data_6PAI
# 
_entry.id   6PAI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6PAI         
WWPDB D_1000241925 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6PAI 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Volkov, O.A.' 1 0000-0001-6487-9518 
'Du, X.'       2 0000-0001-7999-6776 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary Structure STRUE6 2005 0969-2126 ? ? 27 ? 1625 1633.e3 
'Structural Basis and Kinetic Pathway of RBM39 Recruitment to DCAF15 by a Sulfonamide Molecular Glue E7820.' 2019 ? 
10.1016/j.str.2019.10.005 31693911 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv   ?      ?    ?         ? ? ?  ? ?    ?       
'Structural basis of recruitment of RBM39 to DCAF15 by a sulfonamide molecular glue E7820'                   2019 ? 10.1101/758409 
?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Du, X.'           1  ?                   
primary 'Volkov, O.A.'     2  ?                   
primary 'Czerwinski, R.M.' 3  ?                   
primary 'Tan, H.'          4  ?                   
primary 'Huerta, C.'       5  ?                   
primary 'Morton, E.R.'     6  ?                   
primary 'Rizzi, J.P.'      7  ?                   
primary 'Wehn, P.M.'       8  ?                   
primary 'Xu, R.'           9  ?                   
primary 'Nijhawan, D.'     10 ?                   
primary 'Wallace, E.M.'    11 ?                   
1       'Du, X.'           12 0000-0001-7999-6776 
1       'Volkov, O.A.'     13 0000-0001-6487-9518 
1       'Czerwinski, R.'   14 ?                   
1       'Tan, H.L.'        15 ?                   
1       'Huerta, C.'       16 ?                   
1       'Morton, E.'       17 ?                   
1       'Rizzi, J.'        18 ?                   
1       'Wehn, P.'         19 ?                   
1       'Xu, R.'           20 ?                   
1       'Nijhawan, D.'     21 ?                   
1       'Wallace, E.'      22 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.060 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6PAI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     81.507 
_cell.length_a_esd                 ? 
_cell.length_b                     94.767 
_cell.length_b_esd                 ? 
_cell.length_c                     145.706 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6PAI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA damage-binding protein 1'                                    127097.469 1 ? ?                            ? 
? 
2 polymer     man 'DDB1- and CUL4-associated factor 15'                             56414.852  1 ? 'UNP residues 2-275,384-600' ? 
? 
3 polymer     man 'RNA-binding protein 39'                                          12098.624  1 ? ?                            ? 
? 
4 polymer     man 'DET1- and DDB1-associated protein 1'                             11855.297  1 ? ?                            ? 
? 
5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'             238.305    2 ? ?                            ? 
? 
6 non-polymer syn '3-cyano-N-(3-cyano-4-methyl-1H-indol-7-yl)benzene-1-sulfonamide' 336.368    1 ? ?                            ? 
? 
7 non-polymer syn 'ZINC ION'                                                        65.409     1 ? ?                            ? 
? 
8 water       nat water                                                             18.015     1 ? ?                            ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;DDB p127 subunit,DNA damage-binding protein a,DDBa,Damage-specific DNA-binding protein 1,HBV X-associated protein 1,XAP-1,UV-damaged DNA-binding factor,UV-damaged DNA-binding protein 1,UV-DDB 1,XPE-binding factor,XPE-BF,Xeroderma pigmentosum group E-complementing protein,XPCe
;
4 'Placenta cross-immune reaction antigen 1,PCIA-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no 
;MHHHHHHAPSSKSERNSGAGSGGGGPGGAGGKRAAGRRREHVLKQLERVKISGQLSPRLFRKLPPRVCVSLKNIVDEDFL
YAGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIYHLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIV
FGFNTRSANGMLMNMMMMSDENHRDIYVSTVAVPPPGRCAACQDASRAHPGDPNAQCLRHGFMLHTKYQVVYPFPTFQPA
FQLKKDQVVLLNTSYSLVACAVSVHSAGDRSFCQILYDHSTPGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDL
RGRNLRPMRERTAVQGQYLTVEQLTLDFEYVINEVIRHDATWGHQFCSFSDYDIVILEVCPETNQVLINIGLLLLAFPSP
TEEGQLRPKTYHTSLKVAWDLNTGIFETVSVGDLTEVKGQTSGSVWSSYRKSCVDMVMKWLVPESSGRYVNRMTNEALHK
GCSLKVLADSERYTWIVL
;
;MHHHHHHAPSSKSERNSGAGSGGGGPGGAGGKRAAGRRREHVLKQLERVKISGQLSPRLFRKLPPRVCVSLKNIVDEDFL
YAGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIYHLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIV
FGFNTRSANGMLMNMMMMSDENHRDIYVSTVAVPPPGRCAACQDASRAHPGDPNAQCLRHGFMLHTKYQVVYPFPTFQPA
FQLKKDQVVLLNTSYSLVACAVSVHSAGDRSFCQILYDHSTPGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDL
RGRNLRPMRERTAVQGQYLTVEQLTLDFEYVINEVIRHDATWGHQFCSFSDYDIVILEVCPETNQVLINIGLLLLAFPSP
TEEGQLRPKTYHTSLKVAWDLNTGIFETVSVGDLTEVKGQTSGSVWSSYRKSCVDMVMKWLVPESSGRYVNRMTNEALHK
GCSLKVLADSERYTWIVL
;
C ? 
3 'polypeptide(L)' no no 
;GSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ
LNGFELAGRPMKVGHVTERTDDYKDDDDK
;
;GSHMAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ
LNGFELAGRPMKVGHVTERTDDYKDDDDK
;
D ? 
4 'polypeptide(L)' no no 
;MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
GESSAPPRKVARTDSPDMHEDT
;
;MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
GESSAPPRKVARTDSPDMHEDT
;
E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    SER n 
1 3    TYR n 
1 4    ASN n 
1 5    TYR n 
1 6    VAL n 
1 7    VAL n 
1 8    THR n 
1 9    ALA n 
1 10   GLN n 
1 11   LYS n 
1 12   PRO n 
1 13   THR n 
1 14   ALA n 
1 15   VAL n 
1 16   ASN n 
1 17   GLY n 
1 18   CYS n 
1 19   VAL n 
1 20   THR n 
1 21   GLY n 
1 22   HIS n 
1 23   PHE n 
1 24   THR n 
1 25   SER n 
1 26   ALA n 
1 27   GLU n 
1 28   ASP n 
1 29   LEU n 
1 30   ASN n 
1 31   LEU n 
1 32   LEU n 
1 33   ILE n 
1 34   ALA n 
1 35   LYS n 
1 36   ASN n 
1 37   THR n 
1 38   ARG n 
1 39   LEU n 
1 40   GLU n 
1 41   ILE n 
1 42   TYR n 
1 43   VAL n 
1 44   VAL n 
1 45   THR n 
1 46   ALA n 
1 47   GLU n 
1 48   GLY n 
1 49   LEU n 
1 50   ARG n 
1 51   PRO n 
1 52   VAL n 
1 53   LYS n 
1 54   GLU n 
1 55   VAL n 
1 56   GLY n 
1 57   MET n 
1 58   TYR n 
1 59   GLY n 
1 60   LYS n 
1 61   ILE n 
1 62   ALA n 
