.112  1.00 213.35 ? 25  DG  E C5    1 
ATOM 5354 C C6    . DG  E 2 25  ? 47.578 25.886  56.402  1.00 214.13 ? 25  DG  E C6    1 
ATOM 5355 O O6    . DG  E 2 25  ? 48.719 26.080  56.842  1.00 216.86 ? 25  DG  E O6    1 
ATOM 5356 N N1    . DG  E 2 25  ? 47.148 24.591  56.132  1.00 211.82 ? 25  DG  E N1    1 
ATOM 5357 C C2    . DG  E 2 25  ? 45.905 24.262  55.641  1.00 209.07 ? 25  DG  E C2    1 
ATOM 5358 N N2    . DG  E 2 25  ? 45.668 22.957  55.443  1.00 207.55 ? 25  DG  E N2    1 
ATOM 5359 N N3    . DG  E 2 25  ? 44.954 25.154  55.364  1.00 208.28 ? 25  DG  E N3    1 
ATOM 5360 C C4    . DG  E 2 25  ? 45.359 26.422  55.622  1.00 210.52 ? 25  DG  E C4    1 
ATOM 5361 P P     . DT  E 2 26  ? 39.573 26.360  54.675  1.00 204.98 ? 26  DT  E P     1 
ATOM 5362 O OP1   . DT  E 2 26  ? 38.671 26.025  53.551  1.00 202.33 ? 26  DT  E OP1   1 
ATOM 5363 O OP2   . DT  E 2 26  ? 38.997 26.614  56.013  1.00 207.70 ? 26  DT  E OP2   1 
ATOM 5364 O "O5'" . DT  E 2 26  ? 40.703 25.226  54.803  1.00 245.39 ? 26  DT  E "O5'" 1 
ATOM 5365 C "C5'" . DT  E 2 26  ? 40.369 23.842  54.673  1.00 230.27 ? 26  DT  E "C5'" 1 
ATOM 5366 C "C4'" . DT  E 2 26  ? 40.496 23.125  56.007  1.00 204.81 ? 26  DT  E "C4'" 1 
ATOM 5367 O "O4'" . DT  E 2 26  ? 41.860 23.251  56.504  1.00 206.87 ? 26  DT  E "O4'" 1 
ATOM 5368 C "C3'" . DT  E 2 26  ? 39.589 23.682  57.112  1.00 206.95 ? 26  DT  E "C3'" 1 
ATOM 5369 O "O3'" . DT  E 2 26  ? 38.911 22.639  57.883  1.00 212.78 ? 26  DT  E "O3'" 1 
ATOM 5370 C "C2'" . DT  E 2 26  ? 40.566 24.466  57.979  1.00 210.21 ? 26  DT  E "C2'" 1 
ATOM 5371 C "C1'" . DT  E 2 26  ? 41.802 23.593  57.864  1.00 210.13 ? 26  DT  E "C1'" 1 
ATOM 5372 N N1    . DT  E 2 26  ? 43.076 24.275  58.282  1.00 212.86 ? 26  DT  E N1    1 
ATOM 5373 C C2    . DT  E 2 26  ? 44.197 23.518  58.558  1.00 214.08 ? 26  DT  E C2    1 
ATOM 5374 O O2    . DT  E 2 26  ? 44.226 22.305  58.455  1.00 213.06 ? 26  DT  E O2    1 
ATOM 5375 N N3    . DT  E 2 26  ? 45.296 24.248  58.949  1.00 216.94 ? 26  DT  E N3    1 
ATOM 5376 C C4    . DT  E 2 26  ? 45.377 25.621  59.098  1.00 218.77 ? 26  DT  E C4    1 
ATOM 5377 O O4    . DT  E 2 26  ? 46.405 26.189  59.453  1.00 221.66 ? 26  DT  E O4    1 
ATOM 5378 C C5    . DT  E 2 26  ? 44.166 26.345  58.806  1.00 217.50 ? 26  DT  E C5    1 
ATOM 5379 C C7    . DT  E 2 26  ? 44.136 27.839  58.935  1.00 226.90 ? 26  DT  E C7    1 
ATOM 5380 C C6    . DT  E 2 26  ? 43.088 25.645  58.425  1.00 214.63 ? 26  DT  E C6    1 
ATOM 5381 P P     . DT  E 2 27  ? 38.982 21.066  57.531  1.00 221.55 ? 27  DT  E P     1 
ATOM 5382 O OP1   . DT  E 2 27  ? 38.714 20.808  56.098  1.00 202.65 ? 27  DT  E OP1   1 
ATOM 5383 O OP2   . DT  E 2 27  ? 38.083 20.422  58.513  1.00 209.02 ? 27  DT  E OP2   1 
ATOM 5384 O "O5'" . DT  E 2 27  ? 40.466 20.627  57.949  1.00 253.79 ? 27  DT  E "O5'" 1 
ATOM 5385 C "C5'" . DT  E 2 27  ? 40.842 19.246  57.913  1.00 228.32 ? 27  DT  E "C5'" 1 
ATOM 5386 C "C4'" . DT  E 2 27  ? 41.392 18.778  59.256  1.00 210.77 ? 27  DT  E "C4'" 1 
ATOM 5387 O "O4'" . DT  E 2 27  ? 42.375 19.729  59.751  1.00 232.89 ? 27  DT  E "O4'" 1 
ATOM 5388 C "C3'" . DT  E 2 27  ? 40.360 18.631  60.379  1.00 212.21 ? 27  DT  E "C3'" 1 
ATOM 5389 O "O3'" . DT  E 2 27  ? 40.700 17.515  61.197  1.00 218.06 ? 27  DT  E "O3'" 1 
ATOM 5390 C "C2'" . DT  E 2 27  ? 40.538 19.934  61.147  1.00 214.53 ? 27  DT  E "C2'" 1 
ATOM 5391 C "C1'" . DT  E 2 27  ? 42.047 20.067  61.080  1.00 216.19 ? 27  DT  E "C1'" 1 
ATOM 5392 N N1    . DT  E 2 27  ? 42.557 21.433  61.372  1.00 218.18 ? 27  DT  E N1    1 
ATOM 5393 C C2    . DT  E 2 27  ? 43.856 21.584  61.797  1.00 221.14 ? 27  DT  E C2    1 
ATOM 5394 O O2    . DT  E 2 27  ? 44.623 20.649  61.945  1.00 222.23 ? 27  DT  E O2    1 
ATOM 5395 N N3    . DT  E 2 27  ? 44.230 22.878  62.040  1.00 223.19 ? 27  DT  E N3    1 
ATOM 5396 C C4    . DT  E 2 27  ? 43.453 24.010  61.907  1.00 222.74 ? 27  DT  E C4    1 
ATOM 5397 O O4    . DT  E 2 27  ? 43.880 25.132  62.151  1.00 225.17 ? 27  DT  E O4    1 
ATOM 5398 C C5    . DT  E 2 27  ? 42.102 23.782  61.463  1.00 219.63 ? 27  DT  E C5    1 
ATOM 5399 C C7    . DT  E 2 27  ? 41.166 24.940  61.291  1.00 219.38 ? 27  DT  E C7    1 
ATOM 5400 C C6    . DT  E 2 27  ? 41.720 22.518  61.220  1.00 217.48 ? 27  DT  E C6    1 
ATOM 5401 P P     . DG  E 2 28  ? 39.972 16.097  60.997  1.00 233.67 ? 28  DG  E P     1 
ATOM 5402 O OP1   . DG  E 2 28  ? 40.112 15.714  59.574  1.00 240.15 ? 28  DG  E OP1   1 
ATOM 5403 O OP2   . DG  E 2 28  ? 38.629 16.192  61.610  1.00 219.21 ? 28  DG  E OP2   1 
ATOM 5404 O "O5'" . DG  E 2 28  ? 40.840 15.088  61.889  1.00 216.90 ? 28  DG  E "O5'" 1 
ATOM 5405 C "C5'" . DG  E 2 28  ? 40.545 14.924  63.274  1.00 219.94 ? 28  DG  E "C5'" 1 
ATOM 5406 C "C4'" . DG  E 2 28  ? 41.711 15.370  64.139  1.00 223.81 ? 28  DG  E "C4'" 1 
ATOM 5407 O "O4'" . DG  E 2 28  ? 42.028 16.745  63.843  1.00 223.17 ? 28  DG  E "O4'" 1 
ATOM 5408 C "C3'" . DG  E 2 28  ? 41.448 15.311  65.646  1.00 247.43 ? 28  DG  E "C3'" 1 
ATOM 5409 O "O3'" . DG  E 2 28  ? 42.226 14.282  66.249  1.00 231.08 ? 28  DG  E "O3'" 1 
ATOM 5410 C "C2'" . DG  E 2 28  ? 41.845 16.698  66.174  1.00 268.57 ? 28  DG  E "C2'" 1 
ATOM 5411 C "C1'" . DG  E 2 28  ? 42.548 17.354  64.994  1.00 227.21 ? 28  DG  E "C1'" 1 
ATOM 5412 N N9    . DG  E 2 28  ? 42.282 18.784  64.911  1.00 226.68 ? 28  DG  E N9    1 
ATOM 5413 C C8    . DG  E 2 28  ? 41.116 19.376  64.498  1.00 223.88 ? 28  DG  E C8    1 
ATOM 5414 N N7    . DG  E 2 28  ? 41.152 20.676  64.533  1.00 224.61 ? 28  DG  E N7    1 
ATOM 5415 C C5    . DG  E 2 28  ? 42.422 20.969  65.007  1.00 228.06 ? 28  DG  E C5    1 
ATOM 5416 C C6    . DG  E 2 28  ? 43.030 22.219  65.254  1.00 230.62 ? 28  DG  E C6    1 
ATOM 5417 O O6    . DG  E 2 28  ? 42.545 23.347  65.094  1.00 230.36 ? 28  DG  E O6    1 
ATOM 5418 N N1    . DG  E 2 28  ? 44.328 22.077  65.730  1.00 234.18 ? 28  DG  E N1    1 
ATOM 5419 C C2    . DG  E 2 28  ? 44.960 20.875  65.943  1.00 235.25 ? 28  DG  E C2    1 
ATOM 5420 N N2    . DG  E 2 28  ? 46.216 20.935  66.409  1.00 239.23 ? 28  DG  E N2    1 
ATOM 5421 N N3    . DG  E 2 28  ? 44.399 19.691  65.715  1.00 232.99 ? 28  DG  E N3    1 
ATOM 5422 C C4    . DG  E 2 28  ? 43.132 19.816  65.249  1.00 229.38 ? 28  DG  E C4    1 
ATOM 5423 P P     . DA  E 2 29  ? 42.173 14.057  67.840  1.00 235.86 ? 29  DA  E P     1 
ATOM 5424 O OP1   . DA  E 2 29  ? 42.578 12.659  68.106  1.00 244.58 ? 29  DA  E OP1   1 
ATOM 5425 O OP2   . DA  E 2 29  ? 40.868 14.552  68.329  1.00 240.18 ? 29  DA  E OP2   1 
ATOM 5426 O "O5'" . DA  E 2 29  ? 43.306 15.030  68.412  1.00 239.58 ? 29  DA  E "O5'" 1 
ATOM 5427 C "C5'" . DA  E 2 29  ? 44.660 14.604  68.438  1.00 246.43 ? 29  DA  E "C5'" 1 
ATOM 5428 C "C4'" . DA  E 2 29  ? 45.524 15.596  69.192  1.00 266.89 ? 29  DA  E "C4'" 1 
ATOM 5429 O "O4'" . DA  E 2 29  ? 45.230 16.940  68.728  1.00 248.38 ? 29  DA  E "O4'" 1 
ATOM 5430 C "C3'" . DA  E 2 29  ? 45.310 15.615  70.706  1.00 267.04 ? 29  DA  E "C3'" 1 
ATOM 5431 O "O3'" . DA  E 2 29  ? 46.554 15.796  71.372  1.00 257.39 ? 29  DA  E "O3'" 1 
ATOM 5432 C "C2'" . DA  E 2 29  ? 44.388 16.814  70.906  1.00 269.67 ? 29  DA  E "C2'" 1 
ATOM 5433 C "C1'" . DA  E 2 29  ? 44.894 17.757  69.827  1.00 247.58 ? 29  DA  E "C1'" 1 
ATOM 5434 N N9    . DA  E 2 29  ? 43.905 18.739  69.392  1.00 244.10 ? 29  DA  E N9    1 
ATOM 5435 C C8    . DA  E 2 29  ? 42.658 18.491  68.891  1.00 239.78 ? 29  DA  E C8    1 
ATOM 5436 N N7    . DA  E 2 29  ? 41.986 19.576  68.583  1.00 237.89 ? 29  DA  E N7    1 
ATOM 5437 C C5    . DA  E 2 29  ? 42.855 20.606  68.906  1.00 241.17 ? 29  DA  E C5    1 
ATOM 5438 C C6    . DA  E 2 29  ? 42.743 22.009  68.818  1.00 241.70 ? 29  DA  E C6    1 
ATOM 5439 N N6    . DA  E 2 29  ? 41.657 22.634  68.355  1.00 238.77 ? 29  DA  E N6    1 
ATOM 5440 N N1    . DA  E 2 29  ? 43.798 22.748  69.227  1.00 245.82 ? 29  DA  E N1    1 
ATOM 5441 C C2    . DA  E 2 29  ? 44.883 22.118  69.689  1.00 249.13 ? 29  DA  E C2    1 
ATOM 5442 N N3    . DA  E 2 29  ? 45.103 20.812  69.819  1.00 249.13 ? 29  DA  E N3    1 
ATOM 5443 C C4    . DA  E 2 29  ? 44.041 20.106  69.406  1.00 244.99 ? 29  DA  E C4    1 
ATOM 5444 O "O5'" . DT  F 3 1   ? 46.292 32.745  70.754  1.00 219.36 ? 1   DT  F "O5'" 1 
ATOM 5445 C "C5'" . DT  F 3 1   ? 45.623 31.492  70.852  1.00 231.08 ? 1   DT  F "C5'" 1 
ATOM 5446 C "C4'" . DT  F 3 1   ? 46.602 30.385  71.200  1.00 206.88 ? 1   DT  F "C4'" 1 
ATOM 5447 O "O4'" . DT  F 3 1   ? 45.895 29.117  71.280  1.00 194.39 ? 1   DT  F "O4'" 1 
ATOM 5448 C "C3'" . DT  F 3 1   ? 47.703 30.162  70.176  1.00 206.88 ? 1   DT  F "C3'" 1 
ATOM 5449 O "O3'" . DT  F 3 1   ? 48.841 29.602  70.820  1.00 204.64 ? 1   DT  F "O3'" 1 
ATOM 5450 C "C2'" . DT  F 3 1   ? 47.045 29.160  69.238  1.00 207.51 ? 1   DT  F "C2'" 1 
ATOM 5451 C "C1'" . DT  F 3 1   ? 46.334 28.261  70.240  1.00 187.60 ? 1   DT  F "C1'" 1 
ATOM 5452 N N1    . DT  F 3 1   ? 45.141 27.534  69.692  1.00 187.50 ? 1   DT  F N1    1 
ATOM 5453 C C2    . DT  F 3 1   ? 45.117 26.156  69.725  1.00 183.07 ? 1   DT  F C2    1 
ATOM 5454 O O2    . DT  F 3 1   ? 46.031 25.483  70.166  1.00 178.88 ? 1   DT  F O2    1 
ATOM 5455 N N3    . DT  F 3 1   ? 43.977 25.590  69.215  1.00 184.13 ? 1   DT  F N3    1 
ATOM 5456 C C4    . DT  F 3 1   ? 42.883 26.244  68.691  1.00 188.83 ? 1   DT  F C4    1 
ATOM 5457 O O4    . DT  F 3 1   ? 41.906 25.644  68.255  1.00 189.74 ? 1   DT  F O4    1 
ATOM 5458 C C5    . DT  F 3 1   ? 42.969 27.685  68.689  1.00 193.04 ? 1   DT  F C5    1 
ATOM 5459 C C7    . DT  F 3 1   ? 41.841 28.502  68.137  1.00 206.15 ? 1   DT  F C7    1 
ATOM 5460 C C6    . DT  F 3 1   ? 44.080 28.254  69.186  1.00 192.33 ? 1   DT  F C6    1 
ATOM 5461 P P     . DC  F 3 2   ? 50.320 29.898  70.269  1.00 208.36 ? 2   DC  F P     1 
ATOM 5462 O OP1   . DC  F 3 2   ? 51.094 30.504  71.375  1.00 195.96 ? 2   DC  F OP1   1 
ATOM 5463 O OP2   . DC  F 3 2   ? 50.189 30.614  68.980  1.00 191.26 ? 2   DC  F OP2   1 
ATOM 5464 O "O5'" . DC  F 3 2   ? 50.906 28.441  69.964  1.00 203.88 ? 2   DC  F "O5'" 1 
ATOM 5465 C "C5'" . DC  F 3 2   ? 50.170 27.286  70.354  1.00 179.08 ? 2   DC  F "C5'" 1 
ATOM 5466 C "C4'" . DC  F 3 2   ? 50.428 26.141  69.396  1.00 167.87 ? 2   DC  F "C4'" 1 
ATOM 5467 O "O4'" . DC  F 3 2   ? 49.159 25.561  68.971  1.00 168.41 ? 2   DC  F "O4'" 1 
ATOM 5468 C "C3'" . DC  F 3 2   ? 51.147 26.541  68.107  1.00 166.05 ? 2   DC  F "C3'" 1 
ATOM 5469 O "O3'" . DC  F 3 2   ? 51.985 25.483  67.683  1.00 229.64 ? 2   DC  F "O3'" 1 
ATOM 5470 C "C2'" . DC  F 3 2   ? 49.984 26.718  67.145  1.00 168.02 ? 2   DC  F "C2'" 1 
ATOM 5471 C "C1'" . DC  F 3 2   ? 49.126 25.539  67.563  1.00 166.64 ? 2   DC  F "C1'" 1 
ATOM 5472 N N1    . DC  F 3 2   ? 47.715 25.623  67.092  1.00 169.86 ? 2   DC  F N1    1 
ATOM 5473 C C2    . DC  F 3 2   ? 46.995 24.449  66.828  1.00 168.10 ? 2   DC  F C2    1 
ATOM 5474 O O2    . DC  F 3 2   ? 47.538 23.354  67.017  1.00 163.92 ? 2   DC  F O2    1 
ATOM 5475 N N3    . DC  F 3 2   ? 45.717 24.551  66.384  1.00 171.49 ? 2   DC  F N3    1 
ATOM 5476 C C4    . DC  F 3 2   ? 45.171 25.755  66.197  1.00 176.14 ? 2   DC  F C4    1 
ATOM 5477 N N4    . DC  F 3 2   ? 43.910 25.815  65.759  1.00 181.62 ? 2   DC  F N4    1 
ATOM 5478 C C5    . DC  F 3 2   ? 45.894 26.955  66.451  1.00 178.00 ? 2   DC  F C5    1 
ATOM 5479 C C6    . DC  F 3 2   ? 47.150 26.842  66.883  1.00 174.86 ? 2   DC  F C6    1 
ATOM 5480 P P     . DA  F 3 3   ? 53.578 25.561  67.869  1.00 157.84 ? 3   DA  F P     1 
ATOM 5481 O OP1   . DA  F 3 3   ? 53.855 25.485  69.320  1.00 185.94 ? 3   DA  F OP1   1 
ATOM 5482 O OP2   . DA  F 3 3   ? 54.094 26.701  67.082  1.00 160.36 ? 3   DA  F OP2   1 
ATOM 5483 O "O5'" . DA  F 3 3   ? 54.086 24.217  67.170  1.00 152.09 ? 3   DA  F "O5'" 1 
ATOM 5484 C "C5'" . DA  F 3 3   ? 53.541 22.965  67.578  1.00 199.68 ? 3   DA  F "C5'" 1 
ATOM 5485 C "C4'" . DA  F 3 3   ? 53.086 22.142  66.382  1.00 196.01 ? 3   DA  F "C4'" 1 
ATOM 5486 O "O4'" . DA  F 3 3   ? 51.736 22.521  65.992  1.00 168.42 ? 3   DA  F "O4'" 1 
ATOM 5487 C "C3'" . DA  F 3 3   ? 53.941 22.278  65.120  1.00 202.99 ? 3   DA  F "C3'" 1 
ATOM 5488 O "O3'" . DA  F 3 3   ? 54.094 20.999  64.534  1.00 142.70 ? 3   DA  F "O3'" 1 
ATOM 5489 C "C2'" . DA  F 3 3   ? 53.090 23.191  64.239  1.00 149.72 ? 3   DA  F "C2'" 1 
ATOM 5490 C "C1'" . DA  F 3 3   ? 51.703 22.701  64.597  1.00 151.00 ? 3   DA  F "C1'" 1 
ATOM 5491 N N9    . DA  F 3 3   ? 50.640 23.641  64.272  1.00 155.36 ? 3   DA  F N9    1 
ATOM 5492 C C8    . DA  F 3 3   ? 50.698 25.004  64.332  1.00 158.98 ? 3   DA  F C8    1 
ATOM 5493 N N7    . DA  F 3 3   ? 49.580 25.596  63.986  1.00 162.71 ? 3   DA  F N7    1 
ATOM 5494 C C5    . DA  F 3 3   ? 48.731 24.547  63.675  1.00 161.47 ? 3   DA  F C5    1 
ATOM 5495 C C6    . DA  F 3 3   ? 47.394 24.506  63.236  1.00 164.21 ? 3   DA  F C6    1 
ATOM 5496 N N6    . DA  F 3 3   ? 46.658 25.600  63.029  1.00 168.66 ? 3   DA  F N6    1 
ATOM 5497 N N1    . DA  F 3 3   ? 46.844 23.293  63.018  1.00 162.62 ? 3   DA  F N1    1 
ATOM 5498 C C2    . DA  F 3 3   ? 47.587 22.200  63.227  1.00 158.52 ? 3   DA  F C2    1 
ATOM 5499 N N3    . DA  F 3 3   ? 48.850 22.114  63.640  1.00 155.42 ? 3   DA  F N3    1 
ATOM 5500 C C4    . DA  F 3 3   ? 49.369 23.335  63.847  1.00 157.10 ? 3   DA  F C4    1 
ATOM 5501 P P     . DA  F 3 4   ? 55.199 20.729  63.402  1.00 140.68 ? 4   DA  F P     1 
ATOM 5502 O OP1   . DA  F 3 4   ? 56.340 20.062  64.062  1.00 177.51 ? 4   DA  F OP1   1 
ATOM 5503 O OP2   . DA  F 3 4   ? 55.438 21.967  62.635  1.00 143.52 ? 4   DA  F OP2   1 
ATOM 5504 O "O5'" . DA  F 3 4   ? 54.474 19.676  62.446  1.00 139.98 ? 4   DA  F "O5'" 1 
ATOM 5505 C "C5'" . DA  F 3 4   ? 53.878 18.517  63.013  1.00 147.59 ? 4   DA  F "C5'" 1 
ATOM 5506 C "C4'" . DA  F 3 4   ? 52.720 18.015  62.168  1.00 140.26 ? 4   DA  F "C4'" 1 
ATOM 5507 O "O4'" . DA  F 3 4   ? 51.668 19.013  62.124  1.00 143.76 ? 4   DA  F "O4'" 1 
ATOM 5508 C "C3'" . DA  F 3 4   ? 53.056 17.696  60.719  1.00 140.24 ? 4   DA  F "C3'" 1 
ATOM 5509 O "O3'" . DA  F 3 4   ? 52.336 16.547  60.320  1.00 164.91 ? 4   DA  F "O3'" 1 
ATOM 5510 C "C2'" . DA  F 3 4   ? 52.580 18.942  59.978  1.00 143.34 ? 4   DA  F "C2'" 1 
ATOM 5511 C "C1'" . DA  F 3 4   ? 51.350 19.317  60.786  1.00 145.47 ? 4   DA  F "C1'" 1 
ATOM 5512 N N9    . DA  F 3 4   ? 51.005 20.732  60.717  1.00 148.45 ? 4   DA  F N9    1 
ATOM 5513 C C8    . DA  F 3 4   ? 51.818 21.790  61.011  1.00 148.92 ? 4   DA  F C8    1 
ATOM 5514 N N7    . DA  F 3 4   ? 51.238 22.957  60.874  1.00 152.41 ? 4   DA  F N7    1 
ATOM 5515 C C5    . DA  F 3 4   ? 49.952 22.643  60.470  1.00 154.11 ? 4   DA  F C5    1 
ATOM 5516 C C6    . DA  F 3 4   ? 48.840 23.443  60.157  1.00 157.97 ? 4   DA  F C6    1 
ATOM 5517 N N6    . DA  F 3 4   ? 48.863 24.776  60.212  1.00 160.93 ? 4   DA  F N6    1 
ATOM 5518 N N1    . DA  F 3 4   ? 47.702 22.820  59.785  1.00 159.12 ? 4   DA  F N1    1 
ATOM 5519 C C2    . DA  F 3 4   ? 47.689 21.483  59.733  1.00 156.79 ? 4   DA  F C2    1 
ATOM 5520 N N3    . DA  F 3 4   ? 48.673 20.625  60.005  1.00 153.19 ? 4   DA  F N3    1 
ATOM 5521 C C4    . DA  F 3 4   ? 49.788 21.277  60.370  1.00 151.85 ? 4   DA  F C4    1 
ATOM 5522 P P     . DC  F 3 5   ? 52.760 15.746  58.996  1.00 140.54 ? 5   DC  F P     1 
ATOM 5523 O OP1   . DC  F 3 5   ? 52.609 14.304  59.303  1.00 139.53 ? 5   DC  F OP1   1 
ATOM 5524 O OP2   . DC  F 3 5   ? 54.066 16.288  58.560  1.00 139.52 ? 5   DC  F OP2   1 
ATOM 5525 O "O5'" . DC  F 3 5   ? 51.648 16.172  57.922  1.00 144.10 ? 5   DC  F "O5'" 1 
ATOM 5526 C "C5'" . DC  F 3 5   ? 50.276 15.908  58.193  1.00 153.19 ? 5   DC  F "C5'" 1 
ATOM 5527 C "C4'" . DC  F 3 5   ? 49.363 16.613  57.204  1.00 149.60 ? 5   DC  F "C4'" 1 
ATOM 5528 O "O4'" . DC  F 3 5   ? 49.310 18.029  57.490  1.00 175.92 ? 5   DC  F "O4'" 1 
ATOM 5529 C "C3'" . DC  F 3 5   ? 49.767 16.491  55.733  1.00 150.66 ? 5   DC  F "C3'" 1 
ATOM 5530 O "O3'" . DC  F 3 5   ? 48.704 15.903  55.006  1.00 153.58 ? 5   DC  F "O3'" 1 
ATOM 5531 C "C2'" . DC  F 3 5   ? 50.025 17.941  55.293  1.00 151.70 ? 5   DC  F "C2'" 1 
ATOM 5532 C "C1'" . DC  F 3 5   ? 49.179 18.722  56.278  1.00 152.61 ? 5   DC  F "C1'" 1 
ATOM 5533 N N1    . DC  F 3 5   ? 49.624 20.133  56.493  1.00 153.09 ? 5   DC  F N1    1 
ATOM 5534 C C2    . DC  F 3 5   ? 48.719 21.185  56.292  1.00 156.25 ? 5   DC  F C2    1 
ATOM 5535 O O2    . DC  F 3 5   ? 47.566 20.925  55.922  1.00 159.25 ? 5   DC  F O2    1 
ATOM 5536 N N3    . DC  F 3 5   ? 49.137 22.459  56.506  1.00 157.28 ? 5   DC  F N3    1 
ATOM 5537 C C4    . DC  F 3 5   ? 50.390 22.691  56.903  1.00 155.36 ? 5   DC  F C4    1 
ATOM 5538 N N4    . DC  F 3 5   ? 50.761 23.960  57.100  1.00 157.15 ? 5   DC  F N4    1 
ATOM 5539 C C5    . DC  F 3 5   ? 51.319 21.632  57.116  1.00 151.96 ? 5   DC  F C5    1 
ATOM 5540 C C6    . DC  F 3 5   ? 50.898 20.383  56.904  1.00 150.89 ? 5   DC  F C6    1 
ATOM 5541 P P     . DT  F 3 6   ? 48.899 15.493  53.467  1.00 155.68 ? 6   DT  F P     1 
ATOM 5542 O OP1   . DT  F 3 6   ? 48.224 14.192  53.267  1.00 176.88 ? 6   DT  F OP1   1 
ATOM 5543 O OP2   . DT  F 3 6   ? 50.331 15.642  53.127  1.00 153.84 ? 6   DT  F OP2   1 
ATOM 5544 O "O5'" . DT  F 3 6   ? 48.059 16.598  52.682  1.00 158.78 ? 6   DT  F "O5'" 1 
ATOM 5545 C "C5'" . DT  F 3 6   ? 46.727 16.884  53.080  1.00 220.43 ? 6   DT  F "C5'" 1 
ATOM 5546 C "C4'" . DT  F 3 6   ? 46.195 18.087  52.329  1.00 163.40 ? 6   DT  F "C4'" 1 
ATOM 5547 O "O4'" . DT  F 3 6   ? 46.756 19.293  52.892  1.00 162.00 ? 6   DT  F "O4'" 1 
ATOM 5548 C "C3'" . DT  F 3 6   ? 46.533 18.101  50.842  1.00 165.23 ? 6   DT  F "C3'" 1 
ATOM 5549 O "O3'" . DT  F 3 6   ? 45.340 18.147  50.076  1.00 168.96 ? 6   DT  F "O3'" 1 
ATOM 5550 C "C2'" . DT  F 3 6   ? 47.396 19.358  50.648  1.00 226.67 ? 6   DT  F "C2'" 1 
ATOM 5551 C "C1'" . DT  F 3 6   ? 47.061 20.201  51.870  1.00 163.56 ? 6   DT  F "C1'" 1 
ATOM 5552 N N1    . DT  F 3 6   ? 48.194 21.044  52.343  1.00 161.68 ? 6   DT  F N1    1 
ATOM 5553 C C2    . DT  F 3 6   ? 48.018 22.401  52.496  1.00 163.29 ? 6   DT  F C2    1 
ATOM 5554 O O2    . DT  F 3 6   ? 46.972 22.972  52.249  1.00 166.02 ? 6   DT  F O2    1 
ATOM 5555 N N3    . DT  F 3 6   ? 49.122 23.071  52.948  1.00 162.02 ? 6   DT  F N3    1 
ATOM 5556 C C4    . DT  F 3 6   ? 50.355 22.532  53.259  1.00 159.19 ? 6   DT  F C4    1 
ATOM 5557 O O4    . DT  F 3 6   ? 51.290 23.214  53.658  1.00 158.67 ? 6   DT  F O4    1 
ATOM 5558 C C5    . DT  F 3 6   ? 50.469 21.110  53.081  1.00 157.39 ? 6   DT  F C5    1 
ATOM 5559 C C7    . DT  F 3 6   ? 51.762 20.418  53.387  1.00 158.86 ? 6   DT  F C7    1 
ATOM 5560 C C6    . DT  F 3 6   ? 49.396 20.441  52.640  1.00 158.81 ? 6   DT  F C6    1 
ATOM 5561 P P     . DC  F 3 7   ? 45.408 18.012  48.477  1.00 172.66 ? 7   DC  F P     1 
ATOM 5562 O OP1   . DC  F 3 7   ? 44.158 17.362  48.022  1.00 176.30 ? 7   DC  F OP1   1 
ATOM 5563 O OP2   . DC  F 3 7   ? 46.720 17.419  48.134  1.00 170.42 ? 7   DC  F OP2   1 
ATOM 5564 O "O5'" . DC  F 3 7   ? 45.411 19.528  47.981  1.00 173.11 ? 7   DC  F "O5'" 1 
ATOM 5565 C "C5'" . DC  F 3 7   ? 44.507 20.458  48.558  1.00 190.39 ? 7   DC  F "C5'" 1 
ATOM 5566 C "C4'" . DC  F 3 7   ? 44.834 21.866  48.111  1.00 185.51 ? 7   DC  F "C4'" 1 
ATOM 5567 O "O4'" . DC  F 3 7   ? 45.976 22.363  48.862  1.00 172.03 ? 7   DC  F "O4'" 1 
ATOM 5568 C "C3'" . DC  F 3 7   ? 45.216 21.992  46.634  1.00 214.16 ? 7   DC  F "C3'" 1 
ATOM 5569 O "O3'" . DC  F 3 7   ? 44.635 23.163  46.085  1.00 226.66 ? 7   DC  F "O3'" 1 
ATOM 5570 C "C2'" . DC  F 3 7   ? 46.736 22.101  46.690  1.00 204.65 ? 7   DC  F "C2'" 1 
ATOM 5571 C "C1'" . DC  F 3 7   ? 46.901 22.913  47.960  1.00 172.84 ? 7   DC  F "C1'" 1 
ATOM 5572 N N1    . DC  F 3 7   ? 48.267 22.845  48.548  1.00 169.94 ? 7   DC  F N1    1 
ATOM 5573 C C2    . DC  F 3 7   ? 48.858 24.010  49.047  1.00 169.78 ? 7   DC  F C2    1 
ATOM 5574 O O2    . DC  F 3 7   ? 48.221 25.067  48.999  1.00 172.07 ? 7   DC  F O2    1 
ATOM 5575 N N3    . DC  F 3 7   ? 50.105 23.941  49.569  1.00 167.53 ? 7   DC  F N3    1 
ATOM 5576 C C4    . DC  F 3 7   ? 50.750 22.775  49.599  1.00 165.31 ? 7   DC  F C4    1 
ATOM 5577 N N4    . DC  F 3 7   ? 51.979 22.751  50.123  1.00 163.29 ? 7   DC  F N4    1 
ATOM 5578 C C5    . DC  F 3 7   ? 50.165 21.578  49.090  1.00 165.54 ? 7   DC  F C5    1 
ATOM 5579 C C6    . DC  F 3 7   ? 48.936 21.660  48.575  1.00 167.98 ? 7   DC  F C6    1 
ATOM 5580 P P     . DA  F 3 8   ? 43.975 23.128  44.621  1.00 183.99 ? 8   DA  F P     1 
ATOM 5581 O OP1   . DA  F 3 8   ? 42.883 22.130  44.642  1.00 207.58 ? 8   DA  F OP1   1 
ATOM 5582 O OP2   . DA  F 3 8   ? 45.075 22.991  43.642  1.00 212.19 ? 8   DA  F OP2   1 
ATOM 5583 O "O5'" . DA  F 3 8   ? 43.320 24.579  44.466  1.00 197.91 ? 8   DA  F "O5'" 1 
ATOM 5584 C "C5'" . DA  F 3 8   ? 43.957 25.559  43.661  1.00 201.54 ? 8   DA  F "C5'" 1 
ATOM 5585 C "C4'" . DA  F 3 8   ? 43.890 26.925  44.316  1.00 188.27 ? 8   DA  F "C4'" 1 
ATOM 5586 O "O4'" . DA  F 3 8   ? 44.813 26.972  45.423  1.00 185.10 ? 8   DA  F "O4'" 1 
ATOM 5587 C "C3'" . DA  F 3 8   ? 44.337 28.068  43.435  1.00 206.55 ? 8   DA  F "C3'" 1 
ATOM 5588 O "O3'" . DA  F 3 8   ? 43.935 29.305  44.019  1.00 192.36 ? 8   DA  F "O3'" 1 
ATOM 5589 C "C2'" . DA  F 3 8   ? 45.851 27.897  43.510  1.00 204.85 ? 8   DA  F "C2'" 1 
ATOM 5590 C "C1'" . DA  F 3 8   ? 46.032 27.556  44.991  1.00 185.47 ? 8   DA  F "C1'" 1 
ATOM 5591 N N9    . DA  F 3 8   ? 47.095 26.599  45.268  1.00 182.48 ? 8   DA  F N9    1 
ATOM 5592 C C8    . DA  F 3 8   ? 47.030 25.244  45.124  1.00 181.03 ? 8   DA  F C8    1 
ATOM 5593 N N7    . DA  F 3 8   ? 48.127 24.622  45.472  1.00 178.55 ? 8   DA  F N7    1 
ATOM 5594 C C5    . DA  F 3 8   ? 48.964 25.635  45.893  1.00 178.31 ? 8   DA  F C5    1 
ATOM 5595 C C6    . DA  F 3 8   ? 50.275 25.623  46.389  1.00 176.43 ? 8   DA  F C6    1 
ATOM 5596 N N6    . DA  F 3 8   ? 50.984 24.503  46.541  1.00 174.08 ? 8   DA  F N6    1 
ATOM 5597 N N1    . DA  F 3 8   ? 50.834 26.807  46.713  1.00 177.50 ? 8   DA  F N1    1 
ATOM 5598 C C2    . DA  F 3 8   ? 50.113 27.925  46.557  1.00 180.26 ? 8   DA  F C2    1 
ATOM 5599 N N3    . DA  F 3 8   ? 48.868 28.060  46.095  1.00 182.04 ? 8   DA  F N3    1 
ATOM 5600 C C4    . DA  F 3 8   ? 48.345 26.863  45.782  1.00 180.86 ? 8   DA  F C4    1 
ATOM 5601 P P     . DA  F 3 9   ? 42.413 29.817  43.917  1.00 195.27 ? 9   DA  F P     1 
ATOM 5602 O OP1   . DA  F 3 9   ? 42.242 30.808  45.001  1.00 200.86 ? 9   DA  F OP1   1 
ATOM 5603 O OP2   . DA  F 3 9   ? 41.488 28.667  43.822  1.00 194.91 ? 9   DA  F OP2   1 
ATOM 5604 O "O5'" . DA  F 3 9   ? 42.355 30.597  42.524  1.00 219.73 ? 9   DA  F "O5'" 1 
ATOM 5605 C "C5'" . DA  F 3 9   ? 43.098 31.792  42.343  1.00 213.40 ? 9   DA  F "C5'" 1 
ATOM 5606 C "C4'" . DA  F 3 9   ? 42.388 32.720  41.375  1.00 205.27 ? 9   DA  F "C4'" 1 
ATOM 5607 O "O4'" . DA  F 3 9   ? 41.663 31.935  40.402  1.00 206.28 ? 9   DA  F "O4'" 1 
ATOM 5608 C "C3'" . DA  F 3 9   ? 41.330 33.607  41.998  1.00 213.09 ? 9   DA  F "C3'" 1 
ATOM 5609 O "O3'" . DA  F 3 9   ? 41.929 34.774  42.540  1.00 231.57 ? 9   DA  F "O3'" 1 
ATOM 5610 C "C2'" . DA  F 3 9   ? 40.455 33.940  40.795  1.00 222.83 ? 9   DA  F "C2'" 1 
ATOM 5611 C "C1'" . DA  F 3 9   ? 40.508 32.647  39.985  1.00 209.66 ? 9   DA  F "C1'" 1 
ATOM 5612 N N9    . DA  F 3 9   ? 39.335 31.795  40.166  1.00 209.31 ? 9   DA  F N9    1 
ATOM 5613 C C8    . DA  F 3 9   ? 39.303 30.542  40.712  1.00 206.42 ? 9   DA  F C8    1 
ATOM 5614 N N7    . DA  F 3 9   ? 38.104 30.010  40.743  1.00 207.59 ? 9   DA  F N7    1 
ATOM 5615 C C5    . DA  F 3 9   ? 37.292 30.983  40.182  1.00 211.29 ? 9   DA  F C5    1 
ATOM 5616 C C6    . DA  F 3 9   ? 35.906 31.031  39.929  1.00 214.37 ? 9   DA  F C6    1 
ATOM 5617 N N6    . DA  F 3 9   ? 35.073 30.031  40.227  1.00 214.44 ? 9   DA  F N6    1 
ATOM 5618 N N1    . DA  F 3 9   ? 35.410 32.151  39.356  1.00 231.47 ? 9   DA  F N1    1 
ATOM 5619 C C2    . DA  F 3 9   ? 36.252 33.149  39.060  1.00 218.28 ? 9   DA  F C2    1 
ATOM 5620 N N3    . DA  F 3 9   ? 37.571 33.217  39.249  1.00 215.94 ? 9   DA  F N3    1 
ATOM 5621 C C4    . DA  F 3 9   ? 38.033 32.090  39.820  1.00 212.34 ? 9   DA  F C4    1 
ATOM 5622 P P     . DC  F 3 10  ? 41.199 35.578  43.725  1.00 218.83 ? 10  DC  F P     1 
ATOM 5623 O OP1   . DC  F 3 10  ? 42.149 36.595  44.226  1.00 235.28 ? 10  DC  F OP1   1 
ATOM 5624 O OP2   . DC  F 3 10  ? 40.630 34.576  44.655  1.00 213.38 ? 10  DC  F OP2   1 
ATOM 5625 O "O5'" . DC  F 3 10  ? 39.977 36.317  43.002  1.00 225.28 ? 10  DC  F "O5'" 1 
ATOM 5626 C "C5'" . DC  F 3 10  ? 40.220 37.242  41.942  1.00 233.04 ? 10  DC  F "C5'" 1 
ATOM 5627 C "C4'" . DC  F 3 10  ? 38.946 37.509  41.160  1.00 249.89 ? 10  DC  F "C4'" 1 
ATOM 5628 O "O4'" . DC  F 3 10  ? 38.232 36.255  40.956  1.00 252.77 ? 10  DC  F "O4'" 1 
ATOM 5629 C "C3'" . DC  F 3 10  ? 37.946 38.435  41.857  1.00 278.33 ? 10  DC  F "C3'" 1 
ATOM 5630 O "O3'" . DC  F 3 10  ? 37.224 39.202  40.888  1.00 283.52 ? 10  DC  F "O3'" 1 
ATOM 5631 C "C2'" . DC  F 3 10  ? 37.035 37.439  42.556  1.00 278.80 ? 10  DC  F "C2'" 1 
ATOM 5632 C "C1'" . DC  F 3 10  ? 36.925 36.390  41.469  1.00 266.75 ? 10  DC  F "C1'" 1 
ATOM 5633 N N1    . DC  F 3 10  ? 36.432 35.074  41.951  1.00 254.62 ? 10  DC  F N1    1 
ATOM 5634 C C2    . DC  F 3 10  ? 35.071 34.788  41.849  1.00 245.34 ? 10  DC  F C2    1 
ATOM 5635 O O2    . DC  F 3 10  ? 34.326 35.640  41.353  1.00 240.89 ? 10  DC  F O2    1 
ATOM 5636 N N3    . DC  F 3 10  ? 34.614 33.591  42.289  1.00 237.54 ? 10  DC  F N3    1 
ATOM 5637 C C4    . DC  F 3 10  ? 35.465 32.707  42.814  1.00 233.17 ? 10  DC  F C4    1 
ATOM 5638 N N4    . DC  F 3 10  ? 34.971 31.537  43.235  1.00 229.78 ? 10  DC  F N4    1 
ATOM 5639 C C5    . DC  F 3 10  ? 36.860 32.982  42.930  1.00 235.33 ? 10  DC  F C5    1 
ATOM 5640 C C6    . DC  F 3 10  ? 37.296 34.169  42.491  1.00 248.57 ? 10  DC  F C6    1 
ATOM 5641 P P     . DT  F 3 11  ? 36.362 40.483  41.340  1.00 387.77 ? 11  DT  F P     1 
ATOM 5642 O OP1   . DT  F 3 11  ? 36.845 41.637  40.550  1.00 348.99 ? 11  DT  F OP1   1 
ATOM 5643 O OP2   . DT  F 3 11  ? 36.378 40.548  42.819  1.00 335.14 ? 11  DT  F OP2   1 
ATOM 5644 O "O5'" . DT  F 3 11  ? 34.871 40.153  40.850  1.00 362.75 ? 11  DT  F "O5'" 1 
ATOM 5645 C "C5'" . DT  F 3 11  ? 34.234 38.944  41.254  1.00 358.29 ? 11  DT  F "C5'" 1 
ATOM 5646 C "C4'" . DT  F 3 11  ? 32.974 39.224  42.053  1.00 353.20 ? 11  DT  F "C4'" 1 
ATOM 5647 O "O4'" . DT  F 3 11  ? 32.555 38.007  42.735  1.00 350.14 ? 11  DT  F "O4'" 1 
ATOM 5648 C "C3'" . DT  F 3 11  ? 33.124 40.264  43.162  1.00 335.84 ? 11  DT  F "C3'" 1 
ATOM 5649 O "O3'" . DT  F 3 11  ? 31.864 40.872  43.407  1.00 333.50 ? 11  DT  F "O3'" 1 
ATOM 5650 C "C2'" . DT  F 3 11  ? 33.527 39.388  44.334  1.00 335.15 ? 11  DT  F "C2'" 1 
ATOM 5651 C "C1'" . DT  F 3 11  ? 32.549 38.247  44.127  1.00 340.37 ? 11  DT  F "C1'" 1 
ATOM 5652 N N1    . DT  F 3 11  ? 32.898 36.993  44.847  1.00 342.81 ? 11  DT  F N1    1 
ATOM 5653 C C2    . DT  F 3 11  ? 31.954 36.003  44.943  1.00 346.81 ? 11  DT  F C2    1 
ATOM 5654 O O2    . DT  F 3 11  ? 30.842 36.093  44.454  1.00 348.57 ? 11  DT  F O2    1 
ATOM 5655 N N3    . DT  F 3 11  ? 32.355 34.892  45.628  1.00 349.08 ? 11  DT  F N3    1 
ATOM 5656 C C4    . DT  F 3 11  ? 33.582 34.674  46.224  1.00 351.94 ? 11  DT  F C4    1 
ATOM 5657 O O4    . DT  F 3 11  ? 33.844 33.634  46.820  1.00 351.19 ? 11  DT  F O4    1 
ATOM 5658 C C5    . DT  F 3 11  ? 34.531 35.757  46.094  1.00 351.45 ? 11  DT  F C5    1 
ATOM 5659 C C7    . DT  F 3 11  ? 35.899 35.638  46.700  1.00 343.66 ? 11  DT  F C7    1 
ATOM 5660 C C6    . DT  F 3 11  ? 34.146 36.854  45.421  1.00 348.85 ? 11  DT  F C6    1 
ATOM 5661 P P     . DC  F 3 12  ? 31.639 42.441  43.154  1.00 329.18 ? 12  DC  F P     1 
ATOM 5662 O OP1   . DC  F 3 12  ? 32.151 42.761  41.803  1.00 367.88 ? 12  DC  F OP1   1 
ATOM 5663 O OP2   . DC  F 3 12  ? 32.163 43.170  44.329  1.00 322.81 ? 12  DC  F OP2   1 
ATOM 5664 O "O5'" . DC  F 3 12  ? 30.046 42.593  43.156  1.00 329.69 ? 12  DC  F "O5'" 1 
ATOM 5665 C "C5'" . DC  F 3 12  ? 29.262 41.880  42.201  1.00 347.76 ? 12  DC  F "C5'" 1 
ATOM 5666 C "C4'" . DC  F 3 12  ? 28.034 41.247  42.844  1.00 336.93 ? 12  DC  F "C4'" 1 
ATOM 5667 O "O4'" . DC  F 3 12  ? 28.428 40.108  43.656  1.00 337.72 ? 12  DC  F "O4'" 1 
ATOM 5668 C "C3'" . DC  F 3 12  ? 27.235 42.153  43.772  1.00 331.42 ? 12  DC  F "C3'" 1 
ATOM 5669 O "O3'" . DC  F 3 12  ? 25.866 41.789  43.718  1.00 334.27 ? 12  DC  F "O3'" 1 
ATOM 5670 C "C2'" . DC  F 3 12  ? 27.830 41.817  45.134  1.00 338.46 ? 12  DC  F "C2'" 1 
ATOM 5671 C "C1'" . DC  F 3 12  ? 28.018 40.314  44.995  1.00 332.79 ? 12  DC  F "C1'" 1 
ATOM 5672 N N1    . DC  F 3 12  ? 29.066 39.753  45.883  1.00 340.16 ? 12  DC  F N1    1 
ATOM 5673 C C2    . DC  F 3 12  ? 28.867 38.510  46.497  1.00 347.25 ? 12  DC  F C2    1 
ATOM 5674 O O2    . DC  F 3 12  ? 27.808 37.899  46.303  1.00 339.07 ? 12  DC  F O2    1 
ATOM 5675 N N3    . DC  F 3 12  ? 29.845 38.011  47.293  1.00 351.39 ? 12  DC  F N3    1 
ATOM 5676 C C4    . DC  F 3 12  ? 30.971 38.700  47.477  1.00 335.44 ? 12  DC  F C4    1 
ATOM 5677 N N4    . DC  F 3 12  ? 31.908 38.171  48.266  1.00 328.22 ? 12  DC  F N4    1 
ATOM 5678 C C5    . DC  F 3 12  ? 31.190 39.964  46.858  1.00 340.65 ? 12  DC  F C5    1 
ATOM 5679 C C6    . DC  F 3 12  ? 30.223 40.445  46.074  1.00 343.85 ? 12  DC  F C6    1 
ATOM 5680 P P     . DG  F 3 13  ? 24.800 42.711  42.948  1.00 335.31 ? 13  DG  F P     1 
ATOM 5681 O OP1   . DG  F 3 13  ? 23.736 41.820  42.435  1.00 350.56 ? 13  DG  F OP1   1 
ATOM 5682 O OP2   . DG  F 3 13  ? 25.554 43.573  42.012  1.00 356.59 ? 13  DG  F OP2   1 
ATOM 5683 O "O5'" . DG  F 3 13  ? 24.184 43.648  44.092  1.00 328.95 ? 13  DG  F "O5'" 1 
ATOM 5684 C "C5'" . DG  F 3 13  ? 24.240 43.250  45.464  1.00 352.78 ? 13  DG  F "C5'" 1 
ATOM 5685 C "C4'" . DG  F 3 13  ? 23.493 41.946  45.688  1.00 349.32 ? 13  DG  F "C4'" 1 
ATOM 5686 O "O4'" . DG  F 3 13  ? 24.432 40.931  46.126  1.00 343.33 ? 13  DG  F "O4'" 1 
ATOM 5687 C "C3'" . DG  F 3 13  ? 22.433 41.993  46.773  1.00 348.31 ? 13  DG  F "C3'" 1 
ATOM 5688 O "O3'" . DG  F 3 13  ? 21.488 40.953  46.567  1.00 384.83 ? 13  DG  F "O3'" 1 
ATOM 5689 C "C2'" . DG  F 3 13  ? 23.267 41.730  48.018  1.00 326.20 ? 13  DG  F "C2'" 1 
ATOM 5690 C "C1'" . DG  F 3 13  ? 24.244 40.672  47.506  1.00 326.66 ? 13  DG  F "C1'" 1 
ATOM 5691 N N9    . DG  F 3 13  ? 25.546 40.713  48.166  1.00 343.06 ? 13  DG  F N9    1 
ATOM 5692 C C8    . DG  F 3 13  ? 26.466 41.731  48.113  1.00 340.86 ? 13  DG  F C8    1 
ATOM 5693 N N7    . DG  F 3 13  ? 27.546 41.494  48.805  1.00 341.93 ? 13  DG  F N7    1 
ATOM 5694 C C5    . DG  F 3 13  ? 27.327 40.239  49.356  1.00 335.54 ? 13  DG  F C5    1 
ATOM 5695 C C6    . DG  F 3 13  ? 28.150 39.461  50.203  1.00 319.14 ? 13  DG  F C6    1 
ATOM 5696 O O6    . DG  F 3 13  ? 29.272 39.738  50.647  1.00 318.78 ? 13  DG  F O6    1 
ATOM 5697 N N1    . DG  F 3 13  ? 27.550 38.249  50.532  1.00 322.91 ? 13  DG  F N1    1 
ATOM 5698 C C2    . DG  F 3 13  ? 26.311 37.840  50.096  1.00 326.59 ? 13  DG  F C2    1 
ATOM 5699 N N2    . DG  F 3 13  ? 25.899 36.637  50.520  1.00 330.21 ? 13  DG  F N2    1 
ATOM 5700 N N3    . DG  F 3 13  ? 25.530 38.559  49.301  1.00 335.96 ? 13  DG  F N3    1 
ATOM 5701 C C4    . DG  F 3 13  ? 26.100 39.744  48.973  1.00 340.53 ? 13  DG  F C4    1 
ATOM 5702 P P     . DT  F 3 14  ? 20.184 41.187  45.656  1.00 423.59 ? 14  DT  F P     1 
ATOM 5703 O OP1   . DT  F 3 14  ? 20.528 42.134  44.573  1.00 433.33 ? 14  DT  F OP1   1 
ATOM 5704 O OP2   . DT  F 3 14  ? 19.057 41.490  46.566  1.00 425.35 ? 14  DT  F OP2   1 
ATOM 5705 O "O5'" . DT  F 3 14  ? 19.932 39.755  44.989  1.00 436.99 ? 14  DT  F "O5'" 1 
ATOM 5706 C "C5'" . DT  F 3 14  ? 20.967 39.131  44.233  1.00 444.35 ? 14  DT  F "C5'" 1 
ATOM 5707 C "C4'" . DT  F 3 14  ? 21.362 37.800  44.850  1.00 449.35 ? 14  DT  F "C4'" 1 
ATOM 5708 O "O4'" . DT  F 3 14  ? 22.463 37.240  44.110  1.00 451.58 ? 14  DT  F "O4'" 1 
ATOM 5709 C "C3'" . DT  F 3 14  ? 21.835 37.879  46.304  1.00 448.78 ? 14  DT  F "C3'" 1 
ATOM 5710 O "O3'" . DT  F 3 14  ? 20.844 37.337  47.173  1.00 445.08 ? 14  DT  F "O3'" 1 
ATOM 5711 C "C2'" . DT  F 3 14  ? 23.140 37.061  46.344  1.00 451.94 ? 14  DT  F "C2'" 1 
ATOM 5712 C "C1'" . DT  F 3 14  ? 23.199 36.409  44.966  1.00 455.26 ? 14  DT  F "C1'" 1 
ATOM 5713 P P     . DT  F 3 15  ? 20.464 38.093  48.541  1.00 427.31 ? 15  DT  F P     1 
ATOM 5714 O OP1   . DT  F 3 15  ? 21.537 39.074  48.817  1.00 416.86 ? 15  DT  F OP1   1 
ATOM 5715 O OP2   . DT  F 3 15  ? 20.136 37.061  49.549  1.00 425.67 ? 15  DT  F OP2   1 
ATOM 5716 O "O5'" . DT  F 3 15  ? 19.130 38.902  48.180  1.00 416.48 ? 15  DT  F "O5'" 1 
ATOM 5717 C "C5'" . DT  F 3 15  ? 18.291 39.402  49.222  1.00 404.32 ? 15  DT  F "C5'" 1 
ATOM 5718 C "C4'" . DT  F 3 15  ? 18.880 40.658  49.840  1.00 394.92 ? 15  DT  F "C4'" 1 
ATOM 5719 O "O4'" . DT  F 3 15  ? 18.015 41.790  49.553  1.00 390.36 ? 15  DT  F "O4'" 1 
ATOM 5720 C "C3'" . DT  F 3 15  ? 19.034 40.620  51.361  1.00 395.73 ? 15  DT  F "C3'" 1 
ATOM 5721 O "O3'" . DT  F 3 15  ? 20.240 41.272  51.746  1.00 383.00 ? 15  DT  F "O3'" 1 
ATOM 5722 C "C2'" . DT  F 3 15  ? 17.805 41.379  51.850  1.00 397.24 ? 15  DT  F "C2'" 1 
ATOM 5723 C "C1'" . DT  F 3 15  ? 17.639 42.423  50.756  1.00 394.28 ? 15  DT  F "C1'" 1 
ATOM 5724 P P     . DT  F 3 16  ? 20.817 41.095  53.236  1.00 292.85 ? 16  DT  F P     1 
ATOM 5725 O OP1   . DT  F 3 16  ? 20.251 39.847  53.795  1.00 297.62 ? 16  DT  F OP1   1 
ATOM 5726 O OP2   . DT  F 3 16  ? 20.615 42.377  53.947  1.00 290.28 ? 16  DT  F OP2   1 
ATOM 5727 O "O5'" . DT  F 3 16  ? 22.390 40.899  53.018  1.00 254.99 ? 16  DT  F "O5'" 1 
ATOM 5728 C "C5'" . DT  F 3 16  ? 22.854 39.991  52.032  1.00 232.81 ? 16  DT  F "C5'" 1 
ATOM 5729 C "C4'" . DT  F 3 16  ? 24.370 39.952  51.999  1.00 218.56 ? 16  DT  F "C4'" 1 
ATOM 5730 O "O4'" . DT  F 3 16  ? 24.890 41.290  51.814  1.00 220.44 ? 16  DT  F "O4'" 1 
ATOM 5731 C "C3'" . DT  F 3 16  ? 25.029 39.448  53.268  1.00 262.72 ? 16  DT  F "C3'" 1 
ATOM 5732 O "O3'" . DT  F 3 16  ? 25.104 38.028  53.242  1.00 249.16 ? 16  DT  F "O3'" 1 
ATOM 5733 C "C2'" . DT  F 3 16  ? 26.412 40.082  53.175  1.00 249.94 ? 16  DT  F "C2'" 1 
ATOM 5734 C "C1'" . DT  F 3 16  ? 26.096 41.440  52.545  1.00 266.68 ? 16  DT  F "C1'" 1 
ATOM 5735 P P     . DC  F 3 17  ? 25.144 37.192  54.614  1.00 198.88 ? 17  DC  F P     1 
ATOM 5736 O OP1   . DC  F 3 17  ? 24.118 36.129  54.530  1.00 196.53 ? 17  DC  F OP1   1 
ATOM 5737 O OP2   . DC  F 3 17  ? 25.122 38.156  55.736  1.00 190.09 ? 17  DC  F OP2   1 
ATOM 5738 O "O5'" . DC  F 3 17  ? 26.581 36.504  54.602  1.00 187.69 ? 17  DC  F "O5'" 1 
ATOM 5739 C "C5'" . DC  F 3 17  ? 26.879 35.489  55.546  1.00 206.70 ? 17  DC  F "C5'" 1 
ATOM 5740 C "C4'" . DC  F 3 17  ? 26.950 34.138  54.874  1.00 214.82 ? 17  DC  F "C4'" 1 
ATOM 5741 O "O4'" . DC  F 3 17  ? 27.878 34.209  53.773  1.00 230.29 ? 17  DC  F "O4'" 1 
ATOM 5742 C "C3'" . DC  F 3 17  ? 27.473 33.017  55.746  1.00 182.88 ? 17  DC  F "C3'" 1 
ATOM 5743 O "O3'" . DC  F 3 17  ? 26.998 31.758  55.247  1.00 214.03 ? 17  DC  F "O3'" 1 
ATOM 5744 C "C2'" . DC  F 3 17  ? 28.988 33.176  55.600  1.00 190.59 ? 17  DC  F "C2'" 1 
ATOM 5745 C "C1'" . DC  F 3 17  ? 29.146 33.735  54.182  1.00 204.19 ? 17  DC  F "C1'" 1 
ATOM 5746 N N1    . DC  F 3 17  ? 30.184 34.845  54.094  1.00 205.52 ? 17  DC  F N1    1 
ATOM 5747 C C2    . DC  F 3 17  ? 29.959 36.013  53.331  1.00 226.79 ? 17  DC  F C2    1 
ATOM 5748 O O2    . DC  F 3 17  ? 28.901 36.158  52.709  1.00 259.41 ? 17  DC  F O2    1 
ATOM 5749 N N3    . DC  F 3 17  ? 30.927 36.963  53.294  1.00 216.85 ? 17  DC  F N3    1 
ATOM 5750 C C4    . DC  F 3 17  ? 32.063 36.794  53.965  1.00 195.93 ? 17  DC  F C4    1 
ATOM 5751 N N4    . DC  F 3 17  ? 32.981 37.762  53.893  1.00 184.11 ? 17  DC  F N4    1 
ATOM 5752 C C5    . DC  F 3 17  ? 32.311 35.626  54.740  1.00 198.97 ? 17  DC  F C5    1 
ATOM 5753 C C6    . DC  F 3 17  ? 31.357 34.692  54.775  1.00 205.30 ? 17  DC  F C6    1 
ATOM 5754 P P     . DG  F 3 18  ? 27.835 30.398  55.450  1.00 263.35 ? 18  DG  F P     1 
ATOM 5755 O OP1   . DG  F 3 18  ? 26.870 29.287  55.295  1.00 271.99 ? 18  DG  F OP1   1 
ATOM 5756 O OP2   . DG  F 3 18  ? 28.589 30.462  56.724  1.00 266.49 ? 18  DG  F OP2   1 
ATOM 5757 O "O5'" . DG  F 3 18  ? 28.858 30.401  54.212  1.00 261.03 ? 18  DG  F "O5'" 1 
ATOM 5758 C "C5'" . DG  F 3 18  ? 28.779 29.403  53.188  1.00 263.28 ? 18  DG  F "C5'" 1 
ATOM 5759 C "C4'" . DG  F 3 18  ? 27.517 29.558  52.350  1.00 279.58 ? 18  DG  F "C4'" 1 
ATOM 5760 O "O4'" . DG  F 3 18  ? 27.332 30.943  51.978  1.00 279.72 ? 18  DG  F "O4'" 1 
ATOM 5761 C "C3'" . DG  F 3 18  ? 27.504 28.768  51.052  1.00 298.72 ? 18  DG  F "C3'" 1 
ATOM 5762 O "O3'" . DG  F 3 18  ? 26.186 28.312  50.772  1.00 295.55 ? 18  DG  F "O3'" 1 
ATOM 5763 C "C2'" . DG  F 3 18  ? 27.997 29.775  50.009  1.00 306.53 ? 18  DG  F "C2'" 1 
ATOM 5764 C "C1'" . DG  F 3 18  ? 27.634 31.136  50.609  1.00 299.74 ? 18  DG  F "C1'" 1 
ATOM 5765 N N9    . DG  F 3 18  ? 28.724 32.100  50.526  1.00 296.71 ? 18  DG  F N9    1 
ATOM 5766 C C8    . DG  F 3 18  ? 29.962 31.982  51.105  1.00 288.77 ? 18  DG  F C8    1 
ATOM 5767 N N7    . DG  F 3 18  ? 30.745 32.993  50.868  1.00 290.58 ? 18  DG  F N7    1 
ATOM 5768 C C5    . DG  F 3 18  ? 29.977 33.841  50.084  1.00 292.70 ? 18  DG  F C5    1 
ATOM 5769 C C6    . DG  F 3 18  ? 30.302 35.095  49.527  1.00 285.22 ? 18  DG  F C6    1 
ATOM 5770 O O6    . DG  F 3 18  ? 31.366 35.717  49.623  1.00 283.20 ? 18  DG  F O6    1 
ATOM 5771 N N1    . DG  F 3 18  ? 29.242 35.626  48.798  1.00 287.88 ? 18  DG  F N1    1 
ATOM 5772 C C2    . DG  F 3 18  ? 28.020 35.018  48.628  1.00 291.08 ? 18  DG  F C2    1 
ATOM 5773 N N2    . DG  F 3 18  ? 27.120 35.686  47.890  1.00 303.11 ? 18  DG  F N2    1 
ATOM 5774 N N3    . DG  F 3 18  ? 27.701 33.837  49.149  1.00 290.74 ? 18  DG  F N3    1 
ATOM 5775 C C4    . DG  F 3 18  ? 28.727 33.309  49.863  1.00 294.21 ? 18  DG  F C4    1 
ATOM 5776 P P     . DA  F 3 19  ? 25.906 27.368  49.502  1.00 253.06 ? 19  DA  F P     1 
ATOM 5777 O OP1   . DA  F 3 19  ? 24.888 26.373  49.904  1.00 235.02 ? 19  DA  F OP1   1 
ATOM 5778 O OP2   . DA  F 3 19  ? 27.208 26.905  48.972  1.00 264.76 ? 19  DA  F OP2   1 
ATOM 5779 O "O5'" . DA  F 3 19  ? 25.262 28.367  48.435  1.00 267.18 ? 19  DA  F "O5'" 1 
ATOM 5780 C "C5'" . DA  F 3 19  ? 24.818 27.888  47.172  1.00 297.75 ? 19  DA  F "C5'" 1 
ATOM 5781 C "C4'" . DA  F 3 19  ? 24.298 29.041  46.335  1.00 307.47 ? 19  DA  F "C4'" 1 
ATOM 5782 O "O4'" . DA  F 3 19  ? 25.163 30.184  46.528  1.00 307.88 ? 19  DA  F "O4'" 1 
ATOM 5783 C "C3'" . DA  F 3 19  ? 24.288 28.800  44.834  1.00 311.14 ? 19  DA  F "C3'" 1 
ATOM 5784 O "O3'" . DA  F 3 19  ? 23.315 29.637  44.209  1.00 326.59 ? 19  DA  F "O3'" 1 
ATOM 5785 C "C2'" . DA  F 3 19  ? 25.704 29.195  44.436  1.00 309.25 ? 19  DA  F "C2'" 1 
ATOM 5786 C "C1'" . DA  F 3 19  ? 26.022 30.331  45.414  1.00 315.32 ? 19  DA  F "C1'" 1 
ATOM 5787 N N9    . DA  F 3 19  ? 27.407 30.309  45.877  1.00 313.33 ? 19  DA  F N9    1 
ATOM 5788 C C8    . DA  F 3 19  ? 28.058 29.273  46.488  1.00 303.95 ? 19  DA  F C8    1 
ATOM 5789 N N7    . DA  F 3 19  ? 29.312 29.533  46.779  1.00 292.15 ? 19  DA  F N7    1 
ATOM 5790 C C5    . DA  F 3 19  ? 29.496 30.828  46.322  1.00 297.58 ? 19  DA  F C5    1 
ATOM 5791 C C6    . DA  F 3 19  ? 30.610 31.691  46.329  1.00 288.05 ? 19  DA  F C6    1 
ATOM 5792 N N6    . DA  F 3 19  ? 31.802 31.356  46.838  1.00 286.59 ? 19  DA  F N6    1 
ATOM 5793 N N1    . DA  F 3 19  ? 30.452 32.917  45.792  1.00 286.66 ? 19  DA  F N1    1 
ATOM 5794 C C2    . DA  F 3 19  ? 29.261 33.252  45.285  1.00 297.48 ? 19  DA  F C2    1 
ATOM 5795 N N3    . DA  F 3 19  ? 28.146 32.531  45.220  1.00 310.99 ? 19  DA  F N3    1 
ATOM 5796 C C4    . DA  F 3 19  ? 28.332 31.318  45.761  1.00 306.55 ? 19  DA  F C4    1 
ATOM 5797 P P     . DG  F 3 20  ? 23.112 29.603  42.613  1.00 349.58 ? 20  DG  F P     1 
ATOM 5798 O OP1   . DG  F 3 20  ? 21.711 29.988  42.335  1.00 349.34 ? 20  DG  F OP1   1 
ATOM 5799 O OP2   . DG  F 3 20  ? 23.631 28.310  42.113  1.00 353.15 ? 20  DG  F OP2   1 
ATOM 5800 O "O5'" . DG  F 3 20  ? 24.078 30.760  42.078  1.00 339.06 ? 20  DG  F "O5'" 1 
ATOM 5801 C "C5'" . DG  F 3 20  ? 24.061 31.142  40.702  1.00 341.04 ? 20  DG  F "C5'" 1 
ATOM 5802 C "C4'" . DG  F 3 20  ? 24.732 32.492  40.524  1.00 334.13 ? 20  DG  F "C4'" 1 
ATOM 5803 O "O4'" . DG  F 3 20  ? 25.572 32.743  41.670  1.00 306.85 ? 20  DG  F "O4'" 1 
ATOM 5804 C "C3'" . DG  F 3 20  ? 25.636 32.611  39.301  1.00 344.53 ? 20  DG  F "C3'" 1 
ATOM 5805 O "O3'" . DG  F 3 20  ? 24.905 33.181  38.214  1.00 360.66 ? 20  DG  F "O3'" 1 
ATOM 5806 C "C2'" . DG  F 3 20  ? 26.745 33.554  39.765  1.00 327.85 ? 20  DG  F "C2'" 1 
ATOM 5807 C "C1'" . DG  F 3 20  ? 26.775 33.365  41.279  1.00 302.14 ? 20  DG  F "C1'" 1 
ATOM 5808 N N9    . DG  F 3 20  ? 27.895 32.559  41.754  1.00 290.36 ? 20  DG  F N9    1 
ATOM 5809 C C8    . DG  F 3 20  ? 27.848 31.280  42.252  1.00 288.80 ? 20  DG  F C8    1 
ATOM 5810 N N7    . DG  F 3 20  ? 29.016 30.818  42.607  1.00 284.96 ? 20  DG  F N7    1 
ATOM 5811 C C5    . DG  F 3 20  ? 29.891 31.860  42.327  1.00 280.03 ? 20  DG  F C5    1 
ATOM 5812 C C6    . DG  F 3 20  ? 31.293 31.949  42.501  1.00 274.11 ? 20  DG  F C6    1 
ATOM 5813 O O6    . DG  F 3 20  ? 32.068 31.093  42.952  1.00 266.49 ? 20  DG  F O6    1 
ATOM 5814 N N1    . DG  F 3 20  ? 31.785 33.185  42.089  1.00 274.82 ? 20  DG  F N1    1 
ATOM 5815 C C2    . DG  F 3 20  ? 31.018 34.205  41.575  1.00 276.87 ? 20  DG  F C2    1 
ATOM 5816 N N2    . DG  F 3 20  ? 31.660 35.328  41.230  1.00 273.07 ? 20  DG  F N2    1 
ATOM 5817 N N3    . DG  F 3 20  ? 29.707 34.133  41.409  1.00 279.96 ? 20  DG  F N3    1 
ATOM 5818 C C4    . DG  F 3 20  ? 29.214 32.938  41.804  1.00 283.67 ? 20  DG  F C4    1 
ATOM 5819 P P     . DT  F 3 21  ? 25.421 33.013  36.700  1.00 305.05 ? 21  DT  F P     1 
ATOM 5820 O OP1   . DT  F 3 21  ? 24.431 33.673  35.821  1.00 306.73 ? 21  DT  F OP1   1 
ATOM 5821 O OP2   . DT  F 3 21  ? 25.752 31.586  36.497  1.00 293.18 ? 21  DT  F OP2   1 
ATOM 5822 O "O5'" . DT  F 3 21  ? 26.774 33.872  36.638  1.00 301.55 ? 21  DT  F "O5'" 1 
ATOM 5823 C "C5'" . DT  F 3 21  ? 26.728 35.297  36.737  1.00 303.13 ? 21  DT  F "C5'" 1 
ATOM 5824 C "C4'" . DT  F 3 21  ? 28.132 35.878  36.816  1.00 297.47 ? 21  DT  F "C4'" 1 
ATOM 5825 O "O4'" . DT  F 3 21  ? 28.897 35.161  37.813  1.00 294.10 ? 21  DT  F "O4'" 1 
ATOM 5826 C "C3'" . DT  F 3 21  ? 28.932 35.798  35.514  1.00 282.75 ? 21  DT  F "C3'" 1 
ATOM 5827 O "O3'" . DT  F 3 21  ? 29.245 37.106  35.048  1.00 271.23 ? 21  DT  F "O3'" 1 
ATOM 5828 C "C2'" . DT  F 3 21  ? 30.197 35.005  35.872  1.00 284.99 ? 21  DT  F "C2'" 1 
ATOM 5829 C "C1'" . DT  F 3 21  ? 30.234 35.050  37.394  1.00 286.95 ? 21  DT  F "C1'" 1 
ATOM 5830 N N1    . DT  F 3 21  ? 30.806 33.808  38.002  1.00 283.27 ? 21  DT  F N1    1 
ATOM 5831 C C2    . DT  F 3 21  ? 32.159 33.734  38.272  1.00 276.82 ? 21  DT  F C2    1 
ATOM 5832 O O2    . DT  F 3 21  ? 32.938 34.643  38.046  1.00 273.95 ? 21  DT  F O2    1 
ATOM 5833 N N3    . DT  F 3 21  ? 32.565 32.543  38.825  1.00 271.99 ? 21  DT  F N3    1 
ATOM 5834 C C4    . DT  F 3 21  ? 31.772 31.448  39.123  1.00 271.96 ? 21  DT  F C4    1 
ATOM 5835 O O4    . DT  F 3 21  ? 32.224 30.421  39.618  1.00 270.93 ? 21  DT  F O4    1 
ATOM 5836 C C5    . DT  F 3 21  ? 30.371 31.596  38.812  1.00 281.69 ? 21  DT  F C5    1 
ATOM 5837 C C7    . DT  F 3 21  ? 29.416 30.474  39.092  1.00 285.28 ? 21  DT  F C7    1 
ATOM 5838 C C6    . DT  F 3 21  ? 29.963 32.752  38.273  1.00 284.18 ? 21  DT  F C6    1 
ATOM 5839 P P     . DC  F 3 22  ? 29.710 37.328  33.525  1.00 264.57 ? 22  DC  F P     1 
ATOM 5840 O OP1   . DC  F 3 22  ? 29.382 38.721  33.150  1.00 266.53 ? 22  DC  F OP1   1 
ATOM 5841 O OP2   . DC  F 3 22  ? 29.168 36.207  32.726  1.00 245.25 ? 22  DC  F OP2   1 
ATOM 5842 O "O5'" . DC  F 3 22  ? 31.305 37.200  33.588  1.00 264.25 ? 22  DC  F "O5'" 1 
ATOM 5843 C "C5'" . DC  F 3 22  ? 32.057 38.115  34.377  1.00 263.34 ? 22  DC  F "C5'" 1 
ATOM 5844 C "C4'" . DC  F 3 22  ? 33.549 37.850  34.255  1.00 253.29 ? 22  DC  F "C4'" 1 
ATOM 5845 O "O4'" . DC  F 3 22  ? 33.914 36.692  35.054  1.00 250.78 ? 22  DC  F "O4'" 1 
ATOM 5846 C "C3'" . DC  F 3 22  ? 34.049 37.563  32.838  1.00 249.98 ? 22  DC  F "C3'" 1 
ATOM 5847 O "O3'" . DC  F 3 22  ? 35.292 38.220  32.631  1.00 253.31 ? 22  DC  F "O3'" 1 
ATOM 5848 C "C2'" . DC  F 3 22  ? 34.217 36.046  32.842  1.00 244.45 ? 22  DC  F "C2'" 1 
ATOM 5849 C "C1'" . DC  F 3 22  ? 34.682 35.810  34.268  1.00 246.67 ? 22  DC  F "C1'" 1 
ATOM 5850 N N1    . DC  F 3 22  ? 34.449 34.422  34.756  1.00 245.15 ? 22  DC  F N1    1 
ATOM 5851 C C2    . DC  F 3 22  ? 35.522 33.664  35.248  1.00 245.52 ? 22  DC  F C2    1 
ATOM 5852 O O2    . DC  F 3 22  ? 36.655 34.163  35.266  1.00 246.57 ? 22  DC  F O2    1 
ATOM 5853 N N3    . DC  F 3 22  ? 35.283 32.403  35.692  1.00 241.12 ? 22  DC  F N3    1 
ATOM 5854 C C4    . DC  F 3 22  ? 34.043 31.907  35.655  1.00 238.57 ? 22  DC  F C4    1 
ATOM 5855 N N4    . DC  F 3 22  ? 33.849 30.662  36.100  1.00 237.09 ? 22  DC  F N4    1 
ATOM 5856 C C5    . DC  F 3 22  ? 32.945 32.665  35.157  1.00 239.19 ? 22  DC  F C5    1 
ATOM 5857 C C6    . DC  F 3 22  ? 33.192 33.903  34.723  1.00 240.57 ? 22  DC  F C6    1 
ATOM 5858 P P     . DC  F 3 23  ? 35.809 38.548  31.145  1.00 270.37 ? 23  DC  F P     1 
ATOM 5859 O OP1   . DC  F 3 23  ? 35.460 39.956  30.853  1.00 277.68 ? 23  DC  F OP1   1 
ATOM 5860 O OP2   . DC  F 3 23  ? 35.344 37.473  30.240  1.00 251.10 ? 23  DC  F OP2   1 
ATOM 5861 O "O5'" . DC  F 3 23  ? 37.398 38.432  31.270  1.00 255.23 ? 23  DC  F "O5'" 1 
ATOM 5862 C "C5'" . DC  F 3 23  ? 37.980 37.943  32.474  1.00 257.71 ? 23  DC  F "C5'" 1 
ATOM 5863 C "C4'" . DC  F 3 23  ? 39.106 36.974  32.170  1.00 257.41 ? 23  DC  F "C4'" 1 
ATOM 5864 O "O4'" . DC  F 3 23  ? 38.776 35.662  32.707  1.00 249.29 ? 23  DC  F "O4'" 1 
ATOM 5865 C "C3'" . DC  F 3 23  ? 39.376 36.759  30.682  1.00 252.17 ? 23  DC  F "C3'" 1 
ATOM 5866 O "O3'" . DC  F 3 23  ? 40.768 36.581  30.458  1.00 254.59 ? 23  DC  F "O3'" 1 
ATOM 5867 C "C2'" . DC  F 3 23  ? 38.602 35.482  30.391  1.00 246.20 ? 23  DC  F "C2'" 1 
ATOM 5868 C "C1'" . DC  F 3 23  ? 38.846 34.706  31.673  1.00 245.48 ? 23  DC  F "C1'" 1 
ATOM 5869 N N1    . DC  F 3 23  ? 37.836 33.643  31.927  1.00 240.84 ? 23  DC  F N1    1 
ATOM 5870 C C2    . DC  F 3 23  ? 38.236 32.423  32.484  1.00 239.48 ? 23  DC  F C2    1 
ATOM 5871 O O2    . DC  F 3 23  ? 39.429 32.254  32.765  1.00 242.18 ? 23  DC  F O2    1 
ATOM 5872 N N3    . DC  F 3 23  ? 37.300 31.464  32.701  1.00 235.87 ? 23  DC  F N3    1 
ATOM 5873 C C4    . DC  F 3 23  ? 36.025 31.693  32.381  1.00 233.42 ? 23  DC  F C4    1 
ATOM 5874 N N4    . DC  F 3 23  ? 35.134 30.723  32.610  1.00 230.24 ? 23  DC  F N4    1 
ATOM 5875 C C5    . DC  F 3 23  ? 35.604 32.928  31.808  1.00 234.82 ? 23  DC  F C5    1 
ATOM 5876 C C6    . DC  F 3 23  ? 36.533 33.862  31.598  1.00 238.63 ? 23  DC  F C6    1 
ATOM 5877 P P     . DG  F 3 24  ? 41.393 36.875  29.008  1.00 256.91 ? 24  DG  F P     1 
ATOM 5878 O OP1   . DG  F 3 24  ? 41.289 38.330  28.761  1.00 261.88 ? 24  DG  F OP1   1 
ATOM 5879 O OP2   . DG  F 3 24  ? 40.788 35.920  28.053  1.00 256.79 ? 24  DG  F OP2   1 
ATOM 5880 O "O5'" . DG  F 3 24  ? 42.940 36.511  29.172  1.00 260.05 ? 24  DG  F "O5'" 1 
ATOM 5881 C "C5'" . DG  F 3 24  ? 43.493 35.432  28.432  1.00 258.73 ? 24  DG  F "C5'" 1 
ATOM 5882 C "C4'" . DG  F 3 24  ? 43.759 34.238  29.331  1.00 256.35 ? 24  DG  F "C4'" 1 
ATOM 5883 O "O4'" . DG  F 3 24  ? 42.512 33.763  29.907  1.00 251.30 ? 24  DG  F "O4'" 1 
ATOM 5884 C "C3'" . DG  F 3 24  ? 44.400 33.037  28.633  1.00 255.92 ? 24  DG  F "C3'" 1 
ATOM 5885 O "O3'" . DG  F 3 24  ? 45.565 32.619  29.370  1.00 259.44 ? 24  DG  F "O3'" 1 
ATOM 5886 C "C2'" . DG  F 3 24  ? 43.284 31.986  28.613  1.00 249.77 ? 24  DG  F "C2'" 1 
ATOM 5887 C "C1'" . DG  F 3 24  ? 42.456 32.357  29.829  1.00 248.43 ? 24  DG  F "C1'" 1 
ATOM 5888 N N9    . DG  F 3 24  ? 41.051 31.965  29.713  1.00 242.78 ? 24  DG  F N9    1 
ATOM 5889 C C8    . DG  F 3 24  ? 40.032 32.738  29.222  1.00 241.32 ? 24  DG  F C8    1 
ATOM 5890 N N7    . DG  F 3 24  ? 38.873 32.147  29.235  1.00 238.28 ? 24  DG  F N7    1 
ATOM 5891 C C5    . DG  F 3 24  ? 39.134 30.890  29.760  1.00 235.18 ? 24  DG  F C5    1 
ATOM 5892 C C6    . DG  F 3 24  ? 38.253 29.812  30.006  1.00 231.07 ? 24  DG  F C6    1 
ATOM 5893 O O6    . DG  F 3 24  ? 37.035 29.763  29.795  1.00 227.68 ? 24  DG  F O6    1 
ATOM 5894 N N1    . DG  F 3 24  ? 38.914 28.713  30.547  1.00 231.80 ? 24  DG  F N1    1 
ATOM 5895 C C2    . DG  F 3 24  ? 40.261 28.663  30.821  1.00 236.02 ? 24  DG  F C2    1 
ATOM 5896 N N2    . DG  F 3 24  ? 40.719 27.512  31.341  1.00 237.00 ? 24  DG  F N2    1 
ATOM 5897 N N3    . DG  F 3 24  ? 41.106 29.673  30.593  1.00 239.69 ? 24  DG  F N3    1 
ATOM 5898 C C4    . DG  F 3 24  ? 40.471 30.754  30.065  1.00 238.98 ? 24  DG  F C4    1 
ATOM 5899 P P     . DA  F 3 25  ? 46.018 31.076  29.464  1.00 258.81 ? 25  DA  F P     1 
ATOM 5900 O OP1   . DA  F 3 25  ? 45.169 30.446  30.501  1.00 265.53 ? 25  DA  F OP1   1 
ATOM 5901 O OP2   . DA  F 3 25  ? 47.487 31.070  29.641  1.00 277.93 ? 25  DA  F OP2   1 
ATOM 5902 O "O5'" . DA  F 3 25  ? 45.700 30.459  28.018  1.00 259.79 ? 25  DA  F "O5'" 1 
ATOM 5903 C "C5'" . DA  F 3 25  ? 46.331 29.250  27.590  1.00 273.25 ? 25  DA  F "C5'" 1 
ATOM 5904 C "C4'" . DA  F 3 25  ? 46.084 28.117  28.572  1.00 256.00 ? 25  DA  F "C4'" 1 
ATOM 5905 O "O4'" . DA  F 3 25  ? 44.737 28.218  29.109  1.00 250.37 ? 25  DA  F "O4'" 1 
ATOM 5906 C "C3'" . DA  F 3 25  ? 46.171 26.723  27.975  1.00 255.64 ? 25  DA  F "C3'" 1 
ATOM 5907 O "O3'" . DA  F 3 25  ? 46.574 25.793  28.982  1.00 257.66 ? 25  DA  F "O3'" 1 
ATOM 5908 C "C2'" . DA  F 3 25  ? 44.736 26.491  27.520  1.00 269.39 ? 25  DA  F "C2'" 1 
ATOM 5909 C "C1'" . DA  F 3 25  ? 43.945 27.144  28.641  1.00 246.13 ? 25  DA  F "C1'" 1 
ATOM 5910 N N9    . DA  F 3 25  ? 42.657 27.683  28.214  1.00 241.16 ? 25  DA  F N9    1 
ATOM 5911 C C8    . DA  F 3 25  ? 42.407 28.954  27.788  1.00 241.49 ? 25  DA  F C8    1 
ATOM 5912 N N7    . DA  F 3 25  ? 41.156 29.175  27.472  1.00 237.17 ? 25  DA  F N7    1 
ATOM 5913 C C5    . DA  F 3 25  ? 40.537 27.961  27.705  1.00 233.40 ? 25  DA  F C5    1 
ATOM 5914 C C6    . DA  F 3 25  ? 39.203 27.539  27.563  1.00 231.89 ? 25  DA  F C6    1 
ATOM 5915 N N6    . DA  F 3 25  ? 38.224 28.339  27.129  1.00 250.96 ? 25  DA  F N6    1 
ATOM 5916 N N1    . DA  F 3 25  ? 38.912 26.262  27.882  1.00 226.11 ? 25  DA  F N1    1 
ATOM 5917 C C2    . DA  F 3 25  ? 39.897 25.465  28.316  1.00 229.25 ? 25  DA  F C2    1 
ATOM 5918 N N3    . DA  F 3 25  ? 41.189 25.749  28.492  1.00 234.29 ? 25  DA  F N3    1 
ATOM 5919 C C4    . DA  F 3 25  ? 41.445 27.027  28.167  1.00 235.93 ? 25  DA  F C4    1 
ATOM 5920 P P     . DC  F 3 26  ? 46.391 24.208  28.775  1.00 257.01 ? 26  DC  F P     1 
ATOM 5921 O OP1   . DC  F 3 26  ? 45.087 23.852  29.379  1.00 256.33 ? 26  DC  F OP1   1 
ATOM 5922 O OP2   . DC  F 3 26  ? 47.623 23.551  29.267  1.00 280.64 ? 26  DC  F OP2   1 
ATOM 5923 O "O5'" . DC  F 3 26  ? 46.341 24.010  27.186  1.00 256.33 ? 26  DC  F "O5'" 1 
ATOM 5924 C "C5'" . DC  F 3 26  ? 46.433 22.706  26.614  1.00 257.34 ? 26  DC  F "C5'" 1 
ATOM 5925 C "C4'" . DC  F 3 26  ? 45.211 21.863  26.946  1.00 251.61 ? 26  DC  F "C4'" 1 
ATOM 5926 O "O4'" . DC  F 3 26  ? 44.039 22.715  27.083  1.00 245.38 ? 26  DC  F "O4'" 1 
ATOM 5927 C "C3'" . DC  F 3 26  ? 44.850 20.819  25.892  1.00 256.74 ? 26  DC  F "C3'" 1 
ATOM 5928 O "O3'" . DC  F 3 26  ? 44.431 19.615  26.521  1.00 249.55 ? 26  DC  F "O3'" 1 
ATOM 5929 C "C2'" . DC  F 3 26  ? 43.706 21.486  25.132  1.00 273.46 ? 26  DC  F "C2'" 1 
ATOM 5930 C "C1'" . DC  F 3 26  ? 43.005 22.235  26.251  1.00 240.30 ? 26  DC  F "C1'" 1 
ATOM 5931 N N1    . DC  F 3 26  ? 42.197 23.404  25.785  1.00 236.27 ? 26  DC  F N1    1 
ATOM 5932 C C2    . DC  F 3 26  ? 40.830 23.255  25.509  1.00 230.21 ? 26  DC  F C2    1 
ATOM 5933 O O2    . DC  F 3 26  ? 40.302 22.144  25.643  1.00 227.95 ? 26  DC  F O2    1 
ATOM 5934 N N3    . DC  F 3 26  ? 40.126 24.340  25.091  1.00 237.11 ? 26  DC  F N3    1 
ATOM 5935 C C4    . DC  F 3 26  ? 40.736 25.521  24.959  1.00 233.27 ? 26  DC  F C4    1 
ATOM 5936 N N4    . DC  F 3 26  ? 40.010 26.565  24.548  1.00 229.14 ? 26  DC  F N4    1 
ATOM 5937 C C5    . DC  F 3 26  ? 42.120 25.685  25.239  1.00 236.79 ? 26  DC  F C5    1 
ATOM 5938 C C6    . DC  F 3 26  ? 42.802 24.612  25.643  1.00 240.83 ? 26  DC  F C6    1 
ATOM 5939 P P     . DG  F 3 27  ? 44.597 18.210  25.760  1.00 287.04 ? 27  DG  F P     1 
ATOM 5940 O OP1   . DG  F 3 27  ? 45.517 17.371  26.559  1.00 280.37 ? 27  DG  F OP1   1 
ATOM 5941 O OP2   . DG  F 3 27  ? 44.909 18.502  24.343  1.00 252.90 ? 27  DG  F OP2   1 
ATOM 5942 O "O5'" . DG  F 3 27  ? 43.132 17.571  25.810  1.00 267.45 ? 27  DG  F "O5'" 1 
ATOM 5943 C "C5'" . DG  F 3 27  ? 42.003 18.366  25.477  1.00 238.03 ? 27  DG  F "C5'" 1 
ATOM 5944 C "C4'" . DG  F 3 27  ? 40.939 17.536  24.787  1.00 233.33 ? 27  DG  F "C4'" 1 
ATOM 5945 O "O4'" . DG  F 3 27  ? 39.903 18.415  24.294  1.00 237.11 ? 27  DG  F "O4'" 1 
ATOM 5946 C "C3'" . DG  F 3 27  ? 41.413 16.789  23.558  1.00 236.07 ? 27  DG  F "C3'" 1 
ATOM 5947 O "O3'" . DG  F 3 27  ? 40.518 15.722  23.269  1.00 232.85 ? 27  DG  F "O3'" 1 
ATOM 5948 C "C2'" . DG  F 3 27  ? 41.348 17.876  22.492  1.00 246.79 ? 27  DG  F "C2'" 1 
ATOM 5949 C "C1'" . DG  F 3 27  ? 40.102 18.660  22.912  1.00 227.39 ? 27  DG  F "C1'" 1 
ATOM 5950 N N9    . DG  F 3 27  ? 40.231 20.100  22.716  1.00 227.26 ? 27  DG  F N9    1 
ATOM 5951 C C8    . DG  F 3 27  ? 41.358 20.861  22.897  1.00 232.42 ? 27  DG  F C8    1 
ATOM 5952 N N7    . DG  F 3 27  ? 41.177 22.127  22.650  1.00 231.53 ? 27  DG  F N7    1 
ATOM 5953 C C5    . DG  F 3 27  ? 39.842 22.212  22.280  1.00 225.52 ? 27  DG  F C5    1 
ATOM 5954 C C6    . DG  F 3 27  ? 39.072 23.334  21.897  1.00 222.87 ? 27  DG  F C6    1 
ATOM 5955 O O6    . DG  F 3 27  ? 39.431 24.515  21.807  1.00 225.43 ? 27  DG  F O6    1 
ATOM 5956 N N1    . DG  F 3 27  ? 37.760 22.980  21.600  1.00 217.27 ? 27  DG  F N1    1 
ATOM 5957 C C2    . DG  F 3 27  ? 37.256 21.702  21.666  1.00 214.40 ? 27  DG  F C2    1 
ATOM 5958 N N2    . DG  F 3 27  ? 35.965 21.548  21.343  1.00 234.50 ? 27  DG  F N2    1 
ATOM 5959 N N3    . DG  F 3 27  ? 37.968 20.643  22.024  1.00 217.03 ? 27  DG  F N3    1 
ATOM 5960 C C4    . DG  F 3 27  ? 39.247 20.971  22.315  1.00 222.64 ? 27  DG  F C4    1 
ATOM 5961 P P     . DA  F 3 28  ? 40.813 14.719  22.047  1.00 266.02 ? 28  DA  F P     1 
ATOM 5962 O OP1   . DA  F 3 28  ? 40.374 13.370  22.469  1.00 253.32 ? 28  DA  F OP1   1 
ATOM 5963 O OP2   . DA  F 3 28  ? 42.208 14.930  21.600  1.00 262.50 ? 28  DA  F OP2   1 
ATOM 5964 O "O5'" . DA  F 3 28  ? 39.819 15.215  20.896  1.00 259.38 ? 28  DA  F "O5'" 1 
ATOM 5965 C "C5'" . DA  F 3 28  ? 38.411 15.172  21.108  1.00 237.85 ? 28  DA  F "C5'" 1 
ATOM 5966 C "C4'" . DA  F 3 28  ? 37.671 15.933  20.021  1.00 223.24 ? 28  DA  F "C4'" 1 
ATOM 5967 O "O4'" . DA  F 3 28  ? 38.004 17.346  20.098  1.00 218.14 ? 28  DA  F "O4'" 1 
ATOM 5968 C "C3'" . DA  F 3 28  ? 37.996 15.503  18.586  1.00 219.91 ? 28  DA  F "C3'" 1 
ATOM 5969 O "O3'" . DA  F 3 28  ? 36.804 15.495  17.806  1.00 242.84 ? 28  DA  F "O3'" 1 
ATOM 5970 C "C2'" . DA  F 3 28  ? 38.957 16.591  18.119  1.00 230.54 ? 28  DA  F "C2'" 1 
ATOM 5971 C "C1'" . DA  F 3 28  ? 38.362 17.800  18.814  1.00 220.16 ? 28  DA  F "C1'" 1 
ATOM 5972 N N9    . DA  F 3 28  ? 39.283 18.923  18.947  1.00 224.34 ? 28  DA  F N9    1 
ATOM 5973 C C8    . DA  F 3 28  ? 40.594 18.883  19.332  1.00 230.80 ? 28  DA  F C8    1 
ATOM 5974 N N7    . DA  F 3 28  ? 41.172 20.061  19.358  1.00 233.52 ? 28  DA  F N7    1 
ATOM 5975 C C5    . DA  F 3 28  ? 40.170 20.931  18.961  1.00 228.82 ? 28  DA  F C5    1 
ATOM 5976 C C6    . DA  F 3 28  ? 40.136 22.328  18.782  1.00 229.45 ? 28  DA  F C6    1 
ATOM 5977 N N6    . DA  F 3 28  ? 41.189 23.126  18.992  1.00 234.90 ? 28  DA  F N6    1 
ATOM 5978 N N1    . DA  F 3 28  ? 38.973 22.875  18.377  1.00 224.83 ? 28  DA  F N1    1 
ATOM 5979 C C2    . DA  F 3 28  ? 37.922 22.078  18.168  1.00 219.57 ? 28  DA  F C2    1 
ATOM 5980 N N3    . DA  F 3 28  ? 37.832 20.760  18.301  1.00 218.16 ? 28  DA  F N3    1 
ATOM 5981 C C4    . DA  F 3 28  ? 39.001 20.243  18.704  1.00 223.15 ? 28  DA  F C4    1 
ATOM 5982 P P     . DT  F 3 29  ? 36.726 14.640  16.447  1.00 250.09 ? 29  DT  F P     1 
ATOM 5983 O OP1   . DT  F 3 29  ? 35.345 14.755  15.927  1.00 251.44 ? 29  DT  F OP1   1 
ATOM 5984 O OP2   . DT  F 3 29  ? 37.287 13.302  16.734  1.00 234.75 ? 29  DT  F OP2   1 
ATOM 5985 O "O5'" . DT  F 3 29  ? 37.737 15.392  15.458  1.00 232.51 ? 29  DT  F "O5'" 1 
ATOM 5986 C "C5'" . DT  F 3 29  ? 37.275 15.919  14.219  1.00 219.83 ? 29  DT  F "C5'" 1 
ATOM 5987 C "C4'" . DT  F 3 29  ? 36.580 17.254  14.421  1.00 215.70 ? 29  DT  F "C4'" 1 
ATOM 5988 O "O4'" . DT  F 3 29  ? 37.435 18.138  15.193  1.00 219.04 ? 29  DT  F "O4'" 1 
ATOM 5989 C "C3'" . DT  F 3 29  ? 36.240 18.007  13.129  1.00 247.82 ? 29  DT  F "C3'" 1 
ATOM 5990 O "O3'" . DT  F 3 29  ? 34.902 18.485  13.181  1.00 250.15 ? 29  DT  F "O3'" 1 
ATOM 5991 C "C2'" . DT  F 3 29  ? 37.246 19.158  13.112  1.00 240.85 ? 29  DT  F "C2'" 1 
ATOM 5992 C "C1'" . DT  F 3 29  ? 37.432 19.411  14.597  1.00 220.33 ? 29  DT  F "C1'" 1 
ATOM 5993 N N1    . DT  F 3 29  ? 38.708 20.102  14.932  1.00 226.64 ? 29  DT  F N1    1 
ATOM 5994 C C2    . DT  F 3 29  ? 38.784 21.468  14.796  1.00 228.24 ? 29  DT  F C2    1 
ATOM 5995 O O2    . DT  F 3 29  ? 37.855 22.153  14.409  1.00 225.10 ? 29  DT  F O2    1 
ATOM 5996 N N3    . DT  F 3 29  ? 39.994 22.011  15.130  1.00 234.30 ? 29  DT  F N3    1 
ATOM 5997 C C4    . DT  F 3 29  ? 41.115 21.336  15.579  1.00 238.94 ? 29  DT  F C4    1 
ATOM 5998 O O4    . DT  F 3 29  ? 42.160 21.914  15.856  1.00 244.50 ? 29  DT  F O4    1 
ATOM 5999 C C5    . DT  F 3 29  ? 40.967 19.904  15.700  1.00 237.37 ? 29  DT  F C5    1 
ATOM 6000 C C7    . DT  F 3 29  ? 42.115 19.066  16.177  1.00 243.11 ? 29  DT  F C7    1 
ATOM 6001 C C6    . DT  F 3 29  ? 39.784 19.363  15.375  1.00 231.32 ? 29  DT  F C6    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 1.4497 1.6261 1.1491 0.1720  0.0602  -0.2711 1   MET A N     
2    C CA    . MET A 1   ? 1.4319 1.5844 1.1484 0.1818  0.0240  -0.2154 1   MET A CA    
3    C C     . MET A 1   ? 1.3413 1.4748 1.1575 0.1950  0.0013  -0.2210 1   MET A C     
4    O O     . MET A 1   ? 1.3492 1.4785 1.1962 0.1974  -0.0228 -0.2476 1   MET A O     
5    C CB    . MET A 1   ? 1.5518 1.7036 1.2035 0.1774  -0.0126 -0.1953 1   MET A CB    
6    C CG    . MET A 1   ? 1.6943 1.8560 1.2429 0.1630  -0.0072 -0.1641 1   MET A CG    
7    S SD    . MET A 1   ? 2.4637 2.6097 2.0150 0.1655  0.0015  -0.0950 1   MET A SD    
8    C CE    . MET A 1   ? 2.6940 2.8460 2.1268 0.1466  -0.0143 -0.0543 1   MET A CE    
9    N N     . ILE A 2   ? 1.2912 1.4122 1.1563 0.2009  0.0060  -0.1941 2   ILE A N     
10   C CA    . ILE A 2   ? 1.3285 1.4285 1.2618 0.2076  -0.0230 -0.1796 2   ILE A CA    
11   C C     . ILE A 2   ? 1.4152 1.5062 1.3156 0.2066  -0.0413 -0.1332 2   ILE A C     
12   O O     . ILE A 2   ? 1.2504 1.3409 1.1278 0.2061  -0.0285 -0.1040 2   ILE A O     
13   C CB    . ILE A 2   ? 1.1490 1.2416 1.1513 0.2115  -0.0139 -0.1788 2   ILE A CB    
14   C CG1   . ILE A 2   ? 1.3350 1.4375 1.4013 0.2149  0.0007  -0.2313 2   ILE A CG1   
15   C CG2   . ILE A 2   ? 1.1978 1.2676 1.2426 0.2120  -0.0471 -0.1499 2   ILE A CG2   
16   C CD1   . ILE A 2   ? 1.1731 1.2632 1.2975 0.2184  -0.0292 -0.2574 2   ILE A CD1   
17   N N     . ILE A 3   ? 1.5284 1.6135 1.4386 0.2057  -0.0697 -0.1297 3   ILE A N     
18   C CA    . ILE A 3   ? 1.3653 1.4490 1.2558 0.2043  -0.0841 -0.0956 3   ILE A CA    
19   C C     . ILE A 3   ? 1.2072 1.2772 1.1436 0.2005  -0.0956 -0.0773 3   ILE A C     
20   O O     . ILE A 3   ? 1.2906 1.3503 1.2698 0.1969  -0.1099 -0.0882 3   ILE A O     
21   C CB    . ILE A 3   ? 1.1614 1.2550 1.0281 0.2025  -0.1063 -0.1052 3   ILE A CB    
22   C CG1   . ILE A 3   ? 1.4061 1.5139 1.2055 0.2003  -0.0969 -0.1190 3   ILE A CG1   
23   C CG2   . ILE A 3   ? 1.1426 1.2380 1.0140 0.2023  -0.1214 -0.0738 3   ILE A CG2   
24   C CD1   . ILE A 3   ? 1.6553 1.7737 1.4182 0.1966  -0.1262 -0.1213 3   ILE A CD1   
25   N N     . CYS A 4   ? 1.3878 1.4574 1.3154 0.1990  -0.0892 -0.0497 4   CYS A N     
26   C CA    . CYS A 4   ? 1.2722 1.3337 1.2240 0.1897  -0.0941 -0.0327 4   CYS A CA    
27   C C     . CYS A 4   ? 1.4651 1.5378 1.4141 0.1870  -0.0943 -0.0193 4   CYS A C     
28   O O     . CYS A 4   ? 1.3707 1.4489 1.3084 0.1924  -0.0824 -0.0097 4   CYS A O     
29   C CB    . CYS A 4   ? 1.1752 1.2288 1.1277 0.1878  -0.0812 -0.0232 4   CYS A CB    
30   S SG    . CYS A 4   ? 1.3562 1.4047 1.3111 0.1702  -0.0836 -0.0035 4   CYS A SG    
31   N N     . SER A 5   ? 1.1543 1.2307 1.1267 0.1784  -0.1076 -0.0196 5   SER A N     
32   C CA    . SER A 5   ? 1.1725 1.2647 1.1618 0.1748  -0.1058 -0.0121 5   SER A CA    
33   C C     . SER A 5   ? 1.3780 1.4707 1.3791 0.1562  -0.0921 -0.0016 5   SER A C     
34   O O     . SER A 5   ? 1.3562 1.4365 1.3601 0.1418  -0.0996 0.0045  5   SER A O     
35   C CB    . SER A 5   ? 1.2118 1.3139 1.2245 0.1747  -0.1278 -0.0218 5   SER A CB    
36   O OG    . SER A 5   ? 1.5827 1.6747 1.6188 0.1624  -0.1390 -0.0263 5   SER A OG    
37   N N     . VAL A 6   ? 1.4010 1.5078 1.4100 0.1545  -0.0726 0.0001  6   VAL A N     
38   C CA    . VAL A 6   ? 1.1518 1.2624 1.1539 0.1339  -0.0514 0.0035  6   VAL A CA    
39   C C     . VAL A 6   ? 1.4037 1.5410 1.4454 0.1237  -0.0343 -0.0036 6   VAL A C     
40   O O     . VAL A 6   ? 1.1670 1.3195 1.2456 0.1387  -0.0298 -0.0130 6   VAL A O     
41   C CB    . VAL A 6   ? 1.0610 1.1663 1.0410 0.1385  -0.0352 0.0000  6   VAL A CB    
42   C CG1   . VAL A 6   ? 1.2255 1.3353 1.1830 0.1126  -0.0160 -0.0012 6   VAL A CG1   
43   C CG2   . VAL A 6   ? 1.0270 1.1117 0.9843 0.1501  -0.0489 0.0042  6   VAL A CG2   
44   N N     . ASP A 7   ? 1.2648 1.4081 1.3055 0.0965  -0.0251 0.0027  7   ASP A N     
45   C CA    . ASP A 7   ? 1.4024 1.5760 1.4748 0.0781  0.0062  -0.0082 7   ASP A CA    
46   C C     . ASP A 7   ? 1.2419 1.4187 1.2711 0.0609  0.0363  -0.0160 7   ASP A C     
47   O O     . ASP A 7   ? 1.2760 1.4376 1.2473 0.0376  0.0335  0.0003  7   ASP A O     
48   C CB    . ASP A 7   ? 1.4039 1.5846 1.4934 0.0515  0.0057  0.0042  7   ASP A CB    
49   C CG    . ASP A 7   ? 1.7884 2.0069 1.9158 0.0283  0.0466  -0.0105 7   ASP A CG    
50   O OD1   . ASP A 7   ? 2.0875 2.3295 2.2554 0.0419  0.0682  -0.0365 7   ASP A OD1   
51   O OD2   . ASP A 7   ? 1.9618 2.1874 2.0858 -0.0050 0.0587  0.0035  7   ASP A OD2   
52   N N     . ILE A 8   ? 1.9181 2.1137 1.9797 0.0718  0.0606  -0.0416 8   ILE A N     
53   C CA    . ILE A 8   ? 1.1068 1.3056 1.1350 0.0602  0.0878  -0.0599 8   ILE A CA    
54   C C     . ILE A 8   ? 1.3062 1.5362 1.3272 0.0232  0.1302  -0.0777 8   ILE A C     
55   O O     . ILE A 8   ? 1.7245 1.9809 1.7970 0.0141  0.1466  -0.0836 8   ILE A O     
56   C CB    . ILE A 8   ? 1.0828 1.2838 1.1615 0.0892  0.0934  -0.0819 8   ILE A CB    
57   C CG1   . ILE A 8   ? 1.9010 2.0781 1.9904 0.1213  0.0551  -0.0601 8   ILE A CG1   
58   C CG2   . ILE A 8   ? 1.1043 1.2992 1.1457 0.0803  0.1115  -0.1010 8   ILE A CG2   
59   C CD1   . ILE A 8   ? 1.6030 1.7932 1.7625 0.1408  0.0399  -0.0580 8   ILE A CD1   
60   N N     . GLY A 9   ? 1.1936 1.4234 1.1497 -0.0009 0.1496  -0.0888 9   GLY A N     
61   C CA    . GLY A 9   ? 1.6608 1.9215 1.5851 -0.0433 0.1947  -0.1083 9   GLY A CA    
62   C C     . GLY A 9   ? 1.6776 1.9229 1.4945 -0.0732 0.1906  -0.1004 9   GLY A C     
63   O O     . GLY A 9   ? 1.3594 1.5692 1.1292 -0.0697 0.1461  -0.0629 9   GLY A O     
64   N N     . ILE A 10  ? 2.0594 2.3322 1.8422 -0.1023 0.2350  -0.1398 10  ILE A N     
65   C CA    . ILE A 10  ? 1.8578 2.1191 1.5275 -0.1365 0.2278  -0.1345 10  ILE A CA    
66   C C     . ILE A 10  ? 1.8622 2.1148 1.4452 -0.1810 0.2131  -0.0832 10  ILE A C     
67   O O     . ILE A 10  ? 1.5360 1.7551 1.0487 -0.1917 0.1665  -0.0433 10  ILE A O     
68   C CB    . ILE A 10  ? 1.6819 1.9786 1.3349 -0.1592 0.2821  -0.1989 10  ILE A CB    
69   C CG1   . ILE A 10  ? 2.1558 2.4770 1.9402 -0.1228 0.3156  -0.2503 10  ILE A CG1   
70   C CG2   . ILE A 10  ? 1.6866 1.9621 1.2686 -0.1648 0.2584  -0.2092 10  ILE A CG2   
71   C CD1   . ILE A 10  ? 2.7188 3.0745 2.5142 -0.1393 0.3703  -0.3247 10  ILE A CD1   
72   N N     . LYS A 11  ? 2.3487 2.6305 1.9454 -0.2083 0.2498  -0.0807 11  LYS A N     
73   C CA    . LYS A 11  ? 2.4810 2.7564 1.9903 -0.2603 0.2427  -0.0302 11  LYS A CA    
74   C C     . LYS A 11  ? 2.3698 2.5973 1.8901 -0.2436 0.1756  0.0341  11  LYS A C     
75   O O     . LYS A 11  ? 2.5138 2.7082 1.9567 -0.2637 0.1314  0.0778  11  LYS A O     
76   C CB    . LYS A 11  ? 2.8813 3.2018 2.4191 -0.2937 0.3028  -0.0437 11  LYS A CB    
77   C CG    . LYS A 11  ? 3.0732 3.3846 2.5319 -0.3496 0.2955  0.0180  11  LYS A CG    
78   C CD    . LYS A 11  ? 2.9424 3.3088 2.3799 -0.4041 0.3735  -0.0065 11  LYS A CD    
79   C CE    . LYS A 11  ? 2.7844 3.1806 2.1183 -0.4416 0.4190  -0.0538 11  LYS A CE    
80   N NZ    . LYS A 11  ? 2.9143 3.3680 2.2134 -0.5032 0.5017  -0.0793 11  LYS A NZ    
81   N N     . ASN A 12  ? 2.0802 2.3038 1.7018 -0.2074 0.1643  0.0382  12  ASN A N     
82   C CA    . ASN A 12  ? 2.1225 2.3048 1.7690 -0.1917 0.1068  0.0878  12  ASN A CA    
83   C C     . ASN A 12  ? 1.7250 1.8970 1.4631 -0.1324 0.0845  0.0683  12  ASN A C     
84   O O     . ASN A 12  ? 1.8405 2.0220 1.6546 -0.1160 0.0861  0.0646  12  ASN A O     
85   C CB    . ASN A 12  ? 2.5887 2.7757 2.2494 -0.2262 0.1138  0.1234  12  ASN A CB    
86   C CG    . ASN A 12  ? 2.7346 2.9717 2.4601 -0.2326 0.1728  0.0859  12  ASN A CG    
87   O OD1   . ASN A 12  ? 3.0369 3.3019 2.8125 -0.2043 0.2019  0.0341  12  ASN A OD1   
88   N ND2   . ASN A 12  ? 2.3505 2.5989 2.0870 -0.2707 0.1893  0.1135  12  ASN A ND2   
89   N N     . PRO A 13  ? 1.5607 1.7146 1.2905 -0.1023 0.0626  0.0560  13  PRO A N     
90   C CA    . PRO A 13  ? 1.5590 1.7007 1.3585 -0.0520 0.0403  0.0444  13  PRO A CA    
91   C C     . PRO A 13  ? 1.3766 1.4852 1.1955 -0.0416 -0.0068 0.0782  13  PRO A C     
92   O O     . PRO A 13  ? 1.7304 1.8144 1.5107 -0.0647 -0.0346 0.1129  13  PRO A O     
93   C CB    . PRO A 13  ? 1.4240 1.5573 1.2013 -0.0334 0.0367  0.0245  13  PRO A CB    
94   C CG    . PRO A 13  ? 1.4875 1.6109 1.1803 -0.0706 0.0281  0.0419  13  PRO A CG    
95   C CD    . PRO A 13  ? 1.5538 1.7001 1.2093 -0.1160 0.0589  0.0503  13  PRO A CD    
96   N N     . ALA A 14  ? 1.3652 1.4729 1.2478 -0.0080 -0.0182 0.0667  14  ALA A N     
97   C CA    . ALA A 14  ? 1.2902 1.3704 1.2022 0.0034  -0.0581 0.0856  14  ALA A CA    
98   C C     . ALA A 14  ? 1.1747 1.2502 1.1196 0.0451  -0.0709 0.0632  14  ALA A C     
99   O O     . ALA A 14  ? 1.5819 1.6766 1.5398 0.0641  -0.0520 0.0405  14  ALA A O     
100  C CB    . ALA A 14  ? 1.3233 1.4096 1.2772 -0.0129 -0.0598 0.0974  14  ALA A CB    
101  N N     . TYR A 15  ? 1.2849 1.3347 1.2459 0.0573  -0.1031 0.0700  15  TYR A N     
102  C CA    . TYR A 15  ? 1.3895 1.4372 1.3719 0.0909  -0.1109 0.0473  15  TYR A CA    
103  C C     . TYR A 15  ? 1.0912 1.1211 1.1144 0.0983  -0.1399 0.0440  15  TYR A C     
104  O O     . TYR A 15  ? 1.1444 1.1527 1.1853 0.0824  -0.1621 0.0638  15  TYR A O     
105  C CB    . TYR A 15  ? 1.1600 1.2014 1.1171 0.1035  -0.1066 0.0417  15  TYR A CB    
106  C CG    . TYR A 15  ? 1.2288 1.2478 1.1756 0.0904  -0.1278 0.0603  15  TYR A CG    
107  C CD1   . TYR A 15  ? 1.3693 1.3681 1.3545 0.1006  -0.1555 0.0602  15  TYR A CD1   
108  C CD2   . TYR A 15  ? 1.5567 1.5765 1.4595 0.0668  -0.1223 0.0751  15  TYR A CD2   
109  C CE1   . TYR A 15  ? 1.9391 1.9168 1.9303 0.0896  -0.1827 0.0802  15  TYR A CE1   
110  C CE2   . TYR A 15  ? 1.8416 1.8404 1.7321 0.0527  -0.1509 0.0966  15  TYR A CE2   
111  C CZ    . TYR A 15  ? 1.9947 1.9715 1.9350 0.0653  -0.1839 0.1019  15  TYR A CZ    
112  O OH    . TYR A 15  ? 1.9513 1.9066 1.8941 0.0523  -0.2199 0.1261  15  TYR A OH    
113  N N     . ALA A 16  ? 1.7322 1.7710 1.7714 0.1207  -0.1410 0.0182  16  ALA A N     
114  C CA    . ALA A 16  ? 1.5004 1.5276 1.5774 0.1305  -0.1632 -0.0005 16  ALA A CA    
115  C C     . ALA A 16  ? 1.1913 1.2203 1.2547 0.1530  -0.1572 -0.0258 16  ALA A C     
116  O O     . ALA A 16  ? 1.4787 1.5240 1.5073 0.1640  -0.1401 -0.0319 16  ALA A O     
117  C CB    . ALA A 16  ? 1.1371 1.1781 1.2397 0.1300  -0.1706 -0.0139 16  ALA A CB    
118  N N     . ILE A 17  ? 1.1634 1.1759 1.2616 0.1581  -0.1705 -0.0393 17  ILE A N     
119  C CA    . ILE A 17  ? 1.2559 1.2730 1.3519 0.1753  -0.1588 -0.0676 17  ILE A CA    
120  C C     . ILE A 17  ? 1.1017 1.1212 1.2286 0.1829  -0.1670 -0.1082 17  ILE A C     
121  O O     . ILE A 17  ? 1.1145 1.1163 1.3051 0.1793  -0.1889 -0.1173 17  ILE A O     
122  C CB    . ILE A 17  ? 1.0794 1.0809 1.2067 0.1754  -0.1643 -0.0594 17  ILE A CB    
123  C CG1   . ILE A 17  ? 1.2539 1.2509 1.3485 0.1616  -0.1640 -0.0209 17  ILE A CG1   
124  C CG2   . ILE A 17  ? 1.2240 1.2378 1.3510 0.1908  -0.1419 -0.0886 17  ILE A CG2   
125  C CD1   . ILE A 17  ? 1.2401 1.2554 1.2812 0.1670  -0.1355 -0.0198 17  ILE A CD1   
126  N N     . PHE A 18  ? 1.1137 1.1537 1.1951 0.1912  -0.1517 -0.1320 18  PHE A N     
127  C CA    . PHE A 18  ? 1.1474 1.1962 1.2349 0.1958  -0.1546 -0.1786 18  PHE A CA    
128  C C     . PHE A 18  ? 1.3195 1.3822 1.3819 0.2036  -0.1259 -0.2101 18  PHE A C     
129  O O     . PHE A 18  ? 1.1553 1.2231 1.1873 0.2060  -0.1043 -0.1904 18  PHE A O     
130  C CB    . PHE A 18  ? 1.3030 1.3680 1.3449 0.1929  -0.1645 -0.1810 18  PHE A CB    
131  C CG    . PHE A 18  ? 1.1679 1.2281 1.2358 0.1837  -0.1847 -0.1517 18  PHE A CG    
132  C CD1   . PHE A 18  ? 1.2297 1.2957 1.2738 0.1808  -0.1762 -0.1127 18  PHE A CD1   
133  C CD2   . PHE A 18  ? 1.1904 1.2431 1.3133 0.1765  -0.2092 -0.1677 18  PHE A CD2   
134  C CE1   . PHE A 18  ? 1.4752 1.5435 1.5478 0.1697  -0.1866 -0.0919 18  PHE A CE1   
135  C CE2   . PHE A 18  ? 1.2640 1.3164 1.4155 0.1644  -0.2224 -0.1407 18  PHE A CE2   
136  C CZ    . PHE A 18  ? 1.4981 1.5605 1.6230 0.1605  -0.2086 -0.1037 18  PHE A CZ    
137  N N     . ASN A 19  ? 1.2081 1.2793 1.2852 0.2052  -0.1233 -0.2630 19  ASN A N     
138  C CA    . ASN A 19  ? 1.4760 1.5694 1.5134 0.2067  -0.0893 -0.3020 19  ASN A CA    
139  C C     . ASN A 19  ? 1.4902 1.6026 1.4558 0.1995  -0.0934 -0.3306 19  ASN A C     
140  O O     . ASN A 19  ? 1.5543 1.6639 1.5535 0.1974  -0.1155 -0.3661 19  ASN A O     
141  C CB    . ASN A 19  ? 1.6350 1.7270 1.7603 0.2125  -0.0762 -0.3521 19  ASN A CB    
142  C CG    . ASN A 19  ? 1.5634 1.6854 1.6499 0.2099  -0.0307 -0.3990 19  ASN A CG    
143  O OD1   . ASN A 19  ? 1.3123 1.4478 1.3300 0.2057  -0.0037 -0.3738 19  ASN A OD1   
144  N ND2   . ASN A 19  ? 1.6131 1.7463 1.7452 0.2100  -0.0196 -0.4698 19  ASN A ND2   
145  N N     . TYR A 20  ? 1.4341 1.5639 1.3029 0.1937  -0.0767 -0.3130 20  TYR A N     
146  C CA    . TYR A 20  ? 1.4071 1.5550 1.1898 0.1832  -0.0872 -0.3301 20  TYR A CA    
147  C C     . TYR A 20  ? 1.4765 1.6490 1.1968 0.1726  -0.0467 -0.3742 20  TYR A C     
148  O O     . TYR A 20  ? 1.4816 1.6614 1.1645 0.1692  -0.0132 -0.3514 20  TYR A O     
149  C CB    . TYR A 20  ? 1.7957 1.9430 1.5146 0.1810  -0.1068 -0.2696 20  TYR A CB    
150  C CG    . TYR A 20  ? 1.4785 1.6430 1.1055 0.1686  -0.1277 -0.2774 20  TYR A CG    
151  C CD1   . TYR A 20  ? 1.4979 1.6645 1.1399 0.1661  -0.1679 -0.3007 20  TYR A CD1   
152  C CD2   . TYR A 20  ? 2.1466 2.3242 1.6717 0.1566  -0.1110 -0.2585 20  TYR A CD2   
153  C CE1   . TYR A 20  ? 1.9923 2.1751 1.5486 0.1531  -0.1951 -0.3078 20  TYR A CE1   
154  C CE2   . TYR A 20  ? 1.9830 2.1748 1.4137 0.1415  -0.1377 -0.2596 20  TYR A CE2   
155  C CZ    . TYR A 20  ? 2.0938 2.2888 1.5395 0.1404  -0.1819 -0.2857 20  TYR A CZ    
156  O OH    . TYR A 20  ? 2.3054 2.5150 1.6553 0.1237  -0.2162 -0.2867 20  TYR A OH    
157  N N     . ASP A 21  ? 1.5725 1.7593 1.2850 0.1651  -0.0470 -0.4404 21  ASP A N     
158  C CA    . ASP A 21  ? 1.7722 1.9889 1.4159 0.1495  -0.0033 -0.4932 21  ASP A CA    
159  C C     . ASP A 21  ? 1.8886 2.1214 1.3824 0.1296  -0.0073 -0.4603 21  ASP A C     
160  O O     . ASP A 21  ? 1.9713 2.2031 1.4145 0.1237  -0.0524 -0.4503 21  ASP A O     
161  C CB    . ASP A 21  ? 1.8013 2.0290 1.4868 0.1462  -0.0031 -0.5827 21  ASP A CB    
162  C CG    . ASP A 21  ? 1.9244 2.1852 1.5822 0.1327  0.0574  -0.6533 21  ASP A CG    
163  O OD1   . ASP A 21  ? 1.9480 2.2291 1.5040 0.1166  0.0938  -0.6306 21  ASP A OD1   
164  O OD2   . ASP A 21  ? 2.0595 2.3268 1.8044 0.1367  0.0705  -0.7331 21  ASP A OD2   
165  N N     . ASN A 22  ? 2.1903 2.4371 1.6192 0.1177  0.0366  -0.4400 22  ASN A N     
166  C CA    . ASN A 22  ? 2.5584 2.8142 1.8474 0.0964  0.0298  -0.3921 22  ASN A CA    
167  C C     . ASN A 22  ? 2.6381 2.9209 1.8117 0.0698  0.0271  -0.4429 22  ASN A C     
168  O O     . ASN A 22  ? 2.6131 2.8954 1.6874 0.0561  -0.0158 -0.4052 22  ASN A O     
169  C CB    . ASN A 22  ? 2.7359 2.9982 1.9935 0.0868  0.0807  -0.3566 22  ASN A CB    
170  C CG    . ASN A 22  ? 2.4887 2.7239 1.8383 0.1091  0.0743  -0.2992 22  ASN A CG    
171  O OD1   . ASN A 22  ? 2.4192 2.6317 1.7942 0.1228  0.0272  -0.2534 22  ASN A OD1   
172  N ND2   . ASN A 22  ? 2.6181 2.8583 2.0225 0.1115  0.1222  -0.3059 22  ASN A ND2   
173  N N     . THR A 23  ? 2.7388 3.0464 1.9258 0.0610  0.0702  -0.5309 23  THR A N     
174  C CA    . THR A 23  ? 2.8785 3.2156 1.9481 0.0319  0.0725  -0.5907 23  THR A CA    
175  C C     . THR A 23  ? 2.7814 3.1153 1.9091 0.0406  0.0306  -0.6564 23  THR A C     
176  O O     . THR A 23  ? 3.0269 3.3835 2.0557 0.0162  0.0203  -0.7077 23  THR A O     
177  C CB    . THR A 23  ? 2.8389 3.2140 1.8736 0.0098  0.1545  -0.6598 23  THR A CB    
178  O OG1   . THR A 23  ? 2.7358 3.1131 1.9277 0.0313  0.1825  -0.7381 23  THR A OG1   
179  C CG2   . THR A 23  ? 2.8948 3.2731 1.8941 0.0004  0.2008  -0.5963 23  THR A CG2   
180  N N     . SER A 24  ? 2.1946 2.5006 1.4758 0.0712  0.0046  -0.6552 24  SER A N     
181  C CA    . SER A 24  ? 2.1334 2.4315 1.4831 0.0784  -0.0387 -0.7084 24  SER A CA    
182  C C     . SER A 24  ? 2.2236 2.4948 1.6055 0.0914  -0.1084 -0.6432 24  SER A C     
183  O O     . SER A 24  ? 2.3118 2.5802 1.7245 0.0905  -0.1516 -0.6793 24  SER A O     
184  C CB    . SER A 24  ? 2.2351 2.5227 1.7519 0.0987  -0.0151 -0.7691 24  SER A CB    
185  O OG    . SER A 24  ? 2.7286 3.0457 2.2409 0.0882  0.0519  -0.8412 24  SER A OG    
186  N N     . ASN A 25  ? 2.4212 2.6748 1.8044 0.1022  -0.1179 -0.5536 25  ASN A N     
187  C CA    . ASN A 25  ? 2.4090 2.6417 1.8356 0.1145  -0.1748 -0.4935 25  ASN A CA    
188  C C     . ASN A 25  ? 2.3226 2.5359 1.8930 0.1305  -0.1952 -0.5212 25  ASN A C     
189  O O     . ASN A 25  ? 2.6383 2.8465 2.2409 0.1306  -0.2440 -0.5186 25  ASN A O     
190  C CB    . ASN A 25  ? 2.6425 2.8880 1.9662 0.0975  -0.2264 -0.4793 25  ASN A CB    
191  C CG    . ASN A 25  ? 3.0828 3.3412 2.2626 0.0786  -0.2148 -0.4346 25  ASN A CG    
192  O OD1   . ASN A 25  ? 3.2007 3.4519 2.3768 0.0834  -0.1785 -0.3886 25  ASN A OD1   
193  N ND2   . ASN A 25  ? 3.2211 3.4975 2.2814 0.0544  -0.2488 -0.4456 25  ASN A ND2   
194  N N     . THR A 26  ? 2.0319 2.2341 1.6955 0.1423  -0.1599 -0.5448 26  THR A N     
195  C CA    . THR A 26  ? 1.6230 1.8021 1.4269 0.1546  -0.1776 -0.5655 26  THR A CA    
196  C C     . THR A 26  ? 1.9791 2.1331 1.8543 0.1690  -0.1761 -0.4966 26  THR A C     
197  O O     . THR A 26  ? 2.0265 2.1809 1.8844 0.1738  -0.1422 -0.4695 26  THR A O     
198  C CB    . THR A 26  ? 2.0257 2.2089 1.8975 0.1559  -0.1473 -0.6495 26  THR A CB    
199  O OG1   . THR A 26  ? 2.2005 2.4125 1.9897 0.1384  -0.1411 -0.7215 26  THR A OG1   
200  C CG2   . THR A 26  ? 1.9900 2.1441 2.0125 0.1661  -0.1761 -0.6665 26  THR A CG2   
201  N N     . ILE A 27  ? 2.2835 2.4176 2.2358 0.1727  -0.2119 -0.4699 27  ILE A N     
202  C CA    . ILE A 27  ? 1.3901 1.5024 1.3996 0.1805  -0.2127 -0.4065 27  ILE A CA    
203  C C     . ILE A 27  ? 1.4047 1.4934 1.5260 0.1864  -0.2074 -0.4253 27  ILE A C     
204  O O     . ILE A 27  ? 1.9941 2.0747 2.1869 0.1847  -0.2231 -0.4749 27  ILE A O     
205  C CB    . ILE A 27  ? 1.3620 1.4694 1.3940 0.1762  -0.2492 -0.3659 27  ILE A CB    
206  C CG1   . ILE A 27  ? 2.1860 2.3168 2.1288 0.1710  -0.2677 -0.3572 27  ILE A CG1   
207  C CG2   . ILE A 27  ? 1.2926 1.3849 1.3558 0.1794  -0.2414 -0.3020 27  ILE A CG2   
208  C CD1   . ILE A 27  ? 1.4111 1.5524 1.2628 0.1735  -0.2444 -0.3224 27  ILE A CD1   
209  N N     . LYS A 28  ? 1.4579 1.5339 1.6014 0.1927  -0.1899 -0.3856 28  LYS A N     
210  C CA    . LYS A 28  ? 1.3528 1.4020 1.6061 0.1972  -0.1962 -0.3854 28  LYS A CA    
211  C C     . LYS A 28  ? 1.5999 1.6315 1.8590 0.1947  -0.2037 -0.3117 28  LYS A C     
212  O O     . LYS A 28  ? 1.3061 1.3459 1.5110 0.1979  -0.1817 -0.2822 28  LYS A O     
213  C CB    . LYS A 28  ? 1.3160 1.3722 1.5997 0.2061  -0.1651 -0.4289 28  LYS A CB    
214  C CG    . LYS A 28  ? 1.2770 1.3046 1.6774 0.2126  -0.1772 -0.4147 28  LYS A CG    
215  C CD    . LYS A 28  ? 1.9331 1.9326 2.4431 0.2099  -0.2152 -0.4306 28  LYS A CD    
216  C CE    . LYS A 28  ? 1.9293 1.8969 2.5606 0.2152  -0.2352 -0.4115 28  LYS A CE    
217  N NZ    . LYS A 28  ? 1.8480 1.7823 2.5948 0.2104  -0.2763 -0.4184 28  LYS A NZ    
218  N N     . LEU A 29  ? 1.7487 1.7568 2.0712 0.1860  -0.2330 -0.2836 29  LEU A N     
219  C CA    . LEU A 29  ? 1.5984 1.5909 1.9209 0.1776  -0.2384 -0.2176 29  LEU A CA    
220  C C     . LEU A 29  ? 1.2154 1.1852 1.5995 0.1813  -0.2427 -0.2079 29  LEU A C     
221  O O     . LEU A 29  ? 1.2123 1.1592 1.6913 0.1814  -0.2656 -0.2254 29  LEU A O     
222  C CB    . LEU A 29  ? 1.1853 1.1647 1.5449 0.1606  -0.2640 -0.1881 29  LEU A CB    
223  C CG    . LEU A 29  ? 1.1657 1.1337 1.5145 0.1436  -0.2659 -0.1223 29  LEU A CG    
224  C CD1   . LEU A 29  ? 1.9932 1.9249 2.4142 0.1331  -0.2901 -0.0948 29  LEU A CD1   
225  C CD2   . LEU A 29  ? 1.1401 1.1247 1.4087 0.1490  -0.2384 -0.1001 29  LEU A CD2   
226  N N     . ILE A 30  ? 1.1696 1.1448 1.5099 0.1847  -0.2247 -0.1813 30  ILE A N     
227  C CA    . ILE A 30  ? 1.2739 1.2299 1.6721 0.1875  -0.2344 -0.1677 30  ILE A CA    
228  C C     . ILE A 30  ? 1.4472 1.3767 1.8562 0.1689  -0.2632 -0.1041 30  ILE A C     
229  O O     . ILE A 30  ? 1.3091 1.2090 1.8003 0.1633  -0.2967 -0.0892 30  ILE A O     
230  C CB    . ILE A 30  ? 1.1657 1.1421 1.5175 0.1980  -0.2025 -0.1738 30  ILE A CB    
231  C CG1   . ILE A 30  ? 1.4098 1.4125 1.7496 0.2104  -0.1713 -0.2357 30  ILE A CG1   
232  C CG2   . ILE A 30  ? 1.1349 1.0935 1.5513 0.1999  -0.2184 -0.1558 30  ILE A CG2   
233  C CD1   . ILE A 30  ? 1.3992 1.4232 1.6957 0.2167  -0.1354 -0.2403 30  ILE A CD1   
234  N N     . ALA A 31  ? 1.7482 1.6881 2.0764 0.1566  -0.2511 -0.0659 31  ALA A N     
235  C CA    . ALA A 31  ? 1.1520 1.0718 1.4718 0.1335  -0.2713 -0.0083 31  ALA A CA    
236  C C     . ALA A 31  ? 1.1443 1.0820 1.3921 0.1175  -0.2520 0.0157  31  ALA A C     
237  O O     . ALA A 31  ? 1.1220 1.0866 1.3258 0.1283  -0.2255 -0.0062 31  ALA A O     
238  C CB    . ALA A 31  ? 1.1571 1.0702 1.4664 0.1343  -0.2761 0.0123  31  ALA A CB    
239  N N     . ILE A 32  ? 1.6208 1.5439 1.8602 0.0894  -0.2657 0.0625  32  ILE A N     
240  C CA    . ILE A 32  ? 1.3770 1.3202 1.5574 0.0692  -0.2420 0.0842  32  ILE A CA    
241  C C     . ILE A 32  ? 1.3206 1.2502 1.4598 0.0394  -0.2501 0.1332  32  ILE A C     
242  O O     . ILE A 32  ? 1.4977 1.3968 1.6699 0.0203  -0.2842 0.1679  32  ILE A O     
243  C CB    . ILE A 32  ? 1.5259 1.4731 1.7429 0.0563  -0.2447 0.0840  32  ILE A CB    
244  C CG1   . ILE A 32  ? 1.1841 1.1449 1.4345 0.0827  -0.2440 0.0332  32  ILE A CG1   
245  C CG2   . ILE A 32  ? 1.8262 1.7996 1.9965 0.0345  -0.2148 0.1024  32  ILE A CG2   
246  C CD1   . ILE A 32  ? 1.2213 1.1919 1.5096 0.0716  -0.2481 0.0271  32  ILE A CD1   
247  N N     . GLU A 33  ? 1.2031 1.1539 1.2709 0.0334  -0.2217 0.1362  33  GLU A N     
248  C CA    . GLU A 33  ? 1.3881 1.3292 1.4008 0.0043  -0.2293 0.1746  33  GLU A CA    
249  C C     . GLU A 33  ? 1.4141 1.3857 1.3567 -0.0168 -0.1879 0.1750  33  GLU A C     
250  O O     . GLU A 33  ? 1.2901 1.2892 1.2257 0.0027  -0.1550 0.1407  33  GLU A O     
251  C CB    . GLU A 33  ? 1.3007 1.2317 1.3079 0.0205  -0.2456 0.1687  33  GLU A CB    
252  C CG    . GLU A 33  ? 1.7776 1.6802 1.8668 0.0383  -0.2862 0.1669  33  GLU A CG    
253  C CD    . GLU A 33  ? 2.4671 2.3343 2.5870 0.0106  -0.3327 0.2167  33  GLU A CD    
254  O OE1   . GLU A 33  ? 2.5289 2.3914 2.5824 -0.0265 -0.3385 0.2607  33  GLU A OE1   
255  O OE2   . GLU A 33  ? 2.3616 2.2052 2.5733 0.0239  -0.3636 0.2115  33  GLU A OE2   
256  N N     . LYS A 34  ? 1.6057 1.5721 1.4990 -0.0589 -0.1902 0.2140  34  LYS A N     
257  C CA    . LYS A 34  ? 1.3534 1.3487 1.1707 -0.0850 -0.1500 0.2106  34  LYS A CA    
258  C C     . LYS A 34  ? 1.3762 1.3654 1.1343 -0.0884 -0.1609 0.2119  34  LYS A C     
259  O O     . LYS A 34  ? 1.4222 1.3822 1.1962 -0.0801 -0.2053 0.2298  34  LYS A O     
260  C CB    . LYS A 34  ? 1.4288 1.4264 1.2088 -0.1363 -0.1408 0.2500  34  LYS A CB    
261  C CG    . LYS A 34  ? 1.4502 1.4729 1.2773 -0.1416 -0.1079 0.2377  34  LYS A CG    
262  C CD    . LYS A 34  ? 1.8766 1.9060 1.6583 -0.1995 -0.0900 0.2780  34  LYS A CD    
263  C CE    . LYS A 34  ? 2.2322 2.2805 2.0841 -0.2073 -0.0672 0.2734  34  LYS A CE    
264  N NZ    . LYS A 34  ? 2.7129 2.7698 2.5215 -0.2690 -0.0438 0.3157  34  LYS A NZ    
265  N N     . SER A 35  ? 1.3890 1.4074 1.0890 -0.1008 -0.1207 0.1886  35  SER A N     
266  C CA    . SER A 35  ? 1.4208 1.4365 1.0602 -0.1096 -0.1296 0.1850  35  SER A CA    
267  C C     . SER A 35  ? 1.6467 1.6941 1.2070 -0.1467 -0.0843 0.1695  35  SER A C     
268  O O     . SER A 35  ? 1.7784 1.8499 1.3366 -0.1666 -0.0457 0.1652  35  SER A O     
269  C CB    . SER A 35  ? 1.3955 1.4128 1.0779 -0.0645 -0.1286 0.1473  35  SER A CB    
270  O OG    . SER A 35  ? 1.6671 1.6806 1.3026 -0.0738 -0.1418 0.1432  35  SER A OG    
271  N N     . ASP A 36  ? 1.9865 2.0361 1.4867 -0.1578 -0.0880 0.1568  36  ASP A N     
272  C CA    . ASP A 36  ? 2.0286 2.1101 1.4506 -0.1932 -0.0433 0.1292  36  ASP A CA    
273  C C     . ASP A 36  ? 1.8344 1.9273 1.2660 -0.1684 -0.0287 0.0778  36  ASP A C     
274  O O     . ASP A 36  ? 1.7497 1.8203 1.1808 -0.1554 -0.0697 0.0842  36  ASP A O     
275  C CB    . ASP A 36  ? 2.2751 2.3464 1.5853 -0.2512 -0.0681 0.1719  36  ASP A CB    
276  C CG    . ASP A 36  ? 2.5293 2.6374 1.7457 -0.2924 -0.0181 0.1348  36  ASP A CG    
277  O OD1   . ASP A 36  ? 2.6133 2.7548 1.8226 -0.3147 0.0392  0.1172  36  ASP A OD1   
278  O OD2   . ASP A 36  ? 2.6236 2.7299 1.7798 -0.3035 -0.0347 0.1184  36  ASP A OD2   
279  N N     . TRP A 37  ? 1.5444 1.6716 0.9986 -0.1616 0.0282  0.0265  37  TRP A N     
280  C CA    . TRP A 37  ? 1.5297 1.6675 1.0016 -0.1419 0.0464  -0.0247 37  TRP A CA    
281  C C     . TRP A 37  ? 1.8236 1.9951 1.2301 -0.1810 0.0933  -0.0690 37  TRP A C     
282  O O     . TRP A 37  ? 1.7574 1.9452 1.2005 -0.1653 0.1233  -0.1237 37  TRP A O     
283  C CB    . TRP A 37  ? 1.9090 2.0537 1.4887 -0.0925 0.0672  -0.0522 37  TRP A CB    
284  C CG    . TRP A 37  ? 1.5847 1.7013 1.2219 -0.0545 0.0281  -0.0215 37  TRP A CG    
285  C CD1   . TRP A 37  ? 1.4822 1.5686 1.1052 -0.0526 -0.0214 0.0152  37  TRP A CD1   
286  C CD2   . TRP A 37  ? 1.4105 1.5289 1.1305 -0.0145 0.0355  -0.0292 37  TRP A CD2   
287  N NE1   . TRP A 37  ? 1.2667 1.3391 0.9582 -0.0147 -0.0375 0.0241  37  TRP A NE1   
288  C CE2   . TRP A 37  ? 1.6895 1.7806 1.4308 0.0074  -0.0046 -0.0005 37  TRP A CE2   
289  C CE3   . TRP A 37  ? 1.7569 1.8980 1.5378 0.0036  0.0694  -0.0576 37  TRP A CE3   
290  C CZ2   . TRP A 37  ? 1.3588 1.4463 1.1614 0.0427  -0.0081 -0.0009 37  TRP A CZ2   
291  C CZ3   . TRP A 37  ? 1.6544 1.7880 1.4986 0.0398  0.0570  -0.0500 37  TRP A CZ3   
292  C CH2   . TRP A 37  ? 1.2507 1.3585 1.0959 0.0570  0.0203  -0.0226 37  TRP A CH2   
293  N N     . THR A 38  ? 2.2203 2.4023 1.5311 -0.2343 0.1014  -0.0473 38  THR A N     
294  C CA    . THR A 38  ? 1.9469 2.1667 1.1824 -0.2789 0.1534  -0.0943 38  THR A CA    
295  C C     . THR A 38  ? 1.8549 2.0705 1.0291 -0.2904 0.1364  -0.1266 38  THR A C     
296  O O     . THR A 38  ? 2.1376 2.3870 1.2727 -0.3166 0.1849  -0.1873 38  THR A O     
297  C CB    . THR A 38  ? 2.0899 2.3204 1.2219 -0.3403 0.1638  -0.0542 38  THR A CB    
298  O OG1   . THR A 38  ? 2.4667 2.6549 1.5343 -0.3565 0.0908  0.0180  38  THR A OG1   
299  C CG2   . THR A 38  ? 1.9823 2.2297 1.1862 -0.3349 0.1982  -0.0409 38  THR A CG2   
300  N N     . LYS A 39  ? 2.1056 2.2833 1.2786 -0.2725 0.0702  -0.0931 39  LYS A N     
301  C CA    . LYS A 39  ? 2.2609 2.4333 1.3848 -0.2836 0.0457  -0.1216 39  LYS A CA    
302  C C     . LYS A 39  ? 2.4569 2.6022 1.6835 -0.2289 0.0093  -0.1231 39  LYS A C     
303  O O     . LYS A 39  ? 2.4685 2.5847 1.7403 -0.2036 -0.0353 -0.0718 39  LYS A O     
304  C CB    . LYS A 39  ? 2.4093 2.5659 1.4011 -0.3359 -0.0076 -0.0720 39  LYS A CB    
305  C CG    . LYS A 39  ? 2.8039 2.9938 1.6627 -0.4030 0.0350  -0.0859 39  LYS A CG    
306  C CD    . LYS A 39  ? 2.8238 2.9916 1.5524 -0.4570 -0.0245 -0.0116 39  LYS A CD    
307  C CE    . LYS A 39  ? 2.7437 2.8910 1.4991 -0.4573 -0.0405 0.0644  39  LYS A CE    
308  N NZ    . LYS A 39  ? 2.6154 2.8006 1.3730 -0.4761 0.0402  0.0434  39  LYS A NZ    
309  N N     . ASN A 40  ? 2.5037 2.6596 1.7713 -0.2131 0.0314  -0.1844 40  ASN A N     
310  C CA    . ASN A 40  ? 2.2138 2.3479 1.5805 -0.1663 0.0068  -0.1909 40  ASN A CA    
311  C C     . ASN A 40  ? 1.8983 2.0211 1.3664 -0.1193 0.0124  -0.1629 40  ASN A C     
312  O O     . ASN A 40  ? 1.9532 2.0507 1.4559 -0.0968 -0.0290 -0.1202 40  ASN A O     
313  C CB    . ASN A 40  ? 2.4522 2.5598 1.7865 -0.1744 -0.0630 -0.1575 40  ASN A CB    
314  C CG    . ASN A 40  ? 2.9054 3.0230 2.1182 -0.2279 -0.0805 -0.1749 40  ASN A CG    
315  O OD1   . ASN A 40  ? 3.0934 3.2187 2.3054 -0.2335 -0.0774 -0.2272 40  ASN A OD1   
316  N ND2   . ASN A 40  ? 2.9003 3.0170 2.0071 -0.2705 -0.1011 -0.1300 40  ASN A ND2   
317  N N     . TRP A 41  ? 1.9924 2.1367 1.5106 -0.1062 0.0645  -0.1916 41  TRP A N     
318  C CA    . TRP A 41  ? 1.5840 1.7223 1.1778 -0.0708 0.0688  -0.1637 41  TRP A CA    
319  C C     . TRP A 41  ? 1.4063 1.5214 1.0831 -0.0264 0.0469  -0.1538 41  TRP A C     
320  O O     . TRP A 41  ? 1.4173 1.5185 1.1259 -0.0038 0.0280  -0.1166 41  TRP A O     
321  C CB    . TRP A 41  ? 1.4072 1.5760 1.0467 -0.0677 0.1240  -0.1988 41  TRP A CB    
322  C CG    . TRP A 41  ? 1.3934 1.5739 1.1044 -0.0504 0.1562  -0.2564 41  TRP A CG    
323  C CD1   . TRP A 41  ? 1.5888 1.7919 1.2785 -0.0757 0.1901  -0.3161 41  TRP A CD1   
324  C CD2   . TRP A 41  ? 1.6524 1.8220 1.4732 -0.0060 0.1574  -0.2602 41  TRP A CD2   
325  N NE1   . TRP A 41  ? 1.6302 1.8344 1.4244 -0.0466 0.2105  -0.3587 41  TRP A NE1   
326  C CE2   . TRP A 41  ? 1.7828 1.9651 1.6567 -0.0044 0.1888  -0.3199 41  TRP A CE2   
327  C CE3   . TRP A 41  ? 1.4483 1.5981 1.3238 0.0298  0.1337  -0.2189 41  TRP A CE3   
328  C CZ2   . TRP A 41  ? 1.4185 1.5899 1.4054 0.0324  0.1926  -0.3309 41  TRP A CZ2   
329  C CZ3   . TRP A 41  ? 1.4824 1.6245 1.4519 0.0628  0.1391  -0.2288 41  TRP A CZ3   
330  C CH2   . TRP A 41  ? 1.5558 1.7064 1.5837 0.0643  0.1661  -0.2803 41  TRP A CH2   
331  N N     . GLU A 42  ? 1.3695 1.4809 1.0820 -0.0163 0.0506  -0.1874 42  GLU A N     
332  C CA    . GLU A 42  ? 1.4466 1.5372 1.2342 0.0200  0.0337  -0.1734 42  GLU A CA    
333  C C     . GLU A 42  ? 1.4582 1.5284 1.2264 0.0207  -0.0130 -0.1340 42  GLU A C     
334  O O     . GLU A 42  ? 1.5691 1.6274 1.3803 0.0464  -0.0245 -0.1056 42  GLU A O     
335  C CB    . GLU A 42  ? 1.3041 1.3932 1.1433 0.0271  0.0475  -0.2160 42  GLU A CB    
336  C CG    . GLU A 42  ? 1.3269 1.4335 1.2177 0.0328  0.0919  -0.2589 42  GLU A CG    
337  C CD    . GLU A 42  ? 1.6070 1.7074 1.5619 0.0392  0.1019  -0.3025 42  GLU A CD    
338  O OE1   . GLU A 42  ? 1.4381 1.5198 1.4044 0.0432  0.0750  -0.2930 42  GLU A OE1   
339  O OE2   . GLU A 42  ? 1.5382 1.6531 1.5447 0.0405  0.1367  -0.3482 42  GLU A OE2   
340  N N     . ARG A 43  ? 1.9631 2.0307 1.6695 -0.0088 -0.0416 -0.1340 43  ARG A N     
341  C CA    . ARG A 43  ? 1.6667 1.7158 1.3678 -0.0096 -0.0923 -0.0958 43  ARG A CA    
342  C C     . ARG A 43  ? 1.4704 1.5128 1.1642 -0.0054 -0.1039 -0.0537 43  ARG A C     
343  O O     . ARG A 43  ? 1.4494 1.4780 1.1943 0.0170  -0.1255 -0.0301 43  ARG A O     
344  C CB    . ARG A 43  ? 1.8566 1.9047 1.4827 -0.0478 -0.1279 -0.0983 43  ARG A CB    
345  C CG    . ARG A 43  ? 2.3357 2.3867 1.9784 -0.0522 -0.1302 -0.1407 43  ARG A CG    
346  C CD    . ARG A 43  ? 2.7701 2.8270 2.3117 -0.0984 -0.1582 -0.1519 43  ARG A CD    
347  N NE    . ARG A 43  ? 2.7617 2.8053 2.2457 -0.1199 -0.2116 -0.0974 43  ARG A NE    
348  C CZ    . ARG A 43  ? 2.5999 2.6289 2.0828 -0.1302 -0.2754 -0.0759 43  ARG A CZ    
349  N NH1   . ARG A 43  ? 2.4213 2.4503 1.9552 -0.1221 -0.2907 -0.1076 43  ARG A NH1   
350  N NH2   . ARG A 43  ? 2.7699 2.7835 2.2108 -0.1493 -0.3273 -0.0213 43  ARG A NH2   
351  N N     . SER A 44  ? 1.5556 1.6094 1.1921 -0.0284 -0.0865 -0.0483 44  SER A N     
352  C CA    . SER A 44  ? 1.3381 1.3845 0.9716 -0.0286 -0.0988 -0.0090 44  SER A CA    
353  C C     . SER A 44  ? 1.3627 1.4089 1.0710 0.0100  -0.0799 -0.0093 44  SER A C     
354  O O     . SER A 44  ? 1.4682 1.5005 1.2066 0.0235  -0.1031 0.0172  44  SER A O     
355  C CB    . SER A 44  ? 1.4026 1.4652 0.9641 -0.0653 -0.0766 -0.0055 44  SER A CB    
356  O OG    . SER A 44  ? 1.7580 1.8234 1.2316 -0.1069 -0.0916 -0.0068 44  SER A OG    
357  N N     . VAL A 45  ? 1.3104 1.3717 1.0514 0.0268  -0.0406 -0.0399 45  VAL A N     
358  C CA    . VAL A 45  ? 1.3888 1.4497 1.1902 0.0601  -0.0285 -0.0365 45  VAL A CA    
359  C C     . VAL A 45  ? 1.4870 1.5317 1.3296 0.0834  -0.0489 -0.0269 45  VAL A C     
360  O O     . VAL A 45  ? 1.4659 1.5040 1.3326 0.0993  -0.0593 -0.0105 45  VAL A O     
361  C CB    . VAL A 45  ? 1.3332 1.4103 1.1695 0.0719  0.0094  -0.0663 45  VAL A CB    
362  C CG1   . VAL A 45  ? 1.1828 1.2537 1.0759 0.1053  0.0113  -0.0578 45  VAL A CG1   
363  C CG2   . VAL A 45  ? 1.6311 1.7299 1.4526 0.0552  0.0345  -0.0756 45  VAL A CG2   
364  N N     . ALA A 46  ? 1.4913 1.5318 1.3467 0.0836  -0.0521 -0.0416 46  ALA A N     
365  C CA    . ALA A 46  ? 1.1437 1.1740 1.0472 0.1024  -0.0647 -0.0356 46  ALA A CA    
366  C C     . ALA A 46  ? 1.2151 1.2348 1.1237 0.0998  -0.1007 -0.0137 46  ALA A C     
367  O O     . ALA A 46  ? 1.6649 1.6814 1.6200 0.1187  -0.1028 -0.0094 46  ALA A O     
368  C CB    . ALA A 46  ? 1.1667 1.1953 1.0896 0.0981  -0.0644 -0.0562 46  ALA A CB    
369  N N     . ARG A 47  ? 1.4740 1.4884 1.3385 0.0748  -0.1290 0.0002  47  ARG A N     
370  C CA    . ARG A 47  ? 1.7035 1.7034 1.5874 0.0722  -0.1705 0.0257  47  ARG A CA    
371  C C     . ARG A 47  ? 1.4817 1.4787 1.3805 0.0832  -0.1657 0.0384  47  ARG A C     
372  O O     . ARG A 47  ? 1.4193 1.4098 1.3751 0.1010  -0.1778 0.0403  47  ARG A O     
373  C CB    . ARG A 47  ? 1.9426 1.9339 1.7687 0.0377  -0.2087 0.0460  47  ARG A CB    
374  C CG    . ARG A 47  ? 2.2413 2.2297 2.0726 0.0280  -0.2378 0.0382  47  ARG A CG    
375  C CD    . ARG A 47  ? 2.7200 2.6988 2.6431 0.0485  -0.2694 0.0448  47  ARG A CD    
376  N NE    . ARG A 47  ? 3.1496 3.1266 3.0899 0.0379  -0.3056 0.0395  47  ARG A NE    
377  C CZ    . ARG A 47  ? 3.2210 3.1936 3.2521 0.0515  -0.3374 0.0416  47  ARG A CZ    
378  N NH1   . ARG A 47  ? 3.0795 3.0502 3.1892 0.0759  -0.3323 0.0446  47  ARG A NH1   
379  N NH2   . ARG A 47  ? 3.1865 3.1594 3.2362 0.0399  -0.3738 0.0358  47  ARG A NH2   
380  N N     . ASP A 48  ? 1.5865 1.5910 1.4419 0.0720  -0.1463 0.0419  48  ASP A N     
381  C CA    . ASP A 48  ? 1.3536 1.3546 1.2239 0.0772  -0.1484 0.0547  48  ASP A CA    
382  C C     . ASP A 48  ? 1.2680 1.2766 1.1809 0.1077  -0.1258 0.0365  48  ASP A C     
383  O O     . ASP A 48  ? 1.3116 1.3142 1.2567 0.1178  -0.1368 0.0391  48  ASP A O     
384  C CB    . ASP A 48  ? 1.3371 1.3487 1.1584 0.0544  -0.1308 0.0616  48  ASP A CB    
385  C CG    . ASP A 48  ? 1.5888 1.5920 1.3536 0.0166  -0.1545 0.0875  48  ASP A CG    
386  O OD1   . ASP A 48  ? 2.0249 2.0065 1.8019 0.0102  -0.1987 0.1124  48  ASP A OD1   
387  O OD2   . ASP A 48  ? 1.8805 1.8997 1.5908 -0.0087 -0.1294 0.0831  48  ASP A OD2   
388  N N     . LEU A 49  ? 1.4673 1.4880 1.3809 0.1205  -0.0967 0.0182  49  LEU A N     
389  C CA    . LEU A 49  ? 1.7454 1.7731 1.6826 0.1436  -0.0779 0.0082  49  LEU A CA    
390  C C     . LEU A 49  ? 1.8046 1.8287 1.7800 0.1585  -0.0803 0.0006  49  LEU A C     
391  O O     . LEU A 49  ? 1.2695 1.2980 1.2582 0.1719  -0.0722 -0.0070 49  LEU A O     
392  C CB    . LEU A 49  ? 1.6283 1.6671 1.5575 0.1494  -0.0499 -0.0007 49  LEU A CB    
393  C CG    . LEU A 49  ? 1.3415 1.3915 1.2525 0.1381  -0.0396 -0.0018 49  LEU A CG    
394  C CD1   . LEU A 49  ? 1.1866 1.2468 1.1162 0.1495  -0.0163 -0.0123 49  LEU A CD1   
395  C CD2   . LEU A 49  ? 1.4356 1.4873 1.3477 0.1369  -0.0508 0.0073  49  LEU A CD2   
396  N N     . THR A 50  ? 0.9548 1.0638 1.2738 0.2134  -0.0677 -0.1984 50  THR A N     
397  C CA    . THR A 50  ? 1.2371 1.3936 1.6090 0.2160  -0.0752 -0.2562 50  THR A CA    
398  C C     . THR A 50  ? 0.9535 1.1187 1.3794 0.2409  -0.1348 -0.2761 50  THR A C     
399  O O     . THR A 50  ? 0.9434 1.1560 1.4266 0.2471  -0.1470 -0.3320 50  THR A O     
400  C CB    . THR A 50  ? 0.9490 1.1325 1.3161 0.2010  -0.0525 -0.2914 50  THR A CB    
401  O OG1   . THR A 50  ? 2.0363 2.2099 2.3838 0.2094  -0.0829 -0.2807 50  THR A OG1   
402  C CG2   . THR A 50  ? 0.9498 1.1141 1.2722 0.1771  0.0082  -0.2746 50  THR A CG2   
403  N N     . ARG A 51  ? 1.2440 1.3625 1.6549 0.2543  -0.1703 -0.2323 51  ARG A N     
404  C CA    . ARG A 51  ? 1.3540 1.4613 1.8126 0.2813  -0.2306 -0.2416 51  ARG A CA    
405  C C     . ARG A 51  ? 1.1433 1.2799 1.6775 0.2915  -0.2413 -0.2861 51  ARG A C     
406  O O     . ARG A 51  ? 1.2314 1.4037 1.8298 0.3107  -0.2736 -0.3380 51  ARG A O     
407  C CB    . ARG A 51  ? 1.4172 1.4553 1.8376 0.2855  -0.2549 -0.1767 51  ARG A CB    
408  C CG    . ARG A 51  ? 1.9344 1.9392 2.3950 0.3148  -0.3191 -0.1735 51  ARG A CG    
409  C CD    . ARG A 51  ? 1.8528 1.7816 2.2573 0.3115  -0.3366 -0.1014 51  ARG A CD    
410  N NE    . ARG A 51  ? 1.8446 1.7727 2.1664 0.2985  -0.3221 -0.0704 51  ARG A NE    
411  C CZ    . ARG A 51  ? 1.9917 1.9247 2.2882 0.3161  -0.3598 -0.0701 51  ARG A CZ    
412  N NH1   . ARG A 51  ? 2.2357 2.1772 2.4560 0.3010  -0.3426 -0.0478 51  ARG A NH1   
413  N NH2   . ARG A 51  ? 2.3263 2.2618 2.6774 0.3511  -0.4169 -0.0969 51  ARG A NH2   
414  N N     . TYR A 52  ? 1.2438 1.3738 1.7759 0.2805  -0.2163 -0.2720 52  TYR A N     
415  C CA    . TYR A 52  ? 1.3489 1.5177 1.9464 0.2860  -0.2201 -0.3186 52  TYR A CA    
416  C C     . TYR A 52  ? 1.2989 1.5133 1.8664 0.2630  -0.1637 -0.3335 52  TYR A C     
417  O O     . TYR A 52  ? 1.9313 2.1401 2.4722 0.2540  -0.1402 -0.3087 52  TYR A O     
418  C CB    . TYR A 52  ? 1.5630 1.6927 2.1819 0.2914  -0.2391 -0.2937 52  TYR A CB    
419  C CG    . TYR A 52  ? 1.5736 1.6275 2.1739 0.3000  -0.2738 -0.2404 52  TYR A CG    
420  C CD1   . TYR A 52  ? 1.9750 1.9996 2.6219 0.3262  -0.3284 -0.2504 52  TYR A CD1   
421  C CD2   . TYR A 52  ? 1.4278 1.4389 1.9627 0.2820  -0.2515 -0.1793 52  TYR A CD2   
422  C CE1   . TYR A 52  ? 2.1059 2.0526 2.7219 0.3323  -0.3589 -0.1925 52  TYR A CE1   
423  C CE2   . TYR A 52  ? 1.8198 1.7627 2.3284 0.2833  -0.2771 -0.1281 52  TYR A CE2   
424  C CZ    . TYR A 52  ? 1.9339 1.8403 2.4775 0.3075  -0.3305 -0.1307 52  TYR A CZ    
425  O OH    . TYR A 52  ? 1.9258 1.7553 2.4307 0.3074  -0.3558 -0.0711 52  TYR A OH    
426  N N     . ASN A 53  ? 0.9138 1.1735 1.4859 0.2534  -0.1425 -0.3746 53  ASN A N     
427  C CA    . ASN A 53  ? 0.8833 1.1705 1.4134 0.2274  -0.0844 -0.3797 53  ASN A CA    
428  C C     . ASN A 53  ? 1.4881 1.7912 2.0082 0.2231  -0.0657 -0.3735 53  ASN A C     
429  O O     . ASN A 53  ? 0.8648 1.2202 1.4335 0.2253  -0.0722 -0.4226 53  ASN A O     
430  C CB    . ASN A 53  ? 0.9364 1.2843 1.5020 0.2149  -0.0678 -0.4447 53  ASN A CB    
431  C CG    . ASN A 53  ? 1.0376 1.4343 1.6944 0.2352  -0.1113 -0.5085 53  ASN A CG    
432  O OD1   . ASN A 53  ? 1.4736 1.8783 2.1685 0.2489  -0.1334 -0.5199 53  ASN A OD1   
433  N ND2   . ASN A 53  ? 0.9834 1.4168 1.6832 0.2389  -0.1255 -0.5563 53  ASN A ND2   
434  N N     . PRO A 54  ? 1.1335 1.3998 1.5942 0.2186  -0.0444 -0.3184 54  PRO A N     
435  C CA    . PRO A 54  ? 1.1307 1.4152 1.5818 0.2205  -0.0364 -0.3095 54  PRO A CA    
436  C C     . PRO A 54  ? 0.8831 1.2001 1.2876 0.2040  0.0104  -0.3155 54  PRO A C     
437  O O     . PRO A 54  ? 1.0845 1.3974 1.4622 0.1870  0.0427  -0.3200 54  PRO A O     
438  C CB    . PRO A 54  ? 1.2939 1.5259 1.7065 0.2257  -0.0378 -0.2487 54  PRO A CB    
439  C CG    . PRO A 54  ? 0.8844 1.0788 1.2543 0.2170  -0.0174 -0.2231 54  PRO A CG    
440  C CD    . PRO A 54  ? 0.8859 1.0985 1.2911 0.2142  -0.0300 -0.2664 54  PRO A CD    
441  N N     . ASP A 55  ? 0.8859 1.2357 1.2803 0.2078  0.0136  -0.3163 55  ASP A N     
442  C CA    . ASP A 55  ? 1.1376 1.5110 1.4698 0.1950  0.0552  -0.3076 55  ASP A CA    
443  C C     . ASP A 55  ? 0.9720 1.3052 1.2379 0.2045  0.0695  -0.2440 55  ASP A C     
444  O O     . ASP A 55  ? 1.0674 1.3830 1.2677 0.1956  0.1073  -0.2163 55  ASP A O     
445  C CB    . ASP A 55  ? 1.1103 1.5612 1.4657 0.1942  0.0495  -0.3554 55  ASP A CB    
446  C CG    . ASP A 55  ? 1.0187 1.5205 1.4400 0.1835  0.0443  -0.4270 55  ASP A CG    
447  O OD1   . ASP A 55  ? 0.9962 1.4917 1.4103 0.1653  0.0701  -0.4388 55  ASP A OD1   
448  O OD2   . ASP A 55  ? 1.6676 2.2186 2.1557 0.1935  0.0143  -0.4769 55  ASP A OD2   
449  N N     . VAL A 56  ? 0.9150 1.2308 1.2007 0.2219  0.0410  -0.2215 56  VAL A N     
450  C CA    . VAL A 56  ? 1.1882 1.4736 1.4279 0.2346  0.0495  -0.1689 56  VAL A CA    
451  C C     . VAL A 56  ? 0.9114 1.1503 1.1759 0.2383  0.0327  -0.1468 56  VAL A C     
452  O O     . VAL A 56  ? 1.3806 1.6209 1.6994 0.2378  0.0024  -0.1671 56  VAL A O     
453  C CB    . VAL A 56  ? 1.1780 1.5151 1.4176 0.2502  0.0338  -0.1719 56  VAL A CB    
454  C CG1   . VAL A 56  ? 0.9464 1.2604 1.1528 0.2684  0.0365  -0.1236 56  VAL A CG1   
455  C CG2   . VAL A 56  ? 0.9918 1.3815 1.1937 0.2448  0.0511  -0.1925 56  VAL A CG2   
456  N N     . VAL A 57  ? 0.9222 1.1179 1.1457 0.2414  0.0533  -0.1053 57  VAL A N     
457  C CA    . VAL A 57  ? 0.9099 1.0701 1.1459 0.2424  0.0439  -0.0825 57  VAL A CA    
458  C C     . VAL A 57  ? 0.9187 1.0820 1.1375 0.2583  0.0494  -0.0523 57  VAL A C     
459  O O     . VAL A 57  ? 1.4320 1.5845 1.6073 0.2686  0.0729  -0.0305 57  VAL A O     
460  C CB    . VAL A 57  ? 1.2014 1.3174 1.4153 0.2304  0.0640  -0.0735 57  VAL A CB    
461  C CG1   . VAL A 57  ? 0.9611 1.0489 1.1776 0.2293  0.0574  -0.0501 57  VAL A CG1   
462  C CG2   . VAL A 57  ? 1.2313 1.3571 1.4709 0.2182  0.0534  -0.1107 57  VAL A CG2   
463  N N     . ILE A 58  ? 1.1006 1.2778 1.3570 0.2606  0.0276  -0.0520 58  ILE A N     
464  C CA    . ILE A 58  ? 0.9572 1.1543 1.2149 0.2754  0.0286  -0.0347 58  ILE A CA    
465  C C     . ILE A 58  ? 1.0386 1.2033 1.2996 0.2671  0.0382  -0.0137 58  ILE A C     
466  O O     . ILE A 58  ? 1.4122 1.5589 1.6960 0.2488  0.0269  -0.0164 58  ILE A O     
467  C CB    . ILE A 58  ? 1.0874 1.3388 1.3939 0.2790  0.0015  -0.0598 58  ILE A CB    
468  C CG1   . ILE A 58  ? 0.9172 1.2097 1.2215 0.2836  -0.0076 -0.0894 58  ILE A CG1   
469  C CG2   . ILE A 58  ? 1.4044 1.6907 1.7185 0.2962  0.0012  -0.0494 58  ILE A CG2   
470  C CD1   . ILE A 58  ? 1.0046 1.3469 1.3697 0.2813  -0.0352 -0.1266 58  ILE A CD1   
471  N N     . LEU A 59  ? 0.9219 1.0791 1.1591 0.2812  0.0586  0.0070  59  LEU A N     
472  C CA    . LEU A 59  ? 1.2854 1.4258 1.5280 0.2735  0.0723  0.0199  59  LEU A CA    
473  C C     . LEU A 59  ? 1.2060 1.3895 1.4748 0.2918  0.0702  0.0209  59  LEU A C     
474  O O     . LEU A 59  ? 1.4120 1.6284 1.6791 0.3177  0.0609  0.0190  59  LEU A O     
475  C CB    . LEU A 59  ? 1.6203 1.7157 1.8246 0.2732  0.1013  0.0326  59  LEU A CB    
476  C CG    . LEU A 59  ? 0.9527 1.0128 1.1313 0.2581  0.1090  0.0258  59  LEU A CG    
477  C CD1   . LEU A 59  ? 1.2088 1.2734 1.4072 0.2391  0.0833  0.0114  59  LEU A CD1   
478  C CD2   . LEU A 59  ? 1.5261 1.5791 1.6790 0.2692  0.1190  0.0255  59  LEU A CD2   
479  N N     . GLU A 60  ? 1.3761 1.5658 1.6686 0.2774  0.0785  0.0216  60  GLU A N     
480  C CA    . GLU A 60  ? 1.4094 1.6496 1.7396 0.2906  0.0793  0.0139  60  GLU A CA    
481  C C     . GLU A 60  ? 1.0299 1.2574 1.3455 0.3088  0.1043  0.0234  60  GLU A C     
482  O O     . GLU A 60  ? 1.0444 1.2338 1.3383 0.2911  0.1261  0.0296  60  GLU A O     
483  C CB    . GLU A 60  ? 1.8365 2.0966 2.2092 0.2574  0.0778  0.0035  60  GLU A CB    
484  C CG    . GLU A 60  ? 1.5959 1.9252 2.0253 0.2641  0.0759  -0.0171 60  GLU A CG    
485  C CD    . GLU A 60  ? 1.9115 2.2476 2.3740 0.2216  0.0900  -0.0226 60  GLU A CD    
486  O OE1   . GLU A 60  ? 1.9472 2.2285 2.3801 0.1903  0.0962  -0.0042 60  GLU A OE1   
487  O OE2   . GLU A 60  ? 2.2281 2.6257 2.7452 0.2186  0.0947  -0.0453 60  GLU A OE2   
488  N N     . LYS A 61  ? 0.9603 1.2207 1.2886 0.3469  0.0987  0.0220  61  LYS A N     
489  C CA    . LYS A 61  ? 1.0697 1.3102 1.3898 0.3734  0.1185  0.0300  61  LYS A CA    
490  C C     . LYS A 61  ? 1.0673 1.3263 1.4214 0.3528  0.1414  0.0139  61  LYS A C     
491  O O     . LYS A 61  ? 1.6150 1.9313 2.0158 0.3385  0.1376  -0.0051 61  LYS A O     
492  C CB    . LYS A 61  ? 1.0172 1.2954 1.3496 0.4239  0.0988  0.0325  61  LYS A CB    
493  C CG    . LYS A 61  ? 1.2065 1.4594 1.5375 0.4631  0.1118  0.0424  61  LYS A CG    
494  C CD    . LYS A 61  ? 1.3085 1.6036 1.6473 0.5177  0.0811  0.0488  61  LYS A CD    
495  C CE    . LYS A 61  ? 1.2967 1.5806 1.6570 0.5653  0.0857  0.0523  61  LYS A CE    
496  N NZ    . LYS A 61  ? 1.8405 2.2142 2.2832 0.5750  0.0790  0.0127  61  LYS A NZ    
497  N N     . GLN A 62  ? 1.0941 1.3080 1.4255 0.3478  0.1685  0.0175  62  GLN A N     
498  C CA    . GLN A 62  ? 1.5221 1.7543 1.8752 0.3257  0.1957  -0.0008 62  GLN A CA    
499  C C     . GLN A 62  ? 1.6460 1.8770 2.0219 0.3632  0.2120  -0.0118 62  GLN A C     
500  O O     . GLN A 62  ? 2.1149 2.3012 2.4715 0.3990  0.2070  0.0043  62  GLN A O     
501  C CB    . GLN A 62  ? 1.4436 1.6316 1.7523 0.2852  0.2130  0.0044  62  GLN A CB    
502  C CG    . GLN A 62  ? 1.1593 1.3317 1.4428 0.2554  0.1923  0.0183  62  GLN A CG    
503  C CD    . GLN A 62  ? 1.3889 1.5983 1.6961 0.2228  0.1890  0.0148  62  GLN A CD    
504  O OE1   . GLN A 62  ? 2.0191 2.2706 2.3559 0.2128  0.2088  -0.0002 62  GLN A OE1   
505  N NE2   . GLN A 62  ? 1.2484 1.4411 1.5470 0.2044  0.1659  0.0263  62  GLN A NE2   
506  N N     . GLY A 63  ? 1.3588 1.6364 1.7768 0.3542  0.2334  -0.0400 63  GLY A N     
507  C CA    . GLY A 63  ? 1.2551 1.5311 1.7049 0.3906  0.2496  -0.0581 63  GLY A CA    
508  C C     . GLY A 63  ? 1.7614 1.9699 2.1745 0.3795  0.2768  -0.0578 63  GLY A C     
509  O O     . GLY A 63  ? 2.2248 2.3989 2.5884 0.3420  0.2830  -0.0468 63  GLY A O     
510  N N     . PHE A 64  ? 1.8357 2.0282 2.2810 0.4145  0.2921  -0.0752 64  PHE A N     
511  C CA    . PHE A 64  ? 2.2081 2.3366 2.6308 0.4055  0.3203  -0.0833 64  PHE A CA    
512  C C     . PHE A 64  ? 2.2653 2.4349 2.6951 0.3622  0.3534  -0.1224 64  PHE A C     
513  O O     . PHE A 64  ? 1.9885 2.1188 2.3888 0.3399  0.3750  -0.1330 64  PHE A O     
514  C CB    . PHE A 64  ? 2.4887 2.5696 2.9450 0.4612  0.3238  -0.0857 64  PHE A CB    
515  C CG    . PHE A 64  ? 2.5965 2.5952 3.0320 0.4533  0.3521  -0.0912 64  PHE A CG    
516  C CD1   . PHE A 64  ? 2.4988 2.4352 2.8729 0.4286  0.3523  -0.0636 64  PHE A CD1   
517  C CD2   . PHE A 64  ? 2.6794 2.6672 3.1655 0.4701  0.3795  -0.1306 64  PHE A CD2   
518  C CE1   . PHE A 64  ? 2.2708 2.1369 2.6336 0.4169  0.3808  -0.0752 64  PHE A CE1   
519  C CE2   . PHE A 64  ? 2.6623 2.5741 3.1371 0.4598  0.4075  -0.1420 64  PHE A CE2   
520  C CZ    . PHE A 64  ? 2.5269 2.3782 2.9398 0.4316  0.4088  -0.1140 64  PHE A CZ    
521  N N     . LYS A 65  ? 2.3542 2.6067 2.8210 0.3473  0.3594  -0.1463 65  LYS A N     
522  C CA    . LYS A 65  ? 2.3670 2.6689 2.8335 0.3026  0.3942  -0.1825 65  LYS A CA    
523  C C     . LYS A 65  ? 2.3486 2.6657 2.7568 0.2467  0.3896  -0.1593 65  LYS A C     
524  O O     . LYS A 65  ? 2.6785 3.0588 3.0987 0.2157  0.3997  -0.1690 65  LYS A O     
525  C CB    . LYS A 65  ? 2.6517 3.0378 3.1972 0.3165  0.4110  -0.2277 65  LYS A CB    
526  C CG    . LYS A 65  ? 2.7866 3.2254 3.3771 0.3370  0.3837  -0.2194 65  LYS A CG    
527  C CD    . LYS A 65  ? 2.9726 3.5060 3.6529 0.3511  0.4020  -0.2746 65  LYS A CD    
528  C CE    . LYS A 65  ? 3.0259 3.6236 3.7592 0.3711  0.3734  -0.2747 65  LYS A CE    
529  N NZ    . LYS A 65  ? 2.8461 3.5483 3.6786 0.3859  0.3906  -0.3367 65  LYS A NZ    
530  N N     . SER A 66  ? 2.0385 2.2938 2.3849 0.2337  0.3749  -0.1289 66  SER A N     
531  C CA    . SER A 66  ? 1.6935 1.9480 1.9821 0.1882  0.3645  -0.1038 66  SER A CA    
532  C C     . SER A 66  ? 1.7448 1.9373 1.9795 0.1828  0.3540  -0.0890 66  SER A C     
533  O O     . SER A 66  ? 1.8289 1.9741 2.0727 0.2137  0.3486  -0.0866 66  SER A O     
534  C CB    . SER A 66  ? 1.4949 1.7608 1.7954 0.1884  0.3348  -0.0752 66  SER A CB    
535  O OG    . SER A 66  ? 1.0831 1.3133 1.3968 0.2297  0.3075  -0.0581 66  SER A OG    
536  N N     . PRO A 67  ? 2.2213 2.4133 2.3993 0.1440  0.3510  -0.0793 67  PRO A N     
537  C CA    . PRO A 67  ? 2.4636 2.6080 2.5988 0.1406  0.3353  -0.0705 67  PRO A CA    
538  C C     . PRO A 67  ? 2.2155 2.3223 2.3497 0.1567  0.2999  -0.0390 67  PRO A C     
539  O O     . PRO A 67  ? 2.4568 2.5261 2.5742 0.1624  0.2899  -0.0386 67  PRO A O     
540  C CB    . PRO A 67  ? 2.6573 2.8227 2.7325 0.0993  0.3345  -0.0659 67  PRO A CB    
541  C CG    . PRO A 67  ? 2.4692 2.6917 2.5533 0.0780  0.3651  -0.0818 67  PRO A CG    
542  C CD    . PRO A 67  ? 2.1853 2.4226 2.3338 0.1014  0.3646  -0.0790 67  PRO A CD    
543  N N     . ASN A 68  ? 1.2388 1.3618 1.3966 0.1625  0.2831  -0.0195 68  ASN A N     
544  C CA    . ASN A 68  ? 1.3803 1.4779 1.5429 0.1784  0.2511  0.0023  68  ASN A CA    
545  C C     . ASN A 68  ? 1.5057 1.5738 1.6842 0.2139  0.2536  -0.0013 68  ASN A C     
546  O O     . ASN A 68  ? 1.5320 1.5729 1.6986 0.2216  0.2348  0.0103  68  ASN A O     
547  C CB    . ASN A 68  ? 1.5004 1.6298 1.6943 0.1767  0.2362  0.0141  68  ASN A CB    
548  C CG    . ASN A 68  ? 1.1465 1.2896 1.3193 0.1362  0.2360  0.0256  68  ASN A CG    
549  O OD1   . ASN A 68  ? 1.4222 1.5607 1.5520 0.1119  0.2489  0.0250  68  ASN A OD1   
550  N ND2   . ASN A 68  ? 1.2135 1.3725 1.4138 0.1272  0.2218  0.0362  68  ASN A ND2   
551  N N     . SER A 69  ? 1.2230 1.2936 1.4275 0.2352  0.2778  -0.0174 69  SER A N     
552  C CA    . SER A 69  ? 1.5483 1.5747 1.7593 0.2685  0.2820  -0.0129 69  SER A CA    
553  C C     . SER A 69  ? 1.3989 1.3769 1.5791 0.2538  0.2942  -0.0204 69  SER A C     
554  O O     . SER A 69  ? 1.6994 1.6380 1.8661 0.2642  0.2887  -0.0068 69  SER A O     
555  C CB    . SER A 69  ? 1.2941 1.3267 1.5460 0.2986  0.3025  -0.0288 69  SER A CB    
556  O OG    . SER A 69  ? 1.7290 1.7695 1.9863 0.2797  0.3329  -0.0611 69  SER A OG    
557  N N     . LYS A 70  ? 1.1711 1.1581 1.3397 0.2273  0.3124  -0.0456 70  LYS A N     
558  C CA    . LYS A 70  ? 1.3884 1.3424 1.5349 0.2106  0.3220  -0.0614 70  LYS A CA    
559  C C     . LYS A 70  ? 1.5217 1.4758 1.6416 0.1963  0.2920  -0.0471 70  LYS A C     
560  O O     . LYS A 70  ? 1.1132 1.0372 1.2264 0.1930  0.2948  -0.0536 70  LYS A O     
561  C CB    . LYS A 70  ? 1.6738 1.6509 1.8135 0.1863  0.3448  -0.0981 70  LYS A CB    
562  C CG    . LYS A 70  ? 1.3305 1.3477 1.4305 0.1553  0.3262  -0.0987 70  LYS A CG    
563  C CD    . LYS A 70  ? 1.4624 1.5133 1.5519 0.1343  0.3522  -0.1366 70  LYS A CD    
564  C CE    . LYS A 70  ? 2.0039 2.0931 2.0394 0.1050  0.3320  -0.1310 70  LYS A CE    
565  N NZ    . LYS A 70  ? 1.7185 1.8293 1.7391 0.0977  0.3171  -0.0951 70  LYS A NZ    
566  N N     . ILE A 71  ? 1.1205 1.1067 1.2311 0.1875  0.2645  -0.0298 71  ILE A N     
567  C CA    . ILE A 71  ? 1.0625 1.0452 1.1598 0.1809  0.2326  -0.0188 71  ILE A CA    
568  C C     . ILE A 71  ? 1.1627 1.1272 1.2746 0.2024  0.2247  -0.0056 71  ILE A C     
569  O O     . ILE A 71  ? 1.3567 1.3092 1.4630 0.1989  0.2153  -0.0113 71  ILE A O     
570  C CB    . ILE A 71  ? 1.1854 1.1935 1.2727 0.1669  0.2055  -0.0010 71  ILE A CB    
571  C CG1   . ILE A 71  ? 1.2273 1.2545 1.2847 0.1431  0.2161  -0.0088 71  ILE A CG1   
572  C CG2   . ILE A 71  ? 1.0406 1.0410 1.1234 0.1644  0.1697  0.0051  71  ILE A CG2   
573  C CD1   . ILE A 71  ? 1.3905 1.4299 1.4276 0.1249  0.1941  0.0168  71  ILE A CD1   
574  N N     . ILE A 72  ? 1.4242 1.3939 1.5546 0.2253  0.2284  0.0088  72  ILE A N     
575  C CA    . ILE A 72  ? 1.4379 1.3964 1.5717 0.2482  0.2200  0.0238  72  ILE A CA    
576  C C     . ILE A 72  ? 1.3036 1.2147 1.4204 0.2501  0.2439  0.0201  72  ILE A C     
577  O O     . ILE A 72  ? 1.3345 1.2363 1.4382 0.2471  0.2380  0.0227  72  ILE A O     
578  C CB    . ILE A 72  ? 1.1067 1.0851 1.2630 0.2773  0.2180  0.0366  72  ILE A CB    
579  C CG1   . ILE A 72  ? 1.6475 1.6761 1.8265 0.2708  0.1932  0.0383  72  ILE A CG1   
580  C CG2   . ILE A 72  ? 1.0744 1.0321 1.2196 0.3064  0.2154  0.0547  72  ILE A CG2   
581  C CD1   . ILE A 72  ? 2.1362 2.1998 2.3461 0.3000  0.1865  0.0427  72  ILE A CD1   
582  N N     . TYR A 73  ? 1.3081 1.1890 1.4286 0.2524  0.2745  0.0104  73  TYR A N     
583  C CA    . TYR A 73  ? 1.1591 0.9834 1.2679 0.2511  0.3029  0.0080  73  TYR A CA    
584  C C     . TYR A 73  ? 1.1509 0.9745 1.2512 0.2173  0.3086  -0.0192 73  TYR A C     
585  O O     . TYR A 73  ? 1.1769 0.9687 1.2660 0.2084  0.3243  -0.0200 73  TYR A O     
586  C CB    . TYR A 73  ? 1.2190 1.0067 1.3455 0.2637  0.3339  -0.0004 73  TYR A CB    
587  C CG    . TYR A 73  ? 1.4321 1.2144 1.5725 0.3053  0.3277  0.0249  73  TYR A CG    
588  C CD1   . TYR A 73  ? 1.7398 1.4816 1.8597 0.3323  0.3245  0.0595  73  TYR A CD1   
589  C CD2   . TYR A 73  ? 1.6365 1.4596 1.8094 0.3180  0.3245  0.0125  73  TYR A CD2   
590  C CE1   . TYR A 73  ? 1.5859 1.3287 1.7185 0.3768  0.3117  0.0820  73  TYR A CE1   
591  C CE2   . TYR A 73  ? 1.8597 1.6892 2.0560 0.3597  0.3154  0.0281  73  TYR A CE2   
592  C CZ    . TYR A 73  ? 1.7895 1.5786 1.9660 0.3920  0.3058  0.0632  73  TYR A CZ    
593  O OH    . TYR A 73  ? 2.1369 1.9379 2.3364 0.4395  0.2900  0.0780  73  TYR A OH    
594  N N     . PHE A 74  ? 1.9667 1.8288 2.0707 0.1978  0.2953  -0.0418 74  PHE A N     
595  C CA    . PHE A 74  ? 1.6840 1.5588 1.7845 0.1723  0.2898  -0.0699 74  PHE A CA    
596  C C     . PHE A 74  ? 1.2050 1.0941 1.3037 0.1734  0.2652  -0.0615 74  PHE A C     
597  O O     . PHE A 74  ? 1.1785 1.0620 1.2800 0.1584  0.2757  -0.0820 74  PHE A O     
598  C CB    . PHE A 74  ? 1.5318 1.4478 1.6270 0.1578  0.2708  -0.0879 74  PHE A CB    
599  C CG    . PHE A 74  ? 1.3951 1.3336 1.4902 0.1389  0.2555  -0.1187 74  PHE A CG    
600  C CD1   . PHE A 74  ? 1.2665 1.2038 1.3692 0.1201  0.2804  -0.1598 74  PHE A CD1   
601  C CD2   . PHE A 74  ? 1.4511 1.4149 1.5471 0.1416  0.2151  -0.1124 74  PHE A CD2   
602  C CE1   . PHE A 74  ? 1.2292 1.1992 1.3396 0.1052  0.2634  -0.1949 74  PHE A CE1   
603  C CE2   . PHE A 74  ? 1.1355 1.1258 1.2400 0.1305  0.1964  -0.1451 74  PHE A CE2   
604  C CZ    . PHE A 74  ? 1.2905 1.2883 1.4018 0.1127  0.2196  -0.1869 74  PHE A CZ    
605  N N     . ILE A 75  ? 1.4775 1.3902 1.5776 0.1887  0.2349  -0.0379 75  ILE A N     
606  C CA    . ILE A 75  ? 1.3919 1.3244 1.4972 0.1910  0.2110  -0.0369 75  ILE A CA    
607  C C     . ILE A 75  ? 1.1043 1.0122 1.1959 0.1970  0.2345  -0.0267 75  ILE A C     
608  O O     . ILE A 75  ? 1.0662 0.9846 1.1582 0.1851  0.2356  -0.0431 75  ILE A O     
609  C CB    . ILE A 75  ? 1.4141 1.3752 1.5306 0.2040  0.1766  -0.0184 75  ILE A CB    
610  C CG1   . ILE A 75  ? 1.1683 1.1442 1.2879 0.1921  0.1544  -0.0232 75  ILE A CG1   
611  C CG2   . ILE A 75  ? 0.9882 0.9720 1.1165 0.2092  0.1549  -0.0228 75  ILE A CG2   
612  C CD1   . ILE A 75  ? 1.4083 1.4006 1.5392 0.1974  0.1300  -0.0026 75  ILE A CD1   
613  N N     . LYS A 76  ? 1.3096 1.1855 1.3875 0.2159  0.2535  0.0003  76  LYS A N     
614  C CA    . LYS A 76  ? 1.1750 1.0155 1.2260 0.2240  0.2758  0.0207  76  LYS A CA    
615  C C     . LYS A 76  ? 1.1863 0.9915 1.2295 0.1948  0.3120  0.0000  76  LYS A C     
616  O O     . LYS A 76  ? 1.2088 1.0131 1.2338 0.1823  0.3233  -0.0007 76  LYS A O     
617  C CB    . LYS A 76  ? 1.2727 1.0754 1.3139 0.2542  0.2877  0.0526  76  LYS A CB    
618  C CG    . LYS A 76  ? 1.3911 1.2325 1.4370 0.2863  0.2560  0.0745  76  LYS A CG    
619  C CD    . LYS A 76  ? 1.5688 1.3746 1.6122 0.3208  0.2665  0.1004  76  LYS A CD    
620  C CE    . LYS A 76  ? 1.9789 1.8264 2.0220 0.3568  0.2352  0.1218  76  LYS A CE    
621  N NZ    . LYS A 76  ? 1.8188 1.6579 1.8141 0.3665  0.2312  0.1469  76  LYS A NZ    
622  N N     . GLY A 77  ? 1.6451 1.4276 1.7042 0.1801  0.3333  -0.0222 77  GLY A N     
623  C CA    . GLY A 77  ? 1.6345 1.3906 1.6975 0.1476  0.3693  -0.0516 77  GLY A CA    
624  C C     . GLY A 77  ? 1.5088 1.3211 1.5897 0.1236  0.3531  -0.0907 77  GLY A C     
625  O O     . GLY A 77  ? 1.5764 1.3830 1.6560 0.0986  0.3789  -0.1089 77  GLY A O     
626  N N     . PHE A 78  ? 1.2394 1.1060 1.3386 0.1312  0.3103  -0.1038 78  PHE A N     
627  C CA    . PHE A 78  ? 1.3970 1.3169 1.5221 0.1160  0.2870  -0.1440 78  PHE A CA    
628  C C     . PHE A 78  ? 1.2212 1.1637 1.3460 0.1142  0.2828  -0.1454 78  PHE A C     
629  O O     . PHE A 78  ? 1.2068 1.1707 1.3489 0.0902  0.2989  -0.1831 78  PHE A O     
630  C CB    . PHE A 78  ? 1.3785 1.3357 1.5153 0.1298  0.2392  -0.1452 78  PHE A CB    
631  C CG    . PHE A 78  ? 1.3258 1.3329 1.4924 0.1229  0.2065  -0.1846 78  PHE A CG    
632  C CD1   . PHE A 78  ? 1.0863 1.1141 1.2710 0.1044  0.2133  -0.2296 78  PHE A CD1   
633  C CD2   . PHE A 78  ? 1.1994 1.2357 1.3824 0.1380  0.1654  -0.1807 78  PHE A CD2   
634  C CE1   . PHE A 78  ? 1.4175 1.4972 1.6348 0.1049  0.1767  -0.2684 78  PHE A CE1   
635  C CE2   . PHE A 78  ? 1.0598 1.1387 1.2776 0.1384  0.1305  -0.2181 78  PHE A CE2   
636  C CZ    . PHE A 78  ? 0.9995 1.1016 1.2337 0.1240  0.1342  -0.2608 78  PHE A CZ    
637  N N     . PHE A 79  ? 1.7580 1.7048 1.8666 0.1374  0.2632  -0.1112 79  PHE A N     
638  C CA    . PHE A 79  ? 1.4505 1.4302 1.5583 0.1350  0.2583  -0.1192 79  PHE A CA    
639  C C     . PHE A 79  ? 1.6491 1.5917 1.7113 0.1269  0.3012  -0.0940 79  PHE A C     
640  O O     . PHE A 79  ? 1.4877 1.4609 1.5370 0.1227  0.3023  -0.0982 79  PHE A O     
641  C CB    . PHE A 79  ? 1.3923 1.4059 1.5097 0.1609  0.2144  -0.1043 79  PHE A CB    
642  C CG    . PHE A 79  ? 1.4363 1.4849 1.5979 0.1650  0.1707  -0.1301 79  PHE A CG    
643  C CD1   . PHE A 79  ? 1.0507 1.1393 1.2500 0.1533  0.1572  -0.1773 79  PHE A CD1   
644  C CD2   . PHE A 79  ? 1.5564 1.5970 1.7225 0.1808  0.1430  -0.1066 79  PHE A CD2   
645  C CE1   . PHE A 79  ? 1.0256 1.1372 1.2639 0.1634  0.1116  -0.1958 79  PHE A CE1   
646  C CE2   . PHE A 79  ? 1.5171 1.5764 1.7145 0.1842  0.1029  -0.1211 79  PHE A CE2   
647  C CZ    . PHE A 79  ? 1.4223 1.5129 1.6546 0.1785  0.0845  -0.1632 79  PHE A CZ    
648  N N     . TYR A 80  ? 1.8122 2.0460 1.4671 0.2852  0.0280  -0.1201 80  TYR A N     
649  C CA    . TYR A 80  ? 1.8560 2.1518 1.5300 0.2333  0.0153  -0.0660 80  TYR A CA    
650  C C     . TYR A 80  ? 1.6402 2.0259 1.3185 0.2155  0.0255  -0.0677 80  TYR A C     
651  O O     . TYR A 80  ? 1.4158 1.8592 1.1157 0.1715  0.0180  -0.0184 80  TYR A O     
652  C CB    . TYR A 80  ? 1.6250 1.8685 1.3622 0.2192  -0.0056 -0.0159 80  TYR A CB    
653  C CG    . TYR A 80  ? 1.8274 2.1127 1.5830 0.1679  -0.0237 0.0492  80  TYR A CG    
654  C CD1   . TYR A 80  ? 2.2281 2.5067 1.9626 0.1526  -0.0360 0.0733  80  TYR A CD1   
655  C CD2   . TYR A 80  ? 1.3431 1.6738 1.1407 0.1345  -0.0303 0.0890  80  TYR A CD2   
656  C CE1   . TYR A 80  ? 1.8614 2.1795 1.6091 0.1092  -0.0545 0.1353  80  TYR A CE1   
657  C CE2   . TYR A 80  ? 1.3329 1.6991 1.1460 0.0886  -0.0470 0.1552  80  TYR A CE2   
658  C CZ    . TYR A 80  ? 1.5573 1.9175 1.3424 0.0780  -0.0594 0.1783  80  TYR A CZ    
659  O OH    . TYR A 80  ? 1.9300 2.3272 1.7272 0.0356  -0.0780 0.2466  80  TYR A OH    
660  N N     . ASN A 81  ? 2.3244 2.7298 1.9833 0.2486  0.0436  -0.1218 81  ASN A N     
661  C CA    . ASN A 81  ? 2.4228 2.9189 2.0951 0.2343  0.0546  -0.1265 81  ASN A CA    
662  C C     . ASN A 81  ? 2.4977 3.0933 2.1154 0.2167  0.0689  -0.1362 81  ASN A C     
663  O O     . ASN A 81  ? 2.8186 3.4981 2.4465 0.1729  0.0697  -0.0937 81  ASN A O     
664  C CB    . ASN A 81  ? 2.6339 3.1117 2.3169 0.2810  0.0648  -0.1807 81  ASN A CB    
665  C CG    . ASN A 81  ? 2.9167 3.4337 2.6643 0.2636  0.0604  -0.1654 81  ASN A CG    
666  O OD1   . ASN A 81  ? 2.9565 3.5585 2.7245 0.2195  0.0629  -0.1316 81  ASN A OD1   
667  N ND2   . ASN A 81  ? 3.0047 3.4622 2.7867 0.2975  0.0531  -0.1892 81  ASN A ND2   
668  N N     . SER A 82  ? 2.2306 2.8182 1.7905 0.2510  0.0797  -0.1906 82  SER A N     
669  C CA    . SER A 82  ? 2.4641 3.1468 1.9686 0.2409  0.0921  -0.2100 82  SER A CA    
670  C C     . SER A 82  ? 1.7279 2.3667 1.1764 0.2811  0.0959  -0.2706 82  SER A C     
671  O O     . SER A 82  ? 1.4988 2.0478 0.9524 0.3218  0.0959  -0.3028 82  SER A O     
672  C CB    . SER A 82  ? 3.1007 3.8892 2.6135 0.2405  0.1118  -0.2281 82  SER A CB    
673  O OG    . SER A 82  ? 3.3519 4.1065 2.8743 0.2898  0.1206  -0.2832 82  SER A OG    
674  N N     . ASN A 83  ? 1.8428 2.5459 1.2384 0.2681  0.0978  -0.2832 83  ASN A N     
675  C CA    . ASN A 83  ? 1.9072 2.5768 1.2816 0.2906  0.0981  -0.3352 83  ASN A CA    
676  C C     . ASN A 83  ? 1.7248 2.2810 1.0907 0.3084  0.0846  -0.3511 83  ASN A C     
677  O O     . ASN A 83  ? 1.9215 2.4402 1.2789 0.3164  0.0804  -0.3834 83  ASN A O     
678  C CB    . ASN A 83  ? 1.8571 2.5098 1.2703 0.3155  0.1078  -0.3660 83  ASN A CB    
679  C CG    . ASN A 83  ? 2.2135 2.9865 1.6383 0.2998  0.1219  -0.3574 83  ASN A CG    
680  O OD1   . ASN A 83  ? 1.9824 2.8549 1.3813 0.2689  0.1266  -0.3356 83  ASN A OD1   
681  N ND2   . ASN A 83  ? 2.2835 3.0532 1.7492 0.3189  0.1281  -0.3709 83  ASN A ND2   
682  N N     . THR A 84  ? 1.6426 2.1434 1.0165 0.3128  0.0772  -0.3253 84  THR A N     
683  C CA    . THR A 84  ? 1.6237 2.0151 1.0008 0.3305  0.0670  -0.3351 84  THR A CA    
684  C C     . THR A 84  ? 1.2503 1.6180 0.6556 0.2918  0.0471  -0.2742 84  THR A C     
685  O O     . THR A 84  ? 1.4608 1.8148 0.9125 0.2776  0.0428  -0.2267 84  THR A O     
686  C CB    . THR A 84  ? 1.7443 2.0459 1.1590 0.3674  0.0745  -0.3455 84  THR A CB    
687  O OG1   . THR A 84  ? 1.8576 2.1855 1.3050 0.3649  0.0785  -0.3177 84  THR A OG1   
688  C CG2   . THR A 84  ? 1.2439 1.5203 0.6825 0.3766  0.0801  -0.3735 84  THR A CG2   
689  N N     . LYS A 85  ? 1.5792 1.9434 0.9598 0.2761  0.0326  -0.2781 85  LYS A N     
690  C CA    . LYS A 85  ? 1.8204 2.1629 1.2283 0.2429  0.0113  -0.2239 85  LYS A CA    
691  C C     . LYS A 85  ? 1.4890 1.7205 0.9286 0.2636  0.0073  -0.2272 85  LYS A C     
692  O O     . LYS A 85  ? 1.8986 2.0853 1.3183 0.2846  0.0092  -0.2721 85  LYS A O     
693  C CB    . LYS A 85  ? 1.4235 1.8311 0.7902 0.2135  -0.0054 -0.2242 85  LYS A CB    
694  C CG    . LYS A 85  ? 1.6411 2.1525 0.9979 0.1755  -0.0097 -0.1753 85  LYS A CG    
695  C CD    . LYS A 85  ? 2.2950 2.7797 1.7112 0.1519  -0.0204 -0.1016 85  LYS A CD    
696  C CE    . LYS A 85  ? 2.1562 2.5795 1.5990 0.1410  -0.0448 -0.0744 85  LYS A CE    
697  N NZ    . LYS A 85  ? 1.6726 2.0608 1.1781 0.1261  -0.0557 -0.0092 85  LYS A NZ    
698  N N     . VAL A 86  ? 1.2500 1.4382 0.7412 0.2588  0.0026  -0.1803 86  VAL A N     
699  C CA    . VAL A 86  ? 1.4831 1.5817 1.0084 0.2721  -0.0016 -0.1715 86  VAL A CA    
700  C C     . VAL A 86  ? 1.4919 1.6026 1.0322 0.2361  -0.0262 -0.1347 86  VAL A C     
701  O O     . VAL A 86  ? 1.5591 1.7169 1.1145 0.2060  -0.0404 -0.0873 86  VAL A O     
702  C CB    . VAL A 86  ? 1.5563 1.6048 1.1286 0.2926  0.0061  -0.1467 86  VAL A CB    
703  C CG1   . VAL A 86  ? 1.2922 1.3125 0.8490 0.3367  0.0283  -0.1902 86  VAL A CG1   
704  C CG2   . VAL A 86  ? 2.2505 2.3476 1.8515 0.2656  -0.0039 -0.0999 86  VAL A CG2   
705  N N     . ILE A 87  ? 1.2943 1.3654 0.8316 0.2382  -0.0329 -0.1564 87  ILE A N     
706  C CA    . ILE A 87  ? 1.4018 1.4824 0.9583 0.2072  -0.0582 -0.1275 87  ILE A CA    
707  C C     . ILE A 87  ? 1.5773 1.5742 1.1819 0.2215  -0.0559 -0.1213 87  ILE A C     
708  O O     . ILE A 87  ? 1.4131 1.3524 1.0130 0.2493  -0.0390 -0.1576 87  ILE A O     
709  C CB    . ILE A 87  ? 1.3046 1.4376 0.8127 0.1885  -0.0737 -0.1625 87  ILE A CB    
710  C CG1   . ILE A 87  ? 2.2549 2.3380 1.7417 0.2143  -0.0634 -0.2271 87  ILE A CG1   
711  C CG2   . ILE A 87  ? 1.3237 1.5527 0.7826 0.1749  -0.0727 -0.1635 87  ILE A CG2   
712  C CD1   . ILE A 87  ? 2.4916 2.5268 2.0077 0.2038  -0.0801 -0.2339 87  ILE A CD1   
713  N N     . VAL A 88  ? 1.3939 1.3860 1.0469 0.2044  -0.0716 -0.0724 88  VAL A N     
714  C CA    . VAL A 88  ? 1.3415 1.2683 1.0473 0.2161  -0.0682 -0.0590 88  VAL A CA    
715  C C     . VAL A 88  ? 1.4333 1.3755 1.1564 0.1867  -0.0936 -0.0541 88  VAL A C     
716  O O     . VAL A 88  ? 1.4597 1.4510 1.1956 0.1591  -0.1190 -0.0185 88  VAL A O     
717  C CB    . VAL A 88  ? 1.1595 1.0679 0.9156 0.2261  -0.0659 -0.0123 88  VAL A CB    
718  C CG1   . VAL A 88  ? 1.9019 1.7526 1.7095 0.2421  -0.0578 -0.0015 88  VAL A CG1   
719  C CG2   . VAL A 88  ? 1.1379 1.0357 0.8782 0.2538  -0.0452 -0.0230 88  VAL A CG2   
720  N N     . ARG A 89  ? 1.4508 1.3507 1.1768 0.1923  -0.0887 -0.0894 89  ARG A N     
721  C CA    . ARG A 89  ? 1.5375 1.4468 1.2864 0.1648  -0.1135 -0.0940 89  ARG A CA    
722  C C     . ARG A 89  ? 1.5642 1.4318 1.3876 0.1666  -0.1105 -0.0593 89  ARG A C     
723  O O     . ARG A 89  ? 1.2594 1.0743 1.1059 0.1956  -0.0830 -0.0498 89  ARG A O     
724  C CB    . ARG A 89  ? 1.3554 1.2381 1.0752 0.1674  -0.1122 -0.1544 89  ARG A CB    
725  C CG    . ARG A 89  ? 1.4881 1.4104 1.1341 0.1729  -0.1116 -0.1999 89  ARG A CG    
726  C CD    . ARG A 89  ? 1.3948 1.4044 1.0064 0.1411  -0.1435 -0.2041 89  ARG A CD    
727  N NE    . ARG A 89  ? 2.1858 2.2013 1.8334 0.1131  -0.1740 -0.2020 89  ARG A NE    
728  C CZ    . ARG A 89  ? 2.0208 2.0022 1.6772 0.1084  -0.1846 -0.2496 89  ARG A CZ    
729  N NH1   . ARG A 89  ? 2.5176 2.5123 2.2141 0.0801  -0.2152 -0.2453 89  ARG A NH1   
730  N NH2   . ARG A 89  ? 1.7391 1.6712 1.3696 0.1323  -0.1666 -0.3015 89  ARG A NH2   
731  N N     . ASN A 90  ? 1.8775 1.7770 1.7383 0.1372  -0.1392 -0.0397 90  ASN A N     
732  C CA    . ASN A 90  ? 1.7970 1.6651 1.7336 0.1368  -0.1364 -0.0132 90  ASN A CA    
733  C C     . ASN A 90  ? 1.6688 1.4714 1.6180 0.1478  -0.1149 -0.0466 90  ASN A C     
734  O O     . ASN A 90  ? 1.6725 1.4623 1.5783 0.1455  -0.1166 -0.0944 90  ASN A O     
735  C CB    . ASN A 90  ? 1.9008 1.8207 1.8758 0.1019  -0.1747 0.0058  90  ASN A CB    
736  C CG    . ASN A 90  ? 2.0700 2.0349 2.0661 0.0977  -0.1917 0.0590  90  ASN A CG    
737  O OD1   . ASN A 90  ? 2.3860 2.3325 2.3874 0.1214  -0.1730 0.0845  90  ASN A OD1   
738  N ND2   . ASN A 90  ? 2.0794 2.1021 2.0904 0.0687  -0.2297 0.0753  90  ASN A ND2   
739  N N     . PRO A 91  ? 1.5494 1.3103 1.5580 0.1612  -0.0939 -0.0216 91  PRO A N     
740  C CA    . PRO A 91  ? 1.6122 1.3094 1.6385 0.1685  -0.0729 -0.0442 91  PRO A CA    
741  C C     . PRO A 91  ? 1.5803 1.2862 1.6204 0.1320  -0.1022 -0.0768 91  PRO A C     
742  O O     . PRO A 91  ? 1.7944 1.5401 1.8849 0.1022  -0.1289 -0.0600 91  PRO A O     
743  C CB    . PRO A 91  ? 1.7174 1.3945 1.8148 0.1814  -0.0506 0.0004  91  PRO A CB    
744  C CG    . PRO A 91  ? 1.8736 1.6099 2.0027 0.1717  -0.0714 0.0388  91  PRO A CG    
745  C CD    . PRO A 91  ? 1.7808 1.5522 1.8445 0.1720  -0.0876 0.0290  91  PRO A CD    
746  N N     . THR A 92  ? 1.7685 1.4391 1.7640 0.1363  -0.1001 -0.1274 92  THR A N     
747  C CA    . THR A 92  ? 2.0516 1.7244 2.0564 0.1048  -0.1304 -0.1696 92  THR A CA    
748  C C     . THR A 92  ? 2.1157 1.7651 2.2123 0.0809  -0.1340 -0.1494 92  THR A C     
749  O O     . THR A 92  ? 2.4124 2.1111 2.5506 0.0471  -0.1674 -0.1443 92  THR A O     
750  C CB    . THR A 92  ? 2.2704 1.8898 2.2239 0.1223  -0.1211 -0.2267 92  THR A CB    
751  O OG1   . THR A 92  ? 2.1825 1.7201 2.1627 0.1471  -0.0850 -0.2138 92  THR A OG1   
752  C CG2   . THR A 92  ? 2.2601 1.9123 2.1291 0.1467  -0.1147 -0.2452 92  THR A CG2   
753  N N     . PHE A 93  ? 2.3647 1.9437 2.4954 0.0979  -0.0999 -0.1358 93  PHE A N     
754  C CA    . PHE A 93  ? 2.4853 2.0469 2.7102 0.0766  -0.0950 -0.1057 93  PHE A CA    
755  C C     . PHE A 93  ? 2.6008 2.2116 2.8689 0.0822  -0.0855 -0.0468 93  PHE A C     
756  O O     . PHE A 93  ? 2.6161 2.2125 2.8678 0.1184  -0.0519 -0.0173 93  PHE A O     
757  C CB    . PHE A 93  ? 2.3232 1.7963 2.5645 0.0949  -0.0589 -0.1046 93  PHE A CB    
758  C CG    . PHE A 93  ? 2.0951 1.5145 2.3086 0.0875  -0.0737 -0.1641 93  PHE A CG    
759  C CD1   . PHE A 93  ? 1.9765 1.4227 2.2035 0.0493  -0.1188 -0.2079 93  PHE A CD1   
760  C CD2   . PHE A 93  ? 2.3000 1.6461 2.4700 0.1222  -0.0461 -0.1805 93  PHE A CD2   
761  C CE1   . PHE A 93  ? 2.1510 1.5482 2.3529 0.0454  -0.1355 -0.2699 93  PHE A CE1   
762  C CE2   . PHE A 93  ? 2.1648 1.4598 2.3111 0.1189  -0.0625 -0.2390 93  PHE A CE2   
763  C CZ    . PHE A 93  ? 2.1684 1.4876 2.3316 0.0807  -0.1071 -0.2855 93  PHE A CZ    
764  N N     . LYS A 94  ? 2.5784 2.2487 2.9026 0.0491  -0.1173 -0.0327 94  LYS A N     
765  C CA    . LYS A 94  ? 2.5861 2.3084 2.9550 0.0551  -0.1149 0.0193  94  LYS A CA    
766  C C     . LYS A 94  ? 2.5741 2.3257 3.0460 0.0216  -0.1297 0.0394  94  LYS A C     
767  O O     . LYS A 94  ? 2.2635 2.0247 2.7601 -0.0154 -0.1625 0.0082  94  LYS A O     
768  C CB    . LYS A 94  ? 2.4733 2.2596 2.7926 0.0541  -0.1459 0.0213  94  LYS A CB    
769  C CG    . LYS A 94  ? 2.3999 2.2212 2.7429 0.0753  -0.1379 0.0720  94  LYS A CG    
770  C CD    . LYS A 94  ? 2.5832 2.4500 2.8637 0.0767  -0.1637 0.0734  94  LYS A CD    
771  C CE    . LYS A 94  ? 2.7265 2.6114 3.0246 0.1028  -0.1549 0.1193  94  LYS A CE    
772  N NZ    . LYS A 94  ? 2.5417 2.4690 2.7882 0.0990  -0.1816 0.1280  94  LYS A NZ    
773  N N     . GLY A 95  ? 2.8255 2.5949 3.3596 0.0358  -0.1062 0.0885  95  GLY A N     
774  C CA    . GLY A 95  ? 2.9044 2.7132 3.5449 0.0076  -0.1159 0.1136  95  GLY A CA    
775  C C     . GLY A 95  ? 2.8547 2.6157 3.5562 0.0074  -0.0749 0.1310  95  GLY A C     
776  O O     . GLY A 95  ? 2.8219 2.5132 3.4802 0.0288  -0.0414 0.1225  95  GLY A O     
777  N N     . GLY A 96  ? 2.7742 2.5773 3.5810 -0.0190 -0.0794 0.1573  96  GLY A N     
778  C CA    . GLY A 96  ? 2.6224 2.3975 3.5048 -0.0241 -0.0392 0.1862  96  GLY A CA    
779  C C     . GLY A 96  ? 2.5048 2.2508 3.3590 0.0268  0.0181  0.2217  96  GLY A C     
780  O O     . GLY A 96  ? 2.5095 2.2694 3.3041 0.0657  0.0239  0.2274  96  GLY A O     
781  N N     . SER A 97  ? 2.4662 2.1741 3.3649 0.0269  0.0600  0.2472  97  SER A N     
782  C CA    . SER A 97  ? 2.1193 1.8059 2.9881 0.0777  0.1150  0.2815  97  SER A CA    
783  C C     . SER A 97  ? 2.0155 1.6336 2.7667 0.1128  0.1233  0.2514  97  SER A C     
784  O O     . SER A 97  ? 2.4074 1.9829 3.1113 0.0946  0.0958  0.2072  97  SER A O     
785  C CB    . SER A 97  ? 2.0930 1.7594 3.0358 0.0679  0.1589  0.3218  97  SER A CB    
786  O OG    . SER A 97  ? 2.0635 1.6492 2.9962 0.0429  0.1574  0.3005  97  SER A OG    
787  N N     . TYR A 98  ? 3.4092 2.7753 3.7796 0.2676  -0.7149 -0.8643 98  TYR A N     
788  C CA    . TYR A 98  ? 3.3775 2.8228 3.5992 0.1608  -0.6949 -0.7394 98  TYR A CA    
789  C C     . TYR A 98  ? 3.2115 2.8965 3.5882 0.1621  -0.5559 -0.6837 98  TYR A C     
790  O O     . TYR A 98  ? 3.2028 2.9928 3.5212 0.0923  -0.5437 -0.5916 98  TYR A O     