1 63   VAL n 
1 64   MET n 
1 65   GLU n 
1 66   LEU n 
1 67   PHE n 
1 68   ARG n 
1 69   PRO n 
1 70   LYS n 
1 71   GLY n 
1 72   GLU n 
1 73   SER n 
1 74   LYS n 
1 75   ASP n 
1 76   LEU n 
1 77   LEU n 
1 78   PHE n 
1 79   ILE n 
1 80   LEU n 
1 81   THR n 
1 82   ALA n 
1 83   LYS n 
1 84   TYR n 
1 85   ASN n 
1 86   ALA n 
1 87   CYS n 
1 88   ILE n 
1 89   LEU n 
1 90   GLU n 
1 91   TYR n 
1 92   LYS n 
1 93   GLN n 
1 94   SER n 
1 95   GLY n 
1 96   GLU n 
1 97   SER n 
1 98   ILE n 
1 99   ASP n 
1 100  ILE n 
1 101  ILE n 
1 102  THR n 
1 103  ARG n 
1 104  ALA n 
1 105  HIS n 
1 106  GLY n 
1 107  ASN n 
1 108  VAL n 
1 109  GLN n 
1 110  ASP n 
1 111  ARG n 
1 112  ILE n 
1 113  GLY n 
1 114  ARG n 
1 115  PRO n 
1 116  SER n 
1 117  GLU n 
1 118  THR n 
1 119  GLY n 
1 120  ILE n 
1 121  ILE n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  ASP n 
1 126  PRO n 
1 127  GLU n 
1 128  CYS n 
1 129  ARG n 
1 130  MET n 
1 131  ILE n 
1 132  GLY n 
1 133  LEU n 
1 134  ARG n 
1 135  LEU n 
1 136  TYR n 
1 137  ASP n 
1 138  GLY n 
1 139  LEU n 
1 140  PHE n 
1 141  LYS n 
1 142  VAL n 
1 143  ILE n 
1 144  PRO n 
1 145  LEU n 
1 146  ASP n 
1 147  ARG n 
1 148  ASP n 
1 149  ASN n 
1 150  LYS n 
1 151  GLU n 
1 152  LEU n 
1 153  LYS n 
1 154  ALA n 
1 155  PHE n 
1 156  ASN n 
1 157  ILE n 
1 158  ARG n 
1 159  LEU n 
1 160  GLU n 
1 161  GLU n 
1 162  LEU n 
1 163  HIS n 
1 164  VAL n 
1 165  ILE n 
1 166  ASP n 
1 167  VAL n 
1 168  LYS n 
1 169  PHE n 
1 170  LEU n 
1 171  TYR n 
1 172  GLY n 
1 173  CYS n 
1 174  GLN n 
1 175  ALA n 
1 176  PRO n 
1 177  THR n 
1 178  ILE n 
1 179  CYS n 
1 180  PHE n 
1 181  VAL n 
1 182  TYR n 
1 183  GLN n 
1 184  ASP n 
1 185  PRO n 
1 186  GLN n 
1 187  GLY n 
1 188  ARG n 
1 189  HIS n 
1 190  VAL n 
1 191  LYS n 
1 192  THR n 
1 193  TYR n 
1 194  GLU n 
1 195  VAL n 
1 196  SER n 
1 197  LEU n 
1 198  ARG n 
1 199  GLU n 
1 200  LYS n 
1 201  GLU n 
1 202  PHE n 
1 203  ASN n 
1 204  LYS n 
1 205  GLY n 
1 206  PRO n 
1 207  TRP n 
1 208  LYS n 
1 209  GLN n 
1 210  GLU n 
1 211  ASN n 
1 212  VAL n 
1 213  GLU n 
1 214  ALA n 
1 215  GLU n 
1 216  ALA n 
1 217  SER n 
1 218  MET n 
1 219  VAL n 
1 220  ILE n 
1 221  ALA n 
1 222  VAL n 
1 223  PRO n 
1 224  GLU n 
1 225  PRO n 
1 226  PHE n 
1 227  GLY n 
1 228  GLY n 
1 229  ALA n 
1 230  ILE n 
1 231  ILE n 
1 232  ILE n 
1 233  GLY n 
1 234  GLN n 
1 235  GLU n 
1 236  SER n 
1 237  ILE n 
1 238  THR n 
1 239  TYR n 
1 240  HIS n 
1 241  ASN n 
1 242  GLY n 
1 243  ASP n 
1 244  LYS n 
1 245  TYR n 
1 246  LEU n 
1 247  ALA n 
1 248  ILE n 
1 249  ALA n 
1 250  PRO n 
1 251  PRO n 
1 252  ILE n 
1 253  ILE n 
1 254  LYS n 
1 255  GLN n 
1 256  SER n 
1 257  THR n 
1 258  ILE n 
1 259  VAL n 
1 260  CYS n 
1 261  HIS n 
1 262  ASN n 
1 263  ARG n 
1 264  VAL n 
1 265  ASP n 
1 266  PRO n 
1 267  ASN n 
1 268  GLY n 
1 269  SER n 
1 270  ARG n 
1 271  TYR n 
1 272  LEU n 
1 273  LEU n 
1 274  GLY n 
1 275  ASP n 
1 276  MET n 
1 277  GLU n 
1 278  GLY n 
1 279  ARG n 
1 280  LEU n 
1 281  PHE n 
1 282  MET n 
1 283  LEU n 
1 284  LEU n 
1 285  LEU n 
1 286  GLU n 
1 287  LYS n 
1 288  GLU n 
1 289  GLU n 
1 290  GLN n 
1 291  MET n 
1 292  ASP n 
1 293  GLY n 
1 294  THR n 
1 295  VAL n 
1 296  THR n 
1 297  LEU n 
1 298  LYS n 
1 299  ASP n 
1 300  LEU n 
1 301  ARG n 
1 302  VAL n 
1 303  GLU n 
1 304  LEU n 
1 305  LEU n 
1 306  GLY n 
1 307  GLU n 
1 308  THR n 
1 309  SER n 
1 310  ILE n 
1 311  ALA n 
1 312  GLU n 
1 313  CYS n 
1 314  LEU n 
1 315  THR n 
1 316  TYR n 
1 317  LEU n 
1 318  ASP n 
1 319  ASN n 
1 320  GLY n 
1 321  VAL n 
1 322  VAL n 
1 323  PHE n 
1 324  VAL n 
1 325  GLY n 
1 326  SER n 
1 327  ARG n 
1 328  LEU n 
1 329  GLY n 
1 330  ASP n 
1 331  SER n 
1 332  GLN n 
1 333  LEU n 
1 334  VAL n 
1 335  LYS n 
1 336  LEU n 
1 337  ASN n 
1 338  VAL n 
1 339  ASP n 
1 340  SER n 
1 341  ASN n 
1 342  GLU n 
1 343  GLN n 
1 344  GLY n 
1 345  SER n 
1 346  TYR n 
1 347  VAL n 
1 348  VAL n 
1 349  ALA n 
1 350  MET n 
1 351  GLU n 
1 352  THR n 
1 353  PHE n 
1 354  THR n 
1 355  ASN n 
1 356  LEU n 
1 357  GLY n 
1 358  PRO n 
1 359  ILE n 
1 360  VAL n 
1 361  ASP n 
1 362  MET n 
1 363  CYS n 
1 364  VAL n 
1 365  VAL n 
1 366  ASP n 
1 367  LEU n 
1 368  GLU n 
1 369  ARG n 
1 370  GLN n 
1 371  GLY n 
1 372  GLN n 
1 373  GLY n 
1 374  GLN n 
1 375  LEU n 
1 376  VAL n 
1 377  THR n 
1 378  CYS n 
1 379  SER n 
1 380  GLY n 
1 381  ALA n 
1 382  PHE n 
1 383  LYS n 
1 384  GLU n 
1 385  GLY n 
1 386  SER n 
1 387  LEU n 
1 388  ARG n 
1 389  ILE n 
1 390  ILE n 
1 391  ARG n 
1 392  ASN n 
1 393  GLY n 
1 394  ILE n 
1 395  GLY n 
1 396  ILE n 
1 397  HIS n 
1 398  GLU n 
1 399  HIS n 
1 400  ALA n 
1 401  SER n 
1 402  ILE n 
1 403  ASP n 
1 404  LEU n 
1 405  PRO n 
1 406  GLY n 
1 407  ILE n 
1 408  LYS n 
1 409  GLY n 
1 410  LEU n 
1 411  TRP n 
1 412  PRO n 
1 413  LEU n 
1 414  ARG n 
1 415  SER n 
1 416  ASP n 
1 417  PRO n 
1 418  ASN n 
1 419  ARG n 
1 420  GLU n 
1 421  THR n 
1 422  ASP n 
1 423  ASP n 
1 424  THR n 
1 425  LEU n 
1 426  VAL n 
1 427  LEU n 
1 428  SER n 
1 429  PHE n 
1 430  VAL n 
1 431  GLY n 
1 432  GLN n 
1 433  THR n 
1 434  ARG n 
1 435  VAL n 
1 436  LEU n 
1 437  MET n 
1 438  LEU n 
1 439  ASN n 
1 440  GLY n 
1 441  GLU n 
1 442  GLU n 
1 443  VAL n 
1 444  GLU n 
1 445  GLU n 
1 446  THR n 
1 447  GLU n 
1 448  LEU n 
1 449  MET n 
1 450  GLY n 
1 451  PHE n 
1 452  VAL n 
1 453  ASP n 
1 454  ASP n 
1 455  GLN n 
1 456  GLN n 
1 457  THR n 
1 458  PHE n 
1 459  PHE n 
1 460  CYS n 
1 461  GLY n 
1 462  ASN n 
1 463  VAL n 
1 464  ALA n 
1 465  HIS n 
1 466  GLN n 
1 467  GLN n 
1 468  LEU n 
1 469  ILE n 
1 470  GLN n 
1 471  ILE n 
1 472  THR n 
1 473  SER n 
1 474  ALA n 
1 475  SER n 
1 476  VAL n 
1 477  ARG n 
1 478  LEU n 
1 479  VAL n 
1 480  SER n 
1 481  GLN n 
1 482  GLU n 
1 483  PRO n 
1 484  LYS n 
1 485  ALA n 
1 486  LEU n 
1 487  VAL n 
1 488  SER n 
1 489  GLU n 
1 490  TRP n 
1 491  LYS n 
1 492  GLU n 
1 493  PRO n 
1 494  GLN n 
1 495  ALA n 
1 496  LYS n 
1 497  ASN n 
1 498  ILE n 
1 499  SER n 
1 500  VAL n 
1 501  ALA n 
1 502  SER n 
1 503  CYS n 
1 504  ASN n 
1 505  SER n 
1 506  SER n 
1 507  GLN n 
1 508  VAL n 
1 509  VAL n 
1 510  VAL n 
1 511  ALA n 