791  C CB    . TYR A 98  ? 3.4225 2.7782 3.4786 0.1143  -0.7160 -0.7193 98  TYR A CB    
792  C CG    . TYR A 98  ? 3.4707 2.9367 3.4033 0.0132  -0.6754 -0.5996 98  TYR A CG    
793  C CD1   . TYR A 98  ? 3.6686 3.0941 3.4065 -0.0869 -0.7551 -0.5218 98  TYR A CD1   
794  C CD2   . TYR A 98  ? 3.3471 2.9565 3.3540 0.0159  -0.5584 -0.5681 98  TYR A CD2   
795  C CE1   . TYR A 98  ? 3.6932 3.2333 3.3274 -0.1789 -0.7185 -0.4208 98  TYR A CE1   
796  C CE2   . TYR A 98  ? 3.3606 3.0741 3.2591 -0.0705 -0.5268 -0.4641 98  TYR A CE2   
797  C CZ    . TYR A 98  ? 3.5226 3.2084 3.2415 -0.1663 -0.6067 -0.3932 98  TYR A CZ    
798  O OH    . TYR A 98  ? 3.4845 3.2873 3.1041 -0.2520 -0.5756 -0.2976 98  TYR A OH    
799  N N     . ARG A 99  ? 3.0576 2.8298 3.6289 0.2397  -0.4508 -0.7419 99  ARG A N     
800  C CA    . ARG A 99  ? 2.6822 2.6632 3.3931 0.2460  -0.3206 -0.6926 99  ARG A CA    
801  C C     . ARG A 99  ? 2.5455 2.6217 3.3828 0.2702  -0.3078 -0.6882 99  ARG A C     
802  O O     . ARG A 99  ? 2.4653 2.7061 3.3565 0.2478  -0.2336 -0.6180 99  ARG A O     
803  C CB    . ARG A 99  ? 2.6662 2.6956 3.5330 0.3150  -0.2117 -0.7593 99  ARG A CB    
804  C CG    . ARG A 99  ? 2.9720 2.9714 3.7269 0.2785  -0.1842 -0.7343 99  ARG A CG    
805  C CD    . ARG A 99  ? 3.0480 3.1915 3.7487 0.2162  -0.1137 -0.6198 99  ARG A CD    
806  N NE    . ARG A 99  ? 3.0895 3.3888 3.9707 0.2617  0.0141  -0.6190 99  ARG A NE    
807  C CZ    . ARG A 99  ? 3.0666 3.4859 3.9361 0.2334  0.0972  -0.5438 99  ARG A CZ    
808  N NH1   . ARG A 99  ? 3.0896 3.5037 3.7853 0.1602  0.0680  -0.4655 99  ARG A NH1   
809  N NH2   . ARG A 99  ? 2.8927 3.4318 3.9190 0.2786  0.2070  -0.5489 99  ARG A NH2   
810  N N     . ASN A 100 ? 2.3956 2.3704 3.2811 0.3184  -0.3814 -0.7640 100 ASN A N     
811  C CA    . ASN A 100 ? 2.3269 2.3807 3.3176 0.3362  -0.3786 -0.7584 100 ASN A CA    
812  C C     . ASN A 100 ? 2.4654 2.5586 3.3081 0.2411  -0.4258 -0.6540 100 ASN A C     
813  O O     . ASN A 100 ? 2.5209 2.7406 3.4543 0.2404  -0.3884 -0.6222 100 ASN A O     
814  C CB    . ASN A 100 ? 2.6205 2.5397 3.6696 0.4033  -0.4633 -0.8612 100 ASN A CB    
815  C CG    . ASN A 100 ? 2.5412 2.4766 3.7970 0.5059  -0.3964 -0.9754 100 ASN A CG    
816  O OD1   . ASN A 100 ? 2.4495 2.2445 3.6976 0.5527  -0.4594 -1.0681 100 ASN A OD1   
817  N ND2   . ASN A 100 ? 2.3650 2.4722 3.8050 0.5402  -0.2686 -0.9733 100 ASN A ND2   
818  N N     . ARG A 101 ? 2.7771 2.7683 3.3944 0.1581  -0.5053 -0.6036 101 ARG A N     
819  C CA    . ARG A 101 ? 2.8668 2.9151 3.3416 0.0565  -0.5382 -0.5058 101 ARG A CA    
820  C C     . ARG A 101 ? 2.6794 2.9457 3.2142 0.0286  -0.4261 -0.4278 101 ARG A C     
821  O O     . ARG A 101 ? 2.5560 2.9593 3.1236 -0.0038 -0.4013 -0.3748 101 ARG A O     
822  C CB    . ARG A 101 ? 3.4131 3.2934 3.6243 -0.0308 -0.6483 -0.4752 101 ARG A CB    
823  C CG    . ARG A 101 ? 3.6808 3.6276 3.7357 -0.1480 -0.6774 -0.3783 101 ARG A CG    
824  C CD    . ARG A 101 ? 3.9208 3.6881 3.7025 -0.2421 -0.7890 -0.3510 101 ARG A CD    
825  N NE    . ARG A 101 ? 3.8110 3.6203 3.4467 -0.3553 -0.8305 -0.2776 101 ARG A NE    
826  C CZ    . ARG A 101 ? 3.7612 3.7295 3.3402 -0.4376 -0.7824 -0.1970 101 ARG A CZ    
827  N NH1   . ARG A 101 ? 3.7139 3.8037 3.3625 -0.4166 -0.6955 -0.1744 101 ARG A NH1   
828  N NH2   . ARG A 101 ? 3.7806 3.7870 3.2313 -0.5425 -0.8222 -0.1427 101 ARG A NH2   
829  N N     . LYS A 102 ? 2.4220 2.7204 2.9703 0.0429  -0.3595 -0.4230 102 LYS A N     
830  C CA    . LYS A 102 ? 2.1099 2.5965 2.6941 0.0180  -0.2625 -0.3489 102 LYS A CA    
831  C C     . LYS A 102 ? 2.0117 2.6626 2.8098 0.0803  -0.1680 -0.3547 102 LYS A C     
832  O O     . LYS A 102 ? 2.0944 2.8990 2.9079 0.0454  -0.1355 -0.2885 102 LYS A O     
833  C CB    . LYS A 102 ? 2.0348 2.5010 2.5966 0.0309  -0.2101 -0.3538 102 LYS A CB    
834  C CG    . LYS A 102 ? 2.1339 2.7816 2.7934 0.0459  -0.0907 -0.3058 102 LYS A CG    
835  C CD    . LYS A 102 ? 2.2259 2.8430 2.8136 0.0358  -0.0529 -0.2950 102 LYS A CD    
836  C CE    . LYS A 102 ? 2.2848 3.0525 2.9866 0.0703  0.0692  -0.2657 102 LYS A CE    
837  N NZ    . LYS A 102 ? 2.0831 3.0237 2.7995 0.0381  0.0920  -0.1868 102 LYS A NZ    
838  N N     . LYS A 103 ? 2.1605 2.7841 3.1266 0.1727  -0.1227 -0.4377 103 LYS A N     
839  C CA    . LYS A 103 ? 1.9994 2.7683 3.1672 0.2329  -0.0289 -0.4475 103 LYS A CA    
840  C C     . LYS A 103 ? 1.9792 2.7968 3.1763 0.2184  -0.0716 -0.4313 103 LYS A C     
841  O O     . LYS A 103 ? 1.9251 2.9033 3.2031 0.2168  -0.0120 -0.3845 103 LYS A O     
842  C CB    . LYS A 103 ? 2.0296 2.7501 3.3628 0.3270  0.0244  -0.5491 103 LYS A CB    
843  C CG    . LYS A 103 ? 2.4088 3.1017 3.7320 0.3418  0.0867  -0.5683 103 LYS A CG    
844  C CD    . LYS A 103 ? 2.4649 3.2994 3.7759 0.3133  0.1751  -0.4836 103 LYS A CD    
845  C CE    . LYS A 103 ? 2.5272 3.3193 3.7975 0.3165  0.2290  -0.4956 103 LYS A CE    
846  N NZ    . LYS A 103 ? 2.4426 3.3575 3.6810 0.2884  0.3034  -0.4106 103 LYS A NZ    
847  N N     . GLN A 104 ? 1.6467 2.3219 2.7711 0.2073  -0.1777 -0.4701 104 GLN A N     
848  C CA    . GLN A 104 ? 1.6150 2.3187 2.7437 0.1842  -0.2259 -0.4543 104 GLN A CA    
849  C C     . GLN A 104 ? 1.6181 2.4259 2.6163 0.0843  -0.2403 -0.3554 104 GLN A C     
850  O O     . GLN A 104 ? 1.5169 2.4580 2.5819 0.0723  -0.2144 -0.3226 104 GLN A O     
851  C CB    . GLN A 104 ? 1.9377 2.4386 2.9788 0.1862  -0.3478 -0.5141 104 GLN A CB    
852  C CG    . GLN A 104 ? 2.0925 2.5889 3.1380 0.1707  -0.4047 -0.5132 104 GLN A CG    
853  C CD    . GLN A 104 ? 2.3692 2.6396 3.3100 0.1771  -0.5330 -0.5750 104 GLN A CD    
854  O OE1   . GLN A 104 ? 2.1730 2.2909 3.0200 0.1850  -0.5862 -0.6122 104 GLN A OE1   
855  N NE2   . GLN A 104 ? 2.3740 2.6162 3.3271 0.1762  -0.5860 -0.5884 104 GLN A NE2   
856  N N     . SER A 105 ? 1.9156 2.6715 2.7312 0.0115  -0.2791 -0.3109 105 SER A N     
857  C CA    . SER A 105 ? 1.7442 2.6071 2.4325 -0.0886 -0.2913 -0.2234 105 SER A CA    
858  C C     . SER A 105 ? 1.6066 2.6969 2.4264 -0.0685 -0.1822 -0.1771 105 SER A C     
859  O O     . SER A 105 ? 2.0323 3.2609 2.8798 -0.1014 -0.1714 -0.1379 105 SER A O     
860  C CB    . SER A 105 ? 1.8966 2.6623 2.3766 -0.1631 -0.3438 -0.1912 105 SER A CB    
861  O OG    . SER A 105 ? 1.9202 2.7857 2.2692 -0.2678 -0.3634 -0.1145 105 SER A OG    
862  N N     . ILE A 106 ? 1.5283 2.6551 2.4237 -0.0153 -0.1023 -0.1829 106 ILE A N     
863  C CA    . ILE A 106 ? 1.3926 2.7151 2.3928 0.0061  -0.0046 -0.1377 106 ILE A CA    
864  C C     . ILE A 106 ? 1.2475 2.6680 2.4425 0.0740  0.0506  -0.1635 106 ILE A C     
865  O O     . ILE A 106 ? 1.1418 2.7337 2.4034 0.0730  0.1016  -0.1192 106 ILE A O     
866  C CB    . ILE A 106 ? 1.3953 2.7078 2.4137 0.0451  0.0651  -0.1404 106 ILE A CB    
867  C CG1   . ILE A 106 ? 1.7513 2.9799 2.9151 0.1394  0.1135  -0.2232 106 ILE A CG1   
868  C CG2   . ILE A 106 ? 1.5445 2.7500 2.3677 -0.0220 0.0060  -0.1186 106 ILE A CG2   
869  C CD1   . ILE A 106 ? 1.9574 3.1612 3.1300 0.1711  0.1834  -0.2336 106 ILE A CD1   
870  N N     . ASP A 107 ? 1.2483 2.5651 2.5356 0.1332  0.0362  -0.2372 107 ASP A N     
871  C CA    . ASP A 107 ? 1.2050 2.6093 2.6750 0.1951  0.0852  -0.2645 107 ASP A CA    
872  C C     . ASP A 107 ? 1.0853 2.5680 2.5232 0.1400  0.0371  -0.2277 107 ASP A C     
873  O O     . ASP A 107 ? 1.2087 2.8560 2.7471 0.1528  0.0935  -0.1975 107 ASP A O     
874  C CB    . ASP A 107 ? 1.4896 2.7620 3.0609 0.2688  0.0743  -0.3590 107 ASP A CB    
875  C CG    . ASP A 107 ? 1.6215 2.9836 3.3944 0.3395  0.1366  -0.3936 107 ASP A CG    
876  O OD1   . ASP A 107 ? 1.6558 3.1789 3.4975 0.3405  0.1998  -0.3449 107 ASP A OD1   
877  O OD2   . ASP A 107 ? 1.7997 3.0710 3.6626 0.3958  0.1199  -0.4729 107 ASP A OD2   
878  N N     . VAL A 108 ? 1.2084 2.5691 2.5019 0.0774  -0.0679 -0.2327 108 VAL A N     
879  C CA    . VAL A 108 ? 1.2026 2.6270 2.4476 0.0130  -0.1150 -0.2004 108 VAL A CA    
880  C C     . VAL A 108 ? 1.1668 2.7672 2.3497 -0.0578 -0.0876 -0.1220 108 VAL A C     
881  O O     . VAL A 108 ? 1.6789 3.4297 2.9198 -0.0761 -0.0667 -0.0959 108 VAL A O     
882  C CB    . VAL A 108 ? 1.3714 2.6039 2.4442 -0.0479 -0.2372 -0.2205 108 VAL A CB    
883  C CG1   . VAL A 108 ? 1.5833 2.8440 2.4553 -0.1737 -0.2940 -0.1544 108 VAL A CG1   
884  C CG2   . VAL A 108 ? 1.3448 2.5310 2.5014 -0.0126 -0.2699 -0.2680 108 VAL A CG2   
885  N N     . PHE A 109 ? 1.2323 2.8248 2.3058 -0.0940 -0.0850 -0.0880 109 PHE A N     
886  C CA    . PHE A 109 ? 1.1985 2.9651 2.2225 -0.1523 -0.0568 -0.0200 109 PHE A CA    
887  C C     . PHE A 109 ? 1.0293 2.9855 2.2388 -0.0815 0.0427  -0.0074 109 PHE A C     
888  O O     . PHE A 109 ? 0.9555 3.0792 2.1983 -0.1101 0.0564  0.0249  109 PHE A O     
889  C CB    . PHE A 109 ? 1.2978 3.0064 2.1869 -0.1876 -0.0668 0.0058  109 PHE A CB    
890  C CG    . PHE A 109 ? 1.2673 3.1536 2.1104 -0.2390 -0.0377 0.0700  109 PHE A CG    
891  C CD1   . PHE A 109 ? 1.4105 3.3498 2.1051 -0.3510 -0.0970 0.1087  109 PHE A CD1   
892  C CD2   . PHE A 109 ? 1.1785 3.1745 2.1197 -0.1774 0.0466  0.0882  109 PHE A CD2   
893  C CE1   . PHE A 109 ? 1.3113 3.4256 1.9708 -0.3968 -0.0728 0.1597  109 PHE A CE1   
894  C CE2   . PHE A 109 ? 1.2365 3.3944 2.1354 -0.2182 0.0658  0.1429  109 PHE A CE2   
895  C CZ    . PHE A 109 ? 1.3242 3.5489 2.0892 -0.3261 0.0059  0.1763  109 PHE A CZ    
896  N N     . ILE A 110 ? 1.1650 3.0952 2.4880 0.0084  0.1131  -0.0338 110 ILE A N     
897  C CA    . ILE A 110 ? 0.9341 3.0167 2.4168 0.0785  0.2083  -0.0221 110 ILE A CA    
898  C C     . ILE A 110 ? 0.8247 2.9214 2.4032 0.1032  0.2169  -0.0365 110 ILE A C     
899  O O     . ILE A 110 ? 0.8967 2.9650 2.4547 0.1042  0.2452  -0.0077 110 ILE A O     
900  C CB    . ILE A 110 ? 0.8235 2.8230 2.3924 0.1633  0.2771  -0.0601 110 ILE A CB    
901  C CG1   . ILE A 110 ? 0.8955 2.8776 2.3561 0.1411  0.2921  -0.0253 110 ILE A CG1   
902  C CG2   . ILE A 110 ? 1.0099 2.9045 2.6658 0.2242  0.3479  -0.0599 110 ILE A CG2   
903  C CD1   . ILE A 110 ? 0.9037 2.7916 2.4256 0.2105  0.3578  -0.0651 110 ILE A CD1   
904  N N     . GLN A 111 ? 0.8798 2.9349 2.5225 0.1199  0.1803  -0.0900 111 GLN A N     
905  C CA    . GLN A 111 ? 1.0289 3.0002 2.7182 0.1424  0.1884  -0.0887 111 GLN A CA    
906  C C     . GLN A 111 ? 1.0710 3.1443 2.6941 0.0626  0.1346  -0.0653 111 GLN A C     
907  O O     . GLN A 111 ? 1.2740 3.2896 2.9191 0.0753  0.1526  -0.0548 111 GLN A O     
908  C CB    . GLN A 111 ? 1.1904 3.0539 2.9490 0.1969  0.1703  -0.1497 111 GLN A CB    
909  C CG    . GLN A 111 ? 1.4545 3.2774 3.1601 0.1452  0.0659  -0.2029 111 GLN A CG    
910  C CD    . GLN A 111 ? 1.6488 3.3245 3.4360 0.2111  0.0427  -0.2825 111 GLN A CD    
911  O OE1   . GLN A 111 ? 1.4824 3.0914 3.3278 0.2863  0.1105  -0.2953 111 GLN A OE1   
912  N NE2   . GLN A 111 ? 1.9556 3.4866 3.6264 0.1675  -0.0592 -0.3045 111 GLN A NE2   
913  N N     . LYS A 112 ? 1.3390 3.5109 2.8491 -0.0313 0.0666  -0.0470 112 LYS A N     
914  C CA    . LYS A 112 ? 0.8096 3.0537 2.2304 -0.1257 0.0122  -0.0212 112 LYS A CA    
915  C C     . LYS A 112 ? 0.8327 3.1933 2.1517 -0.1914 0.0228  0.0353  112 LYS A C     
916  O O     . LYS A 112 ? 1.2732 3.6802 2.5030 -0.2703 -0.0127 0.0528  112 LYS A O     
917  C CB    . LYS A 112 ? 1.0428 3.0871 2.2863 -0.1992 -0.0914 -0.0384 112 LYS A CB    
918  C CG    . LYS A 112 ? 1.4870 3.3891 2.7928 -0.1497 -0.1247 -0.0968 112 LYS A CG    
919  C CD    . LYS A 112 ? 1.5952 3.2933 2.7020 -0.2274 -0.2377 -0.1098 112 LYS A CD    
920  C CE    . LYS A 112 ? 1.4370 3.2031 2.3880 -0.3567 -0.2859 -0.0646 112 LYS A CE    
921  N NZ    . LYS A 112 ? 1.3054 3.2121 2.3590 -0.3614 -0.2620 -0.0651 112 LYS A NZ    
922  N N     . ILE A 113 ? 1.3170 1.2304 2.0442 -0.1460 -0.3044 0.0231  113 ILE A N     
923  C CA    . ILE A 113 ? 1.4136 1.3094 2.0856 -0.1022 -0.2714 0.0110  113 ILE A CA    
924  C C     . ILE A 113 ? 1.4774 1.2532 2.0957 -0.0904 -0.2941 -0.0115 113 ILE A C     
925  O O     . ILE A 113 ? 1.5216 1.2709 2.0750 -0.0479 -0.2776 -0.0405 113 ILE A O     
926  C CB    . ILE A 113 ? 1.2247 1.1995 1.9387 -0.0948 -0.2308 0.0539  113 ILE A CB    
927  C CG1   . ILE A 113 ? 1.8779 1.8673 2.6667 -0.1361 -0.2416 0.1070  113 ILE A CG1   
928  C CG2   . ILE A 113 ? 1.4421 1.5214 2.1681 -0.0779 -0.1984 0.0491  113 ILE A CG2   
929  C CD1   . ILE A 113 ? 2.3780 2.2648 3.1609 -0.1478 -0.2631 0.1236  113 ILE A CD1   
930  N N     . SER A 114 ? 2.0214 1.7232 2.6678 -0.1266 -0.3328 0.0001  114 SER A N     
931  C CA    . SER A 114 ? 1.9019 1.4783 2.5039 -0.1124 -0.3538 -0.0186 114 SER A CA    
932  C C     . SER A 114 ? 2.0028 1.5176 2.5133 -0.0759 -0.3682 -0.0842 114 SER A C     
933  O O     . SER A 114 ? 2.1539 1.5956 2.6075 -0.0356 -0.3643 -0.1083 114 SER A O     
934  C CB    . SER A 114 ? 2.0367 1.5371 2.6911 -0.1665 -0.4001 0.0020  114 SER A CB    
935  O OG    . SER A 114 ? 2.0744 1.6530 2.8187 -0.2036 -0.3842 0.0692  114 SER A OG    
936  N N     . GLU A 115 ? 2.0732 1.6234 2.5676 -0.0852 -0.3831 -0.1110 115 GLU A N     
937  C CA    . GLU A 115 ? 1.8560 1.3621 2.2614 -0.0531 -0.3973 -0.1687 115 GLU A CA    
938  C C     . GLU A 115 ? 1.6155 1.1812 1.9716 -0.0022 -0.3493 -0.1792 115 GLU A C     
939  O O     . GLU A 115 ? 1.6685 1.2185 1.9505 0.0279  -0.3524 -0.2202 115 GLU A O     
940  C CB    . GLU A 115 ? 2.1199 1.6539 2.5290 -0.0828 -0.4314 -0.1840 115 GLU A CB    
941  C CG    . GLU A 115 ? 2.4100 1.9255 2.8928 -0.1431 -0.4762 -0.1630 115 GLU A CG    
942  C CD    . GLU A 115 ? 2.0989 1.6823 2.6054 -0.1698 -0.5009 -0.1638 115 GLU A CD    
943  O OE1   . GLU A 115 ? 1.8963 1.5429 2.3688 -0.1418 -0.4777 -0.1715 115 GLU A OE1   
944  O OE2   . GLU A 115 ? 2.2058 1.7814 2.7690 -0.2197 -0.5445 -0.1531 115 GLU A OE2   
945  N N     . TYR A 116 ? 1.6225 1.2629 2.0185 0.0063  -0.3063 -0.1426 116 TYR A N     
946  C CA    . TYR A 116 ? 1.5245 1.2357 1.8897 0.0434  -0.2636 -0.1492 116 TYR A CA    
947  C C     . TYR A 116 ? 1.6434 1.3657 2.0046 0.0776  -0.2302 -0.1358 116 TYR A C     
948  O O     . TYR A 116 ? 1.6452 1.3981 1.9634 0.1157  -0.2039 -0.1534 116 TYR A O     
949  C CB    . TYR A 116 ? 1.2580 1.0699 1.6726 0.0231  -0.2442 -0.1257 116 TYR A CB    
950  C CG    . TYR A 116 ? 1.3165 1.1362 1.7290 0.0011  -0.2712 -0.1373 116 TYR A CG    
951  C CD1   . TYR A 116 ? 1.4155 1.2025 1.8610 -0.0363 -0.3129 -0.1323 116 TYR A CD1   
952  C CD2   . TYR A 116 ? 1.2405 1.1047 1.6218 0.0163  -0.2561 -0.1489 116 TYR A CD2   
953  C CE1   . TYR A 116 ? 1.6908 1.4944 2.1350 -0.0534 -0.3403 -0.1412 116 TYR A CE1   
954  C CE2   . TYR A 116 ? 1.5669 1.4403 1.9444 0.0003  -0.2815 -0.1537 116 TYR A CE2   
955  C CZ    . TYR A 116 ? 1.5794 1.4255 1.9870 -0.0323 -0.3240 -0.1510 116 TYR A CZ    
956  O OH    . TYR A 116 ? 1.3593 1.2236 1.7639 -0.0455 -0.3520 -0.1541 116 TYR A OH    
957  N N     . THR A 117 ? 1.4140 1.1211 1.8221 0.0644  -0.2306 -0.1002 117 THR A N     
958  C CA    . THR A 117 ? 1.4564 1.1963 1.8672 0.0967  -0.1977 -0.0790 117 THR A CA    
959  C C     . THR A 117 ? 1.7295 1.3723 2.1219 0.1195  -0.2112 -0.0748 117 THR A C     
960  O O     . THR A 117 ? 2.0729 1.7256 2.4366 0.1657  -0.1887 -0.0776 117 THR A O     
961  C CB    . THR A 117 ? 1.4908 1.3221 1.9691 0.0733  -0.1754 -0.0319 117 THR A CB    
962  O OG1   . THR A 117 ? 1.6891 1.5451 2.1686 0.1030  -0.1510 -0.0070 117 THR A OG1   
963  C CG2   . THR A 117 ? 2.0639 1.8701 2.6001 0.0251  -0.2012 0.0006  117 THR A CG2   
964  N N     . ASP A 118 ? 1.6149 1.1646 2.0282 0.0881  -0.2485 -0.0660 118 ASP A N     
965  C CA    . ASP A 118 ? 1.9025 1.3452 2.3118 0.1023  -0.2654 -0.0531 118 ASP A CA    
966  C C     . ASP A 118 ? 1.6952 1.1885 2.1479 0.1095  -0.2370 0.0079  118 ASP A C     
967  O O     . ASP A 118 ? 1.6755 1.0880 2.1253 0.1295  -0.2450 0.0281  118 ASP A O     
968  C CB    . ASP A 118 ? 2.0064 1.3700 2.3364 0.1620  -0.2700 -0.1047 118 ASP A CB    
969  C CG    . ASP A 118 ? 2.8324 2.1510 3.1072 0.1610  -0.2975 -0.1663 118 ASP A CG    
970  O OD1   . ASP A 118 ? 3.1256 2.4305 3.4268 0.1091  -0.3283 -0.1683 118 ASP A OD1   
971  O OD2   . ASP A 118 ? 3.0937 2.3987 3.2984 0.2140  -0.2885 -0.2111 118 ASP A OD2   
972  N N     . TYR A 119 ? 1.6736 1.2973 2.1632 0.0971  -0.2051 0.0369  119 TYR A N     
973  C CA    . TYR A 119 ? 1.3759 1.0709 1.9057 0.1000  -0.1782 0.0956  119 TYR A CA    
974  C C     . TYR A 119 ? 1.7881 1.5643 2.3841 0.0484  -0.1736 0.1337  119 TYR A C     
975  O O     . TYR A 119 ? 1.2212 1.1161 1.8382 0.0523  -0.1419 0.1547  119 TYR A O     
976  C CB    . TYR A 119 ? 1.3739 1.1679 1.8763 0.1467  -0.1399 0.0873  119 TYR A CB    
977  C CG    . TYR A 119 ? 1.3538 1.0965 1.7974 0.2040  -0.1378 0.0542  119 TYR A CG    
978  C CD1   . TYR A 119 ? 1.4534 1.1127 1.8869 0.2347  -0.1471 0.0764  119 TYR A CD1   
979  C CD2   . TYR A 119 ? 1.3110 1.0942 1.7124 0.2296  -0.1250 0.0047  119 TYR A CD2   
980  C CE1   . TYR A 119 ? 1.5082 1.1279 1.8896 0.2951  -0.1436 0.0447  119 TYR A CE1   
981  C CE2   . TYR A 119 ? 1.8530 1.6073 2.2043 0.2852  -0.1195 -0.0235 119 TYR A CE2   
982  C CZ    . TYR A 119 ? 1.4590 1.1334 1.7999 0.3208  -0.1285 -0.0059 119 TYR A CZ    
983  O OH    . TYR A 119 ? 1.5143 1.1655 1.8067 0.3838  -0.1217 -0.0356 119 TYR A OH    
984  N N     . LYS A 120 ? 1.9105 1.6264 2.5400 0.0007  -0.2076 0.1388  120 LYS A N     
985  C CA    . LYS A 120 ? 1.6642 1.4619 2.3625 -0.0480 -0.2058 0.1738  120 LYS A CA    
986  C C     . LYS A 120 ? 1.9287 1.8061 2.6738 -0.0531 -0.1775 0.2437  120 LYS A C     
987  O O     . LYS A 120 ? 1.5212 1.5207 2.3031 -0.0639 -0.1528 0.2640  120 LYS A O     
988  C CB    . LYS A 120 ? 1.7829 1.4955 2.5147 -0.0998 -0.2525 0.1734  120 LYS A CB    
989  C CG    . LYS A 120 ? 2.2490 2.0260 3.0700 -0.1549 -0.2550 0.2346  120 LYS A CG    
990  C CD    . LYS A 120 ? 2.5543 2.2493 3.4103 -0.2096 -0.3073 0.2273  120 LYS A CD    
991  C CE    . LYS A 120 ? 2.6440 2.4437 3.5917 -0.2628 -0.3077 0.2743  120 LYS A CE    
992  N NZ    . LYS A 120 ? 2.6613 2.3963 3.6471 -0.3189 -0.3630 0.2623  120 LYS A NZ    
993  N N     . ASN A 121 ? 2.1545 1.9663 2.8953 -0.0405 -0.1802 0.2812  121 ASN A N     
994  C CA    . ASN A 121 ? 1.9583 1.8397 2.7442 -0.0498 -0.1573 0.3588  121 ASN A CA    
995  C C     . ASN A 121 ? 1.8335 1.8421 2.5937 -0.0048 -0.1136 0.3628  121 ASN A C     
996  O O     . ASN A 121 ? 2.1398 2.2653 2.9360 -0.0147 -0.0876 0.4087  121 ASN A O     
997  C CB    . ASN A 121 ? 2.0919 1.8511 2.8816 -0.0501 -0.1774 0.4023  121 ASN A CB    
998  C CG    . ASN A 121 ? 2.2472 1.8686 3.0617 -0.0976 -0.2269 0.3912  121 ASN A CG    
999  O OD1   . ASN A 121 ? 2.0723 1.7237 2.9339 -0.1488 -0.2428 0.3897  121 ASN A OD1   
1000 N ND2   . ASN A 121 ? 2.6922 2.1622 3.4753 -0.0787 -0.2539 0.3802  121 ASN A ND2   
1001 N N     . ASP A 122 ? 1.3656 1.3608 2.0645 0.0447  -0.1058 0.3143  122 ASP A N     
1002 C CA    . ASP A 122 ? 1.4083 1.5242 2.0845 0.0838  -0.0701 0.3123  122 ASP A CA    
1003 C C     . ASP A 122 ? 1.4123 1.6488 2.1086 0.0684  -0.0508 0.2916  122 ASP A C     
1004 O O     . ASP A 122 ? 1.6300 1.9831 2.3281 0.0852  -0.0226 0.3072  122 ASP A O     
1005 C CB    . ASP A 122 ? 1.7273 1.8112 2.3431 0.1335  -0.0685 0.2610  122 ASP A CB    
1006 C CG    . ASP A 122 ? 2.1555 2.1226 2.7479 0.1617  -0.0854 0.2772  122 ASP A CG    
1007 O OD1   . ASP A 122 ? 2.3139 2.2443 2.9349 0.1497  -0.0916 0.3398  122 ASP A OD1   
1008 O OD2   . ASP A 122 ? 2.1203 2.0331 2.6665 0.1977  -0.0918 0.2292  122 ASP A OD2   
1009 N N     . ILE A 123 ? 1.7601 1.9699 2.4701 0.0396  -0.0674 0.2556  123 ILE A N     
1010 C CA    . ILE A 123 ? 1.5415 1.8524 2.2724 0.0296  -0.0515 0.2342  123 ILE A CA    
1011 C C     . ILE A 123 ? 1.8576 2.2444 2.6510 -0.0016 -0.0426 0.2875  123 ILE A C     
1012 O O     . ILE A 123 ? 2.2990 2.8012 3.1070 0.0066  -0.0170 0.2867  123 ILE A O     
1013 C CB    . ILE A 123 ? 1.1155 1.3727 1.8355 0.0162  -0.0729 0.1800  123 ILE A CB    
1014 C CG1   . ILE A 123 ? 1.0500 1.2430 1.7075 0.0484  -0.0780 0.1332  123 ILE A CG1   
1015 C CG2   . ILE A 123 ? 1.2311 1.5814 1.9725 0.0118  -0.0577 0.1578  123 ILE A CG2   
1016 C CD1   . ILE A 123 ? 1.0528 1.1884 1.6905 0.0375  -0.0999 0.0868  123 ILE A CD1   
1017 N N     . LEU A 124 ? 1.5143 1.8409 2.3470 -0.0377 -0.0635 0.3335  124 LEU A N     
1018 C CA    . LEU A 124 ? 1.4303 1.8416 2.3304 -0.0706 -0.0528 0.3933  124 LEU A CA    
1019 C C     . LEU A 124 ? 1.5643 2.0707 2.4634 -0.0483 -0.0187 0.4482  124 LEU A C     
1020 O O     . LEU A 124 ? 1.9645 2.5960 2.9003 -0.0543 0.0065  0.4799  124 LEU A O     
1021 C CB    . LEU A 124 ? 1.7110 2.0314 2.6605 -0.1224 -0.0876 0.4315  124 LEU A CB    
1022 C CG    . LEU A 124 ? 1.4417 1.7187 2.4209 -0.1603 -0.1218 0.3975  124 LEU A CG    
1023 C CD1   . LEU A 124 ? 1.1289 1.3632 2.0490 -0.1326 -0.1317 0.3165  124 LEU A CD1   
1024 C CD2   . LEU A 124 ? 1.7528 1.9068 2.7628 -0.2066 -0.1644 0.4241  124 LEU A CD2   
1025 N N     . ASN A 125 ? 1.4831 1.9406 2.3383 -0.0180 -0.0170 0.4599  125 ASN A N     
1026 C CA    . ASN A 125 ? 1.6269 2.1750 2.4761 0.0056  0.0120  0.5174  125 ASN A CA    
1027 C C     . ASN A 125 ? 1.7358 2.4105 2.5476 0.0466  0.0419  0.4768  125 ASN A C     
1028 O O     . ASN A 125 ? 1.8510 2.6563 2.6812 0.0491  0.0687  0.5009  125 ASN A O     
1029 C CB    . ASN A 125 ? 1.7017 2.1516 2.5194 0.0279  0.0002  0.5464  125 ASN A CB    
1030 C CG    . ASN A 125 ? 1.9280 2.2345 2.7804 -0.0120 -0.0339 0.5809  125 ASN A CG    
1031 O OD1   . ASN A 125 ? 2.0123 2.3294 2.9272 -0.0625 -0.0408 0.6241  125 ASN A OD1   
1032 N ND2   . ASN A 125 ? 1.9974 2.1705 2.8117 0.0109  -0.0566 0.5600  125 ASN A ND2   
1033 N N     . LYS A 126 ? 1.6048 2.2457 2.3649 0.0789  0.0372  0.4140  126 LYS A N     
1034 C CA    . LYS A 126 ? 1.6957 2.4429 2.4245 0.1107  0.0585  0.3667  126 LYS A CA    
1035 C C     . LYS A 126 ? 1.9918 2.7826 2.7461 0.0929  0.0622  0.3234  126 LYS A C     
1036 O O     . LYS A 126 ? 2.3510 3.0636 3.1254 0.0665  0.0417  0.3013  126 LYS A O     
1037 C CB    . LYS A 126 ? 1.8004 2.4978 2.4791 0.1415  0.0498  0.3140  126 LYS A CB    
1038 C CG    . LYS A 126 ? 1.6659 2.4690 2.3141 0.1714  0.0672  0.2691  126 LYS A CG    
1039 C CD    . LYS A 126 ? 1.5861 2.3397 2.1987 0.1915  0.0566  0.2170  126 LYS A CD    
1040 C CE    . LYS A 126 ? 1.6566 2.5172 2.2431 0.2190  0.0696  0.1827  126 LYS A CE    
1041 N NZ    . LYS A 126 ? 1.5398 2.4712 2.1083 0.2493  0.0789  0.2298  126 LYS A NZ    
1042 N N     . TYR A 127 ? 2.0363 2.9527 2.7878 0.1110  0.0869  0.3101  127 TYR A N     
1043 C CA    . TYR A 127 ? 2.0764 3.0392 2.8523 0.1035  0.0924  0.2670  127 TYR A CA    
1044 C C     . TYR A 127 ? 1.8293 2.7759 2.6667 0.0654  0.0844  0.3058  127 TYR A C     
1045 O O     . TYR A 127 ? 1.9112 2.7861 2.7661 0.0450  0.0632  0.2750  127 TYR A O     
1046 C CB    . TYR A 127 ? 2.0041 2.9292 2.7518 0.1151  0.0831  0.1875  127 TYR A CB    
1047 C CG    . TYR A 127 ? 1.7841 2.5843 2.5120 0.1056  0.0582  0.1641  127 TYR A CG    
1048 C CD1   . TYR A 127 ? 1.8762 2.5900 2.6283 0.0765  0.0363  0.1638  127 TYR A CD1   
1049 C CD2   . TYR A 127 ? 1.8551 2.6340 2.5389 0.1283  0.0564  0.1412  127 TYR A CD2   
1050 C CE1   . TYR A 127 ? 1.9600 2.5671 2.6853 0.0729  0.0146  0.1391  127 TYR A CE1   
1051 C CE2   . TYR A 127 ? 1.9164 2.5939 2.5794 0.1255  0.0376  0.1195  127 TYR A CE2   
1052 C CZ    . TYR A 127 ? 2.0858 2.6756 2.7656 0.0990  0.0174  0.1172  127 TYR A CZ    
1053 O OH    . TYR A 127 ? 2.5053 3.0021 3.1563 0.1009  -0.0001 0.0929  127 TYR A OH    
1054 N N     . THR A 128 ? 1.6035 2.6267 2.4745 0.0557  0.1012  0.3745  128 THR A N     
1055 C CA    . THR A 128 ? 1.6164 2.6386 2.5576 0.0129  0.0934  0.4246  128 THR A CA    
1056 C C     . THR A 128 ? 1.7659 2.8254 2.7418 0.0080  0.0922  0.3818  128 THR A C     
1057 O O     . THR A 128 ? 2.3512 3.3519 3.3724 -0.0291 0.0672  0.3910  128 THR A O     
1058 C CB    . THR A 128 ? 1.6828 2.8144 2.6560 0.0070  0.1199  0.5087  128 THR A CB    
1059 O OG1   . THR A 128 ? 1.8911 3.0701 2.9401 -0.0288 0.1199  0.5426  128 THR A OG1   
1060 C CG2   . THR A 128 ? 1.5344 2.8070 2.4695 0.0535  0.1563  0.4986  128 THR A CG2   
1061 N N     . LYS A 129 ? 1.3921 2.5426 2.3493 0.0446  0.1149  0.3361  129 LYS A N     
1062 C CA    . LYS A 129 ? 1.1694 2.3412 2.1620 0.0447  0.1110  0.2960  129 LYS A CA    
1063 C C     . LYS A 129 ? 1.0149 2.0488 1.9902 0.0298  0.0761  0.2496  129 LYS A C     
1064 O O     . LYS A 129 ? 0.8493 1.8262 1.7679 0.0482  0.0717  0.2065  129 LYS A O     
1065 C CB    . LYS A 129 ? 1.2805 2.5489 2.2478 0.0915  0.1375  0.2444  129 LYS A CB    
1066 C CG    . LYS A 129 ? 1.1211 2.3975 2.1181 0.1019  0.1328  0.1966  129 LYS A CG    
1067 C CD    . LYS A 129 ? 1.6170 2.9854 2.6887 0.0909  0.1431  0.2407  129 LYS A CD    
1068 C CE    . LYS A 129 ? 1.7559 3.2329 2.8392 0.1365  0.1685  0.2026  129 LYS A CE    
1069 N NZ    . LYS A 129 ? 1.3477 2.9306 2.5102 0.1289  0.1809  0.2500  129 LYS A NZ    
1070 N N     . LEU A 130 ? 1.1856 2.1791 2.2078 -0.0010 0.0524  0.2568  130 LEU A N     
1071 C CA    . LEU A 130 ? 1.1817 2.0496 2.1814 -0.0151 0.0183  0.2188  130 LEU A CA    
1072 C C     . LEU A 130 ? 1.5820 2.4516 2.5937 -0.0039 0.0101  0.1721  130 LEU A C     
1073 O O     . LEU A 130 ? 1.5732 2.3506 2.5691 -0.0166 -0.0184 0.1471  130 LEU A O     
1074 C CB    . LEU A 130 ? 1.1932 1.9850 2.2238 -0.0611 -0.0137 0.2586  130 LEU A CB    
1075 C CG    . LEU A 130 ? 1.4966 2.2506 2.5192 -0.0771 -0.0146 0.3086  130 LEU A CG    
1076 C CD1   . LEU A 130 ? 1.5201 2.1910 2.5822 -0.1270 -0.0523 0.3397  130 LEU A CD1   
1077 C CD2   . LEU A 130 ? 1.2567 1.9390 2.2037 -0.0483 -0.0129 0.2769  130 LEU A CD2   
1078 N N     . ASP A 131 ? 1.7403 2.7102 2.7764 0.0232  0.0339  0.1596  131 ASP A N     
1079 C CA    . ASP A 131 ? 1.4204 2.3923 2.4836 0.0330  0.0233  0.1282  131 ASP A CA    
1080 C C     . ASP A 131 ? 1.2188 2.1435 2.2332 0.0632  0.0249  0.0648  131 ASP A C     
1081 O O     . ASP A 131 ? 1.6774 2.6106 2.7122 0.0812  0.0218  0.0378  131 ASP A O     
1082 C CB    . ASP A 131 ? 1.5980 2.7020 2.7221 0.0503  0.0463  0.1480  131 ASP A CB    
1083 C CG    . ASP A 131 ? 1.8218 3.0144 2.9194 0.0941  0.0841  0.1261  131 ASP A CG    
1084 O OD1   . ASP A 131 ? 1.8672 3.0260 2.9046 0.1044  0.0908  0.1039  131 ASP A OD1   
1085 O OD2   . ASP A 131 ? 2.0942 3.3969 3.2307 0.1207  0.1063  0.1288  131 ASP A OD2   
1086 N N     . ASP A 132 ? 1.1743 2.0498 2.1302 0.0684  0.0283  0.0437  132 ASP A N     
1087 C CA    . ASP A 132 ? 1.1093 1.9288 2.0232 0.0848  0.0249  -0.0103 132 ASP A CA    
1088 C C     . ASP A 132 ? 1.0809 1.7951 1.9551 0.0642  0.0027  -0.0147 132 ASP A C     
1089 O O     . ASP A 132 ? 1.4793 2.1322 2.3418 0.0622  -0.0128 -0.0397 132 ASP A O     
1090 C CB    . ASP A 132 ? 1.2671 2.1418 2.1490 0.1129  0.0497  -0.0392 132 ASP A CB    
1091 C CG    . ASP A 132 ? 1.4664 2.3842 2.3303 0.1103  0.0631  -0.0036 132 ASP A CG    
1092 O OD1   . ASP A 132 ? 1.5284 2.4206 2.4064 0.0854  0.0532  0.0437  132 ASP A OD1   
1093 O OD2   . ASP A 132 ? 1.5734 2.5491 2.4093 0.1335  0.0811  -0.0228 132 ASP A OD2   
1094 N N     . ILE A 133 ? 0.9887 1.6826 1.8401 0.0527  0.0018  0.0106  133 ILE A N     
1095 C CA    . ILE A 133 ? 1.2959 1.8937 2.1089 0.0390  -0.0186 0.0060  133 ILE A CA    
1096 C C     . ILE A 133 ? 0.9390 1.4817 1.7719 0.0152  -0.0480 0.0158  133 ILE A C     
1097 O O     . ILE A 133 ? 0.8486 1.3187 1.6482 0.0108  -0.0660 -0.0040 133 ILE A O     
1098 C CB    . ILE A 133 ? 1.0991 1.6845 1.8895 0.0372  -0.0148 0.0339  133 ILE A CB    
1099 C CG1   . ILE A 133 ? 1.0620 1.6694 1.8961 0.0159  -0.0193 0.0858  133 ILE A CG1   
1100 C CG2   . ILE A 133 ? 0.6566 1.3056 1.4231 0.0633  0.0109  0.0230  133 ILE A CG2   
1101 C CD1   . ILE A 133 ? 1.5549 2.1393 2.3713 0.0144  -0.0173 0.1205  133 ILE A CD1   
1102 N N     . ALA A 134 ? 1.0359 1.6222 1.9237 -0.0002 -0.0535 0.0472  134 ALA A N     
1103 C CA    . ALA A 134 ? 0.8692 1.4197 1.7831 -0.0234 -0.0852 0.0544  134 ALA A CA    
1104 C C     . ALA A 134 ? 0.8820 1.4215 1.7906 -0.0079 -0.0911 0.0222  134 ALA A C     
1105 O O     . ALA A 134 ? 1.3122 1.7861 2.1973 -0.0177 -0.1173 0.0113  134 ALA A O     
1106 C CB    . ALA A 134 ? 0.7399 1.3627 1.7263 -0.0431 -0.0875 0.0965  134 ALA A CB    
1107 N N     . ASN A 135 ? 0.9621 1.5636 1.8899 0.0183  -0.0677 0.0070  135 ASN A N     
1108 C CA    . ASN A 135 ? 1.1795 1.7626 2.1076 0.0351  -0.0733 -0.0201 135 ASN A CA    
1109 C C     . ASN A 135 ? 1.0528 1.5554 1.9205 0.0355  -0.0788 -0.0462 135 ASN A C     
1110 O O     . ASN A 135 ? 1.7205 2.1740 2.5763 0.0319  -0.0989 -0.0509 135 ASN A O     
1111 C CB    . ASN A 135 ? 1.2263 1.8795 2.1808 0.0673  -0.0469 -0.0390 135 ASN A CB    
1112 C CG    . ASN A 135 ? 1.7552 2.5004 2.7755 0.0737  -0.0408 -0.0131 135 ASN A CG    
1113 O OD1   . ASN A 135 ? 1.9148 2.6667 2.9721 0.0527  -0.0627 0.0166  135 ASN A OD1   
1114 N ND2   . ASN A 135 ? 1.8379 2.6626 2.8739 0.1034  -0.0117 -0.0256 135 ASN A ND2   
1115 N N     . SER A 136 ? 0.6711 1.1684 1.5014 0.0406  -0.0610 -0.0595 136 SER A N     
1116 C CA    . SER A 136 ? 1.0580 1.4962 1.8378 0.0407  -0.0626 -0.0810 136 SER A CA    
1117 C C     . SER A 136 ? 0.8889 1.2616 1.6341 0.0243  -0.0863 -0.0702 136 SER A C     
1118 O O     . SER A 136 ? 1.1029 1.4306 1.8198 0.0230  -0.0969 -0.0793 136 SER A O     
1119 C CB    . SER A 136 ? 0.9195 1.3822 1.6737 0.0503  -0.0402 -0.0954 136 SER A CB    
1120 O OG    . SER A 136 ? 0.9142 1.3834 1.6569 0.0456  -0.0385 -0.0735 136 SER A OG    
1121 N N     . PHE A 137 ? 0.7330 1.0981 1.4782 0.0122  -0.0954 -0.0506 137 PHE A N     
1122 C CA    . PHE A 137 ? 1.0065 1.3033 1.7156 -0.0007 -0.1215 -0.0484 137 PHE A CA    
1123 C C     . PHE A 137 ? 1.0383 1.3161 1.7590 -0.0119 -0.1502 -0.0457 137 PHE A C     
1124 O O     . PHE A 137 ? 0.9876 1.2157 1.6623 -0.0116 -0.1663 -0.0573 137 PHE A O     
1125 C CB    . PHE A 137 ? 0.9556 1.2416 1.6748 -0.0141 -0.1294 -0.0268 137 PHE A CB    
1126 C CG    . PHE A 137 ? 0.9048 1.1111 1.5878 -0.0268 -0.1608 -0.0312 137 PHE A CG    
1127 C CD1   . PHE A 137 ? 0.8751 1.0280 1.4979 -0.0114 -0.1581 -0.0488 137 PHE A CD1   
1128 C CD2   . PHE A 137 ? 1.0733 1.2629 1.7840 -0.0525 -0.1947 -0.0204 137 PHE A CD2   
1129 C CE1   . PHE A 137 ? 1.2459 1.3218 1.8295 -0.0171 -0.1879 -0.0606 137 PHE A CE1   
1130 C CE2   . PHE A 137 ? 1.1448 1.2571 1.8182 -0.0644 -0.2283 -0.0324 137 PHE A CE2   
1131 C CZ    . PHE A 137 ? 1.3904 1.4416 1.9967 -0.0447 -0.2245 -0.0549 137 PHE A CZ    
1132 N N     . ASN A 138 ? 1.0396 1.3670 1.8209 -0.0182 -0.1558 -0.0289 138 ASN A N     
1133 C CA    . ASN A 138 ? 1.2043 1.5268 2.0042 -0.0265 -0.1857 -0.0225 138 ASN A CA    
1134 C C     . ASN A 138 ? 1.2249 1.5325 2.0037 -0.0079 -0.1820 -0.0359 138 ASN A C     
1135 O O     . ASN A 138 ? 1.4293 1.7034 2.1825 -0.0114 -0.2075 -0.0350 138 ASN A O     
1136 C CB    . ASN A 138 ? 1.1888 1.5847 2.0673 -0.0335 -0.1887 0.0015  138 ASN A CB    
1137 C CG    . ASN A 138 ? 1.2686 1.6752 2.1749 -0.0615 -0.1985 0.0250  138 ASN A CG    
1138 O OD1   . ASN A 138 ? 1.0349 1.3762 1.9058 -0.0806 -0.2216 0.0217  138 ASN A OD1   
1139 N ND2   . ASN A 138 ? 1.8006 2.2887 2.7697 -0.0630 -0.1805 0.0494  138 ASN A ND2   
1140 N N     . LEU A 139 ? 0.7522 1.0825 1.5397 0.0109  -0.1522 -0.0477 139 LEU A N     
1141 C CA    . LEU A 139 ? 1.2205 1.5259 1.9926 0.0245  -0.1481 -0.0577 139 LEU A CA    
1142 C C     . LEU A 139 ? 1.1359 1.3856 1.8405 0.0186  -0.1528 -0.0632 139 LEU A C     
1143 O O     . LEU A 139 ? 1.0447 1.2657 1.7276 0.0191  -0.1694 -0.0548 139 LEU A O     
1144 C CB    . LEU A 139 ? 0.7121 1.0451 1.5041 0.0408  -0.1177 -0.0763 139 LEU A CB    
1145 C CG    . LEU A 139 ? 0.7269 1.0372 1.5255 0.0545  -0.1113 -0.0884 139 LEU A CG    
1146 C CD1   . LEU A 139 ? 1.0134 1.3318 1.8561 0.0691  -0.1274 -0.0755 139 LEU A CD1   
1147 C CD2   . LEU A 139 ? 0.8736 1.2121 1.6852 0.0657  -0.0850 -0.1159 139 LEU A CD2   
1148 N N     . GLY A 140 ? 0.8677 1.1092 1.5378 0.0163  -0.1375 -0.0744 140 GLY A N     
1149 C CA    . GLY A 140 ? 0.8825 1.0852 1.4897 0.0163  -0.1375 -0.0803 140 GLY A CA    
1150 C C     . GLY A 140 ? 1.2041 1.3714 1.7739 0.0101  -0.1688 -0.0749 140 GLY A C     
1151 O O     . GLY A 140 ? 0.8699 1.0151 1.3977 0.0133  -0.1769 -0.0717 140 GLY A O     
1152 N N     . LEU A 141 ? 1.0885 1.2521 1.6730 -0.0003 -0.1883 -0.0729 141 LEU A N     
1153 C CA    . LEU A 141 ? 0.9168 1.0425 1.4649 -0.0090 -0.2240 -0.0758 141 LEU A CA    
1154 C C     . LEU A 141 ? 1.1943 1.3299 1.7540 -0.0115 -0.2492 -0.0625 141 LEU A C     
1155 O O     . LEU A 141 ? 1.6032 1.7121 2.1091 -0.0097 -0.2721 -0.0667 141 LEU A O     
1156 C CB    . LEU A 141 ? 0.9434 1.0600 1.5184 -0.0266 -0.2422 -0.0740 141 LEU A CB    
1157 C CG    . LEU A 141 ? 1.1105 1.1681 1.6373 -0.0360 -0.2781 -0.0899 141 LEU A CG    
1158 C CD1   . LEU A 141 ? 1.5407 1.5569 1.9881 -0.0130 -0.2640 -0.1136 141 LEU A CD1   
1159 C CD2   . LEU A 141 ? 1.1171 1.1615 1.6859 -0.0588 -0.2929 -0.0819 141 LEU A CD2   
1160 N N     . SER A 142 ? 1.0825 1.2604 1.7084 -0.0104 -0.2447 -0.0466 142 SER A N     
1161 C CA    . SER A 142 ? 1.1258 1.3162 1.7679 -0.0064 -0.2682 -0.0300 142 SER A CA    
1162 C C     . SER A 142 ? 1.0153 1.1814 1.6106 0.0079  -0.2584 -0.0247 142 SER A C     
1163 O O     . SER A 142 ? 1.4038 1.5604 1.9680 0.0106  -0.2841 -0.0124 142 SER A O     
1164 C CB    . SER A 142 ? 1.2770 1.5204 2.0026 0.0002  -0.2611 -0.0162 142 SER A CB    
1165 O OG    . SER A 142 ? 1.7060 1.9523 2.4442 0.0177  -0.2267 -0.0216 142 SER A OG    
1166 N N     . TYR A 143 ? 0.8991 1.0596 1.4902 0.0152  -0.2228 -0.0308 143 TYR A N     
1167 C CA    . TYR A 143 ? 0.9275 1.0663 1.4791 0.0218  -0.2118 -0.0198 143 TYR A CA    
1168 C C     . TYR A 143 ? 1.1494 1.2680 1.6197 0.0213  -0.2215 -0.0229 143 TYR A C     
1169 O O     . TYR A 143 ? 1.4975 1.6085 1.9298 0.0264  -0.2331 -0.0032 143 TYR A O     
1170 C CB    . TYR A 143 ? 0.9506 1.0915 1.5172 0.0226  -0.1750 -0.0294 143 TYR A CB    
1171 C CG    . TYR A 143 ? 0.9267 1.0496 1.4594 0.0212  -0.1606 -0.0146 143 TYR A CG    
1172 C CD1   . TYR A 143 ? 1.2920 1.3975 1.8468 0.0239  -0.1645 0.0107  143 TYR A CD1   
1173 C CD2   . TYR A 143 ? 0.9336 1.0601 1.4166 0.0180  -0.1421 -0.0221 143 TYR A CD2   
1174 C CE1   . TYR A 143 ? 1.3947 1.4844 1.9247 0.0170  -0.1506 0.0325  143 TYR A CE1   
1175 C CE2   . TYR A 143 ? 0.9635 1.0874 1.4228 0.0130  -0.1262 -0.0024 143 TYR A CE2   
1176 C CZ    . TYR A 143 ? 1.1896 1.2940 1.6734 0.0093  -0.1306 0.0271  143 TYR A CZ    
1177 O OH    . TYR A 143 ? 1.0302 1.1319 1.4961 -0.0010 -0.1146 0.0550  143 TYR A OH    
1178 N N     . MET A 144 ? 1.3125 1.4232 1.7526 0.0192  -0.2175 -0.0468 144 MET A N     
1179 C CA    . MET A 144 ? 1.2393 1.3306 1.5972 0.0266  -0.2246 -0.0575 144 MET A CA    
1180 C C     . MET A 144 ? 1.3993 1.4787 1.7262 0.0248  -0.2687 -0.0578 144 MET A C     
1181 O O     . MET A 144 ? 1.9023 1.9766 2.1591 0.0352  -0.2785 -0.0562 144 MET A O     
1182 C CB    . MET A 144 ? 1.3452 1.4239 1.6819 0.0310  -0.2111 -0.0849 144 MET A CB    
1183 C CG    . MET A 144 ? 1.3749 1.4771 1.7419 0.0332  -0.1716 -0.0850 144 MET A CG    
1184 S SD    . MET A 144 ? 1.2004 1.2932 1.5363 0.0467  -0.1559 -0.1109 144 MET A SD    
1185 C CE    . MET A 144 ? 1.7503 1.8477 2.1590 0.0329  -0.1617 -0.1097 144 MET A CE    
1186 N N     . GLU A 145 ? 1.0756 1.1593 1.4541 0.0111  -0.2964 -0.0591 145 GLU A N     
1187 C CA    . GLU A 145 ? 1.4754 1.5577 1.8363 0.0048  -0.3438 -0.0586 145 GLU A CA    
1188 C C     . GLU A 145 ? 1.6156 1.7213 1.9747 0.0147  -0.3529 -0.0262 145 GLU A C     
1189 O O     . GLU A 145 ? 2.0198 2.1263 2.3240 0.0195  -0.3844 -0.0238 145 GLU A O     
1190 C CB    . GLU A 145 ? 1.9488 2.0439 2.3816 -0.0170 -0.3691 -0.0607 145 GLU A CB    
1191 C CG    . GLU A 145 ? 2.0264 2.0886 2.4573 -0.0292 -0.3669 -0.0861 145 GLU A CG    
1192 C CD    . GLU A 145 ? 1.8290 1.9167 2.3480 -0.0536 -0.3775 -0.0749 145 GLU A CD    
1193 O OE1   . GLU A 145 ? 1.7873 1.9270 2.3715 -0.0568 -0.3818 -0.0506 145 GLU A OE1   
1194 O OE2   . GLU A 145 ? 1.4212 1.4794 1.9461 -0.0677 -0.3803 -0.0873 145 GLU A OE2   
1195 N N     . SER A 146 ? 1.5269 1.6493 1.9429 0.0200  -0.3276 -0.0016 146 SER A N     
1196 C CA    . SER A 146 ? 1.7946 1.9268 2.2119 0.0324  -0.3330 0.0343  146 SER A CA    
1197 C C     . SER A 146 ? 1.6072 1.7250 1.9545 0.0414  -0.3110 0.0491  146 SER A C     
1198 O O     . SER A 146 ? 1.6956 1.8168 2.0346 0.0506  -0.3156 0.0862  146 SER A O     
1199 C CB    . SER A 146 ? 1.8817 2.0250 2.3853 0.0380  -0.3149 0.0511  146 SER A CB    
1200 O OG    . SER A 146 ? 1.6622 1.7897 2.1753 0.0370  -0.2728 0.0423  146 SER A OG    
1201 N N     . LEU A 147 ? 1.6582 1.7653 1.9584 0.0403  -0.2865 0.0256  147 LEU A N     
1202 C CA    . LEU A 147 ? 1.7872 1.8975 2.0250 0.0483  -0.2622 0.0428  147 LEU A CA    
1203 C C     . LEU A 147 ? 1.7264 1.8464 1.8737 0.0610  -0.2877 0.0468  147 LEU A C     
1204 O O     . LEU A 147 ? 1.5113 1.6473 1.6095 0.0694  -0.2708 0.0764  147 LEU A O     
1205 C CB    . LEU A 147 ? 1.3813 1.4915 1.6031 0.0479  -0.2259 0.0172  147 LEU A CB    
1206 C CG    . LEU A 147 ? 1.3766 1.4896 1.6649 0.0375  -0.1907 0.0211  147 LEU A CG    
1207 C CD1   . LEU A 147 ? 1.3879 1.5133 1.6512 0.0407  -0.1608 -0.0031 147 LEU A CD1   
1208 C CD2   . LEU A 147 ? 1.4693 1.5830 1.7774 0.0320  -0.1767 0.0636  147 LEU A CD2   
1209 N N     . LEU A 148 ? 1.9501 2.0646 2.0738 0.0612  -0.3285 0.0183  148 LEU A N     
1210 C CA    . LEU A 148 ? 1.9669 2.0907 1.9933 0.0757  -0.3557 0.0098  148 LEU A CA    
1211 C C     . LEU A 148 ? 2.5225 2.6737 2.5361 0.0828  -0.3779 0.0572  148 LEU A C     
1212 O O     . LEU A 148 ? 2.5751 2.7479 2.5236 0.0972  -0.3636 0.0870  148 LEU A O     
1213 C CB    . LEU A 148 ? 1.9071 2.0087 1.9163 0.0693  -0.3987 -0.0399 148 LEU A CB    
1214 C CG    . LEU A 148 ? 2.1344 2.2396 2.0340 0.0863  -0.4315 -0.0646 148 LEU A CG    
1215 C CD1   . LEU A 148 ? 2.0294 2.1377 1.8451 0.1115  -0.3929 -0.0783 148 LEU A CD1   
1216 C CD2   . LEU A 148 ? 2.3728 2.4445 2.2687 0.0727  -0.4818 -0.1159 148 LEU A CD2   
1217 N N     . LYS A 149 ? 2.8741 3.0314 2.9510 0.0747  -0.4121 0.0693  149 LYS A N     
1218 C CA    . LYS A 149 ? 2.9977 3.1825 3.0730 0.0853  -0.4382 0.1172  149 LYS A CA    
1219 C C     . LYS A 149 ? 2.9381 3.1488 2.9018 0.1011  -0.4673 0.1171  149 LYS A C     
1220 O O     . LYS A 149 ? 2.9266 3.1328 2.8338 0.1001  -0.4937 0.0664  149 LYS A O     
1221 C CB    . LYS A 149 ? 3.1382 3.3168 3.2500 0.0907  -0.4002 0.1720  149 LYS A CB    
1222 C CG    . LYS A 149 ? 3.0821 3.2365 3.2984 0.0796  -0.3744 0.1678  149 LYS A CG    
1223 C CD    . LYS A 149 ? 3.0942 3.2283 3.3388 0.0814  -0.3382 0.2126  149 LYS A CD    
1224 C CE    . LYS A 149 ? 3.0967 3.2064 3.4383 0.0740  -0.3167 0.1990  149 LYS A CE    
1225 N NZ    . LYS A 149 ? 3.3117 3.3898 3.6821 0.0709  -0.2848 0.2337  149 LYS A NZ    
1226 N N     . MET B 1   ? 3.0865 2.0687 2.9430 0.0816  -0.3304 -0.0968 1   MET B N     
1227 C CA    . MET B 1   ? 3.0934 2.0150 2.8198 0.1420  -0.3920 -0.1100 1   MET B CA    
1228 C C     . MET B 1   ? 2.5702 1.5751 2.1566 0.1376  -0.2922 -0.0747 1   MET B C     
1229 O O     . MET B 1   ? 2.4951 1.4801 1.8566 0.1569  -0.2723 -0.0336 1   MET B O     
1230 C CB    . MET B 1   ? 3.0836 1.8673 2.6225 0.1928  -0.5000 -0.0975 1   MET B CB    
1231 C CG    . MET B 1   ? 3.3087 2.0156 2.7051 0.2510  -0.5699 -0.1177 1   MET B CG    
1232 S SD    . MET B 1   ? 3.1429 1.8278 2.7589 0.2750  -0.6505 -0.1946 1   MET B SD    
1233 C CE    . MET B 1   ? 2.7480 1.3030 2.1305 0.3419  -0.7519 -0.2077 1   MET B CE    
1234 N N     . ILE B 2   ? 2.0950 1.1929 1.8216 0.1092  -0.2303 -0.0917 2   ILE B N     
1235 C CA    . ILE B 2   ? 2.1030 1.2898 1.7414 0.1013  -0.1378 -0.0585 2   ILE B CA    
1236 C C     . ILE B 2   ? 2.3508 1.4875 1.9488 0.1590  -0.1917 -0.0908 2   ILE B C     
1237 O O     . ILE B 2   ? 2.1486 1.2614 1.9031 0.1657  -0.2439 -0.1422 2   ILE B O     
1238 C CB    . ILE B 2   ? 2.1470 1.4633 1.9539 0.0271  -0.0375 -0.0502 2   ILE B CB    
1239 C CG1   . ILE B 2   ? 1.9157 1.2744 1.7776 -0.0347 0.0145  -0.0280 2   ILE B CG1   
1240 C CG2   . ILE B 2   ? 1.5696 0.9773 1.2834 0.0196  0.0502  -0.0070 2   ILE B CG2   
1241 C CD1   . ILE B 2   ? 1.6178 0.9799 1.2702 -0.0323 0.0557  0.0312  2   ILE B CD1   
1242 N N     . ILE B 3   ? 2.3322 1.4518 1.7237 0.1988  -0.1767 -0.0648 3   ILE B N     
1243 C CA    . ILE B 3   ? 2.5698 1.6301 1.8963 0.2566  -0.2257 -0.0968 3   ILE B CA    
1244 C C     . ILE B 3   ? 2.5742 1.7346 1.9100 0.2493  -0.1351 -0.0755 3   ILE B C     
1245 O O     . ILE B 3   ? 2.6103 1.8534 1.8632 0.2265  -0.0464 -0.0238 3   ILE B O     
1246 C CB    . ILE B 3   ? 2.5987 1.5548 1.6838 0.3061  -0.2782 -0.0916 3   ILE B CB    
1247 C CG1   . ILE B 3   ? 2.7226 1.5690 1.8003 0.3128  -0.3830 -0.1080 3   ILE B CG1   
1248 C CG2   . ILE B 3   ? 2.6060 1.5092 1.6162 0.3597  -0.3112 -0.1260 3   ILE B CG2   
1249 C CD1   . ILE B 3   ? 2.8219 1.5948 2.0448 0.3364  -0.4891 -0.1691 3   ILE B CD1   
1250 N N     . CYS B 4   ? 1.9339 1.0856 1.3733 0.2680  -0.1605 -0.1141 4   CYS B N     
1251 C CA    . CYS B 4   ? 1.8629 1.0960 1.3270 0.2656  -0.0893 -0.0957 4   CYS B CA    
1252 C C     . CYS B 4   ? 2.1196 1.2726 1.5161 0.3321  -0.1418 -0.1354 4   CYS B C     
1253 O O     . CYS B 4   ? 2.2328 1.3278 1.7358 0.3466  -0.2089 -0.1872 4   CYS B O     
1254 C CB    . CYS B 4   ? 2.1791 1.4905 1.8619 0.2062  -0.0554 -0.1009 4   CYS B CB    
1255 S SG    . CYS B 4   ? 1.6987 1.0891 1.4399 0.2016  0.0068  -0.0817 4   CYS B SG    
1256 N N     . SER B 5   ? 2.2452 1.3967 1.4706 0.3695  -0.1072 -0.1150 5   SER B N     
1257 C CA    . SER B 5   ? 2.6414 1.7180 1.7898 0.4306  -0.1443 -0.1544 5   SER B CA    
1258 C C     . SER B 5   ? 2.5979 1.7587 1.7961 0.4362  -0.0698 -0.1333 5   SER B C     
1259 O O     . SER B 5   ? 2.5194 1.7797 1.6889 0.4136  0.0149  -0.0788 5   SER B O     
1260 C CB    . SER B 5   ? 2.5511 1.5491 1.4659 0.4691  -0.1641 -0.1580 5   SER B CB    
1261 O OG    . SER B 5   ? 2.6272 1.7040 1.4299 0.4566  -0.0740 -0.1054 5   SER B OG    
1262 N N     . VAL B 6   ? 2.6197 1.7394 1.8949 0.4656  -0.1038 -0.1748 6   VAL B N     
1263 C CA    . VAL B 6   ? 2.5410 1.7343 1.9058 0.4657  -0.0461 -0.1547 6   VAL B CA    
1264 C C     . VAL B 6   ? 2.3162 1.4419 1.5990 0.5328  -0.0607 -0.1920 6   VAL B C     
1265 O O     . VAL B 6   ? 2.7231 1.7412 1.9909 0.5651  -0.1363 -0.2519 6   VAL B O     
1266 C CB    . VAL B 6   ? 1.9322 1.1511 1.5053 0.4230  -0.0623 -0.1662 6   VAL B CB    
1267 C CG1   . VAL B 6   ? 1.8596 1.1548 1.5149 0.4155  -0.0033 -0.1331 6   VAL B CG1   
1268 C CG2   . VAL B 6   ? 1.8229 1.0983 1.4813 0.3532  -0.0484 -0.1425 6   VAL B CG2   
1269 N N     . ASP B 7   ? 2.3336 1.5237 1.5685 0.5519  0.0125  -0.1585 7   ASP B N     
1270 C CA    . ASP B 7   ? 2.3953 1.5469 1.6119 0.6084  0.0175  -0.1895 7   ASP B CA    
1271 C C     . ASP B 7   ? 2.3671 1.5662 1.7702 0.5931  0.0291  -0.1761 7   ASP B C     
1272 O O     . ASP B 7   ? 2.4846 1.7945 1.9654 0.5569  0.0899  -0.1148 7   ASP B O     
1273 C CB    . ASP B 7   ? 2.4119 1.6116 1.5024 0.6372  0.0918  -0.1637 7   ASP B CB    
1274 C CG    . ASP B 7   ? 2.9659 2.1289 2.0531 0.6963  0.1044  -0.1996 7   ASP B CG    
1275 O OD1   . ASP B 7   ? 3.2972 2.3440 2.3102 0.7339  0.0510  -0.2654 7   ASP B OD1   
1276 O OD2   . ASP B 7   ? 3.1484 2.3976 2.3108 0.7037  0.1663  -0.1621 7   ASP B OD2   
1277 N N     . ILE B 8   ? 2.3540 1.4664 1.8225 0.6163  -0.0315 -0.2320 8   ILE B N     
1278 C CA    . ILE B 8   ? 2.1695 1.3044 1.8133 0.5946  -0.0355 -0.2272 8   ILE B CA    
1279 C C     . ILE B 8   ? 2.2429 1.3984 1.9059 0.6368  0.0080  -0.2140 8   ILE B C     
1280 O O     . ILE B 8   ? 2.6303 1.7522 2.1806 0.6929  0.0254  -0.2355 8   ILE B O     
1281 C CB    . ILE B 8   ? 2.4057 1.4367 2.1165 0.5974  -0.1213 -0.2962 8   ILE B CB    
1282 C CG1   . ILE B 8   ? 2.3651 1.3541 2.0305 0.5763  -0.1759 -0.3204 8   ILE B CG1   
1283 C CG2   . ILE B 8   ? 2.2803 1.3452 2.1775 0.5500  -0.1230 -0.2859 8   ILE B CG2   
1284 C CD1   . ILE B 8   ? 2.2722 1.3353 2.0620 0.5025  -0.1641 -0.2885 8   ILE B CD1   
1285 N N     . GLY B 9   ? 2.1103 1.3199 1.9217 0.6058  0.0259  -0.1790 9   GLY B N     
1286 C CA    . GLY B 9   ? 2.1893 1.4199 2.0543 0.6403  0.0593  -0.1591 9   GLY B CA    
1287 C C     . GLY B 9   ? 2.2520 1.5758 2.2596 0.5793  0.0883  -0.0902 9   GLY B C     
1288 O O     . GLY B 9   ? 2.1733 1.5866 2.1915 0.5181  0.1203  -0.0371 9   GLY B O     
1289 N N     . ILE B 10  ? 2.1846 1.4833 2.2986 0.5908  0.0763  -0.0902 10  ILE B N     
1290 C CA    . ILE B 10  ? 2.3385 1.7172 2.5793 0.5283  0.0991  -0.0201 10  ILE B CA    
1291 C C     . ILE B 10  ? 2.6783 2.1715 2.9054 0.5298  0.1644  0.0587  10  ILE B C     
1292 O O     . ILE B 10  ? 2.5127 2.1022 2.7947 0.4587  0.1938  0.1292  10  ILE B O     
1293 C CB    . ILE B 10  ? 2.5067 1.8153 2.8578 0.5407  0.0629  -0.0407 10  ILE B CB    
1294 C CG1   . ILE B 10  ? 2.6893 1.8941 3.0608 0.5298  -0.0011 -0.1191 10  ILE B CG1   
1295 C CG2   . ILE B 10  ? 2.4882 1.8713 2.9590 0.4718  0.0822  0.0372  10  ILE B CG2   
1296 C CD1   . ILE B 10  ? 2.9367 2.0679 3.4139 0.5332  -0.0372 -0.1433 10  ILE B CD1   
1297 N N     . LYS B 11  ? 2.8825 2.3701 3.0363 0.6057  0.1902  0.0461  11  LYS B N     
1298 C CA    . LYS B 11  ? 2.7610 2.3603 2.9166 0.6125  0.2518  0.1165  11  LYS B CA    
1299 C C     . LYS B 11  ? 2.5056 2.1878 2.5581 0.5783  0.2942  0.1470  11  LYS B C     
1300 O O     . LYS B 11  ? 2.5146 2.3047 2.6065 0.5152  0.3281  0.2211  11  LYS B O     
1301 C CB    . LYS B 11  ? 3.0457 2.6116 3.1783 0.7047  0.2703  0.0854  11  LYS B CB    
1302 C CG    . LYS B 11  ? 3.3035 2.8176 3.5644 0.7355  0.2440  0.0810  11  LYS B CG    
1303 C CD    . LYS B 11  ? 3.4677 2.9861 3.7360 0.8180  0.2805  0.0703  11  LYS B CD    
1304 C CE    . LYS B 11  ? 3.3064 2.9663 3.6046 0.8069  0.3392  0.1535  11  LYS B CE    
1305 N NZ    . LYS B 11  ? 3.1513 2.8831 3.5864 0.7453  0.3277  0.2437  11  LYS B NZ    
1306 N N     . ASN B 12  ? 2.4114 2.0413 2.3254 0.6147  0.2920  0.0921  12  ASN B N     
1307 C CA    . ASN B 12  ? 2.4208 2.1178 2.2215 0.5894  0.3333  0.1177  12  ASN B CA    
1308 C C     . ASN B 12  ? 2.2818 1.9033 1.9926 0.5712  0.2914  0.0677  12  ASN B C     
1309 O O     . ASN B 12  ? 2.1775 1.7337 1.7526 0.6147  0.2826  0.0188  12  ASN B O     
1310 C CB    . ASN B 12  ? 2.7477 2.4695 2.4497 0.6511  0.3840  0.1114  12  ASN B CB    
1311 C CG    . ASN B 12  ? 2.7768 2.3819 2.4295 0.7297  0.3584  0.0301  12  ASN B CG    
1312 O OD1   . ASN B 12  ? 2.6605 2.1608 2.3342 0.7392  0.2975  -0.0235 12  ASN B OD1   
1313 N ND2   . ASN B 12  ? 2.9480 2.5719 2.5357 0.7830  0.4077  0.0170  12  ASN B ND2   
1314 N N     . PRO B 13  ? 2.0069 1.6336 1.7924 0.5044  0.2639  0.0779  13  PRO B N     
1315 C CA    . PRO B 13  ? 2.0829 1.6524 1.8021 0.4831  0.2259  0.0383  13  PRO B CA    
1316 C C     . PRO B 13  ? 1.9967 1.6395 1.6157 0.4516  0.2735  0.0791  13  PRO B C     
1317 O O     . PRO B 13  ? 2.0961 1.8530 1.7406 0.4128  0.3337  0.1467  13  PRO B O     
1318 C CB    . PRO B 13  ? 1.9904 1.5584 1.8521 0.4170  0.1936  0.0381  13  PRO B CB    
1319 C CG    . PRO B 13  ? 2.0948 1.7641 2.0587 0.3738  0.2400  0.1091  13  PRO B CG    
1320 C CD    . PRO B 13  ? 1.8303 1.5068 1.7700 0.4435  0.2629  0.1209  13  PRO B CD    
1321 N N     . ALA B 14  ? 1.4164 1.6913 2.1022 0.4802  0.0077  0.2375  14  ALA B N     
1322 C CA    . ALA B 14  ? 1.3083 1.5455 2.0097 0.4636  0.0200  0.2306  14  ALA B CA    
1323 C C     . ALA B 14  ? 1.2663 1.4506 1.8982 0.4818  0.0368  0.2281  14  ALA B C     
1324 O O     . ALA B 14  ? 1.3931 1.5786 1.9780 0.5086  0.0454  0.2356  14  ALA B O     
1325 C CB    . ALA B 14  ? 1.5027 1.7387 2.2673 0.4511  0.0541  0.2408  14  ALA B CB    
1326 N N     . TYR B 15  ? 1.6853 1.8254 2.3196 0.4675  0.0415  0.2153  15  TYR B N     
1327 C CA    . TYR B 15  ? 1.6384 1.7207 2.2244 0.4891  0.0570  0.2154  15  TYR B CA    
1328 C C     . TYR B 15  ? 1.6049 1.6220 2.2130 0.4727  0.0850  0.2179  15  TYR B C     
1329 O O     . TYR B 15  ? 1.6675 1.6889 2.3252 0.4367  0.0852  0.1986  15  TYR B O     
1330 C CB    . TYR B 15  ? 1.5683 1.6526 2.1242 0.4922  0.0357  0.1836  15  TYR B CB    
1331 C CG    . TYR B 15  ? 1.6418 1.7292 2.2220 0.4520  0.0209  0.1511  15  TYR B CG    
1332 C CD1   . TYR B 15  ? 1.6831 1.8273 2.2725 0.4267  -0.0126 0.1420  15  TYR B CD1   
1333 C CD2   . TYR B 15  ? 1.7143 1.7469 2.3071 0.4382  0.0399  0.1296  15  TYR B CD2   
1334 C CE1   . TYR B 15  ? 1.8571 2.0128 2.4593 0.3859  -0.0321 0.1116  15  TYR B CE1   
1335 C CE2   . TYR B 15  ? 1.8363 1.8786 2.4495 0.3945  0.0295  0.0919  15  TYR B CE2   
1336 C CZ    . TYR B 15  ? 2.0151 2.1237 2.6286 0.3671  -0.0092 0.0825  15  TYR B CZ    
1337 O OH    . TYR B 15  ? 2.2295 2.3562 2.8543 0.3196  -0.0253 0.0443  15  TYR B OH    
1338 N N     . ALA B 16  ? 1.5513 1.5068 2.1211 0.4993  0.1077  0.2417  16  ALA B N     
1339 C CA    . ALA B 16  ? 1.6328 1.5039 2.2094 0.4892  0.1403  0.2512  16  ALA B CA    
1340 C C     . ALA B 16  ? 1.6512 1.4653 2.2027 0.5202  0.1389  0.2478  16  ALA B C     
1341 O O     . ALA B 16  ? 1.6703 1.4919 2.1826 0.5624  0.1241  0.2638  16  ALA B O     
1342 C CB    . ALA B 16  ? 1.6953 1.5284 2.2458 0.4910  0.1730  0.2936  16  ALA B CB    
1343 N N     . ILE B 17  ? 1.6740 1.4359 2.2584 0.4984  0.1558  0.2218  17  ILE B N     
1344 C CA    . ILE B 17  ? 1.7323 1.4339 2.3175 0.5230  0.1621  0.2093  17  ILE B CA    
1345 C C     . ILE B 17  ? 1.9353 1.5258 2.5221 0.5257  0.2030  0.2410  17  ILE B C     
1346 O O     . ILE B 17  ? 2.0090 1.5662 2.6303 0.4811  0.2339  0.2248  17  ILE B O     
1347 C CB    . ILE B 17  ? 1.7196 1.4448 2.3424 0.4886  0.1569  0.1456  17  ILE B CB    
1348 C CG1   . ILE B 17  ? 1.6281 1.4557 2.2382 0.4715  0.1188  0.1216  17  ILE B CG1   
1349 C CG2   . ILE B 17  ? 1.7685 1.4448 2.4022 0.5177  0.1651  0.1238  17  ILE B CG2   
1350 C CD1   . ILE B 17  ? 1.7355 1.6013 2.3079 0.5129  0.0960  0.1279  17  ILE B CD1   
1351 N N     . PHE B 18  ? 1.9038 1.4370 2.4529 0.5768  0.2023  0.2864  18  PHE B N     
1352 C CA    . PHE B 18  ? 2.0328 1.4433 2.5681 0.5881  0.2379  0.3290  18  PHE B CA    
1353 C C     . PHE B 18  ? 2.1004 1.4450 2.6682 0.6272  0.2390  0.3201  18  PHE B C     
1354 O O     . PHE B 18  ? 2.0468 1.4472 2.6360 0.6551  0.2090  0.2893  18  PHE B O     
1355 C CB    . PHE B 18  ? 2.3900 1.7746 2.8467 0.6174  0.2337  0.4007  18  PHE B CB    
1356 C CG    . PHE B 18  ? 2.2740 1.7293 2.7050 0.5832  0.2360  0.4056  18  PHE B CG    
1357 C CD1   . PHE B 18  ? 2.1209 1.6097 2.6026 0.5259  0.2576  0.3669  18  PHE B CD1   
1358 C CD2   . PHE B 18  ? 2.4637 1.9562 2.8277 0.6080  0.2169  0.4453  18  PHE B CD2   
1359 C CE1   . PHE B 18  ? 2.2325 1.7869 2.7102 0.4987  0.2613  0.3688  18  PHE B CE1   
1360 C CE2   . PHE B 18  ? 2.4711 2.0261 2.8226 0.5748  0.2269  0.4437  18  PHE B CE2   
1361 C CZ    . PHE B 18  ? 2.3873 1.9709 2.8015 0.5222  0.2499  0.4060  18  PHE B CZ    
1362 N N     . ASN B 19  ? 2.2279 1.4479 2.8030 0.6292  0.2786  0.3476  19  ASN B N     
1363 C CA    . ASN B 19  ? 2.3208 1.4547 2.9326 0.6758  0.2846  0.3545  19  ASN B CA    
1364 C C     . ASN B 19  ? 2.4500 1.4824 2.9981 0.7242  0.2840  0.4456  19  ASN B C     
1365 O O     . ASN B 19  ? 2.7144 1.6576 3.2217 0.6963  0.3239  0.4853  19  ASN B O     
1366 C CB    . ASN B 19  ? 2.3799 1.4410 3.0655 0.6337  0.3372  0.3026  19  ASN B CB    
1367 C CG    . ASN B 19  ? 2.9232 1.8868 3.6649 0.6824  0.3513  0.3058  19  ASN B CG    
1368 O OD1   . ASN B 19  ? 2.9579 1.9630 3.7253 0.7342  0.3147  0.2973  19  ASN B OD1   
1369 N ND2   . ASN B 19  ? 2.9880 1.8206 3.7591 0.6653  0.4082  0.3144  19  ASN B ND2   
1370 N N     . TYR B 20  ? 2.6234 1.6706 3.1610 0.7938  0.2385  0.4774  20  TYR B N     
1371 C CA    . TYR B 20  ? 2.7095 1.6724 3.1781 0.8479  0.2216  0.5696  20  TYR B CA    
1372 C C     . TYR B 20  ? 3.0402 1.8994 3.5819 0.9007  0.2275  0.5794  20  TYR B C     
1373 O O     . TYR B 20  ? 2.9728 1.8885 3.5919 0.9407  0.1984  0.5374  20  TYR B O     
1374 C CB    . TYR B 20  ? 2.5872 1.6575 2.9980 0.8891  0.1592  0.5962  20  TYR B CB    
1375 C CG    . TYR B 20  ? 2.7838 1.7877 3.1137 0.9468  0.1274  0.6912  20  TYR B CG    
1376 C CD1   . TYR B 20  ? 2.7895 1.7252 3.0056 0.9204  0.1479  0.7596  20  TYR B CD1   
1377 C CD2   . TYR B 20  ? 3.1936 2.2142 3.5573 1.0185  0.0725  0.7053  20  TYR B CD2   
1378 C CE1   . TYR B 20  ? 3.1946 2.0684 3.3166 0.9682  0.1149  0.8512  20  TYR B CE1   
1379 C CE2   . TYR B 20  ? 3.4135 2.3973 3.6942 1.0510  0.0258  0.7788  20  TYR B CE2   
1380 C CZ    . TYR B 20  ? 3.4346 2.3415 3.5880 1.0283  0.0470  0.8567  20  TYR B CZ    
1381 O OH    . TYR B 20  ? 3.6361 2.5045 3.6940 1.0564  -0.0014 0.9329  20  TYR B OH    
1382 N N     . ASP B 21  ? 2.8740 1.5780 3.3973 0.8992  0.2700  0.6318  21  ASP B N     
1383 C CA    . ASP B 21  ? 3.0006 1.5995 3.5952 0.9438  0.2765  0.6406  21  ASP B CA    
1384 C C     . ASP B 21  ? 3.4386 2.0638 3.9878 1.0091  0.1948  0.6931  21  ASP B C     
1385 O O     . ASP B 21  ? 3.1654 1.7560 3.5989 1.0193  0.1692  0.7749  21  ASP B O     
1386 C CB    . ASP B 21  ? 3.2592 1.6897 3.8357 0.9090  0.3448  0.6746  21  ASP B CB    
1387 C CG    . ASP B 21  ? 3.4786 1.8240 4.1534 0.9231  0.3664  0.6422  21  ASP B CG    
1388 O OD1   . ASP B 21  ? 3.4923 1.9104 4.2539 0.9583  0.3311  0.5894  21  ASP B OD1   
1389 O OD2   . ASP B 21  ? 3.5927 1.7979 4.2601 0.8958  0.4239  0.6655  21  ASP B OD2   
1390 N N     . ASN B 22  ? 3.6181 2.3055 4.2605 1.0498  0.1552  0.6420  22  ASN B N     
1391 C CA    . ASN B 22  ? 3.7895 2.5208 4.4125 1.1129  0.0714  0.6772  22  ASN B CA    
1392 C C     . ASN B 22  ? 3.8671 2.4518 4.4520 1.1420  0.0607  0.7556  22  ASN B C     
1393 O O     . ASN B 22  ? 3.9533 2.4231 4.5981 1.1339  0.1103  0.7438  22  ASN B O     
1394 C CB    . ASN B 22  ? 3.7221 2.5473 4.4684 1.1461  0.0422  0.5929  22  ASN B CB    
1395 C CG    . ASN B 22  ? 3.4243 2.3960 4.1937 1.1189  0.0458  0.5215  22  ASN B CG    
1396 O OD1   . ASN B 22  ? 3.3122 2.3094 4.1703 1.0928  0.0884  0.4404  22  ASN B OD1   
1397 N ND2   . ASN B 22  ? 3.1654 2.2322 3.8519 1.1213  0.0035  0.5508  22  ASN B ND2   
1398 N N     . THR B 23  ? 4.0746 2.6618 4.5559 1.1714  -0.0018 0.8360  23  THR B N     
1399 C CA    . THR B 23  ? 4.4526 2.9066 4.8689 1.2009  -0.0276 0.9268  23  THR B CA    
1400 C C     . THR B 23  ? 4.5940 2.9005 4.9210 1.1472  0.0493  0.9806  23  THR B C     
1401 O O     . THR B 23  ? 4.8449 3.0261 5.0925 1.1599  0.0378  1.0644  23  THR B O     
1402 C CB    . THR B 23  ? 4.5200 2.9119 5.0517 1.2560  -0.0507 0.9071  23  THR B CB    
1403 O OG1   . THR B 23  ? 4.4833 3.0133 5.1308 1.2883  -0.0876 0.8205  23  THR B OG1   
1404 C CG2   . THR B 23  ? 4.6572 2.9688 5.1221 1.3096  -0.1237 1.0031  23  THR B CG2   
1405 N N     . SER B 24  ? 4.3966 2.7124 4.7340 1.0856  0.1270  0.9344  24  SER B N     
1406 C CA    . SER B 24  ? 4.2327 2.4190 4.4931 1.0275  0.2062  0.9737  24  SER B CA    
1407 C C     . SER B 24  ? 4.1801 2.4152 4.3228 0.9840  0.2235  1.0006  24  SER B C     
1408 O O     . SER B 24  ? 3.7711 1.8951 3.8218 0.9381  0.2805  1.0481  24  SER B O     
1409 C CB    . SER B 24  ? 4.0478 2.1847 4.4219 0.9819  0.2937  0.8964  24  SER B CB    
1410 O OG    . SER B 24  ? 3.9730 2.0567 4.4571 1.0159  0.2909  0.8663  24  SER B OG    
1411 N N     . ASN B 25  ? 4.2705 2.6653 4.4159 0.9945  0.1814  0.9679  25  ASN B N     
1412 C CA    . ASN B 25  ? 4.3772 2.8300 4.4200 0.9578  0.1963  0.9882  25  ASN B CA    
1413 C C     . ASN B 25  ? 4.1642 2.5501 4.2167 0.8884  0.2931  0.9637  25  ASN B C     
1414 O O     . ASN B 25  ? 4.3776 2.7181 4.3231 0.8378  0.3311  1.0006  25  ASN B O     
1415 C CB    . ASN B 25  ? 4.6158 3.0259 4.4980 0.9667  0.1602  1.0842  25  ASN B CB    
1416 C CG    . ASN B 25  ? 4.4605 2.9516 4.3409 1.0323  0.0581  1.1045  25  ASN B CG    
1417 O OD1   . ASN B 25  ? 4.2649 2.8857 4.2448 1.0638  0.0151  1.0409  25  ASN B OD1   
1418 N ND2   . ASN B 25  ? 4.6315 3.0456 4.3992 1.0491  0.0191  1.1916  25  ASN B ND2   
1419 N N     . THR B 26  ? 3.6365 2.0426 3.8210 0.8668  0.3270  0.8790  26  THR B N     
1420 C CA    . THR B 26  ? 3.2676 1.6519 3.4860 0.7802  0.4026  0.8201  26  THR B CA    
1421 C C     . THR B 26  ? 3.1257 1.6904 3.3970 0.7375  0.3869  0.7302  26  THR B C     
1422 O O     . THR B 26  ? 2.9653 1.6177 3.3299 0.7551  0.3596  0.6658  26  THR B O     
1423 C CB    . THR B 26  ? 3.4038 1.6743 3.7268 0.7753  0.4554  0.7865  26  THR B CB    
1424 O OG1   . THR B 26  ? 3.5360 1.6500 3.8120 0.8165  0.4583  0.8679  26  THR B OG1   
1425 C CG2   . THR B 26  ? 3.4101 1.6555 3.7621 0.6818  0.5346  0.7279  26  THR B CG2   
1426 N N     . ILE B 27  ? 3.0303 1.6450 3.2427 0.6802  0.4066  0.7264  27  ILE B N     
1427 C CA    . ILE B 27  ? 2.9104 1.6872 3.1691 0.6413  0.3909  0.6526  27  ILE B CA    
1428 C C     . ILE B 27  ? 3.0621 1.8344 3.4084 0.5728  0.4455  0.5802  27  ILE B C     
1429 O O     . ILE B 27  ? 3.3701 2.0645 3.6965 0.5204  0.5055  0.5884  27  ILE B O     
1430 C CB    . ILE B 27  ? 3.0551 1.8952 3.2238 0.6164  0.3851  0.6803  27  ILE B CB    
1431 C CG1   . ILE B 27  ? 3.2437 2.0693 3.3060 0.6753  0.3381  0.7591  27  ILE B CG1   
1432 C CG2   . ILE B 27  ? 2.6667 1.6738 2.8924 0.5917  0.3595  0.6112  27  ILE B CG2   
1433 C CD1   . ILE B 27  ? 2.8755 1.7860 2.9797 0.7439  0.2686  0.7462  27  ILE B CD1   
1434 N N     . LYS B 28  ? 2.9410 1.7988 3.3813 0.5688  0.4261  0.5059  28  LYS B N     
1435 C CA    . LYS B 28  ? 2.6890 1.5702 3.2132 0.5022  0.4650  0.4292  28  LYS B CA    
1436 C C     . LYS B 28  ? 2.6254 1.6732 3.1905 0.4844  0.4200  0.3684  28  LYS B C     
1437 O O     . LYS B 28  ? 2.8415 1.9524 3.4282 0.5189  0.3767  0.3445  28  LYS B O     
1438 C CB    . LYS B 28  ? 2.6584 1.4521 3.2548 0.5052  0.4962  0.3956  28  LYS B CB    
1439 C CG    . LYS B 28  ? 2.9205 1.5309 3.4864 0.5174  0.5501  0.4553  28  LYS B CG    
1440 C CD    . LYS B 28  ? 3.1796 1.7049 3.8377 0.4992  0.6003  0.4038  28  LYS B CD    
1441 C CE    . LYS B 28  ? 3.1172 1.6676 3.8350 0.5555  0.5627  0.3791  28  LYS B CE    
1442 N NZ    . LYS B 28  ? 3.0606 1.5310 3.7332 0.6428  0.5302  0.4665  28  LYS B NZ    
1443 N N     . LEU B 29  ? 2.5973 1.7125 3.1758 0.4308  0.4318  0.3439  29  LEU B N     
1444 C CA    . LEU B 29  ? 2.4426 1.7076 3.0587 0.4139  0.3879  0.2958  29  LEU B CA    
1445 C C     . LEU B 29  ? 2.4863 1.7905 3.1748 0.3897  0.3796  0.2238  29  LEU B C     
1446 O O     . LEU B 29  ? 2.6714 1.9395 3.4126 0.3405  0.4204  0.1833  29  LEU B O     
1447 C CB    . LEU B 29  ? 2.2166 1.5362 2.8530 0.3625  0.4061  0.2839  29  LEU B CB    
1448 C CG    . LEU B 29  ? 2.0037 1.4725 2.6831 0.3504  0.3569  0.2443  29  LEU B CG    
1449 C CD1   . LEU B 29  ? 1.9468 1.4714 2.5812 0.3723  0.3369  0.2824  29  LEU B CD1   
1450 C CD2   . LEU B 29  ? 2.0499 1.5758 2.8171 0.2881  0.3693  0.1868  29  LEU B CD2   
1451 N N     . ILE B 30  ? 2.2404 1.6192 2.9282 0.4178  0.3313  0.2029  30  ILE B N     
1452 C CA    . ILE B 30  ? 2.1450 1.5702 2.8859 0.3854  0.3229  0.1309  30  ILE B CA    
1453 C C     . ILE B 30  ? 1.9447 1.4873 2.7118 0.3378  0.2948  0.0941  30  ILE B C     
1454 O O     . ILE B 30  ? 2.0889 1.6508 2.9077 0.2825  0.3094  0.0425  30  ILE B O     
1455 C CB    . ILE B 30  ? 2.3044 1.7525 3.0328 0.4283  0.2907  0.1177  30  ILE B CB    
1456 C CG1   . ILE B 30  ? 2.5143 1.8480 3.2420 0.4790  0.3149  0.1496  30  ILE B CG1   
1457 C CG2   . ILE B 30  ? 2.1153 1.6197 2.8819 0.3838  0.2834  0.0394  30  ILE B CG2   
1458 C CD1   . ILE B 30  ? 2.3439 1.7046 3.0799 0.5226  0.2871  0.1290  30  ILE B CD1   
1459 N N     . ALA B 31  ? 2.0283 1.6521 2.7648 0.3589  0.2532  0.1196  31  ALA B N     
1460 C CA    . ALA B 31  ? 1.9977 1.7309 2.7640 0.3242  0.2192  0.0942  31  ALA B CA    
1461 C C     . ALA B 31  ? 1.8775 1.6596 2.6168 0.3525  0.1980  0.1391  31  ALA B C     
1462 O O     . ALA B 31  ? 1.9261 1.6777 2.6120 0.3978  0.1986  0.1801  31  ALA B O     
1463 C CB    . ALA B 31  ? 1.9155 1.7170 2.6795 0.3097  0.1787  0.0474  31  ALA B CB    
1464 N N     . ILE B 32  ? 1.6965 1.5579 2.4809 0.3247  0.1798  0.1285  32  ILE B N     
1465 C CA    . ILE B 32  ? 1.8558 1.7749 2.6296 0.3474  0.1597  0.1601  32  ILE B CA    
1466 C C     . ILE B 32  ? 1.8744 1.8959 2.7030 0.3240  0.1152  0.1354  32  ILE B C     
1467 O O     . ILE B 32  ? 1.9109 1.9629 2.8116 0.2842  0.1165  0.1076  32  ILE B O     
1468 C CB    . ILE B 32  ? 1.9875 1.8659 2.7645 0.3447  0.2050  0.1922  32  ILE B CB    
1469 C CG1   . ILE B 32  ? 1.5982 1.5430 2.3762 0.3608  0.1907  0.2141  32  ILE B CG1   
1470 C CG2   . ILE B 32  ? 2.0290 1.8934 2.8797 0.2935  0.2406  0.1643  32  ILE B CG2   
1471 C CD1   . ILE B 32  ? 1.6168 1.5147 2.3645 0.3618  0.2381  0.2478  32  ILE B CD1   
1472 N N     . GLU B 33  ? 2.1264 2.2014 2.9234 0.3482  0.0742  0.1451  33  GLU B N     
1473 C CA    . GLU B 33  ? 2.1397 2.3006 2.9746 0.3310  0.0243  0.1305  33  GLU B CA    
1474 C C     . GLU B 33  ? 2.1304 2.3335 2.9490 0.3629  0.0036  0.1609  33  GLU B C     
1475 O O     . GLU B 33  ? 2.3186 2.4928 3.0912 0.3944  0.0265  0.1846  33  GLU B O     
1476 C CB    . GLU B 33  ? 2.3611 2.5340 3.1596 0.3108  -0.0084 0.0969  33  GLU B CB    
1477 C CG    . GLU B 33  ? 2.4969 2.6370 3.3211 0.2705  0.0135  0.0553  33  GLU B CG    
1478 C CD    . GLU B 33  ? 2.5925 2.7818 3.5086 0.2309  0.0073  0.0348  33  GLU B CD    
1479 O OE1   . GLU B 33  ? 2.5398 2.8075 3.4994 0.2310  -0.0353 0.0457  33  GLU B OE1   
1480 O OE2   . GLU B 33  ? 2.4956 2.6447 3.4482 0.2002  0.0467  0.0060  33  GLU B OE2   
1481 N N     . LYS B 34  ? 2.0382 2.3112 2.8972 0.3538  -0.0413 0.1598  34  LYS B N     
1482 C CA    . LYS B 34  ? 2.2039 2.5120 3.0479 0.3809  -0.0634 0.1854  34  LYS B CA    
1483 C C     . LYS B 34  ? 1.8563 2.2041 2.6736 0.3691  -0.1216 0.1801  34  LYS B C     
1484 O O     . LYS B 34  ? 1.7159 2.0947 2.5643 0.3377  -0.1545 0.1607  34  LYS B O     
1485 C CB    . LYS B 34  ? 2.3325 2.6783 3.2682 0.3874  -0.0516 0.2023  34  LYS B CB    
1486 C CG    . LYS B 34  ? 2.0943 2.4978 3.1408 0.3620  -0.0803 0.1886  34  LYS B CG    
1487 C CD    . LYS B 34  ? 1.5376 1.9691 2.6883 0.3671  -0.0506 0.1956  34  LYS B CD    
1488 C CE    . LYS B 34  ? 1.4833 1.9910 2.7658 0.3518  -0.0906 0.1829  34  LYS B CE    
1489 N NZ    . LYS B 34  ? 1.3443 1.8771 2.7476 0.3495  -0.0486 0.1759  34  LYS B NZ    
1490 N N     . SER B 35  ? 1.5879 1.9339 2.3403 0.3905  -0.1325 0.1960  35  SER B N     
1491 C CA    . SER B 35  ? 1.5076 1.8748 2.2060 0.3774  -0.1816 0.1964  35  SER B CA    
1492 C C     . SER B 35  ? 1.4884 1.8785 2.1968 0.4014  -0.1991 0.2318  35  SER B C     
1493 O O     . SER B 35  ? 1.5144 1.9142 2.2899 0.4241  -0.1738 0.2488  35  SER B O     
1494 C CB    . SER B 35  ? 1.5080 1.8344 2.1021 0.3703  -0.1687 0.1710  35  SER B CB    
1495 O OG    . SER B 35  ? 1.7206 2.0213 2.2789 0.4033  -0.1333 0.1789  35  SER B OG    
1496 N N     . ASP B 36  ? 1.4760 1.8705 2.1175 0.3925  -0.2385 0.2418  36  ASP B N     
1497 C CA    . ASP B 36  ? 1.4709 1.8722 2.1123 0.4140  -0.2533 0.2782  36  ASP B CA    
1498 C C     . ASP B 36  ? 1.6961 2.0594 2.2138 0.4088  -0.2446 0.2724  36  ASP B C     
1499 O O     . ASP B 36  ? 1.7440 2.0962 2.1783 0.3770  -0.2668 0.2537  36  ASP B O     
1500 C CB    . ASP B 36  ? 1.6503 2.0941 2.3444 0.4074  -0.3199 0.3080  36  ASP B CB    
1501 C CG    . ASP B 36  ? 1.8938 2.3306 2.5889 0.4324  -0.3350 0.3517  36  ASP B CG    
1502 O OD1   . ASP B 36  ? 1.9950 2.4089 2.6981 0.4567  -0.2840 0.3546  36  ASP B OD1   
1503 O OD2   . ASP B 36  ? 2.1217 2.5744 2.8077 0.4266  -0.3981 0.3835  36  ASP B OD2   
1504 N N     . TRP B 37  ? 1.7481 2.0943 2.2557 0.4344  -0.2074 0.2815  37  TRP B N     
1505 C CA    . TRP B 37  ? 1.9511 2.2643 2.3535 0.4285  -0.1906 0.2709  37  TRP B CA    
1506 C C     . TRP B 37  ? 2.1737 2.4782 2.5734 0.4392  -0.2035 0.3110  37  TRP B C     
1507 O O     . TRP B 37  ? 2.1970 2.4920 2.6104 0.4601  -0.1625 0.3135  37  TRP B O     
1508 C CB    . TRP B 37  ? 1.9277 2.2302 2.3202 0.4474  -0.1323 0.2403  37  TRP B CB    
1509 C CG    . TRP B 37  ? 1.6336 1.9322 2.0328 0.4446  -0.1181 0.2092  37  TRP B CG    
1510 C CD1   . TRP B 37  ? 1.6639 1.9587 2.0554 0.4185  -0.1412 0.1926  37  TRP B CD1   
1511 C CD2   . TRP B 37  ? 1.5314 1.8265 1.9493 0.4691  -0.0772 0.1935  37  TRP B CD2   
1512 N NE1   . TRP B 37  ? 1.7657 2.0452 2.1745 0.4271  -0.1123 0.1683  37  TRP B NE1   
1513 C CE2   . TRP B 37  ? 1.5468 1.8255 1.9686 0.4603  -0.0771 0.1730  37  TRP B CE2   
1514 C CE3   . TRP B 37  ? 1.4473 1.7523 1.8763 0.4958  -0.0417 0.1948  37  TRP B CE3   
1515 C CZ2   . TRP B 37  ? 1.4896 1.7530 1.9235 0.4828  -0.0470 0.1629  37  TRP B CZ2   
1516 C CZ3   . TRP B 37  ? 1.5422 1.8432 1.9768 0.5149  -0.0165 0.1820  37  TRP B CZ3   
1517 C CH2   . TRP B 37  ? 1.5298 1.8060 1.9658 0.5110  -0.0213 0.1707  37  TRP B CH2   
1518 N N     . THR B 38  ? 2.1765 2.4831 2.5571 0.4235  -0.2622 0.3430  38  THR B N     
1519 C CA    . THR B 38  ? 2.0147 2.3013 2.3896 0.4352  -0.2834 0.3916  38  THR B CA    
1520 C C     . THR B 38  ? 2.3915 2.6283 2.6159 0.4041  -0.2938 0.3965  38  THR B C     
1521 O O     . THR B 38  ? 2.4405 2.6354 2.6188 0.4094  -0.2571 0.4033  38  THR B O     
1522 C CB    . THR B 38  ? 1.9772 2.3019 2.4477 0.4461  -0.3493 0.4349  38  THR B CB    
1523 O OG1   . THR B 38  ? 1.9995 2.3607 2.4677 0.4188  -0.3898 0.4138  38  THR B OG1   
1524 C CG2   . THR B 38  ? 2.0956 2.4516 2.7235 0.4828  -0.3220 0.4420  38  THR B CG2   
1525 N N     . LYS B 39  ? 2.7518 2.9914 2.8954 0.3655  -0.3383 0.3885  39  LYS B N     
1526 C CA    . LYS B 39  ? 2.9142 3.1055 2.9023 0.3252  -0.3519 0.3940  39  LYS B CA    
1527 C C     . LYS B 39  ? 2.7702 2.9439 2.6747 0.2928  -0.2983 0.3241  39  LYS B C     
1528 O O     . LYS B 39  ? 2.7371 2.9393 2.6564 0.2754  -0.2999 0.2820  39  LYS B O     
1529 C CB    . LYS B 39  ? 3.1384 3.3483 3.0798 0.2954  -0.4359 0.4260  39  LYS B CB    
1530 C CG    . LYS B 39  ? 3.4990 3.6551 3.2579 0.2439  -0.4519 0.4340  39  LYS B CG    
1531 C CD    . LYS B 39  ? 3.6936 3.7800 3.3975 0.2586  -0.4268 0.4774  39  LYS B CD    
1532 C CE    . LYS B 39  ? 3.8954 3.9171 3.4030 0.2010  -0.4386 0.4888  39  LYS B CE    
1533 N NZ    . LYS B 39  ? 4.0461 4.0845 3.4942 0.1776  -0.5364 0.5417  39  LYS B NZ    
1534 N N     . ASN B 40  ? 2.3486 2.4750 2.1749 0.2841  -0.2482 0.3084  40  ASN B N     
1535 C CA    . ASN B 40  ? 2.2011 2.3142 1.9648 0.2572  -0.1921 0.2369  40  ASN B CA    
1536 C C     . ASN B 40  ? 2.1431 2.2992 2.0138 0.2872  -0.1631 0.1944  40  ASN B C     
1537 O O     . ASN B 40  ? 2.5877 2.7585 2.4586 0.2681  -0.1643 0.1537  40  ASN B O     
1538 C CB    . ASN B 40  ? 2.1425 2.2368 1.7797 0.1937  -0.2131 0.2109  40  ASN B CB    
1539 C CG    . ASN B 40  ? 2.3518 2.4152 1.9053 0.1583  -0.1483 0.1414  40  ASN B CG    
1540 O OD1   . ASN B 40  ? 2.2224 2.3021 1.8417 0.1840  -0.0962 0.0947  40  ASN B OD1   
1541 N ND2   . ASN B 40  ? 2.5049 2.5256 1.9128 0.0972  -0.1518 0.1331  40  ASN B ND2   
1542 N N     . TRP B 41  ? 1.7823 1.9538 1.7418 0.3332  -0.1348 0.2067  41  TRP B N     
1543 C CA    . TRP B 41  ? 1.8473 2.0559 1.9068 0.3661  -0.1157 0.1857  41  TRP B CA    
1544 C C     . TRP B 41  ? 1.9307 2.1392 1.9675 0.3580  -0.0788 0.1218  41  TRP B C     
1545 O O     . TRP B 41  ? 1.6550 1.8818 1.7530 0.3748  -0.0759 0.1064  41  TRP B O     
1546 C CB    . TRP B 41  ? 1.6764 1.9002 1.8134 0.4073  -0.0865 0.2056  41  TRP B CB    
1547 C CG    . TRP B 41  ? 1.8734 2.0811 1.9677 0.4082  -0.0369 0.1816  41  TRP B CG    
1548 C CD1   . TRP B 41  ? 1.9753 2.1502 2.0302 0.4004  -0.0266 0.2056  41  TRP B CD1   
1549 C CD2   . TRP B 41  ? 1.7691 1.9929 1.8599 0.4159  0.0093  0.1263  41  TRP B CD2   
1550 N NE1   . TRP B 41  ? 1.9641 2.1353 1.9918 0.3982  0.0297  0.1630  41  TRP B NE1   
1551 C CE2   . TRP B 41  ? 1.7386 1.9466 1.7911 0.4086  0.0489  0.1125  41  TRP B CE2   
1552 C CE3   . TRP B 41  ? 1.6634 1.9128 1.7849 0.4301  0.0196  0.0884  41  TRP B CE3   
1553 C CZ2   . TRP B 41  ? 1.7318 1.9622 1.7819 0.4129  0.0963  0.0554  41  TRP B CZ2   
1554 C CZ3   . TRP B 41  ? 1.6585 1.9274 1.7781 0.4405  0.0601  0.0395  41  TRP B CZ3   
1555 C CH2   . TRP B 41  ? 1.6890 1.9549 1.7759 0.4308  0.0969  0.0201  41  TRP B CH2   
1556 N N     . GLU B 42  ? 2.0230 2.2083 1.9794 0.3329  -0.0478 0.0834  42  GLU B N     
1557 C CA    . GLU B 42  ? 1.6388 1.8293 1.5933 0.3280  -0.0124 0.0170  42  GLU B CA    
1558 C C     . GLU B 42  ? 1.7122 1.8981 1.6592 0.3001  -0.0324 -0.0070 42  GLU B C     
1559 O O     . GLU B 42  ? 1.9358 2.1323 1.9426 0.3190  -0.0177 -0.0378 42  GLU B O     
1560 C CB    . GLU B 42  ? 1.7401 1.9091 1.6152 0.2982  0.0288  -0.0275 42  GLU B CB    
1561 C CG    . GLU B 42  ? 1.7939 1.9677 1.6795 0.3201  0.0606  -0.0184 42  GLU B CG    
1562 C CD    . GLU B 42  ? 2.1740 2.3040 1.9835 0.2949  0.0513  0.0268  42  GLU B CD    
1563 O OE1   . GLU B 42  ? 2.4706 2.5767 2.2309 0.2707  0.0054  0.0661  42  GLU B OE1   
1564 O OE2   . GLU B 42  ? 2.3287 2.4479 2.1283 0.2988  0.0893  0.0233  42  GLU B OE2   
1565 N N     . ARG B 43  ? 1.7838 1.9526 1.6567 0.2539  -0.0658 0.0068  43  ARG B N     
1566 C CA    . ARG B 43  ? 1.9354 2.1061 1.8019 0.2195  -0.0836 -0.0209 43  ARG B CA    
1567 C C     . ARG B 43  ? 2.0182 2.2131 1.9920 0.2532  -0.1026 0.0005  43  ARG B C     
1568 O O     . ARG B 43  ? 2.3836 2.5762 2.3991 0.2510  -0.0855 -0.0383 43  ARG B O     
1569 C CB    . ARG B 43  ? 2.2404 2.4003 2.0066 0.1645  -0.1279 0.0005  43  ARG B CB    
1570 C CG    . ARG B 43  ? 2.7825 2.9054 2.4146 0.1111  -0.1060 -0.0281 43  ARG B CG    
1571 C CD    . ARG B 43  ? 3.0350 3.1459 2.5632 0.0684  -0.1643 0.0205  43  ARG B CD    
1572 N NE    . ARG B 43  ? 3.1350 3.2019 2.5100 0.0027  -0.1436 -0.0077 43  ARG B NE    
1573 C CZ    . ARG B 43  ? 3.2284 3.2749 2.4781 -0.0458 -0.1915 0.0303  43  ARG B CZ    
1574 N NH1   . ARG B 43  ? 3.1642 3.2398 2.4404 -0.0303 -0.2681 0.0964  43  ARG B NH1   
1575 N NH2   . ARG B 43  ? 3.4974 3.4957 2.5951 -0.1115 -0.1638 0.0016  43  ARG B NH2   
1576 N N     . SER B 44  ? 1.5478 1.7615 1.5719 0.2827  -0.1329 0.0599  44  SER B N     
1577 C CA    . SER B 44  ? 1.6526 1.8874 1.7757 0.3069  -0.1460 0.0783  44  SER B CA    
1578 C C     . SER B 44  ? 1.4820 1.7108 1.6680 0.3475  -0.1033 0.0599  44  SER B C     
1579 O O     . SER B 44  ? 1.4244 1.6469 1.6607 0.3508  -0.0963 0.0462  44  SER B O     
1580 C CB    . SER B 44  ? 1.7073 1.9658 1.8808 0.3289  -0.1800 0.1387  44  SER B CB    
1581 O OG    . SER B 44  ? 2.0691 2.3313 2.1832 0.2982  -0.2279 0.1646  44  SER B OG    
1582 N N     . VAL B 45  ? 1.5493 1.7787 1.7303 0.3771  -0.0747 0.0593  45  VAL B N     
1583 C CA    . VAL B 45  ? 1.4595 1.6898 1.6909 0.4172  -0.0429 0.0456  45  VAL B CA    
1584 C C     . VAL B 45  ? 1.6871 1.8966 1.9143 0.4074  -0.0236 -0.0072 45  VAL B C     
1585 O O     . VAL B 45  ? 1.9112 2.1065 2.1913 0.4282  -0.0149 -0.0095 45  VAL B O     
1586 C CB    . VAL B 45  ? 1.4328 1.6802 1.6558 0.4439  -0.0188 0.0465  45  VAL B CB    
1587 C CG1   . VAL B 45  ? 1.7054 1.9600 1.9597 0.4784  0.0078  0.0184  45  VAL B CG1   
1588 C CG2   . VAL B 45  ? 1.3959 1.6619 1.6570 0.4631  -0.0262 0.0959  45  VAL B CG2   
1589 N N     . ALA B 46  ? 1.6782 1.8795 1.8435 0.3729  -0.0125 -0.0513 46  ALA B N     
1590 C CA    . ALA B 46  ? 1.7354 1.9185 1.9090 0.3601  0.0130  -0.1117 46  ALA B CA    
1591 C C     . ALA B 46  ? 1.7943 1.9574 1.9975 0.3386  0.0029  -0.1174 46  ALA B C     
1592 O O     . ALA B 46  ? 2.1648 2.3068 2.4277 0.3592  0.0230  -0.1383 46  ALA B O     
1593 C CB    . ALA B 46  ? 1.7985 1.9760 1.8928 0.3124  0.0313  -0.1624 46  ALA B CB    
1594 N N     . ARG B 47  ? 1.6926 1.8624 1.8595 0.2981  -0.0293 -0.0982 47  ARG B N     
1595 C CA    . ARG B 47  ? 1.8406 2.0003 2.0351 0.2678  -0.0370 -0.1138 47  ARG B CA    
1596 C C     . ARG B 47  ? 1.7155 1.8657 1.9985 0.3081  -0.0346 -0.0801 47  ARG B C     
1597 O O     . ARG B 47  ? 1.7163 1.8352 2.0466 0.3081  -0.0107 -0.1062 47  ARG B O     
1598 C CB    . ARG B 47  ? 1.9365 2.1199 2.0731 0.2166  -0.0811 -0.0991 47  ARG B CB    
1599 C CG    . ARG B 47  ? 2.1425 2.3223 2.1698 0.1636  -0.0806 -0.1342 47  ARG B CG    
1600 C CD    . ARG B 47  ? 2.3631 2.5662 2.3180 0.1299  -0.1364 -0.0930 47  ARG B CD    
1601 N NE    . ARG B 47  ? 2.7196 2.9458 2.6777 0.0851  -0.1696 -0.1044 47  ARG B NE    
1602 C CZ    . ARG B 47  ? 3.0963 3.3504 2.9885 0.0464  -0.2266 -0.0782 47  ARG B CZ    
1603 N NH1   . ARG B 47  ? 3.2158 3.4648 3.0306 0.0495  -0.2541 -0.0327 47  ARG B NH1   
1604 N NH2   . ARG B 47  ? 3.1678 3.4546 3.0723 0.0042  -0.2569 -0.0970 47  ARG B NH2   
1605 N N     . ASP B 48  ? 1.7889 1.9596 2.0952 0.3400  -0.0531 -0.0240 48  ASP B N     
1606 C CA    . ASP B 48  ? 1.7289 1.8874 2.1075 0.3695  -0.0456 0.0070  48  ASP B CA    
1607 C C     . ASP B 48  ? 1.9761 2.0986 2.3832 0.4129  -0.0112 0.0013  48  ASP B C     
1608 O O     . ASP B 48  ? 1.9679 2.0553 2.4216 0.4253  0.0044  0.0121  48  ASP B O     
1609 C CB    . ASP B 48  ? 1.6892 1.8795 2.0886 0.3903  -0.0649 0.0601  48  ASP B CB    
1610 C CG    . ASP B 48  ? 1.9210 2.1462 2.3234 0.3560  -0.1060 0.0744  48  ASP B CG    
1611 O OD1   . ASP B 48  ? 2.2407 2.4673 2.6486 0.3174  -0.1184 0.0490  48  ASP B OD1   
1612 O OD2   . ASP B 48  ? 2.1086 2.3623 2.5138 0.3679  -0.1267 0.1096  48  ASP B OD2   
1613 N N     . LEU B 49  ? 1.4138 1.5437 1.7954 0.4365  0.0003  -0.0147 49  LEU B N     
1614 C CA    . LEU B 49  ? 1.4524 1.5582 1.8681 0.4837  0.0222  -0.0162 49  LEU B CA    
1615 C C     . LEU B 49  ? 1.4674 1.5344 1.9090 0.4759  0.0447  -0.0671 49  LEU B C     
1616 O O     . LEU B 49  ? 1.4912 1.5181 1.9796 0.5116  0.0592  -0.0582 49  LEU B O     
1617 C CB    . LEU B 49  ? 1.5552 1.6978 1.9503 0.5152  0.0239  -0.0163 49  LEU B CB    
1618 C CG    . LEU B 49  ? 1.8378 2.0130 2.2228 0.5297  0.0125  0.0321  49  LEU B CG    
1619 C CD1   . LEU B 49  ? 2.1998 2.4114 2.5732 0.5610  0.0210  0.0243  49  LEU B CD1   
1620 C CD2   . LEU B 49  ? 1.5594 1.7127 1.9788 0.5460  0.0125  0.0783  49  LEU B CD2   
1621 N N     . THR B 50  ? 1.7228 1.7961 2.1342 0.4281  0.0499  -0.1197 50  THR B N     
1622 C CA    . THR B 50  ? 1.5587 1.5967 2.0023 0.4112  0.0794  -0.1794 50  THR B CA    
1623 C C     . THR B 50  ? 1.8046 1.8099 2.2692 0.3702  0.0858  -0.1905 50  THR B C     
1624 O O     . THR B 50  ? 2.0474 2.0197 2.5439 0.3480  0.1166  -0.2455 50  THR B O     
1625 C CB    . THR B 50  ? 1.5815 1.6424 1.9771 0.3707  0.0923  -0.2424 50  THR B CB    
1626 O OG1   . THR B 50  ? 1.6078 1.6943 1.9235 0.3161  0.0677  -0.2347 50  THR B OG1   
1627 C CG2   . THR B 50  ? 1.5627 1.6541 1.9560 0.4105  0.0969  -0.2463 50  THR B CG2   
1628 N N     . ARG B 51  ? 2.0289 1.7820 2.0669 -0.0286 -0.5115 0.0504  51  ARG B N     
1629 C CA    . ARG B 51  ? 2.1415 1.8858 2.2812 -0.0623 -0.4833 0.0325  51  ARG B CA    
1630 C C     . ARG B 51  ? 2.0863 1.7661 2.1421 -0.0495 -0.3974 0.0305  51  ARG B C     
1631 O O     . ARG B 51  ? 1.7638 1.4413 1.8228 -0.0776 -0.4016 0.0253  51  ARG B O     
1632 C CB    . ARG B 51  ? 1.8545 1.6091 2.1563 -0.0673 -0.4624 0.0103  51  ARG B CB    
1633 C CG    . ARG B 51  ? 1.8828 1.6355 2.3079 -0.1044 -0.4389 -0.0111 51  ARG B CG    
1634 C CD    . ARG B 51  ? 2.1488 1.9275 2.7516 -0.1118 -0.4356 -0.0395 51  ARG B CD    
1635 N NE    . ARG B 51  ? 2.2758 2.1093 2.9590 -0.1208 -0.5380 -0.0366 51  ARG B NE    
1636 C CZ    . ARG B 51  ? 2.3063 2.1789 3.0822 -0.1637 -0.6283 -0.0349 51  ARG B CZ    
1637 N NH1   . ARG B 51  ? 2.3505 2.2639 3.1920 -0.1723 -0.7257 -0.0288 51  ARG B NH1   
1638 N NH2   . ARG B 51  ? 2.2326 2.1008 3.0345 -0.2003 -0.6242 -0.0384 51  ARG B NH2   
1639 N N     . TYR B 52  ? 1.8036 1.4280 1.7831 -0.0098 -0.3218 0.0349  52  TYR B N     
1640 C CA    . TYR B 52  ? 1.8740 1.4258 1.7739 0.0005  -0.2442 0.0364  52  TYR B CA    
1641 C C     . TYR B 52  ? 2.1886 1.6995 1.9164 0.0376  -0.2369 0.0554  52  TYR B C     
1642 O O     . TYR B 52  ? 2.0686 1.5063 1.7198 0.0537  -0.1728 0.0605  52  TYR B O     
1643 C CB    . TYR B 52  ? 1.9282 1.4351 1.8723 0.0065  -0.1557 0.0258  52  TYR B CB    
1644 C CG    . TYR B 52  ? 1.9049 1.4515 2.0281 -0.0271 -0.1532 -0.0010 52  TYR B CG    
1645 C CD1   . TYR B 52  ? 2.0114 1.5495 2.2116 -0.0624 -0.1340 -0.0150 52  TYR B CD1   
1646 C CD2   . TYR B 52  ? 2.1624 1.7552 2.3844 -0.0227 -0.1713 -0.0156 52  TYR B CD2   
1647 C CE1   . TYR B 52  ? 1.9012 1.4762 2.2702 -0.0925 -0.1323 -0.0425 52  TYR B CE1   
1648 C CE2   . TYR B 52  ? 2.2566 1.8872 2.6549 -0.0518 -0.1721 -0.0463 52  TYR B CE2   
1649 C CZ    . TYR B 52  ? 1.8846 1.5062 2.3549 -0.0867 -0.1523 -0.0594 52  TYR B CZ    
1650 O OH    . TYR B 52  ? 2.0235 1.6837 2.6740 -0.1152 -0.1542 -0.0926 52  TYR B OH    
1651 N N     . ASN B 53  ? 2.1765 1.7314 1.8430 0.0489  -0.3045 0.0654  53  ASN B N     
1652 C CA    . ASN B 53  ? 1.9433 1.4687 1.4543 0.0856  -0.3044 0.0787  53  ASN B CA    
1653 C C     . ASN B 53  ? 1.9931 1.4381 1.4217 0.1252  -0.2266 0.0908  53  ASN B C     
1654 O O     . ASN B 53  ? 2.7027 2.0787 2.0648 0.1347  -0.1805 0.0934  53  ASN B O     
1655 C CB    . ASN B 53  ? 2.0626 1.5780 1.5235 0.0733  -0.3153 0.0695  53  ASN B CB    
1656 C CG    . ASN B 53  ? 2.3012 1.8960 1.8283 0.0264  -0.3897 0.0563  53  ASN B CG    
1657 O OD1   . ASN B 53  ? 2.8849 2.5389 2.4882 0.0028  -0.4428 0.0588  53  ASN B OD1   
1658 N ND2   . ASN B 53  ? 1.8934 1.4888 1.3928 0.0100  -0.3968 0.0411  53  ASN B ND2   
1659 N N     . PRO B 54  ? 2.0006 1.4490 1.4274 0.1467  -0.2126 0.0984  54  PRO B N     
1660 C CA    . PRO B 54  ? 2.0451 1.4179 1.3982 0.1742  -0.1344 0.1089  54  PRO B CA    
1661 C C     . PRO B 54  ? 2.2770 1.6106 1.4691 0.2171  -0.1402 0.1291  54  PRO B C     
1662 O O     . PRO B 54  ? 2.5729 1.9484 1.7177 0.2280  -0.2034 0.1314  54  PRO B O     
1663 C CB    . PRO B 54  ? 2.1311 1.5410 1.5711 0.1738  -0.1231 0.1005  54  PRO B CB    
1664 C CG    . PRO B 54  ? 1.9030 1.3953 1.3882 0.1709  -0.2136 0.0996  54  PRO B CG    
1665 C CD    . PRO B 54  ? 2.1162 1.6372 1.6147 0.1428  -0.2692 0.0964  54  PRO B CD    
1666 N N     . ASP B 55  ? 2.3223 1.5740 1.4291 0.2376  -0.0735 0.1427  55  ASP B N     
1667 C CA    . ASP B 55  ? 2.3737 1.5777 1.3295 0.2802  -0.0740 0.1631  55  ASP B CA    
1668 C C     . ASP B 55  ? 2.2762 1.4899 1.1984 0.3043  -0.0608 0.1735  55  ASP B C     
1669 O O     . ASP B 55  ? 2.5412 1.7525 1.3615 0.3394  -0.0885 0.1872  55  ASP B O     
1670 C CB    . ASP B 55  ? 2.5460 1.6409 1.4105 0.2870  -0.0183 0.1765  55  ASP B CB    
1671 C CG    . ASP B 55  ? 2.6328 1.7117 1.5064 0.2742  -0.0397 0.1659  55  ASP B CG    
1672 O OD1   . ASP B 55  ? 2.9696 2.1039 1.8393 0.2808  -0.1025 0.1543  55  ASP B OD1   
1673 O OD2   . ASP B 55  ? 2.6051 1.6179 1.4888 0.2547  0.0064  0.1670  55  ASP B OD2   
1674 N N     . VAL B 56  ? 2.1616 1.3909 1.1724 0.2856  -0.0195 0.1630  56  VAL B N     
1675 C CA    . VAL B 56  ? 2.4566 1.7048 1.4561 0.3046  -0.0048 0.1652  56  VAL B CA    
1676 C C     . VAL B 56  ? 2.2545 1.5876 1.4207 0.2808  -0.0266 0.1385  56  VAL B C     
1677 O O     . VAL B 56  ? 2.1149 1.4629 1.3982 0.2456  -0.0110 0.1183  56  VAL B O     
1678 C CB    . VAL B 56  ? 2.2559 1.4232 1.1804 0.3055  0.0834  0.1746  56  VAL B CB    
1679 C CG1   . VAL B 56  ? 2.2433 1.4408 1.1735 0.3191  0.1034  0.1691  56  VAL B CG1   
1680 C CG2   . VAL B 56  ? 2.3363 1.4104 1.0945 0.3303  0.0940  0.2042  56  VAL B CG2   
1681 N N     . VAL B 57  ? 2.1024 1.4897 1.2831 0.3006  -0.0673 0.1375  57  VAL B N     
1682 C CA    . VAL B 57  ? 1.9567 1.4197 1.2961 0.2840  -0.0938 0.1114  57  VAL B CA    
1683 C C     . VAL B 57  ? 2.3528 1.8156 1.6810 0.3039  -0.0493 0.1036  57  VAL B C     
1684 O O     . VAL B 57  ? 2.7789 2.2286 1.9923 0.3382  -0.0602 0.1239  57  VAL B O     
1685 C CB    . VAL B 57  ? 1.8660 1.4002 1.2491 0.2832  -0.1987 0.1152  57  VAL B CB    
1686 C CG1   . VAL B 57  ? 1.8096 1.4126 1.3601 0.2683  -0.2334 0.0894  57  VAL B CG1   
1687 C CG2   . VAL B 57  ? 1.8509 1.3903 1.2437 0.2565  -0.2385 0.1186  57  VAL B CG2   
1688 N N     . ILE B 58  ? 2.2378 1.7184 1.6865 0.2808  0.0024  0.0707  58  ILE B N     
1689 C CA    . ILE B 58  ? 2.3569 1.8429 1.8096 0.2912  0.0571  0.0530  58  ILE B CA    
1690 C C     . ILE B 58  ? 2.1831 1.7575 1.8062 0.2893  0.0076  0.0184  58  ILE B C     
1691 O O     . ILE B 58  ? 2.3563 1.9734 2.1390 0.2611  -0.0139 -0.0100 58  ILE B O     
1692 C CB    . ILE B 58  ? 2.2999 1.7400 1.7551 0.2613  0.1624  0.0345  58  ILE B CB    
1693 C CG1   . ILE B 58  ? 2.2641 1.6096 1.5645 0.2587  0.1972  0.0709  58  ILE B CG1   
1694 C CG2   . ILE B 58  ? 2.5484 1.9914 1.9781 0.2686  0.2236  0.0174  58  ILE B CG2   
1695 C CD1   . ILE B 58  ? 2.4174 1.7171 1.7332 0.2179  0.2860  0.0558  58  ILE B CD1   
1696 N N     . LEU B 59  ? 2.1323 1.7318 1.7258 0.3197  -0.0139 0.0202  59  LEU B N     
1697 C CA    . LEU B 59  ? 2.2694 1.9471 2.0214 0.3223  -0.0635 -0.0135 59  LEU B CA    
1698 C C     . LEU B 59  ? 2.5127 2.1998 2.2732 0.3328  0.0067  -0.0435 59  LEU B C     
1699 O O     . LEU B 59  ? 2.4976 2.1311 2.1040 0.3465  0.0691  -0.0235 59  LEU B O     
1700 C CB    . LEU B 59  ? 2.0983 1.8081 1.8209 0.3462  -0.1718 0.0141  59  LEU B CB    
1701 C CG    . LEU B 59  ? 1.8923 1.5904 1.5612 0.3345  -0.2366 0.0474  59  LEU B CG    
1702 C CD1   . LEU B 59  ? 1.6894 1.4202 1.3094 0.3524  -0.3367 0.0738  59  LEU B CD1   
1703 C CD2   . LEU B 59  ? 1.7297 1.4547 1.5543 0.2940  -0.2595 0.0251  59  LEU B CD2   
1704 N N     . GLU B 60  ? 2.5678 2.3236 2.5124 0.3245  -0.0057 -0.0941 60  GLU B N     
1705 C CA    . GLU B 60  ? 2.6649 2.4462 2.6450 0.3308  0.0577  -0.1347 60  GLU B CA    
1706 C C     . GLU B 60  ? 2.4845 2.3107 2.4851 0.3670  -0.0157 -0.1337 60  GLU B C     
1707 O O     . GLU B 60  ? 2.6832 2.5573 2.8057 0.3705  -0.1133 -0.1394 60  GLU B O     
1708 C CB    . GLU B 60  ? 2.8284 2.6597 3.0088 0.2958  0.1054  -0.2037 60  GLU B CB    
1709 C CG    . GLU B 60  ? 2.8603 2.7145 3.0630 0.2897  0.1978  -0.2533 60  GLU B CG    
1710 C CD    . GLU B 60  ? 2.8814 2.8115 3.3225 0.2615  0.2207  -0.3349 60  GLU B CD    
1711 O OE1   . GLU B 60  ? 2.9729 2.9294 3.5577 0.2468  0.1660  -0.3486 60  GLU B OE1   
1712 O OE2   . GLU B 60  ? 2.8495 2.8146 3.3355 0.2517  0.2947  -0.3882 60  GLU B OE2   
1713 N N     . LYS B 61  ? 1.7060 2.3489 2.2935 1.0737  -0.0796 -0.2571 61  LYS B N     
1714 C CA    . LYS B 61  ? 1.9440 2.5480 2.6934 1.0765  -0.1390 -0.2996 61  LYS B CA    
1715 C C     . LYS B 61  ? 2.2456 2.8306 2.9120 1.1006  -0.1538 -0.3491 61  LYS B C     
1716 O O     . LYS B 61  ? 1.8119 2.4270 2.2882 1.1314  -0.1787 -0.3824 61  LYS B O     
1717 C CB    . LYS B 61  ? 2.1376 2.7457 2.9511 1.0903  -0.2554 -0.3395 61  LYS B CB    
1718 C CG    . LYS B 61  ? 2.2629 2.8285 3.2560 1.0899  -0.3277 -0.3856 61  LYS B CG    
1719 C CD    . LYS B 61  ? 2.4837 3.0598 3.5199 1.1075  -0.4472 -0.4308 61  LYS B CD    
1720 C CE    . LYS B 61  ? 2.7697 3.3722 3.6009 1.1524  -0.5167 -0.4914 61  LYS B CE    
1721 N NZ    . LYS B 61  ? 2.4253 2.9938 3.2262 1.1744  -0.5385 -0.5490 61  LYS B NZ    
1722 N N     . GLN B 62  ? 2.5606 3.0984 3.3742 1.0870  -0.1393 -0.3516 62  GLN B N     
1723 C CA    . GLN B 62  ? 2.9259 3.4279 3.7046 1.1097  -0.1653 -0.4010 62  GLN B CA    
1724 C C     . GLN B 62  ? 3.0981 3.5494 4.0579 1.1095  -0.2653 -0.4483 62  GLN B C     
1725 O O     . GLN B 62  ? 3.2010 3.6473 4.3368 1.0829  -0.2893 -0.4282 62  GLN B O     
1726 C CB    . GLN B 62  ? 2.7604 3.2422 3.5496 1.0926  -0.0611 -0.3582 62  GLN B CB    
1727 C CG    . GLN B 62  ? 2.4465 2.9758 3.0755 1.0883  0.0424  -0.3094 62  GLN B CG    
1728 C CD    . GLN B 62  ? 2.4374 2.9870 3.1592 1.0522  0.1142  -0.2401 62  GLN B CD    
1729 O OE1   . GLN B 62  ? 2.4532 2.9902 3.3587 1.0317  0.0882  -0.2268 62  GLN B OE1   
1730 N NE2   . GLN B 62  ? 2.5639 3.1303 3.1539 1.0144  0.1992  -0.1929 62  GLN B NE2   
1731 N N     . GLY B 63  ? 3.0258 3.4405 3.9446 1.1408  -0.3272 -0.5140 63  GLY B N     
1732 C CA    . GLY B 63  ? 3.0972 3.4534 4.1865 1.1406  -0.4271 -0.5638 63  GLY B CA    
1733 C C     . GLY B 63  ? 3.2989 3.6028 4.6061 1.0944  -0.3819 -0.5139 63  GLY B C     
1734 O O     . GLY B 63  ? 3.0837 3.4022 4.4108 1.0653  -0.2709 -0.4411 63  GLY B O     
1735 N N     . PHE B 64  ? 3.4634 3.7086 4.9391 1.0874  -0.4728 -0.5538 64  PHE B N     
1736 C CA    . PHE B 64  ? 3.4769 3.6773 5.1822 1.0381  -0.4429 -0.5027 64  PHE B CA    
1737 C C     . PHE B 64  ? 3.5131 3.6606 5.1963 1.0382  -0.3922 -0.4884 64  PHE B C     
1738 O O     . PHE B 64  ? 3.5945 3.7017 5.4637 0.9972  -0.3700 -0.4429 64  PHE B O     
1739 C CB    . PHE B 64  ? 3.4874 3.6415 5.3941 1.0246  -0.5634 -0.5466 64  PHE B CB    
1740 C CG    . PHE B 64  ? 3.6273 3.7263 5.4625 1.0718  -0.6844 -0.6498 64  PHE B CG    
1741 C CD1   . PHE B 64  ? 3.6408 3.7762 5.3341 1.1192  -0.7648 -0.7218 64  PHE B CD1   
1742 C CD2   . PHE B 64  ? 3.7654 3.7768 5.6772 1.0707  -0.7204 -0.6748 64  PHE B CD2   
1743 C CE1   . PHE B 64  ? 3.8268 3.9200 5.4520 1.1688  -0.8769 -0.8224 64  PHE B CE1   
1744 C CE2   . PHE B 64  ? 3.8220 3.7792 5.6701 1.1198  -0.8361 -0.7768 64  PHE B CE2   
1745 C CZ    . PHE B 64  ? 3.8719 3.8739 5.5749 1.1709  -0.9137 -0.8536 64  PHE B CZ    
1746 N N     . LYS B 65  ? 3.4404 3.5923 4.9051 1.0827  -0.3735 -0.5225 65  LYS B N     
1747 C CA    . LYS B 65  ? 3.3847 3.4863 4.8108 1.0915  -0.3327 -0.5162 65  LYS B CA    
1748 C C     . LYS B 65  ? 3.1758 3.3375 4.3991 1.1060  -0.2189 -0.4778 65  LYS B C     
1749 O O     . LYS B 65  ? 3.4022 3.5847 4.4221 1.1544  -0.2330 -0.5287 65  LYS B O     
1750 C CB    . LYS B 65  ? 3.6326 3.6688 5.0060 1.1407  -0.4471 -0.6152 65  LYS B CB    
1751 C CG    . LYS B 65  ? 3.6637 3.7271 4.9600 1.1812  -0.5581 -0.7010 65  LYS B CG    
1752 C CD    . LYS B 65  ? 3.5249 3.6770 4.5644 1.2226  -0.5217 -0.7165 65  LYS B CD    
1753 C CE    . LYS B 65  ? 3.4973 3.6908 4.4712 1.2567  -0.6249 -0.7862 65  LYS B CE    
1754 N NZ    . LYS B 65  ? 3.4323 3.6446 4.5617 1.2146  -0.6424 -0.7496 65  LYS B NZ    
1755 N N     . SER B 66  ? 2.6767 2.8716 3.9601 1.0643  -0.1068 -0.3887 66  SER B N     
1756 C CA    . SER B 66  ? 2.1176 2.3641 3.2374 1.0701  0.0078  -0.3442 66  SER B CA    
1757 C C     . SER B 66  ? 2.0840 2.3560 3.3300 1.0210  0.1158  -0.2497 66  SER B C     
1758 O O     . SER B 66  ? 2.5792 2.8601 4.0024 0.9864  0.1052  -0.2197 66  SER B O     
1759 C CB    . SER B 66  ? 2.2760 2.5938 3.2056 1.0953  0.0086  -0.3656 66  SER B CB    
1760 O OG    . SER B 66  ? 1.9229 2.2699 2.9467 1.0725  -0.0155 -0.3496 66  SER B OG    
1761 N N     . PRO B 67  ? 1.7520 1.5281 3.0334 -0.1160 0.3670  -0.3700 67  PRO B N     
1762 C CA    . PRO B 67  ? 2.0196 1.8310 3.2331 -0.0936 0.3579  -0.3113 67  PRO B CA    
1763 C C     . PRO B 67  ? 2.2806 2.0310 3.2380 -0.0426 0.3053  -0.3335 67  PRO B C     
1764 O O     . PRO B 67  ? 2.3587 2.1416 3.2569 -0.0178 0.2994  -0.3087 67  PRO B O     
1765 C CB    . PRO B 67  ? 1.8346 1.6220 3.0904 -0.1379 0.3881  -0.1971 67  PRO B CB    
1766 C CG    . PRO B 67  ? 1.7762 1.5540 3.2085 -0.1811 0.4243  -0.1984 67  PRO B CG    
1767 C CD    . PRO B 67  ? 1.8323 1.5613 3.1938 -0.1641 0.4036  -0.3034 67  PRO B CD    
1768 N N     . ASN B 68  ? 2.1737 1.8315 2.9773 -0.0289 0.2713  -0.3796 68  ASN B N     
1769 C CA    . ASN B 68  ? 2.0201 1.6119 2.5788 0.0212  0.2197  -0.4031 68  ASN B CA    
1770 C C     . ASN B 68  ? 2.0317 1.6909 2.5935 0.0723  0.1885  -0.4722 68  ASN B C     
1771 O O     . ASN B 68  ? 2.1628 1.7961 2.5656 0.1185  0.1563  -0.4748 68  ASN B O     
1772 C CB    . ASN B 68  ? 2.2330 1.7091 2.6365 0.0191  0.1916  -0.4422 68  ASN B CB    
1773 C CG    . ASN B 68  ? 2.2905 1.6972 2.6834 -0.0275 0.2209  -0.3734 68  ASN B CG    
1774 O OD1   . ASN B 68  ? 2.3481 1.8004 2.8835 -0.0629 0.2608  -0.2980 68  ASN B OD1   
1775 N ND2   . ASN B 68  ? 2.1671 1.4625 2.3925 -0.0291 0.1994  -0.3971 68  ASN B ND2   
1776 N N     . SER B 69  ? 1.9399 1.6853 2.6858 0.0641  0.1981  -0.5291 69  SER B N     
1777 C CA    . SER B 69  ? 1.9460 1.7702 2.7244 0.1098  0.1675  -0.5925 69  SER B CA    
1778 C C     . SER B 69  ? 1.9957 1.8934 2.8206 0.1285  0.1913  -0.5475 69  SER B C     
1779 O O     . SER B 69  ? 1.9659 1.8889 2.7269 0.1805  0.1609  -0.5788 69  SER B O     
1780 C CB    . SER B 69  ? 1.9437 1.8479 2.9196 0.0863  0.1775  -0.6591 69  SER B CB    
1781 O OG    . SER B 69  ? 1.8531 1.8286 3.0421 0.0402  0.2416  -0.6163 69  SER B OG    
1782 N N     . LYS B 70  ? 2.0186 1.9492 2.9585 0.0840  0.2468  -0.4739 70  LYS B N     
1783 C CA    . LYS B 70  ? 2.0709 2.0614 3.0448 0.0887  0.2769  -0.4271 70  LYS B CA    
1784 C C     . LYS B 70  ? 1.9848 1.8998 2.7303 0.1209  0.2571  -0.3939 70  LYS B C     
1785 O O     . LYS B 70  ? 2.0525 2.0095 2.7817 0.1497  0.2651  -0.3981 70  LYS B O     
1786 C CB    . LYS B 70  ? 2.0227 2.0441 3.1439 0.0256  0.3343  -0.3458 70  LYS B CB    
1787 C CG    . LYS B 70  ? 2.2422 2.2412 3.2760 0.0071  0.3585  -0.2549 70  LYS B CG    
1788 C CD    . LYS B 70  ? 1.7997 1.8129 2.9679 -0.0602 0.4022  -0.1664 70  LYS B CD    
1789 C CE    . LYS B 70  ? 1.6507 1.5853 2.7987 -0.0872 0.3919  -0.1372 70  LYS B CE    
1790 N NZ    . LYS B 70  ? 1.8600 1.8083 3.1506 -0.1497 0.4299  -0.0431 70  LYS B NZ    
1791 N N     . ILE B 71  ? 1.9873 1.7891 2.5574 0.1148  0.2359  -0.3643 71  ILE B N     
1792 C CA    . ILE B 71  ? 1.9762 1.6952 2.3147 0.1439  0.2167  -0.3382 71  ILE B CA    
1793 C C     . ILE B 71  ? 2.0744 1.7822 2.3108 0.2143  0.1676  -0.4174 71  ILE B C     
1794 O O     . ILE B 71  ? 2.1292 1.8204 2.2525 0.2508  0.1648  -0.4129 71  ILE B O     
1795 C CB    . ILE B 71  ? 2.3034 1.9055 2.4892 0.1158  0.2060  -0.2900 71  ILE B CB    
1796 C CG1   . ILE B 71  ? 2.4833 2.1035 2.8012 0.0472  0.2482  -0.2104 71  ILE B CG1   
1797 C CG2   . ILE B 71  ? 2.1104 1.6268 2.0585 0.1364  0.1942  -0.2552 71  ILE B CG2   
1798 C CD1   . ILE B 71  ? 2.4226 2.0904 2.7851 0.0169  0.2875  -0.1343 71  ILE B CD1   
1799 N N     . ILE B 72  ? 2.0521 1.7656 2.3276 0.2315  0.1285  -0.4897 72  ILE B N     
1800 C CA    . ILE B 72  ? 1.8613 1.5577 2.0381 0.2956  0.0694  -0.5608 72  ILE B CA    
1801 C C     . ILE B 72  ? 1.6775 1.4713 1.9451 0.3382  0.0763  -0.5839 72  ILE B C     
1802 O O     . ILE B 72  ? 1.7738 1.5335 1.9140 0.3905  0.0541  -0.5935 72  ILE B O     
1803 C CB    . ILE B 72  ? 1.8769 1.5798 2.1124 0.2909  0.0300  -0.6323 72  ILE B CB    
1804 C CG1   . ILE B 72  ? 2.0920 1.6743 2.1924 0.2578  0.0190  -0.6221 72  ILE B CG1   
1805 C CG2   . ILE B 72  ? 1.9601 1.6804 2.1503 0.3539  -0.0352 -0.7042 72  ILE B CG2   
1806 C CD1   . ILE B 72  ? 2.3354 1.8072 2.2025 0.2986  -0.0448 -0.6582 72  ILE B CD1   
1807 N N     . TYR B 73  ? 1.7108 1.6257 2.2060 0.3158  0.1115  -0.5945 73  TYR B N     
1808 C CA    . TYR B 73  ? 1.5373 1.5541 2.1429 0.3534  0.1215  -0.6250 73  TYR B CA    
1809 C C     . TYR B 73  ? 1.5555 1.5634 2.1045 0.3504  0.1732  -0.5664 73  TYR B C     
1810 O O     . TYR B 73  ? 1.7152 1.7564 2.2604 0.3971  0.1748  -0.5916 73  TYR B O     
1811 C CB    . TYR B 73  ? 1.5532 1.6982 2.4147 0.3251  0.1455  -0.6571 73  TYR B CB    
1812 C CG    . TYR B 73  ? 1.6795 1.8339 2.5797 0.3325  0.0896  -0.7280 73  TYR B CG    
1813 C CD1   . TYR B 73  ? 1.6896 1.8624 2.5569 0.3913  0.0241  -0.7935 73  TYR B CD1   
1814 C CD2   . TYR B 73  ? 1.5614 1.6978 2.5224 0.2776  0.1013  -0.7276 73  TYR B CD2   
1815 C CE1   . TYR B 73  ? 1.8427 2.0172 2.7265 0.3897  -0.0320 -0.8557 73  TYR B CE1   
1816 C CE2   . TYR B 73  ? 1.4458 1.5806 2.4252 0.2752  0.0548  -0.7954 73  TYR B CE2   
1817 C CZ    . TYR B 73  ? 1.5028 1.6560 2.4359 0.3286  -0.0139 -0.8585 73  TYR B CZ    
1818 O OH    . TYR B 73  ? 2.0211 2.1684 2.9581 0.3181  -0.0646 -0.9239 73  TYR B OH    
1819 N N     . PHE B 74  ? 1.5354 1.4964 2.0401 0.2936  0.2159  -0.4884 74  PHE B N     
1820 C CA    . PHE B 74  ? 1.7855 1.7157 2.1915 0.2821  0.2599  -0.4297 74  PHE B CA    
1821 C C     . PHE B 74  ? 1.9237 1.7541 2.0999 0.3342  0.2281  -0.4408 74  PHE B C     
1822 O O     . PHE B 74  ? 1.8800 1.7177 2.0144 0.3620  0.2524  -0.4457 74  PHE B O     
1823 C CB    . PHE B 74  ? 1.9297 1.8164 2.3103 0.2081  0.2963  -0.3384 74  PHE B CB    
1824 C CG    . PHE B 74  ? 1.9556 1.8009 2.2133 0.1825  0.3387  -0.2722 74  PHE B CG    
1825 C CD1   . PHE B 74  ? 1.6526 1.5729 2.0250 0.1479  0.3968  -0.2450 74  PHE B CD1   
1826 C CD2   . PHE B 74  ? 1.9923 1.7188 2.0114 0.1871  0.3229  -0.2386 74  PHE B CD2   
1827 C CE1   . PHE B 74  ? 1.6636 1.5388 1.9094 0.1150  0.4382  -0.1861 74  PHE B CE1   
1828 C CE2   . PHE B 74  ? 1.9229 1.6071 1.8188 0.1559  0.3637  -0.1799 74  PHE B CE2   
1829 C CZ    . PHE B 74  ? 1.7238 1.4812 1.7302 0.1180  0.4214  -0.1537 74  PHE B CZ    
1830 N N     . ILE B 75  ? 2.0741 1.8075 2.1018 0.3474  0.1773  -0.4486 75  ILE B N     
1831 C CA    . ILE B 75  ? 2.2689 1.8976 2.0707 0.3966  0.1448  -0.4591 75  ILE B CA    
1832 C C     . ILE B 75  ? 2.0149 1.6891 1.8563 0.4729  0.1093  -0.5336 75  ILE B C     
1833 O O     . ILE B 75  ? 2.0933 1.7308 1.8304 0.5157  0.1154  -0.5385 75  ILE B O     
1834 C CB    . ILE B 75  ? 2.2803 1.7953 1.9226 0.3883  0.0992  -0.4539 75  ILE B CB    
1835 C CG1   . ILE B 75  ? 2.2004 1.6668 1.7985 0.3163  0.1351  -0.3727 75  ILE B CG1   
1836 C CG2   . ILE B 75  ? 2.2620 1.6685 1.6765 0.4445  0.0589  -0.4745 75  ILE B CG2   
1837 C CD1   . ILE B 75  ? 2.1725 1.5439 1.6618 0.2986  0.1001  -0.3706 75  ILE B CD1   
1838 N N     . LYS B 76  ? 1.7968 1.5506 1.7931 0.4892  0.0716  -0.5921 76  LYS B N     
1839 C CA    . LYS B 76  ? 1.8325 1.6433 1.8921 0.5592  0.0290  -0.6603 76  LYS B CA    
1840 C C     . LYS B 76  ? 1.8301 1.7263 2.0031 0.5785  0.0831  -0.6621 76  LYS B C     
1841 O O     . LYS B 76  ? 1.8991 1.7821 2.0212 0.6399  0.0701  -0.6877 76  LYS B O     
1842 C CB    . LYS B 76  ? 1.7840 1.6769 2.0064 0.5559  -0.0151 -0.7168 76  LYS B CB    
1843 C CG    . LYS B 76  ? 1.8253 1.6239 1.9111 0.5559  -0.0830 -0.7394 76  LYS B CG    
1844 C CD    . LYS B 76  ? 2.1482 2.0261 2.3886 0.5440  -0.1229 -0.7991 76  LYS B CD    
1845 C CE    . LYS B 76  ? 2.5175 2.4764 2.8457 0.6074  -0.1774 -0.8592 76  LYS B CE    
1846 N NZ    . LYS B 76  ? 2.6572 2.5177 2.7888 0.6701  -0.2454 -0.8723 76  LYS B NZ    
1847 N N     . GLY B 77  ? 1.7571 1.7377 2.0869 0.5249  0.1476  -0.6352 77  GLY B N     
1848 C CA    . GLY B 77  ? 1.7616 1.8156 2.1903 0.5317  0.2097  -0.6358 77  GLY B CA    
1849 C C     . GLY B 77  ? 1.8405 1.7976 2.0785 0.5318  0.2518  -0.5914 77  GLY B C     
1850 O O     . GLY B 77  ? 1.8913 1.8690 2.1425 0.5694  0.2821  -0.6142 77  GLY B O     
1851 N N     . PHE B 78  ? 1.8562 1.7060 1.9184 0.4867  0.2573  -0.5289 78  PHE B N     
1852 C CA    . PHE B 78  ? 2.1789 1.9306 2.0455 0.4735  0.2989  -0.4819 78  PHE B CA    
1853 C C     . PHE B 78  ? 2.3144 1.9926 2.0380 0.5509  0.2655  -0.5222 78  PHE B C     
1854 O O     . PHE B 78  ? 2.0991 1.7641 1.7823 0.5715  0.3117  -0.5281 78  PHE B O     
1855 C CB    . PHE B 78  ? 1.9313 1.5877 1.6474 0.4103  0.2979  -0.4086 78  PHE B CB    
1856 C CG    . PHE B 78  ? 2.0120 1.5721 1.5286 0.3785  0.3431  -0.3516 78  PHE B CG    
1857 C CD1   . PHE B 78  ? 2.0158 1.6097 1.5716 0.3191  0.4156  -0.3059 78  PHE B CD1   
1858 C CD2   . PHE B 78  ? 2.0926 1.5234 1.3740 0.4016  0.3138  -0.3433 78  PHE B CD2   
1859 C CE1   . PHE B 78  ? 2.1019 1.6032 1.4624 0.2804  0.4572  -0.2536 78  PHE B CE1   
1860 C CE2   . PHE B 78  ? 2.1732 1.5134 1.2652 0.3664  0.3569  -0.2925 78  PHE B CE2   
1861 C CZ    . PHE B 78  ? 2.1794 1.5552 1.3092 0.3041  0.4282  -0.2478 78  PHE B CZ    
1862 N N     . PHE B 79  ? 2.3715 1.9976 2.0191 0.5929  0.1876  -0.5518 79  PHE B N     
1863 C CA    . PHE B 79  ? 2.5199 2.0642 2.0221 0.6664  0.1475  -0.5843 79  PHE B CA    
1864 C C     . PHE B 79  ? 2.7505 2.3857 2.4127 0.7419  0.1129  -0.6548 79  PHE B C     
1865 O O     . PHE B 79  ? 2.6717 2.2465 2.2381 0.8098  0.0683  -0.6836 79  PHE B O     
1866 C CB    . PHE B 79  ? 2.7733 2.2039 2.0947 0.6726  0.0779  -0.5796 79  PHE B CB    
1867 C CG    . PHE B 79  ? 2.6651 1.9780 1.7797 0.6176  0.1062  -0.5136 79  PHE B CG    
1868 C CD1   . PHE B 79  ? 2.7388 1.9626 1.6798 0.6235  0.1460  -0.4877 79  PHE B CD1   
1869 C CD2   . PHE B 79  ? 2.6382 1.9296 1.7373 0.5576  0.0951  -0.4784 79  PHE B CD2   
1870 C CE1   . PHE B 79  ? 2.7573 1.8777 1.5088 0.5671  0.1681  -0.4251 79  PHE B CE1   
1871 C CE2   . PHE B 79  ? 2.6879 1.8778 1.6088 0.5065  0.1173  -0.4155 79  PHE B CE2   
1872 C CZ    . PHE B 79  ? 2.6885 1.7934 1.4305 0.5106  0.1514  -0.3885 79  PHE B CZ    
1873 N N     . TYR B 80  ? 2.6803 2.3400 2.3745 0.8450  -0.1342 -0.5227 80  TYR B N     
1874 C CA    . TYR B 80  ? 2.4527 2.2247 2.1365 0.8753  -0.1817 -0.6050 80  TYR B CA    
1875 C C     . TYR B 80  ? 2.3403 2.1628 2.0715 0.9076  -0.2527 -0.5868 80  TYR B C     
1876 O O     . TYR B 80  ? 2.6606 2.4430 2.4400 0.8772  -0.2353 -0.5358 80  TYR B O     
1877 C CB    . TYR B 80  ? 2.1691 1.9973 1.8768 0.8081  -0.0983 -0.6873 80  TYR B CB    
1878 C CG    . TYR B 80  ? 2.2169 2.1942 1.9007 0.8171  -0.1365 -0.7891 80  TYR B CG    
1879 C CD1   . TYR B 80  ? 2.7608 2.7850 2.3667 0.7943  -0.1389 -0.8190 80  TYR B CD1   
1880 C CD2   . TYR B 80  ? 2.3389 2.4303 2.0834 0.8218  -0.1694 -0.8360 80  TYR B CD2   
1881 C CE1   . TYR B 80  ? 2.7605 2.9587 2.3524 0.7702  -0.1765 -0.8876 80  TYR B CE1   
1882 C CE2   . TYR B 80  ? 2.6069 2.8695 2.3366 0.8235  -0.2062 -0.9311 80  TYR B CE2   
1883 C CZ    . TYR B 80  ? 2.7826 3.1064 2.4382 0.7879  -0.2112 -0.9464 80  TYR B CZ    
1884 O OH    . TYR B 80  ? 3.2165 3.7387 2.8638 0.7652  -0.2511 -1.0167 80  TYR B OH    
1885 N N     . ASN B 81  ? 2.5395 2.4594 2.2524 0.9694  -0.3289 -0.6309 81  ASN B N     
1886 C CA    . ASN B 81  ? 2.8182 2.7850 2.5669 1.0019  -0.3949 -0.6123 81  ASN B CA    
1887 C C     . ASN B 81  ? 2.6078 2.4671 2.3409 0.9924  -0.4122 -0.5136 81  ASN B C     
1888 O O     . ASN B 81  ? 2.6252 2.4752 2.3980 0.9684  -0.4135 -0.4899 81  ASN B O     
1889 C CB    . ASN B 81  ? 2.9850 3.0049 2.8110 0.9571  -0.3604 -0.6529 81  ASN B CB    
1890 C CG    . ASN B 81  ? 3.2058 3.3601 3.0545 0.9464  -0.3408 -0.7625 81  ASN B CG    
1891 O OD1   . ASN B 81  ? 3.1294 3.2782 3.0140 0.8722  -0.2575 -0.7943 81  ASN B OD1   
1892 N ND2   . ASN B 81  ? 3.2360 3.5205 3.0617 1.0130  -0.4093 -0.8185 81  ASN B ND2   
1893 N N     . SER B 82  ? 2.4853 2.2670 2.1606 1.0020  -0.4150 -0.4636 82  SER B N     
1894 C CA    . SER B 82  ? 2.1962 1.8903 1.8615 0.9791  -0.4168 -0.3853 82  SER B CA    
1895 C C     . SER B 82  ? 2.6803 2.3428 2.2721 1.0232  -0.4574 -0.3502 82  SER B C     
1896 O O     . SER B 82  ? 3.1736 2.8775 2.7146 1.0732  -0.4846 -0.3771 82  SER B O     
1897 C CB    . SER B 82  ? 2.2076 1.8290 1.8964 0.9212  -0.3532 -0.3472 82  SER B CB    
1898 O OG    . SER B 82  ? 2.2816 1.8668 1.9292 0.9259  -0.3253 -0.3512 82  SER B OG    
1899 N N     . ASN B 83  ? 2.9456 2.5411 2.5344 1.0052  -0.4563 -0.2916 83  ASN B N     
1900 C CA    . ASN B 83  ? 3.0447 2.5880 2.5671 1.0346  -0.4769 -0.2454 83  ASN B CA    
1901 C C     . ASN B 83  ? 2.5384 1.9965 2.0319 1.0061  -0.4413 -0.2126 83  ASN B C     
1902 O O     . ASN B 83  ? 2.5511 1.9365 2.0319 0.9899  -0.4290 -0.1640 83  ASN B O     
1903 C CB    . ASN B 83  ? 3.2650 2.7769 2.8065 1.0325  -0.4826 -0.2063 83  ASN B CB    
1904 C CG    . ASN B 83  ? 3.2449 2.7091 2.7202 1.0709  -0.5000 -0.1581 83  ASN B CG    
1905 O OD1   . ASN B 83  ? 3.3642 2.8473 2.7717 1.1105  -0.5234 -0.1572 83  ASN B OD1   
1906 N ND2   . ASN B 83  ? 3.1079 2.5108 2.6004 1.0620  -0.4858 -0.1173 83  ASN B ND2   
1907 N N     . THR B 84  ? 2.1466 1.6145 1.6333 1.0016  -0.4185 -0.2442 84  THR B N     
1908 C CA    . THR B 84  ? 2.2135 1.6041 1.6753 0.9756  -0.3761 -0.2177 84  THR B CA    
1909 C C     . THR B 84  ? 2.2640 1.6725 1.6808 1.0072  -0.3658 -0.2668 84  THR B C     
1910 O O     . THR B 84  ? 2.2843 1.7310 1.7469 0.9860  -0.3256 -0.3164 84  THR B O     
1911 C CB    . THR B 84  ? 1.9983 1.3723 1.5374 0.9120  -0.3223 -0.2014 84  THR B CB    
1912 O OG1   . THR B 84  ? 2.1828 1.5432 1.7582 0.8907  -0.3306 -0.1679 84  THR B OG1   
1913 C CG2   . THR B 84  ? 2.1143 1.4248 1.6354 0.8890  -0.2744 -0.1774 84  THR B CG2   
1914 N N     . LYS B 85  ? 2.4363 1.8176 1.7619 1.0557  -0.3934 -0.2569 85  LYS B N     
1915 C CA    . LYS B 85  ? 2.3987 1.8551 1.6839 1.0138  -0.3652 -0.3058 85  LYS B CA    
1916 C C     . LYS B 85  ? 2.4251 1.7962 1.6934 0.9537  -0.2845 -0.2955 85  LYS B C     
1917 O O     . LYS B 85  ? 2.4776 1.7516 1.7008 0.9560  -0.2793 -0.2378 85  LYS B O     
1918 C CB    . LYS B 85  ? 2.4393 1.9617 1.6374 1.0369  -0.4204 -0.2903 85  LYS B CB    
1919 C CG    . LYS B 85  ? 2.6926 2.3583 1.8648 0.9864  -0.4066 -0.3616 85  LYS B CG    
1920 C CD    . LYS B 85  ? 2.8871 2.6673 2.1428 0.9798  -0.4063 -0.4376 85  LYS B CD    
1921 C CE    . LYS B 85  ? 3.1229 3.0554 2.3581 0.9171  -0.3841 -0.5220 85  LYS B CE    
1922 N NZ    . LYS B 85  ? 3.2231 3.2675 2.5418 0.9065  -0.3784 -0.6017 85  LYS B NZ    
1923 N N     . VAL B 86  ? 2.5129 1.9155 1.8189 0.9016  -0.2150 -0.3513 86  VAL B N     
1924 C CA    . VAL B 86  ? 2.6425 1.9759 1.9313 0.8440  -0.1261 -0.3483 86  VAL B CA    
1925 C C     . VAL B 86  ? 2.2911 1.6816 1.5006 0.7924  -0.1100 -0.3836 86  VAL B C     
1926 O O     . VAL B 86  ? 2.3050 1.8150 1.5122 0.7684  -0.1167 -0.4525 86  VAL B O     
1927 C CB    . VAL B 86  ? 2.5781 1.9028 1.9408 0.8181  -0.0447 -0.3861 86  VAL B CB    
1928 C CG1   . VAL B 86  ? 2.7294 2.1616 2.1374 0.8223  -0.0634 -0.4555 86  VAL B CG1   
1929 C CG2   . VAL B 86  ? 2.3045 1.5920 1.6400 0.7501  0.0590  -0.4083 86  VAL B CG2   
1930 N N     . ILE B 87  ? 2.5986 1.9122 1.7429 0.7719  -0.0881 -0.3405 87  ILE B N     
1931 C CA    . ILE B 87  ? 2.8283 2.1855 1.8852 0.7207  -0.0709 -0.3671 87  ILE B CA    
1932 C C     . ILE B 87  ? 2.8971 2.1614 1.9428 0.6580  0.0353  -0.3664 87  ILE B C     
1933 O O     . ILE B 87  ? 3.0069 2.1585 2.0773 0.6733  0.0645  -0.3083 87  ILE B O     
1934 C CB    . ILE B 87  ? 3.0166 2.3708 1.9856 0.7618  -0.1494 -0.3109 87  ILE B CB    
1935 C CG1   . ILE B 87  ? 3.0913 2.2947 2.0521 0.7895  -0.1452 -0.2273 87  ILE B CG1   
1936 C CG2   . ILE B 87  ? 2.9923 2.4470 1.9706 0.8292  -0.2458 -0.3116 87  ILE B CG2   
1937 C CD1   . ILE B 87  ? 3.4258 2.5544 2.3093 0.7424  -0.0938 -0.2030 87  ILE B CD1   
1938 N N     . VAL B 88  ? 2.8363 2.1545 1.8485 0.5860  0.0977  -0.4344 88  VAL B N     
1939 C CA    . VAL B 88  ? 2.7353 1.9662 1.7357 0.5218  0.2133  -0.4429 88  VAL B CA    
1940 C C     . VAL B 88  ? 3.0693 2.2974 1.9617 0.4831  0.2105  -0.4349 88  VAL B C     
1941 O O     . VAL B 88  ? 3.1798 2.5196 2.0127 0.4410  0.1965  -0.4955 88  VAL B O     
1942 C CB    . VAL B 88  ? 2.8619 2.1333 1.9014 0.4597  0.3091  -0.5310 88  VAL B CB    
1943 C CG1   . VAL B 88  ? 3.0611 2.2215 2.0919 0.4022  0.4414  -0.5309 88  VAL B CG1   
1944 C CG2   . VAL B 88  ? 2.4361 1.7197 1.5733 0.5035  0.3036  -0.5392 88  VAL B CG2   
1945 N N     . ARG B 89  ? 3.1776 2.2867 2.0446 0.4954  0.2252  -0.3626 89  ARG B N     
1946 C CA    . ARG B 89  ? 3.1308 2.2124 1.8926 0.4653  0.2250  -0.3416 89  ARG B CA    
1947 C C     . ARG B 89  ? 3.0970 2.1089 1.8404 0.3859  0.3502  -0.3688 89  ARG B C     
1948 O O     . ARG B 89  ? 2.9478 1.8826 1.7641 0.3779  0.4355  -0.3628 89  ARG B O     
1949 C CB    . ARG B 89  ? 3.2083 2.1949 1.9495 0.5247  0.1693  -0.2478 89  ARG B CB    
1950 C CG    . ARG B 89  ? 3.3238 2.2616 1.9530 0.4999  0.1727  -0.2159 89  ARG B CG    
1951 C CD    . ARG B 89  ? 3.5955 2.4524 2.2002 0.5646  0.1077  -0.1309 89  ARG B CD    
1952 N NE    . ARG B 89  ? 3.4319 2.3665 2.0212 0.6313  0.0040  -0.1195 89  ARG B NE    
1953 C CZ    . ARG B 89  ? 3.3671 2.3627 1.8535 0.6505  -0.0546 -0.1095 89  ARG B CZ    
1954 N NH1   . ARG B 89  ? 3.3183 2.3838 1.8010 0.7214  -0.1425 -0.0930 89  ARG B NH1   
1955 N NH2   . ARG B 89  ? 3.6755 2.6649 2.0607 0.6022  -0.0228 -0.1133 89  ARG B NH2   
1956 N N     . ASN B 90  ? 3.0007 4.2389 2.9139 0.7874  0.3705  -1.2513 90  ASN B N     
1957 C CA    . ASN B 90  ? 2.8735 4.0422 2.8146 0.7982  0.2703  -1.1810 90  ASN B CA    
1958 C C     . ASN B 90  ? 2.9189 3.9785 2.7286 0.7147  0.3307  -1.1346 90  ASN B C     
1959 O O     . ASN B 90  ? 2.9749 3.9360 2.6363 0.6993  0.4455  -1.1692 90  ASN B O     
1960 C CB    . ASN B 90  ? 2.7713 3.7455 2.6642 0.9989  0.2056  -1.2127 90  ASN B CB    
1961 C CG    . ASN B 90  ? 2.7612 3.8559 2.8284 1.0629  0.0904  -1.2214 90  ASN B CG    
1962 O OD1   . ASN B 90  ? 2.6646 3.9890 2.9064 0.9509  0.0371  -1.1837 90  ASN B OD1   
1963 N ND2   . ASN B 90  ? 2.9803 3.9219 3.0032 1.2420  0.0480  -1.2669 90  ASN B ND2   
1964 N N     . PRO B 91  ? 2.8034 3.8820 2.6700 0.6571  0.2522  -1.0539 91  PRO B N     
1965 C CA    . PRO B 91  ? 2.7150 3.6930 2.4656 0.5835  0.3036  -1.0006 91  PRO B CA    
1966 C C     . PRO B 91  ? 2.8592 3.5691 2.4120 0.7228  0.3666  -1.0359 91  PRO B C     
1967 O O     . PRO B 91  ? 2.7902 3.3595 2.3121 0.8815  0.3080  -1.0497 91  PRO B O     
1968 C CB    . PRO B 91  ? 2.4918 3.5180 2.3525 0.5518  0.1836  -0.9172 91  PRO B CB    
1969 C CG    . PRO B 91  ? 2.3968 3.6291 2.4600 0.5222  0.0872  -0.9150 91  PRO B CG    
1970 C CD    . PRO B 91  ? 2.4792 3.6846 2.5291 0.6462  0.1105  -1.0036 91  PRO B CD    
1971 N N     . THR B 92  ? 3.3119 3.9518 2.7293 0.6617  0.4852  -1.0499 92  THR B N     
1972 C CA    . THR B 92  ? 3.5429 3.9331 2.7723 0.7778  0.5524  -1.0757 92  THR B CA    
1973 C C     . THR B 92  ? 3.8201 4.0742 3.0041 0.8523  0.4959  -1.0114 92  THR B C     
1974 O O     . THR B 92  ? 4.2010 4.2999 3.3512 0.9978  0.4530  -1.0140 92  THR B O     
1975 C CB    . THR B 92  ? 3.7549 4.1076 2.8630 0.6652  0.6744  -1.0804 92  THR B CB    
1976 O OG1   . THR B 92  ? 3.5724 4.0096 2.7104 0.5066  0.6699  -0.9938 92  THR B OG1   
1977 C CG2   . THR B 92  ? 3.8490 4.3330 2.9899 0.6016  0.7324  -1.1507 92  THR B CG2   
1978 N N     . PHE B 93  ? 3.9019 4.2069 3.1032 0.7290  0.4893  -0.9282 93  PHE B N     
1979 C CA    . PHE B 93  ? 3.8439 4.0502 3.0200 0.7901  0.4306  -0.8600 93  PHE B CA    
1980 C C     . PHE B 93  ? 3.5214 3.8556 2.8670 0.7968  0.2960  -0.8334 93  PHE B C     
1981 O O     . PHE B 93  ? 3.4445 3.9685 2.9233 0.6474  0.2601  -0.7902 93  PHE B O     
1982 C CB    . PHE B 93  ? 3.6816 3.8795 2.7977 0.6598  0.4880  -0.7806 93  PHE B CB    
1983 C CG    . PHE B 93  ? 3.8126 3.8529 2.7546 0.6703  0.6070  -0.7993 93  PHE B CG    
1984 C CD1   . PHE B 93  ? 4.0233 3.8703 2.8453 0.8417  0.6347  -0.8505 93  PHE B CD1   
1985 C CD2   . PHE B 93  ? 3.6991 3.7822 2.6002 0.5069  0.6861  -0.7650 93  PHE B CD2   
1986 C CE1   . PHE B 93  ? 4.0639 3.7811 2.8070 0.7968  0.7132  -0.8360 93  PHE B CE1   
1987 C CE2   . PHE B 93  ? 3.7895 3.7186 2.5328 0.5152  0.7875  -0.7819 93  PHE B CE2   
1988 C CZ    . PHE B 93  ? 3.9453 3.6911 2.6034 0.6696  0.8023  -0.8226 93  PHE B CZ    
1989 N N     . LYS B 94  ? 3.2975 3.5248 2.6372 0.9689  0.2175  -0.8574 94  LYS B N     
1990 C CA    . LYS B 94  ? 3.1968 3.5209 2.6915 0.9928  0.0785  -0.8404 94  LYS B CA    
1991 C C     . LYS B 94  ? 3.3714 3.5459 2.8098 1.1221  0.0049  -0.8043 94  LYS B C     
1992 O O     . LYS B 94  ? 3.4939 3.6628 3.0077 1.2178  -0.1127 -0.8165 94  LYS B O     
1993 C CB    . LYS B 94  ? 3.2043 3.5789 2.7784 1.0736  0.0340  -0.9168 94  LYS B CB    
1994 C CG    . LYS B 94  ? 3.0478 3.5974 2.8265 1.0314  -0.0983 -0.8978 94  LYS B CG    
1995 C CD    . LYS B 94  ? 2.9863 3.6213 2.8481 1.0762  -0.1131 -0.9683 94  LYS B CD    
1996 C CE    . LYS B 94  ? 2.8575 3.7044 2.9410 0.9984  -0.2324 -0.9396 94  LYS B CE    
1997 N NZ    . LYS B 94  ? 2.5115 3.4468 2.6825 1.0507  -0.2495 -1.0019 94  LYS B NZ    
1998 N N     . GLY B 95  ? 3.5210 3.5749 2.8261 1.1270  0.0716  -0.7581 95  GLY B N     
1999 C CA    . GLY B 95  ? 3.6560 3.5752 2.8953 1.2471  0.0156  -0.7176 95  GLY B CA    
2000 C C     . GLY B 95  ? 3.7934 3.8129 3.1259 1.1393  -0.0453 -0.6311 95  GLY B C     
2001 O O     . GLY B 95  ? 3.4687 3.6214 2.9606 1.0870  -0.1505 -0.6214 95  GLY B O     
2002 N N     . GLY B 96  ? 4.1936 4.1511 3.4329 1.1063  0.0174  -0.5640 96  GLY B N     
2003 C CA    . GLY B 96  ? 4.1070 4.1460 3.4223 1.0139  -0.0331 -0.4764 96  GLY B CA    
2004 C C     . GLY B 96  ? 3.9519 4.2145 3.4405 0.8158  -0.0629 -0.4509 96  GLY B C     
2005 O O     . GLY B 96  ? 4.0168 4.3698 3.5214 0.7046  0.0104  -0.4779 96  GLY B O     
2006 N N     . SER B 97  ? 3.7255 4.0785 3.3421 0.7720  -0.1711 -0.3983 97  SER B N     
2007 C CA    . SER B 97  ? 3.4057 3.9792 3.2022 0.5903  -0.2157 -0.3687 97  SER B CA    
2008 C C     . SER B 97  ? 3.2547 3.9304 3.0419 0.4000  -0.1130 -0.3131 97  SER B C     
2009 O O     . SER B 97  ? 3.1715 3.9577 2.9882 0.2892  -0.0526 -0.3425 97  SER B O     
2010 C CB    . SER B 97  ? 3.2542 3.8812 3.1822 0.5909  -0.3579 -0.3171 97  SER B CB    
2011 O OG    . SER B 97  ? 3.2130 3.7803 3.0840 0.5864  -0.3459 -0.2408 97  SER B OG    
2012 N N     . TYR B 98  ? 3.2161 3.8570 2.9598 0.3632  -0.0927 -0.2329 98  TYR B N     
2013 C CA    . TYR B 98  ? 3.2554 3.9955 2.9983 0.1763  -0.0081 -0.1697 98  TYR B CA    
2014 C C     . TYR B 98  ? 3.4894 4.0804 3.0533 0.2108  0.1075  -0.1472 98  TYR B C     
2015 O O     . TYR B 98  ? 3.2171 3.8152 2.7115 0.1247  0.2116  -0.1642 98  TYR B O     
2016 C CB    . TYR B 98  ? 3.1282 3.9960 3.0055 0.0628  -0.0866 -0.0765 98  TYR B CB    
2017 C CG    . TYR B 98  ? 3.0827 4.1401 3.1552 -0.0339 -0.1865 -0.0775 98  TYR B CG    
2018 C CD1   . TYR B 98  ? 3.0280 4.2235 3.1597 -0.1396 -0.1511 -0.1205 98  TYR B CD1   
2019 C CD2   . TYR B 98  ? 3.0344 4.1347 3.2333 -0.0184 -0.3178 -0.0327 98  TYR B CD2   
2020 C CE1   . TYR B 98  ? 2.9124 4.2946 3.2292 -0.2299 -0.2415 -0.1121 98  TYR B CE1   
2021 C CE2   . TYR B 98  ? 2.9557 4.2308 3.3411 -0.1111 -0.4143 -0.0254 98  TYR B CE2   
2022 C CZ    . TYR B 98  ? 2.8642 4.2853 3.3106 -0.2181 -0.3746 -0.0618 98  TYR B CZ    
2023 O OH    . TYR B 98  ? 2.6781 4.2851 3.3167 -0.3112 -0.4704 -0.0459 98  TYR B OH    
2024 N N     . ARG B 99  ? 3.9179 4.3745 3.4051 0.3356  0.0902  -0.1074 99  ARG B N     
2025 C CA    . ARG B 99  ? 4.1074 4.4473 3.4452 0.3495  0.1944  -0.0612 99  ARG B CA    
2026 C C     . ARG B 99  ? 4.0906 4.2932 3.2818 0.4346  0.2875  -0.1337 99  ARG B C     
2027 O O     . ARG B 99  ? 4.2535 4.4034 3.3421 0.3775  0.3916  -0.1066 99  ARG B O     
2028 C CB    . ARG B 99  ? 4.1915 4.4250 3.4819 0.4846  0.1512  -0.0052 99  ARG B CB    
2029 C CG    . ARG B 99  ? 4.0659 4.4020 3.5028 0.4575  0.0293  0.0431  99  ARG B CG    
2030 C CD    . ARG B 99  ? 3.9469 4.4550 3.4916 0.2397  0.0407  0.1274  99  ARG B CD    
2031 N NE    . ARG B 99  ? 3.7892 4.3701 3.4574 0.2280  -0.0703 0.1870  99  ARG B NE    
2032 C CZ    . ARG B 99  ? 3.6806 4.3979 3.5145 0.1531  -0.1730 0.1789  99  ARG B CZ    
2033 N NH1   . ARG B 99  ? 3.6613 4.4701 3.5597 0.0829  -0.1751 0.1162  99  ARG B NH1   
2034 N NH2   . ARG B 99  ? 3.5996 4.3644 3.5375 0.1491  -0.2747 0.2364  99  ARG B NH2   
2035 N N     . ASN B 100 ? 3.8918 4.0338 3.0748 0.5683  0.2485  -0.2234 100 ASN B N     
2036 C CA    . ASN B 100 ? 3.8046 3.8135 2.8550 0.6590  0.3299  -0.2957 100 ASN B CA    
2037 C C     . ASN B 100 ? 3.8844 3.9902 2.9725 0.5449  0.3779  -0.3593 100 ASN B C     
2038 O O     . ASN B 100 ? 4.1370 4.1593 3.1113 0.5398  0.4771  -0.3915 100 ASN B O     
2039 C CB    . ASN B 100 ? 3.8046 3.6851 2.8130 0.8762  0.2670  -0.3596 100 ASN B CB    
2040 C CG    . ASN B 100 ? 3.9232 3.6680 2.8407 1.0192  0.2467  -0.3082 100 ASN B CG    
2041 O OD1   . ASN B 100 ? 3.8471 3.5763 2.8102 1.1249  0.1427  -0.3111 100 ASN B OD1   
2042 N ND2   . ASN B 100 ? 4.1018 3.7485 2.8892 1.0246  0.3445  -0.2594 100 ASN B ND2   
2043 N N     . ARG B 101 ? 4.8720 4.4518 4.0464 0.9644  0.5750  -0.7490 101 ARG B N     
2044 C CA    . ARG B 101 ? 4.5954 3.9594 3.7892 0.9016  0.5833  -0.6734 101 ARG B CA    
2045 C C     . ARG B 101 ? 4.3666 3.6353 3.5061 0.7328  0.6900  -0.5712 101 ARG B C     
2046 O O     . ARG B 101 ? 4.4979 3.5975 3.4248 0.6785  0.7732  -0.4715 101 ARG B O     
2047 C CB    . ARG B 101 ? 4.3576 3.7344 3.8431 0.9466  0.4559  -0.7401 101 ARG B CB    
2048 C CG    . ARG B 101 ? 4.4067 3.5851 3.9340 0.9038  0.4606  -0.6601 101 ARG B CG    
2049 C CD    . ARG B 101 ? 4.3220 3.5431 4.1567 0.9636  0.3280  -0.7164 101 ARG B CD    
2050 N NE    . ARG B 101 ? 4.3129 3.3633 4.1918 0.9407  0.3363  -0.6302 101 ARG B NE    
2051 C CZ    . ARG B 101 ? 4.1173 3.1238 4.1187 0.8468  0.3645  -0.5786 101 ARG B CZ    
2052 N NH1   . ARG B 101 ? 4.0518 3.1666 4.1519 0.7578  0.3823  -0.6067 101 ARG B NH1   
2053 N NH2   . ARG B 101 ? 4.0325 2.8898 4.0545 0.8482  0.3755  -0.4969 101 ARG B NH2   
2054 N N     . LYS B 102 ? 3.7521 3.1229 3.0794 0.6511  0.6809  -0.5973 102 LYS B N     
2055 C CA    . LYS B 102 ? 3.6166 2.8877 2.9135 0.4923  0.7631  -0.5084 102 LYS B CA    
2056 C C     . LYS B 102 ? 3.7921 3.0573 2.8560 0.4179  0.8737  -0.4264 102 LYS B C     
2057 O O     . LYS B 102 ? 4.0153 3.0945 2.9287 0.3198  0.9433  -0.3234 102 LYS B O     
2058 C CB    . LYS B 102 ? 3.4155 2.8202 2.9677 0.4283  0.7239  -0.5609 102 LYS B CB    
2059 C CG    . LYS B 102 ? 3.4225 2.7832 2.9318 0.2660  0.8087  -0.4832 102 LYS B CG    
2060 C CD    . LYS B 102 ? 3.3253 2.8651 3.0734 0.2137  0.7735  -0.5450 102 LYS B CD    
2061 C CE    . LYS B 102 ? 3.2963 2.8085 2.9895 0.0549  0.8560  -0.4662 102 LYS B CE    
2062 N NZ    . LYS B 102 ? 3.1463 2.8348 3.0717 0.0009  0.8239  -0.5237 102 LYS B NZ    
2063 N N     . LYS B 103 ? 3.9973 3.4660 3.0319 0.4668  0.8876  -0.4661 103 LYS B N     
2064 C CA    . LYS B 103 ? 4.0835 3.5821 2.9283 0.3947  0.9938  -0.3746 103 LYS B CA    
2065 C C     . LYS B 103 ? 4.2769 3.6048 2.8597 0.4190  1.0453  -0.2904 103 LYS B C     
2066 O O     . LYS B 103 ? 4.4120 3.6147 2.8450 0.3078  1.1244  -0.1754 103 LYS B O     
2067 C CB    . LYS B 103 ? 4.2346 4.0103 3.1088 0.4648  0.9995  -0.4328 103 LYS B CB    
2068 C CG    . LYS B 103 ? 4.3910 4.2435 3.1263 0.3763  1.1118  -0.3248 103 LYS B CG    
2069 C CD    . LYS B 103 ? 4.2447 4.0057 3.0456 0.1910  1.1538  -0.2417 103 LYS B CD    
2070 C CE    . LYS B 103 ? 4.3387 4.1588 3.0147 0.0920  1.2567  -0.1148 103 LYS B CE    
2071 N NZ    . LYS B 103 ? 4.2089 3.9078 2.9392 -0.0906 1.2828  -0.0311 103 LYS B NZ    
2072 N N     . GLN B 104 ? 4.3348 3.6474 2.8629 0.5626  0.9935  -0.3450 104 GLN B N     
2073 C CA    . GLN B 104 ? 4.5062 3.6494 2.7920 0.5921  1.0356  -0.2694 104 GLN B CA    
2074 C C     . GLN B 104 ? 4.4616 3.3329 2.6975 0.5020  1.0527  -0.1907 104 GLN B C     
2075 O O     . GLN B 104 ? 4.6315 3.3444 2.6577 0.4431  1.1213  -0.0863 104 GLN B O     
2076 C CB    . GLN B 104 ? 4.5583 3.7331 2.8241 0.7673  0.9595  -0.3539 104 GLN B CB    
2077 C CG    . GLN B 104 ? 4.7536 3.7803 2.7657 0.8151  0.9996  -0.2848 104 GLN B CG    
2078 C CD    . GLN B 104 ? 4.7402 3.7987 2.7431 0.9904  0.9128  -0.3737 104 GLN B CD    
2079 O OE1   . GLN B 104 ? 4.6033 3.7699 2.8021 1.0738  0.8105  -0.4862 104 GLN B OE1   
2080 N NE2   . GLN B 104 ? 4.9054 3.8631 2.6838 1.0466  0.9449  -0.3226 104 GLN B NE2   
2081 N N     . SER B 105 ? 4.3600 3.1757 2.7859 0.4934  0.9895  -0.2356 105 SER B N     
2082 C CA    . SER B 105 ? 4.4084 2.9752 2.7880 0.4232  1.0057  -0.1642 105 SER B CA    
2083 C C     . SER B 105 ? 4.3873 2.8586 2.6648 0.2653  1.0833  -0.0686 105 SER B C     
2084 O O     . SER B 105 ? 4.5553 2.8172 2.6271 0.2166  1.1322  0.0243  105 SER B O     
2085 C CB    . SER B 105 ? 4.1964 2.7655 2.8241 0.4447  0.9279  -0.2242 105 SER B CB    
2086 O OG    . SER B 105 ? 4.1307 2.4652 2.7009 0.4037  0.9450  -0.1548 105 SER B OG    
2087 N N     . ILE B 106 ? 4.2740 2.8911 2.6980 0.1835  1.0871  -0.0900 106 ILE B N     
2088 C CA    . ILE B 106 ? 4.3437 2.8661 2.6963 0.0277  1.1455  0.0008  106 ILE B CA    
2089 C C     . ILE B 106 ? 4.5513 3.0742 2.6934 -0.0129 1.2187  0.0927  106 ILE B C     
2090 O O     . ILE B 106 ? 4.6873 3.0333 2.6928 -0.1252 1.2604  0.1951  106 ILE B O     
2091 C CB    . ILE B 106 ? 4.1685 2.8582 2.7422 -0.0488 1.1284  -0.0430 106 ILE B CB    
2092 C CG1   . ILE B 106 ? 4.3558 3.3440 3.0229 0.0090  1.1270  -0.1062 106 ILE B CG1   
2093 C CG2   . ILE B 106 ? 3.9761 2.6378 2.7521 -0.0236 1.0588  -0.1123 106 ILE B CG2   
2094 C CD1   . ILE B 106 ? 4.1783 3.3446 3.0719 -0.0545 1.1062  -0.1564 106 ILE B CD1   
2095 N N     . ASP B 107 ? 4.5974 3.3077 2.7035 0.0824  1.2306  0.0632  107 ASP B N     
2096 C CA    . ASP B 107 ? 4.7959 3.5252 2.7067 0.0537  1.3045  0.1622  107 ASP B CA    
2097 C C     . ASP B 107 ? 4.9832 3.4554 2.6641 0.0649  1.3237  0.2384  107 ASP B C     
2098 O O     . ASP B 107 ? 5.1445 3.4762 2.6772 -0.0405 1.3727  0.3556  107 ASP B O     
2099 C CB    . ASP B 107 ? 4.8674 3.8690 2.7882 0.1737  1.3123  0.1071  107 ASP B CB    
2100 C CG    . ASP B 107 ? 4.8209 4.0841 2.9211 0.1417  1.3185  0.0683  107 ASP B CG    
2101 O OD1   . ASP B 107 ? 4.7602 4.0001 2.9301 -0.0020 1.3437  0.1275  107 ASP B OD1   
2102 O OD2   . ASP B 107 ? 4.7684 4.2548 2.9361 0.2644  1.2933  -0.0228 107 ASP B OD2   
2103 N N     . VAL B 108 ? 4.9715 3.3772 2.6251 0.1926  1.2794  0.1765  108 VAL B N     
2104 C CA    . VAL B 108 ? 5.1449 3.3042 2.5852 0.2113  1.2950  0.2445  108 VAL B CA    
2105 C C     . VAL B 108 ? 5.3511 3.2440 2.7473 0.1003  1.2973  0.3080  108 VAL B C     
2106 O O     . VAL B 108 ? 5.4330 3.1148 2.6260 0.0521  1.3297  0.4032  108 VAL B O     
2107 C CB    . VAL B 108 ? 5.1116 3.2580 2.5587 0.3710  1.2391  0.1648  108 VAL B CB    
2108 C CG1   . VAL B 108 ? 5.1073 3.2054 2.7487 0.3981  1.1698  0.0915  108 VAL B CG1   
2109 C CG2   . VAL B 108 ? 5.3151 3.2464 2.5213 0.4015  1.2653  0.2400  108 VAL B CG2   
2110 N N     . PHE B 109 ? 5.0062 2.8999 2.5841 0.0628  1.2591  0.2568  109 PHE B N     
2111 C CA    . PHE B 109 ? 5.0453 2.6979 2.5786 -0.0387 1.2593  0.3122  109 PHE B CA    
2112 C C     . PHE B 109 ? 5.1969 2.7821 2.6164 -0.1850 1.3047  0.4167  109 PHE B C     
2113 O O     . PHE B 109 ? 5.3890 2.7243 2.6130 -0.2381 1.3198  0.5038  109 PHE B O     
2114 C CB    . PHE B 109 ? 4.8418 2.5599 2.6105 -0.0510 1.2130  0.2376  109 PHE B CB    
2115 C CG    . PHE B 109 ? 4.9265 2.4183 2.6570 -0.1501 1.2105  0.2863  109 PHE B CG    
2116 C CD1   . PHE B 109 ? 4.9950 2.2613 2.6497 -0.0991 1.1931  0.2975  109 PHE B CD1   
2117 C CD2   . PHE B 109 ? 4.8581 2.3657 2.6297 -0.2869 1.2224  0.3211  109 PHE B CD2   
2118 C CE1   . PHE B 109 ? 4.9530 2.0068 2.5532 -0.1740 1.1880  0.3373  109 PHE B CE1   
2119 C CE2   . PHE B 109 ? 4.9085 2.1955 2.6331 -0.3708 1.2096  0.3598  109 PHE B CE2   
2120 C CZ    . PHE B 109 ? 4.9613 2.0184 2.5913 -0.3098 1.1924  0.3648  109 PHE B CZ    
2121 N N     . ILE B 110 ? 5.2723 3.0767 2.8234 -0.2525 1.3202  0.4121  110 ILE B N     
2122 C CA    . ILE B 110 ? 5.4535 3.2231 2.9421 -0.4000 1.3560  0.5190  110 ILE B CA    
2123 C C     . ILE B 110 ? 5.6795 3.3723 2.9483 -0.4070 1.4008  0.6252  110 ILE B C     
2124 O O     . ILE B 110 ? 5.9134 3.4530 3.0737 -0.5281 1.4149  0.7368  110 ILE B O     
2125 C CB    . ILE B 110 ? 5.3695 3.4377 3.0571 -0.4462 1.3694  0.4928  110 ILE B CB    
2126 C CG1   . ILE B 110 ? 5.2688 3.2606 3.0549 -0.5911 1.3500  0.5204  110 ILE B CG1   
2127 C CG2   . ILE B 110 ? 5.5095 3.7561 3.1279 -0.4584 1.4301  0.5728  110 ILE B CG2   
2128 C CD1   . ILE B 110 ? 5.1288 3.4078 3.1254 -0.6385 1.3598  0.4927  110 ILE B CD1   
2129 N N     . GLN B 111 ? 5.6296 3.4171 2.8300 -0.2788 1.4162  0.5958  111 GLN B N     
2130 C CA    . GLN B 111 ? 5.8612 3.5895 2.8549 -0.2800 1.4608  0.6997  111 GLN B CA    
2131 C C     . GLN B 111 ? 5.8902 3.2958 2.6816 -0.2603 1.4447  0.7392  111 GLN B C     
2132 O O     . GLN B 111 ? 6.1013 3.3614 2.7213 -0.3262 1.4682  0.8536  111 GLN B O     
2133 C CB    . GLN B 111 ? 5.8767 3.8595 2.8678 -0.1481 1.4874  0.6576  111 GLN B CB    
2134 C CG    . GLN B 111 ? 5.9370 3.9297 2.7420 -0.1587 1.5457  0.7783  111 GLN B CG    
2135 C CD    . GLN B 111 ? 6.0264 4.0624 2.8454 -0.3157 1.5868  0.9093  111 GLN B CD    
2136 O OE1   . GLN B 111 ? 5.9008 4.1267 2.8931 -0.3710 1.5936  0.8938  111 GLN B OE1   
2137 N NE2   . GLN B 111 ? 6.3625 4.2300 3.0220 -0.3887 1.6022  1.0403  111 GLN B NE2   
2138 N N     . LYS B 112 ? 5.8001 3.0937 2.6150 -0.1708 1.4027  0.6542  112 LYS B N     
2139 C CA    . LYS B 112 ? 5.9459 2.9565 2.5727 -0.1254 1.3906  0.6842  112 LYS B CA    
2140 C C     . LYS B 112 ? 6.6466 3.3949 3.2503 -0.1975 1.3522  0.7012  112 LYS B C     
2141 O O     . LYS B 112 ? 6.4548 3.0303 2.9824 -0.1518 1.3081  0.6983  112 LYS B O     
2142 C CB    . LYS B 112 ? 5.8410 2.9088 2.5125 0.0383  1.3643  0.5885  112 LYS B CB    
2143 C CG    . LYS B 112 ? 6.0102 2.8609 2.4748 0.1132  1.3658  0.6265  112 LYS B CG    
2144 C CD    . LYS B 112 ? 6.2276 3.0566 2.4981 0.0822  1.4108  0.7245  112 LYS B CD    
2145 C CE    . LYS B 112 ? 6.4699 3.1396 2.6226 0.1608  1.3794  0.7333  112 LYS B CE    
2146 N NZ    . LYS B 112 ? 6.5633 3.2727 2.6300 0.1272  1.3850  0.8082  112 LYS B NZ    
2147 N N     . ILE B 113 ? 2.7497 2.7516 4.7285 0.0303  0.4062  1.1286  113 ILE B N     
2148 C CA    . ILE B 113 ? 2.8008 2.7845 4.8028 -0.0451 0.4503  1.1499  113 ILE B CA    
2149 C C     . ILE B 113 ? 2.8261 2.7598 4.7401 -0.1056 0.5704  1.1538  113 ILE B C     
2150 O O     . ILE B 113 ? 2.9733 2.8495 4.8543 -0.1372 0.6081  1.1640  113 ILE B O     
2151 C CB    . ILE B 113 ? 2.8687 2.9524 4.9493 -0.0807 0.3967  1.1169  113 ILE B CB    
2152 C CG1   . ILE B 113 ? 2.9316 3.1118 4.9968 -0.0775 0.3939  1.0565  113 ILE B CG1   
2153 C CG2   . ILE B 113 ? 2.8946 2.9947 5.0788 -0.0435 0.2780  1.1396  113 ILE B CG2   
2154 C CD1   . ILE B 113 ? 3.0072 3.2857 5.1492 -0.1058 0.3342  1.0189  113 ILE B CD1   
2155 N N     . SER B 114 ? 2.7528 2.7180 4.6082 -0.1128 0.6179  1.1303  114 SER B N     
2156 C CA    . SER B 114 ? 2.7316 2.6650 4.5253 -0.1873 0.7169  1.1333  114 SER B CA    
2157 C C     . SER B 114 ? 2.7726 2.5737 4.4723 -0.1844 0.7589  1.1506  114 SER B C     
2158 O O     . SER B 114 ? 2.4842 2.2428 4.1085 -0.2324 0.7898  1.1158  114 SER B O     
2159 C CB    . SER B 114 ? 2.7474 2.7552 4.4987 -0.1885 0.7527  1.1171  114 SER B CB    
2160 O OG    . SER B 114 ? 2.6676 2.8139 4.4735 -0.1640 0.6924  1.0709  114 SER B OG    
2161 N N     . GLU B 115 ? 3.0652 2.8038 4.7494 -0.1195 0.7424  1.1844  115 GLU B N     
2162 C CA    . GLU B 115 ? 3.2901 2.9220 4.8677 -0.1058 0.7694  1.1788  115 GLU B CA    
2163 C C     . GLU B 115 ? 3.1110 2.7148 4.6837 -0.0978 0.7395  1.1606  115 GLU B C     
2164 O O     . GLU B 115 ? 3.1931 2.7159 4.6908 -0.0818 0.7594  1.1582  115 GLU B O     
2165 C CB    . GLU B 115 ? 3.4610 3.0452 5.0187 -0.0367 0.7629  1.2182  115 GLU B CB    
2166 C CG    . GLU B 115 ? 3.4872 3.1173 5.0647 -0.0209 0.7880  1.2557  115 GLU B CG    
2167 C CD    . GLU B 115 ? 3.5011 3.1016 5.0530 0.0723  0.7452  1.2723  115 GLU B CD    
2168 O OE1   . GLU B 115 ? 3.4235 2.9552 4.9914 0.1115  0.7043  1.2874  115 GLU B OE1   
2169 O OE2   . GLU B 115 ? 3.5202 3.1820 5.0296 0.1104  0.7467  1.2613  115 GLU B OE2   
2170 N N     . TYR B 116 ? 2.6942 2.3699 4.3478 -0.1075 0.6944  1.1537  116 TYR B N     
2171 C CA    . TYR B 116 ? 2.5360 2.2115 4.2015 -0.0885 0.6657  1.1556  116 TYR B CA    
2172 C C     . TYR B 116 ? 2.8416 2.5506 4.5087 -0.1361 0.6755  1.1307  116 TYR B C     
2173 O O     . TYR B 116 ? 3.0172 2.7032 4.6577 -0.1261 0.6859  1.1341  116 TYR B O     
2174 C CB    . TYR B 116 ? 2.2021 1.9390 3.9744 -0.0404 0.5836  1.1883  116 TYR B CB    
2175 C CG    . TYR B 116 ? 2.3535 2.0496 4.1209 0.0177  0.5609  1.2113  116 TYR B CG    
2176 C CD1   . TYR B 116 ? 2.6649 2.2750 4.3315 0.0363  0.6102  1.2080  116 TYR B CD1   
2177 C CD2   . TYR B 116 ? 2.4084 2.1452 4.2683 0.0564  0.4809  1.2333  116 TYR B CD2   
2178 C CE1   . TYR B 116 ? 2.7985 2.3728 4.4514 0.0909  0.5876  1.2254  116 TYR B CE1   
2179 C CE2   . TYR B 116 ? 2.5192 2.2141 4.3615 0.1157  0.4511  1.2452  116 TYR B CE2   
2180 C CZ    . TYR B 116 ? 2.7880 2.4058 4.5249 0.1318  0.5089  1.2418  116 TYR B CZ    
2181 O OH    . TYR B 116 ? 2.9317 2.5102 4.6413 0.1914  0.4776  1.2494  116 TYR B OH    
2182 N N     . THR B 117 ? 3.0245 2.7918 4.7245 -0.1845 0.6743  1.1085  117 THR B N     
2183 C CA    . THR B 117 ? 3.2730 3.0842 4.9861 -0.2243 0.6707  1.0867  117 THR B CA    
2184 C C     . THR B 117 ? 3.2434 3.0188 4.8848 -0.2875 0.7243  1.0448  117 THR B C     
2185 O O     . THR B 117 ? 3.3329 3.0925 4.9473 -0.3102 0.7406  1.0303  117 THR B O     
2186 C CB    . THR B 117 ? 3.4536 3.3745 5.2788 -0.2321 0.6074  1.0925  117 THR B CB    
2187 O OG1   . THR B 117 ? 3.6061 3.5680 5.4248 -0.2912 0.6217  1.0539  117 THR B OG1   
2188 C CG2   . THR B 117 ? 3.3883 3.3375 5.2757 -0.2158 0.5831  1.1072  117 THR B CG2   
2189 N N     . ASP B 118 ? 3.2010 2.9704 4.8200 -0.3170 0.7506  1.0312  118 ASP B N     
2190 C CA    . ASP B 118 ? 3.3905 3.1439 4.9602 -0.3859 0.7892  0.9957  118 ASP B CA    
2191 C C     . ASP B 118 ? 3.3353 3.1777 4.9594 -0.4298 0.7663  0.9654  118 ASP B C     
2192 O O     . ASP B 118 ? 3.4346 3.2677 5.0266 -0.4901 0.7905  0.9340  118 ASP B O     
2193 C CB    . ASP B 118 ? 3.6585 3.2915 5.1363 -0.4011 0.8282  0.9878  118 ASP B CB    
2194 C CG    . ASP B 118 ? 3.8048 3.3460 5.2253 -0.3576 0.8471  1.0151  118 ASP B CG    
2195 O OD1   . ASP B 118 ? 3.8484 3.4129 5.2825 -0.3330 0.8437  1.0362  118 ASP B OD1   
2196 O OD2   . ASP B 118 ? 3.8862 3.3326 5.2516 -0.3449 0.8665  1.0176  118 ASP B OD2   
2197 N N     . TYR B 119 ? 3.2494 3.1760 4.9595 -0.4031 0.7140  0.9766  119 TYR B N     
2198 C CA    . TYR B 119 ? 3.2816 3.3029 5.0531 -0.4385 0.6815  0.9510  119 TYR B CA    
2199 C C     . TYR B 119 ? 3.1697 3.2908 5.0490 -0.4189 0.6309  0.9641  119 TYR B C     
2200 O O     . TYR B 119 ? 3.2205 3.4129 5.1804 -0.4104 0.5711  0.9703  119 TYR B O     
2201 C CB    . TYR B 119 ? 3.3538 3.3861 5.1371 -0.4284 0.6578  0.9591  119 TYR B CB    
2202 C CG    . TYR B 119 ? 3.4017 3.3463 5.1026 -0.4429 0.7083  0.9513  119 TYR B CG    
2203 C CD1   . TYR B 119 ? 3.3711 3.2845 5.0287 -0.5039 0.7431  0.9120  119 TYR B CD1   
2204 C CD2   . TYR B 119 ? 3.4252 3.3204 5.1040 -0.3947 0.7187  0.9870  119 TYR B CD2   
2205 C CE1   . TYR B 119 ? 3.4033 3.2248 5.0022 -0.5152 0.7856  0.9089  119 TYR B CE1   
2206 C CE2   . TYR B 119 ? 3.3777 3.1924 4.9948 -0.4018 0.7677  0.9843  119 TYR B CE2   
2207 C CZ    . TYR B 119 ? 3.3865 3.1573 4.9655 -0.4615 0.8007  0.9452  119 TYR B CZ    
2208 O OH    . TYR B 119 ? 3.4807 3.1554 5.0105 -0.4661 0.8479  0.9453  119 TYR B OH    
2209 N N     . LYS B 120 ? 3.0112 3.1420 4.9010 -0.4110 0.6531  0.9744  120 LYS B N     
2210 C CA    . LYS B 120 ? 2.7154 2.9364 4.7257 -0.3804 0.6076  0.9985  120 LYS B CA    
2211 C C     . LYS B 120 ? 2.5288 2.8730 4.6252 -0.4155 0.5699  0.9641  120 LYS B C     
2212 O O     . LYS B 120 ? 2.6150 3.0187 4.7821 -0.3790 0.4813  0.9567  120 LYS B O     
2213 C CB    . LYS B 120 ? 2.7175 2.9371 4.7000 -0.3571 0.6475  1.0114  120 LYS B CB    
2214 C CG    . LYS B 120 ? 2.5956 2.9171 4.6192 -0.2939 0.5739  0.9824  120 LYS B CG    
2215 C CD    . LYS B 120 ? 2.7500 3.0804 4.7110 -0.2552 0.6118  0.9864  120 LYS B CD    
2216 C CE    . LYS B 120 ? 2.7682 3.1302 4.6855 -0.3263 0.7026  0.9837  120 LYS B CE    
2217 N NZ    . LYS B 120 ? 2.6724 3.0629 4.5303 -0.2905 0.7431  0.9999  120 LYS B NZ    
2218 N N     . ASN B 121 ? 2.2426 2.6171 4.2952 -0.4730 0.6140  0.9223  121 ASN B N     
2219 C CA    . ASN B 121 ? 2.1170 2.6191 4.2526 -0.5046 0.5809  0.8858  121 ASN B CA    
2220 C C     . ASN B 121 ? 2.3109 2.8215 4.4709 -0.5123 0.5192  0.8704  121 ASN B C     
2221 O O     . ASN B 121 ? 2.4506 3.0595 4.7092 -0.5058 0.4510  0.8564  121 ASN B O     
2222 C CB    . ASN B 121 ? 2.1392 2.6659 4.2146 -0.5671 0.6396  0.8483  121 ASN B CB    
2223 C CG    . ASN B 121 ? 2.2948 2.9812 4.4593 -0.5831 0.6142  0.8133  121 ASN B CG    
2224 O OD1   . ASN B 121 ? 2.0816 2.8339 4.3070 -0.5523 0.5340  0.7877  121 ASN B OD1   
2225 N ND2   . ASN B 121 ? 2.2694 3.0160 4.4175 -0.6230 0.6703  0.8043  121 ASN B ND2   
2226 N N     . ASP B 122 ? 2.3216 2.7385 4.3919 -0.5202 0.5375  0.8722  122 ASP B N     
2227 C CA    . ASP B 122 ? 2.1276 2.5683 4.2156 -0.5281 0.4908  0.8658  122 ASP B CA    
2228 C C     . ASP B 122 ? 1.9437 2.4174 4.1242 -0.4781 0.4093  0.9108  122 ASP B C     
2229 O O     . ASP B 122 ? 1.9685 2.5056 4.2056 -0.4847 0.3464  0.9081  122 ASP B O     
2230 C CB    . ASP B 122 ? 2.2687 2.6212 4.2566 -0.5422 0.5369  0.8653  122 ASP B CB    
2231 C CG    . ASP B 122 ? 2.5446 2.8524 4.4550 -0.5988 0.6004  0.8246  122 ASP B CG    
2232 O OD1   . ASP B 122 ? 2.5723 2.9433 4.5082 -0.6375 0.6021  0.7913  122 ASP B OD1   
2233 O OD2   . ASP B 122 ? 2.6691 2.8824 4.5027 -0.6049 0.6444  0.8292  122 ASP B OD2   
2234 N N     . ILE B 123 ? 1.9295 2.3590 4.1291 -0.4300 0.4023  0.9556  123 ILE B N     
2235 C CA    . ILE B 123 ? 2.0633 2.5175 4.3630 -0.3866 0.3125  1.0051  123 ILE B CA    
2236 C C     . ILE B 123 ? 1.8709 2.4045 4.2768 -0.3673 0.2328  0.9872  123 ILE B C     
2237 O O     . ILE B 123 ? 1.6404 2.2205 4.1325 -0.3507 0.1311  0.9987  123 ILE B O     