1 512  VAL n 
1 513  GLY n 
1 514  ARG n 
1 515  ALA n 
1 516  LEU n 
1 517  TYR n 
1 518  TYR n 
1 519  LEU n 
1 520  GLN n 
1 521  ILE n 
1 522  HIS n 
1 523  PRO n 
1 524  GLN n 
1 525  GLU n 
1 526  LEU n 
1 527  ARG n 
1 528  GLN n 
1 529  ILE n 
1 530  SER n 
1 531  HIS n 
1 532  THR n 
1 533  GLU n 
1 534  MET n 
1 535  GLU n 
1 536  HIS n 
1 537  GLU n 
1 538  VAL n 
1 539  ALA n 
1 540  CYS n 
1 541  LEU n 
1 542  ASP n 
1 543  ILE n 
1 544  THR n 
1 545  PRO n 
1 546  LEU n 
1 547  GLY n 
1 548  ASP n 
1 549  SER n 
1 550  ASN n 
1 551  GLY n 
1 552  LEU n 
1 553  SER n 
1 554  PRO n 
1 555  LEU n 
1 556  CYS n 
1 557  ALA n 
1 558  ILE n 
1 559  GLY n 
1 560  LEU n 
1 561  TRP n 
1 562  THR n 
1 563  ASP n 
1 564  ILE n 
1 565  SER n 
1 566  ALA n 
1 567  ARG n 
1 568  ILE n 
1 569  LEU n 
1 570  LYS n 
1 571  LEU n 
1 572  PRO n 
1 573  SER n 
1 574  PHE n 
1 575  GLU n 
1 576  LEU n 
1 577  LEU n 
1 578  HIS n 
1 579  LYS n 
1 580  GLU n 
1 581  MET n 
1 582  LEU n 
1 583  GLY n 
1 584  GLY n 
1 585  GLU n 
1 586  ILE n 
1 587  ILE n 
1 588  PRO n 
1 589  ARG n 
1 590  SER n 
1 591  ILE n 
1 592  LEU n 
1 593  MET n 
1 594  THR n 
1 595  THR n 
1 596  PHE n 
1 597  GLU n 
1 598  SER n 
1 599  SER n 
1 600  HIS n 
1 601  TYR n 
1 602  LEU n 
1 603  LEU n 
1 604  CYS n 
1 605  ALA n 
1 606  LEU n 
1 607  GLY n 
1 608  ASP n 
1 609  GLY n 
1 610  ALA n 
1 611  LEU n 
1 612  PHE n 
1 613  TYR n 
1 614  PHE n 
1 615  GLY n 
1 616  LEU n 
1 617  ASN n 
1 618  ILE n 
1 619  GLU n 
1 620  THR n 
1 621  GLY n 
1 622  LEU n 
1 623  LEU n 
1 624  SER n 
1 625  ASP n 
1 626  ARG n 
1 627  LYS n 
1 628  LYS n 
1 629  VAL n 
1 630  THR n 
1 631  LEU n 
1 632  GLY n 
1 633  THR n 
1 634  GLN n 
1 635  PRO n 
1 636  THR n 
1 637  VAL n 
1 638  LEU n 
1 639  ARG n 
1 640  THR n 
1 641  PHE n 
1 642  ARG n 
1 643  SER n 
1 644  LEU n 
1 645  SER n 
1 646  THR n 
1 647  THR n 
1 648  ASN n 
1 649  VAL n 
1 650  PHE n 
1 651  ALA n 
1 652  CYS n 
1 653  SER n 
1 654  ASP n 
1 655  ARG n 
1 656  PRO n 
1 657  THR n 
1 658  VAL n 
1 659  ILE n 
1 660  TYR n 
1 661  SER n 
1 662  SER n 
1 663  ASN n 
1 664  HIS n 
1 665  LYS n 
1 666  LEU n 
1 667  VAL n 
1 668  PHE n 
1 669  SER n 
1 670  ASN n 
1 671  VAL n 
1 672  ASN n 
1 673  LEU n 
1 674  LYS n 
1 675  GLU n 
1 676  VAL n 
1 677  ASN n 
1 678  TYR n 
1 679  MET n 
1 680  CYS n 
1 681  PRO n 
1 682  LEU n 
1 683  ASN n 
1 684  SER n 
1 685  ASP n 
1 686  GLY n 
1 687  TYR n 
1 688  PRO n 
1 689  ASP n 
1 690  SER n 
1 691  LEU n 
1 692  ALA n 
1 693  LEU n 
1 694  ALA n 
1 695  ASN n 
1 696  ASN n 
1 697  SER n 
1 698  THR n 
1 699  LEU n 
1 700  THR n 
1 701  ILE n 
1 702  GLY n 
1 703  THR n 
1 704  ILE n 
1 705  ASP n 
1 706  GLU n 
1 707  ILE n 
1 708  GLN n 
1 709  LYS n 
1 710  LEU n 
1 711  HIS n 
1 712  ILE n 
1 713  ARG n 
1 714  THR n 
1 715  VAL n 
1 716  PRO n 
1 717  LEU n 
1 718  TYR n 
1 719  GLU n 
1 720  SER n 
1 721  PRO n 
1 722  ARG n 
1 723  LYS n 
1 724  ILE n 
1 725  CYS n 
1 726  TYR n 
1 727  GLN n 
1 728  GLU n 
1 729  VAL n 
1 730  SER n 
1 731  GLN n 
1 732  CYS n 
1 733  PHE n 
1 734  GLY n 
1 735  VAL n 
1 736  LEU n 
1 737  SER n 
1 738  SER n 
1 739  ARG n 
1 740  ILE n 
1 741  GLU n 
1 742  VAL n 
1 743  GLN n 
1 744  ASP n 
1 745  THR n 
1 746  SER n 
1 747  GLY n 
1 748  GLY n 
1 749  THR n 
1 750  THR n 
1 751  ALA n 
1 752  LEU n 
1 753  ARG n 
1 754  PRO n 
1 755  SER n 
1 756  ALA n 
1 757  SER n 
1 758  THR n 
1 759  GLN n 
1 760  ALA n 
1 761  LEU n 
1 762  SER n 
1 763  SER n 
1 764  SER n 
1 765  VAL n 
1 766  SER n 
1 767  SER n 
1 768  SER n 
1 769  LYS n 
1 770  LEU n 
1 771  PHE n 
1 772  SER n 
1 773  SER n 
1 774  SER n 
1 775  THR n 
1 776  ALA n 
1 777  PRO n 
1 778  HIS n 
1 779  GLU n 
1 780  THR n 
1 781  SER n 
1 782  PHE n 
1 783  GLY n 
1 784  GLU n 
1 785  GLU n 
1 786  VAL n 
1 787  GLU n 
1 788  VAL n 
1 789  HIS n 
1 790  ASN n 
1 791  LEU n 
1 792  LEU n 
1 793  ILE n 
1 794  ILE n 
1 795  ASP n 
1 796  GLN n 
1 797  HIS n 
1 798  THR n 
1 799  PHE n 
1 800  GLU n 
1 801  VAL n 
1 802  LEU n 
1 803  HIS n 
1 804  ALA n 
1 805  HIS n 
1 806  GLN n 
1 807  PHE n 
1 808  LEU n 
1 809  GLN n 
1 810  ASN n 
1 811  GLU n 
1 812  TYR n 
1 813  ALA n 
1 814  LEU n 
1 815  SER n 
1 816  LEU n 
1 817  VAL n 
1 818  SER n 
1 819  CYS n 
1 820  LYS n 
1 821  LEU n 
1 822  GLY n 
1 823  LYS n 
1 824  ASP n 
1 825  PRO n 
1 826  ASN n 
1 827  THR n 
1 828  TYR n 
1 829  PHE n 
1 830  ILE n 
1 831  VAL n 
1 832  GLY n 
1 833  THR n 
1 834  ALA n 
1 835  MET n 
1 836  VAL n 
1 837  TYR n 
1 838  PRO n 
1 839  GLU n 
1 840  GLU n 
1 841  ALA n 
1 842  GLU n 
1 843  PRO n 
1 844  LYS n 
1 845  GLN n 
1 846  GLY n 
1 847  ARG n 
1 848  ILE n 
1 849  VAL n 
1 850  VAL n 
1 851  PHE n 
1 852  GLN n 
1 853  TYR n 
1 854  SER n 
1 855  ASP n 
1 856  GLY n 
1 857  LYS n 
1 858  LEU n 
1 859  GLN n 
1 860  THR n 
1 861  VAL n 
1 862  ALA n 
1 863  GLU n 
1 864  LYS n 
1 865  GLU n 
1 866  VAL n 
1 867  LYS n 
1 868  GLY n 
1 869  ALA n 
1 870  VAL n 
1 871  TYR n 
1 872  SER n 
1 873  MET n 
1 874  VAL n 
1 875  GLU n 
1 876  PHE n 
1 877  ASN n 
1 878  GLY n 
1 879  LYS n 
1 880  LEU n 
1 881  LEU n 
1 882  ALA n 
1 883  SER n 
1 884  ILE n 
1 885  ASN n 
1 886  SER n 
1 887  THR n 
1 888  VAL n 
1 889  ARG n 
1 890  LEU n 
1 891  TYR n 
1 892  GLU n 
1 893  TRP n 
1 894  THR n 
1 895  THR n 
1 896  GLU n 
1 897  LYS n 
1 898  GLU n 
1 899  LEU n 
1 900  ARG n 
1 901  THR n 
1 902  GLU n 
1 903  CYS n 
1 904  ASN n 
1 905  HIS n 
1 906  TYR n 
1 907  ASN n 
1 908  ASN n 
1 909  ILE n 
1 910  MET n 
1 911  ALA n 
1 912  LEU n 
1 913  TYR n 
1 914  LEU n 
1 915  LYS n 
1 916  THR n 
1 917  LYS n 
1 918  GLY n 
1 919  ASP n 
1 920  PHE n 
1 921  ILE n 
1 922  LEU n 
1 923  VAL n 
1 924  GLY n 
1 925  ASP n 
1 926  LEU n 
1 927  MET n 
1 928  ARG n 
1 929  SER n 
1 930  VAL n 
1 931  LEU n 
1 932  LEU n 
1 933  LEU n 
1 934  ALA n 
1 935  TYR n 
1 936  LYS n 
1 937  PRO n 
1 938  MET n 
1 939  GLU n 
1 940  GLY n 
1 941  ASN n 
1 942  PHE n 
1 943  GLU n 
1 944  GLU n 
1 945  ILE n 
1 946  ALA n 
1 947  ARG n 
1 948  ASP n 
1 949  PHE n 
1 950  ASN n 
1 951  PRO n 
1 952  ASN n 
1 953  TRP n 
1 954  MET n 
1 955  SER n 
1 956  ALA n 
1 957  VAL n 
1 958  GLU n 
1 959  ILE n 
1 960  LEU n 
1 961  ASP n 