2238 C CB    . ILE B 123 ? 1.9668 2.3368 4.2373 -0.3376 0.3263  1.0551  123 ILE B CB    
2239 C CG1   . ILE B 123 ? 1.9668 2.2663 4.1124 -0.3429 0.3976  1.0507  123 ILE B CG1   
2240 C CG2   . ILE B 123 ? 1.8766 2.2689 4.2543 -0.2972 0.2239  1.1122  123 ILE B CG2   
2241 C CD1   . ILE B 123 ? 1.9671 2.3076 4.1136 -0.3544 0.3737  1.0605  123 ILE B CD1   
2242 N N     . LEU B 124 ? 1.7998 2.3463 4.1595 -0.3519 0.2652  0.9418  124 LEU B N     
2243 C CA    . LEU B 124 ? 1.7028 2.3260 4.1039 -0.3036 0.1833  0.8944  124 LEU B CA    
2244 C C     . LEU B 124 ? 1.6679 2.3900 4.1191 -0.3408 0.1456  0.8471  124 LEU B C     
2245 O O     . LEU B 124 ? 1.7952 2.5758 4.3107 -0.2993 0.0406  0.8178  124 LEU B O     
2246 C CB    . LEU B 124 ? 1.8278 2.4603 4.1584 -0.2731 0.2396  0.8651  124 LEU B CB    
2247 C CG    . LEU B 124 ? 1.6172 2.1714 3.9110 -0.2059 0.2351  0.8979  124 LEU B CG    
2248 C CD1   . LEU B 124 ? 1.7516 2.3289 3.9669 -0.1847 0.3051  0.8759  124 LEU B CD1   
2249 C CD2   . LEU B 124 ? 1.5851 2.1444 3.9493 -0.1289 0.0996  0.8958  124 LEU B CD2   
2250 N N     . ASN B 125 ? 1.4210 2.3770 3.8902 0.2240  0.5328  -0.1306 125 ASN B N     
2251 C CA    . ASN B 125 ? 1.5658 2.7218 4.0212 0.1881  0.5309  -0.0760 125 ASN B CA    
2252 C C     . ASN B 125 ? 1.7508 3.0390 4.1664 0.1297  0.4931  -0.0687 125 ASN B C     
2253 O O     . ASN B 125 ? 1.5652 3.0096 3.9573 0.1198  0.4788  0.0080  125 ASN B O     
2254 C CB    . ASN B 125 ? 1.5874 2.8988 4.1422 0.0937  0.5830  -0.1339 125 ASN B CB    
2255 C CG    . ASN B 125 ? 1.5215 2.9923 4.0690 0.0970  0.5871  -0.0487 125 ASN B CG    
2256 O OD1   . ASN B 125 ? 1.6010 3.0981 4.0826 0.1580  0.5524  0.0547  125 ASN B OD1   
2257 N ND2   . ASN B 125 ? 1.5179 3.0977 4.1412 0.0302  0.6349  -0.0893 125 ASN B ND2   
2258 N N     . LYS B 126 ? 1.8596 3.0954 4.2732 0.0916  0.4770  -0.1391 126 LYS B N     
2259 C CA    . LYS B 126 ? 1.8548 3.2190 4.2311 0.0264  0.4435  -0.1395 126 LYS B CA    
2260 C C     . LYS B 126 ? 2.0049 3.2700 4.2726 0.1201  0.3961  -0.0476 126 LYS B C     
2261 O O     . LYS B 126 ? 2.0142 3.4078 4.2428 0.1142  0.3736  0.0294  126 LYS B O     
2262 C CB    . LYS B 126 ? 1.7650 3.1248 4.1935 -0.0659 0.4554  -0.2631 126 LYS B CB    
2263 C CG    . LYS B 126 ? 1.9162 3.3026 4.2817 -0.0945 0.4113  -0.2649 126 LYS B CG    
2264 C CD    . LYS B 126 ? 2.0082 3.6330 4.3457 -0.1722 0.3922  -0.2189 126 LYS B CD    
2265 C CE    . LYS B 126 ? 1.8641 3.4699 4.1088 -0.1366 0.3392  -0.1557 126 LYS B CE    
2266 N NZ    . LYS B 126 ? 1.7031 3.5375 3.9238 -0.1869 0.3162  -0.0727 126 LYS B NZ    
2267 N N     . TYR B 127 ? 2.0597 3.1011 4.2806 0.2028  0.3840  -0.0505 127 TYR B N     
2268 C CA    . TYR B 127 ? 2.1364 3.0786 4.2569 0.2533  0.3441  -0.0082 127 TYR B CA    
2269 C C     . TYR B 127 ? 2.4404 3.2990 4.4755 0.3615  0.3418  0.1106  127 TYR B C     
2270 O O     . TYR B 127 ? 2.4950 3.4214 4.4820 0.3740  0.3266  0.1829  127 TYR B O     
2271 C CB    . TYR B 127 ? 2.0181 2.7755 4.1298 0.2721  0.3322  -0.0743 127 TYR B CB    
2272 C CG    . TYR B 127 ? 2.1848 3.0193 4.3794 0.1676  0.3375  -0.1850 127 TYR B CG    
2273 C CD1   . TYR B 127 ? 2.3351 3.2808 4.5084 0.0963  0.3155  -0.2090 127 TYR B CD1   
2274 C CD2   . TYR B 127 ? 2.2243 3.0203 4.5260 0.1379  0.3725  -0.2646 127 TYR B CD2   
2275 C CE1   . TYR B 127 ? 2.3180 3.3296 4.5678 -0.0053 0.3298  -0.3167 127 TYR B CE1   
2276 C CE2   . TYR B 127 ? 2.1048 2.9621 4.4953 0.0418  0.3925  -0.3687 127 TYR B CE2   
2277 C CZ    . TYR B 127 ? 2.1786 3.1424 4.5398 -0.0317 0.3722  -0.3981 127 TYR B CZ    
2278 O OH    . TYR B 127 ? 2.1971 3.2161 4.6461 -0.1326 0.4007  -0.5075 127 TYR B OH    
2279 N N     . THR B 128 ? 2.5562 3.2612 4.5749 0.4390  0.3622  0.1323  128 THR B N     
2280 C CA    . THR B 128 ? 2.6655 3.2619 4.6055 0.5408  0.3757  0.2330  128 THR B CA    
2281 C C     . THR B 128 ? 2.6432 3.0805 4.4652 0.5919  0.3551  0.2618  128 THR B C     
2282 O O     . THR B 128 ? 2.7232 3.0266 4.4639 0.6739  0.3749  0.3320  128 THR B O     
2283 C CB    . THR B 128 ? 2.6536 3.4303 4.6280 0.5421  0.3926  0.3198  128 THR B CB    
2284 O OG1   . THR B 128 ? 2.5478 3.5074 4.6288 0.4629  0.4061  0.2762  128 THR B OG1   
2285 C CG2   . THR B 128 ? 2.6429 3.3080 4.5735 0.6457  0.4269  0.4127  128 THR B CG2   
2286 N N     . LYS B 129 ? 2.3479 2.7910 4.1582 0.5396  0.3218  0.2025  129 LYS B N     
2287 C CA    . LYS B 129 ? 1.9945 2.2717 3.6950 0.5742  0.3006  0.2057  129 LYS B CA    
2288 C C     . LYS B 129 ? 1.8451 2.0385 3.5719 0.5407  0.2787  0.1135  129 LYS B C     
2289 O O     . LYS B 129 ? 2.0947 2.3539 3.8615 0.4734  0.2553  0.0471  129 LYS B O     
2290 C CB    . LYS B 129 ? 2.0942 2.4583 3.7615 0.5447  0.2806  0.2282  129 LYS B CB    
2291 C CG    . LYS B 129 ? 2.3178 2.5108 3.8553 0.6108  0.2840  0.2823  129 LYS B CG    
2292 C CD    . LYS B 129 ? 2.3221 2.4183 3.8146 0.6994  0.3306  0.3712  129 LYS B CD    
2293 C CE    . LYS B 129 ? 2.3256 2.2306 3.6842 0.7577  0.3503  0.4147  129 LYS B CE    
2294 N NZ    . LYS B 129 ? 2.3124 2.1057 3.6279 0.8399  0.4093  0.4931  129 LYS B NZ    
2295 N N     . LEU B 130 ? 1.6007 1.6511 3.3098 0.5881  0.2890  0.1160  130 LEU B N     
2296 C CA    . LEU B 130 ? 1.7086 1.6995 3.4785 0.5639  0.2756  0.0480  130 LEU B CA    
2297 C C     . LEU B 130 ? 1.8351 1.6768 3.5198 0.5756  0.2400  0.0346  130 LEU B C     
2298 O O     . LEU B 130 ? 1.7804 1.6040 3.5336 0.5441  0.2214  -0.0208 130 LEU B O     
2299 C CB    . LEU B 130 ? 1.7204 1.6512 3.5252 0.6037  0.3029  0.0666  130 LEU B CB    
2300 C CG    . LEU B 130 ? 1.7647 1.8442 3.6562 0.5885  0.3403  0.0777  130 LEU B CG    
2301 C CD1   . LEU B 130 ? 1.8407 1.8452 3.7564 0.6319  0.3689  0.0985  130 LEU B CD1   
2302 C CD2   . LEU B 130 ? 1.6878 1.9415 3.7069 0.4954  0.3452  0.0000  130 LEU B CD2   
2303 N N     . ASP B 131 ? 2.0546 1.7924 3.5990 0.6169  0.2350  0.0852  131 ASP B N     
2304 C CA    . ASP B 131 ? 2.0600 1.6333 3.4975 0.6318  0.2079  0.0831  131 ASP B CA    
2305 C C     . ASP B 131 ? 2.2295 1.8314 3.6858 0.5765  0.1675  0.0239  131 ASP B C     
2306 O O     . ASP B 131 ? 2.6483 2.1313 3.9999 0.5815  0.1432  0.0263  131 ASP B O     
2307 C CB    . ASP B 131 ? 2.3648 1.8152 3.6437 0.6841  0.2306  0.1486  131 ASP B CB    
2308 C CG    . ASP B 131 ? 2.5498 2.1051 3.8378 0.6976  0.2609  0.1941  131 ASP B CG    
2309 O OD1   . ASP B 131 ? 2.5742 2.2781 3.9727 0.6862  0.2753  0.1990  131 ASP B OD1   
2310 O OD2   . ASP B 131 ? 2.6311 2.1253 3.8197 0.7167  0.2724  0.2293  131 ASP B OD2   
2311 N N     . ASP B 132 ? 2.2087 1.9639 3.7909 0.5179  0.1640  -0.0317 132 ASP B N     
2312 C CA    . ASP B 132 ? 2.2701 2.0565 3.9017 0.4604  0.1331  -0.0987 132 ASP B CA    
2313 C C     . ASP B 132 ? 1.9459 1.7836 3.7412 0.4250  0.1394  -0.1574 132 ASP B C     
2314 O O     . ASP B 132 ? 1.9515 1.7269 3.7816 0.4162  0.1150  -0.1826 132 ASP B O     
2315 C CB    . ASP B 132 ? 2.3357 2.2521 3.9704 0.4096  0.1310  -0.1208 132 ASP B CB    
2316 C CG    . ASP B 132 ? 2.2193 2.2944 3.9208 0.3900  0.1625  -0.1071 132 ASP B CG    
2317 O OD1   . ASP B 132 ? 2.2105 2.2925 3.9614 0.4163  0.1889  -0.0876 132 ASP B OD1   
2318 O OD2   . ASP B 132 ? 2.0914 2.2913 3.7937 0.3437  0.1594  -0.1124 132 ASP B OD2   
2319 N N     . ILE B 133 ? 2.3351 2.2102 2.3412 0.5624  0.9740  0.2573  133 ILE B N     
2320 C CA    . ILE B 133 ? 2.2783 2.1991 2.2172 0.5614  0.9278  0.2778  133 ILE B CA    
2321 C C     . ILE B 133 ? 2.3908 2.3488 2.2889 0.5036  0.9404  0.2308  133 ILE B C     
2322 O O     . ILE B 133 ? 2.7388 2.7347 2.5721 0.4921  0.9150  0.2513  133 ILE B O     
2323 C CB    . ILE B 133 ? 2.4120 2.3107 2.3667 0.5993  0.8927  0.2890  133 ILE B CB    
2324 C CG1   . ILE B 133 ? 1.9766 1.8637 1.9896 0.5779  0.9140  0.2224  133 ILE B CG1   
2325 C CG2   . ILE B 133 ? 1.7232 1.5886 1.7011 0.6486  0.8786  0.3408  133 ILE B CG2   
2326 C CD1   . ILE B 133 ? 2.1353 2.0078 2.1682 0.6068  0.8806  0.2306  133 ILE B CD1   
2327 N N     . ALA B 134 ? 2.1195 2.0731 2.0548 0.4668  0.9809  0.1643  134 ALA B N     
2328 C CA    . ALA B 134 ? 2.1922 2.1907 2.0766 0.3996  1.0012  0.1193  134 ALA B CA    
2329 C C     . ALA B 134 ? 2.5582 2.5735 2.3885 0.3651  1.0095  0.1368  134 ALA B C     
2330 O O     . ALA B 134 ? 2.6406 2.6916 2.3951 0.3262  0.9943  0.1457  134 ALA B O     
2331 C CB    . ALA B 134 ? 1.9304 1.9406 1.8726 0.3696  1.0464  0.0352  134 ALA B CB    
2332 N N     . ASN B 135 ? 2.7045 2.6901 2.5717 0.3764  1.0360  0.1445  135 ASN B N     
2333 C CA    . ASN B 135 ? 2.8588 2.8642 2.6784 0.3403  1.0458  0.1649  135 ASN B CA    
2334 C C     . ASN B 135 ? 2.5707 2.6227 2.3408 0.3571  0.9940  0.2261  135 ASN B C     
2335 O O     . ASN B 135 ? 2.6047 2.6974 2.3157 0.3164  0.9834  0.2312  135 ASN B O     
2336 C CB    . ASN B 135 ? 3.1646 3.1208 3.0342 0.3530  1.0900  0.1730  135 ASN B CB    
2337 C CG    . ASN B 135 ? 3.4698 3.4419 3.2916 0.2992  1.1120  0.1819  135 ASN B CG    
2338 O OD1   . ASN B 135 ? 3.5118 3.5244 3.2701 0.2466  1.1016  0.1627  135 ASN B OD1   
2339 N ND2   . ASN B 135 ? 3.6399 3.5764 3.4876 0.3067  1.1445  0.2177  135 ASN B ND2   
2340 N N     . SER B 136 ? 2.5415 2.5915 2.3370 0.4188  0.9619  0.2690  136 SER B N     
2341 C CA    . SER B 136 ? 2.4538 2.5617 2.2148 0.4448  0.9146  0.3131  136 SER B CA    
2342 C C     . SER B 136 ? 2.3974 2.5231 2.1047 0.4387  0.8860  0.3032  136 SER B C     
2343 O O     . SER B 136 ? 2.4601 2.6347 2.1234 0.4316  0.8659  0.3188  136 SER B O     
2344 C CB    . SER B 136 ? 2.0244 2.1298 1.8171 0.5108  0.8889  0.3538  136 SER B CB    
2345 O OG    . SER B 136 ? 1.8349 1.8946 1.6410 0.5431  0.8736  0.3441  136 SER B OG    
2346 N N     . PHE B 137 ? 2.3851 2.4728 2.0936 0.4427  0.8869  0.2813  137 PHE B N     
2347 C CA    . PHE B 137 ? 2.4115 2.5047 2.0552 0.4325  0.8679  0.2815  137 PHE B CA    
2348 C C     . PHE B 137 ? 2.7685 2.8799 2.3453 0.3539  0.8886  0.2608  137 PHE B C     
2349 O O     . PHE B 137 ? 2.8678 2.9946 2.3711 0.3502  0.8646  0.2864  137 PHE B O     
2350 C CB    . PHE B 137 ? 2.3553 2.4130 2.0148 0.4347  0.8762  0.2597  137 PHE B CB    
2351 C CG    . PHE B 137 ? 2.4406 2.4961 2.0185 0.4150  0.8645  0.2676  137 PHE B CG    
2352 C CD1   . PHE B 137 ? 2.5393 2.5816 2.0866 0.4848  0.8227  0.3126  137 PHE B CD1   
2353 C CD2   . PHE B 137 ? 2.7544 2.8212 2.2736 0.3242  0.8954  0.2332  137 PHE B CD2   
2354 C CE1   . PHE B 137 ? 2.4286 2.4542 1.8787 0.4677  0.8114  0.3316  137 PHE B CE1   
2355 C CE2   . PHE B 137 ? 2.6450 2.7005 2.0631 0.2896  0.8835  0.2528  137 PHE B CE2   
2356 C CZ    . PHE B 137 ? 2.4530 2.4790 1.8312 0.3620  0.8404  0.3066  137 PHE B CZ    
2357 N N     . ASN B 138 ? 2.8275 2.9350 2.4218 0.2946  0.9322  0.2169  138 ASN B N     
2358 C CA    . ASN B 138 ? 2.3999 2.5254 1.9226 0.2124  0.9515  0.1968  138 ASN B CA    
2359 C C     . ASN B 138 ? 2.2956 2.4473 1.7904 0.2092  0.9362  0.2313  138 ASN B C     
2360 O O     . ASN B 138 ? 2.3388 2.5009 1.7489 0.1645  0.9251  0.2445  138 ASN B O     
2361 C CB    . ASN B 138 ? 2.3395 2.4622 1.8947 0.1642  1.0032  0.1363  138 ASN B CB    
2362 C CG    . ASN B 138 ? 2.7050 2.8317 2.2822 0.1538  1.0217  0.0916  138 ASN B CG    
2363 O OD1   . ASN B 138 ? 2.7243 2.8606 2.2484 0.1388  1.0022  0.1051  138 ASN B OD1   
2364 N ND2   . ASN B 138 ? 2.8924 3.0115 2.5468 0.1617  1.0616  0.0381  138 ASN B ND2   
2365 N N     . LEU B 139 ? 2.3443 2.5095 1.9025 0.2513  0.9352  0.2508  139 LEU B N     
2366 C CA    . LEU B 139 ? 2.4116 2.6259 1.9540 0.2487  0.9212  0.2838  139 LEU B CA    
2367 C C     . LEU B 139 ? 2.5483 2.8018 2.0520 0.2945  0.8760  0.3186  139 LEU B C     
2368 O O     . LEU B 139 ? 2.6481 2.9313 2.0923 0.2695  0.8660  0.3345  139 LEU B O     
2369 C CB    . LEU B 139 ? 2.2284 2.4600 1.8404 0.2812  0.9286  0.3045  139 LEU B CB    
2370 C CG    . LEU B 139 ? 2.1022 2.3992 1.7113 0.2610  0.9270  0.3342  139 LEU B CG    
2371 C CD1   . LEU B 139 ? 2.5189 2.7980 2.0880 0.1818  0.9606  0.3173  139 LEU B CD1   
2372 C CD2   . LEU B 139 ? 1.9974 2.3127 1.6633 0.2892  0.9331  0.3639  139 LEU B CD2   
2373 N N     . GLY B 140 ? 2.5371 2.7899 2.0703 0.3695  0.8478  0.3333  140 GLY B N     
2374 C CA    . GLY B 140 ? 2.4808 2.7747 1.9779 0.4346  0.8049  0.3642  140 GLY B CA    
2375 C C     . GLY B 140 ? 2.3446 2.6004 1.7327 0.4017  0.7959  0.3720  140 GLY B C     
2376 O O     . GLY B 140 ? 2.5169 2.8111 1.8398 0.4213  0.7683  0.4008  140 GLY B O     
2377 N N     . LEU B 141 ? 2.2360 2.4218 1.5921 0.3482  0.8156  0.3497  141 LEU B N     
2378 C CA    . LEU B 141 ? 2.5716 2.7100 1.7975 0.2935  0.8025  0.3650  141 LEU B CA    
2379 C C     . LEU B 141 ? 2.8286 2.9663 1.9780 0.2054  0.8127  0.3654  141 LEU B C     
2380 O O     . LEU B 141 ? 3.0799 3.1850 2.1093 0.1777  0.7649  0.4007  141 LEU B O     
2381 C CB    . LEU B 141 ? 2.4996 2.5913 1.7181 0.2390  0.8281  0.3332  141 LEU B CB    
2382 C CG    . LEU B 141 ? 2.9203 2.9549 1.9931 0.1926  0.7970  0.3657  141 LEU B CG    
2383 C CD1   . LEU B 141 ? 2.8748 2.8906 1.9148 0.2937  0.7152  0.4193  141 LEU B CD1   
2384 C CD2   . LEU B 141 ? 3.3288 3.3530 2.4145 0.1326  0.8309  0.3272  141 LEU B CD2   
2385 N N     . SER B 142 ? 2.9547 3.1166 2.1674 0.1575  0.8543  0.3283  142 SER B N     
2386 C CA    . SER B 142 ? 3.0795 3.2424 2.2229 0.0770  0.8644  0.3300  142 SER B CA    
2387 C C     . SER B 142 ? 2.9909 3.2019 2.1132 0.1292  0.8290  0.3802  142 SER B C     
2388 O O     . SER B 142 ? 3.3421 3.5312 2.3746 0.0758  0.7827  0.3984  142 SER B O     
2389 C CB    . SER B 142 ? 3.1151 3.2973 2.3324 0.0329  0.9118  0.2845  142 SER B CB    
2390 O OG    . SER B 142 ? 3.0723 3.2982 2.3841 0.0926  0.9132  0.2967  142 SER B OG    
2391 N N     . TYR B 143 ? 2.9373 3.2243 2.1646 0.2220  0.8197  0.3890  143 TYR B N     
2392 C CA    . TYR B 143 ? 2.9309 3.3107 2.1671 0.2811  0.7735  0.4211  143 TYR B CA    
2393 C C     . TYR B 143 ? 3.0380 3.3816 2.2245 0.3079  0.6585  0.4275  143 TYR B C     
2394 O O     . TYR B 143 ? 2.7958 3.1569 1.9644 0.2954  0.5772  0.4316  143 TYR B O     
2395 C CB    . TYR B 143 ? 2.3224 2.8049 1.6774 0.3680  0.7837  0.4205  143 TYR B CB    
2396 C CG    . TYR B 143 ? 2.1062 2.7239 1.4986 0.4340  0.7313  0.4321  143 TYR B CG    
2397 C CD1   . TYR B 143 ? 2.3435 3.0492 1.7670 0.3957  0.7430  0.4372  143 TYR B CD1   
2398 C CD2   . TYR B 143 ? 1.9936 2.6486 1.4099 0.5285  0.6515  0.4226  143 TYR B CD2   
2399 C CE1   . TYR B 143 ? 2.3668 3.2129 1.8522 0.4488  0.6834  0.4290  143 TYR B CE1   
2400 C CE2   . TYR B 143 ? 2.0998 2.8884 1.5794 0.5896  0.5874  0.4071  143 TYR B CE2   
2401 C CZ    . TYR B 143 ? 2.0417 2.9347 1.5598 0.5490  0.6070  0.4085  143 TYR B CZ    
2402 O OH    . TYR B 143 ? 1.8764 2.9270 1.4723 0.6097  0.5465  0.3832  143 TYR B OH    
2403 N N     . MET B 144 ? 3.2332 3.5190 2.3998 0.3443  0.6400  0.4288  144 MET B N     
2404 C CA    . MET B 144 ? 3.2592 3.4881 2.3725 0.3666  0.5154  0.4388  144 MET B CA    
2405 C C     . MET B 144 ? 3.2700 3.3940 2.2561 0.2430  0.4635  0.4497  144 MET B C     
2406 O O     . MET B 144 ? 3.3415 3.4240 2.2834 0.2413  0.3369  0.4623  144 MET B O     
2407 C CB    . MET B 144 ? 3.2838 3.4702 2.4017 0.4262  0.5083  0.4423  144 MET B CB    
2408 C CG    . MET B 144 ? 3.2685 3.5526 2.4982 0.5443  0.5497  0.4341  144 MET B CG    
2409 S SD    . MET B 144 ? 3.3087 3.5368 2.5446 0.6139  0.5409  0.4394  144 MET B SD    
2410 C CE    . MET B 144 ? 3.0665 3.4020 2.3882 0.7637  0.4667  0.4260  144 MET B CE    
2411 N N     . GLU B 145 ? 3.2752 3.3553 2.2003 0.1377  0.5530  0.4408  145 GLU B N     
2412 C CA    . GLU B 145 ? 3.2059 3.2023 1.9978 0.0033  0.5166  0.4483  145 GLU B CA    
2413 C C     . GLU B 145 ? 3.2162 3.2378 2.0045 -0.0260 0.4722  0.4535  145 GLU B C     
2414 O O     . GLU B 145 ? 3.6840 3.6337 2.3737 -0.0993 0.3730  0.4729  145 GLU B O     
2415 C CB    . GLU B 145 ? 3.2363 3.2119 1.9795 -0.0960 0.6365  0.4194  145 GLU B CB    
2416 C CG    . GLU B 145 ? 3.3324 3.2890 2.0776 -0.0844 0.6798  0.4088  145 GLU B CG    
2417 C CD    . GLU B 145 ? 3.8919 3.7661 2.5234 -0.1364 0.5766  0.4410  145 GLU B CD    
2418 O OE1   . GLU B 145 ? 4.2906 4.1038 2.8094 -0.2242 0.4883  0.4656  145 GLU B OE1   
2419 O OE2   . GLU B 145 ? 3.9023 3.7651 2.5535 -0.0944 0.5756  0.4459  145 GLU B OE2   
2420 N N     . SER B 146 ? 3.1556 3.2760 2.0479 0.0236  0.5375  0.4402  146 SER B N     
2421 C CA    . SER B 146 ? 3.2142 3.3800 2.1235 0.0051  0.4957  0.4452  146 SER B CA    
2422 C C     . SER B 146 ? 3.2118 3.4298 2.1822 0.0988  0.3699  0.4525  146 SER B C     
2423 O O     . SER B 146 ? 3.3787 3.6444 2.3749 0.0896  0.3186  0.4526  146 SER B O     
2424 C CB    . SER B 146 ? 3.3319 3.5912 2.3309 0.0184  0.6027  0.4328  146 SER B CB    
2425 O OG    . SER B 146 ? 3.4142 3.7440 2.4511 0.0142  0.5596  0.4398  146 SER B OG    
2426 N N     . LEU B 147 ? 3.1216 3.3357 2.1226 0.1912  0.3150  0.4518  147 LEU B N     
2427 C CA    . LEU B 147 ? 2.9964 3.2652 2.0676 0.2932  0.1887  0.4418  147 LEU B CA    
2428 C C     . LEU B 147 ? 3.0805 3.2264 2.0562 0.2388  0.0322  0.4579  147 LEU B C     
2429 O O     . LEU B 147 ? 3.1595 3.3477 2.1864 0.2767  -0.0729 0.4451  147 LEU B O     
2430 C CB    . LEU B 147 ? 2.9478 3.2506 2.0843 0.4149  0.1805  0.4293  147 LEU B CB    
2431 C CG    . LEU B 147 ? 2.6438 3.1002 1.9006 0.4995  0.2896  0.4112  147 LEU B CG    
2432 C CD1   . LEU B 147 ? 2.5652 3.0397 1.8682 0.6141  0.2658  0.3988  147 LEU B CD1   
2433 C CD2   . LEU B 147 ? 2.5802 3.1965 1.9358 0.5371  0.2787  0.3900  147 LEU B CD2   
2434 N N     . LEU B 148 ? 3.2310 3.2289 2.0697 0.1458  0.0085  0.4854  148 LEU B N     
2435 C CA    . LEU B 148 ? 3.3304 3.1889 2.0540 0.0743  -0.1521 0.5128  148 LEU B CA    
2436 C C     . LEU B 148 ? 3.3058 3.1321 1.9536 -0.0487 -0.1599 0.5253  148 LEU B C     
2437 O O     . LEU B 148 ? 3.2413 3.0380 1.8893 -0.0488 -0.2968 0.5305  148 LEU B O     
2438 C CB    . LEU B 148 ? 3.2989 3.0209 1.8871 -0.0050 -0.1716 0.5444  148 LEU B CB    
2439 C CG    . LEU B 148 ? 3.3486 3.0493 1.9771 0.1004  -0.2261 0.5442  148 LEU B CG    
2440 C CD1   . LEU B 148 ? 3.3222 3.1343 2.0536 0.1828  -0.0678 0.5182  148 LEU B CD1   
2441 C CD2   . LEU B 148 ? 3.2992 2.8380 1.7676 -0.0065 -0.3115 0.5889  148 LEU B CD2   
2442 N N     . MET C 1   ? 2.3503 2.4580 2.0909 -0.2808 -0.3052 -0.2443 1   MET C N     
2443 C CA    . MET C 1   ? 2.1992 2.2941 2.0236 -0.2275 -0.3277 -0.2498 1   MET C CA    
2444 C C     . MET C 1   ? 1.8871 1.9731 1.8139 -0.1892 -0.2648 -0.2744 1   MET C C     
2445 O O     . MET C 1   ? 1.8065 1.8663 1.7313 -0.2275 -0.1857 -0.2919 1   MET C O     
2446 C CB    . MET C 1   ? 2.0892 2.1178 1.8614 -0.2950 -0.3245 -0.2512 1   MET C CB    
2447 C CG    . MET C 1   ? 2.3874 2.3443 2.1096 -0.3910 -0.2293 -0.2783 1   MET C CG    
2448 S SD    . MET C 1   ? 2.8403 2.7290 2.4665 -0.4892 -0.2353 -0.2734 1   MET C SD    
2449 C CE    . MET C 1   ? 2.8182 2.7069 2.5380 -0.4091 -0.2959 -0.2675 1   MET C CE    
2450 N N     . ILE C 2   ? 1.7102 1.8203 1.7308 -0.1152 -0.2994 -0.2739 2   ILE C N     
2451 C CA    . ILE C 2   ? 1.6515 1.7645 1.7821 -0.0740 -0.2514 -0.2881 2   ILE C CA    
2452 C C     . ILE C 2   ? 1.8469 1.8946 2.0058 -0.1065 -0.2143 -0.3057 2   ILE C C     
2453 O O     . ILE C 2   ? 2.3734 2.4138 2.5323 -0.0939 -0.2652 -0.3017 2   ILE C O     
2454 C CB    . ILE C 2   ? 1.5870 1.7779 1.8033 0.0230  -0.3123 -0.2756 2   ILE C CB    
2455 C CG1   . ILE C 2   ? 1.7567 2.0121 1.9557 0.0538  -0.3340 -0.2623 2   ILE C CG1   
2456 C CG2   . ILE C 2   ? 1.6060 1.8011 1.9405 0.0602  -0.2729 -0.2833 2   ILE C CG2   
2457 C CD1   . ILE C 2   ? 2.2207 2.5094 2.3464 0.0593  -0.4093 -0.2466 2   ILE C CD1   
2458 N N     . ILE C 3   ? 1.6309 1.6292 1.8173 -0.1495 -0.1224 -0.3263 3   ILE C N     
2459 C CA    . ILE C 3   ? 1.4781 1.4087 1.6877 -0.1921 -0.0733 -0.3473 3   ILE C CA    
2460 C C     . ILE C 3   ? 1.4118 1.3590 1.7650 -0.1355 -0.0394 -0.3517 3   ILE C C     
2461 O O     . ILE C 3   ? 1.3602 1.3351 1.7786 -0.1073 -0.0006 -0.3475 3   ILE C O     
2462 C CB    . ILE C 3   ? 1.6014 1.4570 1.7305 -0.2969 0.0117  -0.3710 3   ILE C CB    
2463 C CG1   . ILE C 3   ? 1.8864 1.7376 1.8724 -0.3548 -0.0348 -0.3581 3   ILE C CG1   
2464 C CG2   . ILE C 3   ? 1.5476 1.3332 1.7083 -0.3418 0.0705  -0.3969 3   ILE C CG2   
2465 C CD1   . ILE C 3   ? 2.1478 1.9266 2.0328 -0.4717 0.0345  -0.3800 3   ILE C CD1   
2466 N N     . CYS C 4   ? 1.7209 1.6535 2.1259 -0.1205 -0.0548 -0.3568 4   CYS C N     
2467 C CA    . CYS C 4   ? 1.6906 1.6470 2.2361 -0.0675 -0.0332 -0.3557 4   CYS C CA    
2468 C C     . CYS C 4   ? 1.7608 1.6450 2.3369 -0.1188 0.0325  -0.3804 4   CYS C C     
2469 O O     . CYS C 4   ? 1.7920 1.6471 2.3301 -0.1387 0.0003  -0.3877 4   CYS C O     
2470 C CB    . CYS C 4   ? 1.5322 1.5589 2.1246 0.0107  -0.1248 -0.3370 4   CYS C CB    
2471 S SG    . CYS C 4   ? 1.4559 1.5184 2.2113 0.0662  -0.1127 -0.3316 4   CYS C SG    
2472 N N     . SER C 5   ? 1.6786 1.5325 2.3276 -0.1407 0.1268  -0.3935 5   SER C N     
2473 C CA    . SER C 5   ? 1.8321 1.6172 2.5246 -0.1907 0.2031  -0.4206 5   SER C CA    
2474 C C     . SER C 5   ? 1.3536 1.1767 2.2143 -0.1285 0.2183  -0.4087 5   SER C C     
2475 O O     . SER C 5   ? 1.4815 1.3602 2.4349 -0.0738 0.2240  -0.3855 5   SER C O     
2476 C CB    . SER C 5   ? 2.0794 1.7944 2.7368 -0.2715 0.3110  -0.4490 5   SER C CB    
2477 O OG    . SER C 5   ? 1.9430 1.6863 2.6842 -0.2387 0.3582  -0.4385 5   SER C OG    
2478 N N     . VAL C 6   ? 1.4392 1.2365 2.3399 -0.1382 0.2216  -0.4209 6   VAL C N     
2479 C CA    . VAL C 6   ? 1.7257 1.5706 2.7803 -0.0782 0.2173  -0.4048 6   VAL C CA    
2480 C C     . VAL C 6   ? 1.8771 1.6574 3.0089 -0.1247 0.3115  -0.4311 6   VAL C C     
2481 O O     . VAL C 6   ? 1.7027 1.4144 2.7583 -0.1886 0.3307  -0.4613 6   VAL C O     
2482 C CB    . VAL C 6   ? 1.3124 1.2072 2.3576 -0.0313 0.1151  -0.3911 6   VAL C CB    
2483 C CG1   . VAL C 6   ? 1.1985 1.1548 2.4021 0.0274  0.1081  -0.3709 6   VAL C CG1   
2484 C CG2   . VAL C 6   ? 1.2167 1.1686 2.1823 0.0086  0.0271  -0.3710 6   VAL C CG2   
2485 N N     . ASP C 7   ? 1.5331 1.3367 2.8201 -0.0937 0.3710  -0.4179 7   ASP C N     
2486 C CA    . ASP C 7   ? 1.4578 1.2271 2.8641 -0.1119 0.4434  -0.4329 7   ASP C CA    
2487 C C     . ASP C 7   ? 1.7830 1.6263 3.2792 -0.0475 0.3693  -0.4056 7   ASP C C     
2488 O O     . ASP C 7   ? 2.0826 2.0134 3.6767 0.0228  0.3289  -0.3646 7   ASP C O     
2489 C CB    . ASP C 7   ? 1.4414 1.2010 2.9851 -0.1092 0.5457  -0.4278 7   ASP C CB    
2490 C CG    . ASP C 7   ? 1.7328 1.4619 3.4200 -0.1235 0.6240  -0.4410 7   ASP C CG    
2491 O OD1   . ASP C 7   ? 2.0294 1.7179 3.6743 -0.1617 0.6205  -0.4686 7   ASP C OD1   
2492 O OD2   . ASP C 7   ? 1.9422 1.6887 3.7901 -0.0964 0.6897  -0.4219 7   ASP C OD2   
2493 N N     . ILE C 8   ? 1.5592 1.3687 3.0181 -0.0761 0.3514  -0.4279 8   ILE C N     
2494 C CA    . ILE C 8   ? 1.4325 1.3052 2.9436 -0.0261 0.2736  -0.4090 8   ILE C CA    
2495 C C     . ILE C 8   ? 1.7562 1.6520 3.4493 -0.0071 0.3260  -0.3982 8   ILE C C     
2496 O O     . ILE C 8   ? 2.1020 1.9391 3.8606 -0.0485 0.4268  -0.4188 8   ILE C O     
2497 C CB    . ILE C 8   ? 1.5332 1.3572 2.9160 -0.0661 0.2272  -0.4364 8   ILE C CB    
2498 C CG1   . ILE C 8   ? 1.9116 1.6921 3.1192 -0.1056 0.2011  -0.4489 8   ILE C CG1   
2499 C CG2   . ILE C 8   ? 1.3860 1.2819 2.7920 -0.0099 0.1305  -0.4168 8   ILE C CG2   
2500 C CD1   . ILE C 8   ? 2.4706 2.1480 3.5920 -0.1994 0.2813  -0.4870 8   ILE C CD1   
2501 N N     . GLY C 9   ? 1.9202 1.9059 3.6994 0.0539  0.2579  -0.3654 9   GLY C N     
2502 C CA    . GLY C 9   ? 2.1329 2.1580 4.0888 0.0764  0.2904  -0.3468 9   GLY C CA    
2503 C C     . GLY C 9   ? 2.1428 2.2922 4.1955 0.1505  0.2130  -0.2949 9   GLY C C     
2504 O O     . GLY C 9   ? 1.7695 1.9743 3.8102 0.1884  0.1757  -0.2657 9   GLY C O     
2505 N N     . ILE C 10  ? 2.4266 2.6238 4.5701 0.1674  0.1869  -0.2834 10  ILE C N     
2506 C CA    . ILE C 10  ? 2.4663 2.7894 4.7144 0.2296  0.1198  -0.2309 10  ILE C CA    
2507 C C     . ILE C 10  ? 2.4149 2.7524 4.7368 0.2350  0.1681  -0.1773 10  ILE C C     
2508 O O     . ILE C 10  ? 2.3394 2.7458 4.6359 0.2648  0.1159  -0.1231 10  ILE C O     
2509 C CB    . ILE C 10  ? 2.4584 2.8194 4.7485 0.2316  0.0778  -0.2322 10  ILE C CB    
2510 C CG1   . ILE C 10  ? 2.2979 2.6127 4.4195 0.2074  0.0193  -0.2755 10  ILE C CG1   
2511 C CG2   . ILE C 10  ? 2.4329 2.8868 4.7127 0.2608  0.0100  -0.1689 10  ILE C CG2   
2512 C CD1   . ILE C 10  ? 2.2447 2.5950 4.3965 0.2084  -0.0252 -0.2809 10  ILE C CD1   
2513 N N     . LYS C 11  ? 2.4600 2.7252 4.8609 0.2019  0.2713  -0.1942 11  LYS C N     
2514 C CA    . LYS C 11  ? 2.5362 2.7986 5.0128 0.2022  0.3232  -0.1462 11  LYS C CA    
2515 C C     . LYS C 11  ? 2.3157 2.6023 4.7327 0.2251  0.3028  -0.1156 11  LYS C C     
2516 O O     . LYS C 11  ? 2.3565 2.7114 4.7747 0.2562  0.2539  -0.0569 11  LYS C O     
2517 C CB    . LYS C 11  ? 2.8228 2.9860 5.3725 0.1530  0.4447  -0.1845 11  LYS C CB    
2518 C CG    . LYS C 11  ? 2.8457 2.9284 5.3199 0.1155  0.4961  -0.2613 11  LYS C CG    
2519 C CD    . LYS C 11  ? 2.9552 2.9345 5.4717 0.0563  0.6264  -0.3000 11  LYS C CD    
2520 C CE    . LYS C 11  ? 2.7628 2.6583 5.1440 0.0136  0.6704  -0.3570 11  LYS C CE    
2521 N NZ    . LYS C 11  ? 2.6231 2.4973 4.8065 -0.0119 0.5874  -0.3853 11  LYS C NZ    
2522 N N     . ASN C 12  ? 1.9934 2.2249 4.3532 0.2076  0.3422  -0.1574 12  ASN C N     
2523 C CA    . ASN C 12  ? 1.7861 2.0305 4.0914 0.2239  0.3344  -0.1367 12  ASN C CA    
2524 C C     . ASN C 12  ? 1.3147 1.5133 3.5289 0.2083  0.3452  -0.1964 12  ASN C C     
2525 O O     . ASN C 12  ? 1.5420 1.6609 3.7547 0.1709  0.4364  -0.2336 12  ASN C O     
2526 C CB    . ASN C 12  ? 2.2603 2.4633 4.6450 0.2079  0.4196  -0.1102 12  ASN C CB    
2527 C CG    . ASN C 12  ? 2.2299 2.3350 4.6826 0.1545  0.5323  -0.1550 12  ASN C CG    
2528 O OD1   . ASN C 12  ? 2.3656 2.4283 4.7926 0.1258  0.5541  -0.2123 12  ASN C OD1   
2529 N ND2   . ASN C 12  ? 1.9523 2.0163 4.4883 0.1379  0.6065  -0.1311 12  ASN C ND2   
2530 N N     . PRO C 13  ? 1.3198 1.5596 3.4415 0.2301  0.2544  -0.2079 13  PRO C N     
2531 C CA    . PRO C 13  ? 1.3813 1.5524 3.3100 0.1896  0.2406  -0.2494 13  PRO C CA    
2532 C C     . PRO C 13  ? 1.4149 1.5934 3.3024 0.1996  0.2514  -0.2359 13  PRO C C     
2533 O O     . PRO C 13  ? 1.3615 1.6213 3.3332 0.2515  0.2265  -0.1902 13  PRO C O     
2534 C CB    . PRO C 13  ? 1.1075 1.3274 2.9436 0.2126  0.1295  -0.2500 13  PRO C CB    
2535 C CG    . PRO C 13  ? 1.0623 1.4002 3.0240 0.2761  0.0761  -0.1990 13  PRO C CG    
2536 C CD    . PRO C 13  ? 1.6136 1.9446 3.7125 0.2686  0.1484  -0.1720 13  PRO C CD    
2537 N N     . ALA C 14  ? 1.6758 1.3621 2.5096 0.1883  -0.2591 -0.2325 14  ALA C N     
2538 C CA    . ALA C 14  ? 1.5511 1.2329 2.4449 0.1651  -0.2806 -0.1869 14  ALA C CA    
2539 C C     . ALA C 14  ? 1.7991 1.4814 2.6240 0.1576  -0.2765 -0.2284 14  ALA C C     
2540 O O     . ALA C 14  ? 1.9946 1.6324 2.7301 0.1759  -0.2602 -0.2991 14  ALA C O     
2541 C CB    . ALA C 14  ? 1.6702 1.2562 2.6672 0.1607  -0.2913 -0.1906 14  ALA C CB    
2542 N N     . TYR C 15  ? 1.9833 1.7127 2.8491 0.1324  -0.2900 -0.1863 15  TYR C N     
2543 C CA    . TYR C 15  ? 2.0601 1.8081 2.8822 0.1289  -0.2939 -0.2273 15  TYR C CA    
2544 C C     . TYR C 15  ? 2.0490 1.8014 2.9722 0.0945  -0.3113 -0.2088 15  TYR C C     
2545 O O     . TYR C 15  ? 1.9112 1.6788 2.9163 0.0677  -0.3103 -0.1424 15  TYR C O     
2546 C CB    . TYR C 15  ? 1.7345 1.5809 2.4752 0.1346  -0.2798 -0.2121 15  TYR C CB    
2547 C CG    . TYR C 15  ? 1.7090 1.6462 2.4923 0.1070  -0.2756 -0.1290 15  TYR C CG    
2548 C CD1   . TYR C 15  ? 1.8763 1.8641 2.7180 0.0763  -0.2798 -0.1053 15  TYR C CD1   
2549 C CD2   . TYR C 15  ? 1.7645 1.7373 2.5243 0.1103  -0.2656 -0.0795 15  TYR C CD2   
2550 C CE1   . TYR C 15  ? 2.0838 2.1384 2.9504 0.0471  -0.2667 -0.0312 15  TYR C CE1   
2551 C CE2   . TYR C 15  ? 2.0539 2.0963 2.8305 0.0857  -0.2613 -0.0024 15  TYR C CE2   
2552 C CZ    . TYR C 15  ? 2.1938 2.2692 3.0183 0.0530  -0.2580 0.0230  15  TYR C CZ    
2553 O OH    . TYR C 15  ? 2.2945 2.4231 3.1239 0.0246  -0.2446 0.0984  15  TYR C OH    
2554 N N     . ALA C 16  ? 1.9773 1.7094 2.8880 0.0964  -0.3261 -0.2724 16  ALA C N     
2555 C CA    . ALA C 16  ? 1.5773 1.3281 2.5821 0.0617  -0.3426 -0.2783 16  ALA C CA    
2556 C C     . ALA C 16  ? 1.7568 1.5962 2.7248 0.0693  -0.3544 -0.3117 16  ALA C C     
2557 O O     . ALA C 16  ? 1.5802 1.4032 2.4433 0.1099  -0.3631 -0.3670 16  ALA C O     
2558 C CB    . ALA C 16  ? 1.7342 1.3801 2.7755 0.0569  -0.3578 -0.3357 16  ALA C CB    
2559 N N     . ILE C 17  ? 2.0539 1.9813 3.1058 0.0322  -0.3509 -0.2790 17  ILE C N     
2560 C CA    . ILE C 17  ? 1.8345 1.8652 2.8833 0.0360  -0.3604 -0.3085 17  ILE C CA    
2561 C C     . ILE C 17  ? 1.4070 1.4588 2.5727 0.0009  -0.3826 -0.3516 17  ILE C C     
2562 O O     . ILE C 17  ? 1.5016 1.5638 2.7778 -0.0525 -0.3637 -0.3138 17  ILE C O     
2563 C CB    . ILE C 17  ? 1.5458 1.6743 2.6013 0.0160  -0.3288 -0.2425 17  ILE C CB    
2564 C CG1   . ILE C 17  ? 1.5395 1.6421 2.5004 0.0373  -0.3060 -0.1923 17  ILE C CG1   
2565 C CG2   . ILE C 17  ? 1.3143 1.5467 2.3494 0.0335  -0.3346 -0.2800 17  ILE C CG2   
2566 C CD1   . ILE C 17  ? 1.9871 2.0706 2.8160 0.0907  -0.3074 -0.2388 17  ILE C CD1   
2567 N N     . PHE C 18  ? 1.4959 1.5519 2.6318 0.0309  -0.4209 -0.4323 18  PHE C N     
2568 C CA    . PHE C 18  ? 1.4558 1.5511 2.6988 0.0025  -0.4508 -0.4908 18  PHE C CA    
2569 C C     . PHE C 18  ? 1.4338 1.6669 2.6984 0.0175  -0.4702 -0.5264 18  PHE C C     
2570 O O     . PHE C 18  ? 1.5726 1.8400 2.7358 0.0669  -0.4701 -0.5239 18  PHE C O     
2571 C CB    . PHE C 18  ? 1.9194 1.9173 3.1150 0.0277  -0.4908 -0.5664 18  PHE C CB    
2572 C CG    . PHE C 18  ? 1.9244 1.7798 3.0918 0.0217  -0.4719 -0.5466 18  PHE C CG    
2573 C CD1   . PHE C 18  ? 2.2987 2.0713 3.3337 0.0671  -0.4586 -0.5365 18  PHE C CD1   
2574 C CD2   . PHE C 18  ? 1.6712 1.4728 2.9487 -0.0296 -0.4643 -0.5469 18  PHE C CD2   
2575 C CE1   . PHE C 18  ? 2.2776 1.9281 3.3029 0.0622  -0.4401 -0.5266 18  PHE C CE1   
2576 C CE2   . PHE C 18  ? 1.7515 1.4228 3.0121 -0.0310 -0.4460 -0.5320 18  PHE C CE2   
2577 C CZ    . PHE C 18  ? 2.2010 1.8017 3.3406 0.0159  -0.4356 -0.5230 18  PHE C CZ    
2578 N N     . ASN C 19  ? 1.4585 1.7679 2.8604 -0.0242 -0.4863 -0.5686 19  ASN C N     
2579 C CA    . ASN C 19  ? 1.4461 1.8963 2.9012 -0.0096 -0.5157 -0.6246 19  ASN C CA    
2580 C C     . ASN C 19  ? 1.5883 2.0405 3.0817 0.0003  -0.5779 -0.7211 19  ASN C C     
2581 O O     . ASN C 19  ? 1.5363 1.9649 3.1377 -0.0573 -0.5763 -0.7431 19  ASN C O     
2582 C CB    . ASN C 19  ? 1.4286 1.9950 3.0332 -0.0764 -0.4729 -0.5951 19  ASN C CB    
2583 C CG    . ASN C 19  ? 1.7587 2.4859 3.4434 -0.0629 -0.5007 -0.6605 19  ASN C CG    
2584 O OD1   . ASN C 19  ? 1.3967 2.1643 2.9901 0.0076  -0.5302 -0.6836 19  ASN C OD1   
2585 N ND2   . ASN C 19  ? 1.7935 2.6120 3.6531 -0.1300 -0.4880 -0.6939 19  ASN C ND2   
2586 N N     . TYR C 20  ? 1.8184 2.2920 3.2156 0.0741  -0.6315 -0.7788 20  TYR C N     
2587 C CA    . TYR C 20  ? 1.5807 2.0563 2.9840 0.0976  -0.7022 -0.8742 20  TYR C CA    
2588 C C     . TYR C 20  ? 1.6303 2.2901 3.1459 0.1083  -0.7412 -0.9329 20  TYR C C     
2589 O O     . TYR C 20  ? 1.7475 2.4717 3.1976 0.1706  -0.7532 -0.9316 20  TYR C O     
2590 C CB    . TYR C 20  ? 1.7586 2.1062 2.9522 0.1808  -0.7377 -0.8992 20  TYR C CB    
2591 C CG    . TYR C 20  ? 2.1461 2.4892 3.3101 0.2182  -0.8181 -0.9973 20  TYR C CG    
2592 C CD1   . TYR C 20  ? 2.2065 2.4770 3.4135 0.1751  -0.8367 -1.0410 20  TYR C CD1   
2593 C CD2   . TYR C 20  ? 2.3590 2.7663 3.4445 0.3002  -0.8767 -1.0466 20  TYR C CD2   
2594 C CE1   . TYR C 20  ? 2.1757 2.4414 3.3444 0.2084  -0.9137 -1.1336 20  TYR C CE1   
2595 C CE2   . TYR C 20  ? 2.5176 2.9203 3.5629 0.3416  -0.9588 -1.1361 20  TYR C CE2   
2596 C CZ    . TYR C 20  ? 2.5121 2.8458 3.5972 0.2933  -0.9782 -1.1805 20  TYR C CZ    
2597 O OH    . TYR C 20  ? 2.7677 3.0931 3.7964 0.3348  -1.0498 -1.2579 20  TYR C OH    
2598 N N     . ASP C 21  ? 1.9050 2.6501 3.5948 0.0474  -0.7580 -0.9891 21  ASP C N     
2599 C CA    . ASP C 21  ? 1.9167 2.8513 3.7390 0.0541  -0.7995 -1.0612 21  ASP C CA    
2600 C C     . ASP C 21  ? 2.1644 3.1044 3.8839 0.1452  -0.8960 -1.1448 21  ASP C C     
2601 O O     . ASP C 21  ? 2.0801 2.9379 3.7587 0.1466  -0.9412 -1.1970 21  ASP C O     
2602 C CB    . ASP C 21  ? 1.9600 2.9807 4.0026 -0.0453 -0.7822 -1.1050 21  ASP C CB    
2603 C CG    . ASP C 21  ? 2.2198 3.4562 4.4381 -0.0600 -0.7930 -1.1623 21  ASP C CG    
2604 O OD1   . ASP C 21  ? 2.2073 3.5089 4.4695 -0.0790 -0.7325 -1.1065 21  ASP C OD1   
2605 O OD2   . ASP C 21  ? 2.3678 3.6671 4.6202 -0.0447 -0.8344 -1.2377 21  ASP C OD2   
2606 N N     . ASN C 22  ? 2.3394 3.3673 4.0081 0.2235  -0.9258 -1.1561 22  ASN C N     
2607 C CA    . ASN C 22  ? 2.4051 3.4104 3.9315 0.3280  -1.0133 -1.2190 22  ASN C CA    
2608 C C     . ASN C 22  ? 2.3001 3.3793 3.9090 0.3233  -1.0565 -1.2965 22  ASN C C     
2609 O O     . ASN C 22  ? 2.0854 3.3129 3.8830 0.2676  -1.0351 -1.3200 22  ASN C O     
2610 C CB    . ASN C 22  ? 2.5466 3.6166 3.9953 0.4140  -1.0165 -1.1993 22  ASN C CB    
2611 C CG    . ASN C 22  ? 2.2673 3.2109 3.5616 0.4268  -0.9404 -1.1012 22  ASN C CG    
2612 O OD1   . ASN C 22  ? 2.0006 2.7656 3.1472 0.4274  -0.9188 -1.0671 22  ASN C OD1   
2613 N ND2   . ASN C 22  ? 2.2041 3.2419 3.5358 0.4336  -0.8947 -1.0590 22  ASN C ND2   
2614 N N     . THR C 23  ? 2.5016 3.4702 3.9624 0.3796  -1.1129 -1.3368 23  THR C N     
2615 C CA    . THR C 23  ? 2.8191 3.8347 4.3133 0.3932  -1.1671 -1.4126 23  THR C CA    
2616 C C     . THR C 23  ? 2.7800 3.8219 4.4422 0.2824  -1.1411 -1.4401 23  THR C C     
2617 O O     . THR C 23  ? 2.9438 4.0217 4.6378 0.2828  -1.1830 -1.5059 23  THR C O     
2618 C CB    . THR C 23  ? 2.9337 4.1222 4.5049 0.4446  -1.1994 -1.4550 23  THR C CB    
2619 O OG1   . THR C 23  ? 2.8353 4.1785 4.6251 0.3628  -1.1430 -1.4452 23  THR C OG1   
2620 C CG2   . THR C 23  ? 2.8257 3.9768 4.2227 0.5588  -1.2195 -1.4278 23  THR C CG2   
2621 N N     . SER C 24  ? 2.5527 3.5728 4.3189 0.1887  -1.0714 -1.3915 24  SER C N     
2622 C CA    . SER C 24  ? 2.2782 3.2930 4.1861 0.0835  -1.0337 -1.4094 24  SER C CA    
2623 C C     . SER C 24  ? 2.7976 3.6176 4.6152 0.0493  -1.0081 -1.3747 24  SER C C     
2624 O O     . SER C 24  ? 2.0238 2.8078 3.9236 -0.0257 -0.9806 -1.3929 24  SER C O     
2625 C CB    . SER C 24  ? 2.0511 3.1833 4.1640 -0.0072 -0.9598 -1.3811 24  SER C CB    
2626 O OG    . SER C 24  ? 2.2430 3.2961 4.3401 -0.0388 -0.9037 -1.2978 24  SER C OG    
2627 N N     . ASN C 25  ? 3.1885 3.8776 4.8378 0.1018  -1.0096 -1.3264 25  ASN C N     
2628 C CA    . ASN C 25  ? 3.3393 3.8317 4.8919 0.0759  -0.9770 -1.2904 25  ASN C CA    
2629 C C     . ASN C 25  ? 3.1749 3.6525 4.8884 -0.0312 -0.9018 -1.2452 25  ASN C C     
2630 O O     . ASN C 25  ? 3.2141 3.5809 4.9381 -0.0821 -0.8702 -1.2420 25  ASN C O     
2631 C CB    . ASN C 25  ? 3.5508 3.9394 4.9954 0.0957  -1.0093 -1.3374 25  ASN C CB    
2632 C CG    . ASN C 25  ? 3.6963 4.0652 4.9537 0.2067  -1.0770 -1.3681 25  ASN C CG    
2633 O OD1   . ASN C 25  ? 3.8151 4.1712 4.9610 0.2764  -1.0863 -1.3395 25  ASN C OD1   
2634 N ND2   . ASN C 25  ? 3.7641 4.1237 4.9790 0.2238  -1.1210 -1.4239 25  ASN C ND2   
2635 N N     . THR C 26  ? 2.5832 3.1636 4.4051 -0.0602 -0.8603 -1.1961 26  THR C N     
2636 C CA    . THR C 26  ? 2.1601 2.7206 4.1073 -0.1511 -0.7730 -1.1290 26  THR C CA    
2637 C C     . THR C 26  ? 2.0638 2.5198 3.8916 -0.1266 -0.7147 -1.0152 26  THR C C     
2638 O O     . THR C 26  ? 2.0604 2.5863 3.8483 -0.0881 -0.7041 -0.9732 26  THR C O     
2639 C CB    . THR C 26  ? 1.7456 2.4909 3.8913 -0.2082 -0.7496 -1.1482 26  THR C CB    
2640 O OG1   . THR C 26  ? 2.0021 2.8441 4.2167 -0.2122 -0.7914 -1.2411 26  THR C OG1   
2641 C CG2   . THR C 26  ? 1.7422 2.4397 4.0007 -0.3052 -0.6557 -1.0825 26  THR C CG2   
2642 N N     . ILE C 27  ? 2.1996 2.4935 3.9758 -0.1486 -0.6773 -0.9703 27  ILE C N     
2643 C CA    . ILE C 27  ? 2.0696 2.2635 3.7414 -0.1267 -0.6271 -0.8708 27  ILE C CA    
2644 C C     . ILE C 27  ? 2.2168 2.4255 4.0070 -0.1977 -0.5544 -0.7921 27  ILE C C     
2645 O O     . ILE C 27  ? 2.5318 2.6873 4.4220 -0.2632 -0.5243 -0.7934 27  ILE C O     
2646 C CB    . ILE C 27  ? 2.1149 2.1269 3.6681 -0.1047 -0.6272 -0.8691 27  ILE C CB    
2647 C CG1   . ILE C 27  ? 2.3396 2.3163 3.7713 -0.0446 -0.6965 -0.9567 27  ILE C CG1   
2648 C CG2   . ILE C 27  ? 2.2705 2.2025 3.7157 -0.0720 -0.5843 -0.7807 27  ILE C CG2   
2649 C CD1   . ILE C 27  ? 2.7590 2.7031 4.2537 -0.0842 -0.7292 -1.0409 27  ILE C CD1   
2650 N N     . LYS C 28  ? 2.1329 2.4021 3.9009 -0.1848 -0.5226 -0.7232 28  LYS C N     
2651 C CA    . LYS C 28  ? 2.1156 2.3818 3.9574 -0.2426 -0.4529 -0.6377 28  LYS C CA    
2652 C C     . LYS C 28  ? 2.2414 2.4328 3.9553 -0.2025 -0.4265 -0.5467 28  LYS C C     
2653 O O     . LYS C 28  ? 2.3855 2.6274 4.0042 -0.1496 -0.4392 -0.5363 28  LYS C O     
2654 C CB    . LYS C 28  ? 2.1408 2.5641 4.0931 -0.2791 -0.4318 -0.6444 28  LYS C CB    
2655 C CG    . LYS C 28  ? 2.3487 2.8590 4.4638 -0.3363 -0.4445 -0.7344 28  LYS C CG    
2656 C CD    . LYS C 28  ? 2.3893 3.0014 4.6406 -0.4070 -0.3832 -0.7149 28  LYS C CD    
2657 C CE    . LYS C 28  ? 2.3234 3.0663 4.5501 -0.3690 -0.3858 -0.7036 28  LYS C CE    
2658 N NZ    . LYS C 28  ? 2.1438 3.0211 4.4018 -0.3207 -0.4597 -0.8069 28  LYS C NZ    
2659 N N     . LEU C 29  ? 2.2184 2.2918 3.9330 -0.2264 -0.3900 -0.4844 29  LEU C N     
2660 C CA    . LEU C 29  ? 2.0329 2.0435 3.6442 -0.1920 -0.3678 -0.4012 29  LEU C CA    
2661 C C     . LEU C 29  ? 2.0101 2.0953 3.6377 -0.2157 -0.3256 -0.3256 29  LEU C C     
2662 O O     . LEU C 29  ? 2.2305 2.3126 3.9503 -0.2755 -0.2844 -0.2889 29  LEU C O     
2663 C CB    . LEU C 29  ? 1.8396 1.7059 3.4578 -0.2033 -0.3485 -0.3639 29  LEU C CB    
2664 C CG    . LEU C 29  ? 1.9044 1.7119 3.4315 -0.1651 -0.3324 -0.2859 29  LEU C CG    
2665 C CD1   . LEU C 29  ? 1.7702 1.5855 3.1683 -0.1003 -0.3611 -0.3196 29  LEU C CD1   
2666 C CD2   . LEU C 29  ? 2.2120 1.8850 3.7689 -0.1732 -0.3161 -0.2551 29  LEU C CD2   
2667 N N     . ILE C 30  ? 1.5032 1.6445 3.0323 -0.1713 -0.3298 -0.3036 30  ILE C N     
2668 C CA    . ILE C 30  ? 1.4914 1.6973 3.0163 -0.1922 -0.2882 -0.2321 30  ILE C CA    
2669 C C     . ILE C 30  ? 1.5386 1.6557 3.0073 -0.1900 -0.2614 -0.1391 30  ILE C C     
2670 O O     . ILE C 30  ? 1.7485 1.8517 3.2556 -0.2335 -0.2208 -0.0719 30  ILE C O     
2671 C CB    . ILE C 30  ? 1.6488 1.9566 3.0961 -0.1491 -0.2996 -0.2516 30  ILE C CB    
2672 C CG1   . ILE C 30  ? 1.7459 2.1570 3.2656 -0.1483 -0.3289 -0.3399 30  ILE C CG1   
2673 C CG2   . ILE C 30  ? 1.6077 1.9684 3.0322 -0.1711 -0.2524 -0.1750 30  ILE C CG2   
2674 C CD1   . ILE C 30  ? 1.3625 1.8688 2.8099 -0.0989 -0.3396 -0.3613 30  ILE C CD1   
2675 N N     . ALA C 31  ? 1.4889 1.5425 2.8638 -0.1384 -0.2827 -0.1358 31  ALA C N     
2676 C CA    . ALA C 31  ? 1.5095 1.5006 2.8371 -0.1285 -0.2654 -0.0535 31  ALA C CA    
2677 C C     . ALA C 31  ? 1.4990 1.3991 2.7790 -0.0843 -0.2893 -0.0765 31  ALA C C     
2678 O O     . ALA C 31  ? 1.5481 1.4347 2.7933 -0.0559 -0.3140 -0.1512 31  ALA C O     
2679 C CB    . ALA C 31  ? 1.4738 1.5401 2.7158 -0.1149 -0.2484 -0.0032 31  ALA C CB    
2680 N N     . ILE C 32  ? 1.9676 1.8007 3.2449 -0.0776 -0.2803 -0.0124 32  ILE C N     
2681 C CA    . ILE C 32  ? 2.1046 1.8624 3.3453 -0.0354 -0.2957 -0.0276 32  ILE C CA    
2682 C C     . ILE C 32  ? 2.1785 1.9398 3.3828 -0.0167 -0.2893 0.0530  32  ILE C C     
2683 O O     . ILE C 32  ? 2.3398 2.0853 3.5793 -0.0390 -0.2756 0.1281  32  ILE C O     
2684 C CB    . ILE C 32  ? 2.0108 1.6589 3.3305 -0.0464 -0.3002 -0.0581 32  ILE C CB    
2685 C CG1   . ILE C 32  ? 2.0740 1.6809 3.3496 -0.0177 -0.3195 -0.1500 32  ILE C CG1   
2686 C CG2   . ILE C 32  ? 1.9106 1.4780 3.2616 -0.0328 -0.2937 0.0042  32  ILE C CG2   
2687 C CD1   . ILE C 32  ? 1.8709 1.3600 3.2079 -0.0245 -0.3202 -0.1834 32  ILE C CD1   
2688 N N     . GLU C 33  ? 2.1304 1.9150 3.2552 0.0234  -0.2976 0.0360  33  GLU C N     
2689 C CA    . GLU C 33  ? 1.9314 1.7438 3.0171 0.0429  -0.2983 0.1019  33  GLU C CA    
2690 C C     . GLU C 33  ? 1.8032 1.5884 2.8609 0.0854  -0.3092 0.0625  33  GLU C C     
2691 O O     . GLU C 33  ? 1.9004 1.6607 2.9273 0.0995  -0.3067 -0.0169 33  GLU C O     
2692 C CB    . GLU C 33  ? 1.8047 1.7220 2.8111 0.0346  -0.2854 0.1296  33  GLU C CB    
2693 C CG    . GLU C 33  ? 1.8181 1.7714 2.8522 -0.0110 -0.2654 0.1728  33  GLU C CG    
2694 C CD    . GLU C 33  ? 2.1801 2.0800 3.2548 -0.0300 -0.2586 0.2609  33  GLU C CD    
2695 O OE1   . GLU C 33  ? 2.0990 1.9689 3.1534 0.0005  -0.2752 0.3061  33  GLU C OE1   
2696 O OE2   . GLU C 33  ? 2.2946 2.1802 3.4207 -0.0740 -0.2353 0.2825  33  GLU C OE2   
2697 N N     . LYS C 34  ? 2.0116 1.7989 3.0785 0.1066  -0.3202 0.1167  34  LYS C N     
2698 C CA    . LYS C 34  ? 2.1527 1.9429 3.2033 0.1450  -0.3286 0.0827  34  LYS C CA    
2699 C C     . LYS C 34  ? 2.5607 2.4534 3.5338 0.1535  -0.3306 0.1170  34  LYS C C     
2700 O O     . LYS C 34  ? 2.7205 2.6393 3.6990 0.1587  -0.3475 0.1950  34  LYS C O     
2701 C CB    . LYS C 34  ? 2.2441 1.9630 3.3855 0.1683  -0.3460 0.1081  34  LYS C CB    
2702 C CG    . LYS C 34  ? 2.3594 2.1041 3.5046 0.2081  -0.3567 0.0778  34  LYS C CG    
2703 C CD    . LYS C 34  ? 2.4018 2.1097 3.6354 0.2395  -0.3835 0.1318  34  LYS C CD    
2704 C CE    . LYS C 34  ? 2.2891 2.0521 3.5397 0.2799  -0.3988 0.0983  34  LYS C CE    
2705 N NZ    . LYS C 34  ? 2.0521 1.9348 3.2112 0.2788  -0.4029 0.1045  34  LYS C NZ    
2706 N N     . SER C 35  ? 2.5809 2.5234 3.4720 0.1555  -0.3117 0.0589  35  SER C N     
2707 C CA    . SER C 35  ? 2.5693 2.6093 3.3807 0.1569  -0.3063 0.0815  35  SER C CA    
2708 C C     . SER C 35  ? 2.4957 2.5604 3.3108 0.1871  -0.3154 0.0521  35  SER C C     
2709 O O     . SER C 35  ? 2.7961 2.8023 3.6814 0.2079  -0.3242 0.0170  35  SER C O     
2710 C CB    . SER C 35  ? 2.5673 2.6468 3.2869 0.1434  -0.2745 0.0352  35  SER C CB    
2711 O OG    . SER C 35  ? 2.7043 2.8748 3.3449 0.1389  -0.2627 0.0573  35  SER C OG    
2712 N N     . ASP C 36  ? 1.7493 1.9063 2.4933 0.1869  -0.3105 0.0606  36  ASP C N     
2713 C CA    . ASP C 36  ? 1.5221 1.7283 2.2703 0.2099  -0.3174 0.0236  36  ASP C CA    
2714 C C     . ASP C 36  ? 1.7441 2.0106 2.3872 0.1968  -0.2763 -0.0344 36  ASP C C     
2715 O O     . ASP C 36  ? 1.5159 1.8412 2.0813 0.1762  -0.2645 0.0016  36  ASP C O     
2716 C CB    . ASP C 36  ? 1.4706 1.7377 2.2459 0.2265  -0.3634 0.1027  36  ASP C CB    
2717 C CG    . ASP C 36  ? 1.8230 2.1669 2.6130 0.2504  -0.3771 0.0577  36  ASP C CG    
2718 O OD1   . ASP C 36  ? 2.2421 2.5536 3.1231 0.2761  -0.3865 0.0101  36  ASP C OD1   
2719 O OD2   . ASP C 36  ? 2.0072 2.4475 2.7230 0.2409  -0.3762 0.0649  36  ASP C OD2   
2720 N N     . TRP C 37  ? 1.9726 2.2162 2.6101 0.2064  -0.2474 -0.1257 37  TRP C N     
2721 C CA    . TRP C 37  ? 1.8287 2.1123 2.3631 0.1944  -0.1980 -0.1896 37  TRP C CA    
2722 C C     . TRP C 37  ? 1.9227 2.2757 2.4903 0.2036  -0.2000 -0.2336 37  TRP C C     
2723 O O     . TRP C 37  ? 2.1279 2.4411 2.7056 0.2080  -0.1643 -0.3227 37  TRP C O     
2724 C CB    . TRP C 37  ? 1.4076 1.5873 1.8838 0.1945  -0.1490 -0.2689 37  TRP C CB    
2725 C CG    . TRP C 37  ? 1.3993 1.5267 1.8523 0.1892  -0.1542 -0.2372 37  TRP C CG    
2726 C CD1   . TRP C 37  ? 1.4348 1.6107 1.8947 0.1749  -0.1781 -0.1576 37  TRP C CD1   
2727 C CD2   . TRP C 37  ? 1.5229 1.5422 1.9452 0.1975  -0.1355 -0.2899 37  TRP C CD2   
2728 N NE1   . TRP C 37  ? 1.5725 1.6912 2.0242 0.1725  -0.1758 -0.1629 37  TRP C NE1   
2729 C CE2   . TRP C 37  ? 1.5024 1.5266 1.9276 0.1891  -0.1552 -0.2420 37  TRP C CE2   
2730 C CE3   . TRP C 37  ? 1.9299 1.8455 2.3174 0.2106  -0.1027 -0.3756 37  TRP C CE3   
2731 C CZ2   . TRP C 37  ? 1.4075 1.3505 1.8082 0.1972  -0.1528 -0.2786 37  TRP C CZ2   
2732 C CZ3   . TRP C 37  ? 1.6969 1.5154 2.0406 0.2195  -0.0984 -0.4058 37  TRP C CZ3   
2733 C CH2   . TRP C 37  ? 1.4489 1.2885 1.8027 0.2148  -0.1281 -0.3580 37  TRP C CH2   
2734 N N     . THR C 38  ? 1.7401 2.1971 2.3226 0.2058  -0.2408 -0.1746 38  THR C N     
2735 C CA    . THR C 38  ? 1.9238 2.4741 2.5459 0.2161  -0.2546 -0.2146 38  THR C CA    
2736 C C     . THR C 38  ? 2.1890 2.8368 2.7058 0.1891  -0.2226 -0.2383 38  THR C C     
2737 O O     . THR C 38  ? 2.4334 3.1057 2.9310 0.1778  -0.1763 -0.3320 38  THR C O     
2738 C CB    . THR C 38  ? 2.1435 2.7423 2.8585 0.2472  -0.3333 -0.1366 38  THR C CB    
2739 O OG1   . THR C 38  ? 2.0396 2.5399 2.8571 0.2716  -0.3542 -0.1228 38  THR C OG1   
2740 C CG2   . THR C 38  ? 2.3803 3.0947 3.1475 0.2638  -0.3582 -0.1835 38  THR C CG2   
2741 N N     . LYS C 39  ? 2.2117 2.9089 2.6567 0.1742  -0.2389 -0.1589 39  LYS C N     
2742 C CA    . LYS C 39  ? 2.3219 3.1119 2.6631 0.1455  -0.2095 -0.1731 39  LYS C CA    
2743 C C     . LYS C 39  ? 2.3430 3.0786 2.5749 0.1192  -0.1442 -0.1829 39  LYS C C     
2744 O O     . LYS C 39  ? 2.3647 3.0557 2.5827 0.1163  -0.1532 -0.1160 39  LYS C O     
2745 C CB    . LYS C 39  ? 2.6448 3.5229 2.9658 0.1460  -0.2676 -0.0802 39  LYS C CB    
2746 C CG    . LYS C 39  ? 2.9574 3.9210 3.1562 0.1096  -0.2342 -0.0838 39  LYS C CG    
2747 C CD    . LYS C 39  ? 3.0661 4.0886 3.2225 0.1083  -0.2887 0.0190  39  LYS C CD    
2748 C CE    . LYS C 39  ? 2.9542 4.0487 2.9793 0.0660  -0.2476 0.0172  39  LYS C CE    
2749 N NZ    . LYS C 39  ? 2.8257 4.0174 2.8363 0.0534  -0.2282 -0.0768 39  LYS C NZ    
2750 N N     . ASN C 40  ? 2.1807 2.9192 2.3382 0.1011  -0.0761 -0.2693 40  ASN C N     
2751 C CA    . ASN C 40  ? 1.8122 2.4967 1.8573 0.0845  -0.0101 -0.2873 40  ASN C CA    
2752 C C     . ASN C 40  ? 1.6448 2.2091 1.7116 0.1049  -0.0101 -0.2797 40  ASN C C     
2753 O O     . ASN C 40  ? 1.4400 1.9881 1.4930 0.1030  -0.0220 -0.2188 40  ASN C O     
2754 C CB    . ASN C 40  ? 1.5672 2.3228 1.5350 0.0595  -0.0083 -0.2186 40  ASN C CB    
2755 C CG    . ASN C 40  ? 2.0828 2.8124 1.9289 0.0416  0.0712  -0.2586 40  ASN C CG    
2756 O OD1   . ASN C 40  ? 1.6143 2.2462 1.4314 0.0572  0.1098  -0.3027 40  ASN C OD1   
2757 N ND2   . ASN C 40  ? 2.5465 3.3576 2.3133 0.0113  0.0961  -0.2434 40  ASN C ND2   
2758 N N     . TRP C 41  ? 1.9983 1.8751 2.3604 0.0100  -0.3311 0.4257  41  TRP C N     
2759 C CA    . TRP C 41  ? 1.7423 1.5922 2.1222 0.0482  -0.2813 0.3843  41  TRP C CA    
2760 C C     . TRP C 41  ? 1.6397 1.5117 1.9281 0.0185  -0.2123 0.3429  41  TRP C C     
2761 O O     . TRP C 41  ? 1.6491 1.4808 1.8994 0.0184  -0.1852 0.3194  41  TRP C O     
2762 C CB    . TRP C 41  ? 1.6543 1.5593 2.1819 0.1231  -0.2548 0.3522  41  TRP C CB    
2763 C CG    . TRP C 41  ? 1.7295 1.7351 2.2923 0.1294  -0.2048 0.3196  41  TRP C CG    
2764 C CD1   . TRP C 41  ? 1.9097 1.9879 2.5381 0.1288  -0.2257 0.3329  41  TRP C CD1   
2765 C CD2   . TRP C 41  ? 1.6472 1.6837 2.1724 0.1334  -0.1282 0.2692  41  TRP C CD2   
2766 N NE1   . TRP C 41  ? 1.6422 1.7853 2.2673 0.1282  -0.1616 0.2927  41  TRP C NE1   
2767 C CE2   . TRP C 41  ? 1.5715 1.6851 2.1313 0.1339  -0.1039 0.2554  41  TRP C CE2   
2768 C CE3   . TRP C 41  ? 1.8149 1.8200 2.2764 0.1341  -0.0821 0.2357  41  TRP C CE3   
2769 C CZ2   . TRP C 41  ? 1.4028 1.5454 1.9247 0.1373  -0.0366 0.2124  41  TRP C CZ2   
2770 C CZ3   . TRP C 41  ? 1.4031 1.4497 1.8378 0.1412  -0.0210 0.1942  41  TRP C CZ3   
2771 C CH2   . TRP C 41  ? 1.3684 1.4748 1.8282 0.1440  0.0006  0.1844  41  TRP C CH2   
2772 N N     . GLU C 42  ? 1.6455 1.5802 1.8986 -0.0064 -0.1854 0.3326  42  GLU C N     
2773 C CA    . GLU C 42  ? 1.4663 1.4251 1.6432 -0.0250 -0.1249 0.2934  42  GLU C CA    
2774 C C     . GLU C 42  ? 1.4822 1.3912 1.5499 -0.0844 -0.1318 0.3014  42  GLU C C     
2775 O O     . GLU C 42  ? 1.4584 1.3660 1.4944 -0.0855 -0.0954 0.2684  42  GLU C O     
2776 C CB    . GLU C 42  ? 1.4847 1.5024 1.6411 -0.0388 -0.0997 0.2850  42  GLU C CB    
2777 C CG    . GLU C 42  ? 1.5780 1.6483 1.8295 0.0069  -0.0843 0.2713  42  GLU C CG    
2778 C CD    . GLU C 42  ? 2.1094 2.2208 2.3226 -0.0173 -0.0615 0.2660  42  GLU C CD    
2779 O OE1   . GLU C 42  ? 2.2505 2.3488 2.3650 -0.0596 -0.0479 0.2652  42  GLU C OE1   
2780 O OE2   . GLU C 42  ? 2.2329 2.3878 2.5137 0.0028  -0.0536 0.2592  42  GLU C OE2   
2781 N N     . ARG C 43  ? 1.8921 1.7618 1.8981 -0.1405 -0.1787 0.3436  43  ARG C N     
2782 C CA    . ARG C 43  ? 1.9049 1.7195 1.7974 -0.2098 -0.1838 0.3510  43  ARG C CA    
2783 C C     . ARG C 43  ? 1.8567 1.5998 1.7453 -0.2037 -0.1973 0.3520  43  ARG C C     
2784 O O     . ARG C 43  ? 1.8566 1.5909 1.6830 -0.2374 -0.1642 0.3239  43  ARG C O     
2785 C CB    . ARG C 43  ? 2.0845 1.8540 1.9033 -0.2751 -0.2382 0.4011  43  ARG C CB    
2786 C CG    . ARG C 43  ? 2.5774 2.2843 2.2614 -0.3625 -0.2390 0.4074  43  ARG C CG    
2787 C CD    . ARG C 43  ? 2.5837 2.2399 2.1816 -0.4328 -0.2934 0.4579  43  ARG C CD    
2788 N NE    . ARG C 43  ? 2.6935 2.4195 2.2957 -0.4401 -0.2717 0.4491  43  ARG C NE    
2789 C CZ    . ARG C 43  ? 3.0897 2.7898 2.6193 -0.5024 -0.3103 0.4859  43  ARG C CZ    
2790 N NH1   . ARG C 43  ? 3.1054 2.7100 2.5500 -0.5618 -0.3780 0.5375  43  ARG C NH1   
2791 N NH2   . ARG C 43  ? 3.3398 3.0995 2.8701 -0.5096 -0.2827 0.4719  43  ARG C NH2   
2792 N N     . SER C 44  ? 1.7394 1.4315 1.6966 -0.1615 -0.2450 0.3817  44  SER C N     
2793 C CA    . SER C 44  ? 1.7904 1.3930 1.7367 -0.1545 -0.2589 0.3844  44  SER C CA    
2794 C C     . SER C 44  ? 1.7753 1.4161 1.7536 -0.1205 -0.1945 0.3271  44  SER C C     
2795 O O     . SER C 44  ? 1.9591 1.5509 1.8747 -0.1521 -0.1790 0.3107  44  SER C O     
2796 C CB    . SER C 44  ? 2.0762 1.6219 2.1096 -0.1004 -0.3202 0.4228  44  SER C CB    
2797 O OG    . SER C 44  ? 2.5048 2.0265 2.5157 -0.1287 -0.3892 0.4786  44  SER C OG    
2798 N N     . VAL C 45  ? 1.6117 1.3370 1.6778 -0.0632 -0.1573 0.2960  45  VAL C N     
2799 C CA    . VAL C 45  ? 1.4977 1.2593 1.5854 -0.0330 -0.1001 0.2435  45  VAL C CA    
2800 C C     . VAL C 45  ? 1.7288 1.5315 1.7321 -0.0816 -0.0634 0.2138  45  VAL C C     
2801 O O     . VAL C 45  ? 1.6595 1.4501 1.6333 -0.0947 -0.0405 0.1852  45  VAL C O     
2802 C CB    . VAL C 45  ? 1.5655 1.4007 1.7440 0.0274  -0.0697 0.2197  45  VAL C CB    
2803 C CG1   . VAL C 45  ? 1.3413 1.2227 1.5045 0.0409  -0.0132 0.1694  45  VAL C CG1   
2804 C CG2   . VAL C 45  ? 1.9662 1.7693 2.2480 0.0827  -0.0873 0.2267  45  VAL C CG2   
2805 N N     . ALA C 46  ? 1.6752 1.5318 1.6437 -0.1089 -0.0556 0.2166  46  ALA C N     
2806 C CA    . ALA C 46  ? 1.5123 1.4201 1.4184 -0.1483 -0.0185 0.1835  46  ALA C CA    
2807 C C     . ALA C 46  ? 1.6158 1.4698 1.4428 -0.2174 -0.0290 0.1874  46  ALA C C     
2808 O O     . ALA C 46  ? 1.8269 1.7155 1.6317 -0.2368 0.0028  0.1489  46  ALA C O     
2809 C CB    . ALA C 46  ? 1.5109 1.4674 1.3897 -0.1676 -0.0081 0.1870  46  ALA C CB    
2810 N N     . ARG C 47  ? 1.6200 1.3874 1.3995 -0.2590 -0.0760 0.2340  47  ARG C N     
2811 C CA    . ARG C 47  ? 1.7977 1.4908 1.4816 -0.3343 -0.0874 0.2412  47  ARG C CA    
2812 C C     . ARG C 47  ? 1.9072 1.5550 1.6022 -0.3192 -0.0793 0.2217  47  ARG C C     
2813 O O     . ARG C 47  ? 2.0957 1.7533 1.7361 -0.3698 -0.0508 0.1896  47  ARG C O     
2814 C CB    . ARG C 47  ? 2.1136 1.6995 1.7367 -0.3750 -0.1502 0.3028  47  ARG C CB    
2815 C CG    . ARG C 47  ? 2.3972 2.0069 1.9616 -0.4273 -0.1568 0.3206  47  ARG C CG    
2816 C CD    . ARG C 47  ? 2.4065 1.8968 1.8934 -0.4758 -0.2287 0.3857  47  ARG C CD    
2817 N NE    . ARG C 47  ? 2.8024 2.1825 2.1774 -0.5473 -0.2423 0.3960  47  ARG C NE    
2818 C CZ    . ARG C 47  ? 3.2396 2.5124 2.6146 -0.5260 -0.2800 0.4199  47  ARG C CZ    
2819 N NH1   . ARG C 47  ? 3.2368 2.5085 2.7312 -0.4311 -0.3055 0.4325  47  ARG C NH1   
2820 N NH2   . ARG C 47  ? 3.2553 2.4173 2.5076 -0.6025 -0.2880 0.4277  47  ARG C NH2   
2821 N N     . ASP C 48  ? 2.1474 1.7479 1.9145 -0.2531 -0.1009 0.2367  48  ASP C N     
2822 C CA    . ASP C 48  ? 2.1836 1.7212 1.9525 -0.2412 -0.0919 0.2184  48  ASP C CA    
2823 C C     . ASP C 48  ? 1.9621 1.5930 1.7531 -0.2293 -0.0357 0.1589  48  ASP C C     
2824 O O     . ASP C 48  ? 2.3398 1.9365 2.0903 -0.2591 -0.0194 0.1342  48  ASP C O     
2825 C CB    . ASP C 48  ? 2.4667 1.9414 2.3214 -0.1667 -0.1200 0.2404  48  ASP C CB    
2826 C CG    . ASP C 48  ? 2.7822 2.1443 2.6117 -0.1773 -0.1882 0.3017  48  ASP C CG    
2827 O OD1   . ASP C 48  ? 2.9854 2.2669 2.7003 -0.2521 -0.2117 0.3250  48  ASP C OD1   
2828 O OD2   . ASP C 48  ? 2.8487 2.2042 2.7719 -0.1133 -0.2198 0.3259  48  ASP C OD2   
2829 N N     . LEU C 49  ? 1.7761 1.5187 1.6232 -0.1890 -0.0090 0.1364  49  LEU C N     
2830 C CA    . LEU C 49  ? 1.6912 1.5171 1.5571 -0.1721 0.0338  0.0849  49  LEU C CA    
2831 C C     . LEU C 49  ? 1.8743 1.7780 1.6891 -0.2304 0.0563  0.0553  49  LEU C C     
2832 O O     . LEU C 49  ? 2.0702 2.0220 1.8811 -0.2409 0.0802  0.0150  49  LEU C O     
2833 C CB    . LEU C 49  ? 1.6972 1.5937 1.6342 -0.1027 0.0511  0.0731  49  LEU C CB    
2834 C CG    . LEU C 49  ? 1.8464 1.6936 1.8508 -0.0427 0.0454  0.0828  49  LEU C CG    
2835 C CD1   . LEU C 49  ? 1.9431 1.8617 1.9933 0.0089  0.0729  0.0611  49  LEU C CD1   
2836 C CD2   . LEU C 49  ? 1.7317 1.5091 1.7303 -0.0423 0.0533  0.0647  49  LEU C CD2   
2837 N N     . THR C 50  ? 2.0501 1.9725 1.8286 -0.2710 0.0507  0.0709  50  THR C N     
2838 C CA    . THR C 50  ? 1.9745 1.9751 1.7130 -0.3299 0.0784  0.0368  50  THR C CA    
2839 C C     . THR C 50  ? 1.9363 1.8681 1.5867 -0.4213 0.0723  0.0408  50  THR C C     
2840 O O     . THR C 50  ? 1.9598 1.9586 1.5760 -0.4827 0.1000  0.0076  50  THR C O     
2841 C CB    . THR C 50  ? 2.0682 2.1246 1.8046 -0.3339 0.0878  0.0411  50  THR C CB    
2842 O OG1   . THR C 50  ? 2.4847 2.4495 2.1775 -0.3608 0.0529  0.0928  50  THR C OG1   
2843 C CG2   . THR C 50  ? 1.7860 1.9110 1.5937 -0.2515 0.1012  0.0288  50  THR C CG2   
2844 N N     . ARG C 51  ? 1.8856 1.6829 1.4982 -0.4321 0.0382  0.0785  51  ARG C N     
2845 C CA    . ARG C 51  ? 1.9480 1.6506 1.4555 -0.5231 0.0291  0.0872  51  ARG C CA    
2846 C C     . ARG C 51  ? 1.9802 1.7495 1.4704 -0.5703 0.0688  0.0307  51  ARG C C     
2847 O O     . ARG C 51  ? 1.9364 1.7382 1.3629 -0.6567 0.0910  0.0073  51  ARG C O     
2848 C CB    . ARG C 51  ? 2.2500 1.7896 1.7321 -0.5060 -0.0155 0.1334  51  ARG C CB    
2849 C CG    . ARG C 51  ? 2.2246 1.6288 1.5769 -0.5995 -0.0331 0.1526  51  ARG C CG    
2850 C CD    . ARG C 51  ? 2.3375 1.5698 1.6722 -0.5665 -0.0873 0.2065  51  ARG C CD    
2851 N NE    . ARG C 51  ? 2.5751 1.7954 1.9606 -0.5125 -0.1328 0.2562  51  ARG C NE    
2852 C CZ    . ARG C 51  ? 2.9992 2.1585 2.3074 -0.5629 -0.1731 0.3021  51  ARG C CZ    
2853 N NH1   . ARG C 51  ? 3.0478 2.2096 2.4119 -0.5123 -0.2168 0.3448  51  ARG C NH1   
2854 N NH2   . ARG C 51  ? 3.2938 2.3905 2.4629 -0.6712 -0.1690 0.3036  51  ARG C NH2   
2855 N N     . TYR C 52  ? 2.1104 1.9037 1.6554 -0.5202 0.0793  0.0056  52  TYR C N     
2856 C CA    . TYR C 52  ? 2.2006 2.0773 1.7450 -0.5553 0.1121  -0.0500 52  TYR C CA    
2857 C C     . TYR C 52  ? 2.1023 2.1266 1.7466 -0.4804 0.1296  -0.0824 52  TYR C C     
2858 O O     . TYR C 52  ? 2.1499 2.1545 1.8465 -0.4028 0.1204  -0.0716 52  TYR C O     
2859 C CB    . TYR C 52  ? 2.2045 1.9709 1.7108 -0.5663 0.1071  -0.0522 52  TYR C CB    
2860 C CG    . TYR C 52  ? 2.4310 2.0115 1.8389 -0.6156 0.0789  -0.0081 52  TYR C CG    
2861 C CD1   . TYR C 52  ? 2.5609 2.0903 1.8572 -0.7256 0.0869  -0.0156 52  TYR C CD1   
2862 C CD2   . TYR C 52  ? 2.7241 2.1785 2.1505 -0.5525 0.0426  0.0405  52  TYR C CD2   
2863 C CE1   . TYR C 52  ? 2.7539 2.0918 1.9424 -0.7716 0.0554  0.0295  52  TYR C CE1   
2864 C CE2   . TYR C 52  ? 2.9246 2.2010 2.2629 -0.5885 0.0075  0.0848  52  TYR C CE2   
2865 C CZ    . TYR C 52  ? 2.9233 2.1324 2.1343 -0.6982 0.0118  0.0819  52  TYR C CZ    
2866 O OH    . TYR C 52  ? 3.0964 2.1077 2.2020 -0.7353 -0.0285 0.1306  52  TYR C OH    
2867 N N     . ASN C 53  ? 1.9745 2.1414 1.6433 -0.5040 0.1548  -0.1229 53  ASN C N     
2868 C CA    . ASN C 53  ? 1.5145 1.8159 1.2701 -0.4319 0.1655  -0.1497 53  ASN C CA    
2869 C C     . ASN C 53  ? 1.4888 1.8180 1.2776 -0.3917 0.1638  -0.1738 53  ASN C C     
2870 O O     . ASN C 53  ? 1.5357 1.9390 1.3223 -0.4341 0.1751  -0.2152 53  ASN C O     
2871 C CB    . ASN C 53  ? 1.9408 2.3864 1.7193 -0.4701 0.1927  -0.1937 53  ASN C CB    
2872 C CG    . ASN C 53  ? 1.7837 2.1990 1.5152 -0.5224 0.2021  -0.1762 53  ASN C CG    
2873 O OD1   . ASN C 53  ? 2.1872 2.4776 1.8702 -0.5245 0.1799  -0.1255 53  ASN C OD1   
2874 N ND2   . ASN C 53  ? 1.7864 2.3188 1.5326 -0.5681 0.2346  -0.2205 53  ASN C ND2   
2875 N N     . PRO C 54  ? 1.4519 1.7278 1.2684 -0.3171 0.1515  -0.1522 54  PRO C N     
2876 C CA    . PRO C 54  ? 1.4546 1.7263 1.2797 -0.2911 0.1520  -0.1728 54  PRO C CA    
2877 C C     . PRO C 54  ? 1.3758 1.7749 1.2524 -0.2397 0.1532  -0.2027 54  PRO C C     
2878 O O     . PRO C 54  ? 1.4412 1.9168 1.3554 -0.2050 0.1538  -0.2031 54  PRO C O     
2879 C CB    . PRO C 54  ? 1.4648 1.6116 1.2942 -0.2394 0.1429  -0.1363 54  PRO C CB    
2880 C CG    . PRO C 54  ? 1.5580 1.7183 1.4177 -0.2022 0.1358  -0.1062 54  PRO C CG    
2881 C CD    . PRO C 54  ? 1.9441 2.1619 1.7819 -0.2600 0.1396  -0.1108 54  PRO C CD    
2882 N N     . ASP C 55  ? 1.3952 1.8039 1.2643 -0.2357 0.1516  -0.2269 55  ASP C N     
2883 C CA    . ASP C 55  ? 1.5358 2.0368 1.4375 -0.1835 0.1426  -0.2484 55  ASP C CA    
2884 C C     . ASP C 55  ? 1.3400 1.7572 1.2319 -0.1235 0.1415  -0.2315 55  ASP C C     
2885 O O     . ASP C 55  ? 1.4457 1.9076 1.3551 -0.0674 0.1328  -0.2330 55  ASP C O     
2886 C CB    . ASP C 55  ? 1.7679 2.3540 1.6614 -0.2292 0.1372  -0.2909 55  ASP C CB    
2887 C CG    . ASP C 55  ? 1.4437 2.1539 1.3660 -0.2832 0.1419  -0.3192 55  ASP C CG    
2888 O OD1   . ASP C 55  ? 1.4653 2.2546 1.4370 -0.2523 0.1430  -0.3194 55  ASP C OD1   
2889 O OD2   . ASP C 55  ? 1.5525 2.2768 1.4450 -0.3607 0.1493  -0.3444 55  ASP C OD2   
2890 N N     . VAL C 56  ? 1.4912 1.7842 1.3529 -0.1359 0.1520  -0.2182 56  VAL C N     
2891 C CA    . VAL C 56  ? 1.9676 2.1769 1.8270 -0.0860 0.1610  -0.2069 56  VAL C CA    
2892 C C     . VAL C 56  ? 1.9558 2.0506 1.8245 -0.0841 0.1685  -0.1763 56  VAL C C     
2893 O O     . VAL C 56  ? 1.6383 1.6817 1.4863 -0.1313 0.1659  -0.1690 56  VAL C O     
2894 C CB    . VAL C 56  ? 1.6328 1.8141 1.4501 -0.0988 0.1690  -0.2367 56  VAL C CB    
2895 C CG1   . VAL C 56  ? 1.6669 1.9575 1.4777 -0.0847 0.1503  -0.2593 56  VAL C CG1   
2896 C CG2   . VAL C 56  ? 1.6697 1.8053 1.4480 -0.1678 0.1760  -0.2529 56  VAL C CG2   
2897 N N     . VAL C 57  ? 1.7919 1.8475 1.6910 -0.0303 0.1750  -0.1578 57  VAL C N     
2898 C CA    . VAL C 57  ? 1.4318 1.3900 1.3591 -0.0156 0.1780  -0.1311 57  VAL C CA    
2899 C C     . VAL C 57  ? 1.7395 1.6375 1.6786 0.0195  0.2034  -0.1470 57  VAL C C     
2900 O O     . VAL C 57  ? 1.8035 1.7361 1.7442 0.0521  0.2150  -0.1573 57  VAL C O     
2901 C CB    . VAL C 57  ? 1.3609 1.3409 1.3272 0.0092  0.1638  -0.0959 57  VAL C CB    
2902 C CG1   . VAL C 57  ? 1.3929 1.2844 1.4004 0.0289  0.1585  -0.0683 57  VAL C CG1   
2903 C CG2   . VAL C 57  ? 1.7644 1.7967 1.7102 -0.0338 0.1465  -0.0856 57  VAL C CG2   
2904 N N     . ILE C 58  ? 1.7874 1.5874 1.7286 0.0108  0.2147  -0.1511 58  ILE C N     
2905 C CA    . ILE C 58  ? 1.6551 1.3913 1.6088 0.0372  0.2484  -0.1754 58  ILE C CA    
2906 C C     . ILE C 58  ? 1.8416 1.5249 1.8756 0.0806  0.2507  -0.1533 58  ILE C C     
2907 O O     . ILE C 58  ? 1.7278 1.3549 1.7836 0.0757  0.2282  -0.1271 58  ILE C O     
2908 C CB    . ILE C 58  ? 1.7801 1.4411 1.6790 -0.0027 0.2665  -0.2061 58  ILE C CB    
2909 C CG1   . ILE C 58  ? 2.0627 1.7954 1.8915 -0.0525 0.2554  -0.2264 58  ILE C CG1   
2910 C CG2   . ILE C 58  ? 1.8404 1.4383 1.7440 0.0197  0.3102  -0.2396 58  ILE C CG2   
2911 C CD1   . ILE C 58  ? 2.4445 2.2563 2.2538 -0.0347 0.2589  -0.2441 58  ILE C CD1   
2912 N N     . LEU C 59  ? 2.1475 1.8489 2.2233 0.1202  0.2755  -0.1641 59  LEU C N     
2913 C CA    . LEU C 59  ? 2.1360 1.8109 2.3053 0.1634  0.2820  -0.1521 59  LEU C CA    
2914 C C     . LEU C 59  ? 2.1363 1.7661 2.3288 0.1832  0.3349  -0.1958 59  LEU C C     
2915 O O     . LEU C 59  ? 2.0285 1.6607 2.1539 0.1645  0.3653  -0.2301 59  LEU C O     
2916 C CB    . LEU C 59  ? 1.8650 1.6178 2.0720 0.1856  0.2677  -0.1267 59  LEU C CB    
2917 C CG    . LEU C 59  ? 1.8136 1.6207 1.9862 0.1627  0.2266  -0.0920 59  LEU C CG    
2918 C CD1   . LEU C 59  ? 1.7227 1.5933 1.9201 0.1829  0.2228  -0.0750 59  LEU C CD1   
2919 C CD2   . LEU C 59  ? 1.8834 1.6440 2.0711 0.1464  0.1888  -0.0584 59  LEU C CD2   
2920 N N     . GLU C 60  ? 2.0898 1.6793 2.3790 0.2204  0.3451  -0.1959 60  GLU C N     
2921 C CA    . GLU C 60  ? 2.1626 1.7160 2.4951 0.2422  0.4033  -0.2431 60  GLU C CA    
2922 C C     . GLU C 60  ? 2.0067 1.6322 2.4129 0.2715  0.4222  -0.2467 60  GLU C C     
2923 O O     . GLU C 60  ? 2.0756 1.7441 2.5661 0.2979  0.3888  -0.2122 60  GLU C O     
2924 C CB    . GLU C 60  ? 2.5236 1.9853 2.9273 0.2689  0.4096  -0.2513 60  GLU C CB    
2925 C CG    . GLU C 60  ? 2.7506 2.2135 3.2502 0.3050  0.3552  -0.2024 60  GLU C CG    
2926 C CD    . GLU C 60  ? 3.1430 2.5025 3.7132 0.3410  0.3584  -0.2111 60  GLU C CD    
2927 O OE1   . GLU C 60  ? 3.2384 2.5120 3.7601 0.3267  0.4010  -0.2522 60  GLU C OE1   
2928 O OE2   . GLU C 60  ? 3.2315 2.5910 3.9035 0.3840  0.3163  -0.1769 60  GLU C OE2   
2929 N N     . LYS C 61  ? 1.3939 2.3243 3.0959 0.5581  0.4176  -0.2379 61  LYS C N     
2930 C CA    . LYS C 61  ? 1.2686 2.1941 2.9963 0.5628  0.4317  -0.2130 61  LYS C CA    
2931 C C     . LYS C 61  ? 1.2602 2.1574 3.0241 0.5454  0.4396  -0.2100 61  LYS C C     
2932 O O     . LYS C 61  ? 1.2880 2.2057 3.0462 0.5545  0.4429  -0.2225 61  LYS C O     
2933 C CB    . LYS C 61  ? 1.3148 2.3094 3.0183 0.6082  0.4460  -0.2012 61  LYS C CB    
2934 C CG    . LYS C 61  ? 1.2886 2.2787 3.0195 0.6123  0.4607  -0.1766 61  LYS C CG    
2935 C CD    . LYS C 61  ? 1.3358 2.3946 3.0440 0.6549  0.4720  -0.1720 61  LYS C CD    
2936 C CE    . LYS C 61  ? 1.6849 2.7718 3.3571 0.6729  0.4625  -0.1774 61  LYS C CE    
2937 N NZ    . LYS C 61  ? 1.8831 2.9263 3.5692 0.6551  0.4584  -0.1621 61  LYS C NZ    
2938 N N     . GLN C 62  ? 1.5605 2.4103 3.3614 0.5210  0.4433  -0.1921 62  GLN C N     
2939 C CA    . GLN C 62  ? 1.8776 2.6978 3.7162 0.5027  0.4514  -0.1852 62  GLN C CA    
2940 C C     . GLN C 62  ? 2.0383 2.8747 3.8965 0.5185  0.4717  -0.1557 62  GLN C C     
2941 O O     . GLN C 62  ? 1.7353 2.5839 3.5867 0.5315  0.4768  -0.1393 62  GLN C O     
2942 C CB    . GLN C 62  ? 1.8536 2.5975 3.7240 0.4552  0.4387  -0.1883 62  GLN C CB    
2943 C CG    . GLN C 62  ? 1.4674 2.1867 3.3227 0.4331  0.4164  -0.2182 62  GLN C CG    
2944 C CD    . GLN C 62  ? 1.9530 2.6757 3.8061 0.4285  0.4116  -0.2427 62  GLN C CD    
2945 O OE1   . GLN C 62  ? 2.0185 2.7545 3.8857 0.4381  0.4244  -0.2365 62  GLN C OE1   
2946 N NE2   . GLN C 62  ? 1.9163 2.6273 3.7516 0.4138  0.3928  -0.2709 62  GLN C NE2   
2947 N N     . GLY C 63  ? 1.1646 2.0019 3.0477 0.5176  0.4835  -0.1492 63  GLY C N     
2948 C CA    . GLY C 63  ? 1.7621 2.6068 3.6706 0.5258  0.5026  -0.1201 63  GLY C CA    
2949 C C     . GLY C 63  ? 2.0388 2.8179 3.9837 0.4908  0.5025  -0.0987 63  GLY C C     
2950 O O     . GLY C 63  ? 1.9813 2.7065 3.9396 0.4569  0.4885  -0.1086 63  GLY C O     
2951 N N     . PHE C 64  ? 2.1276 2.9099 4.0899 0.4981  0.5185  -0.0687 64  PHE C N     
2952 C CA    . PHE C 64  ? 2.1034 2.8245 4.0995 0.4669  0.5205  -0.0443 64  PHE C CA    
2953 C C     . PHE C 64  ? 1.8607 2.5495 3.8960 0.4435  0.5258  -0.0372 64  PHE C C     
2954 O O     . PHE C 64  ? 1.3963 2.0824 3.4600 0.4432  0.5423  -0.0101 64  PHE C O     
2955 C CB    . PHE C 64  ? 2.2011 2.9343 4.2002 0.4825  0.5356  -0.0138 64  PHE C CB    
2956 C CG    . PHE C 64  ? 1.8364 2.6260 3.8359 0.5143  0.5551  -0.0017 64  PHE C CG    
2957 C CD1   . PHE C 64  ? 1.6916 2.5451 3.6557 0.5505  0.5562  -0.0173 64  PHE C CD1   
2958 C CD2   . PHE C 64  ? 1.7831 2.5628 3.8186 0.5078  0.5724  0.0260  64  PHE C CD2   
2959 C CE1   . PHE C 64  ? 1.6473 2.5520 3.6129 0.5782  0.5737  -0.0078 64  PHE C CE1   
2960 C CE2   . PHE C 64  ? 2.1281 2.9608 4.1648 0.5361  0.5904  0.0371  64  PHE C CE2   