1 962  ASP n 
1 963  ASP n 
1 964  ASN n 
1 965  PHE n 
1 966  LEU n 
1 967  GLY n 
1 968  ALA n 
1 969  GLU n 
1 970  ASN n 
1 971  ALA n 
1 972  PHE n 
1 973  ASN n 
1 974  LEU n 
1 975  PHE n 
1 976  VAL n 
1 977  CYS n 
1 978  GLN n 
1 979  LYS n 
1 980  ASP n 
1 981  SER n 
1 982  ALA n 
1 983  ALA n 
1 984  THR n 
1 985  THR n 
1 986  ASP n 
1 987  GLU n 
1 988  GLU n 
1 989  ARG n 
1 990  GLN n 
1 991  HIS n 
1 992  LEU n 
1 993  GLN n 
1 994  GLU n 
1 995  VAL n 
1 996  GLY n 
1 997  LEU n 
1 998  PHE n 
1 999  HIS n 
1 1000 LEU n 
1 1001 GLY n 
1 1002 GLU n 
1 1003 PHE n 
1 1004 VAL n 
1 1005 ASN n 
1 1006 VAL n 
1 1007 PHE n 
1 1008 CYS n 
1 1009 HIS n 
1 1010 GLY n 
1 1011 SER n 
1 1012 LEU n 
1 1013 VAL n 
1 1014 MET n 
1 1015 GLN n 
1 1016 ASN n 
1 1017 LEU n 
1 1018 GLY n 
1 1019 GLU n 
1 1020 THR n 
1 1021 SER n 
1 1022 THR n 
1 1023 PRO n 
1 1024 THR n 
1 1025 GLN n 
1 1026 GLY n 
1 1027 SER n 
1 1028 VAL n 
1 1029 LEU n 
1 1030 PHE n 
1 1031 GLY n 
1 1032 THR n 
1 1033 VAL n 
1 1034 ASN n 
1 1035 GLY n 
1 1036 MET n 
1 1037 ILE n 
1 1038 GLY n 
1 1039 LEU n 
1 1040 VAL n 
1 1041 THR n 
1 1042 SER n 
1 1043 LEU n 
1 1044 SER n 
1 1045 GLU n 
1 1046 SER n 
1 1047 TRP n 
1 1048 TYR n 
1 1049 ASN n 
1 1050 LEU n 
1 1051 LEU n 
1 1052 LEU n 
1 1053 ASP n 
1 1054 MET n 
1 1055 GLN n 
1 1056 ASN n 
1 1057 ARG n 
1 1058 LEU n 
1 1059 ASN n 
1 1060 LYS n 
1 1061 VAL n 
1 1062 ILE n 
1 1063 LYS n 
1 1064 SER n 
1 1065 VAL n 
1 1066 GLY n 
1 1067 LYS n 
1 1068 ILE n 
1 1069 GLU n 
1 1070 HIS n 
1 1071 SER n 
1 1072 PHE n 
1 1073 TRP n 
1 1074 ARG n 
1 1075 SER n 
1 1076 PHE n 
1 1077 HIS n 
1 1078 THR n 
1 1079 GLU n 
1 1080 ARG n 
1 1081 LYS n 
1 1082 THR n 
1 1083 GLU n 
1 1084 PRO n 
1 1085 ALA n 
1 1086 THR n 
1 1087 GLY n 
1 1088 PHE n 
1 1089 ILE n 
1 1090 ASP n 
1 1091 GLY n 
1 1092 ASP n 
1 1093 LEU n 
1 1094 ILE n 
1 1095 GLU n 
1 1096 SER n 
1 1097 PHE n 
1 1098 LEU n 
1 1099 ASP n 
1 1100 ILE n 
1 1101 SER n 
1 1102 ARG n 
1 1103 PRO n 
1 1104 LYS n 
1 1105 MET n 
1 1106 GLN n 
1 1107 GLU n 
1 1108 VAL n 
1 1109 VAL n 
1 1110 ALA n 
1 1111 ASN n 
1 1112 LEU n 
1 1113 GLN n 
1 1114 TYR n 
1 1115 ASP n 
1 1116 ASP n 
1 1117 GLY n 
1 1118 SER n 
1 1119 GLY n 
1 1120 MET n 
1 1121 LYS n 
1 1122 ARG n 
1 1123 GLU n 
1 1124 ALA n 
1 1125 THR n 
1 1126 ALA n 
1 1127 ASP n 
1 1128 ASP n 
1 1129 LEU n 
1 1130 ILE n 
1 1131 LYS n 
1 1132 VAL n 
1 1133 VAL n 
1 1134 GLU n 
1 1135 GLU n 
1 1136 LEU n 
1 1137 THR n 
1 1138 ARG n 
1 1139 ILE n 
1 1140 HIS n 
2 1    MET n 
2 2    HIS n 
2 3    HIS n 
2 4    HIS n 
2 5    HIS n 
2 6    HIS n 
2 7    HIS n 
2 8    ALA n 
2 9    PRO n 
2 10   SER n 
2 11   SER n 
2 12   LYS n 
2 13   SER n 
2 14   GLU n 
2 15   ARG n 
2 16   ASN n 
2 17   SER n 
2 18   GLY n 
2 19   ALA n 
2 20   GLY n 
2 21   SER n 
2 22   GLY n 
2 23   GLY n 
2 24   GLY n 
2 25   GLY n 
2 26   PRO n 
2 27   GLY n 
2 28   GLY n 
2 29   ALA n 
2 30   GLY n 
2 31   GLY n 
2 32   LYS n 
2 33   ARG n 
2 34   ALA n 
2 35   ALA n 
2 36   GLY n 
2 37   ARG n 
2 38   ARG n 
2 39   ARG n 
2 40   GLU n 
2 41   HIS n 
2 42   VAL n 
2 43   LEU n 
2 44   LYS n 
2 45   GLN n 
2 46   LEU n 
2 47   GLU n 
2 48   ARG n 
2 49   VAL n 
2 50   LYS n 
2 51   ILE n 
2 52   SER n 
2 53   GLY n 
2 54   GLN n 
2 55   LEU n 
2 56   SER n 
2 57   PRO n 
2 58   ARG n 
2 59   LEU n 
2 60   PHE n 
2 61   ARG n 
2 62   LYS n 
2 63   LEU n 
2 64   PRO n 
2 65   PRO n 
2 66   ARG n 
2 67   VAL n 
2 68   CYS n 
2 69   VAL n 
2 70   SER n 
2 71   LEU n 
2 72   LYS n 
2 73   ASN n 
2 74   ILE n 
2 75   VAL n 
2 76   ASP n 
2 77   GLU n 
2 78   ASP n 
2 79   PHE n 
2 80   LEU n 
2 81   TYR n 
2 82   ALA n 
2 83   GLY n 
2 84   HIS n 
2 85   ILE n 
2 86   PHE n 
2 87   LEU n 
2 88   GLY n 
2 89   PHE n 
2 90   SER n 
2 91   LYS n 
2 92   CYS n 
2 93   GLY n 
2 94   ARG n 
2 95   TYR n 
2 96   VAL n 
2 97   LEU n 
2 98   SER n 
2 99   TYR n 
2 100  THR n 
2 101  SER n 
2 102  SER n 
2 103  SER n 
2 104  GLY n 
2 105  ASP n 
2 106  ASP n 
2 107  ASP n 
2 108  PHE n 
2 109  SER n 
2 110  PHE n 
2 111  TYR n 
2 112  ILE n 
2 113  TYR n 
2 114  HIS n 
2 115  LEU n 
2 116  TYR n 
2 117  TRP n 
2 118  TRP n 
2 119  GLU n 
2 120  PHE n 
2 121  ASN n 
2 122  VAL n 
2 123  HIS n 
2 124  SER n 
2 125  LYS n 
2 126  LEU n 
2 127  LYS n 
2 128  LEU n 
2 129  VAL n 
2 130  ARG n 
2 131  GLN n 
2 132  VAL n 
2 133  ARG n 
2 134  LEU n 
2 135  PHE n 
2 136  GLN n 
2 137  ASP n 
2 138  GLU n 
2 139  GLU n 
2 140  ILE n 
2 141  TYR n 
2 142  SER n 
2 143  ASP n 
2 144  LEU n 
2 145  TYR n 
2 146  LEU n 
2 147  THR n 
2 148  VAL n 
2 149  CYS n 
2 150  GLU n 
2 151  TRP n 
2 152  PRO n 
2 153  SER n 
2 154  ASP n 
2 155  ALA n 
2 156  SER n 
2 157  LYS n 
2 158  VAL n 
2 159  ILE n 
2 160  VAL n 
2 161  PHE n 
2 162  GLY n 
2 163  PHE n 
2 164  ASN n 
2 165  THR n 
2 166  ARG n 
2 167  SER n 
2 168  ALA n 
2 169  ASN n 
2 170  GLY n 
2 171  MET n 
2 172  LEU n 
2 173  MET n 
2 174  ASN n 
2 175  MET n 
2 176  MET n 
2 177  MET n 
2 178  MET n 
2 179  SER n 
2 180  ASP n 
2 181  GLU n 
2 182  ASN n 
2 183  HIS n 
2 184  ARG n 
2 185  ASP n 
2 186  ILE n 
2 187  TYR n 
2 188  VAL n 
2 189  SER n 
2 190  THR n 
2 191  VAL n 
2 192  ALA n 
2 193  VAL n 
2 194  PRO n 
2 195  PRO n 
2 196  PRO n 
2 197  GLY n 
2 198  ARG n 
2 199  CYS n 
2 200  ALA n 
2 201  ALA n 
2 202  CYS n 
2 203  GLN n 
2 204  ASP n 
2 205  ALA n 
2 206  SER n 
2 207  ARG n 
2 208  ALA n 
2 209  HIS n 
2 210  PRO n 
2 211  GLY n 
2 212  ASP n 
2 213  PRO n 
2 214  ASN n 
2 215  ALA n 
2 216  GLN n 
2 217  CYS n 
2 218  LEU n 
2 219  ARG n 
2 220  HIS n 
2 221  GLY n 
2 222  PHE n 
2 223  MET n 
2 224  LEU n 
2 225  HIS n 
2 226  THR n 
2 227  LYS n 
2 228  TYR n 
2 229  GLN n 
2 230  VAL n 
2 231  VAL n 
2 232  TYR n 
2 233  PRO n 
2 234  PHE n 
2 235  PRO n 
2 236  THR n 
2 237  PHE n 
2 238  GLN n 
2 239  PRO n 
2 240  ALA n 
2 241  PHE n 
2 242  GLN n 
2 243  LEU n 
2 244  LYS n 
2 245  LYS n 
2 246  ASP n 
2 247  GLN n 
2 248  VAL n 
2 249  VAL n 
2 250  LEU n 
2 251  LEU n 
2 252  ASN n 
2 253  THR n 
2 254  SER n 
2 255  TYR n 
2 256  SER n 
2 257  LEU n 
2 258  VAL n 
2 259  ALA n 
2 260  CYS n 
2 261  ALA n 
2 262  VAL n 
2 263  SER n 
2 264  VAL n 
2 265  HIS n 
2 266  SER n 
2 267  ALA n 
2 268  GLY n 
2 269  ASP n 
2 270  ARG n 
2 271  SER n 