2961 C CZ    . PHE C 64  ? 2.1366 3.0308 4.1387 0.5708  0.5909  0.0195  64  PHE C CZ    
2962 N N     . LYS C 65  ? 2.6750 3.3393 4.7109 0.4234  0.5109  -0.0628 65  LYS C N     
2963 C CA    . LYS C 65  ? 2.9904 3.6238 5.0595 0.4007  0.5123  -0.0629 65  LYS C CA    
2964 C C     . LYS C 65  ? 2.7758 3.3440 4.8575 0.3597  0.4928  -0.0801 65  LYS C C     
2965 O O     . LYS C 65  ? 3.1347 3.6693 5.2461 0.3369  0.4924  -0.0803 65  LYS C O     
2966 C CB    . LYS C 65  ? 3.2318 3.9147 5.2883 0.4244  0.5165  -0.0808 65  LYS C CB    
2967 C CG    . LYS C 65  ? 3.2277 3.9240 5.2490 0.4292  0.4992  -0.1167 65  LYS C CG    
2968 C CD    . LYS C 65  ? 3.2153 3.9721 5.2155 0.4623  0.5060  -0.1312 65  LYS C CD    
2969 C CE    . LYS C 65  ? 3.2304 4.0520 5.2004 0.5029  0.5161  -0.1255 65  LYS C CE    
2970 N NZ    . LYS C 65  ? 3.2443 4.1222 5.1853 0.5340  0.5180  -0.1461 65  LYS C NZ    
2971 N N     . SER C 66  ? 1.5274 2.0781 3.5881 0.3499  0.4765  -0.0950 66  SER C N     
2972 C CA    . SER C 66  ? 1.4080 1.9051 3.4749 0.3133  0.4556  -0.1186 66  SER C CA    
2973 C C     . SER C 66  ? 1.8291 2.2948 3.8889 0.2983  0.4450  -0.1146 66  SER C C     
2974 O O     . SER C 66  ? 1.8539 2.3527 3.8911 0.3236  0.4508  -0.1028 66  SER C O     
2975 C CB    . SER C 66  ? 1.8172 2.3400 3.8554 0.3213  0.4423  -0.1549 66  SER C CB    
2976 O OG    . SER C 66  ? 1.6287 2.2049 3.6259 0.3542  0.4418  -0.1619 66  SER C OG    
2977 N N     . PRO C 67  ? 1.9905 2.3937 4.0689 0.2581  0.4294  -0.1246 67  PRO C N     
2978 C CA    . PRO C 67  ? 2.0759 2.4512 4.1449 0.2440  0.4174  -0.1244 67  PRO C CA    
2979 C C     . PRO C 67  ? 2.2228 2.6353 4.2481 0.2622  0.4039  -0.1497 67  PRO C C     
2980 O O     . PRO C 67  ? 2.5600 2.9614 4.5718 0.2580  0.3950  -0.1489 67  PRO C O     
2981 C CB    . PRO C 67  ? 2.0586 2.3609 4.1587 0.1957  0.4027  -0.1346 67  PRO C CB    
2982 C CG    . PRO C 67  ? 2.1905 2.4791 4.3228 0.1867  0.4130  -0.1272 67  PRO C CG    
2983 C CD    . PRO C 67  ? 2.0251 2.3793 4.1359 0.2239  0.4229  -0.1345 67  PRO C CD    
2984 N N     . ASN C 68  ? 2.0517 2.1552 2.8666 0.2070  0.2373  -0.0799 68  ASN C N     
2985 C CA    . ASN C 68  ? 2.2177 2.2994 2.9390 0.2118  0.2373  -0.0779 68  ASN C CA    
2986 C C     . ASN C 68  ? 2.0212 2.1179 2.7222 0.2060  0.2713  -0.0437 68  ASN C C     
2987 O O     . ASN C 68  ? 2.0695 2.1395 2.7045 0.2027  0.2644  -0.0388 68  ASN C O     
2988 C CB    . ASN C 68  ? 2.4371 2.5387 3.1267 0.2350  0.2429  -0.1003 68  ASN C CB    
2989 C CG    . ASN C 68  ? 2.2949 2.3737 3.0077 0.2428  0.2052  -0.1309 68  ASN C CG    
2990 O OD1   . ASN C 68  ? 2.1584 2.2196 2.9159 0.2328  0.1792  -0.1331 68  ASN C OD1   
2991 N ND2   . ASN C 68  ? 2.3889 2.4703 3.0762 0.2622  0.2005  -0.1559 68  ASN C ND2   
2992 N N     . SER C 69  ? 1.5750 1.7148 2.3362 0.2040  0.3071  -0.0171 69  SER C N     
2993 C CA    . SER C 69  ? 1.5915 1.7418 2.3442 0.1973  0.3371  0.0248  69  SER C CA    
2994 C C     . SER C 69  ? 1.7212 1.8233 2.4957 0.1769  0.3148  0.0326  69  SER C C     
2995 O O     . SER C 69  ? 1.7733 1.8576 2.5054 0.1747  0.3183  0.0518  69  SER C O     
2996 C CB    . SER C 69  ? 1.4499 1.6604 2.2700 0.1969  0.3812  0.0574  69  SER C CB    
2997 O OG    . SER C 69  ? 1.7451 1.9548 2.6647 0.1816  0.3743  0.0530  69  SER C OG    
2998 N N     . LYS C 70  ? 1.6331 1.7192 2.4769 0.1638  0.2901  0.0137  70  LYS C N     
2999 C CA    . LYS C 70  ? 1.4354 1.4844 2.3041 0.1464  0.2647  0.0090  70  LYS C CA    
3000 C C     . LYS C 70  ? 1.4170 1.4303 2.1960 0.1480  0.2329  -0.0133 70  LYS C C     
3001 O O     . LYS C 70  ? 1.8370 1.8280 2.6026 0.1396  0.2240  -0.0095 70  LYS C O     
3002 C CB    . LYS C 70  ? 1.7763 1.8274 2.7358 0.1347  0.2417  -0.0150 70  LYS C CB    
3003 C CG    . LYS C 70  ? 1.6102 1.6435 2.5380 0.1369  0.1960  -0.0555 70  LYS C CG    
3004 C CD    . LYS C 70  ? 1.7938 1.8438 2.8121 0.1307  0.1758  -0.0787 70  LYS C CD    
3005 C CE    . LYS C 70  ? 1.5775 1.6146 2.5564 0.1350  0.1292  -0.1109 70  LYS C CE    
3006 N NZ    . LYS C 70  ? 1.9744 2.0361 3.0365 0.1343  0.1078  -0.1343 70  LYS C NZ    
3007 N N     . ILE C 71  ? 1.3308 1.3398 2.0518 0.1586  0.2164  -0.0361 71  ILE C N     
3008 C CA    . ILE C 71  ? 1.0658 1.0445 1.7014 0.1577  0.1902  -0.0529 71  ILE C CA    
3009 C C     . ILE C 71  ? 1.5787 1.5590 2.1488 0.1651  0.2131  -0.0348 71  ILE C C     
3010 O O     . ILE C 71  ? 1.0716 1.0308 1.5953 0.1586  0.1986  -0.0400 71  ILE C O     
3011 C CB    . ILE C 71  ? 1.0687 1.0391 1.6705 0.1661  0.1675  -0.0764 71  ILE C CB    
3012 C CG1   . ILE C 71  ? 1.6544 1.6290 2.3244 0.1623  0.1438  -0.0911 71  ILE C CG1   
3013 C CG2   . ILE C 71  ? 1.0679 1.0079 1.5897 0.1599  0.1403  -0.0899 71  ILE C CG2   
3014 C CD1   . ILE C 71  ? 1.5072 1.4701 2.1556 0.1724  0.1180  -0.1090 71  ILE C CD1   
3015 N N     . ILE C 72  ? 1.7302 1.7434 2.2956 0.1799  0.2487  -0.0151 72  ILE C N     
3016 C CA    . ILE C 72  ? 1.1074 1.1332 1.6110 0.1903  0.2711  0.0039  72  ILE C CA    
3017 C C     . ILE C 72  ? 1.1097 1.1219 1.6348 0.1802  0.2757  0.0308  72  ILE C C     
3018 O O     . ILE C 72  ? 1.1616 1.1583 1.6312 0.1815  0.2676  0.0297  72  ILE C O     
3019 C CB    . ILE C 72  ? 1.6470 1.7269 2.1503 0.2087  0.3100  0.0213  72  ILE C CB    
3020 C CG1   . ILE C 72  ? 1.7042 1.7956 2.1739 0.2235  0.3013  -0.0152 72  ILE C CG1   
3021 C CG2   . ILE C 72  ? 1.1500 1.2545 1.6048 0.2192  0.3365  0.0526  72  ILE C CG2   
3022 C CD1   . ILE C 72  ? 1.4838 1.6403 1.9444 0.2452  0.3374  -0.0100 72  ILE C CD1   
3023 N N     . TYR C 73  ? 1.6600 1.6782 2.2735 0.1703  0.2881  0.0539  73  TYR C N     
3024 C CA    . TYR C 73  ? 1.1212 1.1221 1.7724 0.1612  0.2911  0.0800  73  TYR C CA    
3025 C C     . TYR C 73  ? 1.3884 1.3512 2.0414 0.1483  0.2509  0.0456  73  TYR C C     
3026 O O     . TYR C 73  ? 1.2794 1.2250 1.9243 0.1471  0.2451  0.0527  73  TYR C O     
3027 C CB    . TYR C 73  ? 1.1346 1.1507 1.8923 0.1513  0.3147  0.1133  73  TYR C CB    
3028 C CG    . TYR C 73  ? 1.3354 1.3991 2.0890 0.1627  0.3603  0.1596  73  TYR C CG    
3029 C CD1   . TYR C 73  ? 1.3571 1.4310 2.0737 0.1721  0.3821  0.2032  73  TYR C CD1   
3030 C CD2   . TYR C 73  ? 1.2271 1.3332 2.0121 0.1656  0.3808  0.1591  73  TYR C CD2   
3031 C CE1   . TYR C 73  ? 1.6952 1.8249 2.4022 0.1832  0.4243  0.2485  73  TYR C CE1   
3032 C CE2   . TYR C 73  ? 1.4279 1.5917 2.2067 0.1761  0.4242  0.1993  73  TYR C CE2   
3033 C CZ    . TYR C 73  ? 1.6181 1.7958 2.3553 0.1845  0.4463  0.2455  73  TYR C CZ    
3034 O OH    . TYR C 73  ? 1.3927 1.6395 2.1184 0.1955  0.4900  0.2887  73  TYR C OH    
3035 N N     . PHE C 74  ? 1.3532 1.3084 2.0149 0.1404  0.2221  0.0078  74  PHE C N     
3036 C CA    . PHE C 74  ? 1.2913 1.2253 1.9374 0.1295  0.1840  -0.0275 74  PHE C CA    
3037 C C     . PHE C 74  ? 1.3785 1.3034 1.9240 0.1355  0.1764  -0.0365 74  PHE C C     
3038 O O     . PHE C 74  ? 1.3826 1.2968 1.9164 0.1299  0.1595  -0.0504 74  PHE C O     
3039 C CB    . PHE C 74  ? 1.3008 1.2375 1.9620 0.1225  0.1554  -0.0596 74  PHE C CB    
3040 C CG    . PHE C 74  ? 1.6061 1.5356 2.2452 0.1111  0.1168  -0.0947 74  PHE C CG    
3041 C CD1   . PHE C 74  ? 1.2862 1.2210 1.9985 0.1001  0.0991  -0.1142 74  PHE C CD1   
3042 C CD2   . PHE C 74  ? 1.4652 1.3887 2.0148 0.1108  0.0987  -0.1098 74  PHE C CD2   
3043 C CE1   . PHE C 74  ? 1.1717 1.1145 1.8621 0.0910  0.0643  -0.1506 74  PHE C CE1   
3044 C CE2   . PHE C 74  ? 1.1084 1.0367 1.6350 0.0988  0.0659  -0.1389 74  PHE C CE2   
3045 C CZ    . PHE C 74  ? 1.0609 1.0032 1.6548 0.0899  0.0489  -0.1606 74  PHE C CZ    
3046 N N     . ILE C 75  ? 1.2872 1.2201 1.7653 0.1474  0.1880  -0.0336 75  ILE C N     
3047 C CA    . ILE C 75  ? 1.2284 1.1559 1.6160 0.1522  0.1816  -0.0453 75  ILE C CA    
3048 C C     . ILE C 75  ? 1.1242 1.0564 1.4980 0.1611  0.1995  -0.0221 75  ILE C C     
3049 O O     . ILE C 75  ? 1.0799 1.0039 1.4119 0.1591  0.1848  -0.0367 75  ILE C O     
3050 C CB    . ILE C 75  ? 1.2628 1.2005 1.5968 0.1646  0.1910  -0.0507 75  ILE C CB    
3051 C CG1   . ILE C 75  ? 1.2051 1.1323 1.5520 0.1580  0.1684  -0.0718 75  ILE C CG1   
3052 C CG2   . ILE C 75  ? 1.2965 1.2317 1.5461 0.1688  0.1860  -0.0645 75  ILE C CG2   
3053 C CD1   . ILE C 75  ? 1.4125 1.3252 1.7855 0.1399  0.1362  -0.0878 75  ILE C CD1   
3054 N N     . LYS C 76  ? 1.1025 1.0523 1.5113 0.1715  0.2315  0.0164  76  LYS C N     
3055 C CA    . LYS C 76  ? 1.5804 1.5360 1.9811 0.1819  0.2486  0.0487  76  LYS C CA    
3056 C C     . LYS C 76  ? 1.4288 1.3572 1.8789 0.1710  0.2277  0.0430  76  LYS C C     
3057 O O     . LYS C 76  ? 1.1238 1.0460 1.5367 0.1769  0.2184  0.0380  76  LYS C O     
3058 C CB    . LYS C 76  ? 1.1509 1.1350 1.5926 0.1912  0.2869  0.0986  76  LYS C CB    
3059 C CG    . LYS C 76  ? 1.4585 1.4859 1.8387 0.2097  0.3120  0.1051  76  LYS C CG    
3060 C CD    . LYS C 76  ? 1.6853 1.7536 2.1073 0.2172  0.3518  0.1575  76  LYS C CD    
3061 C CE    . LYS C 76  ? 1.6634 1.7901 2.0151 0.2406  0.3781  0.1647  76  LYS C CE    
3062 N NZ    . LYS C 76  ? 2.0604 2.2400 2.4478 0.2473  0.4194  0.2209  76  LYS C NZ    
3063 N N     . GLY C 77  ? 1.3467 1.2626 1.8855 0.1560  0.2177  0.0369  77  GLY C N     
3064 C CA    . GLY C 77  ? 1.2240 1.1191 1.8213 0.1465  0.1947  0.0207  77  GLY C CA    
3065 C C     . GLY C 77  ? 1.2218 1.1137 1.7641 0.1408  0.1606  -0.0301 77  GLY C C     
3066 O O     . GLY C 77  ? 1.3456 1.2303 1.8930 0.1420  0.1455  -0.0443 77  GLY C O     
3067 N N     . PHE C 78  ? 1.1689 1.0692 1.6595 0.1347  0.1484  -0.0564 78  PHE C N     
3068 C CA    . PHE C 78  ? 1.3187 1.2230 1.7582 0.1251  0.1175  -0.0997 78  PHE C CA    
3069 C C     . PHE C 78  ? 1.1430 1.0499 1.5062 0.1339  0.1192  -0.1029 78  PHE C C     
3070 O O     . PHE C 78  ? 1.5840 1.4954 1.9434 0.1298  0.0994  -0.1302 78  PHE C O     
3071 C CB    . PHE C 78  ? 1.1367 1.0461 1.5376 0.1177  0.1071  -0.1137 78  PHE C CB    
3072 C CG    . PHE C 78  ? 1.3136 1.2329 1.6685 0.1037  0.0759  -0.1504 78  PHE C CG    
3073 C CD1   . PHE C 78  ? 1.2424 1.1768 1.6444 0.0912  0.0493  -0.1793 78  PHE C CD1   
3074 C CD2   . PHE C 78  ? 1.5758 1.4959 1.8434 0.1024  0.0733  -0.1569 78  PHE C CD2   
3075 C CE1   . PHE C 78  ? 1.3036 1.2597 1.6593 0.0778  0.0223  -0.2099 78  PHE C CE1   
3076 C CE2   . PHE C 78  ? 1.6938 1.6282 1.9203 0.0863  0.0471  -0.1846 78  PHE C CE2   
3077 C CZ    . PHE C 78  ? 1.5066 1.4620 1.7736 0.0741  0.0222  -0.2091 78  PHE C CZ    
3078 N N     . PHE C 79  ? 1.2624 1.1733 1.5674 0.1473  0.1418  -0.0803 79  PHE C N     
3079 C CA    . PHE C 79  ? 1.2228 1.1420 1.4546 0.1572  0.1433  -0.0864 79  PHE C CA    
3080 C C     . PHE C 79  ? 1.4347 1.3549 1.6851 0.1752  0.1595  -0.0550 79  PHE C C     
3081 O O     . PHE C 79  ? 1.4011 1.3332 1.5929 0.1877  0.1619  -0.0571 79  PHE C O     
3082 C CB    . PHE C 79  ? 1.1798 1.1093 1.3399 0.1642  0.1559  -0.0860 79  PHE C CB    
3083 C CG    . PHE C 79  ? 1.3980 1.3223 1.5268 0.1471  0.1353  -0.1160 79  PHE C CG    
3084 C CD1   . PHE C 79  ? 1.5162 1.4438 1.6102 0.1321  0.1113  -0.1471 79  PHE C CD1   
3085 C CD2   . PHE C 79  ? 1.2384 1.1578 1.3745 0.1464  0.1400  -0.1109 79  PHE C CD2   
3086 C CE1   . PHE C 79  ? 1.6113 1.5360 1.6766 0.1146  0.0932  -0.1653 79  PHE C CE1   
3087 C CE2   . PHE C 79  ? 1.7209 1.6313 1.8325 0.1316  0.1190  -0.1314 79  PHE C CE2   
3088 C CZ    . PHE C 79  ? 1.8987 1.8110 1.9736 0.1146  0.0961  -0.1550 79  PHE C CZ    
3089 N N     . TYR C 80  ? 1.6461 1.5550 1.9805 0.1763  0.1693  -0.0247 80  TYR C N     
3090 C CA    . TYR C 80  ? 1.1382 1.0452 1.4961 0.1933  0.1852  0.0167  80  TYR C CA    
3091 C C     . TYR C 80  ? 2.0393 1.9395 2.3936 0.1980  0.1621  -0.0066 80  TYR C C     
3092 O O     . TYR C 80  ? 1.1643 1.0716 1.4892 0.2174  0.1701  0.0170  80  TYR C O     
3093 C CB    . TYR C 80  ? 1.1643 1.0567 1.6271 0.1884  0.1986  0.0547  80  TYR C CB    
3094 C CG    . TYR C 80  ? 1.3633 1.2557 1.8511 0.2051  0.2216  0.1153  80  TYR C CG    
3095 C CD1   . TYR C 80  ? 1.2159 1.0853 1.7551 0.2104  0.2068  0.1229  80  TYR C CD1   
3096 C CD2   . TYR C 80  ? 1.4126 1.3325 1.8754 0.2166  0.2571  0.1656  80  TYR C CD2   
3097 C CE1   . TYR C 80  ? 1.2624 1.1294 1.8268 0.2263  0.2257  0.1862  80  TYR C CE1   
3098 C CE2   . TYR C 80  ? 1.3313 1.2587 1.8128 0.2316  0.2787  0.2288  80  TYR C CE2   
3099 C CZ    . TYR C 80  ? 1.6105 1.5078 2.1427 0.2361  0.2624  0.2425  80  TYR C CZ    
3100 O OH    . TYR C 80  ? 1.3429 1.2450 1.8961 0.2516  0.2819  0.3131  80  TYR C OH    
3101 N N     . ASN C 81  ? 2.5459 2.7973 2.8130 0.0950  0.7369  -0.1893 81  ASN C N     
3102 C CA    . ASN C 81  ? 2.7726 3.0899 3.1265 0.0936  0.7309  -0.1678 81  ASN C CA    
3103 C C     . ASN C 81  ? 2.6509 3.0182 2.9209 0.1076  0.6652  -0.1333 81  ASN C C     
3104 O O     . ASN C 81  ? 2.8177 3.2076 3.0968 0.1535  0.6834  -0.0772 81  ASN C O     
3105 C CB    . ASN C 81  ? 2.8543 3.2043 3.2965 0.0384  0.7121  -0.2263 81  ASN C CB    
3106 C CG    . ASN C 81  ? 2.9499 3.2385 3.4432 0.0281  0.7024  -0.2363 81  ASN C CG    
3107 O OD1   . ASN C 81  ? 2.8818 3.1430 3.3607 -0.0051 0.6671  -0.2813 81  ASN C OD1   
3108 N ND2   . ASN C 81  ? 2.9879 3.2518 3.5333 0.0554  0.7317  -0.1961 81  ASN C ND2   
3109 N N     . SER C 82  ? 2.3663 2.7501 2.5517 0.0708  0.5901  -0.1685 82  SER C N     
3110 C CA    . SER C 82  ? 2.3684 2.8063 2.4760 0.0781  0.5231  -0.1493 82  SER C CA    
3111 C C     . SER C 82  ? 2.4633 2.9027 2.4809 0.0299  0.4514  -0.1994 82  SER C C     
3112 O O     . SER C 82  ? 1.2668 1.6594 1.2734 -0.0050 0.4537  -0.2448 82  SER C O     
3113 C CB    . SER C 82  ? 2.6112 3.1265 2.8122 0.0755  0.5125  -0.1342 82  SER C CB    
3114 O OG    . SER C 82  ? 2.7258 3.2607 3.0124 0.0189  0.5040  -0.1833 82  SER C OG    
3115 N N     . ASN C 83  ? 2.6116 3.1039 2.5619 0.0316  0.3896  -0.1921 83  ASN C N     
3116 C CA    . ASN C 83  ? 2.5280 3.0418 2.4207 -0.0211 0.3204  -0.2411 83  ASN C CA    
3117 C C     . ASN C 83  ? 2.3167 2.7695 2.0887 -0.0326 0.2983  -0.2673 83  ASN C C     
3118 O O     . ASN C 83  ? 2.3268 2.7889 2.0364 -0.0729 0.2431  -0.3062 83  ASN C O     
3119 C CB    . ASN C 83  ? 2.6725 3.1967 2.6560 -0.0783 0.3201  -0.2860 83  ASN C CB    
3120 C CG    . ASN C 83  ? 2.8892 3.4435 2.8282 -0.1320 0.2543  -0.3311 83  ASN C CG    
3121 O OD1   . ASN C 83  ? 3.0336 3.6378 2.9195 -0.1266 0.2075  -0.3250 83  ASN C OD1   
3122 N ND2   . ASN C 83  ? 2.7405 3.2635 2.6998 -0.1826 0.2526  -0.3789 83  ASN C ND2   
3123 N N     . THR C 84  ? 1.8925 2.2812 1.6311 0.0011  0.3425  -0.2483 84  THR C N     
3124 C CA    . THR C 84  ? 1.8173 2.1449 1.4499 -0.0123 0.3248  -0.2775 84  THR C CA    
3125 C C     . THR C 84  ? 1.9855 2.2758 1.5467 0.0452  0.3535  -0.2346 84  THR C C     
3126 O O     . THR C 84  ? 2.1671 2.4467 1.7817 0.0889  0.4125  -0.1915 84  THR C O     
3127 C CB    . THR C 84  ? 1.9079 2.1784 1.5806 -0.0471 0.3528  -0.3227 84  THR C CB    
3128 O OG1   . THR C 84  ? 2.1928 2.4925 1.9966 -0.0616 0.3830  -0.3278 84  THR C OG1   
3129 C CG2   . THR C 84  ? 1.4906 1.7452 1.0929 -0.0995 0.2974  -0.3769 84  THR C CG2   
3130 N N     . LYS C 85  ? 1.5947 1.8619 1.0337 0.0448  0.3147  -0.2471 85  LYS C N     
3131 C CA    . LYS C 85  ? 2.1946 2.4208 1.5495 0.0963  0.3377  -0.2117 85  LYS C CA    
3132 C C     . LYS C 85  ? 2.2522 2.4011 1.5525 0.0743  0.3468  -0.2504 85  LYS C C     
3133 O O     . LYS C 85  ? 2.5022 2.6407 1.7119 0.0470  0.2951  -0.2846 85  LYS C O     
3134 C CB    . LYS C 85  ? 2.5871 2.8608 1.8409 0.1235  0.2827  -0.1913 85  LYS C CB    
3135 C CG    . LYS C 85  ? 2.7588 3.1178 2.0616 0.1483  0.2660  -0.1586 85  LYS C CG    
3136 C CD    . LYS C 85  ? 2.7600 3.1088 2.1350 0.2025  0.3369  -0.1002 85  LYS C CD    
3137 C CE    . LYS C 85  ? 2.5844 3.0183 2.0176 0.2256  0.3205  -0.0710 85  LYS C CE    
3138 N NZ    . LYS C 85  ? 2.5064 2.9870 2.0370 0.1652  0.2959  -0.1126 85  LYS C NZ    
3139 N N     . VAL C 86  ? 2.3062 2.4025 1.6652 0.0859  0.4135  -0.2486 86  VAL C N     
3140 C CA    . VAL C 86  ? 1.8767 1.9012 1.1870 0.0751  0.4287  -0.2832 86  VAL C CA    
3141 C C     . VAL C 86  ? 1.7564 1.7477 0.9594 0.1205  0.4368  -0.2493 86  VAL C C     
3142 O O     . VAL C 86  ? 2.0477 2.0360 1.2642 0.1711  0.4838  -0.1962 86  VAL C O     
3143 C CB    . VAL C 86  ? 1.8654 1.8545 1.2852 0.0725  0.4982  -0.3003 86  VAL C CB    
3144 C CG1   . VAL C 86  ? 1.5232 1.5352 1.0219 0.0231  0.4798  -0.3482 86  VAL C CG1   
3145 C CG2   . VAL C 86  ? 2.6332 2.6331 2.1375 0.1168  0.5655  -0.2465 86  VAL C CG2   
3146 N N     . ILE C 87  ? 1.8488 1.8126 0.9417 0.1041  0.3926  -0.2789 87  ILE C N     
3147 C CA    . ILE C 87  ? 2.4053 2.3370 1.3869 0.1434  0.3943  -0.2534 87  ILE C CA    
3148 C C     . ILE C 87  ? 2.6513 2.5101 1.5925 0.1273  0.4098  -0.2946 87  ILE C C     
3149 O O     . ILE C 87  ? 2.5748 2.4209 1.4987 0.0813  0.3720  -0.3481 87  ILE C O     
3150 C CB    . ILE C 87  ? 2.0223 2.0000 0.8992 0.1431  0.3194  -0.2508 87  ILE C CB    
3151 C CG1   . ILE C 87  ? 1.9322 1.9936 0.8612 0.1484  0.2934  -0.2266 87  ILE C CG1   
3152 C CG2   . ILE C 87  ? 2.7489 2.7026 1.5167 0.1945  0.3259  -0.2157 87  ILE C CG2   
3153 C CD1   . ILE C 87  ? 1.9712 2.0904 0.8204 0.1350  0.2147  -0.2426 87  ILE C CD1   
3154 N N     . VAL C 88  ? 1.9342 1.7432 0.8570 0.1667  0.4666  -0.2703 88  VAL C N     
3155 C CA    . VAL C 88  ? 2.1108 1.8572 1.0087 0.1559  0.4839  -0.3078 88  VAL C CA    
3156 C C     . VAL C 88  ? 2.7043 2.4387 1.4897 0.1773  0.4528  -0.2882 88  VAL C C     
3157 O O     . VAL C 88  ? 2.3014 2.0143 1.0479 0.2277  0.4963  -0.2401 88  VAL C O     
3158 C CB    . VAL C 88  ? 2.3654 2.0876 1.3856 0.1716  0.5584  -0.2988 88  VAL C CB    
3159 C CG1   . VAL C 88  ? 2.2574 1.9617 1.3175 0.1528  0.5373  -0.3328 88  VAL C CG1   
3160 C CG2   . VAL C 88  ? 1.8107 1.5608 0.9591 0.1535  0.5865  -0.3114 88  VAL C CG2   
3161 N N     . ARG C 89  ? 2.7633 2.5188 1.5136 0.1393  0.3782  -0.3224 89  ARG C N     
3162 C CA    . ARG C 89  ? 2.6202 2.3759 1.2864 0.1473  0.3432  -0.3108 89  ARG C CA    
3163 C C     . ARG C 89  ? 2.6490 2.3800 1.3605 0.1356  0.3474  -0.3339 89  ARG C C     
3164 O O     . ARG C 89  ? 2.6036 2.3438 1.4041 0.1106  0.3348  -0.3703 89  ARG C O     
3165 C CB    . ARG C 89  ? 2.8840 2.6953 1.5084 0.1105  0.2623  -0.3308 89  ARG C CB    
3166 C CG    . ARG C 89  ? 3.0877 2.9332 1.6737 0.1217  0.2485  -0.3132 89  ARG C CG    
3167 C CD    . ARG C 89  ? 2.9735 2.8728 1.5537 0.0669  0.1738  -0.3447 89  ARG C CD    
3168 N NE    . ARG C 89  ? 3.0142 2.9262 1.5209 0.0639  0.1319  -0.3318 89  ARG C NE    
3169 C CZ    . ARG C 89  ? 3.1314 3.0558 1.6521 0.0227  0.1022  -0.3552 89  ARG C CZ    
3170 N NH1   . ARG C 89  ? 3.0758 3.0010 1.5254 0.0193  0.0701  -0.3423 89  ARG C NH1   
3171 N NH2   . ARG C 89  ? 3.1125 3.0637 1.7453 0.0164  0.0970  -0.3853 89  ARG C NH2   
3172 N N     . ASN C 90  ? 3.7259 3.0566 2.6768 -0.0431 -0.2294 -1.2799 90  ASN C N     
3173 C CA    . ASN C 90  ? 3.7521 3.0172 2.6043 -0.0503 -0.1866 -1.2440 90  ASN C CA    
3174 C C     . ASN C 90  ? 3.8568 3.1140 2.7832 -0.0470 -0.1515 -1.2782 90  ASN C C     
3175 O O     . ASN C 90  ? 3.8628 3.1566 2.8973 -0.0530 -0.1688 -1.3320 90  ASN C O     
3176 C CB    . ASN C 90  ? 3.7964 3.0212 2.5444 -0.0630 -0.2069 -1.2390 90  ASN C CB    
3177 C CG    . ASN C 90  ? 4.1310 3.3799 2.9180 -0.0712 -0.2684 -1.2918 90  ASN C CG    
3178 O OD1   . ASN C 90  ? 4.0903 3.4032 2.9897 -0.0610 -0.3047 -1.3285 90  ASN C OD1   
3179 N ND2   . ASN C 90  ? 4.3385 3.5398 3.0319 -0.0932 -0.2812 -1.3005 90  ASN C ND2   
3180 N N     . PRO C 91  ? 3.9700 3.1923 2.8544 -0.0380 -0.1019 -1.2524 91  PRO C N     
3181 C CA    . PRO C 91  ? 4.0230 3.2455 2.9949 -0.0335 -0.0606 -1.2903 91  PRO C CA    
3182 C C     . PRO C 91  ? 4.2219 3.3891 3.1821 -0.0405 -0.0770 -1.3406 91  PRO C C     
3183 O O     . PRO C 91  ? 4.4568 3.5465 3.2917 -0.0385 -0.0828 -1.3358 91  PRO C O     
3184 C CB    . PRO C 91  ? 4.1261 3.3264 3.0392 -0.0141 -0.0084 -1.2569 91  PRO C CB    
3185 C CG    . PRO C 91  ? 4.1856 3.3495 2.9490 -0.0112 -0.0309 -1.2051 91  PRO C CG    
3186 C CD    . PRO C 91  ? 4.0696 3.2649 2.8395 -0.0329 -0.0803 -1.1926 91  PRO C CD    
3187 N N     . THR C 92  ? 4.3274 3.5328 3.4127 -0.0578 -0.0831 -1.3909 92  THR C N     
3188 C CA    . THR C 92  ? 4.6152 3.7734 3.6895 -0.0790 -0.1127 -1.4445 92  THR C CA    
3189 C C     . THR C 92  ? 4.8132 3.8455 3.7645 -0.0695 -0.0777 -1.4531 92  THR C C     
3190 O O     . THR C 92  ? 5.0086 3.9637 3.8275 -0.0816 -0.1081 -1.4601 92  THR C O     
3191 C CB    . THR C 92  ? 4.5339 3.7528 3.7717 -0.1027 -0.1076 -1.4941 92  THR C CB    
3192 O OG1   . THR C 92  ? 4.3925 3.6041 3.6951 -0.0973 -0.0345 -1.4914 92  THR C OG1   
3193 C CG2   . THR C 92  ? 4.3587 3.6977 3.7191 -0.1062 -0.1360 -1.4947 92  THR C CG2   
3194 N N     . PHE C 93  ? 4.7629 3.7740 3.7608 -0.0495 -0.0084 -1.4567 93  PHE C N     
3195 C CA    . PHE C 93  ? 4.8795 3.7718 3.7759 -0.0241 0.0377  -1.4710 93  PHE C CA    
3196 C C     . PHE C 93  ? 4.9960 3.8527 3.7574 0.0122  0.0491  -1.4234 93  PHE C C     
3197 O O     . PHE C 93  ? 4.9210 3.8130 3.7125 0.0462  0.1053  -1.3947 93  PHE C O     
3198 C CB    . PHE C 93  ? 4.7300 3.6285 3.7508 -0.0137 0.1224  -1.4910 93  PHE C CB    
3199 C CG    . PHE C 93  ? 4.6925 3.5893 3.8159 -0.0550 0.1186  -1.5429 93  PHE C CG    
3200 C CD1   . PHE C 93  ? 4.8014 3.6239 3.8435 -0.0848 0.0617  -1.5874 93  PHE C CD1   
3201 C CD2   . PHE C 93  ? 4.5154 3.4830 3.8118 -0.0737 0.1715  -1.5478 93  PHE C CD2   
3202 C CE1   . PHE C 93  ? 4.7495 3.5722 3.8802 -0.1293 0.0541  -1.6369 93  PHE C CE1   
3203 C CE2   . PHE C 93  ? 4.5071 3.4726 3.8960 -0.1156 0.1673  -1.5946 93  PHE C CE2   
3204 C CZ    . PHE C 93  ? 4.6014 3.4964 3.9070 -0.1422 0.1073  -1.6398 93  PHE C CZ    
3205 N N     . LYS C 94  ? 5.1564 3.9527 3.7742 -0.0064 -0.0010 -1.4165 94  LYS C N     
3206 C CA    . LYS C 94  ? 5.1081 3.8594 3.5860 0.0125  0.0139  -1.3738 94  LYS C CA    
3207 C C     . LYS C 94  ? 5.1607 3.7995 3.5379 0.0424  0.0361  -1.3983 94  LYS C C     
3208 O O     . LYS C 94  ? 5.3230 3.9040 3.5851 0.0085  0.0055  -1.3942 94  LYS C O     
3209 C CB    . LYS C 94  ? 5.0232 3.8329 3.4623 -0.0410 -0.0419 -1.3421 94  LYS C CB    
3210 C CG    . LYS C 94  ? 4.8663 3.7169 3.2470 -0.0433 -0.0181 -1.2825 94  LYS C CG    
3211 C CD    . LYS C 94  ? 4.5228 3.4452 2.9588 -0.0145 0.0056  -1.2377 94  LYS C CD    
3212 C CE    . LYS C 94  ? 4.5205 3.5183 3.0317 -0.0342 -0.0447 -1.2303 94  LYS C CE    
3213 N NZ    . LYS C 94  ? 4.6201 3.6666 3.1096 -0.0727 -0.1002 -1.2203 94  LYS C NZ    
3214 N N     . GLY C 95  ? 4.6643 3.2885 3.1058 0.1034  0.0962  -1.4353 95  GLY C N     
3215 C CA    . GLY C 95  ? 4.5888 3.1511 2.9856 0.1525  0.1243  -1.4832 95  GLY C CA    
3216 C C     . GLY C 95  ? 4.8008 3.3908 3.3319 0.1852  0.2455  -1.5109 95  GLY C C     
3217 O O     . GLY C 95  ? 4.1306 2.7894 2.7941 0.1691  0.2966  -1.4809 95  GLY C O     
3218 N N     . GLY C 96  ? 5.4855 4.0189 3.9965 0.2083  0.3115  -1.5549 96  GLY C N     
3219 C CA    . GLY C 96  ? 5.5604 4.0586 4.1762 0.2173  0.4685  -1.5492 96  GLY C CA    
3220 C C     . GLY C 96  ? 5.4487 4.0181 4.1558 0.2384  0.5714  -1.4725 96  GLY C C     
3221 O O     . GLY C 96  ? 5.4704 4.1314 4.1390 0.2482  0.5270  -1.4303 96  GLY C O     
3222 N N     . SER C 97  ? 5.2211 3.7352 4.0445 0.2447  0.7168  -1.4463 97  SER C N     
3223 C CA    . SER C 97  ? 4.9094 3.4633 3.8281 0.2675  0.8411  -1.3557 97  SER C CA    
3224 C C     . SER C 97  ? 4.7507 3.4219 3.7527 0.2280  0.7865  -1.3318 97  SER C C     
3225 O O     . SER C 97  ? 4.6815 3.3887 3.7163 0.1865  0.6846  -1.3802 97  SER C O     
3226 C CB    . SER C 97  ? 4.8118 3.2662 3.8597 0.2932  1.0121  -1.3184 97  SER C CB    
3227 O OG    . SER C 97  ? 4.6866 3.1782 3.8434 0.3295  1.1438  -1.2034 97  SER C OG    
3228 N N     . TYR C 98  ? 4.6038 3.3282 3.6315 0.2396  0.8660  -1.2471 98  TYR C N     
3229 C CA    . TYR C 98  ? 4.3922 3.2602 3.5241 0.1937  0.8092  -1.1836 98  TYR C CA    
3230 C C     . TYR C 98  ? 4.3763 3.2586 3.7200 0.1756  0.8796  -1.1411 98  TYR C C     
3231 O O     . TYR C 98  ? 4.3202 3.2766 3.7438 0.1218  0.8173  -1.1597 98  TYR C O     
3232 C CB    . TYR C 98  ? 4.3046 3.3064 3.4256 0.2035  0.7964  -1.0182 98  TYR C CB    
3233 C CG    . TYR C 98  ? 4.2154 3.3522 3.3312 0.1443  0.6852  -0.9786 98  TYR C CG    
3234 C CD1   . TYR C 98  ? 4.1207 3.3005 3.3472 0.0916  0.6523  -1.0122 98  TYR C CD1   
3235 C CD2   . TYR C 98  ? 4.1822 3.3924 3.1728 0.1383  0.6199  -0.9087 98  TYR C CD2   
3236 C CE1   . TYR C 98  ? 4.0278 3.3108 3.2363 0.0368  0.5674  -0.9812 98  TYR C CE1   
3237 C CE2   . TYR C 98  ? 4.1131 3.4191 3.0786 0.0807  0.5307  -0.8777 98  TYR C CE2   
3238 C CZ    . TYR C 98  ? 4.0197 3.3571 3.0923 0.0312  0.5095  -0.9161 98  TYR C CZ    
3239 O OH    . TYR C 98  ? 3.8845 3.2983 2.9200 -0.0272 0.4361  -0.8905 98  TYR C OH    
3240 N N     . ARG C 99  ? 4.4082 3.2154 3.8476 0.2210  1.0149  -1.0832 99  ARG C N     
3241 C CA    . ARG C 99  ? 4.4431 3.2500 4.0859 0.2053  1.0848  -1.0434 99  ARG C CA    
3242 C C     . ARG C 99  ? 4.6466 3.3385 4.2740 0.1675  1.0590  -1.2174 99  ARG C C     
3243 O O     . ARG C 99  ? 4.6173 3.3543 4.3891 0.1243  1.0517  -1.2116 99  ARG C O     
3244 C CB    . ARG C 99  ? 4.4962 3.2391 4.2521 0.2717  1.2447  -0.9347 99  ARG C CB    
3245 C CG    . ARG C 99  ? 4.4707 3.2528 4.4657 0.2573  1.3148  -0.8399 99  ARG C CG    
3246 C CD    . ARG C 99  ? 4.3116 3.2994 4.4030 0.1912  1.2232  -0.7263 99  ARG C CD    
3247 N NE    . ARG C 99  ? 4.2251 3.2511 4.5277 0.1574  1.2659  -0.6609 99  ARG C NE    
3248 C CZ    . ARG C 99  ? 4.0005 3.1773 4.3899 0.0836  1.1956  -0.5866 99  ARG C CZ    
3249 N NH1   . ARG C 99  ? 3.8316 3.1219 4.1091 0.0380  1.0860  -0.5730 99  ARG C NH1   
3250 N NH2   . ARG C 99  ? 3.9416 3.1454 4.5204 0.0514  1.2386  -0.5276 99  ARG C NH2   
3251 N N     . ASN C 100 ? 4.8160 3.4171 4.2814 0.1741  0.9966  -1.3182 100 ASN C N     
3252 C CA    . ASN C 100 ? 4.8988 3.4701 4.3433 0.1308  0.8972  -1.4067 100 ASN C CA    
3253 C C     . ASN C 100 ? 4.9208 3.6076 4.3308 0.0846  0.7402  -1.4425 100 ASN C C     
3254 O O     . ASN C 100 ? 5.0050 3.6852 4.4281 0.0461  0.6676  -1.4952 100 ASN C O     
3255 C CB    . ASN C 100 ? 4.9311 3.3833 4.2198 0.1523  0.8745  -1.4613 100 ASN C CB    
3256 C CG    . ASN C 100 ? 5.0756 3.3934 4.4103 0.1886  1.0313  -1.4373 100 ASN C CG    
3257 O OD1   . ASN C 100 ? 5.2231 3.4749 4.4672 0.2339  1.0899  -1.4204 100 ASN C OD1   
3258 N ND2   . ASN C 100 ? 5.0797 3.3550 4.5606 0.1693  1.1038  -1.4308 100 ASN C ND2   
3259 N N     . ARG C 101 ? 4.7105 3.4958 4.0743 0.0878  0.6937  -1.4071 101 ARG C N     
3260 C CA    . ARG C 101 ? 4.4511 3.3417 3.7983 0.0499  0.5605  -1.4226 101 ARG C CA    
3261 C C     . ARG C 101 ? 4.3269 3.2826 3.8450 -0.0026 0.5729  -1.4303 101 ARG C C     
3262 O O     . ARG C 101 ? 4.4412 3.4429 3.9725 -0.0348 0.4783  -1.4614 101 ARG C O     
3263 C CB    . ARG C 101 ? 4.3903 3.3642 3.6616 0.0586  0.5299  -1.3749 101 ARG C CB    
3264 C CG    . ARG C 101 ? 4.3949 3.4774 3.6764 0.0200  0.4251  -1.3693 101 ARG C CG    
3265 C CD    . ARG C 101 ? 4.4342 3.4902 3.6140 0.0250  0.2991  -1.3943 101 ARG C CD    
3266 N NE    . ARG C 101 ? 4.2743 3.4153 3.4472 0.0024  0.2198  -1.3680 101 ARG C NE    
3267 C CZ    . ARG C 101 ? 4.0572 3.2626 3.3405 -0.0349 0.1932  -1.3823 101 ARG C CZ    
3268 N NH1   . ARG C 101 ? 4.1468 3.3475 3.5537 -0.0591 0.2299  -1.4224 101 ARG C NH1   
3269 N NH2   . ARG C 101 ? 3.7357 3.0048 3.0057 -0.0477 0.1361  -1.3560 101 ARG C NH2   
3270 N N     . LYS C 102 ? 4.2066 3.1612 3.8641 -0.0114 0.6997  -1.3945 102 LYS C N     
3271 C CA    . LYS C 102 ? 4.1014 3.1049 3.9296 -0.0647 0.7224  -1.4027 102 LYS C CA    
3272 C C     . LYS C 102 ? 4.4468 3.3652 4.3369 -0.0735 0.7391  -1.4471 102 LYS C C     
3273 O O     . LYS C 102 ? 4.2735 3.2409 4.2509 -0.1219 0.6938  -1.4793 102 LYS C O     
3274 C CB    . LYS C 102 ? 3.7650 2.8578 3.7269 -0.0672 0.7952  -1.2323 102 LYS C CB    
3275 C CG    . LYS C 102 ? 3.3434 2.5095 3.4820 -0.1266 0.8052  -1.1975 102 LYS C CG    
3276 C CD    . LYS C 102 ? 3.2876 2.5237 3.5680 -0.1287 0.8856  -1.0143 102 LYS C CD    
3277 C CE    . LYS C 102 ? 3.6934 2.8111 4.0287 -0.0646 1.0025  -0.9797 102 LYS C CE    
3278 N NZ    . LYS C 102 ? 3.8667 2.8491 4.2527 -0.0688 1.0425  -1.1033 102 LYS C NZ    
3279 N N     . LYS C 103 ? 4.9574 3.7457 4.7945 -0.0307 0.8067  -1.4490 103 LYS C N     
3280 C CA    . LYS C 103 ? 5.0913 3.7772 4.9691 -0.0449 0.8375  -1.4899 103 LYS C CA    
3281 C C     . LYS C 103 ? 5.1681 3.8655 4.9611 -0.0832 0.7029  -1.5619 103 LYS C C     
3282 O O     . LYS C 103 ? 5.2471 3.9675 5.1376 -0.1319 0.6839  -1.5913 103 LYS C O     
3283 C CB    . LYS C 103 ? 5.2235 3.7595 5.0294 0.0097  0.9355  -1.4774 103 LYS C CB    
3284 C CG    . LYS C 103 ? 5.3391 3.7450 5.1545 -0.0078 0.9727  -1.5239 103 LYS C CG    
3285 C CD    . LYS C 103 ? 5.5175 3.7731 5.2656 0.0477  1.0856  -1.5051 103 LYS C CD    
3286 C CE    . LYS C 103 ? 5.6975 3.8074 5.4230 0.0224  1.1187  -1.5611 103 LYS C CE    
3287 N NZ    . LYS C 103 ? 5.7667 3.8620 5.3390 -0.0271 0.9767  -1.6543 103 LYS C NZ    
3288 N N     . GLN C 104 ? 5.1573 3.8358 4.7742 -0.0627 0.6135  -1.5841 104 GLN C N     
3289 C CA    . GLN C 104 ? 5.0665 3.7446 4.6053 -0.0982 0.4947  -1.6375 104 GLN C CA    
3290 C C     . GLN C 104 ? 4.9651 3.7926 4.6054 -0.1369 0.4211  -1.6304 104 GLN C C     
3291 O O     . GLN C 104 ? 4.8229 3.6689 4.4997 -0.1814 0.3657  -1.6696 104 GLN C O     
3292 C CB    . GLN C 104 ? 5.0413 3.6637 4.3785 -0.0694 0.4213  -1.6493 104 GLN C CB    
3293 C CG    . GLN C 104 ? 4.8335 3.5343 4.1167 -0.0312 0.3937  -1.5976 104 GLN C CG    
3294 C CD    . GLN C 104 ? 4.8635 3.4824 3.9519 0.0042  0.3519  -1.6053 104 GLN C CD    
3295 O OE1   . GLN C 104 ? 5.0275 3.5275 4.0246 0.0037  0.3576  -1.6511 104 GLN C OE1   
3296 N NE2   . GLN C 104 ? 4.7214 3.4004 3.7415 0.0308  0.3096  -1.5623 104 GLN C NE2   
3297 N N     . SER C 105 ? 5.0039 3.9378 4.6882 -0.1235 0.4236  -1.5819 105 SER C N     
3298 C CA    . SER C 105 ? 4.8495 3.9209 4.6285 -0.1578 0.3671  -1.5740 105 SER C CA    
3299 C C     . SER C 105 ? 4.6410 3.7476 4.5961 -0.2070 0.4106  -1.5939 105 SER C C     
3300 O O     . SER C 105 ? 4.7163 3.8744 4.7254 -0.2429 0.3529  -1.6267 105 SER C O     
3301 C CB    . SER C 105 ? 4.8022 3.9568 4.5813 -0.1427 0.3799  -1.5197 105 SER C CB    
3302 O OG    . SER C 105 ? 4.8388 3.9657 4.4542 -0.1006 0.3316  -1.4994 105 SER C OG    
3303 N N     . ILE C 106 ? 4.3180 3.3948 4.3738 -0.2109 0.5195  -1.5711 106 ILE C N     
3304 C CA    . ILE C 106 ? 3.8869 2.9877 4.1156 -0.2614 0.5674  -1.5829 106 ILE C CA    
3305 C C     . ILE C 106 ? 3.9229 2.9336 4.1411 -0.2796 0.5553  -1.6360 106 ILE C C     
3306 O O     . ILE C 106 ? 3.8604 2.9095 4.1961 -0.3290 0.5505  -1.6601 106 ILE C O     
3307 C CB    . ILE C 106 ? 3.6478 2.7168 3.9955 -0.2624 0.6982  -1.5350 106 ILE C CB    
3308 C CG1   . ILE C 106 ? 3.8615 2.7770 4.1628 -0.2124 0.7902  -1.5220 106 ILE C CG1   
3309 C CG2   . ILE C 106 ? 3.0748 2.2271 3.4151 -0.2615 0.7093  -1.4867 106 ILE C CG2   
3310 C CD1   . ILE C 106 ? 3.8197 2.7030 4.2572 -0.1956 0.9303  -1.4380 106 ILE C CD1   
3311 N N     . ASP C 107 ? 4.0419 2.9272 4.1108 -0.2473 0.5505  -1.6571 107 ASP C N     
3312 C CA    . ASP C 107 ? 4.1854 2.9673 4.2097 -0.2759 0.5339  -1.7134 107 ASP C CA    
3313 C C     . ASP C 107 ? 4.3962 3.2572 4.4064 -0.3175 0.4160  -1.7527 107 ASP C C     
3314 O O     . ASP C 107 ? 4.3025 3.1737 4.3969 -0.3694 0.4044  -1.7871 107 ASP C O     
3315 C CB    . ASP C 107 ? 4.2379 2.8619 4.0839 -0.2368 0.5550  -1.7290 107 ASP C CB    
3316 C CG    . ASP C 107 ? 4.3778 2.8649 4.1618 -0.2735 0.5556  -1.7887 107 ASP C CG    
3317 O OD1   . ASP C 107 ? 4.3028 2.8107 4.1976 -0.3262 0.5554  -1.8115 107 ASP C OD1   
3318 O OD2   . ASP C 107 ? 4.5624 2.9182 4.1812 -0.2541 0.5560  -1.8149 107 ASP C OD2   
3319 N N     . VAL C 108 ? 4.6025 3.5188 4.5149 -0.2962 0.3325  -1.7442 108 VAL C N     
3320 C CA    . VAL C 108 ? 4.6191 3.6197 4.5424 -0.3313 0.2310  -1.7726 108 VAL C CA    
3321 C C     . VAL C 108 ? 4.3951 3.5469 4.5131 -0.3616 0.2350  -1.7646 108 VAL C C     
3322 O O     . VAL C 108 ? 4.4536 3.6619 4.6512 -0.4072 0.1900  -1.8011 108 VAL C O     
3323 C CB    . VAL C 108 ? 4.6790 3.7063 4.4755 -0.2977 0.1566  -1.7534 108 VAL C CB    
3324 C CG1   . VAL C 108 ? 4.6913 3.8278 4.5413 -0.3292 0.0659  -1.7753 108 VAL C CG1   
3325 C CG2   . VAL C 108 ? 4.9044 3.7754 4.5010 -0.2799 0.1456  -1.7696 108 VAL C CG2   
3326 N N     . PHE C 109 ? 3.8329 3.0479 4.0300 -0.3432 0.2931  -1.7184 109 PHE C N     
3327 C CA    . PHE C 109 ? 3.4063 2.7485 3.7764 -0.3786 0.3102  -1.7097 109 PHE C CA    
3328 C C     . PHE C 109 ? 3.6542 2.9723 4.1430 -0.4305 0.3464  -1.7426 109 PHE C C     
3329 O O     . PHE C 109 ? 3.4724 2.8539 4.0318 -0.4688 0.2976  -1.7782 109 PHE C O     
3330 C CB    . PHE C 109 ? 3.2972 2.6722 3.7027 -0.3642 0.3776  -1.6552 109 PHE C CB    
3331 C CG    . PHE C 109 ? 3.3205 2.8032 3.8857 -0.4124 0.4104  -1.6428 109 PHE C CG    
3332 C CD1   . PHE C 109 ? 3.1582 2.7563 3.7417 -0.4193 0.3685  -1.6329 109 PHE C CD1   
3333 C CD2   . PHE C 109 ? 3.3167 2.7721 4.0088 -0.4532 0.4914  -1.6374 109 PHE C CD2   
3334 C CE1   . PHE C 109 ? 2.8471 2.5322 3.5576 -0.4710 0.4056  -1.6224 109 PHE C CE1   
3335 C CE2   . PHE C 109 ? 3.1460 2.6934 3.9757 -0.5091 0.5215  -1.6226 109 PHE C CE2   
3336 C CZ    . PHE C 109 ? 2.8751 2.5380 3.7055 -0.5205 0.4785  -1.6165 109 PHE C CZ    
3337 N N     . ILE C 110 ? 4.1305 3.3424 4.6354 -0.4306 0.4329  -1.7327 110 ILE C N     
3338 C CA    . ILE C 110 ? 4.2070 3.3754 4.8208 -0.4792 0.4778  -1.7566 110 ILE C CA    
3339 C C     . ILE C 110 ? 4.2874 3.3985 4.8336 -0.5097 0.4127  -1.8154 110 ILE C C     
3340 O O     . ILE C 110 ? 4.4192 3.5300 5.0596 -0.5624 0.4198  -1.8416 110 ILE C O     
3341 C CB    . ILE C 110 ? 4.3641 3.4011 4.9954 -0.4617 0.5929  -1.7295 110 ILE C CB    
3342 C CG1   . ILE C 110 ? 4.4511 3.4727 5.2456 -0.5150 0.6546  -1.7317 110 ILE C CG1   
3343 C CG2   . ILE C 110 ? 4.5174 3.3879 4.9779 -0.4268 0.6023  -1.7533 110 ILE C CG2   
3344 C CD1   . ILE C 110 ? 4.5403 3.4290 5.3871 -0.4952 0.7817  -1.6932 110 ILE C CD1   
3345 N N     . GLN C 111 ? 4.2168 3.2761 4.5978 -0.4858 0.3467  -1.8353 111 GLN C N     
3346 C CA    . GLN C 111 ? 4.0370 3.0402 4.3433 -0.5292 0.2762  -1.8906 111 GLN C CA    
3347 C C     . GLN C 111 ? 4.0326 3.1946 4.4474 -0.5673 0.1953  -1.9092 111 GLN C C     
3348 O O     . GLN C 111 ? 3.8794 3.0404 4.3405 -0.6275 0.1629  -1.9488 111 GLN C O     
3349 C CB    . GLN C 111 ? 4.0494 2.9407 4.1421 -0.5004 0.2327  -1.9029 111 GLN C CB    
3350 C CG    . GLN C 111 ? 4.1958 3.0229 4.1875 -0.5568 0.1481  -1.9582 111 GLN C CG    
3351 C CD    . GLN C 111 ? 4.2683 2.9872 4.0443 -0.5342 0.1020  -1.9667 111 GLN C CD    
3352 O OE1   . GLN C 111 ? 4.2644 2.9576 3.9677 -0.4705 0.1360  -1.9312 111 GLN C OE1   
3353 N NE2   . GLN C 111 ? 4.4455 3.1011 4.1170 -0.5929 0.0209  -2.0124 111 GLN C NE2   
3354 N N     . LYS C 112 ? 3.9795 3.2758 4.4384 -0.5342 0.1655  -1.8814 112 LYS C N     
3355 C CA    . LYS C 112 ? 3.8555 3.2987 4.4163 -0.5587 0.0932  -1.9025 112 LYS C CA    
3356 C C     . LYS C 112 ? 3.7617 3.3545 4.5115 -0.5665 0.1291  -1.8838 112 LYS C C     
3357 O O     . LYS C 112 ? 3.6504 3.3708 4.4995 -0.5783 0.0818  -1.9025 112 LYS C O     
3358 C CB    . LYS C 112 ? 3.7659 3.2414 4.2284 -0.5207 0.0211  -1.8974 112 LYS C CB    
3359 C CG    . LYS C 112 ? 3.7798 3.1471 4.0870 -0.5454 -0.0477 -1.9324 112 LYS C CG    
3360 C CD    . LYS C 112 ? 3.7104 3.1264 3.9458 -0.5174 -0.1245 -1.9267 112 LYS C CD    
3361 C CE    . LYS C 112 ? 3.7262 3.0495 3.7949 -0.4575 -0.0988 -1.8849 112 LYS C CE    
3362 N NZ    . LYS C 112 ? 3.8619 2.9966 3.7526 -0.4702 -0.0819 -1.8998 112 LYS C NZ    
3363 N N     . ILE C 113 ? 3.1670 1.6864 3.6916 -0.3096 -1.2371 0.1246  113 ILE C N     
3364 C CA    . ILE C 113 ? 3.2739 1.7277 3.6505 -0.3858 -1.2750 0.1982  113 ILE C CA    
3365 C C     . ILE C 113 ? 3.3363 1.7674 3.7421 -0.3996 -1.2391 0.1870  113 ILE C C     
3366 O O     . ILE C 113 ? 3.3270 1.6994 3.5624 -0.4401 -1.2315 0.1970  113 ILE C O     
3367 C CB    . ILE C 113 ? 3.5192 1.9787 3.9534 -0.4421 -1.3701 0.3186  113 ILE C CB    
3368 C CG1   . ILE C 113 ? 3.7294 2.2532 4.4378 -0.4146 -1.3828 0.3466  113 ILE C CG1   
3369 C CG2   . ILE C 113 ? 3.4476 1.9051 3.7783 -0.4555 -1.4113 0.3394  113 ILE C CG2   
3370 C CD1   . ILE C 113 ? 3.9473 2.4980 4.7416 -0.4656 -1.4726 0.4696  113 ILE C CD1   
3371 N N     . SER C 114 ? 3.3965 1.8693 4.0175 -0.3680 -1.2147 0.1669  114 SER C N     
3372 C CA    . SER C 114 ? 3.4041 1.8513 4.0834 -0.3916 -1.1869 0.1763  114 SER C CA    
3373 C C     . SER C 114 ? 3.1566 1.5821 3.7187 -0.3788 -1.1173 0.0862  114 SER C C     
3374 O O     . SER C 114 ? 3.0320 1.4091 3.5421 -0.4199 -1.1054 0.1110  114 SER C O     
3375 C CB    . SER C 114 ? 3.5871 2.0815 4.5279 -0.3590 -1.1695 0.1693  114 SER C CB    
3376 O OG    . SER C 114 ? 3.6035 2.1280 4.6641 -0.3643 -1.2288 0.2511  114 SER C OG    
3377 N N     . GLU C 115 ? 3.1887 1.6535 3.7107 -0.3222 -1.0708 -0.0127 115 GLU C N     
3378 C CA    . GLU C 115 ? 3.3401 1.8110 3.7862 -0.2992 -1.0005 -0.1063 115 GLU C CA    
3379 C C     . GLU C 115 ? 3.3832 1.7959 3.5812 -0.3295 -0.9907 -0.1005 115 GLU C C     
3380 O O     . GLU C 115 ? 3.4750 1.8998 3.5996 -0.3065 -0.9311 -0.1767 115 GLU C O     
3381 C CB    . GLU C 115 ? 3.4271 1.9774 3.9289 -0.2222 -0.9570 -0.2070 115 GLU C CB    
3382 C CG    . GLU C 115 ? 3.5481 2.1131 3.9711 -0.1939 -0.9760 -0.2010 115 GLU C CG    
3383 C CD    . GLU C 115 ? 3.5361 2.1833 4.0184 -0.1143 -0.9340 -0.2922 115 GLU C CD    
3384 O OE1   . GLU C 115 ? 3.5434 2.2448 4.1505 -0.0821 -0.9035 -0.3555 115 GLU C OE1   
3385 O OE2   . GLU C 115 ? 3.3971 2.0566 3.8008 -0.0851 -0.9329 -0.2989 115 GLU C OE2   
3386 N N     . TYR C 116 ? 3.3431 1.6966 3.4066 -0.3803 -1.0486 -0.0131 116 TYR C N     
3387 C CA    . TYR C 116 ? 3.4876 1.7836 3.2978 -0.4022 -1.0397 -0.0120 116 TYR C CA    
3388 C C     . TYR C 116 ? 3.6305 1.8388 3.2985 -0.4767 -1.0804 0.0698  116 TYR C C     
3389 O O     . TYR C 116 ? 3.9932 2.1478 3.4560 -0.4890 -1.0548 0.0540  116 TYR C O     
3390 C CB    . TYR C 116 ? 3.6058 1.9008 3.3133 -0.3935 -1.0643 0.0034  116 TYR C CB    
3391 C CG    . TYR C 116 ? 3.4548 1.8237 3.2362 -0.3165 -1.0122 -0.0815 116 TYR C CG    
3392 C CD1   . TYR C 116 ? 3.4362 1.8610 3.2761 -0.2619 -0.9392 -0.1762 116 TYR C CD1   
3393 C CD2   . TYR C 116 ? 3.4533 1.8381 3.2397 -0.3010 -1.0381 -0.0649 116 TYR C CD2   
3394 C CE1   . TYR C 116 ? 3.3907 1.8878 3.2830 -0.1917 -0.8958 -0.2476 116 TYR C CE1   
3395 C CE2   . TYR C 116 ? 3.3628 1.8109 3.2087 -0.2296 -0.9913 -0.1371 116 TYR C CE2   
3396 C CZ    . TYR C 116 ? 3.3741 1.8794 3.2673 -0.1739 -0.9212 -0.2264 116 TYR C CZ    
3397 O OH    . TYR C 116 ? 3.3791 1.9534 3.3194 -0.1022 -0.8794 -0.2917 116 TYR C OH    
3398 N N     . THR C 117 ? 3.5747 1.7670 3.3353 -0.5246 -1.1403 0.1601  117 THR C N     
3399 C CA    . THR C 117 ? 3.8523 1.9625 3.4488 -0.5990 -1.1880 0.2481  117 THR C CA    
3400 C C     . THR C 117 ? 3.9636 2.0494 3.6470 -0.6224 -1.1660 0.2740  117 THR C C     
3401 O O     . THR C 117 ? 4.1122 2.1239 3.6205 -0.6633 -1.1643 0.3010  117 THR C O     
3402 C CB    . THR C 117 ? 4.0253 2.1344 3.6220 -0.6493 -1.2826 0.3528  117 THR C CB    
3403 O OG1   . THR C 117 ? 3.9185 2.0707 3.7564 -0.6527 -1.3020 0.4092  117 THR C OG1   
3404 C CG2   . THR C 117 ? 4.0552 2.2050 3.6516 -0.6194 -1.3001 0.3285  117 THR C CG2   
3405 N N     . ASP C 118 ? 3.8284 1.9678 3.7726 -0.5984 -1.1454 0.2706  118 ASP C N     
3406 C CA    . ASP C 118 ? 4.0313 2.1494 4.0948 -0.6187 -1.1147 0.3019  118 ASP C CA    
3407 C C     . ASP C 118 ? 4.2128 2.2740 4.1987 -0.6862 -1.1692 0.4346  118 ASP C C     
3408 O O     . ASP C 118 ? 4.2468 2.2813 4.3122 -0.7058 -1.1396 0.4805  118 ASP C O     
3409 C CB    . ASP C 118 ? 4.2775 2.3709 4.2755 -0.6056 -1.0437 0.2177  118 ASP C CB    
3410 C CG    . ASP C 118 ? 4.3110 2.4757 4.3756 -0.5382 -0.9889 0.0861  118 ASP C CG    
3411 O OD1   . ASP C 118 ? 4.3328 2.5648 4.5560 -0.4995 -0.9926 0.0597  118 ASP C OD1   
3412 O OD2   . ASP C 118 ? 4.2680 2.4244 4.2212 -0.5222 -0.9428 0.0125  118 ASP C OD2   
3413 N N     . TYR C 119 ? 4.4234 2.4697 4.2548 -0.7229 -1.2461 0.4973  119 TYR C N     
3414 C CA    . TYR C 119 ? 4.5319 2.5464 4.2871 -0.7881 -1.3115 0.6248  119 TYR C CA    
3415 C C     . TYR C 119 ? 4.4887 2.5608 4.3211 -0.7998 -1.3897 0.6856  119 TYR C C     
3416 O O     . TYR C 119 ? 4.5054 2.5606 4.1782 -0.8572 -1.4672 0.7521  119 TYR C O     
3417 C CB    . TYR C 119 ? 4.5065 2.4352 3.9421 -0.8418 -1.3359 0.6410  119 TYR C CB    
3418 C CG    . TYR C 119 ? 4.4951 2.3616 3.8466 -0.8366 -1.2629 0.6020  119 TYR C CG    
3419 C CD1   . TYR C 119 ? 4.5177 2.3699 3.9827 -0.8464 -1.2247 0.6644  119 TYR C CD1   
3420 C CD2   . TYR C 119 ? 4.4506 2.2731 3.6113 -0.8196 -1.2269 0.5103  119 TYR C CD2   
3421 C CE1   . TYR C 119 ? 4.6005 2.3967 3.9991 -0.8446 -1.1583 0.6353  119 TYR C CE1   
3422 C CE2   . TYR C 119 ? 4.4780 2.2456 3.5646 -0.8165 -1.1631 0.4794  119 TYR C CE2   
3423 C CZ    . TYR C 119 ? 4.6396 2.3942 3.8487 -0.8319 -1.1320 0.5419  119 TYR C CZ    
3424 O OH    . TYR C 119 ? 4.6772 2.3774 3.8222 -0.8311 -1.0683 0.5168  119 TYR C OH    
3425 N N     . LYS C 120 ? 4.4634 2.6060 4.5426 -0.7484 -1.3709 0.6604  120 LYS C N     
3426 C CA    . LYS C 120 ? 4.3049 2.5112 4.4874 -0.7477 -1.4364 0.7075  120 LYS C CA    
3427 C C     . LYS C 120 ? 4.3723 2.6060 4.6712 -0.7841 -1.4829 0.8419  120 LYS C C     
3428 O O     . LYS C 120 ? 4.1452 2.4447 4.5887 -0.7765 -1.5267 0.8882  120 LYS C O     
3429 C CB    . LYS C 120 ? 4.0434 2.3112 4.4358 -0.6726 -1.3901 0.6238  120 LYS C CB    
3430 C CG    . LYS C 120 ? 3.9056 2.2277 4.3294 -0.6586 -1.4446 0.6260  120 LYS C CG    
3431 C CD    . LYS C 120 ? 3.5431 1.9210 4.1621 -0.5804 -1.3905 0.5392  120 LYS C CD    
3432 C CE    . LYS C 120 ? 3.0228 1.4565 3.6989 -0.5646 -1.4424 0.5544  120 LYS C CE    
3433 N NZ    . LYS C 120 ? 3.0915 1.5633 3.8769 -0.6073 -1.5184 0.6818  120 LYS C NZ    
3434 N N     . ASN C 121 ? 4.6529 2.8425 4.8929 -0.8193 -1.4695 0.9110  121 ASN C N     
3435 C CA    . ASN C 121 ? 4.8764 3.0984 5.2160 -0.8455 -1.5024 1.0476  121 ASN C CA    
3436 C C     . ASN C 121 ? 5.3758 3.6236 5.5684 -0.9097 -1.6081 1.1245  121 ASN C C     
3437 O O     . ASN C 121 ? 5.2681 3.5915 5.5954 -0.9127 -1.6599 1.1885  121 ASN C O     
3438 C CB    . ASN C 121 ? 4.7792 2.9464 5.0862 -0.8567 -1.4459 1.1007  121 ASN C CB    
3439 C CG    . ASN C 121 ? 4.8545 3.0532 5.2136 -0.8799 -1.4740 1.2522  121 ASN C CG    
3440 O OD1   . ASN C 121 ? 4.8689 3.1383 5.4011 -0.8656 -1.5027 1.3136  121 ASN C OD1   
3441 N ND2   . ASN C 121 ? 4.9396 3.0905 5.1448 -0.9099 -1.4604 1.3162  121 ASN C ND2   
3442 N N     . ASP C 122 ? 5.9602 4.1465 5.8752 -0.9655 -1.6394 1.1166  122 ASP C N     
3443 C CA    . ASP C 122 ? 6.2869 4.4895 6.0402 -1.0398 -1.7392 1.1704  122 ASP C CA    
3444 C C     . ASP C 122 ? 6.2509 4.4946 6.0333 -1.0400 -1.7933 1.1175  122 ASP C C     
3445 O O     . ASP C 122 ? 6.4274 4.7240 6.2100 -1.0928 -1.8770 1.1803  122 ASP C O     
3446 C CB    . ASP C 122 ? 6.5123 4.6239 5.9481 -1.0977 -1.7479 1.1455  122 ASP C CB    
3447 C CG    . ASP C 122 ? 6.6647 4.7392 6.0599 -1.0935 -1.6915 1.2073  122 ASP C CG    
3448 O OD1   . ASP C 122 ? 6.6715 4.7990 6.2601 -1.0649 -1.6692 1.3012  122 ASP C OD1   
3449 O OD2   . ASP C 122 ? 6.7551 4.7462 5.9236 -1.1145 -1.6636 1.1649  122 ASP C OD2   
3450 N N     . ILE C 123 ? 5.9423 4.1708 5.7621 -0.9776 -1.7399 1.0065  123 ILE C N     
3451 C CA    . ILE C 123 ? 5.6367 3.9030 5.4786 -0.9621 -1.7755 0.9584  123 ILE C CA    
3452 C C     . ILE C 123 ? 5.4758 3.8414 5.6143 -0.9220 -1.7860 1.0036  123 ILE C C     
3453 O O     . ILE C 123 ? 5.3748 3.7962 5.5569 -0.9414 -1.8518 1.0300  123 ILE C O     
3454 C CB    . ILE C 123 ? 5.4318 3.6514 5.1911 -0.8982 -1.6974 0.8267  123 ILE C CB    
3455 C CG1   . ILE C 123 ? 5.5437 3.6629 5.0095 -0.9349 -1.6782 0.7896  123 ILE C CG1   
3456 C CG2   . ILE C 123 ? 5.2359 3.4878 4.9971 -0.8729 -1.7188 0.7840  123 ILE C CG2   
3457 C CD1   . ILE C 123 ? 5.4122 3.4931 4.8038 -0.8676 -1.5846 0.6691  123 ILE C CD1   
3458 N N     . LEU C 124 ? 5.4499 3.8364 5.7978 -0.8679 -1.7190 1.0140  124 LEU C N     
3459 C CA    . LEU C 124 ? 5.4457 3.9181 6.0690 -0.8292 -1.7213 1.0597  124 LEU C CA    
3460 C C     . LEU C 124 ? 5.9124 4.4438 6.5829 -0.8867 -1.7954 1.2029  124 LEU C C     
3461 O O     . LEU C 124 ? 5.8442 4.4575 6.6639 -0.8848 -1.8383 1.2512  124 LEU C O     
3462 C CB    . LEU C 124 ? 5.2125 3.6775 6.0304 -0.7615 -1.6235 1.0262  124 LEU C CB    
3463 C CG    . LEU C 124 ? 5.0498 3.5822 6.1501 -0.7009 -1.5943 1.0278  124 LEU C CG    
3464 C CD1   . LEU C 124 ? 4.9677 3.4685 6.1822 -0.6381 -1.4922 0.9306  124 LEU C CD1   
3465 C CD2   . LEU C 124 ? 5.0782 3.6639 6.3301 -0.7183 -1.6207 1.1688  124 LEU C CD2   
3466 N N     . ASN C 125 ? 4.4892 6.4267 6.1118 0.7218  1.1435  0.8780  125 ASN C N     
3467 C CA    . ASN C 125 ? 4.7044 6.6979 6.4402 0.8483  1.1259  1.0252  125 ASN C CA    
3468 C C     . ASN C 125 ? 4.6915 6.6838 6.3670 0.9189  0.9279  1.0186  125 ASN C C     
3469 O O     . ASN C 125 ? 4.9883 6.9444 6.6927 0.9769  0.8349  1.1105  125 ASN C O     
3470 C CB    . ASN C 125 ? 5.0130 7.0313 6.5768 0.9178  1.1691  1.1026  125 ASN C CB    
3471 C CG    . ASN C 125 ? 5.1588 7.0604 6.6846 0.8098  1.2954  1.0729  125 ASN C CG    
3472 O OD1   . ASN C 125 ? 5.1835 6.9564 6.8444 0.7091  1.3500  1.0425  125 ASN C OD1   
3473 N ND2   . ASN C 125 ? 5.2481 7.1700 6.5652 0.8252  1.3231  1.0668  125 ASN C ND2   
3474 N N     . LYS C 126 ? 3.8600 5.8827 5.4435 0.9051  0.8586  0.9142  126 LYS C N     
3475 C CA    . LYS C 126 ? 3.1595 5.1582 4.6014 0.9684  0.6741  0.8920  126 LYS C CA    
3476 C C     . LYS C 126 ? 3.0643 5.0213 4.7041 0.9534  0.5749  0.9110  126 LYS C C     
3477 O O     . LYS C 126 ? 3.0089 4.9372 4.6217 1.0052  0.4549  0.9882  126 LYS C O     
3478 C CB    . LYS C 126 ? 2.7598 4.7977 4.0542 0.9608  0.6531  0.7793  126 LYS C CB    
3479 C CG    . LYS C 126 ? 2.6643 4.6608 3.7227 1.0351  0.4990  0.7512  126 LYS C CG    
3480 C CD    . LYS C 126 ? 2.7314 4.7423 3.5191 1.0961  0.5337  0.7530  126 LYS C CD    
3481 C CE    . LYS C 126 ? 2.7862 4.7494 3.3415 1.1488  0.4268  0.6873  126 LYS C CE    
3482 N NZ    . LYS C 126 ? 2.7738 4.7453 3.0779 1.2084  0.4837  0.6852  126 LYS C NZ    
3483 N N     . TYR C 127 ? 2.8987 4.8594 4.7380 0.8763  0.6217  0.8463  127 TYR C N     
3484 C CA    . TYR C 127 ? 2.7373 4.6644 4.7407 0.8618  0.5152  0.8404  127 TYR C CA    
3485 C C     . TYR C 127 ? 2.4547 4.3603 4.7704 0.7838  0.6388  0.8562  127 TYR C C     
3486 O O     . TYR C 127 ? 2.4236 4.3041 4.7568 0.6952  0.7825  0.7985  127 TYR C O     
3487 C CB    . TYR C 127 ? 2.6516 4.5868 4.5592 0.8475  0.4209  0.7213  127 TYR C CB    
3488 C CG    . TYR C 127 ? 2.8476 4.7649 4.4713 0.9240  0.2766  0.7065  127 TYR C CG    
3489 C CD1   . TYR C 127 ? 2.9277 4.8068 4.4972 0.9705  0.1337  0.7765  127 TYR C CD1   
3490 C CD2   . TYR C 127 ? 2.8732 4.8115 4.2811 0.9429  0.2905  0.6272  127 TYR C CD2   
3491 C CE1   . TYR C 127 ? 3.1458 4.9903 4.4288 1.0223  0.0127  0.7543  127 TYR C CE1   
3492 C CE2   . TYR C 127 ? 2.9889 4.8849 4.1276 1.0092  0.1811  0.6081  127 TYR C CE2   
3493 C CZ    . TYR C 127 ? 3.2110 5.0510 4.2760 1.0429  0.0443  0.6649  127 TYR C CZ    
3494 O OH    . TYR C 127 ? 3.3934 5.1738 4.1655 1.0914  -0.0549 0.6378  127 TYR C OH    
3495 N N     . THR C 128 ? 2.3274 4.1991 4.8345 0.7954  0.5689  0.9228  128 THR C N     
3496 C CA    . THR C 128 ? 2.1816 3.9519 4.9143 0.7067  0.6639  0.9217  128 THR C CA    
3497 C C     . THR C 128 ? 1.9552 3.6725 4.7378 0.6377  0.5897  0.8142  128 THR C C     
3498 O O     . THR C 128 ? 1.8374 3.4287 4.7317 0.5496  0.6549  0.7867  128 THR C O     
3499 C CB    . THR C 128 ? 2.1614 3.9068 5.0662 0.7581  0.6526  1.0795  128 THR C CB    
3500 O OG1   . THR C 128 ? 2.1191 3.9436 4.9515 0.8476  0.6791  1.1905  128 THR C OG1   
3501 C CG2   . THR C 128 ? 2.1587 3.7404 5.2136 0.6631  0.8002  1.0840  128 THR C CG2   
3502 N N     . LYS C 129 ? 1.8468 3.6436 4.5285 0.6782  0.4587  0.7538  129 LYS C N     
3503 C CA    . LYS C 129 ? 1.6000 3.3524 4.3090 0.6200  0.3799  0.6501  129 LYS C CA    
3504 C C     . LYS C 129 ? 1.7391 3.5196 4.2972 0.5707  0.4099  0.5185  129 LYS C C     
3505 O O     . LYS C 129 ? 1.6540 3.5210 4.0653 0.6195  0.4315  0.5173  129 LYS C O     
3506 C CB    . LYS C 129 ? 1.3908 3.1861 4.0983 0.6963  0.1837  0.6885  129 LYS C CB    
3507 C CG    . LYS C 129 ? 1.6468 3.3712 4.5273 0.6764  0.1349  0.7606  129 LYS C CG    
3508 C CD    . LYS C 129 ? 1.6051 3.3220 4.5933 0.7066  0.2172  0.9052  129 LYS C CD    
3509 C CE    . LYS C 129 ? 1.5513 3.1490 4.7411 0.6364  0.2997  0.9394  129 LYS C CE    
3510 N NZ    . LYS C 129 ? 1.6478 3.2190 4.9471 0.6586  0.4190  1.0736  129 LYS C NZ    
3511 N N     . LEU C 130 ? 2.1306 3.8369 4.7094 0.4742  0.4110  0.4172  130 LEU C N     
3512 C CA    . LEU C 130 ? 2.1864 3.9090 4.6257 0.4027  0.4468  0.3016  130 LEU C CA    
3513 C C     . LEU C 130 ? 2.1590 3.8697 4.5778 0.3769  0.3479  0.2141  130 LEU C C     
3514 O O     . LEU C 130 ? 2.2677 4.0335 4.5606 0.3577  0.3435  0.1402  130 LEU C O     
3515 C CB    . LEU C 130 ? 2.3034 3.9323 4.7029 0.2765  0.5817  0.2657  130 LEU C CB    
3516 C CG    . LEU C 130 ? 2.3212 3.9272 4.6987 0.2672  0.7010  0.3261  130 LEU C CG    
3517 C CD1   . LEU C 130 ? 2.5490 4.0578 5.0992 0.2904  0.7402  0.4258  130 LEU C CD1   
3518 C CD2   . LEU C 130 ? 2.0922 3.6476 4.3194 0.1403  0.7839  0.2506  130 LEU C CD2   
3519 N N     . ASP C 131 ? 2.1450 3.7873 4.6726 0.3777  0.2681  0.2268  131 ASP C N     
3520 C CA    . ASP C 131 ? 2.1905 3.7803 4.6769 0.3177  0.2144  0.1403  131 ASP C CA    
3521 C C     . ASP C 131 ? 2.2031 3.8723 4.5836 0.3806  0.1004  0.0888  131 ASP C C     
3522 O O     . ASP C 131 ? 2.1889 3.8031 4.5402 0.3451  0.0393  0.0368  131 ASP C O     
3523 C CB    . ASP C 131 ? 2.3779 3.8585 4.9994 0.2961  0.1698  0.1701  131 ASP C CB    
3524 C CG    . ASP C 131 ? 2.5102 3.9095 5.2679 0.2700  0.2731  0.2500  131 ASP C CG    
3525 O OD1   . ASP C 131 ? 2.5771 3.9821 5.3003 0.2498  0.3862  0.2662  131 ASP C OD1   
3526 O OD2   . ASP C 131 ? 2.4719 3.7963 5.3653 0.2700  0.2437  0.3013  131 ASP C OD2   
3527 N N     . ASP C 132 ? 2.2451 4.0185 4.5586 0.4733  0.0755  0.1071  132 ASP C N     
3528 C CA    . ASP C 132 ? 2.1373 3.9684 4.3337 0.5304  -0.0010 0.0532  132 ASP C CA    
3529 C C     . ASP C 132 ? 1.8404 3.7501 3.9338 0.5297  0.0940  0.0239  132 ASP C C     
3530 O O     . ASP C 132 ? 1.8334 3.7527 3.8281 0.4882  0.1051  -0.0371 132 ASP C O     
3531 C CB    . ASP C 132 ? 2.3636 4.1924 4.4918 0.6431  -0.1399 0.1007  132 ASP C CB    
3532 C CG    . ASP C 132 ? 2.5643 4.3923 4.6354 0.6921  -0.1155 0.2040  132 ASP C CG    
3533 O OD1   . ASP C 132 ? 2.5385 4.4099 4.7176 0.6613  0.0180  0.2467  132 ASP C OD1   
3534 O OD2   . ASP C 132 ? 2.7632 4.5448 4.6743 0.7535  -0.2280 0.2432  132 ASP C OD2   
3535 N N     . ILE C 133 ? 3.4029 2.0643 3.6501 -0.2924 0.0939  -0.9359 133 ILE C N     
3536 C CA    . ILE C 133 ? 3.3346 1.8920 3.3669 -0.3293 0.0433  -0.9269 133 ILE C CA    
3537 C C     . ILE C 133 ? 3.5460 1.9977 3.3941 -0.2626 0.0918  -0.9482 133 ILE C C     
3538 O O     . ILE C 133 ? 3.5665 1.9627 3.2543 -0.2860 0.1037  -0.9335 133 ILE C O     
3539 C CB    . ILE C 133 ? 3.0113 1.5160 3.0122 -0.3660 -0.0996 -0.9237 133 ILE C CB    
3540 C CG1   . ILE C 133 ? 3.1151 1.5523 3.1217 -0.3013 -0.1506 -0.9591 133 ILE C CG1   
3541 C CG2   . ILE C 133 ? 3.0690 1.6768 3.2243 -0.4212 -0.1471 -0.9040 133 ILE C CG2   
3542 C CD1   . ILE C 133 ? 3.0981 1.4876 3.0924 -0.3331 -0.2877 -0.9463 133 ILE C CD1   
3543 N N     . ALA C 134 ? 3.5860 2.0049 3.4443 -0.1724 0.1176  -0.9834 134 ALA C N     
3544 C CA    . ALA C 134 ? 3.4617 1.7754 3.1317 -0.0898 0.1675  -1.0114 134 ALA C CA    
3545 C C     . ALA C 134 ? 3.7048 2.0833 3.3525 -0.0727 0.3062  -0.9851 134 ALA C C     
3546 O O     . ALA C 134 ? 3.8034 2.1023 3.2570 -0.0603 0.3250  -0.9881 134 ALA C O     
3547 C CB    . ALA C 134 ? 3.7039 1.9805 3.3967 0.0196  0.1819  -1.0523 134 ALA C CB    
3548 N N     . ASN C 135 ? 3.7256 2.2508 3.5808 -0.0708 0.4020  -0.9547 135 ASN C N     
3549 C CA    . ASN C 135 ? 3.6577 2.2579 3.5258 -0.0565 0.5392  -0.9170 135 ASN C CA    
3550 C C     . ASN C 135 ? 3.2704 1.8578 3.0475 -0.1495 0.5207  -0.8901 135 ASN C C     
3551 O O     . ASN C 135 ? 3.3236 1.8832 2.9582 -0.1273 0.5930  -0.8763 135 ASN C O     
3552 C CB    . ASN C 135 ? 3.3631 2.1273 3.5136 -0.0547 0.6244  -0.8787 135 ASN C CB    
3553 C CG    . ASN C 135 ? 3.4188 2.2654 3.6066 -0.0133 0.7822  -0.8307 135 ASN C CG    
3554 O OD1   . ASN C 135 ? 3.5869 2.3673 3.5753 0.0487  0.8434  -0.8344 135 ASN C OD1   
3555 N ND2   . ASN C 135 ? 3.3869 2.3786 3.8367 -0.0456 0.8449  -0.7820 135 ASN C ND2   
3556 N N     . SER C 136 ? 3.1430 1.7516 2.9923 -0.2459 0.4259  -0.8797 136 SER C N     
3557 C CA    . SER C 136 ? 3.2810 1.8801 3.0420 -0.3267 0.4094  -0.8488 136 SER C CA    
3558 C C     . SER C 136 ? 3.1745 1.6434 2.6802 -0.3217 0.3588  -0.8576 136 SER C C     
3559 O O     . SER C 136 ? 3.2636 1.7192 2.6497 -0.3371 0.4101  -0.8320 136 SER C O     
3560 C CB    . SER C 136 ? 2.9355 1.5753 2.8042 -0.4112 0.3113  -0.8373 136 SER C CB    
3561 O OG    . SER C 136 ? 2.9572 1.5264 2.7733 -0.4156 0.1861  -0.8582 136 SER C OG    
3562 N N     . PHE C 137 ? 3.2240 1.5950 2.6530 -0.3022 0.2526  -0.8903 137 PHE C N     
3563 C CA    . PHE C 137 ? 3.3677 1.6052 2.5752 -0.3004 0.1836  -0.8988 137 PHE C CA    
3564 C C     . PHE C 137 ? 3.6418 1.8241 2.6962 -0.2175 0.2727  -0.9207 137 PHE C C     
3565 O O     . PHE C 137 ? 3.5133 1.6313 2.3957 -0.2320 0.2638  -0.9083 137 PHE C O     
3566 C CB    . PHE C 137 ? 3.5319 1.6737 2.7217 -0.2892 0.0522  -0.9299 137 PHE C CB    
3567 C CG    . PHE C 137 ? 3.6421 1.6363 2.6304 -0.2918 -0.0400 -0.9377 137 PHE C CG    
3568 C CD1   . PHE C 137 ? 3.6244 1.6856 2.6257 -0.3607 -0.1254 -0.8639 137 PHE C CD1   
3569 C CD2   . PHE C 137 ? 3.7349 1.6151 2.5921 -0.2031 -0.0453 -0.9908 137 PHE C CD2   
3570 C CE1   . PHE C 137 ? 3.5272 1.5493 2.4363 -0.3566 -0.2048 -0.8394 137 PHE C CE1   
3571 C CE2   . PHE C 137 ? 3.8729 1.7166 2.6360 -0.2002 -0.1395 -0.9729 137 PHE C CE2   
3572 C CZ    . PHE C 137 ? 3.6239 1.5362 2.4197 -0.2837 -0.2162 -0.8956 137 PHE C CZ    
3573 N N     . ASN C 138 ? 3.7776 1.9867 2.8878 -0.1225 0.3584  -0.9491 138 ASN C N     
3574 C CA    . ASN C 138 ? 3.7988 1.9604 2.7524 -0.0229 0.4509  -0.9677 138 ASN C CA    
3575 C C     . ASN C 138 ? 3.8241 2.0742 2.7727 -0.0443 0.5711  -0.9167 138 ASN C C     
3576 O O     . ASN C 138 ? 4.0688 2.2562 2.8244 -0.0096 0.6018  -0.9184 138 ASN C O     
3577 C CB    . ASN C 138 ? 3.8150 2.0039 2.8439 0.0945  0.5268  -0.9957 138 ASN C CB    
3578 C CG    . ASN C 138 ? 3.9242 1.9983 2.9150 0.1362  0.4127  -1.0528 138 ASN C CG    
3579 O OD1   . ASN C 138 ? 4.0651 1.9942 2.8939 0.1174  0.2911  -1.0847 138 ASN C OD1   
3580 N ND2   . ASN C 138 ? 3.9262 2.0663 3.0800 0.1905  0.4478  -1.0603 138 ASN C ND2   
3581 N N     . LEU C 139 ? 3.6628 2.0531 2.8218 -0.1019 0.6326  -0.8714 139 LEU C N     
3582 C CA    . LEU C 139 ? 3.4112 1.8808 2.5824 -0.1333 0.7379  -0.8184 139 LEU C CA    
3583 C C     . LEU C 139 ? 3.3769 1.7791 2.3801 -0.2086 0.6705  -0.8013 139 LEU C C     
3584 O O     . LEU C 139 ? 3.4268 1.8131 2.2888 -0.1887 0.7361  -0.7810 139 LEU C O     
3585 C CB    . LEU C 139 ? 3.2548 1.8649 2.6932 -0.1930 0.7831  -0.7794 139 LEU C CB    
3586 C CG    . LEU C 139 ? 3.1911 1.8962 2.6999 -0.2136 0.9091  -0.7211 139 LEU C CG    
3587 C CD1   . LEU C 139 ? 3.6252 2.3718 3.1192 -0.1011 1.0563  -0.7022 139 LEU C CD1   
3588 C CD2   . LEU C 139 ? 3.0483 1.8632 2.8222 -0.2867 0.9105  -0.6934 139 LEU C CD2   
3589 N N     . GLY C 140 ? 3.3789 1.7487 2.3986 -0.2905 0.5414  -0.8018 140 GLY C N     
3590 C CA    . GLY C 140 ? 3.2603 1.5781 2.1380 -0.3600 0.4745  -0.7715 140 GLY C CA    
3591 C C     . GLY C 140 ? 3.6384 1.8321 2.2840 -0.3156 0.4371  -0.7934 140 GLY C C     
3592 O O     . GLY C 140 ? 3.6039 1.7835 2.1184 -0.3321 0.4656  -0.7623 140 GLY C O     
3593 N N     . LEU C 141 ? 3.8112 1.9075 2.4015 -0.2559 0.3673  -0.8491 141 LEU C N     
3594 C CA    . LEU C 141 ? 3.8881 1.8435 2.2538 -0.2091 0.3091  -0.8818 141 LEU C CA    
3595 C C     . LEU C 141 ? 3.9379 1.8969 2.1782 -0.1196 0.4368  -0.8908 141 LEU C C     
3596 O O     . LEU C 141 ? 3.9972 1.9192 2.0842 -0.1047 0.4020  -0.8762 141 LEU C O     
3597 C CB    . LEU C 141 ? 4.0831 1.9547 2.4502 -0.1525 0.2028  -0.9353 141 LEU C CB    
3598 C CG    . LEU C 141 ? 4.1915 2.0479 2.5863 -0.2102 0.0267  -0.9039 141 LEU C CG    
3599 C CD1   . LEU C 141 ? 4.4036 2.1662 2.7632 -0.1366 -0.0573 -0.9620 141 LEU C CD1   
3600 C CD2   . LEU C 141 ? 4.0750 1.9433 2.3724 -0.2577 -0.0127 -0.8438 141 LEU C CD2   
3601 N N     . SER C 142 ? 4.1054 2.1630 2.4589 -0.0528 0.5735  -0.8896 142 SER C N     
3602 C CA    . SER C 142 ? 4.2421 2.3245 2.4903 0.0383  0.7101  -0.8812 142 SER C CA    
3603 C C     . SER C 142 ? 4.0797 2.2250 2.2967 -0.0301 0.7668  -0.8177 142 SER C C     
3604 O O     . SER C 142 ? 4.4060 2.5278 2.4562 0.0155  0.7963  -0.8058 142 SER C O     
3605 C CB    . SER C 142 ? 4.3035 2.5018 2.7208 0.1182  0.8497  -0.8708 142 SER C CB    
3606 O OG    . SER C 142 ? 4.3566 2.5964 2.6862 0.2123  0.9941  -0.8469 142 SER C OG    
3607 N N     . TYR C 143 ? 3.9041 2.1447 2.2920 -0.1352 0.7684  -0.7687 143 TYR C N     
3608 C CA    . TYR C 143 ? 3.9797 2.2656 2.3266 -0.2019 0.8094  -0.7087 143 TYR C CA    
3609 C C     . TYR C 143 ? 4.1652 2.3420 2.3093 -0.2421 0.6931  -0.7080 143 TYR C C     
3610 O O     . TYR C 143 ? 4.1890 2.3975 2.2418 -0.2421 0.7240  -0.6583 143 TYR C O     
3611 C CB    . TYR C 143 ? 3.7861 2.1726 2.3341 -0.2997 0.8154  -0.6643 143 TYR C CB    
3612 C CG    . TYR C 143 ? 3.5599 1.9816 2.0503 -0.3595 0.8578  -0.6032 143 TYR C CG    
3613 C CD1   . TYR C 143 ? 3.7757 2.2662 2.2700 -0.3228 1.0048  -0.5659 143 TYR C CD1   
3614 C CD2   . TYR C 143 ? 3.3623 1.7519 1.7939 -0.4448 0.7564  -0.5746 143 TYR C CD2   
3615 C CE1   . TYR C 143 ? 3.8050 2.3242 2.2442 -0.3727 1.0472  -0.5089 143 TYR C CE1   
3616 C CE2   . TYR C 143 ? 3.5808 2.0033 1.9533 -0.4907 0.8006  -0.5147 143 TYR C CE2   
3617 C CZ    . TYR C 143 ? 3.6295 2.1126 2.0038 -0.4558 0.9447  -0.4858 143 TYR C CZ    
3618 O OH    . TYR C 143 ? 3.3084 1.8549 1.6891 -0.4904 0.9574  -0.4050 143 TYR C OH    
3619 N N     . MET C 144 ? 4.0987 2.1983 2.2362 -0.2745 0.5399  -0.7328 144 MET C N     
3620 C CA    . MET C 144 ? 4.0616 2.1170 2.0955 -0.3128 0.4074  -0.6972 144 MET C CA    
3621 C C     . MET C 144 ? 4.4142 2.4126 2.2830 -0.2260 0.3976  -0.7188 144 MET C C     
3622 O O     . MET C 144 ? 4.5529 2.5465 2.3248 -0.2487 0.3603  -0.6754 144 MET C O     
3623 C CB    . MET C 144 ? 4.0745 2.0877 2.1815 -0.3502 0.2490  -0.7058 144 MET C CB    
3624 C CG    . MET C 144 ? 4.0067 2.0894 2.2863 -0.4230 0.2307  -0.6801 144 MET C CG    
3625 S SD    . MET C 144 ? 3.9681 2.1326 2.2637 -0.5226 0.2210  -0.5801 144 MET C SD    
3626 C CE    . MET C 144 ? 3.8635 1.9662 2.0281 -0.5323 0.0968  -0.5347 144 MET C CE    
3627 N N     . GLU C 145 ? 4.4277 2.3851 2.2652 -0.1207 0.4285  -0.7844 145 GLU C N     
3628 C CA    . GLU C 145 ? 4.3375 2.2538 2.0196 -0.0217 0.4262  -0.8088 145 GLU C CA    
3629 C C     . GLU C 145 ? 4.3896 2.4036 2.0334 0.0111  0.5653  -0.7587 145 GLU C C     
3630 O O     . GLU C 145 ? 4.6074 2.6124 2.1303 0.0405  0.5392  -0.7431 145 GLU C O     
3631 C CB    . GLU C 145 ? 4.5112 2.3742 2.1750 0.0945  0.4355  -0.8847 145 GLU C CB    
3632 C CG    . GLU C 145 ? 4.7321 2.5024 2.4403 0.0735  0.2872  -0.9314 145 GLU C CG    
3633 C CD    . GLU C 145 ? 5.1439 2.8775 2.8674 0.1831  0.3231  -0.9993 145 GLU C CD    
3634 O OE1   . GLU C 145 ? 5.2707 3.0624 2.9843 0.2745  0.4716  -1.0023 145 GLU C OE1   
3635 O OE2   . GLU C 145 ? 5.2798 2.9395 3.0399 0.1809  0.2077  -1.0391 145 GLU C OE2   
3636 N N     . SER C 146 ? 4.3505 2.4675 2.1195 0.0039  0.7086  -0.7277 146 SER C N     
3637 C CA    . SER C 146 ? 4.3679 2.6066 2.1594 0.0249  0.8361  -0.6605 146 SER C CA    
3638 C C     . SER C 146 ? 4.2011 2.4817 2.0020 -0.0793 0.8117  -0.5889 146 SER C C     
3639 O O     . SER C 146 ? 4.4348 2.8216 2.2764 -0.0686 0.8962  -0.5254 146 SER C O     
3640 C CB    . SER C 146 ? 4.5114 2.8559 2.4763 0.0483  0.9894  -0.6407 146 SER C CB    
3641 O OG    . SER C 146 ? 4.6205 2.9805 2.7216 -0.0622 0.9943  -0.6304 146 SER C OG    
3642 N N     . LEU C 147 ? 4.0929 2.3050 1.8769 -0.1744 0.6932  -0.5887 147 LEU C N     
3643 C CA    . LEU C 147 ? 4.1768 2.4344 1.9738 -0.2661 0.6741  -0.5124 147 LEU C CA    
3644 C C     . LEU C 147 ? 4.4564 2.7014 2.1273 -0.2437 0.6231  -0.4816 147 LEU C C     
3645 O O     . LEU C 147 ? 4.2463 2.5809 1.9521 -0.2618 0.6713  -0.4132 147 LEU C O     
3646 C CB    . LEU C 147 ? 3.7378 1.9447 1.5705 -0.3665 0.5654  -0.5089 147 LEU C CB    
3647 C CG    . LEU C 147 ? 3.5263 1.7837 1.3767 -0.4567 0.5483  -0.4238 147 LEU C CG    
3648 C CD1   . LEU C 147 ? 3.3906 1.7675 1.3522 -0.4598 0.6807  -0.3759 147 LEU C CD1   
3649 C CD2   . LEU C 147 ? 4.0774 2.3064 1.9815 -0.5394 0.4502  -0.4147 147 LEU C CD2   
3650 N N     . LEU C 148 ? 5.0434 3.1814 2.5878 -0.2027 0.5166  -0.5329 148 LEU C N     
3651 C CA    . LEU C 148 ? 5.3569 3.4704 2.7781 -0.1822 0.4586  -0.5138 148 LEU C CA    
3652 C C     . LEU C 148 ? 5.6808 3.8380 3.0405 -0.0617 0.5390  -0.5389 148 LEU C C     
3653 O O     . LEU C 148 ? 5.6830 3.9160 3.0233 -0.0442 0.5782  -0.4923 148 LEU C O     
3654 C CB    . LEU C 148 ? 5.5601 3.5353 2.8912 -0.2031 0.2865  -0.5513 148 LEU C CB    
3655 C CG    . LEU C 148 ? 5.6320 3.5671 2.8460 -0.2071 0.2044  -0.5251 148 LEU C CG    
3656 C CD1   . LEU C 148 ? 5.4311 3.4348 2.6928 -0.3053 0.2127  -0.4264 148 LEU C CD1   
3657 C CD2   . LEU C 148 ? 5.7003 3.4949 2.8502 -0.2101 0.0307  -0.5707 148 LEU C CD2   
3658 N N     . ILE D 2   ? 1.0973 2.8176 2.3244 0.2606  -0.2960 0.3532  2   ILE D N     
3659 C CA    . ILE D 2   ? 1.3487 3.0584 2.5496 0.1152  -0.2801 0.4925  2   ILE D CA    
3660 C C     . ILE D 2   ? 1.6592 3.2936 2.9421 0.0325  -0.2557 0.4618  2   ILE D C     
3661 O O     . ILE D 2   ? 1.4117 2.9828 2.7850 0.0314  -0.2218 0.3148  2   ILE D O     
3662 C CB    . ILE D 2   ? 1.2937 2.9824 2.4789 0.0464  -0.2625 0.4952  2   ILE D CB    
3663 C CG1   . ILE D 2   ? 1.2674 2.9052 2.4228 -0.1208 -0.2487 0.6161  2   ILE D CG1   
3664 C CG2   . ILE D 2   ? 1.5081 3.1981 2.8354 0.0802  -0.2410 0.3276  2   ILE D CG2   
3665 C CD1   . ILE D 2   ? 1.1833 2.7866 2.2970 -0.1820 -0.2279 0.6257  2   ILE D CD1   
3666 N N     . ILE D 3   ? 1.9165 3.4446 3.0934 -0.0426 -0.2537 0.5671  3   ILE D N     
3667 C CA    . ILE D 3   ? 2.1048 3.4382 3.2527 -0.1155 -0.2189 0.5160  3   ILE D CA    
3668 C C     . ILE D 3   ? 2.0881 3.2532 3.1448 -0.2881 -0.1885 0.5681  3   ILE D C     
3669 O O     . ILE D 3   ? 2.1604 3.3493 3.1398 -0.3529 -0.2079 0.6983  3   ILE D O     
3670 C CB    . ILE D 3   ? 2.2267 3.5529 3.3245 -0.0634 -0.2397 0.5895  3   ILE D CB    
3671 C CG1   . ILE D 3   ? 2.2069 3.7088 3.3828 0.1269  -0.2705 0.5339  3   ILE D CG1   
3672 C CG2   . ILE D 3   ? 2.1953 3.3104 3.2546 -0.1422 -0.2064 0.5401  3   ILE D CG2   
3673 C CD1   . ILE D 3   ? 2.4519 3.9314 3.5819 0.1983  -0.2797 0.5849  3   ILE D CD1   
3674 N N     . CYS D 4   ? 2.0001 3.0043 3.0678 -0.3563 -0.1410 0.4625  4   CYS D N     
3675 C CA    . CYS D 4   ? 1.9442 2.7812 2.9195 -0.5066 -0.1087 0.4930  4   CYS D CA    
3676 C C     . CYS D 4   ? 2.0216 2.6749 2.9568 -0.5603 -0.0835 0.4446  4   CYS D C     
3677 O O     . CYS D 4   ? 2.3711 2.9673 3.3758 -0.5304 -0.0471 0.3130  4   CYS D O     
3678 C CB    . CYS D 4   ? 1.9141 2.7316 2.9331 -0.5378 -0.0638 0.4154  4   CYS D CB    
3679 S SG    . CYS D 4   ? 2.2476 2.8496 3.1483 -0.6985 -0.0124 0.4277  4   CYS D SG    
3680 N N     . SER D 5   ? 1.6986 2.2612 2.5307 -0.6390 -0.1028 0.5458  5   SER D N     
3681 C CA    . SER D 5   ? 1.8269 2.2077 2.6110 -0.6922 -0.0848 0.5078  5   SER D CA    
3682 C C     . SER D 5   ? 2.2415 2.4637 2.9304 -0.8314 -0.0604 0.5160  5   SER D C     
3683 O O     . SER D 5   ? 2.6531 2.8849 3.2529 -0.8699 -0.0786 0.5923  5   SER D O     