2 272  PHE n 
2 273  CYS n 
2 274  GLN n 
2 275  ILE n 
2 276  LEU n 
2 277  TYR n 
2 278  ASP n 
2 279  HIS n 
2 280  SER n 
2 281  THR n 
2 282  PRO n 
2 283  GLY n 
2 284  TYR n 
2 285  VAL n 
2 286  ASN n 
2 287  TYR n 
2 288  THR n 
2 289  LYS n 
2 290  LEU n 
2 291  TYR n 
2 292  TYR n 
2 293  VAL n 
2 294  LEU n 
2 295  GLU n 
2 296  SER n 
2 297  GLY n 
2 298  GLU n 
2 299  GLY n 
2 300  THR n 
2 301  GLU n 
2 302  PRO n 
2 303  GLU n 
2 304  ASP n 
2 305  GLU n 
2 306  LEU n 
2 307  GLU n 
2 308  ASP n 
2 309  ASP n 
2 310  LYS n 
2 311  ILE n 
2 312  SER n 
2 313  LEU n 
2 314  PRO n 
2 315  PHE n 
2 316  VAL n 
2 317  VAL n 
2 318  THR n 
2 319  ASP n 
2 320  LEU n 
2 321  ARG n 
2 322  GLY n 
2 323  ARG n 
2 324  ASN n 
2 325  LEU n 
2 326  ARG n 
2 327  PRO n 
2 328  MET n 
2 329  ARG n 
2 330  GLU n 
2 331  ARG n 
2 332  THR n 
2 333  ALA n 
2 334  VAL n 
2 335  GLN n 
2 336  GLY n 
2 337  GLN n 
2 338  TYR n 
2 339  LEU n 
2 340  THR n 
2 341  VAL n 
2 342  GLU n 
2 343  GLN n 
2 344  LEU n 
2 345  THR n 
2 346  LEU n 
2 347  ASP n 
2 348  PHE n 
2 349  GLU n 
2 350  TYR n 
2 351  VAL n 
2 352  ILE n 
2 353  ASN n 
2 354  GLU n 
2 355  VAL n 
2 356  ILE n 
2 357  ARG n 
2 358  HIS n 
2 359  ASP n 
2 360  ALA n 
2 361  THR n 
2 362  TRP n 
2 363  GLY n 
2 364  HIS n 
2 365  GLN n 
2 366  PHE n 
2 367  CYS n 
2 368  SER n 
2 369  PHE n 
2 370  SER n 
2 371  ASP n 
2 372  TYR n 
2 373  ASP n 
2 374  ILE n 
2 375  VAL n 
2 376  ILE n 
2 377  LEU n 
2 378  GLU n 
2 379  VAL n 
2 380  CYS n 
2 381  PRO n 
2 382  GLU n 
2 383  THR n 
2 384  ASN n 
2 385  GLN n 
2 386  VAL n 
2 387  LEU n 
2 388  ILE n 
2 389  ASN n 
2 390  ILE n 
2 391  GLY n 
2 392  LEU n 
2 393  LEU n 
2 394  LEU n 
2 395  LEU n 
2 396  ALA n 
2 397  PHE n 
2 398  PRO n 
2 399  SER n 
2 400  PRO n 
2 401  THR n 
2 402  GLU n 
2 403  GLU n 
2 404  GLY n 
2 405  GLN n 
2 406  LEU n 
2 407  ARG n 
2 408  PRO n 
2 409  LYS n 
2 410  THR n 
2 411  TYR n 
2 412  HIS n 
2 413  THR n 
2 414  SER n 
2 415  LEU n 
2 416  LYS n 
2 417  VAL n 
2 418  ALA n 
2 419  TRP n 
2 420  ASP n 
2 421  LEU n 
2 422  ASN n 
2 423  THR n 
2 424  GLY n 
2 425  ILE n 
2 426  PHE n 
2 427  GLU n 
2 428  THR n 
2 429  VAL n 
2 430  SER n 
2 431  VAL n 
2 432  GLY n 
2 433  ASP n 
2 434  LEU n 
2 435  THR n 
2 436  GLU n 
2 437  VAL n 
2 438  LYS n 
2 439  GLY n 
2 440  GLN n 
2 441  THR n 
2 442  SER n 
2 443  GLY n 
2 444  SER n 
2 445  VAL n 
2 446  TRP n 
2 447  SER n 
2 448  SER n 
2 449  TYR n 
2 450  ARG n 
2 451  LYS n 
2 452  SER n 
2 453  CYS n 
2 454  VAL n 
2 455  ASP n 
2 456  MET n 
2 457  VAL n 
2 458  MET n 
2 459  LYS n 
2 460  TRP n 
2 461  LEU n 
2 462  VAL n 
2 463  PRO n 
2 464  GLU n 
2 465  SER n 
2 466  SER n 
2 467  GLY n 
2 468  ARG n 
2 469  TYR n 
2 470  VAL n 
2 471  ASN n 
2 472  ARG n 
2 473  MET n 
2 474  THR n 
2 475  ASN n 
2 476  GLU n 
2 477  ALA n 
2 478  LEU n 
2 479  HIS n 
2 480  LYS n 
2 481  GLY n 
2 482  CYS n 
2 483  SER n 
2 484  LEU n 
2 485  LYS n 
2 486  VAL n 
2 487  LEU n 
2 488  ALA n 
2 489  ASP n 
2 490  SER n 
2 491  GLU n 
2 492  ARG n 
2 493  TYR n 
2 494  THR n 
2 495  TRP n 
2 496  ILE n 
2 497  VAL n 
2 498  LEU n 
3 1    GLY n 
3 2    SER n 
3 3    HIS n 
3 4    MET n 
3 5    ALA n 
3 6    ALA n 
3 7    ALA n 
3 8    MET n 
3 9    ALA n 
3 10   ASN n 
3 11   ASN n 
3 12   LEU n 
3 13   GLN n 
3 14   LYS n 
3 15   GLY n 
3 16   SER n 
3 17   ALA n 
3 18   GLY n 
3 19   PRO n 
3 20   MET n 
3 21   ARG n 
3 22   LEU n 
3 23   TYR n 
3 24   VAL n 
3 25   GLY n 
3 26   SER n 
3 27   LEU n 
3 28   HIS n 
3 29   PHE n 
3 30   ASN n 
3 31   ILE n 
3 32   THR n 
3 33   GLU n 
3 34   ASP n 
3 35   MET n 
3 36   LEU n 
3 37   ARG n 
3 38   GLY n 
3 39   ILE n 
3 40   PHE n 
3 41   GLU n 
3 42   PRO n 
3 43   PHE n 
3 44   GLY n 
3 45   ARG n 
3 46   ILE n 
3 47   GLU n 
3 48   SER n 
3 49   ILE n 
3 50   GLN n 
3 51   LEU n 
3 52   MET n 
3 53   MET n 
3 54   ASP n 
3 55   SER n 
3 56   GLU n 
3 57   THR n 
3 58   GLY n 
3 59   ARG n 
3 60   SER n 
3 61   LYS n 
3 62   GLY n 
3 63   TYR n 
3 64   GLY n 
3 65   PHE n 
3 66   ILE n 
3 67   THR n 
3 68   PHE n 
3 69   SER n 
3 70   ASP n 
3 71   SER n 
3 72   GLU n 
3 73   CYS n 
3 74   ALA n 
3 75   LYS n 
3 76   LYS n 
3 77   ALA n 
3 78   LEU n 
3 79   GLU n 
3 80   GLN n 
3 81   LEU n 
3 82   ASN n 
3 83   GLY n 
3 84   PHE n 
3 85   GLU n 
3 86   LEU n 
3 87   ALA n 
3 88   GLY n 
3 89   ARG n 
3 90   PRO n 
3 91   MET n 
3 92   LYS n 
3 93   VAL n 
3 94   GLY n 
3 95   HIS n 
3 96   VAL n 
3 97   THR n 
3 98   GLU n 
3 99   ARG n 
3 100  THR n 
3 101  ASP n 
3 102  ASP n 
3 103  TYR n 
3 104  LYS n 
3 105  ASP n 
3 106  ASP n 
3 107  ASP n 
3 108  ASP n 
3 109  LYS n 
4 1    MET n 
4 2    ALA n 
4 3    ASP n 
4 4    PHE n 
4 5    LEU n 
4 6    LYS n 
4 7    GLY n 
4 8    LEU n 
4 9    PRO n 
4 10   VAL n 
4 11   TYR n 
4 12   ASN n 
4 13   LYS n 
4 14   SER n 
4 15   ASN n 
4 16   PHE n 
4 17   SER n 
4 18   ARG n 
4 19   PHE n 
4 20   HIS n 
4 21   ALA n 
4 22   ASP n 
4 23   SER n 
4 24   VAL n 
4 25   CYS n 
4 26   LYS n 
4 27   ALA n 
4 28   SER n 
4 29   ASN n 
4 30   ARG n 
4 31   ARG n 
4 32   PRO n 
4 33   SER n 
4 34   VAL n 
4 35   TYR n 
4 36   LEU n 
4 37   PRO n 
4 38   THR n 
4 39   ARG n 
4 40   GLU n 
4 41   TYR n 
4 42   PRO n 
4 43   SER n 
4 44   GLU n 
4 45   GLN n 
4 46   ILE n 
4 47   ILE n 
4 48   VAL n 
4 49   THR n 
4 50   GLU n 
4 51   LYS n 
4 52   THR n 
4 53   ASN n 
4 54   ILE n 
4 55   LEU n 
4 56   LEU n 
4 57   ARG n 
4 58   TYR n 
4 59   LEU n 
4 60   HIS n 
4 61   GLN n 
4 62   GLN n 
4 63   TRP n 
4 64   ASP n 
4 65   LYS n 
4 66   LYS n 
4 67   ASN n 
4 68   ALA n 
4 69   ALA n 
4 70   LYS n 
4 71   LYS n 
4 72   ARG n 
4 73   ASP n 
4 74   GLN n 
4 75   GLU n 
4 76   GLN n 
4 77   VAL n 
4 78   GLU n 
4 79   LEU n 
4 80   GLU n 
4 81   GLY n 
4 82   GLU n 
4 83   SER n 
4 84   SER n 
4 85   ALA n 
4 86   PRO n 
4 87   PRO n 
4 88   ARG n 
4 89   LYS n 
4 90   VAL n 
4 91   ALA n 
4 92   ARG n 
4 93   THR n 
4 94   ASP n 
4 95   SER n 
4 96   PRO n 
4 97   ASP n 
4 98   MET n 
4 99   HIS n 
4 100  GLU n 
4 101  ASP n 
4 102  THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   1140 Human ? 'DDB1, XAP1'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Bacmid  ? ? ? pFastBac1 ? ? 
2 1 sample 'Biological sequence' 1   281  Human ? 'DCAF15, C19orf72'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Bacmid  ? ? ? pFastBac1 ? ? 
2 2 sample 'Biological sequence' 282 498  Human ? 'DCAF15, C19orf72'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Bacmid  ? ? ? pFastBac1 ? ? 
3 1 sample 'Biological sequence' 1   109  Human ? DKFZp781I1140           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli'      562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ?         ? ? 
4 1 sample 'Biological sequence' 1   102  Human ? 'DDA1, C19orf58, PCIA1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? Bacmid  ? ? ? pFastBac1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DDB1_HUMAN   Q16531 ? 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1   
2 UNP DCA15_HUMAN  Q66K64 ? 2 
;APSSKSERNSGAGSGGGGPGGAGGKRAAGRRREHVLKQLERVKISGQLSPRLFRKLPPRVCVSLKNIVDEDFLYAGHIFL
GFSKCGRYVLSYTSSSGDDDFSFYIYHLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIVFGFNTRS
ANGMLMNMMMMSDENHRDIYVSTVAVPPPGRCAACQDASRAHPGDPNAQCLRHGFMLHTKYQVVYPFPTFQPAFQLKKDQ
VVLLNTSYSLVACAVSVHSAGDRSFCQILYDHST
;
2   
3 UNP DCA15_HUMAN  Q66K64 ? 2 
;PGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDLRGRNLRPMRERTAVQGQYLTVEQLTLDFEYVINEVIRHDAT
WGHQFCSFSDYDIVILEVCPETNQVLINIGLLLLAFPSPTEEGQLRPKTYHTSLKVAWDLNTGIFETVSVGDLTEVKGQT
SGSVWSSYRKSCVDMVMKWLVPESSGRYVNRMTNEALHKGCSLKVLADSERYTWIVL
;
384 
4 UNP Q7Z3L0_HUMAN Q7Z3L0 ? 3 
;AAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGF
ELAGRPMKVGHVTERTD
;
78  
5 UNP DDA1_HUMAN   Q9BW61 ? 4 
;MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE
GESSAPPRKVARTDSPDMHEDT
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6PAI A 1   ? 1140 ? Q16531 1   ? 1140 ? 1   1140 
2 2 6PAI C 8   ? 281  ? Q66K64 2   ? 275  ? 2   383  
3 3 6PAI C 282 ? 498  ? Q66K64 384 ? 600  ? 384 600  
4 4 6PAI D 5   ? 101  ? Q7Z3L0 78  ? 174  ? 235 331  
5 5 6PAI E 1   ? 102  ? Q9BW61 1   ? 102  ? 1   102  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6PAI MET C 1   ? UNP Q66K64 ? ? 'expression tag' -5  1  
2 6PAI HIS C 2   ? UNP Q66K64 ? ? 'expression tag' -4  2  
2 6PAI HIS C 3   ? UNP Q66K64 ? ? 'expression tag' -3  3  
2 6PAI HIS C 4   ? UNP Q66K64 ? ? 'expression tag' -2  4  
2 6PAI HIS C 5   ? UNP Q66K64 ? ? 'expression tag' -1  5  
2 6PAI HIS C 6   ? UNP Q66K64 ? ? 'expression tag' 0   6  
2 6PAI HIS C 7   ? UNP Q66K64 ? ? 'expression tag' 1   7  
4 6PAI GLY D 1   ? UNP Q7Z3L0 ? ? 'expression tag' 231 8  
4 6PAI SER D 2   ? UNP Q7Z3L0 ? ? 'expression tag' 232 9  
4 6PAI HIS D 3   ? UNP Q7Z3L0 ? ? 'expression tag' 233 10 
4 6PAI MET D 4   ? UNP Q7Z3L0 ? ? 'expression tag' 234 11 
4 6PAI ASP D 102 ? UNP Q7Z3L0 ? ? 'expression tag' 332 12 
4 6PAI TYR D 103 ? UNP Q7Z3L0 ? ? 'expression tag' 333 13 
4 6PAI LYS D 104 ? UNP Q7Z3L0 ? ? 'expression tag' 334 14 
4 6PAI ASP D 105 ? UNP Q7Z3L0 ? ? 'expression tag' 335 15 
4 6PAI ASP D 106 ? UNP Q7Z3L0 ? ? 'expression tag' 336 16 
4 6PAI ASP D 107 ? UNP Q7Z3L0 ? ? 'expression tag' 337 17 
4 6PAI ASP D 108 ? UNP Q7Z3L0 ? ? 'expression tag' 338 18 
4 6PAI LYS D 109 ? UNP Q7Z3L0 ? ? 'expression tag' 339 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                           ?     'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                          ?     'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ?     'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ?     'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ?     'C3 H7 N O2 S'    121.158 
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'             HEPES 'C8 H18 N2 O4 S'  238.305 
GLN 'L-peptide linking' y GLUTAMINE                                                         ?     'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ?     'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                           ?     'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ?     'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                             ?     'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                        ?     'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ?     'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                            ?     'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                        ?     'C5 H11 N O2 S'   149.211 
O6M non-polymer         . '3-cyano-N-(3-cyano-4-methyl-1H-indol-7-yl)benzene-1-sulfonamide' ?     'C17 H12 N4 O2 S' 336.368 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ?     'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                           ?     'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                            ?     'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                         ?     'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                        ?     'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                          ?     'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                            ?     'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                        ?     'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6PAI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.69 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium HEPES, pH 7.0, 15% w/v PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-10-31 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            53.3 
_reflns.entry_id                         6PAI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47114 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.600 
_reflns.pdbx_Rmerge_I_obs                0.087 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         12.3 
_reflns.pdbx_netI_over_sigmaI            6.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.753 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.102 
_reflns.pdbx_Rpim_I_all                  0.052 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.900 2.950  ? 1.4 ? ? ? ? 2204 92.300 ? ? ? ? 0.487 ? ? ? ? ? ? ? ? 3.300 ? 0.458 ? ? 0.575 0.298 ? 1  1 0.818 ? 
2.950 3.000  ? ?   ? ? ? ? 2258 94.200 ? ? ? ? 0.419 ? ? ? ? ? ? ? ? 3.300 ? 0.481 ? ? 0.493 0.256 ? 2  1 0.864 ? 
3.000 3.060  ? ?   ? ? ? ? 2307 94.700 ? ? ? ? 0.346 ? ? ? ? ? ? ? ? 3.300 ? 0.461 ? ? 0.409 0.213 ? 3  1 0.902 ? 
3.060 3.120  ? ?   ? ? ? ? 2336 96.200 ? ? ? ? 0.319 ? ? ? ? ? ? ? ? 3.400 ? 0.506 ? ? 0.376 0.195 ? 4  1 0.911 ? 
3.120 3.190  ? ?   ? ? ? ? 2304 95.700 ? ? ? ? 0.266 ? ? ? ? ? ? ? ? 3.300 ? 0.519 ? ? 0.315 0.165 ? 5  1 0.935 ? 
3.190 3.270  ? ?   ? ? ? ? 2215 90.600 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 3.200 ? 0.557 ? ? 0.283 0.150 ? 6  1 0.930 ? 
3.270 3.350  ? ?   ? ? ? ? 2320 98.000 ? ? ? ? 0.203 ? ? ? ? ? ? ? ? 3.600 ? 0.577 ? ? 0.238 0.123 ? 7  1 0.948 ? 
3.350 3.440  ? ?   ? ? ? ? 2416 98.800 ? ? ? ? 0.169 ? ? ? ? ? ? ? ? 3.700 ? 0.637 ? ? 0.198 0.101 ? 8  1 0.973 ? 
3.440 3.540  ? ?   ? ? ? ? 2420 99.200 ? ? ? ? 0.163 ? ? ? ? ? ? ? ? 3.700 ? 0.654 ? ? 0.191 0.098 ? 9  1 0.969 ? 
3.540 3.650  ? ?   ? ? ? ? 2372 99.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 3.700 ? 0.696 ? ? 0.173 0.089 ? 10 1 0.973 ? 
3.650 3.780  ? ?   ? ? ? ? 2413 99.100 ? ? ? ? 0.134 ? ? ? ? ? ? ? ? 3.600 ? 0.762 ? ? 0.158 0.082 ? 11 1 0.973 ? 
3.780 3.940  ? ?   ? ? ? ? 2392 98.500 ? ? ? ? 0.137 ? ? ? ? ? ? ? ? 3.600 ? 0.766 ? ? 0.162 0.086 ? 12 1 0.308 ? 
3.940 4.110  ? ?   ? ? ? ? 2290 94.000 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? 3.600 ? 0.852 ? ? 0.117 0.060 ? 13 1 0.985 ? 