3684 C CB    . SER D 5   ? 1.8934 2.2685 2.6384 -0.6750 -0.1224 0.6062  5   SER D CB    
3685 O OG    . SER D 5   ? 2.3451 2.7480 3.0261 -0.7499 -0.1534 0.7477  5   SER D OG    
3686 N N     . VAL D 6   ? 2.2012 2.2741 2.8823 -0.8637 -0.0157 0.4099  6   VAL D N     
3687 C CA    . VAL D 6   ? 2.2344 2.1620 2.8094 -0.9287 0.0262  0.3711  6   VAL D CA    
3688 C C     . VAL D 6   ? 2.6857 2.4428 3.1976 -0.9609 0.0361  0.3322  6   VAL D C     
3689 O O     . VAL D 6   ? 2.8553 2.5570 3.4297 -0.9648 0.0460  0.2685  6   VAL D O     
3690 C CB    . VAL D 6   ? 1.9862 1.9079 2.6250 -0.9209 0.0894  0.2742  6   VAL D CB    
3691 C CG1   . VAL D 6   ? 2.4429 2.2425 2.9840 -0.9342 0.1295  0.2536  6   VAL D CG1   
3692 C CG2   . VAL D 6   ? 1.8147 1.9117 2.5394 -0.8843 0.0779  0.3044  6   VAL D CG2   
3693 N N     . ASP D 7   ? 2.8651 2.5489 3.2653 -0.9823 0.0257  0.3655  7   ASP D N     
3694 C CA    . ASP D 7   ? 3.0998 2.6304 3.4479 -1.0083 0.0401  0.3163  7   ASP D CA    
3695 C C     . ASP D 7   ? 3.1342 2.6133 3.4639 -1.0079 0.0834  0.2553  7   ASP D C     
3696 O O     . ASP D 7   ? 3.1969 2.7041 3.4639 -1.0144 0.0810  0.2877  7   ASP D O     
3697 C CB    . ASP D 7   ? 3.5334 3.0285 3.7982 -1.0361 -0.0031 0.3812  7   ASP D CB    
3698 C CG    . ASP D 7   ? 3.8500 3.1978 4.0682 -1.0640 0.0048  0.3292  7   ASP D CG    
3699 O OD1   . ASP D 7   ? 3.8316 3.1022 4.0844 -1.0549 0.0346  0.2541  7   ASP D OD1   
3700 O OD2   . ASP D 7   ? 4.0363 3.3513 4.1887 -1.0954 -0.0243 0.3602  7   ASP D OD2   
3701 N N     . ILE D 8   ? 3.2195 2.6271 3.5975 -0.9991 0.1139  0.1744  8   ILE D N     
3702 C CA    . ILE D 8   ? 3.3299 2.6938 3.6859 -0.9943 0.1493  0.1266  8   ILE D CA    
3703 C C     . ILE D 8   ? 3.7171 2.9635 3.9664 -1.0237 0.1427  0.1146  8   ILE D C     
3704 O O     . ILE D 8   ? 3.7544 2.9359 3.9815 -1.0396 0.1149  0.1136  8   ILE D O     
3705 C CB    . ILE D 8   ? 3.2923 2.6455 3.7158 -0.9686 0.1833  0.0378  8   ILE D CB    
3706 C CG1   . ILE D 8   ? 3.1231 2.5887 3.6576 -0.9472 0.1806  0.0296  8   ILE D CG1   
3707 C CG2   . ILE D 8   ? 3.3339 2.6742 3.7312 -0.9579 0.2375  0.0013  8   ILE D CG2   
3708 C CD1   . ILE D 8   ? 3.0055 2.4452 3.5833 -0.9437 0.1687  -0.0097 8   ILE D CD1   
3709 N N     . GLY D 9   ? 3.8704 3.0842 4.0473 -1.0342 0.1703  0.1049  9   GLY D N     
3710 C CA    . GLY D 9   ? 4.1708 3.2721 4.2357 -1.0674 0.1678  0.0840  9   GLY D CA    
3711 C C     . GLY D 9   ? 4.3057 3.3937 4.2618 -1.0930 0.1849  0.1070  9   GLY D C     
3712 O O     . GLY D 9   ? 4.3252 3.4933 4.2689 -1.0964 0.1688  0.1654  9   GLY D O     
3713 N N     . ILE D 10  ? 4.4049 3.3878 4.2675 -1.1119 0.2204  0.0604  10  ILE D N     
3714 C CA    . ILE D 10  ? 4.3365 3.2830 4.0645 -1.1468 0.2364  0.0818  10  ILE D CA    
3715 C C     . ILE D 10  ? 4.2400 3.1701 3.8764 -1.1963 0.1670  0.1220  10  ILE D C     
3716 O O     . ILE D 10  ? 4.2709 3.1924 3.7917 -1.2321 0.1596  0.1519  10  ILE D O     
3717 C CB    . ILE D 10  ? 4.3463 3.1697 3.9802 -1.1578 0.3030  0.0189  10  ILE D CB    
3718 C CG1   . ILE D 10  ? 4.4975 3.2132 4.0811 -1.1800 0.2760  -0.0281 10  ILE D CG1   
3719 C CG2   . ILE D 10  ? 4.1235 2.9691 3.8542 -1.1102 0.3775  -0.0261 10  ILE D CG2   
3720 C CD1   . ILE D 10  ? 4.6056 3.1958 4.0925 -1.1869 0.3466  -0.0953 10  ILE D CD1   
3721 N N     . LYS D 11  ? 4.0357 2.9580 3.7204 -1.2012 0.1162  0.1222  11  LYS D N     
3722 C CA    . LYS D 11  ? 4.3506 3.2663 3.9801 -1.2468 0.0471  0.1591  11  LYS D CA    
3723 C C     . LYS D 11  ? 4.3192 3.3586 3.9604 -1.2502 0.0136  0.2337  11  LYS D C     
3724 O O     . LYS D 11  ? 4.5068 3.5502 4.0437 -1.2924 -0.0137 0.2614  11  LYS D O     
3725 C CB    . LYS D 11  ? 4.5131 3.3981 4.2200 -1.2399 0.0158  0.1466  11  LYS D CB    
3726 C CG    . LYS D 11  ? 4.3052 3.2448 4.1470 -1.1842 0.0434  0.1386  11  LYS D CG    
3727 C CD    . LYS D 11  ? 4.2833 3.1838 4.1847 -1.1812 0.0150  0.1350  11  LYS D CD    
3728 C CE    . LYS D 11  ? 3.8762 2.8395 3.8931 -1.1355 0.0339  0.1380  11  LYS D CE    
3729 N NZ    . LYS D 11  ? 3.5193 2.4694 3.5737 -1.1011 0.0810  0.0730  11  LYS D NZ    
3730 N N     . ASN D 12  ? 4.1112 3.2502 3.8693 -1.2076 0.0132  0.2645  12  ASN D N     
3731 C CA    . ASN D 12  ? 3.9211 3.1835 3.6977 -1.2027 -0.0213 0.3348  12  ASN D CA    
3732 C C     . ASN D 12  ? 3.5991 2.9508 3.4950 -1.1461 0.0029  0.3465  12  ASN D C     
3733 O O     . ASN D 12  ? 3.5140 2.8958 3.4695 -1.1371 -0.0219 0.3711  12  ASN D O     
3734 C CB    . ASN D 12  ? 3.9008 3.1684 3.6602 -1.2437 -0.0889 0.3755  12  ASN D CB    
3735 C CG    . ASN D 12  ? 4.0277 3.2178 3.8416 -1.2451 -0.0943 0.3495  12  ASN D CG    
3736 O OD1   . ASN D 12  ? 4.1004 3.2485 3.9690 -1.2115 -0.0538 0.3048  12  ASN D OD1   
3737 N ND2   . ASN D 12  ? 4.2382 3.4080 4.0430 -1.2858 -0.1450 0.3770  12  ASN D ND2   
3738 N N     . PRO D 13  ? 3.3179 2.7093 3.2496 -1.1107 0.0513  0.3308  13  PRO D N     
3739 C CA    . PRO D 13  ? 3.1809 2.6570 3.2276 -1.0638 0.0691  0.3347  13  PRO D CA    
3740 C C     . PRO D 13  ? 3.2899 2.8893 3.3384 -1.0540 0.0248  0.4079  13  PRO D C     
3741 O O     . PRO D 13  ? 3.7421 3.3856 3.7197 -1.0690 -0.0028 0.4500  13  PRO D O     
3742 C CB    . PRO D 13  ? 2.7727 2.2520 2.8556 -1.0369 0.1301  0.2981  13  PRO D CB    
3743 C CG    . PRO D 13  ? 2.8523 2.2972 2.8140 -1.0651 0.1337  0.3152  13  PRO D CG    
3744 C CD    . PRO D 13  ? 2.9683 2.3294 2.8346 -1.1155 0.0920  0.3134  13  PRO D CD    
3745 N N     . ALA D 14  ? 2.0098 5.5651 5.9421 0.2919  0.2118  -0.1155 14  ALA D N     
3746 C CA    . ALA D 14  ? 1.6370 5.1000 5.5344 0.2910  0.2007  -0.1178 14  ALA D CA    
3747 C C     . ALA D 14  ? 1.3837 4.7699 5.3332 0.2866  0.1493  -0.1093 14  ALA D C     
3748 O O     . ALA D 14  ? 1.4076 4.7903 5.4301 0.2921  0.1170  -0.1104 14  ALA D O     
3749 C CB    . ALA D 14  ? 1.6681 5.0655 5.5657 0.3073  0.2104  -0.1549 14  ALA D CB    
3750 N N     . TYR D 15  ? 1.3785 4.6990 5.2951 0.2730  0.1429  -0.0970 15  TYR D N     
3751 C CA    . TYR D 15  ? 1.3763 4.6133 5.3442 0.2592  0.0975  -0.0813 15  TYR D CA    
3752 C C     . TYR D 15  ? 1.5044 4.6396 5.4564 0.2474  0.0924  -0.0882 15  TYR D C     
3753 O O     . TYR D 15  ? 1.4622 4.6007 5.3455 0.2450  0.1291  -0.0924 15  TYR D O     
3754 C CB    . TYR D 15  ? 1.3664 4.6431 5.3238 0.2407  0.0942  -0.0461 15  TYR D CB    
3755 C CG    . TYR D 15  ? 1.3409 4.6499 5.2206 0.2268  0.1314  -0.0318 15  TYR D CG    
3756 C CD1   . TYR D 15  ? 1.3269 4.7497 5.1527 0.2279  0.1651  -0.0301 15  TYR D CD1   
3757 C CD2   . TYR D 15  ? 1.5165 4.7438 5.3839 0.2070  0.1316  -0.0177 15  TYR D CD2   
3758 C CE1   . TYR D 15  ? 1.3568 4.8108 5.1183 0.2113  0.1924  -0.0171 15  TYR D CE1   
3759 C CE2   . TYR D 15  ? 1.4965 4.7473 5.3029 0.1941  0.1647  -0.0045 15  TYR D CE2   
3760 C CZ    . TYR D 15  ? 1.4590 4.8227 5.2129 0.1970  0.1922  -0.0053 15  TYR D CZ    
3761 O OH    . TYR D 15  ? 1.2870 4.6735 4.9875 0.1801  0.2188  0.0059  15  TYR D OH    
3762 N N     . ALA D 16  ? 1.4443 4.4915 5.4633 0.2353  0.0443  -0.0866 16  ALA D N     
3763 C CA    . ALA D 16  ? 1.3832 4.3303 5.4032 0.2134  0.0298  -0.0931 16  ALA D CA    
3764 C C     . ALA D 16  ? 1.4253 4.3165 5.4943 0.1751  -0.0072 -0.0567 16  ALA D C     
3765 O O     . ALA D 16  ? 1.4112 4.3019 5.5441 0.1688  -0.0496 -0.0359 16  ALA D O     
3766 C CB    . ALA D 16  ? 1.3991 4.2902 5.4561 0.2236  0.0004  -0.1280 16  ALA D CB    
3767 N N     . ILE D 17  ? 1.3767 4.2199 5.4174 0.1460  0.0110  -0.0475 17  ILE D N     
3768 C CA    . ILE D 17  ? 1.3845 4.1719 5.4660 0.0993  -0.0132 -0.0129 17  ILE D CA    
3769 C C     . ILE D 17  ? 1.3903 4.0777 5.4963 0.0589  -0.0369 -0.0309 17  ILE D C     
3770 O O     . ILE D 17  ? 1.5819 4.2400 5.6420 0.0564  -0.0015 -0.0582 17  ILE D O     
3771 C CB    . ILE D 17  ? 1.3690 4.1833 5.4058 0.0889  0.0318  0.0130  17  ILE D CB    
3772 C CG1   . ILE D 17  ? 1.3599 4.2840 5.3566 0.1252  0.0559  0.0204  17  ILE D CG1   
3773 C CG2   . ILE D 17  ? 1.3818 4.1489 5.4653 0.0402  0.0098  0.0519  17  ILE D CG2   
3774 C CD1   . ILE D 17  ? 1.3477 4.3037 5.3029 0.1140  0.0913  0.0477  17  ILE D CD1   
3775 N N     . PHE D 18  ? 1.6318 4.2691 5.8073 0.0227  -0.1003 -0.0155 18  PHE D N     
3776 C CA    . PHE D 18  ? 1.8271 4.3293 5.9475 -0.0355 -0.1368 -0.0269 18  PHE D CA    
3777 C C     . PHE D 18  ? 2.1506 4.5662 6.2257 -0.1078 -0.1586 0.0152  18  PHE D C     
3778 O O     . PHE D 18  ? 1.7924 4.2734 5.9335 -0.1061 -0.1605 0.0560  18  PHE D O     
3779 C CB    . PHE D 18  ? 1.8230 4.2877 5.9668 -0.0323 -0.2019 -0.0383 18  PHE D CB    
3780 C CG    . PHE D 18  ? 1.4498 4.0122 5.6652 0.0389  -0.1843 -0.0776 18  PHE D CG    
3781 C CD1   . PHE D 18  ? 1.5080 4.1093 5.6601 0.0767  -0.1173 -0.1131 18  PHE D CD1   
3782 C CD2   . PHE D 18  ? 1.4696 4.0499 5.7502 0.0629  -0.2304 -0.0754 18  PHE D CD2   
3783 C CE1   . PHE D 18  ? 1.5284 4.1762 5.6517 0.1313  -0.0948 -0.1455 18  PHE D CE1   
3784 C CE2   . PHE D 18  ? 1.4657 4.0895 5.7278 0.1210  -0.2038 -0.1129 18  PHE D CE2   
3785 C CZ    . PHE D 18  ? 1.4358 4.0947 5.6159 0.1526  -0.1354 -0.1482 18  PHE D CZ    
3786 N N     . ASN D 19  ? 2.9670 5.2357 6.9249 -0.1767 -0.1728 0.0029  19  ASN D N     
3787 C CA    . ASN D 19  ? 3.2291 5.3990 7.1352 -0.2624 -0.2061 0.0387  19  ASN D CA    
3788 C C     . ASN D 19  ? 3.5739 5.6279 7.4148 -0.3188 -0.2759 0.0315  19  ASN D C     
3789 O O     . ASN D 19  ? 3.6132 5.5808 7.3612 -0.3421 -0.2709 -0.0114 19  ASN D O     
3790 C CB    . ASN D 19  ? 3.2276 5.3282 7.0540 -0.3141 -0.1498 0.0319  19  ASN D CB    
3791 C CG    . ASN D 19  ? 3.1877 5.3367 7.0144 -0.2621 -0.0786 -0.0039 19  ASN D CG    
3792 O OD1   . ASN D 19  ? 3.1962 5.3501 7.0031 -0.2245 -0.0746 -0.0432 19  ASN D OD1   
3793 N ND2   . ASN D 19  ? 3.1618 5.3479 7.0140 -0.2622 -0.0225 0.0127  19  ASN D ND2   
3794 N N     . TYR D 20  ? 3.7749 5.8287 7.6663 -0.3436 -0.3433 0.0757  20  TYR D N     
3795 C CA    . TYR D 20  ? 3.9904 5.9477 7.8419 -0.4005 -0.4213 0.0818  20  TYR D CA    
3796 C C     . TYR D 20  ? 4.0432 5.9019 7.8276 -0.5130 -0.4624 0.1270  20  TYR D C     
3797 O O     . TYR D 20  ? 4.1011 6.0051 7.9464 -0.5233 -0.4791 0.1802  20  TYR D O     
3798 C CB    . TYR D 20  ? 4.0646 6.1020 8.0463 -0.3415 -0.4749 0.0990  20  TYR D CB    
3799 C CG    . TYR D 20  ? 4.2084 6.1536 8.1708 -0.4015 -0.5636 0.1167  20  TYR D CG    
3800 C CD1   . TYR D 20  ? 4.2557 6.1271 8.1460 -0.4118 -0.5799 0.0718  20  TYR D CD1   
3801 C CD2   . TYR D 20  ? 4.2543 6.1886 8.2721 -0.4509 -0.6340 0.1820  20  TYR D CD2   
3802 C CE1   . TYR D 20  ? 4.3403 6.1304 8.2168 -0.4715 -0.6665 0.0916  20  TYR D CE1   
3803 C CE2   . TYR D 20  ? 4.3283 6.1829 8.3380 -0.5123 -0.7209 0.2064  20  TYR D CE2   
3804 C CZ    . TYR D 20  ? 4.3807 6.1639 8.3210 -0.5232 -0.7381 0.1611  20  TYR D CZ    
3805 O OH    . TYR D 20  ? 4.4426 6.1494 8.3786 -0.5889 -0.8299 0.1891  20  TYR D OH    
3806 N N     . ASP D 21  ? 3.7495 5.4760 7.4050 -0.6022 -0.4772 0.1048  21  ASP D N     
3807 C CA    . ASP D 21  ? 3.3887 5.0158 6.9716 -0.7263 -0.5240 0.1453  21  ASP D CA    
3808 C C     . ASP D 21  ? 3.5701 5.1938 7.2127 -0.7472 -0.6244 0.1919  21  ASP D C     
3809 O O     . ASP D 21  ? 3.3777 4.9757 7.0198 -0.7326 -0.6664 0.1682  21  ASP D O     
3810 C CB    . ASP D 21  ? 3.1986 4.6900 6.6267 -0.8227 -0.5060 0.1001  21  ASP D CB    
3811 C CG    . ASP D 21  ? 2.9632 4.4458 6.3448 -0.8238 -0.4089 0.0658  21  ASP D CG    
3812 O OD1   . ASP D 21  ? 2.8143 4.3778 6.2673 -0.7829 -0.3678 0.0942  21  ASP D OD1   
3813 O OD2   . ASP D 21  ? 2.9568 4.3518 6.2359 -0.8671 -0.3747 0.0111  21  ASP D OD2   
3814 N N     . ASN D 22  ? 3.6993 5.3500 7.3985 -0.7813 -0.6635 0.2605  22  ASN D N     
3815 C CA    . ASN D 22  ? 3.7187 5.3866 7.5100 -0.7889 -0.7574 0.3151  22  ASN D CA    
3816 C C     . ASN D 22  ? 3.6929 5.2374 7.3927 -0.9053 -0.8341 0.3275  22  ASN D C     
3817 O O     . ASN D 22  ? 3.8882 5.3355 7.4581 -1.0232 -0.8308 0.3314  22  ASN D O     
3818 C CB    . ASN D 22  ? 3.7859 5.5086 7.6499 -0.8060 -0.7779 0.3892  22  ASN D CB    
3819 C CG    . ASN D 22  ? 3.7432 5.5994 7.7122 -0.6920 -0.7156 0.3821  22  ASN D CG    
3820 O OD1   . ASN D 22  ? 3.6997 5.6391 7.7562 -0.5868 -0.6931 0.3441  22  ASN D OD1   
3821 N ND2   . ASN D 22  ? 3.7715 5.6512 7.7298 -0.7184 -0.6871 0.4184  22  ASN D ND2   
3822 N N     . THR D 23  ? 3.3363 4.8867 7.1069 -0.8761 -0.9016 0.3312  23  THR D N     
3823 C CA    . THR D 23  ? 2.9884 4.4365 6.6987 -0.9828 -0.9914 0.3538  23  THR D CA    
3824 C C     . THR D 23  ? 2.9096 4.2448 6.4436 -1.0558 -0.9664 0.2901  23  THR D C     
3825 O O     . THR D 23  ? 2.9222 4.1666 6.3841 -1.1562 -1.0377 0.3006  23  THR D O     
3826 C CB    . THR D 23  ? 2.9334 4.3489 6.6431 -1.0991 -1.0591 0.4431  23  THR D CB    
3827 O OG1   . THR D 23  ? 2.6837 4.2057 6.5272 -1.0310 -1.0487 0.4919  23  THR D OG1   
3828 C CG2   . THR D 23  ? 2.9021 4.2701 6.6486 -1.1680 -1.1762 0.4931  23  THR D CG2   
3829 N N     . SER D 24  ? 2.8600 4.2015 6.3286 -1.0096 -0.8678 0.2247  24  SER D N     
3830 C CA    . SER D 24  ? 2.9559 4.1946 6.2653 -1.0723 -0.8324 0.1583  24  SER D CA    
3831 C C     . SER D 24  ? 2.9560 4.2102 6.2618 -0.9770 -0.8041 0.0877  24  SER D C     
3832 O O     . SER D 24  ? 2.9407 4.1063 6.1170 -1.0267 -0.7872 0.0314  24  SER D O     
3833 C CB    . SER D 24  ? 2.8975 4.1182 6.1320 -1.1024 -0.7388 0.1343  24  SER D CB    
3834 O OG    . SER D 24  ? 2.9286 4.0550 6.0248 -1.1546 -0.6956 0.0634  24  SER D OG    
3835 N N     . ASN D 25  ? 2.9129 4.2780 6.3548 -0.8469 -0.7955 0.0873  25  ASN D N     
3836 C CA    . ASN D 25  ? 2.8939 4.2886 6.3413 -0.7515 -0.7631 0.0232  25  ASN D CA    
3837 C C     . ASN D 25  ? 2.8670 4.2454 6.2154 -0.7310 -0.6642 -0.0409 25  ASN D C     
3838 O O     . ASN D 25  ? 2.8923 4.2216 6.1545 -0.7235 -0.6468 -0.0995 25  ASN D O     
3839 C CB    . ASN D 25  ? 2.9404 4.2553 6.3374 -0.7960 -0.8408 0.0085  25  ASN D CB    
3840 C CG    . ASN D 25  ? 2.8996 4.2364 6.4189 -0.8096 -0.9415 0.0753  25  ASN D CG    
3841 O OD1   . ASN D 25  ? 2.7789 4.2162 6.4500 -0.7410 -0.9432 0.1153  25  ASN D OD1   
3842 N ND2   . ASN D 25  ? 2.9640 4.2082 6.4233 -0.9018 -1.0279 0.0889  25  ASN D ND2   
3843 N N     . THR D 26  ? 2.9579 4.9577 4.5534 0.7154  1.2297  1.7677  26  THR D N     
3844 C CA    . THR D 26  ? 2.8693 4.9774 4.5115 0.7234  1.2134  1.7529  26  THR D CA    
3845 C C     . THR D 26  ? 3.2458 5.3588 4.9512 0.6481  1.1522  1.6657  26  THR D C     
3846 O O     . THR D 26  ? 2.7267 4.8060 4.2870 0.6858  1.1174  1.5936  26  THR D O     
3847 C CB    . THR D 26  ? 2.5600 4.6759 3.9940 0.8430  1.2199  1.7431  26  THR D CB    
3848 O OG1   . THR D 26  ? 2.4615 4.5672 3.8285 0.9178  1.2709  1.8192  26  THR D OG1   
3849 C CG2   . THR D 26  ? 2.3330 4.5617 3.8248 0.8543  1.2105  1.7418  26  THR D CG2   
3850 N N     . ILE D 27  ? 3.8892 6.0437 5.8180 0.5427  1.1368  1.6694  27  ILE D N     
3851 C CA    . ILE D 27  ? 3.9602 6.1302 5.9780 0.4655  1.0728  1.5882  27  ILE D CA    
3852 C C     . ILE D 27  ? 3.9789 6.2841 6.0875 0.4621  1.0442  1.5672  27  ILE D C     
3853 O O     . ILE D 27  ? 4.1415 6.5380 6.3816 0.4490  1.0695  1.6214  27  ILE D O     
3854 C CB    . ILE D 27  ? 4.0845 6.2162 6.2936 0.3505  1.0595  1.5882  27  ILE D CB    
3855 C CG1   . ILE D 27  ? 4.1989 6.1957 6.3143 0.3630  1.0958  1.6221  27  ILE D CG1   
3856 C CG2   . ILE D 27  ? 3.9756 6.1180 6.2628 0.2771  0.9824  1.4953  27  ILE D CG2   
3857 C CD1   . ILE D 27  ? 4.2070 6.1312 6.4721 0.2550  1.0759  1.6064  27  ILE D CD1   
3858 N N     . LYS D 28  ? 3.5682 5.8866 5.6052 0.4778  0.9919  1.4890  28  LYS D N     
3859 C CA    . LYS D 28  ? 3.1870 5.6298 5.2982 0.4778  0.9544  1.4577  28  LYS D CA    
3860 C C     . LYS D 28  ? 2.8421 5.2658 4.9927 0.4165  0.8692  1.3604  28  LYS D C     
3861 O O     . LYS D 28  ? 2.7367 5.0197 4.6957 0.4407  0.8261  1.2885  28  LYS D O     
3862 C CB    . LYS D 28  ? 3.1537 5.6051 5.0697 0.5914  0.9688  1.4546  28  LYS D CB    
3863 C CG    . LYS D 28  ? 3.1584 5.5668 4.9478 0.6692  1.0345  1.5254  28  LYS D CG    
3864 C CD    . LYS D 28  ? 3.0460 5.4470 4.6390 0.7769  1.0382  1.5066  28  LYS D CD    
3865 C CE    . LYS D 28  ? 3.0897 5.4302 4.5307 0.8599  1.0903  1.5590  28  LYS D CE    
3866 N NZ    . LYS D 28  ? 3.0955 5.3068 4.4174 0.8667  1.0931  1.5365  28  LYS D NZ    
3867 N N     . LEU D 29  ? 2.6442 5.1714 5.0107 0.3346  0.8290  1.3417  29  LEU D N     
3868 C CA    . LEU D 29  ? 2.3610 4.8526 4.7376 0.2787  0.7283  1.2323  29  LEU D CA    
3869 C C     . LEU D 29  ? 2.4036 5.0043 4.7381 0.3372  0.6957  1.1983  29  LEU D C     
3870 O O     . LEU D 29  ? 2.6997 5.4770 5.1855 0.3419  0.7169  1.2417  29  LEU D O     
3871 C CB    . LEU D 29  ? 2.1965 4.7430 4.8290 0.1609  0.6959  1.2183  29  LEU D CB    
3872 C CG    . LEU D 29  ? 1.9188 4.4401 4.5931 0.0930  0.5894  1.1032  29  LEU D CG    
3873 C CD1   . LEU D 29  ? 1.9141 4.3913 4.7726 -0.0192 0.5738  1.0908  29  LEU D CD1   
3874 C CD2   . LEU D 29  ? 2.0211 4.7220 4.8014 0.0980  0.5422  1.0681  29  LEU D CD2   
3875 N N     . ILE D 30  ? 2.1407 4.6386 4.2756 0.3836  0.6477  1.1244  30  ILE D N     
3876 C CA    . ILE D 30  ? 2.0446 4.6317 4.1279 0.4456  0.6191  1.0930  30  ILE D CA    
3877 C C     . ILE D 30  ? 2.0842 4.7490 4.2948 0.3831  0.5326  1.0199  30  ILE D C     
3878 O O     . ILE D 30  ? 2.3981 5.2387 4.7343 0.3909  0.5219  1.0293  30  ILE D O     
3879 C CB    . ILE D 30  ? 1.9811 4.4269 3.8021 0.5302  0.6151  1.0527  30  ILE D CB    
3880 C CG1   . ILE D 30  ? 2.0663 4.4652 3.7660 0.6041  0.6987  1.1193  30  ILE D CG1   
3881 C CG2   . ILE D 30  ? 1.9426 4.4667 3.7152 0.5914  0.5836  1.0178  30  ILE D CG2   
3882 C CD1   . ILE D 30  ? 2.1317 4.6983 3.9106 0.6602  0.7647  1.2025  30  ILE D CD1   
3883 N N     . ALA D 31  ? 1.7493 4.2934 3.9294 0.3245  0.4684  0.9444  31  ALA D N     
3884 C CA    . ALA D 31  ? 1.5590 4.1767 3.8373 0.2773  0.3811  0.8655  31  ALA D CA    
3885 C C     . ALA D 31  ? 1.8943 4.3949 4.2122 0.1867  0.3279  0.8042  31  ALA D C     
3886 O O     . ALA D 31  ? 1.9748 4.3103 4.1873 0.1768  0.3499  0.8105  31  ALA D O     
3887 C CB    . ALA D 31  ? 1.4996 4.1090 3.6135 0.3565  0.3405  0.8128  31  ALA D CB    
3888 N N     . ILE D 32  ? 1.9841 4.5791 4.4561 0.1242  0.2557  0.7412  32  ILE D N     
3889 C CA    . ILE D 32  ? 1.9644 4.4630 4.4739 0.0440  0.1899  0.6641  32  ILE D CA    
3890 C C     . ILE D 32  ? 1.8087 4.4130 4.3650 0.0390  0.0970  0.5737  32  ILE D C     
3891 O O     . ILE D 32  ? 1.7468 4.5428 4.4736 0.0261  0.0789  0.5728  32  ILE D O     
3892 C CB    . ILE D 32  ? 1.8164 4.3223 4.5408 -0.0558 0.2143  0.6946  32  ILE D CB    
3893 C CG1   . ILE D 32  ? 1.8246 4.2786 4.6359 -0.1427 0.1322  0.5994  32  ILE D CG1   
3894 C CG2   . ILE D 32  ? 1.6267 4.3381 4.5765 -0.0743 0.2497  0.7532  32  ILE D CG2   
3895 C CD1   . ILE D 32  ? 1.7812 4.0248 4.3922 -0.1347 0.1071  0.5526  32  ILE D CD1   
3896 N N     . GLU D 33  ? 1.7031 4.1929 4.1097 0.0537  0.0381  0.4982  33  GLU D N     
3897 C CA    . GLU D 33  ? 1.6623 4.2486 4.0748 0.0707  -0.0470 0.4155  33  GLU D CA    
3898 C C     . GLU D 33  ? 1.8473 4.3076 4.2089 0.0263  -0.1168 0.3272  33  GLU D C     
3899 O O     . GLU D 33  ? 1.6571 3.9312 3.9015 0.0144  -0.0956 0.3325  33  GLU D O     
3900 C CB    . GLU D 33  ? 1.4413 4.0490 3.6708 0.1854  -0.0376 0.4268  33  GLU D CB    
3901 C CG    . GLU D 33  ? 1.5443 4.2924 3.8155 0.2424  0.0243  0.5059  33  GLU D CG    
3902 C CD    . GLU D 33  ? 1.7395 4.7236 4.2375 0.2114  -0.0094 0.4954  33  GLU D CD    
3903 O OE1   . GLU D 33  ? 1.8239 4.8807 4.3972 0.1791  -0.0936 0.4124  33  GLU D OE1   
3904 O OE2   . GLU D 33  ? 1.8268 4.9298 4.4299 0.2214  0.0474  0.5681  33  GLU D OE2   
3905 N N     . LYS D 34  ? 2.2630 4.8349 4.7151 0.0052  -0.2017 0.2440  34  LYS D N     
3906 C CA    . LYS D 34  ? 2.4128 4.8924 4.7962 -0.0145 -0.2778 0.1505  34  LYS D CA    
3907 C C     . LYS D 34  ? 2.5651 5.1017 4.8026 0.0807  -0.3210 0.1123  34  LYS D C     
3908 O O     . LYS D 34  ? 2.5694 5.2962 4.9001 0.1021  -0.3660 0.0811  34  LYS D O     
3909 C CB    . LYS D 34  ? 2.4290 4.9889 5.0329 -0.1121 -0.3453 0.0755  34  LYS D CB    
3910 C CG    . LYS D 34  ? 2.3747 4.8650 4.9062 -0.1207 -0.4320 -0.0303 34  LYS D CG    
3911 C CD    . LYS D 34  ? 2.3643 4.9966 5.1139 -0.1920 -0.5155 -0.1231 34  LYS D CD    
3912 C CE    . LYS D 34  ? 2.2978 5.1766 5.1453 -0.1504 -0.5481 -0.1361 34  LYS D CE    
3913 N NZ    . LYS D 34  ? 2.3162 5.2251 4.9572 -0.0344 -0.5732 -0.1499 34  LYS D NZ    
3914 N N     . SER D 35  ? 2.6912 5.0682 4.7065 0.1397  -0.3057 0.1164  35  SER D N     
3915 C CA    . SER D 35  ? 2.7745 5.1837 4.6391 0.2383  -0.3302 0.0960  35  SER D CA    
3916 C C     . SER D 35  ? 2.7012 5.0802 4.5229 0.2313  -0.4150 0.0014  35  SER D C     
3917 O O     . SER D 35  ? 2.7731 5.1180 4.6920 0.1487  -0.4590 -0.0543 35  SER D O     
3918 C CB    . SER D 35  ? 2.9187 5.1789 4.5763 0.3119  -0.2593 0.1571  35  SER D CB    
3919 O OG    . SER D 35  ? 3.0061 5.2971 4.5308 0.4101  -0.2729 0.1469  35  SER D OG    
3920 N N     . ASP D 36  ? 2.2417 4.6321 3.9151 0.3240  -0.4347 -0.0149 36  ASP D N     
3921 C CA    . ASP D 36  ? 1.9104 4.2759 3.5142 0.3394  -0.5089 -0.0969 36  ASP D CA    
3922 C C     . ASP D 36  ? 1.7829 3.9864 3.1584 0.4169  -0.4743 -0.0716 36  ASP D C     
3923 O O     . ASP D 36  ? 1.5437 3.7729 2.8230 0.5052  -0.4324 -0.0217 36  ASP D O     
3924 C CB    . ASP D 36  ? 1.9153 4.5032 3.5905 0.3843  -0.5785 -0.1496 36  ASP D CB    
3925 C CG    . ASP D 36  ? 2.0124 4.5866 3.5969 0.4190  -0.6530 -0.2314 36  ASP D CG    
3926 O OD1   . ASP D 36  ? 2.1152 4.6592 3.7741 0.3455  -0.7111 -0.3057 36  ASP D OD1   
3927 O OD2   . ASP D 36  ? 1.9867 4.5789 3.4252 0.5237  -0.6504 -0.2193 36  ASP D OD2   
3928 N N     . TRP D 37  ? 1.9403 3.9774 3.2366 0.3842  -0.4898 -0.1057 37  TRP D N     
3929 C CA    . TRP D 37  ? 1.8892 3.7676 2.9834 0.4482  -0.4619 -0.0896 37  TRP D CA    
3930 C C     . TRP D 37  ? 1.9332 3.8061 2.9698 0.4682  -0.5348 -0.1660 37  TRP D C     
3931 O O     . TRP D 37  ? 2.0231 3.7602 3.0198 0.4241  -0.5530 -0.2006 37  TRP D O     
3932 C CB    . TRP D 37  ? 1.6861 3.3643 2.7224 0.4002  -0.4044 -0.0517 37  TRP D CB    
3933 C CG    . TRP D 37  ? 1.6245 3.3082 2.6969 0.3949  -0.3302 0.0242  37  TRP D CG    
3934 C CD1   . TRP D 37  ? 1.6545 3.4694 2.7595 0.4471  -0.2993 0.0692  37  TRP D CD1   
3935 C CD2   . TRP D 37  ? 1.7045 3.2642 2.7803 0.3412  -0.2771 0.0644  37  TRP D CD2   
3936 N NE1   . TRP D 37  ? 1.6226 3.4002 2.7487 0.4295  -0.2303 0.1334  37  TRP D NE1   
3937 C CE2   . TRP D 37  ? 1.6210 3.2457 2.7284 0.3664  -0.2158 0.1319  37  TRP D CE2   
3938 C CE3   . TRP D 37  ? 2.0288 3.4335 3.0796 0.2805  -0.2745 0.0516  37  TRP D CE3   
3939 C CZ2   . TRP D 37  ? 1.8883 3.4322 2.9996 0.3359  -0.1534 0.1851  37  TRP D CZ2   
3940 C CZ3   . TRP D 37  ? 2.1151 3.4413 3.1719 0.2499  -0.2122 0.1065  37  TRP D CZ3   
3941 C CH2   . TRP D 37  ? 2.0167 3.4143 3.1016 0.2790  -0.1529 0.1718  37  TRP D CH2   
3942 N N     . THR D 38  ? 1.7722 3.7994 2.8017 0.5410  -0.5754 -0.1906 38  THR D N     
3943 C CA    . THR D 38  ? 1.9955 4.0506 2.9550 0.5876  -0.6424 -0.2574 38  THR D CA    
3944 C C     . THR D 38  ? 2.3651 4.4659 3.1874 0.7156  -0.6203 -0.2213 38  THR D C     
3945 O O     . THR D 38  ? 2.4320 4.4641 3.1253 0.7718  -0.6338 -0.2389 38  THR D O     
3946 C CB    . THR D 38  ? 2.1209 4.3571 3.2376 0.5469  -0.7339 -0.3442 38  THR D CB    
3947 O OG1   . THR D 38  ? 2.0852 4.3947 3.3863 0.4614  -0.7239 -0.3326 38  THR D OG1   
3948 C CG2   . THR D 38  ? 2.1419 4.2940 3.2497 0.4989  -0.7969 -0.4278 38  THR D CG2   
3949 N N     . LYS D 39  ? 2.4535 4.6683 3.3027 0.7662  -0.5823 -0.1669 39  LYS D N     
3950 C CA    . LYS D 39  ? 2.6071 4.8547 3.3320 0.8904  -0.5451 -0.1175 39  LYS D CA    
3951 C C     . LYS D 39  ? 2.5849 4.6600 3.2137 0.9068  -0.4479 -0.0365 39  LYS D C     
3952 O O     . LYS D 39  ? 2.7603 4.8259 3.4581 0.8616  -0.4042 0.0030  39  LYS D O     
3953 C CB    . LYS D 39  ? 2.5715 5.0565 3.3857 0.9423  -0.5637 -0.1099 39  LYS D CB    
3954 C CG    . LYS D 39  ? 2.3916 4.9495 3.3576 0.8738  -0.5385 -0.0807 39  LYS D CG    
3955 C CD    . LYS D 39  ? 2.3640 5.1629 3.4528 0.8913  -0.5817 -0.1024 39  LYS D CD    
3956 C CE    . LYS D 39  ? 2.3707 5.2582 3.5762 0.8193  -0.6775 -0.2029 39  LYS D CE    
3957 N NZ    . LYS D 39  ? 2.3575 5.4327 3.6869 0.8085  -0.7093 -0.2250 39  LYS D NZ    
3958 N N     . ASN D 40  ? 2.4127 4.3556 2.8880 0.9722  -0.4144 -0.0140 40  ASN D N     
3959 C CA    . ASN D 40  ? 2.2004 3.9629 2.5783 0.9884  -0.3276 0.0492  40  ASN D CA    
3960 C C     . ASN D 40  ? 1.8747 3.5326 2.3141 0.8838  -0.3037 0.0546  40  ASN D C     
3961 O O     . ASN D 40  ? 1.5745 3.2286 2.0417 0.8785  -0.2491 0.1028  40  ASN D O     
3962 C CB    . ASN D 40  ? 2.4855 4.3061 2.8253 1.0842  -0.2651 0.1170  40  ASN D CB    
3963 C CG    . ASN D 40  ? 2.4891 4.4943 2.9563 1.0747  -0.2725 0.1300  40  ASN D CG    
3964 O OD1   . ASN D 40  ? 2.5623 4.5387 3.0825 1.0289  -0.2304 0.1619  40  ASN D OD1   
3965 N ND2   . ASN D 40  ? 2.2834 4.4771 2.7959 1.1181  -0.3235 0.1053  40  ASN D ND2   
3966 N N     . TRP D 41  ? 2.0113 3.5860 2.4681 0.8054  -0.3448 0.0048  41  TRP D N     
3967 C CA    . TRP D 41  ? 2.2378 3.7450 2.7754 0.7033  -0.3340 0.0043  41  TRP D CA    
3968 C C     . TRP D 41  ? 2.2350 3.5889 2.6967 0.7056  -0.2535 0.0603  41  TRP D C     
3969 O O     . TRP D 41  ? 2.2526 3.6070 2.7815 0.6586  -0.2215 0.0885  41  TRP D O     
3970 C CB    . TRP D 41  ? 2.1990 3.6322 2.7547 0.6301  -0.3897 -0.0582 41  TRP D CB    
3971 C CG    . TRP D 41  ? 2.1382 3.4058 2.5505 0.6574  -0.3782 -0.0641 41  TRP D CG    
3972 C CD1   . TRP D 41  ? 1.9496 3.2225 2.2783 0.7188  -0.4112 -0.0927 41  TRP D CD1   
3973 C CD2   . TRP D 41  ? 2.2716 3.3522 2.6112 0.6272  -0.3293 -0.0398 41  TRP D CD2   
3974 N NE1   . TRP D 41  ? 2.0490 3.1464 2.2639 0.7255  -0.3827 -0.0841 41  TRP D NE1   
3975 C CE2   . TRP D 41  ? 2.1085 3.0875 2.3301 0.6680  -0.3349 -0.0551 41  TRP D CE2   
3976 C CE3   . TRP D 41  ? 2.0461 3.0434 2.4087 0.5742  -0.2814 -0.0064 41  TRP D CE3   
3977 C CZ2   . TRP D 41  ? 2.0071 2.8072 2.1433 0.6518  -0.2965 -0.0413 41  TRP D CZ2   
3978 C CZ3   . TRP D 41  ? 1.7705 2.5934 2.0398 0.5627  -0.2463 0.0039  41  TRP D CZ3   
3979 C CH2   . TRP D 41  ? 1.9817 2.7085 2.1437 0.5984  -0.2552 -0.0150 41  TRP D CH2   
3980 N N     . GLU D 42  ? 2.1649 3.3913 2.4912 0.7622  -0.2186 0.0765  42  GLU D N     
3981 C CA    . GLU D 42  ? 2.0389 3.1263 2.2987 0.7666  -0.1461 0.1194  42  GLU D CA    
3982 C C     . GLU D 42  ? 2.2752 3.4410 2.5509 0.8207  -0.0936 0.1716  42  GLU D C     
3983 O O     . GLU D 42  ? 2.2664 3.3974 2.5621 0.7951  -0.0499 0.2003  42  GLU D O     
3984 C CB    . GLU D 42  ? 2.1468 3.0789 2.2755 0.8081  -0.1220 0.1194  42  GLU D CB    
3985 C CG    . GLU D 42  ? 2.7815 3.7573 2.8447 0.9034  -0.1225 0.1282  42  GLU D CG    
3986 C CD    . GLU D 42  ? 2.7354 3.5469 2.6843 0.9375  -0.0881 0.1356  42  GLU D CD    
3987 O OE1   . GLU D 42  ? 2.2208 2.8912 2.1422 0.8908  -0.0602 0.1345  42  GLU D OE1   
3988 O OE2   . GLU D 42  ? 2.8033 3.6323 2.6937 1.0130  -0.0876 0.1440  42  GLU D OE2   
3989 N N     . ARG D 43  ? 2.3810 3.6556 2.6429 0.9029  -0.0953 0.1860  43  ARG D N     
3990 C CA    . ARG D 43  ? 2.3696 3.7379 2.6560 0.9578  -0.0495 0.2349  43  ARG D CA    
3991 C C     . ARG D 43  ? 2.2280 3.7286 2.6517 0.8978  -0.0665 0.2378  43  ARG D C     
3992 O O     . ARG D 43  ? 2.2503 3.7585 2.6958 0.9012  -0.0153 0.2791  43  ARG D O     
3993 C CB    . ARG D 43  ? 2.4389 3.9204 2.6954 1.0577  -0.0558 0.2486  43  ARG D CB    
3994 C CG    . ARG D 43  ? 2.2748 3.8491 2.5472 1.1259  -0.0040 0.3028  43  ARG D CG    
3995 C CD    . ARG D 43  ? 2.3181 3.9884 2.5467 1.2226  -0.0056 0.3187  43  ARG D CD    
3996 N NE    . ARG D 43  ? 2.7414 4.4199 2.9394 1.2652  0.0588  0.3682  43  ARG D NE    
3997 C CZ    . ARG D 43  ? 2.8370 4.6768 3.1205 1.2676  0.0526  0.3840  43  ARG D CZ    
3998 N NH1   . ARG D 43  ? 2.9427 4.9524 3.3602 1.2229  -0.0147 0.3523  43  ARG D NH1   
3999 N NH2   . ARG D 43  ? 2.5618 4.3917 2.8015 1.3105  0.1131  0.4298  43  ARG D NH2   
4000 N N     . SER D 44  ? 1.7317 3.3398 2.2544 0.8442  -0.1370 0.1933  44  SER D N     
4001 C CA    . SER D 44  ? 1.6511 3.3900 2.3267 0.7810  -0.1537 0.1949  44  SER D CA    
4002 C C     . SER D 44  ? 1.7635 3.3900 2.4633 0.7054  -0.1173 0.2133  44  SER D C     
4003 O O     . SER D 44  ? 1.8146 3.5095 2.5948 0.6880  -0.0833 0.2523  44  SER D O     
4004 C CB    . SER D 44  ? 1.5166 3.3749 2.2976 0.7333  -0.2399 0.1316  44  SER D CB    
4005 O OG    . SER D 44  ? 1.7564 3.7611 2.7051 0.6773  -0.2549 0.1340  44  SER D OG    
4006 N N     . VAL D 45  ? 1.4886 2.9485 2.1178 0.6656  -0.1216 0.1889  45  VAL D N     
4007 C CA    . VAL D 45  ? 1.7867 3.1387 2.4257 0.6028  -0.0863 0.2073  45  VAL D CA    
4008 C C     . VAL D 45  ? 2.1319 3.4357 2.7030 0.6535  -0.0096 0.2621  45  VAL D C     
4009 O O     . VAL D 45  ? 2.1704 3.5030 2.8009 0.6276  0.0262  0.2980  45  VAL D O     
4010 C CB    . VAL D 45  ? 1.7261 2.9115 2.2898 0.5621  -0.1062 0.1698  45  VAL D CB    
4011 C CG1   . VAL D 45  ? 1.4590 2.5146 1.9818 0.5316  -0.0546 0.1976  45  VAL D CG1   
4012 C CG2   . VAL D 45  ? 1.8537 3.0818 2.5157 0.4891  -0.1750 0.1185  45  VAL D CG2   
4013 N N     . ALA D 46  ? 2.2541 3.4814 2.7019 0.7287  0.0191  0.2690  46  ALA D N     
4014 C CA    . ALA D 46  ? 2.3670 3.5409 2.7484 0.7811  0.0903  0.3111  46  ALA D CA    
4015 C C     . ALA D 46  ? 2.2272 3.5600 2.6869 0.8151  0.1158  0.3542  46  ALA D C     
4016 O O     . ALA D 46  ? 2.2333 3.5610 2.6982 0.8195  0.1659  0.3900  46  ALA D O     
4017 C CB    . ALA D 46  ? 2.4323 3.5026 2.6877 0.8558  0.1153  0.3080  46  ALA D CB    
4018 N N     . ARG D 47  ? 1.8595 3.3428 2.3801 0.8438  0.0812  0.3509  47  ARG D N     
4019 C CA    . ARG D 47  ? 1.7573 3.4083 2.3610 0.8781  0.1018  0.3915  47  ARG D CA    
4020 C C     . ARG D 47  ? 2.0464 3.7753 2.7822 0.8024  0.1019  0.4081  47  ARG D C     
4021 O O     . ARG D 47  ? 2.2227 4.0107 2.9908 0.8242  0.1518  0.4565  47  ARG D O     
4022 C CB    . ARG D 47  ? 1.6715 3.4799 2.3210 0.9195  0.0544  0.3766  47  ARG D CB    
4023 C CG    . ARG D 47  ? 1.5587 3.5585 2.3000 0.9595  0.0708  0.4168  47  ARG D CG    
4024 C CD    . ARG D 47  ? 1.6326 3.8016 2.4230 0.9991  0.0147  0.3942  47  ARG D CD    
4025 N NE    . ARG D 47  ? 1.9083 4.1443 2.8031 0.9176  -0.0645 0.3358  47  ARG D NE    
4026 C CZ    . ARG D 47  ? 1.8009 3.9818 2.6449 0.9097  -0.1177 0.2821  47  ARG D CZ    
4027 N NH1   . ARG D 47  ? 1.6630 3.7240 2.3572 0.9780  -0.0971 0.2859  47  ARG D NH1   
4028 N NH2   . ARG D 47  ? 1.6875 3.9330 2.6353 0.8349  -0.1895 0.2245  47  ARG D NH2   
4029 N N     . ASP D 48  ? 1.9395 3.6671 2.7552 0.7157  0.0504  0.3708  48  ASP D N     
4030 C CA    . ASP D 48  ? 1.8276 3.6223 2.7830 0.6400  0.0547  0.3903  48  ASP D CA    
4031 C C     . ASP D 48  ? 1.5586 3.2248 2.4587 0.6232  0.1143  0.4252  48  ASP D C     
4032 O O     . ASP D 48  ? 1.5813 3.3139 2.5704 0.5991  0.1497  0.4700  48  ASP D O     
4033 C CB    . ASP D 48  ? 1.8387 3.6548 2.8972 0.5534  -0.0152 0.3368  48  ASP D CB    
4034 C CG    . ASP D 48  ? 1.9308 3.9193 3.0817 0.5637  -0.0779 0.3005  48  ASP D CG    
4035 O OD1   . ASP D 48  ? 1.8680 4.0053 3.0675 0.6140  -0.0623 0.3319  48  ASP D OD1   
4036 O OD2   . ASP D 48  ? 2.0803 4.0610 3.2537 0.5254  -0.1440 0.2383  48  ASP D OD2   
4037 N N     . LEU D 49  ? 1.4863 2.9770 2.2437 0.6385  0.1268  0.4062  49  LEU D N     
4038 C CA    . LEU D 49  ? 1.8693 3.2416 2.5673 0.6255  0.1760  0.4298  49  LEU D CA    
4039 C C     . LEU D 49  ? 1.9597 3.3294 2.5829 0.7036  0.2428  0.4717  49  LEU D C     
4040 O O     . LEU D 49  ? 2.0434 3.3856 2.6570 0.7003  0.2887  0.5046  49  LEU D O     
4041 C CB    . LEU D 49  ? 1.7448 2.9382 2.3314 0.6057  0.1581  0.3865  49  LEU D CB    
4042 C CG    . LEU D 49  ? 1.6140 2.7821 2.2648 0.5233  0.1004  0.3471  49  LEU D CG    
4043 C CD1   . LEU D 49  ? 1.4668 2.4571 2.0025 0.5090  0.0935  0.3138  49  LEU D CD1   
4044 C CD2   . LEU D 49  ? 1.4617 2.6987 2.2506 0.4554  0.1085  0.3766  49  LEU D CD2   
4045 N N     . THR D 50  ? 2.0585 3.4558 2.6260 0.7789  0.2513  0.4716  50  THR D N     
4046 C CA    . THR D 50  ? 2.1936 3.5866 2.6932 0.8575  0.3149  0.5071  50  THR D CA    
4047 C C     . THR D 50  ? 2.0543 3.6267 2.6555 0.8839  0.3403  0.5588  50  THR D C     
4048 O O     . THR D 50  ? 1.9847 3.5668 2.5339 0.9551  0.3942  0.5903  50  THR D O     
4049 C CB    . THR D 50  ? 2.1816 3.5000 2.5693 0.9322  0.3230  0.4874  50  THR D CB    
4050 O OG1   . THR D 50  ? 2.3778 3.8041 2.8153 0.9486  0.2811  0.4792  50  THR D OG1   
4051 C CG2   . THR D 50  ? 1.9833 3.1151 2.2665 0.9131  0.3128  0.4431  50  THR D CG2   
4052 N N     . ARG D 51  ? 2.1123 3.8282 2.8614 0.8298  0.3033  0.5658  51  ARG D N     
4053 C CA    . ARG D 51  ? 2.1670 4.0658 3.0279 0.8521  0.3271  0.6161  51  ARG D CA    
4054 C C     . ARG D 51  ? 2.2677 4.1580 3.1183 0.8690  0.3963  0.6695  51  ARG D C     
4055 O O     . ARG D 51  ? 2.5073 4.4391 3.3153 0.9465  0.4462  0.7052  51  ARG D O     
4056 C CB    . ARG D 51  ? 2.0965 4.1379 3.1366 0.7740  0.2748  0.6077  51  ARG D CB    
4057 C CG    . ARG D 51  ? 2.0839 4.1507 3.1408 0.7571  0.1994  0.5480  51  ARG D CG    
4058 C CD    . ARG D 51  ? 2.2105 4.4306 3.2896 0.8290  0.1879  0.5551  51  ARG D CD    
4059 N NE    . ARG D 51  ? 2.3241 4.7515 3.5829 0.8026  0.1794  0.5815  51  ARG D NE    
4060 C CZ    . ARG D 51  ? 2.2515 4.8044 3.6519 0.7448  0.1124  0.5428  51  ARG D CZ    
4061 N NH1   . ARG D 51  ? 2.1482 4.8926 3.7230 0.7203  0.1097  0.5679  51  ARG D NH1   
4062 N NH2   . ARG D 51  ? 2.2128 4.7033 3.5848 0.7125  0.0479  0.4763  51  ARG D NH2   
4063 N N     . TYR D 52  ? 2.1472 3.9850 3.0332 0.8024  0.4020  0.6770  52  TYR D N     
4064 C CA    . TYR D 52  ? 2.2279 4.0433 3.0895 0.8185  0.4664  0.7257  52  TYR D CA    
4065 C C     . TYR D 52  ? 2.4222 4.0476 3.1537 0.8056  0.4700  0.6928  52  TYR D C     
4066 O O     . TYR D 52  ? 2.6537 4.2353 3.4268 0.7375  0.4584  0.6921  52  TYR D O     
4067 C CB    . TYR D 52  ? 2.4293 4.3735 3.4622 0.7601  0.4815  0.7791  52  TYR D CB    
4068 C CG    . TYR D 52  ? 2.7079 4.8542 3.8831 0.7724  0.4814  0.8136  52  TYR D CG    
4069 C CD1   . TYR D 52  ? 2.8492 5.0599 3.9690 0.8618  0.5034  0.8268  52  TYR D CD1   
4070 C CD2   . TYR D 52  ? 2.7671 5.0422 4.1386 0.6966  0.4631  0.8345  52  TYR D CD2   
4071 C CE1   . TYR D 52  ? 2.8264 5.2315 4.0752 0.8783  0.5041  0.8602  52  TYR D CE1   
4072 C CE2   . TYR D 52  ? 2.7682 5.2399 4.2800 0.7073  0.4618  0.8636  52  TYR D CE2   
4073 C CZ    . TYR D 52  ? 2.7790 5.3189 4.2252 0.8000  0.4815  0.8771  52  TYR D CZ    
4074 O OH    . TYR D 52  ? 2.7475 5.4919 4.3325 0.8149  0.4797  0.9070  52  TYR D OH    
4075 N N     . ASN D 53  ? 2.4569 3.9712 3.0377 0.8715  0.4859  0.6641  53  ASN D N     
4076 C CA    . ASN D 53  ? 2.6181 3.9537 3.0675 0.8700  0.4864  0.6224  53  ASN D CA    
4077 C C     . ASN D 53  ? 2.5863 3.8909 3.0506 0.8261  0.5051  0.6445  53  ASN D C     
4078 O O     . ASN D 53  ? 2.6033 3.9460 3.0529 0.8654  0.5586  0.6878  53  ASN D O     
4079 C CB    . ASN D 53  ? 2.6886 3.9520 3.0054 0.9599  0.5288  0.6108  53  ASN D CB    
4080 C CG    . ASN D 53  ? 2.9677 4.0518 3.1578 0.9590  0.5245  0.5576  53  ASN D CG    
4081 O OD1   . ASN D 53  ? 3.0366 4.0433 3.2251 0.8982  0.4825  0.5240  53  ASN D OD1   
4082 N ND2   . ASN D 53  ? 3.0177 4.0378 3.1047 1.0277  0.5671  0.5463  53  ASN D ND2   
4083 N N     . PRO D 54  ? 2.3922 3.6307 2.8825 0.7512  0.4650  0.6189  54  PRO D N     
4084 C CA    . PRO D 54  ? 2.1513 3.3739 2.6754 0.7073  0.4841  0.6493  54  PRO D CA    
4085 C C     . PRO D 54  ? 2.2380 3.3203 2.6168 0.7338  0.5028  0.6242  54  PRO D C     
4086 O O     . PRO D 54  ? 2.2523 3.2355 2.5148 0.7715  0.4935  0.5738  54  PRO D O     
4087 C CB    . PRO D 54  ? 1.9436 3.1579 2.5662 0.6166  0.4276  0.6260  54  PRO D CB    
4088 C CG    . PRO D 54  ? 1.8980 3.0388 2.4498 0.6241  0.3776  0.5605  54  PRO D CG    
4089 C CD    . PRO D 54  ? 2.0392 3.2219 2.5337 0.7071  0.4014  0.5642  54  PRO D CD    
4090 N N     . ASP D 55  ? 2.3005 3.3819 2.6947 0.7156  0.5318  0.6621  55  ASP D N     
4091 C CA    . ASP D 55  ? 2.3276 3.2913 2.5963 0.7346  0.5441  0.6385  55  ASP D CA    
4092 C C     . ASP D 55  ? 2.2948 3.1688 2.5751 0.6617  0.5062  0.6147  55  ASP D C     
4093 O O     . ASP D 55  ? 2.4697 3.2266 2.6385 0.6701  0.4936  0.5692  55  ASP D O     
4094 C CB    . ASP D 55  ? 2.2989 3.3214 2.5496 0.7836  0.6080  0.6984  55  ASP D CB    
4095 C CG    . ASP D 55  ? 2.4753 3.5601 2.6751 0.8710  0.6484  0.7106  55  ASP D CG    
4096 O OD1   . ASP D 55  ? 2.4283 3.4435 2.5329 0.9117  0.6347  0.6532  55  ASP D OD1   
4097 O OD2   . ASP D 55  ? 2.6504 3.8515 2.9084 0.9009  0.6973  0.7795  55  ASP D OD2   
4098 N N     . VAL D 56  ? 2.0980 3.0253 2.5155 0.5911  0.4884  0.6423  56  VAL D N     
4099 C CA    . VAL D 56  ? 1.9735 2.8169 2.4143 0.5197  0.4505  0.6183  56  VAL D CA    
4100 C C     . VAL D 56  ? 2.0906 2.9833 2.6599 0.4554  0.4004  0.6002  56  VAL D C     
4101 O O     . VAL D 56  ? 2.4612 3.4811 3.1487 0.4492  0.4089  0.6338  56  VAL D O     
4102 C CB    . VAL D 56  ? 1.8058 2.6520 2.2844 0.5000  0.4908  0.6766  56  VAL D CB    
4103 C CG1   . VAL D 56  ? 1.8706 2.8566 2.5051 0.4847  0.5300  0.7532  56  VAL D CG1   
4104 C CG2   . VAL D 56  ? 1.7875 2.5365 2.2832 0.4308  0.4535  0.6504  56  VAL D CG2   
4105 N N     . VAL D 57  ? 1.8640 2.6630 2.4100 0.4111  0.3467  0.5439  57  VAL D N     
4106 C CA    . VAL D 57  ? 1.5367 2.3727 2.1942 0.3501  0.2918  0.5150  57  VAL D CA    
4107 C C     . VAL D 57  ? 1.5371 2.3012 2.2437 0.2787  0.2721  0.5082  57  VAL D C     
4108 O O     . VAL D 57  ? 2.2183 2.8598 2.8196 0.2796  0.2656  0.4831  57  VAL D O     
4109 C CB    . VAL D 57  ? 1.5126 2.3095 2.0948 0.3725  0.2432  0.4505  57  VAL D CB    
4110 C CG1   . VAL D 57  ? 1.4879 2.3305 2.1773 0.3158  0.1823  0.4152  57  VAL D CG1   
4111 C CG2   . VAL D 57  ? 1.5208 2.3841 2.0592 0.4468  0.2687  0.4621  57  VAL D CG2   
4112 N N     . ILE D 58  ? 1.5366 2.3776 2.4090 0.2171  0.2634  0.5293  58  ILE D N     
4113 C CA    . ILE D 58  ? 1.5475 2.3265 2.4924 0.1465  0.2512  0.5289  58  ILE D CA    
4114 C C     . ILE D 58  ? 1.5242 2.2978 2.5320 0.0936  0.1765  0.4594  58  ILE D C     
4115 O O     . ILE D 58  ? 1.9236 2.8111 3.0385 0.0796  0.1489  0.4452  58  ILE D O     
4116 C CB    . ILE D 58  ? 1.5770 2.4386 2.6799 0.1121  0.3018  0.6043  58  ILE D CB    
4117 C CG1   . ILE D 58  ? 2.0147 2.9091 3.0541 0.1788  0.3777  0.6767  58  ILE D CG1   
4118 C CG2   . ILE D 58  ? 1.5997 2.3773 2.7683 0.0454  0.2990  0.6090  58  ILE D CG2   
4119 C CD1   . ILE D 58  ? 1.6276 2.4010 2.5067 0.2167  0.4014  0.6794  58  ILE D CD1   
4120 N N     . LEU D 59  ? 1.5228 2.1711 2.4621 0.0689  0.1427  0.4145  59  LEU D N     
4121 C CA    . LEU D 59  ? 1.7842 2.4137 2.7649 0.0244  0.0712  0.3443  59  LEU D CA    
4122 C C     . LEU D 59  ? 2.0404 2.5883 3.0882 -0.0437 0.0619  0.3385  59  LEU D C     
4123 O O     . LEU D 59  ? 2.1900 2.6661 3.2050 -0.0448 0.1081  0.3834  59  LEU D O     
4124 C CB    . LEU D 59  ? 1.8709 2.4223 2.6916 0.0692  0.0341  0.2872  59  LEU D CB    
4125 C CG    . LEU D 59  ? 1.9129 2.5106 2.6427 0.1451  0.0527  0.2951  59  LEU D CG    
4126 C CD1   . LEU D 59  ? 2.0820 2.5825 2.6634 0.1842  0.0250  0.2451  59  LEU D CD1   
4127 C CD2   . LEU D 59  ? 1.6469 2.3978 2.4862 0.1499  0.0353  0.2955  59  LEU D CD2   
4128 N N     . GLU D 60  ? 2.2477 2.8107 3.3906 -0.0966 0.0019  0.2813  60  GLU D N     
4129 C CA    . GLU D 60  ? 2.5233 2.9985 3.7288 -0.1611 -0.0156 0.2613  60  GLU D CA    
4130 C C     . GLU D 60  ? 2.8879 3.2462 3.9553 -0.1484 -0.0651 0.1954  60  GLU D C     
4131 O O     . GLU D 60  ? 2.9903 3.3795 4.0214 -0.1298 -0.1200 0.1357  60  GLU D O     
4132 C CB    . GLU D 60  ? 2.4982 3.0583 3.9061 -0.2312 -0.0540 0.2295  60  GLU D CB    
4133 C CG    . GLU D 60  ? 2.5850 3.0494 4.0774 -0.2996 -0.0574 0.2200  60  GLU D CG    
4134 C CD    . GLU D 60  ? 2.7903 3.3011 4.4342 -0.3632 -0.1259 0.1435  60  GLU D CD    
4135 O OE1   . GLU D 60  ? 2.8628 3.4953 4.5509 -0.3527 -0.1712 0.1007  60  GLU D OE1   
4136 O OE2   . GLU D 60  ? 2.8767 3.3021 4.5915 -0.4197 -0.1361 0.1222  60  GLU D OE2   
4137 N N     . LYS D 61  ? 3.0216 3.2525 4.0135 -0.1539 -0.0437 0.2096  61  LYS D N     
4138 C CA    . LYS D 61  ? 3.0171 3.1358 3.8807 -0.1414 -0.0852 0.1530  61  LYS D CA    
4139 C C     . LYS D 61  ? 3.2010 3.3068 4.1526 -0.1958 -0.1491 0.0854  61  LYS D C     
4140 O O     . LYS D 61  ? 3.3817 3.4782 4.4671 -0.2563 -0.1440 0.0931  61  LYS D O     
4141 C CB    . LYS D 61  ? 2.9366 2.9345 3.7048 -0.1316 -0.0440 0.1884  61  LYS D CB    
4142 C CG    . LYS D 61  ? 2.9346 2.8160 3.5716 -0.1176 -0.0803 0.1371  61  LYS D CG    
4143 C CD    . LYS D 61  ? 2.9932 2.8817 3.5004 -0.0572 -0.0973 0.1081  61  LYS D CD    
4144 C CE    . LYS D 61  ? 3.0221 2.7912 3.3973 -0.0392 -0.1176 0.0728  61  LYS D CE    
4145 N NZ    . LYS D 61  ? 3.1314 2.8481 3.5468 -0.0826 -0.1668 0.0241  61  LYS D NZ    
4146 N N     . GLN D 62  ? 3.1913 3.2969 4.0712 -0.1716 -0.2074 0.0190  62  GLN D N     
4147 C CA    . GLN D 62  ? 3.1976 3.2839 4.1309 -0.2104 -0.2733 -0.0553 62  GLN D CA    
4148 C C     . GLN D 62  ? 3.4398 3.4123 4.2154 -0.1780 -0.3008 -0.0954 62  GLN D C     
4149 O O     . GLN D 62  ? 3.3882 3.3304 4.0243 -0.1204 -0.2822 -0.0793 62  GLN D O     
4150 C CB    . GLN D 62  ? 2.9997 3.2246 4.0201 -0.2102 -0.3275 -0.1059 62  GLN D CB    
4151 C CG    . GLN D 62  ? 2.9620 3.3179 4.1481 -0.2403 -0.3036 -0.0690 62  GLN D CG    
4152 C CD    . GLN D 62  ? 3.0075 3.4826 4.3373 -0.2741 -0.3698 -0.1374 62  GLN D CD    
4153 O OE1   . GLN D 62  ? 2.9794 3.4520 4.2645 -0.2609 -0.4355 -0.2135 62  GLN D OE1   
4154 N NE2   . GLN D 62  ? 3.0414 3.6285 4.5477 -0.3154 -0.3531 -0.1119 62  GLN D NE2   
4155 N N     . GLY D 63  ? 3.6266 3.5359 4.4321 -0.2155 -0.3437 -0.1489 63  GLY D N     
4156 C CA    . GLY D 63  ? 3.8390 3.6543 4.5101 -0.1856 -0.3770 -0.1936 63  GLY D CA    
4157 C C     . GLY D 63  ? 3.9758 3.8642 4.6019 -0.1427 -0.4335 -0.2518 63  GLY D C     
4158 O O     . GLY D 63  ? 3.9125 3.9064 4.5440 -0.1087 -0.4293 -0.2382 63  GLY D O     
4159 N N     . PHE D 64  ? 4.1087 3.9436 4.6864 -0.1379 -0.4845 -0.3145 64  PHE D N     
4160 C CA    . PHE D 64  ? 4.1968 4.0998 4.7260 -0.0906 -0.5410 -0.3726 64  PHE D CA    
4161 C C     . PHE D 64  ? 4.1966 4.2270 4.8712 -0.1212 -0.5962 -0.4294 64  PHE D C     
4162 O O     . PHE D 64  ? 4.3433 4.4452 4.9895 -0.0817 -0.6515 -0.4869 64  PHE D O     
4163 C CB    . PHE D 64  ? 4.2408 4.0399 4.6591 -0.0683 -0.5720 -0.4163 64  PHE D CB    
4164 C CG    . PHE D 64  ? 4.2286 4.0896 4.5705 -0.0039 -0.6208 -0.4650 64  PHE D CG    
4165 C CD1   . PHE D 64  ? 4.1908 4.1048 4.4491 0.0636  -0.5984 -0.4314 64  PHE D CD1   
4166 C CD2   . PHE D 64  ? 4.2039 4.0713 4.5586 -0.0064 -0.6871 -0.5443 64  PHE D CD2   
4167 C CE1   . PHE D 64  ? 4.1338 4.1076 4.3218 0.1304  -0.6370 -0.4676 64  PHE D CE1   
4168 C CE2   . PHE D 64  ? 4.1772 4.1108 4.4555 0.0623  -0.7304 -0.5861 64  PHE D CE2   
4169 C CZ    . PHE D 64  ? 4.1380 4.1260 4.3325 0.1322  -0.7032 -0.5435 64  PHE D CZ    
4170 N N     . LYS D 65  ? 4.0701 4.1370 4.9035 -0.1877 -0.5805 -0.4131 65  LYS D N     
4171 C CA    . LYS D 65  ? 3.8708 4.0535 4.8684 -0.2301 -0.6348 -0.4744 65  LYS D CA    
4172 C C     . LYS D 65  ? 3.9129 4.2564 4.9093 -0.1777 -0.6675 -0.4952 65  LYS D C     
4173 O O     . LYS D 65  ? 3.8411 4.2810 4.9089 -0.1818 -0.7367 -0.5737 65  LYS D O     
4174 C CB    . LYS D 65  ? 3.6881 3.8894 4.8625 -0.3056 -0.5949 -0.4328 65  LYS D CB    
4175 C CG    . LYS D 65  ? 3.4643 3.5137 4.6287 -0.3437 -0.5399 -0.3823 65  LYS D CG    
4176 C CD    . LYS D 65  ? 3.2625 3.3445 4.5998 -0.4060 -0.4890 -0.3252 65  LYS D CD    
4177 C CE    . LYS D 65  ? 3.1673 3.1061 4.4844 -0.4311 -0.4267 -0.2635 65  LYS D CE    
4178 N NZ    . LYS D 65  ? 3.1595 3.1322 4.6460 -0.4848 -0.3692 -0.1980 65  LYS D NZ    
4179 N N     . SER D 66  ? 3.8511 4.2280 4.7673 -0.1247 -0.6201 -0.4292 66  SER D N     
4180 C CA    . SER D 66  ? 3.8169 4.3506 4.7441 -0.0741 -0.6388 -0.4340 66  SER D CA    
4181 C C     . SER D 66  ? 3.6762 4.1788 4.4376 0.0070  -0.5941 -0.3786 66  SER D C     
4182 O O     . SER D 66  ? 3.6497 4.0329 4.3282 0.0093  -0.5379 -0.3248 66  SER D O     
4183 C CB    . SER D 66  ? 3.8740 4.5288 4.9724 -0.1183 -0.6186 -0.4033 66  SER D CB    
4184 O OG    . SER D 66  ? 3.9318 4.6173 5.2046 -0.1978 -0.6585 -0.4571 66  SER D OG    
4185 N N     . PRO D 67  ? 3.2906 3.9001 4.0029 0.0776  -0.6166 -0.3912 67  PRO D N     
4186 C CA    . PRO D 67  ? 3.0164 3.6021 3.5914 0.1549  -0.5672 -0.3345 67  PRO D CA    
4187 C C     . PRO D 67  ? 3.0595 3.6622 3.6646 0.1505  -0.4987 -0.2588 67  PRO D C     
4188 O O     . PRO D 67  ? 3.1860 3.7558 3.6848 0.2094  -0.4527 -0.2132 67  PRO D O     
4189 C CB    . PRO D 67  ? 2.9253 3.6455 3.4739 0.2280  -0.6109 -0.3676 67  PRO D CB    
4190 C CG    . PRO D 67  ? 3.1118 3.9667 3.8180 0.1816  -0.6734 -0.4283 67  PRO D CG    
4191 C CD    . PRO D 67  ? 3.1740 3.9297 3.9519 0.0944  -0.6907 -0.4631 67  PRO D CD    
4192 N N     . ASN D 68  ? 2.9620 3.6156 3.7122 0.0849  -0.4885 -0.2444 68  ASN D N     
4193 C CA    . ASN D 68  ? 2.8864 3.5653 3.6692 0.0835  -0.4223 -0.1708 68  ASN D CA    
4194 C C     . ASN D 68  ? 2.7663 3.3004 3.4273 0.0997  -0.3597 -0.1192 68  ASN D C     
4195 O O     . ASN D 68  ? 2.7514 3.3022 3.3937 0.1257  -0.3043 -0.0622 68  ASN D O     
4196 C CB    . ASN D 68  ? 2.9987 3.7374 3.9634 0.0039  -0.4190 -0.1622 68  ASN D CB    
4197 C CG    . ASN D 68  ? 3.1122 3.7427 4.1236 -0.0674 -0.4356 -0.1913 68  ASN D CG    
4198 O OD1   . ASN D 68  ? 3.0355 3.5298 3.9302 -0.0583 -0.4332 -0.2002 68  ASN D OD1   
4199 N ND2   . ASN D 68  ? 3.2128 3.9039 4.4029 -0.1388 -0.4504 -0.2055 68  ASN D ND2   
4200 N N     . SER D 69  ? 2.7293 3.1279 3.3097 0.0869  -0.3686 -0.1409 69  SER D N     
4201 C CA    . SER D 69  ? 2.5941 2.8643 3.0585 0.1054  -0.3155 -0.1004 69  SER D CA    
4202 C C     . SER D 69  ? 2.2290 2.4980 2.5762 0.1845  -0.2890 -0.0807 69  SER D C     
4203 O O     . SER D 69  ? 2.4423 2.6618 2.7309 0.2064  -0.2344 -0.0375 69  SER D O     
4204 C CB    . SER D 69  ? 2.7105 2.8489 3.1142 0.0810  -0.3365 -0.1327 69  SER D CB    
4205 O OG    . SER D 69  ? 2.6671 2.8020 3.0044 0.1175  -0.3841 -0.1829 69  SER D OG    
4206 N N     . LYS D 70  ? 1.9527 2.2758 2.2657 0.2317  -0.3255 -0.1127 70  LYS D N     
4207 C CA    . LYS D 70  ? 1.9591 2.2831 2.1740 0.3099  -0.2950 -0.0888 70  LYS D CA    
4208 C C     . LYS D 70  ? 2.1070 2.5161 2.3634 0.3319  -0.2510 -0.0411 70  LYS D C     
4209 O O     . LYS D 70  ? 1.9165 2.2803 2.0954 0.3786  -0.2014 -0.0075 70  LYS D O     
4210 C CB    . LYS D 70  ? 1.8311 2.2175 2.0131 0.3622  -0.3406 -0.1253 70  LYS D CB    
4211 C CG    . LYS D 70  ? 1.9388 2.4969 2.2022 0.3876  -0.3636 -0.1285 70  LYS D CG    
4212 C CD    . LYS D 70  ? 2.2646 2.8924 2.4966 0.4387  -0.4177 -0.1725 70  LYS D CD    
4213 C CE    . LYS D 70  ? 1.9717 2.7854 2.2879 0.4669  -0.4445 -0.1791 70  LYS D CE    
4214 N NZ    . LYS D 70  ? 1.7866 2.6887 2.2588 0.3879  -0.4832 -0.2102 70  LYS D NZ    
4215 N N     . ILE D 71  ? 2.2898 2.8195 2.6738 0.2973  -0.2662 -0.0384 71  ILE D N     
4216 C CA    . ILE D 71  ? 2.3145 2.9284 2.7452 0.3155  -0.2213 0.0112  71  ILE D CA    
4217 C C     . ILE D 71  ? 2.1612 2.6854 2.5670 0.2943  -0.1637 0.0538  71  ILE D C     
4218 O O     . ILE D 71  ? 2.1452 2.6748 2.5106 0.3367  -0.1129 0.0938  71  ILE D O     
4219 C CB    . ILE D 71  ? 2.3088 3.0791 2.8971 0.2784  -0.2521 0.0034  71  ILE D CB    
4220 C CG1   . ILE D 71  ? 2.3868 3.2534 2.9945 0.3031  -0.3179 -0.0501 71  ILE D CG1   
4221 C CG2   . ILE D 71  ? 2.2043 3.0730 2.8393 0.3052  -0.2041 0.0585  71  ILE D CG2   
4222 C CD1   . ILE D 71  ? 2.4860 3.5170 3.2594 0.2645  -0.3574 -0.0708 71  ILE D CD1   
4223 N N     . ILE D 72  ? 1.9938 2.4367 2.4204 0.2336  -0.1704 0.0447  72  ILE D N     
4224 C CA    . ILE D 72  ? 1.6830 2.0452 2.0778 0.2197  -0.1179 0.0842  72  ILE D CA    
4225 C C     . ILE D 72  ? 1.6219 1.8853 1.8731 0.2754  -0.0858 0.0888  72  ILE D C     
4226 O O     . ILE D 72  ? 1.7373 1.9949 1.9529 0.3054  -0.0355 0.1240  72  ILE D O     
4227 C CB    . ILE D 72  ? 1.4730 1.7580 1.9051 0.1525  -0.1330 0.0721  72  ILE D CB    
4228 C CG1   . ILE D 72  ? 1.7826 2.1619 2.3801 0.0927  -0.1460 0.0801  72  ILE D CG1   
4229 C CG2   . ILE D 72  ? 1.4508 1.6352 1.8095 0.1551  -0.0834 0.1057  72  ILE D CG2   
4230 C CD1   . ILE D 72  ? 1.6925 1.9926 2.3403 0.0278  -0.1477 0.0795  72  ILE D CD1   
4231 N N     . TYR D 73  ? 1.7406 1.9271 1.9121 0.2913  -0.1137 0.0512  73  TYR D N     
4232 C CA    . TYR D 73  ? 2.0814 2.1688 2.1328 0.3374  -0.0825 0.0525  73  TYR D CA    
4233 C C     . TYR D 73  ? 1.9613 2.0990 1.9820 0.4053  -0.0539 0.0702  73  TYR D C     
4234 O O     . TYR D 73  ? 1.9162 1.9964 1.8709 0.4400  -0.0100 0.0842  73  TYR D O     
4235 C CB    . TYR D 73  ? 2.2060 2.2009 2.1905 0.3363  -0.1153 0.0135  73  TYR D CB    
4236 C CG    . TYR D 73  ? 2.1989 2.1164 2.1899 0.2784  -0.1320 -0.0007 73  TYR D CG    
4237 C CD1   . TYR D 73  ? 2.1874 2.0228 2.1321 0.2685  -0.0974 0.0152  73  TYR D CD1   
4238 C CD2   . TYR D 73  ? 2.3493 2.2792 2.3929 0.2376  -0.1825 -0.0321 73  TYR D CD2   
4239 C CE1   . TYR D 73  ? 2.1289 1.8968 2.0771 0.2221  -0.1091 0.0076  73  TYR D CE1   
4240 C CE2   . TYR D 73  ? 2.4661 2.3192 2.5169 0.1877  -0.1937 -0.0426 73  TYR D CE2   
4241 C CZ    . TYR D 73  ? 2.3191 2.0916 2.3210 0.1814  -0.1550 -0.0189 73  TYR D CZ    
4242 O OH    . TYR D 73  ? 2.5665 2.2654 2.5726 0.1383  -0.1629 -0.0243 73  TYR D OH    
4243 N N     . PHE D 74  ? 2.1427 2.3905 2.2135 0.4274  -0.0775 0.0682  74  PHE D N     
4244 C CA    . PHE D 74  ? 2.0276 2.3342 2.0782 0.4951  -0.0457 0.0927  74  PHE D CA    
4245 C C     . PHE D 74  ? 1.8729 2.2212 1.9541 0.5000  0.0022  0.1325  74  PHE D C     
4246 O O     . PHE D 74  ? 1.5371 1.8556 1.5600 0.5520  0.0476  0.1503  74  PHE D O     
4247 C CB    . PHE D 74  ? 1.7093 2.1455 1.8149 0.5184  -0.0843 0.0836  74  PHE D CB    
4248 C CG    . PHE D 74  ? 1.6893 2.1952 1.7766 0.5941  -0.0514 0.1131  74  PHE D CG    
4249 C CD1   . PHE D 74  ? 1.7059 2.3221 1.8626 0.6022  -0.0286 0.1459  74  PHE D CD1   
4250 C CD2   . PHE D 74  ? 1.9300 2.3918 1.9341 0.6607  -0.0394 0.1124  74  PHE D CD2   
4251 C CE1   . PHE D 74  ? 1.7373 2.4164 1.8749 0.6761  0.0034  0.1745  74  PHE D CE1   
4252 C CE2   . PHE D 74  ? 2.2230 2.7434 2.2113 0.7347  -0.0044 0.1436  74  PHE D CE2   
4253 C CZ    . PHE D 74  ? 2.0760 2.7043 2.1284 0.7429  0.0158  0.1730  74  PHE D CZ    
4254 N N     . ILE D 75  ? 1.8069 2.2240 1.9832 0.4486  -0.0045 0.1473  75  ILE D N     
4255 C CA    . ILE D 75  ? 1.7208 2.1858 1.9282 0.4565  0.0439  0.1909  75  ILE D CA    
4256 C C     . ILE D 75  ? 1.7912 2.1387 1.9101 0.4643  0.0840  0.1963  75  ILE D C     
4257 O O     . ILE D 75  ? 1.7397 2.0916 1.8213 0.5089  0.1305  0.2194  75  ILE D O     
4258 C CB    . ILE D 75  ? 1.7283 2.2896 2.0687 0.3967  0.0316  0.2103  75  ILE D CB    
4259 C CG1   . ILE D 75  ? 1.7860 2.4872 2.2242 0.3959  -0.0074 0.2005  75  ILE D CG1   
4260 C CG2   . ILE D 75  ? 1.7012 2.3003 2.0655 0.4060  0.0881  0.2622  75  ILE D CG2   
4261 C CD1   . ILE D 75  ? 1.8624 2.6524 2.4516 0.3261  -0.0289 0.2064  75  ILE D CD1   
4262 N N     . LYS D 76  ? 2.0382 2.2846 2.1229 0.4241  0.0653  0.1720  76  LYS D N     
4263 C CA    . LYS D 76  ? 1.9933 2.1347 1.9917 0.4341  0.0968  0.1694  76  LYS D CA    
4264 C C     . LYS D 76  ? 1.9919 2.0727 1.8990 0.4952  0.1202  0.1526  76  LYS D C     
4265 O O     . LYS D 76  ? 2.0419 2.0948 1.9005 0.5277  0.1605  0.1591  76  LYS D O     
4266 C CB    . LYS D 76  ? 1.9858 2.0333 1.9621 0.3853  0.0682  0.1436  76  LYS D CB    
4267 C CG    . LYS D 76  ? 2.2297 2.3065 2.2839 0.3294  0.0655  0.1677  76  LYS D CG    
4268 C CD    . LYS D 76  ? 2.3762 2.3525 2.4004 0.2882  0.0413  0.1437  76  LYS D CD    
4269 C CE    . LYS D 76  ? 2.4217 2.3074 2.3444 0.3122  0.0696  0.1388  76  LYS D CE    
4270 N NZ    . LYS D 76  ? 2.2379 2.1646 2.1661 0.3281  0.1163  0.1806  76  LYS D NZ    
4271 N N     . GLY D 77  ? 1.9351 1.9942 1.8200 0.5141  0.0971  0.1300  77  GLY D N     
4272 C CA    . GLY D 77  ? 1.9622 1.9600 1.7752 0.5722  0.1255  0.1195  77  GLY D CA    
4273 C C     . GLY D 77  ? 2.1011 2.1691 1.9240 0.6281  0.1653  0.1473  77  GLY D C     
4274 O O     . GLY D 77  ? 2.1663 2.1762 1.9349 0.6699  0.2050  0.1420  77  GLY D O     
4275 N N     . PHE D 78  ? 2.1360 2.3313 2.0327 0.6302  0.1548  0.1740  78  PHE D N     
4276 C CA    . PHE D 78  ? 2.1597 2.4330 2.0684 0.6886  0.1915  0.2036  78  PHE D CA    
4277 C C     . PHE D 78  ? 2.2212 2.4915 2.1141 0.7021  0.2369  0.2210  78  PHE D C     
4278 O O     . PHE D 78  ? 2.4255 2.6610 2.2672 0.7582  0.2782  0.2212  78  PHE D O     
4279 C CB    . PHE D 78  ? 2.1496 2.5745 2.1527 0.6817  0.1653  0.2263  78  PHE D CB    
4280 C CG    . PHE D 78  ? 2.3855 2.9038 2.4041 0.7466  0.1995  0.2591  78  PHE D CG    
4281 C CD1   . PHE D 78  ? 2.4743 2.9839 2.4500 0.8115  0.2109  0.2595  78  PHE D CD1   
4282 C CD2   . PHE D 78  ? 2.4072 3.0241 2.4848 0.7469  0.2244  0.2947  78  PHE D CD2   
4283 C CE1   . PHE D 78  ? 2.3304 2.9253 2.3188 0.8760  0.2449  0.2925  78  PHE D CE1   
4284 C CE2   . PHE D 78  ? 2.3299 3.0361 2.4210 0.8100  0.2569  0.3263  78  PHE D CE2   
4285 C CZ    . PHE D 78  ? 2.1723 2.8663 2.2173 0.8748  0.2663  0.3240  78  PHE D CZ    
4286 N N     . PHE D 79  ? 1.7629 2.0692 1.7000 0.6550  0.2319  0.2360  79  PHE D N     
4287 C CA    . PHE D 79  ? 1.8079 2.1328 1.7343 0.6707  0.2742  0.2596  79  PHE D CA    
4288 C C     . PHE D 79  ? 1.9525 2.1608 1.7967 0.6657  0.2857  0.2306  79  PHE D C     
4289 O O     . PHE D 79  ? 1.9112 2.1380 1.7430 0.6747  0.3146  0.2482  79  PHE D O     
4290 C CB    . PHE D 79  ? 1.9716 2.4074 1.9980 0.6289  0.2708  0.3013  79  PHE D CB    
4291 C CG    . PHE D 79  ? 2.4121 2.9879 2.5249 0.6466  0.2727  0.3344  79  PHE D CG    
4292 C CD1   . PHE D 79  ? 2.4503 3.0801 2.5449 0.7132  0.3158  0.3590  79  PHE D CD1   
4293 C CD2   . PHE D 79  ? 2.4027 3.0599 2.6172 0.5989  0.2299  0.3367  79  PHE D CD2   
4294 C CE1   . PHE D 79  ? 2.4073 3.1744 2.5825 0.7330  0.3179  0.3911  79  PHE D CE1   
4295 C CE2   . PHE D 79  ? 2.3092 3.1080 2.6096 0.6160  0.2282  0.3626  79  PHE D CE2   
4296 C CZ    . PHE D 79  ? 2.3703 3.2265 2.6506 0.6838  0.2730  0.3927  79  PHE D CZ    
4297 N N     . TYR D 80  ? 2.3066 2.4043 2.0960 0.6558  0.2647  0.1876  80  TYR D N     
4298 C CA    . TYR D 80  ? 2.4082 2.4033 2.1292 0.6453  0.2679  0.1546  80  TYR D CA    
4299 C C     . TYR D 80  ? 2.7552 2.7279 2.4160 0.6989  0.3108  0.1422  80  TYR D C     
4300 O O     . TYR D 80  ? 2.8841 2.8761 2.5279 0.6996  0.3262  0.1515  80  TYR D O     
4301 C CB    . TYR D 80  ? 2.2931 2.1816 1.9746 0.6330  0.2423  0.1122  80  TYR D CB    
4302 C CG    . TYR D 80  ? 2.3530 2.1471 1.9800 0.6101  0.2348  0.0771  80  TYR D CG    
4303 C CD1   . TYR D 80  ? 2.5658 2.3641 2.2079 0.5610  0.2131  0.0860  80  TYR D CD1   
4304 C CD2   . TYR D 80  ? 2.2981 2.0010 1.8649 0.6387  0.2508  0.0342  80  TYR D CD2   
4305 C CE1   . TYR D 80  ? 2.4019 2.1226 1.9915 0.5460  0.2063  0.0558  80  TYR D CE1   
4306 C CE2   . TYR D 80  ? 2.2833 1.9124 1.8058 0.6191  0.2409  -0.0019 80  TYR D CE2   
4307 C CZ    . TYR D 80  ? 2.2586 1.9006 1.7883 0.5752  0.2180  0.0104  80  TYR D CZ    
4308 O OH    . TYR D 80  ? 2.2497 1.8269 1.7331 0.5610  0.2080  -0.0234 80  TYR D OH    
4309 N N     . ASN D 81  ? 2.7997 2.7322 2.4282 0.7479  0.3320  0.1210  81  ASN D N     
4310 C CA    . ASN D 81  ? 2.7931 2.6970 2.3664 0.7996  0.3702  0.0979  81  ASN D CA    
4311 C C     . ASN D 81  ? 2.8645 2.8777 2.4595 0.8408  0.4042  0.1410  81  ASN D C     
4312 O O     . ASN D 81  ? 3.0525 3.0684 2.6029 0.8790  0.4328  0.1294  81  ASN D O     
4313 C CB    . ASN D 81  ? 2.8432 2.6538 2.3839 0.8367  0.3862  0.0583  81  ASN D CB    
4314 C CG    . ASN D 81  ? 2.9781 2.8200 2.5580 0.8564  0.3892  0.0877  81  ASN D CG    
4315 O OD1   . ASN D 81  ? 3.1586 3.1062 2.7901 0.8493  0.3796  0.1330  81  ASN D OD1   
4316 N ND2   . ASN D 81  ? 2.9291 2.6831 2.4894 0.8839  0.4041  0.0628  81  ASN D ND2   
4317 N N     . SER D 82  ? 2.7338 2.8435 2.3971 0.8370  0.4008  0.1884  82  SER D N     
4318 C CA    . SER D 82  ? 2.7539 2.9797 2.4507 0.8745  0.4336  0.2355  82  SER D CA    
4319 C C     . SER D 82  ? 2.4567 2.7337 2.1564 0.8615  0.4462  0.2609  82  SER D C     
4320 O O     . SER D 82  ? 2.3630 2.6013 2.0554 0.8150  0.4241  0.2512  82  SER D O     
4321 C CB    . SER D 82  ? 2.6651 2.9969 2.4505 0.8600  0.4179  0.2786  82  SER D CB    
4322 O OG    . SER D 82  ? 2.4921 2.7890 2.2678 0.8861  0.4119  0.2628  82  SER D OG    
4323 N N     . ASN D 83  ? 2.5419 2.9105 2.2521 0.9091  0.4861  0.2990  83  ASN D N     
4324 C CA    . ASN D 83  ? 2.8542 3.2772 2.5578 0.9156  0.5102  0.3302  83  ASN D CA    
4325 C C     . ASN D 83  ? 2.7269 3.2039 2.5145 0.8464  0.4900  0.3746  83  ASN D C     
4326 O O     . ASN D 83  ? 2.4221 2.9059 2.1959 0.8376  0.5022  0.3934  83  ASN D O     
4327 C CB    . ASN D 83  ? 3.2256 3.7507 2.9363 0.9823  0.5588  0.3717  83  ASN D CB    
4328 C CG    . ASN D 83  ? 3.3024 3.9398 3.1164 0.9734  0.5595  0.4237  83  ASN D CG    
4329 O OD1   . ASN D 83  ? 3.1749 3.7966 3.0281 0.9426  0.5261  0.4104  83  ASN D OD1   
4330 N ND2   . ASN D 83  ? 3.2913 4.0510 3.1508 1.0042  0.5977  0.4833  83  ASN D ND2   
4331 N N     . THR D 84  ? 2.9508 3.4677 2.8272 0.8002  0.4602  0.3904  84  THR D N     
4332 C CA    . THR D 84  ? 2.9535 3.5227 2.9270 0.7320  0.4410  0.4275  84  THR D CA    
4333 C C     . THR D 84  ? 2.8985 3.3601 2.8371 0.6804  0.4072  0.3923  84  THR D C     
4334 O O     . THR D 84  ? 2.9730 3.3275 2.8310 0.6869  0.3872  0.3363  84  THR D O     
4335 C CB    . THR D 84  ? 3.0111 3.6589 3.0906 0.7001  0.4122  0.4411  84  THR D CB    
4336 O OG1   . THR D 84  ? 3.1852 3.7611 3.2735 0.6439  0.3593  0.4013  84  THR D OG1   
4337 C CG2   . THR D 84  ? 2.8835 3.5615 2.9382 0.7620  0.4249  0.4330  84  THR D CG2   
4338 N N     . LYS D 85  ? 2.6257 3.1171 2.6330 0.6292  0.4041  0.4286  85  LYS D N     
4339 C CA    . LYS D 85  ? 2.4075 2.8070 2.3916 0.5803  0.3762  0.4052  85  LYS D CA    
4340 C C     . LYS D 85  ? 2.4235 2.8561 2.5283 0.5061  0.3446  0.4235  85  LYS D C     
4341 O O     . LYS D 85  ? 2.3390 2.8615 2.5463 0.4848  0.3666  0.4794  85  LYS D O     
4342 C CB    . LYS D 85  ? 2.4109 2.7983 2.3427 0.6015  0.4117  0.4304  85  LYS D CB    
4343 C CG    . LYS D 85  ? 2.4965 2.8558 2.3081 0.6769  0.4383  0.4011  85  LYS D CG    
4344 C CD    . LYS D 85  ? 2.6794 3.0330 2.4315 0.7018  0.4662  0.4200  85  LYS D CD    
4345 C CE    . LYS D 85  ? 2.8976 3.1571 2.6199 0.6563  0.4328  0.3907  85  LYS D CE    
4346 N NZ    . LYS D 85  ? 2.8173 2.9727 2.4636 0.6571  0.3954  0.3094  85  LYS D NZ    
4347 N N     . VAL D 86  ? 2.4991 2.8605 2.5967 0.4683  0.2945  0.3753  86  VAL D N     
4348 C CA    . VAL D 86  ? 2.0637 2.4482 2.2692 0.4000  0.2556  0.3757  86  VAL D CA    
4349 C C     . VAL D 86  ? 2.0767 2.3871 2.2818 0.3537  0.2492  0.3787  86  VAL D C     
4350 O O     . VAL D 86  ? 2.2446 2.4508 2.3502 0.3610  0.2380  0.3435  86  VAL D O     
4351 C CB    . VAL D 86  ? 1.6483 2.0042 1.8410 0.3933  0.2049  0.3225  86  VAL D CB    
4352 C CG1   . VAL D 86  ? 1.6183 2.0008 1.9185 0.3258  0.1592  0.3121  86  VAL D CG1   
4353 C CG2   . VAL D 86  ? 1.7620 2.1926 1.9530 0.4467  0.2165  0.3260  86  VAL D CG2   
4354 N N     . ILE D 87  ? 2.1402 2.5049 2.4633 0.3069  0.2586  0.4221  87  ILE D N     
4355 C CA    . ILE D 87  ? 2.0347 2.3336 2.3754 0.2625  0.2587  0.4345  87  ILE D CA    
4356 C C     . ILE D 87  ? 2.2714 2.5871 2.7440 0.1890  0.2183  0.4224  87  ILE D C     
4357 O O     . ILE D 87  ? 2.1062 2.5262 2.7027 0.1682  0.2175  0.4420  87  ILE D O     
4358 C CB    . ILE D 87  ? 1.6608 1.9979 2.0183 0.2822  0.3222  0.5070  87  ILE D CB    
4359 C CG1   . ILE D 87  ? 1.8995 2.1783 2.3018 0.2332  0.3268  0.5307  87  ILE D CG1   
4360 C CG2   . ILE D 87  ? 1.6217 2.0927 2.0927 0.2891  0.3574  0.5631  87  ILE D CG2   
4361 C CD1   . ILE D 87  ? 1.9583 2.1114 2.2413 0.2348  0.2993  0.4833  87  ILE D CD1   
4362 N N     . VAL D 88  ? 2.2133 2.4297 2.6612 0.1516  0.1834  0.3859  88  VAL D N     
4363 C CA    . VAL D 88  ? 1.9606 2.1722 2.5176 0.0837  0.1382  0.3589  88  VAL D CA    
4364 C C     . VAL D 88  ? 1.9933 2.1630 2.6171 0.0402  0.1647  0.3995  88  VAL D C     
4365 O O     . VAL D 88  ? 2.1431 2.2155 2.6760 0.0496  0.1742  0.3998  88  VAL D O     
4366 C CB    . VAL D 88  ? 1.9199 2.0485 2.3975 0.0793  0.0786  0.2851  88  VAL D CB    
4367 C CG1   . VAL D 88  ? 2.1450 2.3477 2.6439 0.0939  0.0405  0.2479  88  VAL D CG1   
4368 C CG2   . VAL D 88  ? 2.0472 2.0815 2.3636 0.1271  0.0910  0.2709  88  VAL D CG2   
4369 N N     . ARG D 89  ? 1.9462 2.1908 2.7344 -0.0061 0.1786  0.4352  89  ARG D N     
4370 C CA    . ARG D 89  ? 1.9978 2.2060 2.8720 -0.0477 0.2135  0.4839  89  ARG D CA    
4371 C C     . ARG D 89  ? 2.0191 2.1576 2.9614 -0.1146 0.1606  0.4305  89  ARG D C     
4372 O O     . ARG D 89  ? 2.1378 2.3129 3.1369 -0.1428 0.1030  0.3705  89  ARG D O     
4373 C CB    . ARG D 89  ? 2.0543 2.3776 3.0880 -0.0647 0.2641  0.5557  89  ARG D CB    
4374 C CG    . ARG D 89  ? 2.4112 2.7025 3.5603 -0.1092 0.3094  0.6162  89  ARG D CG    
4375 C CD    . ARG D 89  ? 2.6283 3.0360 3.9160 -0.1094 0.3755  0.7026  89  ARG D CD    
4376 N NE    . ARG D 89  ? 2.7824 3.2306 3.9534 -0.0269 0.4326  0.7598  89  ARG D NE    
4377 C CZ    . ARG D 89  ? 2.8452 3.3970 4.0964 -0.0040 0.4987  0.8425  89  ARG D CZ    
4378 N NH1   . ARG D 89  ? 2.8983 3.4819 4.0250 0.0785  0.5453  0.8844  89  ARG D NH1   
4379 N NH2   . ARG D 89  ? 2.7294 3.3560 4.1898 -0.0625 0.5183  0.8813  89  ARG D NH2   
4380 N N     . ASN D 90  ? 3.6834 2.4004 2.8436 -0.1136 0.1480  0.2549  90  ASN D N     
4381 C CA    . ASN D 90  ? 3.5297 2.5117 2.9076 -0.0377 0.0825  0.1821  90  ASN D CA    
4382 C C     . ASN D 90  ? 3.8331 2.9287 3.2777 0.0440  0.0986  0.0970  90  ASN D C     
4383 O O     . ASN D 90  ? 3.5046 2.4360 2.8512 0.0090  0.1193  0.0869  90  ASN D O     
4384 C CB    . ASN D 90  ? 3.5382 2.4528 3.0068 -0.1182 -0.0401 0.1700  90  ASN D CB    
4385 C CG    . ASN D 90  ? 3.4835 2.6069 3.1163 -0.0853 -0.0859 0.1717  90  ASN D CG    
4386 O OD1   . ASN D 90  ? 3.4786 2.7742 3.1245 -0.0220 -0.0229 0.1954  90  ASN D OD1   
4387 N ND2   . ASN D 90  ? 3.5930 2.7062 3.3583 -0.1312 -0.1975 0.1490  90  ASN D ND2   
4388 N N     . PRO D 91  ? 3.8835 3.2636 3.4910 0.1486  0.0908  0.0336  91  PRO D N     
4389 C CA    . PRO D 91  ? 3.9563 3.4487 3.6276 0.2218  0.0985  -0.0464 91  PRO D CA    
4390 C C     . PRO D 91  ? 4.1901 3.5847 3.9212 0.1751  0.0045  -0.1095 91  PRO D C     
4391 O O     . PRO D 91  ? 4.1637 3.6426 4.0473 0.1771  -0.0879 -0.1609 91  PRO D O     
4392 C CB    . PRO D 91  ? 3.7584 3.5765 3.5858 0.3283  0.1022  -0.0989 91  PRO D CB    
4393 C CG    . PRO D 91  ? 3.7310 3.6025 3.6188 0.3000  0.0665  -0.0677 91  PRO D CG    
4394 C CD    . PRO D 91  ? 3.8749 3.4931 3.5931 0.2038  0.0917  0.0376  91  PRO D CD    
4395 N N     . THR D 92  ? 4.3293 3.5471 3.9467 0.1312  0.0267  -0.1053 92  THR D N     
4396 C CA    . THR D 92  ? 4.4249 3.6237 4.1102 0.1187  -0.0455 -0.1766 92  THR D CA    
4397 C C     . THR D 92  ? 4.9658 4.4336 4.7935 0.2383  -0.0425 -0.2580 92  THR D C     
4398 O O     . THR D 92  ? 4.5943 4.1644 4.5748 0.2610  -0.1322 -0.3335 92  THR D O     
4399 C CB    . THR D 92  ? 4.2462 3.2249 3.7699 0.0482  -0.0042 -0.1519 92  THR D CB    
4400 O OG1   . THR D 92  ? 4.1100 3.1536 3.5645 0.1201  0.1149  -0.1348 92  THR D OG1   
4401 C CG2   . THR D 92  ? 4.3492 3.0543 3.7171 -0.0817 -0.0090 -0.0778 92  THR D CG2   
4402 N N     . PHE D 93  ? 5.6796 5.2549 5.4571 0.3118  0.0584  -0.2422 93  PHE D N     
4403 C CA    . PHE D 93  ? 5.6374 5.4725 5.5205 0.4209  0.0764  -0.3041 93  PHE D CA    
4404 C C     . PHE D 93  ? 5.5259 5.5741 5.5796 0.4724  0.0108  -0.3740 93  PHE D C     
4405 O O     . PHE D 93  ? 5.6455 5.7169 5.7313 0.4570  -0.0036 -0.3499 93  PHE D O     
4406 C CB    . PHE D 93  ? 5.7377 5.6620 5.5444 0.4811  0.1909  -0.2441 93  PHE D CB    
4407 C CG    . PHE D 93  ? 5.6979 5.9217 5.6093 0.5844  0.2083  -0.2869 93  PHE D CG    