4.110 4.330  ? ?   ? ? ? ? 2410 99.200 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 3.900 ? 0.852 ? ? 0.096 0.048 ? 14 1 0.989 ? 
4.330 4.600  ? ?   ? ? ? ? 2411 99.300 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 3.800 ? 0.898 ? ? 0.078 0.039 ? 15 1 0.993 ? 
4.600 4.960  ? ?   ? ? ? ? 2425 99.100 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 3.800 ? 0.934 ? ? 0.068 0.034 ? 16 1 0.995 ? 
4.960 5.460  ? ?   ? ? ? ? 2342 95.600 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 3.600 ? 0.900 ? ? 0.067 0.034 ? 17 1 0.995 ? 
5.460 6.240  ? ?   ? ? ? ? 2450 99.600 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 3.900 ? 0.881 ? ? 0.070 0.035 ? 18 1 0.995 ? 
6.240 7.860  ? ?   ? ? ? ? 2393 97.600 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 3.600 ? 0.922 ? ? 0.061 0.031 ? 19 1 0.996 ? 
7.860 50.000 ? ?   ? ? ? ? 2436 96.400 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 3.700 ? 1.411 ? ? 0.050 0.025 ? 20 1 0.996 ? 
# 
_refine.aniso_B[1][1]                            -2.6500 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            2.3300 
_refine.aniso_B[2][2]                            -0.7100 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            2.5900 
_refine.B_iso_max                                176.120 
_refine.B_iso_mean                               86.9220 
_refine.B_iso_min                                46.120 
_refine.correlation_coeff_Fo_to_Fc               0.9360 
_refine.correlation_coeff_Fo_to_Fc_free          0.9140 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6PAI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             49.4500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     44775 
_refine.ls_number_reflns_R_free                  2310 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.2600 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2104 
_refine.ls_R_factor_R_free                       0.2518 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2083 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entries 3E0C & 2JRS' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.4080 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             48.7690 
_refine.overall_SU_ML                            0.3920 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        49.4500 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               13143 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1649 
_refine_hist.pdbx_B_iso_mean_ligand           74.02 
_refine_hist.pdbx_B_iso_mean_solvent          57.99 
_refine_hist.pdbx_number_atoms_protein        13087 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  0.012  13460 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.126  1.634  18227 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 6.894  5.000  1637  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 33.151 22.518 695   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 15.990 15.000 2342  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 18.214 15.000 80    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.096  0.200  1749  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  10138 ? r_gen_planes_refined   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.9000 
_refine_ls_shell.d_res_low                        2.9750 
_refine_ls_shell.number_reflns_all                3040 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             163 
_refine_ls_shell.number_reflns_R_work             2877 
_refine_ls_shell.percent_reflns_obs               85.2700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3420 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6PAI 
_struct.title                        
'Structure of the human DDB1-DDA1-DCAF15 E3 ubiquitin ligase bound to RBM39 and sulfonamide E7820' 
_struct.pdbx_descriptor              
'DNA damage-binding protein 1, DDB1- and CUL4-associated factor 15, RNA-binding protein 39, DET1- and DDB1-associated protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6PAI 
_struct_keywords.text            'sulfonamide, RBM39, DCAF15, LIGASE' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 250  ? GLN A 255  ? PRO A 250  GLN A 255  5 ? 6  
HELX_P HELX_P2  AA2 ALA A 381  ? GLU A 384  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P3  AA3 SER A 755  ? GLN A 759  ? SER A 755  GLN A 759  5 ? 5  
HELX_P HELX_P4  AA4 GLU A 987  ? GLN A 990  ? GLU A 987  GLN A 990  5 ? 4  
HELX_P HELX_P5  AA5 SER A 1044 ? ILE A 1062 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P6  AA6 GLU A 1069 ? ARG A 1074 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P7  AA7 GLY A 1091 ? SER A 1096 ? GLY A 1091 SER A 1096 1 ? 6  
HELX_P HELX_P8  AA8 PHE A 1097 ? ASP A 1099 ? PHE A 1097 ASP A 1099 5 ? 3  
HELX_P HELX_P9  AA9 SER A 1101 ? VAL A 1109 ? SER A 1101 VAL A 1109 1 ? 9  
HELX_P HELX_P10 AB1 THR A 1125 ? THR A 1137 ? THR A 1125 THR A 1137 1 ? 13 
HELX_P HELX_P11 AB2 ARG A 1138 ? HIS A 1140 ? ARG A 1138 HIS A 1140 5 ? 3  
HELX_P HELX_P12 AB3 HIS B 41   ? GLY B 53   ? HIS C 35   GLY C 47   1 ? 13 
HELX_P HELX_P13 AB4 LEU B 59   ? LEU B 63   ? LEU C 53   LEU C 57   5 ? 5  
HELX_P HELX_P14 AB5 LYS B 72   ? ILE B 74   ? LYS C 66   ILE C 68   5 ? 3  
HELX_P HELX_P15 AB6 CYS B 199  ? SER B 206  ? CYS C 193  SER C 200  1 ? 8  
HELX_P HELX_P16 AB7 GLN B 238  ? LEU B 243  ? GLN C 232  LEU C 237  1 ? 6  
HELX_P HELX_P17 AB8 PHE B 348  ? ASP B 359  ? PHE C 450  ASP C 461  1 ? 12 
HELX_P HELX_P18 AB9 THR B 441  ? LEU B 461  ? THR C 543  LEU C 563  1 ? 21 
HELX_P HELX_P19 AC1 THR C 32   ? GLU C 41   ? THR D 262  GLU D 271  1 ? 10 
HELX_P HELX_P20 AC2 PRO C 42   ? GLY C 44   ? PRO D 272  GLY D 274  5 ? 3  
HELX_P HELX_P21 AC3 ASP C 70   ? ASN C 82   ? ASP D 300  ASN D 312  1 ? 13 
HELX_P HELX_P22 AC4 ALA D 2    ? LYS D 6    ? ALA E 2    LYS E 6    5 ? 5  
HELX_P HELX_P23 AC5 ASN D 53   ? LYS D 65   ? ASN E 53   LYS E 65   1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B CYS 199 SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 193 C ZN 902 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc2 metalc ? ? B CYS 202 SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 196 C ZN 902 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc3 metalc ? ? B CYS 217 SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 211 C ZN 902 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc4 metalc ? ? B HIS 220 ND1 ? ? ? 1_555 H ZN . ZN ? ? C HIS 214 C ZN 902 1_555 ? ? ? ? ? ? ? 2.516 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 224 A . ? GLU 224 A PRO 225 A ? PRO 225 A 1 17.59  
2 GLY 357 A . ? GLY 357 A PRO 358 A ? PRO 358 A 1 -11.99 
3 LEU 571 A . ? LEU 571 A PRO 572 A ? PRO 572 A 1 5.67   
4 TYR 232 B . ? TYR 226 C PRO 233 B ? PRO 227 C 1 -6.46  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 9 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 3 ? 
AB9 ? 5 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 4 ? 
AC5 ? 2 ? 
AC6 ? 3 ? 
AC7 ? 4 ? 
AC8 ? 6 ? 