4408 C CD1   . PHE D 93  ? 5.6627 6.0062 5.6208 0.6396  0.2107  -0.3391 93  PHE D CD1   
4409 C CD2   . PHE D 93  ? 5.6827 6.0718 5.6371 0.6183  0.2233  -0.2712 93  PHE D CD2   
4410 C CE1   . PHE D 93  ? 5.5706 6.1863 5.6101 0.7238  0.2247  -0.3769 93  PHE D CE1   
4411 C CE2   . PHE D 93  ? 5.5968 6.2647 5.6318 0.7014  0.2416  -0.3111 93  PHE D CE2   
4412 C CZ    . PHE D 93  ? 5.5400 6.3178 5.6137 0.7529  0.2416  -0.3646 93  PHE D CZ    
4413 N N     . LYS D 94  ? 4.8688 5.0748 5.0336 0.5326  -0.0269 -0.4639 94  LYS D N     
4414 C CA    . LYS D 94  ? 4.1424 4.5587 4.4800 0.5898  -0.0871 -0.5563 94  LYS D CA    
4415 C C     . LYS D 94  ? 3.7189 4.0238 4.1515 0.5301  -0.1909 -0.5797 94  LYS D C     
4416 O O     . LYS D 94  ? 3.6303 3.9950 4.1271 0.5294  -0.2018 -0.5696 94  LYS D O     
4417 C CB    . LYS D 94  ? 3.9509 4.6009 4.3102 0.6574  -0.0180 -0.5448 94  LYS D CB    
4418 C CG    . LYS D 94  ? 3.6797 4.5942 4.2002 0.7335  -0.0515 -0.6577 94  LYS D CG    
4419 C CD    . LYS D 94  ? 3.5629 4.7235 4.0731 0.7938  0.0295  -0.6417 94  LYS D CD    
4420 C CE    . LYS D 94  ? 3.3783 4.8066 4.0246 0.8667  0.0082  -0.7644 94  LYS D CE    
4421 N NZ    . LYS D 94  ? 3.2062 4.6598 4.0155 0.8652  -0.0705 -0.8518 94  LYS D NZ    
4422 N N     . GLY D 95  ? 3.4432 3.5879 3.8889 0.4760  -0.2713 -0.6065 95  GLY D N     
4423 C CA    . GLY D 95  ? 3.2573 3.2889 3.8095 0.4162  -0.3894 -0.6303 95  GLY D CA    
4424 C C     . GLY D 95  ? 3.3105 3.4300 4.0208 0.4581  -0.4797 -0.7433 95  GLY D C     
4425 O O     . GLY D 95  ? 3.3701 3.4058 4.0385 0.4348  -0.5068 -0.7596 95  GLY D O     
4426 N N     . GLY D 96  ? 3.2940 3.5818 4.1891 0.5182  -0.5262 -0.8244 96  GLY D N     
4427 C CA    . GLY D 96  ? 3.1999 3.5852 4.2522 0.5698  -0.6055 -0.9443 96  GLY D CA    
4428 C C     . GLY D 96  ? 3.1133 3.6870 4.1286 0.6519  -0.5331 -0.9970 96  GLY D C     
4429 O O     . GLY D 96  ? 2.9692 3.7529 3.9863 0.7215  -0.4499 -1.0118 96  GLY D O     
4430 N N     . SER D 97  ? 3.2139 3.7197 4.1940 0.6374  -0.5675 -1.0202 97  SER D N     
4431 C CA    . SER D 97  ? 3.2233 3.9024 4.1743 0.7075  -0.5118 -1.0664 97  SER D CA    
4432 C C     . SER D 97  ? 3.3075 4.0238 4.0911 0.7173  -0.3817 -0.9708 97  SER D C     
4433 O O     . SER D 97  ? 3.2190 3.7845 3.8896 0.6605  -0.3383 -0.8705 97  SER D O     
4434 C CB    . SER D 97  ? 3.2160 3.7992 4.1667 0.6777  -0.5851 -1.1008 97  SER D CB    
4435 O OG    . SER D 97  ? 3.2282 3.5950 4.0341 0.5899  -0.5723 -1.0031 97  SER D OG    
4436 N N     . TYR D 98  ? 3.4721 4.3880 4.2423 0.7882  -0.3232 -1.0025 98  TYR D N     
4437 C CA    . TYR D 98  ? 3.5278 4.5023 4.1639 0.8078  -0.2076 -0.9149 98  TYR D CA    
4438 C C     . TYR D 98  ? 3.5334 4.5039 4.1042 0.8129  -0.1878 -0.9015 98  TYR D C     
4439 O O     . TYR D 98  ? 3.6126 4.6507 4.0954 0.8390  -0.0975 -0.8343 98  TYR D O     
4440 C CB    . TYR D 98  ? 3.5208 4.7575 4.1911 0.8811  -0.1462 -0.9392 98  TYR D CB    
4441 C CG    . TYR D 98  ? 3.6742 4.9483 4.2185 0.8897  -0.0364 -0.8285 98  TYR D CG    
4442 C CD1   . TYR D 98  ? 3.8011 4.9368 4.2727 0.8445  0.0002  -0.7363 98  TYR D CD1   
4443 C CD2   . TYR D 98  ? 3.6908 5.1344 4.1925 0.9398  0.0240  -0.8126 98  TYR D CD2   
4444 C CE1   . TYR D 98  ? 3.8619 5.0187 4.2240 0.8525  0.0944  -0.6352 98  TYR D CE1   
4445 C CE2   . TYR D 98  ? 3.7528 5.2244 4.1539 0.9481  0.1153  -0.7061 98  TYR D CE2   
4446 C CZ    . TYR D 98  ? 3.8362 5.1605 4.1692 0.9063  0.1504  -0.6198 98  TYR D CZ    
4447 O OH    . TYR D 98  ? 3.8884 5.2279 4.1261 0.9147  0.2357  -0.5141 98  TYR D OH    
4448 N N     . ARG D 99  ? 3.4883 4.3815 4.1071 0.7864  -0.2735 -0.9581 99  ARG D N     
4449 C CA    . ARG D 99  ? 3.3607 4.2616 3.9336 0.7868  -0.2655 -0.9507 99  ARG D CA    
4450 C C     . ARG D 99  ? 3.3194 3.9740 3.8040 0.6995  -0.2768 -0.8849 99  ARG D C     
4451 O O     . ARG D 99  ? 3.3222 3.9289 3.8131 0.6706  -0.3280 -0.9077 99  ARG D O     
4452 C CB    . ARG D 99  ? 3.2149 4.2300 3.8995 0.8182  -0.3534 -1.0656 99  ARG D CB    
4453 C CG    . ARG D 99  ? 3.0580 4.3303 3.8185 0.9003  -0.3364 -1.1447 99  ARG D CG    
4454 C CD    . ARG D 99  ? 3.0531 4.4139 3.9116 0.9247  -0.4241 -1.2638 99  ARG D CD    
4455 N NE    . ARG D 99  ? 3.0519 4.6647 3.9661 0.9973  -0.4001 -1.3474 99  ARG D NE    
4456 C CZ    . ARG D 99  ? 3.1386 4.8293 4.1669 1.0284  -0.4353 -1.4463 99  ARG D CZ    
4457 N NH1   . ARG D 99  ? 3.1704 4.7044 4.2828 0.9966  -0.5039 -1.4670 99  ARG D NH1   
4458 N NH2   . ARG D 99  ? 3.1240 5.0542 4.1857 1.0881  -0.4019 -1.5245 99  ARG D NH2   
4459 N N     . ASN D 100 ? 3.2774 3.7741 3.6717 0.6502  -0.2285 -0.8030 100 ASN D N     
4460 C CA    . ASN D 100 ? 3.3296 3.5830 3.6265 0.5546  -0.2354 -0.7454 100 ASN D CA    
4461 C C     . ASN D 100 ? 3.5773 3.7716 3.7371 0.5485  -0.1116 -0.6515 100 ASN D C     
4462 O O     . ASN D 100 ? 3.6071 3.5931 3.6661 0.4657  -0.0957 -0.6008 100 ASN D O     
4463 C CB    . ASN D 100 ? 3.3011 3.3736 3.6021 0.4784  -0.3004 -0.7335 100 ASN D CB    
4464 C CG    . ASN D 100 ? 3.3594 3.4320 3.8035 0.4650  -0.4392 -0.8201 100 ASN D CG    
4465 O OD1   . ASN D 100 ? 3.3658 3.4753 3.9075 0.4822  -0.4852 -0.8537 100 ASN D OD1   
4466 N ND2   . ASN D 100 ? 3.3638 3.3959 3.8298 0.4339  -0.5087 -0.8559 100 ASN D ND2   
4467 N N     . ARG D 101 ? 3.6285 3.9981 3.7839 0.6308  -0.0250 -0.6278 101 ARG D N     
4468 C CA    . ARG D 101 ? 3.7730 4.0883 3.8198 0.6348  0.0913  -0.5387 101 ARG D CA    
4469 C C     . ARG D 101 ? 3.8818 4.1083 3.8833 0.5960  0.1075  -0.5245 101 ARG D C     
4470 O O     . ARG D 101 ? 4.0378 4.0613 3.9375 0.5243  0.1458  -0.4784 101 ARG D O     
4471 C CB    . ARG D 101 ? 3.7749 4.3147 3.8484 0.7306  0.1620  -0.5154 101 ARG D CB    
4472 C CG    . ARG D 101 ? 3.7726 4.4155 3.8754 0.7649  0.1651  -0.5173 101 ARG D CG    
4473 C CD    . ARG D 101 ? 3.7885 4.6583 3.9074 0.8468  0.2299  -0.4873 101 ARG D CD    
4474 N NE    . ARG D 101 ? 3.8449 4.8280 3.9824 0.8728  0.2398  -0.4831 101 ARG D NE    
4475 C CZ    . ARG D 101 ? 3.8900 5.0792 4.0375 0.9315  0.2865  -0.4551 101 ARG D CZ    
4476 N NH1   . ARG D 101 ? 3.8650 5.1647 4.0120 0.9729  0.3230  -0.4255 101 ARG D NH1   
4477 N NH2   . ARG D 101 ? 3.9107 5.2014 4.0708 0.9435  0.2939  -0.4517 101 ARG D NH2   
4478 N N     . LYS D 102 ? 3.6147 3.9950 3.6896 0.6364  0.0762  -0.5674 102 LYS D N     
4479 C CA    . LYS D 102 ? 3.2950 3.6507 3.3448 0.6159  0.1028  -0.5486 102 LYS D CA    
4480 C C     . LYS D 102 ? 3.6843 3.7943 3.6445 0.5072  0.0948  -0.5291 102 LYS D C     
4481 O O     . LYS D 102 ? 3.6028 3.6243 3.4824 0.4849  0.1861  -0.4744 102 LYS D O     
4482 C CB    . LYS D 102 ? 2.9090 3.4209 3.0573 0.6413  0.0187  -0.6173 102 LYS D CB    
4483 C CG    . LYS D 102 ? 2.6696 3.4391 2.8910 0.7394  0.0338  -0.6353 102 LYS D CG    
4484 C CD    . LYS D 102 ? 2.6607 3.5565 2.9570 0.7500  -0.0426 -0.6958 102 LYS D CD    
4485 C CE    . LYS D 102 ? 2.7600 3.9120 3.1191 0.8349  -0.0388 -0.7226 102 LYS D CE    
4486 N NZ    . LYS D 102 ? 2.8706 4.0893 3.2757 0.8615  -0.0844 -0.7920 102 LYS D NZ    
4487 N N     . LYS D 103 ? 3.9622 3.9603 3.9381 0.4358  -0.0144 -0.5737 103 LYS D N     
4488 C CA    . LYS D 103 ? 4.1765 3.9518 4.0678 0.3163  -0.0441 -0.5580 103 LYS D CA    
4489 C C     . LYS D 103 ? 4.3562 3.9576 4.1091 0.2702  0.0610  -0.4881 103 LYS D C     
4490 O O     . LYS D 103 ? 4.5049 4.0395 4.1788 0.2399  0.1428  -0.4536 103 LYS D O     
4491 C CB    . LYS D 103 ? 4.0997 3.7770 4.0385 0.2493  -0.1842 -0.6038 103 LYS D CB    
4492 C CG    . LYS D 103 ? 3.9989 3.8089 4.0732 0.2812  -0.3000 -0.6826 103 LYS D CG    
4493 C CD    . LYS D 103 ? 4.0351 3.7382 4.1753 0.2224  -0.4375 -0.7243 103 LYS D CD    
4494 C CE    . LYS D 103 ? 4.0265 3.8323 4.3006 0.2467  -0.5580 -0.8077 103 LYS D CE    
4495 N NZ    . LYS D 103 ? 3.9007 3.9540 4.2636 0.3723  -0.5251 -0.8602 103 LYS D NZ    
4496 N N     . GLN D 104 ? 4.3197 3.8554 4.0466 0.2677  0.0642  -0.4691 104 GLN D N     
4497 C CA    . GLN D 104 ? 4.3741 3.7175 3.9589 0.2098  0.1503  -0.4065 104 GLN D CA    
4498 C C     . GLN D 104 ? 4.3865 3.7914 3.9316 0.2837  0.2931  -0.3597 104 GLN D C     
4499 O O     . GLN D 104 ? 4.5178 3.7731 3.9499 0.2341  0.3796  -0.3230 104 GLN D O     
4500 C CB    . GLN D 104 ? 4.3268 3.6007 3.9027 0.1913  0.1134  -0.3924 104 GLN D CB    
4501 C CG    . GLN D 104 ? 4.1616 3.6383 3.8303 0.3048  0.1315  -0.3978 104 GLN D CG    
4502 C CD    . GLN D 104 ? 3.9836 3.5393 3.7734 0.3139  0.0133  -0.4531 104 GLN D CD    
4503 O OE1   . GLN D 104 ? 3.9534 3.4219 3.7786 0.2453  -0.0927 -0.4894 104 GLN D OE1   
4504 N NE2   . GLN D 104 ? 3.8229 3.5482 3.6831 0.3975  0.0302  -0.4601 104 GLN D NE2   
4505 N N     . SER D 105 ? 4.0032 3.6291 3.6437 0.3993  0.3182  -0.3619 105 SER D N     
4506 C CA    . SER D 105 ? 3.7854 3.4738 3.4064 0.4718  0.4428  -0.3081 105 SER D CA    
4507 C C     . SER D 105 ? 4.0944 3.7656 3.6989 0.4602  0.5028  -0.3007 105 SER D C     
4508 O O     . SER D 105 ? 3.8655 3.3921 3.3770 0.4305  0.6010  -0.2619 105 SER D O     
4509 C CB    . SER D 105 ? 3.3658 3.3118 3.0974 0.5853  0.4398  -0.3107 105 SER D CB    
4510 O OG    . SER D 105 ? 3.1493 3.1228 2.8948 0.5959  0.3999  -0.3158 105 SER D OG    
4511 N N     . ILE D 106 ? 4.4716 4.2858 4.1661 0.4787  0.4448  -0.3412 106 ILE D N     
4512 C CA    . ILE D 106 ? 4.8766 4.7068 4.5726 0.4734  0.5038  -0.3296 106 ILE D CA    
4513 C C     . ILE D 106 ? 5.4523 5.0581 5.0352 0.3494  0.5101  -0.3356 106 ILE D C     
4514 O O     . ILE D 106 ? 5.5244 5.0727 5.0600 0.3332  0.6090  -0.3113 106 ILE D O     
4515 C CB    . ILE D 106 ? 4.6906 4.7338 4.5076 0.5174  0.4338  -0.3666 106 ILE D CB    
4516 C CG1   . ILE D 106 ? 4.6778 4.7941 4.5236 0.5432  0.5165  -0.3357 106 ILE D CG1   
4517 C CG2   . ILE D 106 ? 4.6319 4.6182 4.4570 0.4333  0.3040  -0.4270 106 ILE D CG2   
4518 C CD1   . ILE D 106 ? 4.6832 4.8541 4.5432 0.6298  0.6410  -0.2713 106 ILE D CD1   
4519 N N     . ASP D 107 ? 5.8713 5.3427 5.4071 0.2565  0.4108  -0.3647 107 ASP D N     
4520 C CA    . ASP D 107 ? 6.0538 5.3125 5.4700 0.1231  0.4081  -0.3647 107 ASP D CA    
4521 C C     . ASP D 107 ? 5.9654 5.0375 5.2421 0.0864  0.5276  -0.3223 107 ASP D C     
4522 O O     . ASP D 107 ? 6.1551 5.1414 5.3543 0.0408  0.6184  -0.3121 107 ASP D O     
4523 C CB    . ASP D 107 ? 6.3005 5.4612 5.7119 0.0314  0.2605  -0.3964 107 ASP D CB    
4524 C CG    . ASP D 107 ? 6.5983 5.5590 5.8914 -0.1210 0.2344  -0.3938 107 ASP D CG    
4525 O OD1   . ASP D 107 ? 6.7157 5.6523 5.9485 -0.1510 0.3236  -0.3821 107 ASP D OD1   
4526 O OD2   . ASP D 107 ? 6.6951 5.5277 5.9597 -0.2141 0.1237  -0.4017 107 ASP D OD2   
4527 N N     . VAL D 108 ? 5.4870 4.4982 4.7312 0.1058  0.5330  -0.2997 108 VAL D N     
4528 C CA    . VAL D 108 ? 5.0767 3.8971 4.1817 0.0681  0.6400  -0.2602 108 VAL D CA    
4529 C C     . VAL D 108 ? 5.3288 4.2166 4.4522 0.1585  0.7843  -0.2335 108 VAL D C     
4530 O O     . VAL D 108 ? 4.9005 3.6334 3.9152 0.1116  0.8893  -0.2217 108 VAL D O     
4531 C CB    . VAL D 108 ? 4.6591 3.4203 3.7389 0.0731  0.6056  -0.2361 108 VAL D CB    
4532 C CG1   . VAL D 108 ? 4.5240 3.3175 3.5988 0.1673  0.7176  -0.1901 108 VAL D CG1   
4533 C CG2   . VAL D 108 ? 4.6185 3.1202 3.5469 -0.0734 0.5709  -0.2271 108 VAL D CG2   
4534 N N     . PHE D 109 ? 5.8051 4.9256 5.0703 0.2854  0.7910  -0.2254 109 PHE D N     
4535 C CA    . PHE D 109 ? 5.5583 4.7518 4.8651 0.3725  0.9172  -0.1927 109 PHE D CA    
4536 C C     . PHE D 109 ? 5.4688 4.6381 4.7631 0.3296  0.9746  -0.2119 109 PHE D C     
4537 O O     . PHE D 109 ? 5.5923 4.6026 4.7908 0.2898  1.0838  -0.2038 109 PHE D O     
4538 C CB    . PHE D 109 ? 5.3299 4.7917 4.7941 0.5020  0.8961  -0.1761 109 PHE D CB    
4539 C CG    . PHE D 109 ? 5.1895 4.6998 4.6682 0.5541  0.8673  -0.1497 109 PHE D CG    
4540 C CD1   . PHE D 109 ? 5.2387 4.5579 4.6025 0.5065  0.8911  -0.1263 109 PHE D CD1   
4541 C CD2   . PHE D 109 ? 5.0122 4.7648 4.6139 0.6439  0.8164  -0.1475 109 PHE D CD2   
4542 C CE1   . PHE D 109 ? 5.1246 4.5011 4.5049 0.5496  0.8643  -0.0980 109 PHE D CE1   
4543 C CE2   . PHE D 109 ? 4.8923 4.7048 4.5043 0.6849  0.7940  -0.1242 109 PHE D CE2   
4544 C CZ    . PHE D 109 ? 4.9295 4.5573 4.4350 0.6388  0.8180  -0.0977 109 PHE D CZ    
4545 N N     . ILE D 110 ? 5.0749 4.3899 4.4563 0.3255  0.8977  -0.2423 110 ILE D N     
4546 C CA    . ILE D 110 ? 4.7454 4.0790 4.1353 0.2888  0.9452  -0.2565 110 ILE D CA    
4547 C C     . ILE D 110 ? 4.8796 3.9730 4.1050 0.1470  0.9790  -0.2754 110 ILE D C     
4548 O O     . ILE D 110 ? 4.9330 4.0027 4.1342 0.1159  1.0698  -0.2818 110 ILE D O     
4549 C CB    . ILE D 110 ? 4.3374 3.8573 3.8389 0.2940  0.8300  -0.2850 110 ILE D CB    
4550 C CG1   . ILE D 110 ? 4.1716 3.9016 3.8059 0.3882  0.8925  -0.2639 110 ILE D CG1   
4551 C CG2   . ILE D 110 ? 4.2603 3.6625 3.6815 0.1524  0.7551  -0.3213 110 ILE D CG2   
4552 C CD1   . ILE D 110 ? 3.9279 3.8481 3.6706 0.3978  0.7807  -0.2880 110 ILE D CD1   
4553 N N     . GLN D 111 ? 4.8942 3.8112 4.0048 0.0557  0.9111  -0.2830 111 GLN D N     
4554 C CA    . GLN D 111 ? 5.0463 3.7305 3.9851 -0.0932 0.9373  -0.2961 111 GLN D CA    
4555 C C     . GLN D 111 ? 5.1667 3.6770 3.9861 -0.0972 1.0806  -0.2777 111 GLN D C     
4556 O O     . GLN D 111 ? 5.2005 3.5939 3.9187 -0.1703 1.1778  -0.2932 111 GLN D O     
4557 C CB    . GLN D 111 ? 5.0475 3.6096 3.9168 -0.2039 0.7921  -0.3060 111 GLN D CB    
4558 C CG    . GLN D 111 ? 5.0119 3.6626 3.9504 -0.2571 0.6555  -0.3338 111 GLN D CG    
4559 C CD    . GLN D 111 ? 5.1093 3.6111 3.9806 -0.3784 0.5145  -0.3388 111 GLN D CD    
4560 O OE1   . GLN D 111 ? 5.2092 3.5376 3.9707 -0.4336 0.5223  -0.3189 111 GLN D OE1   
4561 N NE2   . GLN D 111 ? 5.0652 3.6313 4.0084 -0.4222 0.3792  -0.3618 111 GLN D NE2   
4562 N N     . LYS D 112 ? 5.1891 3.6786 4.0152 -0.0233 1.0988  -0.2471 112 LYS D N     
4563 C CA    . LYS D 112 ? 5.3540 3.6211 4.0314 -0.0638 1.1995  -0.2319 112 LYS D CA    
4564 C C     . LYS D 112 ? 5.3526 3.6642 4.0915 0.0680  1.3217  -0.1998 112 LYS D C     
4565 O O     . LYS D 112 ? 5.5101 3.6280 4.1280 0.0401  1.4118  -0.1896 112 LYS D O     
4566 C CB    . LYS D 112 ? 5.3695 3.4895 3.9478 -0.1422 1.1018  -0.2169 112 LYS D CB    
4567 C CG    . LYS D 112 ? 5.4936 3.3291 3.8635 -0.2559 1.1699  -0.2112 112 LYS D CG    
4568 C CD    . LYS D 112 ? 5.4069 3.1034 3.6819 -0.3683 1.0455  -0.1969 112 LYS D CD    
4569 C CE    . LYS D 112 ? 5.2694 2.9536 3.5261 -0.4892 0.9282  -0.2228 112 LYS D CE    
4570 N NZ    . LYS D 112 ? 5.2106 2.7403 3.3772 -0.6096 0.8069  -0.2026 112 LYS D NZ    
4571 N N     . ILE D 113 ? 3.4537 5.2000 3.1502 -0.0293 0.0536  1.2678  113 ILE D N     
4572 C CA    . ILE D 113 ? 3.1817 5.1057 3.0205 0.0553  -0.0428 1.3543  113 ILE D CA    
4573 C C     . ILE D 113 ? 3.2220 5.0644 3.1647 0.0154  -0.0091 1.2306  113 ILE D C     
4574 O O     . ILE D 113 ? 3.2481 5.0669 3.2464 0.0456  -0.0764 1.3299  113 ILE D O     
4575 C CB    . ILE D 113 ? 3.0456 5.3525 3.0049 0.1710  -0.1051 1.3457  113 ILE D CB    
4576 C CG1   . ILE D 113 ? 2.9571 5.4189 2.9917 0.1590  -0.0222 1.1141  113 ILE D CG1   
4577 C CG2   . ILE D 113 ? 3.1541 5.5506 3.0245 0.2220  -0.1707 1.5194  113 ILE D CG2   
4578 C CD1   . ILE D 113 ? 2.8284 5.6742 2.9836 0.2775  -0.0801 1.0972  113 ILE D CD1   
4579 N N     . SER D 114 ? 3.2411 5.0384 3.2091 -0.0555 0.0965  1.0093  114 SER D N     
4580 C CA    . SER D 114 ? 3.0808 4.8756 3.1777 -0.0836 0.1262  0.8539  114 SER D CA    
4581 C C     . SER D 114 ? 3.4179 4.9103 3.4692 -0.1579 0.1305  0.9177  114 SER D C     
4582 O O     . SER D 114 ? 3.1044 4.6367 3.2763 -0.1408 0.0927  0.8866  114 SER D O     
4583 C CB    . SER D 114 ? 2.9293 4.7308 3.0491 -0.1564 0.2527  0.5926  114 SER D CB    
4584 O OG    . SER D 114 ? 2.4986 4.5744 2.6596 -0.0922 0.2561  0.5314  114 SER D OG    
4585 N N     . GLU D 115 ? 3.9788 5.1727 3.8587 -0.2346 0.1721  1.0024  115 GLU D N     
4586 C CA    . GLU D 115 ? 4.2242 5.1192 4.0614 -0.3137 0.1926  1.0363  115 GLU D CA    
4587 C C     . GLU D 115 ? 4.2850 5.1731 4.1514 -0.2556 0.0811  1.2532  115 GLU D C     
4588 O O     . GLU D 115 ? 4.3590 5.0075 4.1952 -0.3142 0.0896  1.3023  115 GLU D O     
4589 C CB    . GLU D 115 ? 4.3787 4.9406 4.0100 -0.4105 0.2811  1.0373  115 GLU D CB    
4590 C CG    . GLU D 115 ? 4.4825 5.0216 4.0374 -0.4658 0.3940  0.8524  115 GLU D CG    
4591 C CD    . GLU D 115 ? 4.4981 5.0878 3.9230 -0.4238 0.3780  0.9414  115 GLU D CD    
4592 O OE1   . GLU D 115 ? 4.3947 5.1272 3.8342 -0.3373 0.2713  1.1250  115 GLU D OE1   
4593 O OE2   . GLU D 115 ? 4.5771 5.0572 3.8793 -0.4798 0.4732  0.8256  115 GLU D OE2   
4594 N N     . TYR D 116 ? 4.2588 5.3952 4.1802 -0.1447 -0.0184 1.3814  116 TYR D N     
4595 C CA    . TYR D 116 ? 4.2615 5.3730 4.1800 -0.0940 -0.1145 1.5994  116 TYR D CA    
4596 C C     . TYR D 116 ? 4.0838 5.4294 4.1541 0.0028  -0.2052 1.6269  116 TYR D C     
4597 O O     . TYR D 116 ? 4.1012 5.3748 4.1963 0.0201  -0.2654 1.7537  116 TYR D O     
4598 C CB    . TYR D 116 ? 4.3582 5.4780 4.1900 -0.0497 -0.1488 1.6886  116 TYR D CB    
4599 C CG    . TYR D 116 ? 4.5167 5.3784 4.1976 -0.1199 -0.0775 1.6184  116 TYR D CG    
4600 C CD1   . TYR D 116 ? 4.6956 5.2711 4.2899 -0.2151 -0.0042 1.5750  116 TYR D CD1   
4601 C CD2   . TYR D 116 ? 4.5321 5.4266 4.1549 -0.0878 -0.0834 1.5810  116 TYR D CD2   
4602 C CE1   . TYR D 116 ? 4.8384 5.1602 4.2716 -0.2599 0.0577  1.4925  116 TYR D CE1   
4603 C CE2   . TYR D 116 ? 4.6614 5.3152 4.1313 -0.1353 -0.0296 1.5109  116 TYR D CE2   
4604 C CZ    . TYR D 116 ? 4.8582 5.2222 4.2230 -0.2144 0.0404  1.4659  116 TYR D CZ    
4605 O OH    . TYR D 116 ? 5.0205 5.1257 4.2104 -0.2454 0.0955  1.3859  116 TYR D OH    
4606 N N     . THR D 117 ? 3.6570 5.2762 3.8237 0.0702  -0.2157 1.5074  117 THR D N     
4607 C CA    . THR D 117 ? 3.1911 5.0540 3.4828 0.1839  -0.3071 1.5249  117 THR D CA    
4608 C C     . THR D 117 ? 3.1076 5.0780 3.5411 0.1852  -0.2817 1.2984  117 THR D C     
4609 O O     . THR D 117 ? 3.0378 5.1032 3.5649 0.2548  -0.3555 1.3073  117 THR D O     
4610 C CB    . THR D 117 ? 2.8298 4.9658 3.1190 0.2922  -0.3616 1.5902  117 THR D CB    
4611 O OG1   . THR D 117 ? 2.8215 5.1896 3.2239 0.4102  -0.4445 1.5801  117 THR D OG1   
4612 C CG2   . THR D 117 ? 2.7224 4.9683 3.0080 0.2679  -0.2835 1.4272  117 THR D CG2   
4613 N N     . ASP D 118 ? 2.9679 4.9249 3.4134 0.1114  -0.1784 1.0895  118 ASP D N     
4614 C CA    . ASP D 118 ? 2.7796 4.8712 3.3619 0.1076  -0.1382 0.8379  118 ASP D CA    
4615 C C     . ASP D 118 ? 2.6857 5.1397 3.3795 0.2458  -0.2008 0.7753  118 ASP D C     
4616 O O     . ASP D 118 ? 2.6822 5.2922 3.5070 0.2721  -0.1909 0.5714  118 ASP D O     
4617 C CB    . ASP D 118 ? 2.6870 4.6579 3.3464 0.0716  -0.1567 0.7888  118 ASP D CB    
4618 C CG    . ASP D 118 ? 2.6191 4.2340 3.1782 -0.0601 -0.0974 0.8482  118 ASP D CG    
4619 O OD1   . ASP D 118 ? 2.6344 4.0870 3.0715 -0.1416 -0.0115 0.8423  118 ASP D OD1   
4620 O OD2   . ASP D 118 ? 2.5793 4.0748 3.1779 -0.0778 -0.1383 0.8984  118 ASP D OD2   
4621 N N     . TYR D 119 ? 2.7569 5.3528 3.4023 0.3369  -0.2652 0.9374  119 TYR D N     
4622 C CA    . TYR D 119 ? 2.8963 5.8344 3.6321 0.4754  -0.3254 0.8938  119 TYR D CA    
4623 C C     . TYR D 119 ? 3.1637 6.2222 3.8448 0.4849  -0.2903 0.9084  119 TYR D C     
4624 O O     . TYR D 119 ? 3.1366 6.3737 3.8028 0.5876  -0.3649 1.0405  119 TYR D O     
4625 C CB    . TYR D 119 ? 2.7961 5.8149 3.5307 0.5981  -0.4560 1.0893  119 TYR D CB    
4626 C CG    . TYR D 119 ? 2.8420 5.7439 3.6237 0.5980  -0.5021 1.0922  119 TYR D CG    
4627 C CD1   . TYR D 119 ? 2.9069 5.9293 3.8215 0.6282  -0.5030 0.8766  119 TYR D CD1   
4628 C CD2   . TYR D 119 ? 2.9020 5.5807 3.5987 0.5690  -0.5459 1.3048  119 TYR D CD2   
4629 C CE1   . TYR D 119 ? 2.9663 5.8852 3.9236 0.6288  -0.5518 0.8769  119 TYR D CE1   
4630 C CE2   . TYR D 119 ? 2.9640 5.5377 3.7063 0.5684  -0.5897 1.3115  119 TYR D CE2   
4631 C CZ    . TYR D 119 ? 3.0045 5.6973 3.8751 0.5986  -0.5956 1.0996  119 TYR D CZ    
4632 O OH    . TYR D 119 ? 3.0952 5.6877 4.0113 0.5991  -0.6457 1.1032  119 TYR D OH    
4633 N N     . LYS D 120 ? 3.2970 6.2477 3.9387 0.3743  -0.1739 0.7723  120 LYS D N     
4634 C CA    . LYS D 120 ? 3.3479 6.3920 3.9290 0.3731  -0.1348 0.7770  120 LYS D CA    
4635 C C     . LYS D 120 ? 3.5705 6.9962 4.2763 0.5005  -0.1738 0.6903  120 LYS D C     
4636 O O     . LYS D 120 ? 3.5045 7.0910 4.1859 0.5896  -0.2463 0.8367  120 LYS D O     
4637 C CB    . LYS D 120 ? 3.1764 6.0372 3.6965 0.2362  0.0053  0.6094  120 LYS D CB    
4638 C CG    . LYS D 120 ? 3.0260 6.0295 3.5127 0.2428  0.0540  0.5571  120 LYS D CG    
4639 C CD    . LYS D 120 ? 3.0607 5.9393 3.5182 0.1240  0.2017  0.3331  120 LYS D CD    
4640 C CE    . LYS D 120 ? 2.9700 6.0019 3.3972 0.1370  0.2459  0.2842  120 LYS D CE    
4641 N NZ    . LYS D 120 ? 2.8486 5.7959 3.1230 0.1494  0.1908  0.5111  120 LYS D NZ    
4642 N N     . ASN D 121 ? 3.8020 7.3819 4.6449 0.5112  -0.1246 0.4436  121 ASN D N     
4643 C CA    . ASN D 121 ? 3.7287 7.6791 4.6997 0.6321  -0.1494 0.3295  121 ASN D CA    
4644 C C     . ASN D 121 ? 3.6752 7.8277 4.7176 0.7917  -0.2837 0.4244  121 ASN D C     
4645 O O     . ASN D 121 ? 3.7210 8.1774 4.8395 0.9147  -0.3286 0.3961  121 ASN D O     
4646 C CB    . ASN D 121 ? 3.7824 7.8341 4.8790 0.5896  -0.0454 0.0149  121 ASN D CB    
4647 C CG    . ASN D 121 ? 3.7956 7.6725 4.8108 0.4429  0.0968  -0.0930 121 ASN D CG    
4648 O OD1   . ASN D 121 ? 3.7351 7.5539 4.6354 0.4175  0.1102  0.0297  121 ASN D OD1   
4649 N ND2   . ASN D 121 ? 3.8601 7.6450 4.9252 0.3451  0.2044  -0.3282 121 ASN D ND2   
4650 N N     . ASP D 122 ? 3.2789 7.2646 4.2913 0.7954  -0.3481 0.5371  122 ASP D N     
4651 C CA    . ASP D 122 ? 2.8457 6.9872 3.8952 0.9479  -0.4760 0.6412  122 ASP D CA    
4652 C C     . ASP D 122 ? 3.0053 7.0068 3.8890 0.9682  -0.4956 0.8162  122 ASP D C     
4653 O O     . ASP D 122 ? 2.7558 6.7600 3.6110 1.0473  -0.5275 0.8008  122 ASP D O     
4654 C CB    . ASP D 122 ? 2.6696 6.5719 3.6794 0.9183  -0.5237 0.7426  122 ASP D CB    
4655 C CG    . ASP D 122 ? 2.5307 6.4267 3.5242 1.0345  -0.6170 0.7886  122 ASP D CG    
4656 O OD1   . ASP D 122 ? 2.5950 6.6185 3.6113 1.1191  -0.6240 0.6749  122 ASP D OD1   
4657 O OD2   . ASP D 122 ? 2.3932 6.0746 3.3221 1.0182  -0.6643 0.9234  122 ASP D OD2   
4658 N N     . ILE D 123 ? 3.2375 7.0896 4.0097 0.8849  -0.4659 0.9640  123 ILE D N     
4659 C CA    . ILE D 123 ? 3.4489 7.1613 4.0885 0.8764  -0.4554 1.0785  123 ILE D CA    
4660 C C     . ILE D 123 ? 3.3672 7.2681 4.0269 0.8884  -0.4063 0.9785  123 ILE D C     
4661 O O     . ILE D 123 ? 3.4874 7.3790 4.0980 0.9231  -0.4055 0.9956  123 ILE D O     
4662 C CB    . ILE D 123 ? 3.5487 6.9792 4.0638 0.7760  -0.4390 1.2533  123 ILE D CB    
4663 C CG1   . ILE D 123 ? 3.6168 6.8450 4.1139 0.7572  -0.4793 1.3365  123 ILE D CG1   
4664 C CG2   . ILE D 123 ? 3.6238 6.9310 4.0507 0.7609  -0.4217 1.3257  123 ILE D CG2   
4665 C CD1   . ILE D 123 ? 3.7305 6.8972 4.2183 0.8269  -0.5292 1.3483  123 ILE D CD1   
4666 N N     . LEU D 124 ? 3.1070 7.1840 3.8508 0.8540  -0.3594 0.8605  124 LEU D N     
4667 C CA    . LEU D 124 ? 2.7706 7.0071 3.5298 0.8510  -0.3023 0.7538  124 LEU D CA    
4668 C C     . LEU D 124 ? 3.0950 7.4938 3.9249 0.9400  -0.3031 0.5896  124 LEU D C     
4669 O O     . LEU D 124 ? 2.9611 7.4086 3.7471 0.9537  -0.2783 0.5631  124 LEU D O     
4670 C CB    . LEU D 124 ? 2.3432 6.7103 3.1996 0.7731  -0.2265 0.6280  124 LEU D CB    
4671 C CG    . LEU D 124 ? 2.1207 6.3870 2.8557 0.6871  -0.1658 0.6749  124 LEU D CG    
4672 C CD1   . LEU D 124 ? 2.1014 6.1185 2.7830 0.5380  -0.0294 0.5079  124 LEU D CD1   
4673 C CD2   . LEU D 124 ? 2.0654 6.5085 2.8047 0.7420  -0.1546 0.6104  124 LEU D CD2   
4674 N N     . ASN D 125 ? 4.5026 6.9463 4.0980 -0.1578 -0.0619 1.5293  125 ASN D N     
4675 C CA    . ASN D 125 ? 4.5689 7.1299 4.1410 -0.2714 -0.0360 1.5472  125 ASN D CA    
4676 C C     . ASN D 125 ? 4.3633 6.8434 4.0572 -0.2696 -0.0835 1.5750  125 ASN D C     
4677 O O     . ASN D 125 ? 4.3828 6.9239 4.0499 -0.3746 -0.0560 1.5991  125 ASN D O     
4678 C CB    . ASN D 125 ? 4.6643 7.5417 4.2754 -0.2483 -0.0767 1.4883  125 ASN D CB    
4679 C CG    . ASN D 125 ? 4.6445 7.6514 4.4575 -0.0801 -0.2051 1.4237  125 ASN D CG    
4680 O OD1   . ASN D 125 ? 4.6009 7.4834 4.5501 0.0018  -0.2758 1.4339  125 ASN D OD1   
4681 N ND2   . ASN D 125 ? 4.6410 7.9087 4.4793 -0.0289 -0.2398 1.3540  125 ASN D ND2   
4682 N N     . LYS D 126 ? 4.1380 6.4860 3.9632 -0.1578 -0.1548 1.5749  126 LYS D N     
4683 C CA    . LYS D 126 ? 3.8579 6.1370 3.7997 -0.1618 -0.2061 1.6080  126 LYS D CA    
4684 C C     . LYS D 126 ? 3.8167 5.8336 3.7913 -0.1233 -0.2074 1.6405  126 LYS D C     
4685 O O     . LYS D 126 ? 3.5348 5.4983 3.6240 -0.1096 -0.2641 1.6676  126 LYS D O     
4686 C CB    . LYS D 126 ? 3.6923 6.1593 3.8288 -0.0542 -0.3389 1.5680  126 LYS D CB    
4687 C CG    . LYS D 126 ? 3.6757 6.3984 3.8034 -0.1118 -0.3471 1.5388  126 LYS D CG    
4688 C CD    . LYS D 126 ? 3.5459 6.4376 3.8822 -0.0076 -0.4924 1.4962  126 LYS D CD    
4689 C CE    . LYS D 126 ? 3.4430 6.5835 3.7711 -0.0692 -0.5011 1.4609  126 LYS D CE    
4690 N NZ    . LYS D 126 ? 3.2519 6.5560 3.7936 0.0298  -0.6549 1.4132  126 LYS D NZ    
4691 N N     . TYR D 127 ? 3.9870 5.8416 3.8671 -0.1087 -0.1511 1.6388  127 TYR D N     
4692 C CA    . TYR D 127 ? 3.9853 5.5798 3.8747 -0.0898 -0.1371 1.6646  127 TYR D CA    
4693 C C     . TYR D 127 ? 4.0595 5.4912 3.7703 -0.2166 -0.0208 1.6910  127 TYR D C     
4694 O O     . TYR D 127 ? 4.0398 5.4948 3.6218 -0.2557 0.0351  1.6805  127 TYR D O     
4695 C CB    . TYR D 127 ? 3.8993 5.4114 3.8718 0.0693  -0.1981 1.6309  127 TYR D CB    
4696 C CG    . TYR D 127 ? 3.7361 5.2775 3.9170 0.1968  -0.3200 1.6215  127 TYR D CG    
4697 C CD1   . TYR D 127 ? 3.6697 5.4400 3.9787 0.2766  -0.4160 1.5853  127 TYR D CD1   
4698 C CD2   . TYR D 127 ? 3.6202 4.9593 3.8756 0.2358  -0.3446 1.6469  127 TYR D CD2   
4699 C CE1   . TYR D 127 ? 3.5203 5.3076 4.0307 0.3926  -0.5402 1.5790  127 TYR D CE1   
4700 C CE2   . TYR D 127 ? 3.4714 4.8292 3.9189 0.3468  -0.4613 1.6460  127 TYR D CE2   
4701 C CZ    . TYR D 127 ? 3.3943 4.9717 3.9711 0.4252  -0.5621 1.6144  127 TYR D CZ    
4702 O OH    . TYR D 127 ? 3.1251 4.7148 3.9038 0.5355  -0.6907 1.6155  127 TYR D OH    
4703 N N     . THR D 128 ? 4.0724 5.3469 3.7823 -0.2820 0.0090  1.7239  128 THR D N     
4704 C CA    . THR D 128 ? 4.1866 5.2942 3.7519 -0.3984 0.1075  1.7411  128 THR D CA    
4705 C C     . THR D 128 ? 4.0616 4.9824 3.6892 -0.3986 0.1031  1.7559  128 THR D C     
4706 O O     . THR D 128 ? 3.8992 4.8731 3.5957 -0.4415 0.0845  1.7806  128 THR D O     
4707 C CB    . THR D 128 ? 4.2538 5.4770 3.7118 -0.5494 0.1763  1.7621  128 THR D CB    
4708 O OG1   . THR D 128 ? 4.1691 5.6127 3.6053 -0.5402 0.1624  1.7463  128 THR D OG1   
4709 C CG2   . THR D 128 ? 4.3627 5.3988 3.6884 -0.6374 0.2602  1.7190  128 THR D CG2   
4710 N N     . LYS D 129 ? 4.1457 4.8557 3.7497 -0.3535 0.1176  1.7399  129 LYS D N     
4711 C CA    . LYS D 129 ? 4.0483 4.5770 3.7067 -0.3520 0.1172  1.7441  129 LYS D CA    
4712 C C     . LYS D 129 ? 4.2829 4.5857 3.8445 -0.3632 0.1696  1.7205  129 LYS D C     
4713 O O     . LYS D 129 ? 4.3514 4.6363 3.8202 -0.3548 0.1908  1.7073  129 LYS D O     
4714 C CB    . LYS D 129 ? 3.7117 4.2374 3.5423 -0.2150 0.0196  1.7433  129 LYS D CB    
4715 C CG    . LYS D 129 ? 3.4827 3.9058 3.3919 -0.2382 0.0087  1.7617  129 LYS D CG    
4716 C CD    . LYS D 129 ? 3.4215 3.9776 3.3257 -0.3660 0.0303  1.7978  129 LYS D CD    
4717 C CE    . LYS D 129 ? 3.3344 3.8143 3.3200 -0.3921 0.0145  1.8186  129 LYS D CE    
4718 N NZ    . LYS D 129 ? 3.5078 3.7786 3.4294 -0.4250 0.0787  1.7895  129 LYS D NZ    
4719 N N     . LEU D 130 ? 4.2910 4.4251 3.8768 -0.3859 0.1861  1.7137  130 LEU D N     
4720 C CA    . LEU D 130 ? 4.3037 4.2261 3.7921 -0.4301 0.2411  1.6864  130 LEU D CA    
4721 C C     . LEU D 130 ? 4.5008 4.2534 4.0118 -0.3027 0.2051  1.6570  130 LEU D C     
4722 O O     . LEU D 130 ? 4.0375 3.7322 3.4533 -0.2979 0.2224  1.6459  130 LEU D O     
4723 C CB    . LEU D 130 ? 3.9965 3.8222 3.5046 -0.5075 0.2732  1.6644  130 LEU D CB    
4724 C CG    . LEU D 130 ? 3.6604 3.6308 3.1521 -0.6194 0.3072  1.6393  130 LEU D CG    
4725 C CD1   . LEU D 130 ? 3.4648 3.3462 2.9870 -0.6744 0.3325  1.5988  130 LEU D CD1   
4726 C CD2   . LEU D 130 ? 3.4976 3.5097 2.8614 -0.7025 0.3630  1.6032  130 LEU D CD2   
4727 N N     . ASP D 131 ? 5.1642 4.8369 4.8009 -0.2009 0.1522  1.6471  131 ASP D N     
4728 C CA    . ASP D 131 ? 5.5263 4.9934 5.1867 -0.0916 0.1265  1.6131  131 ASP D CA    
4729 C C     . ASP D 131 ? 5.5535 5.0538 5.3676 0.0625  0.0405  1.6148  131 ASP D C     
4730 O O     . ASP D 131 ? 5.6863 5.0213 5.5733 0.1446  0.0118  1.5930  131 ASP D O     
4731 C CB    . ASP D 131 ? 5.7594 5.0111 5.4032 -0.1418 0.1633  1.5820  131 ASP D CB    
4732 C CG    . ASP D 131 ? 5.8432 5.1217 5.5962 -0.1580 0.1483  1.5907  131 ASP D CG    
4733 O OD1   . ASP D 131 ? 5.8357 5.3051 5.6182 -0.2158 0.1450  1.6285  131 ASP D OD1   
4734 O OD2   . ASP D 131 ? 5.8806 4.9924 5.6893 -0.1158 0.1379  1.5601  131 ASP D OD2   
4735 N N     . ASP D 132 ? 5.4611 5.1749 5.3334 0.1069  -0.0073 1.6363  132 ASP D N     
4736 C CA    . ASP D 132 ? 5.2434 5.0038 5.2717 0.2601  -0.1019 1.6337  132 ASP D CA    
4737 C C     . ASP D 132 ? 5.1128 4.9462 5.1372 0.3676  -0.1379 1.6111  132 ASP D C     
4738 O O     . ASP D 132 ? 5.2597 4.9823 5.3469 0.4980  -0.1827 1.5850  132 ASP D O     
4739 C CB    . ASP D 132 ? 5.0856 5.0461 5.2203 0.2404  -0.1524 1.6696  132 ASP D CB    
4740 C CG    . ASP D 132 ? 4.9692 5.1262 5.0141 0.1274  -0.1113 1.6876  132 ASP D CG    
4741 O OD1   . ASP D 132 ? 4.9980 5.1050 4.8969 0.0114  -0.0245 1.6859  132 ASP D OD1   
4742 O OD2   . ASP D 132 ? 4.8559 5.2144 4.9791 0.1573  -0.1702 1.6998  132 ASP D OD2   
4743 N N     . ILE D 133 ? 3.3368 5.2411 4.6165 -1.0114 -0.3356 1.0532  133 ILE D N     
4744 C CA    . ILE D 133 ? 3.1179 4.9853 4.3418 -1.0305 -0.3100 1.1246  133 ILE D CA    
4745 C C     . ILE D 133 ? 3.0585 4.7272 4.2180 -1.1219 -0.4648 1.0454  133 ILE D C     
4746 O O     . ILE D 133 ? 3.0197 4.5836 4.1690 -1.1243 -0.4380 1.0309  133 ILE D O     
4747 C CB    . ILE D 133 ? 2.4819 4.4765 3.6192 -1.0337 -0.2961 1.2646  133 ILE D CB    
4748 C CG1   . ILE D 133 ? 2.3379 4.3318 3.3881 -1.1263 -0.4555 1.2848  133 ILE D CG1   
4749 C CG2   . ILE D 133 ? 2.2864 4.4166 3.4663 -0.9207 -0.1578 1.3103  133 ILE D CG2   
4750 C CD1   . ILE D 133 ? 2.0731 4.2002 3.0473 -1.1358 -0.4554 1.4184  133 ILE D CD1   
4751 N N     . ALA D 134 ? 3.1634 4.7272 4.2478 -1.1705 -0.6235 0.9680  134 ALA D N     
4752 C CA    . ALA D 134 ? 3.3547 4.6582 4.3249 -1.2135 -0.7692 0.8594  134 ALA D CA    
4753 C C     . ALA D 134 ? 3.5912 4.7307 4.6248 -1.1741 -0.7613 0.7130  134 ALA D C     
4754 O O     . ALA D 134 ? 3.6044 4.6012 4.5945 -1.1924 -0.7787 0.6908  134 ALA D O     
4755 C CB    . ALA D 134 ? 3.3577 4.5472 4.2195 -1.2209 -0.8948 0.7838  134 ALA D CB    
4756 N N     . ASN D 135 ? 3.7488 4.9098 4.8865 -1.1183 -0.7263 0.6153  135 ASN D N     
4757 C CA    . ASN D 135 ? 3.9060 4.8782 5.0782 -1.0553 -0.7090 0.4561  135 ASN D CA    
4758 C C     . ASN D 135 ? 3.9341 4.8988 5.1297 -0.9793 -0.5418 0.4970  135 ASN D C     
4759 O O     . ASN D 135 ? 4.1133 4.8772 5.2607 -0.9662 -0.5632 0.4170  135 ASN D O     
4760 C CB    . ASN D 135 ? 3.9180 4.9275 5.1861 -0.9968 -0.6809 0.3478  135 ASN D CB    
4761 C CG    . ASN D 135 ? 4.0493 4.9518 5.2284 -1.0049 -0.8148 0.2334  135 ASN D CG    
4762 O OD1   . ASN D 135 ? 4.2205 4.9412 5.2525 -1.0115 -0.9085 0.1804  135 ASN D OD1   
4763 N ND2   . ASN D 135 ? 3.9860 4.9949 5.2362 -0.9747 -0.7878 0.1907  135 ASN D ND2   
4764 N N     . SER D 136 ? 3.4304 4.6124 4.6984 -0.9301 -0.3777 0.6241  136 SER D N     
4765 C CA    . SER D 136 ? 2.9111 4.0947 4.2143 -0.8496 -0.2122 0.6575  136 SER D CA    
4766 C C     . SER D 136 ? 2.7642 3.8770 3.9740 -0.8979 -0.2333 0.7272  136 SER D C     
4767 O O     . SER D 136 ? 2.7895 3.7373 3.9750 -0.8602 -0.2018 0.6588  136 SER D O     
4768 C CB    . SER D 136 ? 2.5465 3.9850 3.9486 -0.7908 -0.0425 0.7837  136 SER D CB    
4769 O OG    . SER D 136 ? 2.4635 4.0886 3.8400 -0.8575 -0.0550 0.9476  136 SER D OG    
4770 N N     . PHE D 137 ? 2.5811 3.8163 3.7352 -0.9844 -0.2879 0.8616  137 PHE D N     
4771 C CA    . PHE D 137 ? 2.7126 3.8972 3.7746 -1.0382 -0.3050 0.9352  137 PHE D CA    
4772 C C     . PHE D 137 ? 3.0708 3.9782 4.0256 -1.0915 -0.4634 0.8127  137 PHE D C     
4773 O O     . PHE D 137 ? 3.0599 3.8447 3.9572 -1.0902 -0.4429 0.8053  137 PHE D O     
4774 C CB    . PHE D 137 ? 2.7154 4.0949 3.7412 -1.1251 -0.3361 1.1008  137 PHE D CB    
4775 C CG    . PHE D 137 ? 2.6272 3.9837 3.5622 -1.1832 -0.3386 1.1882  137 PHE D CG    
4776 C CD1   . PHE D 137 ? 2.5978 4.0279 3.5492 -1.0989 -0.1737 1.2471  137 PHE D CD1   
4777 C CD2   . PHE D 137 ? 2.8003 4.0357 3.6094 -1.2958 -0.5073 1.1869  137 PHE D CD2   
4778 C CE1   . PHE D 137 ? 2.7346 4.1291 3.5855 -1.1263 -0.1747 1.2982  137 PHE D CE1   
4779 C CE2   . PHE D 137 ? 3.0884 4.2909 3.7924 -1.3313 -0.5046 1.2534  137 PHE D CE2   
4780 C CZ    . PHE D 137 ? 2.9849 4.2749 3.7149 -1.2482 -0.3368 1.3084  137 PHE D CZ    
4781 N N     . ASN D 138 ? 3.2577 4.0623 4.1826 -1.1407 -0.6263 0.7159  138 ASN D N     
4782 C CA    . ASN D 138 ? 3.5659 4.1009 4.3907 -1.1916 -0.7875 0.5961  138 ASN D CA    
4783 C C     . ASN D 138 ? 3.6377 3.9806 4.4922 -1.1027 -0.7340 0.4494  138 ASN D C     
4784 O O     . ASN D 138 ? 3.7950 3.9436 4.5682 -1.1217 -0.7852 0.4006  138 ASN D O     
4785 C CB    . ASN D 138 ? 3.7020 4.1530 4.4576 -1.2028 -0.9334 0.5061  138 ASN D CB    
4786 C CG    . ASN D 138 ? 3.8238 4.3857 4.4874 -1.2599 -0.9844 0.6304  138 ASN D CG    
4787 O OD1   . ASN D 138 ? 3.8708 4.4819 4.4700 -1.3221 -0.9825 0.7529  138 ASN D OD1   
4788 N ND2   . ASN D 138 ? 3.8592 4.4573 4.5151 -1.2377 -1.0235 0.5974  138 ASN D ND2   
4789 N N     . LEU D 139 ? 3.5424 3.9365 4.5108 -1.0066 -0.6291 0.3796  139 LEU D N     
4790 C CA    . LEU D 139 ? 3.3338 3.5597 4.3374 -0.9176 -0.5629 0.2463  139 LEU D CA    
4791 C C     . LEU D 139 ? 3.2963 3.5212 4.2846 -0.8793 -0.4299 0.3202  139 LEU D C     
4792 O O     . LEU D 139 ? 3.2438 3.2620 4.1762 -0.8705 -0.4588 0.2393  139 LEU D O     
4793 C CB    . LEU D 139 ? 3.0807 3.3931 4.2116 -0.8248 -0.4580 0.1783  139 LEU D CB    
4794 C CG    . LEU D 139 ? 2.8985 3.1422 4.0545 -0.8379 -0.5818 0.0386  139 LEU D CG    
4795 C CD1   . LEU D 139 ? 2.7997 3.1509 4.0802 -0.7456 -0.4516 -0.0104 139 LEU D CD1   
4796 C CD2   . LEU D 139 ? 2.8217 2.7783 3.9163 -0.8525 -0.7213 -0.1306 139 LEU D CD2   
4797 N N     . GLY D 140 ? 3.1880 3.6442 4.2263 -0.8565 -0.2855 0.4731  140 GLY D N     
4798 C CA    . GLY D 140 ? 3.0929 3.5672 4.1252 -0.8182 -0.1534 0.5457  140 GLY D CA    
4799 C C     . GLY D 140 ? 3.0300 3.3827 3.9297 -0.9060 -0.2508 0.5807  140 GLY D C     
4800 O O     . GLY D 140 ? 2.9685 3.1684 3.8295 -0.8802 -0.2218 0.5319  140 GLY D O     
4801 N N     . LEU D 141 ? 3.0567 3.4723 3.8819 -1.0139 -0.3705 0.6646  141 LEU D N     
4802 C CA    . LEU D 141 ? 3.2284 3.5427 3.9203 -1.1089 -0.4662 0.7110  141 LEU D CA    
4803 C C     . LEU D 141 ? 3.2841 3.2941 3.8896 -1.1347 -0.6146 0.5572  141 LEU D C     
4804 O O     . LEU D 141 ? 3.4473 3.3203 3.9613 -1.1663 -0.6383 0.5568  141 LEU D O     
4805 C CB    . LEU D 141 ? 3.3446 3.7964 3.9799 -1.2203 -0.5667 0.8312  141 LEU D CB    
4806 C CG    . LEU D 141 ? 3.4637 3.9096 3.9791 -1.3161 -0.6075 0.9381  141 LEU D CG    
4807 C CD1   . LEU D 141 ? 3.3926 3.9689 3.9475 -1.2609 -0.4175 1.0346  141 LEU D CD1   
4808 C CD2   . LEU D 141 ? 3.4494 4.0364 3.9164 -1.4250 -0.7084 1.0516  141 LEU D CD2   
4809 N N     . SER D 142 ? 3.1808 3.0814 3.8137 -1.1223 -0.7171 0.4231  142 SER D N     
4810 C CA    . SER D 142 ? 2.9492 2.5595 3.5089 -1.1333 -0.8545 0.2653  142 SER D CA    
4811 C C     . SER D 142 ? 2.9804 2.4560 3.5743 -1.0426 -0.7479 0.1777  142 SER D C     
4812 O O     . SER D 142 ? 2.9534 2.2352 3.4443 -1.0403 -0.7965 0.1150  142 SER D O     
4813 C CB    . SER D 142 ? 2.9609 2.5351 3.5175 -1.0576 -0.9135 0.1302  142 SER D CB    
4814 O OG    . SER D 142 ? 3.0576 2.4349 3.5174 -0.9688 -0.9420 -0.0205 142 SER D OG    
4815 N N     . TYR D 143 ? 2.9136 2.5105 3.6332 -0.9344 -0.5762 0.1703  143 TYR D N     
4816 C CA    . TYR D 143 ? 2.7330 2.2230 3.4890 -0.8399 -0.4564 0.0986  143 TYR D CA    
4817 C C     . TYR D 143 ? 3.1305 2.6257 3.8177 -0.8596 -0.3858 0.2016  143 TYR D C     
4818 O O     . TYR D 143 ? 2.7719 2.0763 3.4117 -0.8385 -0.3878 0.1269  143 TYR D O     
4819 C CB    . TYR D 143 ? 2.3232 1.9702 3.2257 -0.7274 -0.2801 0.0950  143 TYR D CB    
4820 C CG    . TYR D 143 ? 2.4400 2.0075 3.3919 -0.6245 -0.1366 0.0374  143 TYR D CG    
4821 C CD1   . TYR D 143 ? 2.5398 1.8888 3.5061 -0.5719 -0.1726 -0.1385 143 TYR D CD1   
4822 C CD2   . TYR D 143 ? 2.5674 2.2823 3.5565 -0.5785 0.0350  0.1570  143 TYR D CD2   
4823 C CE1   . TYR D 143 ? 2.5518 1.8283 3.5642 -0.4778 -0.0413 -0.1911 143 TYR D CE1   
4824 C CE2   . TYR D 143 ? 2.4449 2.0886 3.4813 -0.4837 0.1656  0.1048  143 TYR D CE2   
4825 C CZ    . TYR D 143 ? 2.4854 1.9091 3.5319 -0.4341 0.1273  -0.0679 143 TYR D CZ    
4826 O OH    . TYR D 143 ? 1.9388 1.2911 3.0327 -0.3399 0.2570  -0.1199 143 TYR D OH    
4827 N N     . MET D 144 ? 3.9663 3.6825 4.6491 -0.9000 -0.3216 0.3712  144 MET D N     
4828 C CA    . MET D 144 ? 4.2036 3.9516 4.8287 -0.9194 -0.2439 0.4736  144 MET D CA    
4829 C C     . MET D 144 ? 4.4232 3.9873 4.8891 -1.0309 -0.4062 0.4667  144 MET D C     
4830 O O     . MET D 144 ? 4.6002 4.0541 5.0036 -1.0307 -0.3750 0.4628  144 MET D O     
4831 C CB    . MET D 144 ? 4.2285 4.2739 4.9015 -0.9314 -0.1323 0.6517  144 MET D CB    
4832 C CG    . MET D 144 ? 4.0564 4.2855 4.8832 -0.8233 0.0283  0.6683  144 MET D CG    
4833 S SD    . MET D 144 ? 3.9860 4.4958 4.8825 -0.7832 0.2325  0.8467  144 MET D SD    
4834 C CE    . MET D 144 ? 4.1178 4.6900 4.8814 -0.9304 0.1213  0.9786  144 MET D CE    
4835 N N     . GLU D 145 ? 4.2643 3.7915 4.6605 -1.1287 -0.5819 0.4661  145 GLU D N     
4836 C CA    . GLU D 145 ? 4.1635 3.5027 4.4039 -1.2394 -0.7507 0.4556  145 GLU D CA    
4837 C C     . GLU D 145 ? 4.1919 3.2663 4.3775 -1.1627 -0.8072 0.2749  145 GLU D C     
4838 O O     . GLU D 145 ? 4.2555 3.2092 4.3243 -1.1642 -0.8345 0.2592  145 GLU D O     
4839 C CB    . GLU D 145 ? 4.0936 3.4862 4.2644 -1.3030 -0.8961 0.4835  145 GLU D CB    
4840 C CG    . GLU D 145 ? 3.9445 3.6060 4.1507 -1.3935 -0.8585 0.6700  145 GLU D CG    
4841 C CD    . GLU D 145 ? 3.9225 3.6499 4.0401 -1.4594 -0.8131 0.8034  145 GLU D CD    
4842 O OE1   . GLU D 145 ? 4.0862 3.6255 4.0763 -1.4718 -0.8754 0.7537  145 GLU D OE1   
4843 O OE2   . GLU D 145 ? 3.7902 3.7717 3.9547 -1.4630 -0.7017 0.9446  145 GLU D OE2   
4844 N N     . SER D 146 ? 3.9977 3.0247 4.2634 -1.0643 -0.7970 0.1370  146 SER D N     
4845 C CA    . SER D 146 ? 3.9050 2.7725 4.1342 -0.9487 -0.7874 -0.0272 146 SER D CA    
4846 C C     . SER D 146 ? 3.7784 2.5610 4.0606 -0.9041 -0.6677 -0.0570 146 SER D C     
4847 O O     . SER D 146 ? 3.6493 2.3341 3.8963 -0.8131 -0.6366 -0.1769 146 SER D O     
4848 C CB    . SER D 146 ? 3.8801 2.7713 4.1663 -0.8606 -0.7879 -0.1502 146 SER D CB    
4849 O OG    . SER D 146 ? 3.8070 2.7534 4.2392 -0.8364 -0.7004 -0.1633 146 SER D OG    
4850 N N     . LEU D 147 ? 3.7299 2.5954 4.1008 -0.9539 -0.5687 0.0690  147 LEU D N     
4851 C CA    . LEU D 147 ? 3.6640 2.5167 4.0860 -0.8573 -0.4005 0.0533  147 LEU D CA    
4852 C C     . LEU D 147 ? 3.8362 2.5692 4.1344 -0.9101 -0.4182 0.0909  147 LEU D C     
4853 O O     . LEU D 147 ? 3.9305 2.5077 4.2223 -0.8532 -0.3717 0.0085  147 LEU D O     
4854 C CB    . LEU D 147 ? 3.3593 2.4974 3.9016 -0.7886 -0.2011 0.1715  147 LEU D CB    
4855 C CG    . LEU D 147 ? 3.1433 2.3074 3.7640 -0.6768 -0.0086 0.1643  147 LEU D CG    
4856 C CD1   . LEU D 147 ? 2.9287 1.8847 3.5944 -0.5926 -0.0139 -0.0153 147 LEU D CD1   
4857 C CD2   . LEU D 147 ? 3.0746 2.5214 3.8233 -0.6127 0.1602  0.2715  147 LEU D CD2   
4858 O "O5'" . DA  E 1   ? 2.4812 4.1409 2.9126 0.8959  0.0065  0.0622  1   DA  E "O5'" 
4859 C "C5'" . DA  E 1   ? 2.3775 3.9208 2.8042 0.8629  0.0239  0.0415  1   DA  E "C5'" 
4860 C "C4'" . DA  E 1   ? 2.1383 3.5901 2.5102 0.8153  0.0427  0.0425  1   DA  E "C4'" 
4861 O "O4'" . DA  E 1   ? 2.1039 3.4526 2.2923 0.8560  0.0465  0.0181  1   DA  E "O4'" 
4862 C "C3'" . DA  E 1   ? 1.7475 3.0913 2.1188 0.7732  0.0628  0.0220  1   DA  E "C3'" 
4863 O "O3'" . DA  E 1   ? 1.7340 3.0553 2.1332 0.7126  0.0751  0.0404  1   DA  E "O3'" 
4864 C "C2'" . DA  E 1   ? 1.9633 3.1597 2.1410 0.8181  0.0696  -0.0159 1   DA  E "C2'" 
4865 C "C1'" . DA  E 1   ? 1.9447 3.1290 2.0170 0.8524  0.0611  -0.0122 1   DA  E "C1'" 
4866 N N9    . DA  E 1   ? 2.0521 3.1573 1.9771 0.9221  0.0504  -0.0418 1   DA  E N9    
4867 C C8    . DA  E 1   ? 2.0456 3.2041 1.9740 0.9791  0.0350  -0.0512 1   DA  E C8    
4868 N N7    . DA  E 1   ? 2.1897 3.2528 1.9753 1.0358  0.0244  -0.0777 1   DA  E N7    
4869 C C5    . DA  E 1   ? 2.2477 3.1842 1.9302 1.0141  0.0315  -0.0860 1   DA  E C5    
4870 C C6    . DA  E 1   ? 2.3886 3.1803 1.9131 1.0490  0.0201  -0.1102 1   DA  E C6    
4871 N N6    . DA  E 1   ? 2.4660 3.2167 1.9090 1.1170  -0.0014 -0.1317 1   DA  E N6    
4872 N N1    . DA  E 1   ? 2.4493 3.1384 1.9093 1.0106  0.0279  -0.1100 1   DA  E N1    
4873 C C2    . DA  E 1   ? 2.3715 3.1033 1.9169 0.9424  0.0485  -0.0874 1   DA  E C2    
4874 N N3    . DA  E 1   ? 2.2382 3.1029 1.9372 0.9047  0.0600  -0.0636 1   DA  E N3    
4875 C C4    . DA  E 1   ? 2.1826 3.1444 1.9451 0.9439  0.0493  -0.0641 1   DA  E C4    
4876 P P     . DT  E 2   ? 1.7884 2.9745 2.1324 0.6674  0.1002  0.0178  2   DT  E P     
4877 O OP1   . DT  E 2   ? 1.7280 2.9493 2.1717 0.6012  0.1064  0.0477  2   DT  E OP1   
4878 O OP2   . DT  E 2   ? 1.9817 3.1510 2.3580 0.6716  0.1057  -0.0127 2   DT  E OP2   
4879 O "O5'" . DT  E 2   ? 1.9338 2.9744 2.0589 0.7014  0.1054  -0.0030 2   DT  E "O5'" 
4880 C "C5'" . DT  E 2   ? 1.9887 2.9425 2.0414 0.6636  0.1175  0.0027  2   DT  E "C5'" 
4881 C "C4'" . DT  E 2   ? 2.2434 3.0371 2.1516 0.6605  0.1291  -0.0241 2   DT  E "C4'" 
4882 O "O4'" . DT  E 2   ? 2.4115 3.1373 2.1819 0.7280  0.1133  -0.0449 2   DT  E "O4'" 
4883 C "C3'" . DT  E 2   ? 2.0757 2.8630 2.0427 0.6283  0.1441  -0.0409 2   DT  E "C3'" 
4884 O "O3'" . DT  E 2   ? 2.1508 2.8221 2.0305 0.5852  0.1609  -0.0482 2   DT  E "O3'" 
4885 C "C2'" . DT  E 2   ? 2.1223 2.8944 2.0221 0.6873  0.1322  -0.0633 2   DT  E "C2'" 
4886 C "C1'" . DT  E 2   ? 2.2435 2.9118 1.9738 0.7306  0.1180  -0.0647 2   DT  E "C1'" 
4887 N N1    . DT  E 2   ? 2.2938 2.9555 1.9541 0.8023  0.0976  -0.0793 2   DT  E N1    
4888 C C2    . DT  E 2   ? 2.4296 2.9622 1.9269 0.8379  0.0826  -0.0903 2   DT  E C2    
4889 O O2    . DT  E 2   ? 2.5123 2.9340 1.9180 0.8128  0.0842  -0.0878 2   DT  E O2    
4890 N N3    . DT  E 2   ? 2.4679 3.0042 1.9186 0.9037  0.0619  -0.1029 2   DT  E N3    
4891 C C4    . DT  E 2   ? 2.3850 3.0404 1.9278 0.9363  0.0570  -0.1052 2   DT  E C4    
4892 O O4    . DT  E 2   ? 2.4299 3.0788 1.9196 0.9958  0.0376  -0.1162 2   DT  E O4    
4893 C C5    . DT  E 2   ? 2.2443 3.0310 1.9567 0.8947  0.0723  -0.0923 2   DT  E C5    
4894 C C7    . DT  E 2   ? 2.1477 3.0685 1.9782 0.9223  0.0637  -0.0908 2   DT  E C7    
4895 C C6    . DT  E 2   ? 2.2066 2.9890 1.9720 0.8308  0.0905  -0.0803 2   DT  E C6    
4896 P P     . DC  E 3   ? 2.0823 2.7816 2.0800 0.5103  0.1841  -0.0495 3   DC  E P     
4897 O OP1   . DC  E 3   ? 2.0381 2.7630 2.0943 0.4724  0.1862  -0.0189 3   DC  E OP1   
4898 O OP2   . DC  E 3   ? 1.9898 2.7934 2.1323 0.5110  0.1852  -0.0682 3   DC  E OP2   
4899 O "O5'" . DC  E 3   ? 2.3639 2.9277 2.2141 0.4844  0.1984  -0.0665 3   DC  E "O5'" 
4900 C "C5'" . DC  E 3   ? 2.4322 2.8734 2.1339 0.4791  0.1946  -0.0524 3   DC  E "C5'" 
4901 C "C4'" . DC  E 3   ? 2.4437 2.7664 1.9735 0.5058  0.1840  -0.0642 3   DC  E "C4'" 
4902 O "O4'" . DC  E 3   ? 2.7615 3.1053 2.2614 0.5774  0.1618  -0.0719 3   DC  E "O4'" 
4903 C "C3'" . DC  E 3   ? 2.4656 2.7777 1.9838 0.4696  0.2002  -0.0834 3   DC  E "C3'" 
4904 O "O3'" . DC  E 3   ? 2.5760 2.7677 1.9655 0.4297  0.2033  -0.0730 3   DC  E "O3'" 
4905 C "C2'" . DC  E 3   ? 2.5004 2.8204 1.9702 0.5255  0.1836  -0.0986 3   DC  E "C2'" 
4906 C "C1'" . DC  E 3   ? 2.5404 2.8248 1.9464 0.5896  0.1562  -0.0854 3   DC  E "C1'" 
4907 N N1    . DC  E 3   ? 2.5137 2.8624 1.9444 0.6534  0.1400  -0.0970 3   DC  E N1    
4908 C C2    . DC  E 3   ? 2.6247 2.8896 1.9225 0.7069  0.1134  -0.0982 3   DC  E C2    
4909 O O2    . DC  E 3   ? 2.7452 2.8811 1.9115 0.6994  0.1007  -0.0885 3   DC  E O2    
4910 N N3    . DC  E 3   ? 2.5985 2.9258 1.9218 0.7645  0.0990  -0.1082 3   DC  E N3    
4911 C C4    . DC  E 3   ? 2.4694 2.9350 1.9413 0.7680  0.1093  -0.1152 3   DC  E C4    
4912 N N4    . DC  E 3   ? 2.4488 2.9731 1.9402 0.8243  0.0936  -0.1230 3   DC  E N4    
4913 C C5    . DC  E 3   ? 2.3578 2.9068 1.9717 0.7133  0.1325  -0.1129 3   DC  E C5    
4914 C C6    . DC  E 3   ? 2.3838 2.8711 1.9723 0.6583  0.1476  -0.1046 3   DC  E C6    
4915 P P     . DG  E 4   ? 2.6287 2.8003 1.9693 0.3831  0.2185  -0.0876 4   DG  E P     
4916 O OP1   . DG  E 4   ? 2.6907 2.7801 1.9651 0.3224  0.2285  -0.0699 4   DG  E OP1   
4917 O OP2   . DG  E 4   ? 2.5160 2.8231 2.0065 0.3726  0.2385  -0.1201 4   DG  E OP2   
4918 O "O5'" . DG  E 4   ? 3.4059 3.4913 2.5919 0.4281  0.1895  -0.0821 4   DG  E "O5'" 
4919 C "C5'" . DG  E 4   ? 3.0889 3.0412 2.1364 0.4546  0.1594  -0.0573 4   DG  E "C5'" 
4920 C "C4'" . DG  E 4   ? 3.0171 2.8973 1.9386 0.4864  0.1302  -0.0516 4   DG  E "C4'" 
4921 O "O4'" . DG  E 4   ? 2.9466 2.8887 1.9102 0.5570  0.1166  -0.0667 4   DG  E "O4'" 
4922 C "C3'" . DG  E 4   ? 3.0232 2.9251 1.9142 0.4366  0.1431  -0.0559 4   DG  E "C3'" 
4923 O "O3'" . DG  E 4   ? 3.1782 2.9549 1.9113 0.4277  0.1118  -0.0267 4   DG  E "O3'" 
4924 C "C2'" . DG  E 4   ? 2.9490 2.9626 1.9171 0.4762  0.1473  -0.0834 4   DG  E "C2'" 
4925 C "C1'" . DG  E 4   ? 2.9597 2.9418 1.9104 0.5568  0.1170  -0.0775 4   DG  E "C1'" 
4926 N N9    . DG  E 4   ? 2.8454 2.9520 1.9157 0.6005  0.1239  -0.1013 4   DG  E N9    
4927 C C8    . DG  E 4   ? 2.7023 2.9354 1.9348 0.5836  0.1514  -0.1211 4   DG  E C8    
4928 N N7    . DG  E 4   ? 2.6274 2.9527 1.9428 0.6299  0.1462  -0.1359 4   DG  E N7    
4929 C C5    . DG  E 4   ? 2.7250 2.9829 1.9229 0.6824  0.1164  -0.1273 4   DG  E C5    
4930 C C6    . DG  E 4   ? 2.7050 3.0138 1.9210 0.7458  0.0984  -0.1355 4   DG  E C6    
4931 O O6    . DG  E 4   ? 2.5940 3.0213 1.9354 0.7670  0.1052  -0.1507 4   DG  E O6    
4932 N N1    . DG  E 4   ? 2.8329 3.0394 1.9081 0.7851  0.0662  -0.1217 4   DG  E N1    
4933 C C2    . DG  E 4   ? 2.9662 3.0352 1.9050 0.7641  0.0492  -0.1002 4   DG  E C2    
4934 N N2    . DG  E 4   ? 3.0817 3.0633 1.9091 0.8084  0.0112  -0.0869 4   DG  E N2    
4935 N N3    . DG  E 4   ? 2.9872 3.0072 1.9054 0.7027  0.0651  -0.0902 4   DG  E N3    
4936 C C4    . DG  E 4   ? 2.8607 2.9823 1.9109 0.6654  0.1005  -0.1060 4   DG  E C4    
4937 P P     . DT  E 5   ? 3.5027 3.2925 2.1710 0.3672  0.1181  -0.0199 5   DT  E P     
4938 O OP1   . DT  E 5   ? 3.4686 3.1152 1.9913 0.3345  0.0870  0.0239  5   DT  E OP1   
4939 O OP2   . DT  E 5   ? 3.3917 3.3118 2.1806 0.3146  0.1657  -0.0527 5   DT  E OP2   
4940 O "O5'" . DT  E 5   ? 3.5416 3.3696 2.1909 0.4180  0.0982  -0.0287 5   DT  E "O5'" 
4941 C "C5'" . DT  E 5   ? 3.3496 3.0802 1.9158 0.4835  0.0520  -0.0080 5   DT  E "C5'" 
4942 C "C4'" . DT  E 5   ? 3.3422 3.1354 1.9143 0.5261  0.0405  -0.0201 5   DT  E "C4'" 
4943 O "O4'" . DT  E 5   ? 3.1988 3.1099 1.9074 0.5703  0.0633  -0.0571 5   DT  E "O4'" 
4944 C "C3'" . DT  E 5   ? 3.4219 3.2866 1.9716 0.4699  0.0548  -0.0232 5   DT  E "C3'" 
4945 O "O3'" . DT  E 5   ? 3.6055 3.3854 2.0241 0.4746  0.0104  0.0150  5   DT  E "O3'" 
4946 C "C2'" . DT  E 5   ? 3.5191 3.5354 2.1971 0.4991  0.0817  -0.0693 5   DT  E "C2'" 
4947 C "C1'" . DT  E 5   ? 3.1703 3.1734 1.9059 0.5782  0.0683  -0.0754 5   DT  E "C1'" 
4948 N N1    . DT  E 5   ? 3.0102 3.1532 1.9093 0.5966  0.0991  -0.1153 5   DT  E N1    
4949 C C2    . DT  E 5   ? 2.9633 3.1675 1.9097 0.6592  0.0872  -0.1291 5   DT  E C2    
4950 O O2    . DT  E 5   ? 3.0450 3.1956 1.9053 0.7029  0.0544  -0.1128 5   DT  E O2    
4951 N N3    . DT  E 5   ? 2.8181 3.1495 1.9231 0.6677  0.1118  -0.1607 5   DT  E N3    
4952 C C4    . DT  E 5   ? 2.7181 3.1179 1.9430 0.6218  0.1442  -0.1799 5   DT  E C4    
4953 O O4    . DT  E 5   ? 2.5936 3.1046 1.9688 0.6323  0.1577  -0.2041 5   DT  E O4    
4954 C C5    . DT  E 5   ? 2.7728 3.1039 1.9397 0.5594  0.1574  -0.1667 5   DT  E C5    
4955 C C7    . DT  E 5   ? 2.6748 3.0714 1.9667 0.5068  0.1909  -0.1856 5   DT  E C7    
4956 C C6    . DT  E 5   ? 2.9142 3.1227 1.9202 0.5493  0.1353  -0.1350 5   DT  E C6    
4957 P P     . DC  E 6   ? 3.5504 3.4042 1.9210 0.4226  0.0134  0.0204  6   DC  E P     
4958 O OP1   . DC  E 6   ? 3.7708 3.4977 1.9924 0.4038  -0.0389 0.0804  6   DC  E OP1   
4959 O OP2   . DC  E 6   ? 3.4673 3.4390 1.9110 0.3523  0.0656  -0.0132 6   DC  E OP2   
4960 O "O5'" . DC  E 6   ? 3.4871 3.4284 1.9160 0.4873  0.0105  -0.0080 6   DC  E "O5'" 
4961 C "C5'" . DC  E 6   ? 3.5134 3.3828 1.9257 0.5717  -0.0275 0.0034  6   DC  E "C5'" 
4962 C "C4'" . DC  E 6   ? 3.4580 3.4265 1.9199 0.6176  -0.0275 -0.0207 6   DC  E "C4'" 
4963 O "O4'" . DC  E 6   ? 3.2968 3.3799 1.9083 0.6454  0.0104  -0.0690 6   DC  E "O4'" 
4964 C "C3'" . DC  E 6   ? 3.6452 3.7019 2.0767 0.5639  -0.0183 -0.0232 6   DC  E "C3'" 
4965 O "O3'" . DC  E 6   ? 3.9277 3.9718 2.3057 0.6074  -0.0559 -0.0044 6   DC  E "O3'" 
4966 C "C2'" . DC  E 6   ? 3.7139 3.9322 2.2917 0.5496  0.0350  -0.0847 6   DC  E "C2'" 
4967 C "C1'" . DC  E 6   ? 3.2267 3.4481 1.9050 0.6246  0.0363  -0.1036 6   DC  E "C1'" 
4968 N N1    . DC  E 6   ? 3.0774 3.4068 1.9096 0.6077  0.0811  -0.1494 6   DC  E N1    
4969 C C2    . DC  E 6   ? 2.9535 3.3890 1.9185 0.6543  0.0919  -0.1845 6   DC  E C2    
4970 O O2    . DC  E 6   ? 2.9669 3.4089 1.9145 0.7102  0.0676  -0.1792 6   DC  E O2    
4971 N N3    . DC  E 6   ? 2.8238 3.3525 1.9386 0.6349  0.1254  -0.2207 6   DC  E N3    
4972 C C4    . DC  E 6   ? 2.8141 3.3335 1.9464 0.5748  0.1501  -0.2254 6   DC  E C4    
4973 N N4    . DC  E 6   ? 2.6871 3.2983 1.9782 0.5576  0.1783  -0.2598 6   DC  E N4    
4974 C C5    . DC  E 6   ? 2.9364 3.3524 1.9297 0.5280  0.1433  -0.1920 6   DC  E C5    
4975 C C6    . DC  E 6   ? 3.0650 3.3888 1.9133 0.5453  0.1076  -0.1536 6   DC  E C6    
4976 P P     . DG  E 7   ? 3.6323 3.7284 1.9284 0.5527  -0.0678 0.0163  7   DG  E P     
4977 O OP1   . DG  E 7   ? 3.7932 3.7508 1.9591 0.5646  -0.1309 0.0819  7   DG  E OP1   
4978 O OP2   . DG  E 7   ? 3.6056 3.7898 1.9170 0.4635  -0.0254 -0.0041 7   DG  E OP2   
4979 O "O5'" . DG  E 7   ? 3.5412 3.7639 1.9188 0.5992  -0.0558 -0.0246 7   DG  E "O5'" 
4980 C "C5'" . DG  E 7   ? 3.5308 3.7235 1.9489 0.6907  -0.0773 -0.0288 7   DG  E "C5'" 
4981 C "C4'" . DG  E 7   ? 3.3737 3.7154 1.9119 0.7196  -0.0484 -0.0812 7   DG  E "C4'" 
4982 O "O4'" . DG  E 7   ? 3.2363 3.6514 1.9066 0.7106  -0.0034 -0.1274 7   DG  E "O4'" 
4983 C "C3'" . DG  E 7   ? 3.4498 3.9080 1.9757 0.6695  -0.0358 -0.0980 7   DG  E "C3'" 
4984 O "O3'" . DG  E 7   ? 3.3594 3.8714 1.9107 0.7246  -0.0521 -0.1068 7   DG  E "O3'" 
4985 C "C2'" . DG  E 7   ? 3.5497 4.1341 2.1952 0.6214  0.0199  -0.1588 7   DG  E "C2'" 
4986 C "C1'" . DG  E 7   ? 3.1532 3.7174 1.9098 0.6723  0.0325  -0.1769 7   DG  E "C1'" 
4987 N N9    . DG  E 7   ? 3.0772 3.6826 1.9170 0.6226  0.0728  -0.2083 7   DG  E N9    
4988 C C8    . DG  E 7   ? 3.1393 3.6920 1.9138 0.5576  0.0829  -0.1907 7   DG  E C8    
4989 N N7    . DG  E 7   ? 3.0461 3.6555 1.9264 0.5251  0.1203  -0.2272 7   DG  E N7    
4990 C C5    . DG  E 7   ? 2.9149 3.6190 1.9447 0.5700  0.1330  -0.2698 7   DG  E C5    
4991 C C6    . DG  E 7   ? 2.9828 3.7766 2.1817 0.5608  0.1648  -0.3165 7   DG  E C6    
4992 O O6    . DG  E 7   ? 2.8591 3.6668 2.1087 0.5115  0.1912  -0.3328 7   DG  E O6    
4993 N N1    . DG  E 7   ? 2.8910 3.7639 2.2113 0.6147  0.1604  -0.3424 7   DG  E N1    
4994 C C2    . DG  E 7   ? 2.7570 3.6258 2.0356 0.6716  0.1325  -0.3273 7   DG  E C2    
4995 N N2    . DG  E 7   ? 2.6622 3.6183 2.0760 0.7158  0.1310  -0.3537 7   DG  E N2    
4996 N N3    . DG  E 7   ? 2.8305 3.6157 1.9509 0.6830  0.1043  -0.2863 7   DG  E N3    
4997 C C4    . DG  E 7   ? 2.9315 3.6361 1.9364 0.6298  0.1049  -0.2584 7   DG  E C4    
4998 P P     . DG  E 8   ? 3.4212 4.0452 1.9412 0.6858  -0.0513 -0.1172 8   DG  E P     
4999 O OP1   . DG  E 8   ? 3.8334 4.4041 2.2834 0.7399  -0.1000 -0.0763 8   DG  E OP1   
5000 O OP2   . DG  E 8   ? 3.4597 4.1059 1.9087 0.5914  -0.0370 -0.1083 8   DG  E OP2   
5001 O "O5'" . DG  E 8   ? 3.2297 4.0134 1.9123 0.6986  -0.0088 -0.1930 8   DG  E "O5'" 
5002 C "C5'" . DG  E 8   ? 3.1274 3.9187 1.9161 0.7753  -0.0101 -0.2108 8   DG  E "C5'" 
5003 C "C4'" . DG  E 8   ? 2.9781 3.9118 1.9343 0.7655  0.0308  -0.2802 8   DG  E "C4'" 
5004 O "O4'" . DG  E 8   ? 3.5012 4.4305 2.5141 0.7224  0.0620  -0.2994 8   DG  E "O4'" 
5005 C "C3'" . DG  E 8   ? 2.9655 4.0384 1.9475 0.7213  0.0487  -0.3265 8   DG  E "C3'" 
5006 O "O3'" . DG  E 8   ? 2.8606 4.0315 1.9681 0.7676  0.0511  -0.3665 8   DG  E "O3'" 
5007 C "C2'" . DG  E 8   ? 2.9280 4.0633 1.9648 0.6473  0.0901  -0.3707 8   DG  E "C2'" 
5008 C "C1'" . DG  E 8   ? 2.8590 3.9243 1.9698 0.6711  0.0982  -0.3628 8   DG  E "C1'" 
5009 N N9    . DG  E 8   ? 2.8728 3.9178 1.9732 0.6066  0.1239  -0.3686 8   DG  E N9    
5010 C C8    . DG  E 8   ? 2.9955 3.9576 1.9496 0.5574  0.1164  -0.3254 8   DG  E C8    
5011 N N7    . DG  E 8   ? 2.9765 3.9426 1.9590 0.5043  0.1444  -0.3412 8   DG  E N7    
5012 C C5    . DG  E 8   ? 2.8958 3.9508 2.0592 0.5202  0.1711  -0.3989 8   DG  E C5    
5013 C C6    . DG  E 8   ? 2.9151 4.0135 2.1923 0.4822  0.2045  -0.4377 8   DG  E C6    
5014 O O6    . DG  E 8   ? 3.0799 4.1484 2.3132 0.4257  0.2211  -0.4304 8   DG  E O6    
5015 N N1    . DG  E 8   ? 2.7825 3.9690 2.2466 0.5141  0.2153  -0.4866 8   DG  E N1    
5016 C C2    . DG  E 8   ? 2.7506 3.9799 2.2791 0.5740  0.1969  -0.4955 8   DG  E C2    
5017 N N2    . DG  E 8   ? 2.6848 3.9992 2.4046 0.5933  0.2053  -0.5390 8   DG  E N2    
5018 N N3    . DG  E 8   ? 2.6322 3.8242 2.0500 0.6111  0.1689  -0.4613 8   DG  E N3    
5019 C C4    . DG  E 8   ? 2.7676 3.8713 2.0067 0.5819  0.1572  -0.4146 8   DG  E C4    
5020 P P     . DG  E 9   ? 2.8781 4.0093 1.9551 0.8487  0.0118  -0.3297 9   DG  E P     
5021 O OP1   . DG  E 9   ? 2.8706 3.9449 2.0159 0.9074  0.0048  -0.3140 9   DG  E OP1   
5022 O OP2   . DG  E 9   ? 3.0276 4.0791 1.9331 0.8393  -0.0206 -0.2753 9   DG  E OP2   
5023 O "O5'" . DG  E 9   ? 2.7903 4.0723 1.9821 0.8601  0.0207  -0.3852 9   DG  E "O5'" 
5024 C "C5'" . DG  E 9   ? 2.8199 4.2044 1.9923 0.8032  0.0355  -0.4237 9   DG  E "C5'" 
5025 C "C4'" . DG  E 9   ? 2.8387 4.2784 1.9904 0.8369  0.0118  -0.4214 9   DG  E "C4'" 
5026 O "O4'" . DG  E 9   ? 2.9833 4.3533 1.9599 0.8210  -0.0163 -0.3631 9   DG  E "O4'" 
5027 C "C3'" . DG  E 9   ? 2.9197 4.3284 2.1272 0.9231  -0.0139 -0.3984 9   DG  E "C3'" 
5028 O "O3'" . DG  E 9   ? 2.8618 4.3827 2.2473 0.9402  0.0017  -0.4555 9   DG  E "O3'" 
5029 C "C2'" . DG  E 9   ? 2.8737 4.2734 1.9717 0.9467  -0.0477 -0.3625 9   DG  E "C2'" 
5030 C "C1'" . DG  E 9   ? 2.9993 4.3805 1.9561 0.8741  -0.0473 -0.3427 9   DG  E "C1'" 
5031 N N9    . DG  E 9   ? 3.1343 4.3860 1.9356 0.8910  -0.0893 -0.2639 9   DG  E N9    
5032 C C8    . DG  E 9   ? 3.2265 4.3501 1.9261 0.8697  -0.1019 -0.2143 9   DG  E C8    
5033 N N7    . DG  E 9   ? 3.3448 4.3681 1.9261 0.8928  -0.1482 -0.1488 9   DG  E N7    
5034 C C5    . DG  E 9   ? 3.3278 4.4197 1.9301 0.9319  -0.1649 -0.1543 9   DG  E C5    
5035 C C6    . DG  E 9   ? 3.4221 4.4602 1.9389 0.9699  -0.2143 -0.1002 9   DG  E C6    
5036 O O6    . DG  E 9   ? 3.7767 4.6887 2.1849 0.9779  -0.2573 -0.0355 9   DG  E O6    
5037 N N1    . DG  E 9   ? 3.3634 4.5087 1.9397 1.0008  -0.2147 -0.1273 9   DG  E N1    
5038 C C2    . DG  E 9   ? 3.2326 4.5167 1.9387 0.9955  -0.1752 -0.1990 9   DG  E C2    
5039 N N2    . DG  E 9   ? 3.1957 4.5667 1.9446 1.0278  -0.1850 -0.2151 9   DG  E N2    
5040 N N3    . DG  E 9   ? 3.1456 4.4787 1.9407 0.9609  -0.1323 -0.2515 9   DG  E N3    
5041 C C4    . DG  E 9   ? 3.1988 4.4313 1.9333 0.9307  -0.1285 -0.2247 9   DG  E C4    
5042 P P     . DG  E 10  ? 3.2328 4.7438 2.7183 1.0196  -0.0179 -0.4371 10  DG  E P     
5043 O OP1   . DG  E 10  ? 3.0342 4.6556 2.7165 1.0123  0.0008  -0.4951 10  DG  E OP1   
5044 O OP2   . DG  E 10  ? 2.6027 3.9796 2.0078 1.0501  -0.0319 -0.3792 10  DG  E OP2   
5045 O "O5'" . DG  E 10  ? 2.5943 4.1313 2.0289 1.0650  -0.0485 -0.4182 10  DG  E "O5'" 
5046 C "C5'" . DG  E 10  ? 2.5828 4.2373 2.0519 1.0399  -0.0430 -0.4646 10  DG  E "C5'" 
5047 C "C4'" . DG  E 10  ? 2.6870 4.3550 2.1207 1.0949  -0.0758 -0.4374 10  DG  E "C4'" 
5048 O "O4'" . DG  E 10  ? 2.9590 4.5305 2.2114 1.0969  -0.1004 -0.3783 10  DG  E "O4'" 
5049 C "C3'" . DG  E 10  ? 2.5905 4.2416 2.1035 1.1711  -0.0961 -0.4113 10  DG  E "C3'" 
5050 O "O3'" . DG  E 10  ? 2.7262 4.4679 2.3006 1.2035  -0.1123 -0.4263 10  DG  E "O3'" 
5051 C "C2'" . DG  E 10  ? 2.8323 4.3449 2.1992 1.2095  -0.1220 -0.3423 10  DG  E "C2'" 
5052 C "C1'" . DG  E 10  ? 2.7658 4.2508 1.9833 1.1706  -0.1322 -0.3248 10  DG  E "C1'" 
5053 N N9    . DG  E 10  ? 2.8842 4.2296 1.9595 1.1637  -0.1476 -0.2716 10  DG  E N9    
5054 C C8    . DG  E 10  ? 2.9031 4.1814 1.9532 1.1240  -0.1290 -0.2689 10  DG  E C8    
5055 N N7    . DG  E 10  ? 3.0227 4.1741 1.9405 1.1259  -0.1540 -0.2157 10  DG  E N7    
5056 C C5    . DG  E 10  ? 3.0878 4.2205 1.9423 1.1708  -0.1927 -0.1811 10  DG  E C5    
5057 C C6    . DG  E 10  ? 3.2234 4.2354 1.9476 1.1937  -0.2373 -0.1200 10  DG  E C6    
5058 O O6    . DG  E 10  ? 3.3161 4.2090 1.9527 1.1777  -0.2527 -0.0839 10  DG  E O6    
5059 N N1    . DG  E 10  ? 3.2496 4.2871 1.9565 1.2396  -0.2692 -0.1015 10  DG  E N1    
5060 C C2    . DG  E 10  ? 3.1558 4.3206 1.9548 1.2596  -0.2579 -0.1370 10  DG  E C2    
5061 N N2    . DG  E 10  ? 3.1997 4.3709 1.9640 1.3037  -0.2934 -0.1099 10  DG  E N2    
5062 N N3    . DG  E 10  ? 3.0296 4.3065 1.9531 1.2378  -0.2179 -0.1950 10  DG  E N3    
5063 C C4    . DG  E 10  ? 3.0030 4.2559 1.9493 1.1942  -0.1876 -0.2142 10  DG  E C4    
5064 P P     . DA  E 11  ? 4.6989 2.7983 3.5894 0.1587  0.8868  -0.0484 11  DA  E P     
5065 O OP1   . DA  E 11  ? 4.8477 2.6990 3.7925 0.1108  0.7997  -0.0906 11  DA  E OP1   
5066 O OP2   . DA  E 11  ? 4.1012 2.5952 3.2403 0.1758  1.1012  0.0773  11  DA  E OP2   
5067 O "O5'" . DA  E 11  ? 4.3250 2.5326 3.3360 0.1369  0.6856  -0.1216 11  DA  E "O5'" 
5068 C "C5'" . DA  E 11  ? 4.5619 2.4372 3.2946 0.1311  0.4761  -0.2417 11  DA  E "C5'" 
5069 C "C4'" . DA  E 11  ? 4.4929 2.5039 3.5102 0.0848  0.2758  -0.2968 11  DA  E "C4'" 
5070 O "O4'" . DA  E 11  ? 4.3495 2.5054 3.2839 0.1213  0.2437  -0.3125 11  DA  E "O4'" 
5071 C "C3'" . DA  E 11  ? 4.2131 2.5868 3.7567 0.0415  0.3127  -0.2250 11  DA  E "C3'" 
5072 O "O3'" . DA  E 11  ? 4.3485 2.6864 4.1063 -0.0165 0.0933  -0.2889 11  DA  E "O3'" 
5073 C "C2'" . DA  E 11  ? 3.8746 2.6295 3.5543 0.0822  0.4272  -0.1565 11  DA  E "C2'" 
5074 C "C1'" . DA  E 11  ? 3.9822 2.5704 3.3039 0.1191  0.3184  -0.2357 11  DA  E "C1'" 
5075 N N9    . DA  E 11  ? 3.7922 2.5382 2.9506 0.1766  0.4726  -0.1765 11  DA  E N9    
5076 C C8    . DA  E 11  ? 3.6916 2.5012 2.7511 0.2081  0.6916  -0.0856 11  DA  E C8    
5077 N N7    . DA  E 11  ? 3.5347 2.4835 2.4496 0.2516  0.7806  -0.0432 11  DA  E N7    
5078 C C5    . DA  E 11  ? 3.5368 2.5066 2.4458 0.2519  0.6107  -0.1160 11  DA  E C5    
5079 C C6    . DA  E 11  ? 3.4213 2.5034 2.1978 0.2869  0.5955  -0.1180 11  DA  E C6    
5080 N N6    . DA  E 11  ? 3.2758 2.4758 1.8968 0.3244  0.7563  -0.0385 11  DA  E N6    
5081 N N1    . DA  E 11  ? 3.4679 2.5336 2.2762 0.2800  0.4049  -0.2011 11  DA  E N1    
5082 C C2    . DA  E 11  ? 3.6978 2.6508 2.6691 0.2377  0.2394  -0.2723 11  DA  E C2    
5083 N N3    . DA  E 11  ? 3.8539 2.6934 2.9606 0.1966  0.2280  -0.2761 11  DA  E N3    
5084 C C4    . DA  E 11  ? 3.6915 2.5419 2.7533 0.2076  0.4218  -0.1975 11  DA  E C4    
5085 P P     . DA  E 12  ? 4.1264 2.8003 4.4459 -0.0706 0.0827  -0.2248 12  DA  E P     
5086 O OP1   . DA  E 12  ? 4.3523 2.7790 4.7410 -0.1415 -0.0991 -0.2821 12  DA  E OP1   
5087 O OP2   . DA  E 12  ? 3.8232 2.7771 4.3369 -0.0503 0.3259  -0.1084 12  DA  E OP2   
5088 O "O5'" . DA  E 12  ? 3.9029 2.8513 4.4178 -0.0576 -0.0145 -0.2349 12  DA  E "O5'" 
5089 C "C5'" . DA  E 12  ? 4.0734 2.8158 4.3900 -0.0614 -0.2264 -0.3382 12  DA  E "C5'" 
5090 C "C4'" . DA  E 12  ? 3.8388 2.8624 4.2700 -0.0237 -0.2500 -0.3298 12  DA  E "C4'" 
5091 O "O4'" . DA  E 12  ? 3.7080 2.7968 3.8813 0.0432  -0.0849 -0.2978 12  DA  E "O4'" 
5092 C "C3'" . DA  E 12  ? 3.5213 2.9718 4.4703 -0.0360 -0.2087 -0.2445 12  DA  E "C3'" 
5093 O "O3'" . DA  E 12  ? 3.4941 3.0420 4.5635 -0.0336 -0.3753 -0.2851 12  DA  E "O3'" 
5094 C "C2'" . DA  E 12  ? 3.2353 2.9490 4.1823 0.0218  0.0303  -0.1546 12  DA  E "C2'" 
5095 C "C1'" . DA  E 12  ? 3.3614 2.8561 3.8295 0.0700  0.0211  -0.2159 12  DA  E "C1'" 
5096 N N9    . DA  E 12  ? 3.2092 2.7958 3.5027 0.1184  0.2390  -0.1462 12  DA  E N9    
5097 C C8    . DA  E 12  ? 3.1909 2.7520 3.4414 0.1181  0.4156  -0.0821 12  DA  E C8    
5098 N N7    . DA  E 12  ? 3.0433 2.7093 3.1287 0.1646  0.5864  -0.0203 12  DA  E N7    
5099 C C5    . DA  E 12  ? 2.9663 2.7226 2.9713 0.1962  0.5138  -0.0492 12  DA  E C5    
5100 C C6    . DA  E 12  ? 2.8190 2.6961 2.6410 0.2450  0.6097  -0.0105 12  DA  E C6    
5101 N N6    . DA  E 12  ? 2.7112 2.6530 2.4065 0.2688  0.8075  0.0741  12  DA  E N6    
5102 N N1    . DA  E 12  ? 2.7921 2.7200 2.5663 0.2667  0.4912  -0.0577 12  DA  E N1    
5103 C C2    . DA  E 12  ? 2.8999 2.7697 2.8076 0.2434  0.2937  -0.1360 12  DA  E C2    
5104 N N3    . DA  E 12  ? 3.0368 2.8032 3.1319 0.1944  0.1847  -0.1737 12  DA  E N3    
5105 C C4    . DA  E 12  ? 3.0668 2.7749 3.1962 0.1715  0.3031  -0.1282 12  DA  E C4    
5106 P P     . DG  E 13  ? 3.2601 3.1816 4.8732 -0.0545 -0.4159 -0.2191 13  DG  E P     
5107 O OP1   . DG  E 13  ? 3.5570 3.3220 5.3290 -0.1291 -0.6200 -0.2620 13  DG  E OP1   
5108 O OP2   . DG  E 13  ? 2.9726 3.2154 4.8548 -0.0364 -0.1933 -0.1037 13  DG  E OP2   
5109 O "O5'" . DG  E 13  ? 3.1599 3.2173 4.7306 -0.0007 -0.4896 -0.2467 13  DG  E "O5'" 
5110 C "C5'" . DG  E 13  ? 3.1891 3.1256 4.3453 0.0561  -0.4388 -0.2873 13  DG  E "C5'" 
5111 C "C4'" . DG  E 13  ? 3.0175 3.1790 4.2344 0.1103  -0.4652 -0.2812 13  DG  E "C4'" 
5112 O "O4'" . DG  E 13  ? 2.9307 3.1852 3.9337 0.1696  -0.2863 -0.2405 13  DG  E "O4'" 
5113 C "C3'" . DG  E 13  ? 2.8804 3.4214 4.5923 0.1141  -0.4483 -0.2002 13  DG  E "C3'" 
5114 O "O3'" . DG  E 13  ? 3.0303 3.6807 4.7397 0.1611  -0.5370 -0.2240 13  DG  E "O3'" 
5115 C "C2'" . DG  E 13  ? 2.6527 3.4331 4.4610 0.1440  -0.1970 -0.0965 13  DG  E "C2'" 
5116 C "C1'" . DG  E 13  ? 2.6380 3.2525 3.9760 0.1881  -0.1161 -0.1285 13  DG  E "C1'" 
5117 N N9    . DG  E 13  ? 2.5070 3.0939 3.7234 0.1867  0.0783  -0.0735 13  DG  E N9    
5118 C C8    . DG  E 13  ? 2.6056 3.0657 3.8657 0.1394  0.1218  -0.0607 13  DG  E C8    
5119 N N7    . DG  E 13  ? 2.5558 3.0194 3.6716 0.1554  0.3108  -0.0048 13  DG  E N7    
5120 C C5    . DG  E 13  ? 2.3799 2.9792 3.3460 0.2115  0.3920  0.0220  13  DG  E C5    
5121 C C6    . DG  E 13  ? 2.2520 2.9185 3.0293 0.2457  0.5851  0.0892  13  DG  E C6    
5122 O O6    . DG  E 13  ? 2.2415 2.8698 2.9539 0.2371  0.7329  0.1415  13  DG  E O6    
5123 N N1    . DG  E 13  ? 2.1338 2.9226 2.7923 0.2936  0.5960  0.0977  13  DG  E N1    
5124 C C2    . DG  E 13  ? 2.1409 2.9769 2.8497 0.3126  0.4450  0.0450  13  DG  E C2    
5125 N N2    . DG  E 13  ? 2.0310 2.9716 2.5908 0.3611  0.4810  0.0623  13  DG  E N2    
5126 N N3    . DG  E 13  ? 2.2531 3.0374 3.1471 0.2851  0.2689  -0.0158 13  DG  E N3    
5127 C C4    . DG  E 13  ? 2.3680 3.0350 3.3836 0.2323  0.2501  -0.0228 13  DG  E C4    
5128 P P     . DT  E 14  ? 3.2804 4.3145 5.4556 0.1866  -0.5441 -0.1488 14  DT  E P     
5129 O OP1   . DT  E 14  ? 3.5780 4.5254 5.8280 0.1655  -0.7792 -0.2128 14  DT  E OP1   
5130 O OP2   . DT  E 14  ? 3.1773 4.4553 5.7389 0.1631  -0.4080 -0.0457