AC9 ? 5 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
AA3 8 9 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? parallel      
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 1004 ? HIS A 1009 ? VAL A 1004 HIS A 1009 
AA1 2 GLN A 1025 ? THR A 1032 ? GLN A 1025 THR A 1032 
AA1 3 ILE A 1037 ? SER A 1042 ? ILE A 1037 SER A 1042 
AA1 4 ASN A 4    ? GLN A 10   ? ASN A 4    GLN A 10   
AA1 5 PHE A 1088 ? ASP A 1090 ? PHE A 1088 ASP A 1090 
AA2 1 GLY A 17   ? GLY A 21   ? GLY A 17   GLY A 21   
AA2 2 ASN A 30   ? LYS A 35   ? ASN A 30   LYS A 35   
AA2 3 ARG A 38   ? VAL A 44   ? ARG A 38   VAL A 44   
AA2 4 LEU A 49   ? GLY A 56   ? LEU A 49   GLY A 56   
AA2 5 VAL D 34   ? TYR D 35   ? VAL E 34   TYR E 35   
AA3 1 ILE A 61   ? PHE A 67   ? ILE A 61   PHE A 67   
AA3 2 LEU A 76   ? THR A 81   ? LEU A 76   THR A 81   
AA3 3 ASN A 85   ? SER A 94   ? ASN A 85   SER A 94   
AA3 4 SER A 97   ? ASN A 107  ? SER A 97   ASN A 107  
AA3 5 GLN D 45   ? THR D 49   ? GLN E 45   THR E 49   
AA3 6 GLU A 151  ? ARG A 158  ? GLU A 151  ARG A 158  
AA3 7 LEU A 139  ? PRO A 144  ? LEU A 139  PRO A 144  
AA3 8 MET A 130  ? TYR A 136  ? MET A 130  TYR A 136  
AA3 9 ILE A 121  ? ILE A 124  ? ILE A 121  ILE A 124  
AA4 1 VAL A 164  ? PHE A 169  ? VAL A 164  PHE A 169  
AA4 2 THR A 177  ? ASP A 184  ? THR A 177  ASP A 184  
AA4 3 GLY A 187  ? SER A 196  ? GLY A 187  SER A 196  
AA4 4 GLU A 201  ? LYS A 204  ? GLU A 201  LYS A 204  
AA5 1 VAL A 164  ? PHE A 169  ? VAL A 164  PHE A 169  
AA5 2 THR A 177  ? ASP A 184  ? THR A 177  ASP A 184  
AA5 3 GLY A 187  ? SER A 196  ? GLY A 187  SER A 196  
AA5 4 GLU A 210  ? ASN A 211  ? GLU A 210  ASN A 211  
AA6 1 MET A 218  ? ALA A 221  ? MET A 218  ALA A 221  
AA6 2 ALA A 229  ? ILE A 232  ? ALA A 229  ILE A 232  
AA6 3 ILE A 237  ? HIS A 240  ? ILE A 237  HIS A 240  
AA6 4 TYR A 245  ? ILE A 248  ? TYR A 245  ILE A 248  
AA7 1 ILE A 258  ? ARG A 263  ? ILE A 258  ARG A 263  
AA7 2 ARG A 270  ? ASP A 275  ? ARG A 270  ASP A 275  
AA7 3 ARG A 279  ? GLU A 289  ? ARG A 279  GLU A 289  
AA7 4 VAL A 295  ? GLU A 307  ? VAL A 295  GLU A 307  
AA8 1 CYS A 313  ? TYR A 316  ? CYS A 313  TYR A 316  
AA8 2 VAL A 321  ? GLY A 325  ? VAL A 321  GLY A 325  
AA8 3 SER A 331  ? LEU A 336  ? SER A 331  LEU A 336  
AA8 4 VAL A 347  ? PHE A 353  ? VAL A 347  PHE A 353  
AA9 1 ILE A 359  ? VAL A 365  ? ILE A 359  VAL A 365  
AA9 2 GLN A 374  ? SER A 379  ? GLN A 374  SER A 379  
AA9 3 SER A 386  ? ASN A 392  ? SER A 386  ASN A 392  
AA9 4 LEU A 710  ? PRO A 716  ? LEU A 710  PRO A 716  
AB1 1 ILE A 396  ? ASP A 403  ? ILE A 396  ASP A 403  
AB1 2 THR A 698  ? ILE A 704  ? THR A 698  ILE A 704  
AB1 3 SER A 690  ? ALA A 694  ? SER A 690  ALA A 694  
AB1 4 TYR A 678  ? LEU A 682  ? TYR A 678  LEU A 682  
AB2 1 GLY A 409  ? LEU A 413  ? GLY A 409  LEU A 413  
AB2 2 THR A 424  ? SER A 428  ? THR A 424  SER A 428  
AB2 3 THR A 433  ? MET A 437  ? THR A 433  MET A 437  
AB2 4 GLU A 445  ? THR A 446  ? GLU A 445  THR A 446  
AB3 1 THR A 457  ? VAL A 463  ? THR A 457  VAL A 463  
AB3 2 GLN A 467  ? THR A 472  ? GLN A 467  THR A 472  
AB3 3 VAL A 476  ? VAL A 479  ? VAL A 476  VAL A 479  
AB3 4 LEU A 486  ? TRP A 490  ? LEU A 486  TRP A 490  
AB4 1 VAL A 500  ? CYS A 503  ? VAL A 500  CYS A 503  
AB4 2 GLN A 507  ? VAL A 512  ? GLN A 507  VAL A 512  
AB4 3 ALA A 515  ? HIS A 522  ? ALA A 515  HIS A 522  
AB4 4 GLU A 525  ? GLU A 533  ? GLU A 525  GLU A 533  
AB5 1 VAL A 538  ? ASP A 542  ? VAL A 538  ASP A 542  
AB5 2 LEU A 555  ? LEU A 560  ? LEU A 555  LEU A 560  
AB5 3 SER A 565  ? LYS A 570  ? SER A 565  LYS A 570  
AB5 4 LEU A 576  ? MET A 581  ? LEU A 576  MET A 581  
AB6 1 PRO A 588  ? THR A 595  ? PRO A 588  THR A 595  
AB6 2 HIS A 600  ? LEU A 606  ? HIS A 600  LEU A 606  
AB6 3 ALA A 610  ? LEU A 616  ? ALA A 610  LEU A 616  
AB6 4 LEU A 623  ? THR A 630  ? LEU A 623  THR A 630  
AB7 1 VAL A 637  ? SER A 643  ? VAL A 637  SER A 643  
AB7 2 THR A 646  ? CYS A 652  ? THR A 646  CYS A 652  
AB7 3 THR A 657  ? SER A 662  ? THR A 657  SER A 662  
AB7 4 LYS A 665  ? ASN A 670  ? LYS A 665  ASN A 670  
AB8 1 SER A 720  ? GLN A 727  ? SER A 720  GLN A 727  
AB8 2 CYS A 732  ? VAL A 742  ? CYS A 732  VAL A 742  
AB8 3 THR A 750  ? ALA A 751  ? THR A 750  ALA A 751  
AB9 1 SER A 720  ? GLN A 727  ? SER A 720  GLN A 727  
AB9 2 CYS A 732  ? VAL A 742  ? CYS A 732  VAL A 742  
AB9 3 GLU A 785  ? ASP A 795  ? GLU A 785  ASP A 795  
AB9 4 VAL A 801  ? GLN A 806  ? VAL A 801  GLN A 806  
AB9 5 SER A 762  ? VAL A 765  ? SER A 762  VAL A 765  
AC1 1 GLU A 811  ? CYS A 819  ? GLU A 811  CYS A 819  
AC1 2 TYR A 828  ? MET A 835  ? TYR A 828  MET A 835  
AC1 3 GLY A 846  ? SER A 854  ? GLY A 846  SER A 854  
AC1 4 LYS A 857  ? VAL A 866  ? LYS A 857  VAL A 866  
AC2 1 VAL A 870  ? PHE A 876  ? VAL A 870  PHE A 876  
AC2 2 LYS A 879  ? ILE A 884  ? LYS A 879  ILE A 884  
AC2 3 THR A 887  ? TRP A 893  ? THR A 887  TRP A 893  
AC2 4 LEU A 899  ? HIS A 905  ? LEU A 899  HIS A 905  
AC3 1 ALA A 911  ? LYS A 917  ? ALA A 911  LYS A 917  
AC3 2 PHE A 920  ? ASP A 925  ? PHE A 920  ASP A 925  
AC3 3 VAL A 930  ? LYS A 936  ? VAL A 930  LYS A 936  
AC3 4 ASN A 941  ? ARG A 947  ? ASN A 941  ARG A 947  
AC4 1 MET A 954  ? ASP A 961  ? MET A 954  ASP A 961  
AC4 2 ASN A 964  ? GLU A 969  ? ASN A 964  GLU A 969  
AC4 3 ASN A 973  ? LYS A 979  ? ASN A 973  LYS A 979  
AC4 4 LEU A 992  ? HIS A 999  ? LEU A 992  HIS A 999  
AC5 1 PHE A 1076 ? HIS A 1077 ? PHE A 1076 HIS A 1077 
AC5 2 THR A 1082 ? GLU A 1083 ? THR A 1082 GLU A 1083 
AC6 1 VAL B 67   ? SER B 70   ? VAL C 61   SER C 64   
AC6 2 THR B 494  ? VAL B 497  ? THR C 596  VAL C 599  
AC6 3 VAL B 486  ? ALA B 488  ? VAL C 588  ALA C 590  
AC7 1 ILE B 85   ? PHE B 89   ? ILE C 79   PHE C 83   
AC7 2 TYR B 95   ? SER B 102  ? TYR C 89   SER C 96   
AC7 3 ILE B 112  ? ASN B 121  ? ILE C 106  ASN C 115  
AC7 4 SER B 124  ? LEU B 134  ? SER C 118  LEU C 128  
AC8 1 PHE B 315  ? THR B 318  ? PHE C 417  THR C 420  
AC8 2 MET B 223  ? VAL B 231  ? MET C 217  VAL C 225  
AC8 3 HIS B 183  ? ALA B 192  ? HIS C 177  ALA C 186  
AC8 4 LYS B 157  ? ASN B 164  ? LYS C 151  ASN C 158  
AC8 5 TYR B 145  ? GLU B 150  ? TYR C 139  GLU C 144  
AC8 6 ASN B 471  ? MET B 473  ? ASN C 573  MET C 575  
AC9 1 VAL B 248  ? ASN B 252  ? VAL C 242  ASN C 246  
AC9 2 SER B 256  ? HIS B 265  ? SER C 250  HIS C 259  
AC9 3 TYR B 338  ? ASP B 347  ? TYR C 440  ASP C 449  
AC9 4 LEU B 290  ? VAL B 293  ? LEU C 392  VAL C 395  
AC9 5 ARG B 326  ? PRO B 327  ? ARG C 428  PRO C 429  
AD1 1 PHE B 366  ? CYS B 380  ? PHE C 468  CYS C 482  
AD1 2 GLN B 385  ? ALA B 396  ? GLN C 487  ALA C 498  
AD1 3 LYS B 409  ? ASP B 420  ? LYS C 511  ASP C 522  
AD1 4 PHE B 426  ? VAL B 431  ? PHE C 528  VAL C 533  
AD2 1 PHE B 366  ? CYS B 380  ? PHE C 468  CYS C 482  
AD2 2 GLN B 385  ? ALA B 396  ? GLN C 487  ALA C 498  
AD2 3 LYS B 409  ? ASP B 420  ? LYS C 511  ASP C 522  
AD2 4 THR B 435  ? GLU B 436  ? THR C 537  GLU C 538  
AD3 1 ILE C 46   ? MET C 53   ? ILE D 276  MET D 283  
AD3 2 SER C 60   ? PHE C 68   ? SER D 290  PHE D 298  
AD3 3 MET C 20   ? GLY C 25   ? MET D 250  GLY D 255  
AD3 4 ARG C 89   ? HIS C 95   ? ARG D 319  HIS D 325  
AD3 5 PHE C 84   ? LEU C 86   ? PHE D 314  LEU D 316  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 1005 ? N ASN A 1005 O GLY A 1031 ? O GLY A 1031 
AA1 2 3 N VAL A 1028 ? N VAL A 1028 O VAL A 1040 ? O VAL A 1040 
AA1 3 4 O ILE A 1037 ? O ILE A 1037 N ALA A 9    ? N ALA A 9    
AA1 4 5 N VAL A 6    ? N VAL A 6    O ILE A 1089 ? O ILE A 1089 
AA2 1 2 N GLY A 17   ? N GLY A 17   O ALA A 34   ? O ALA A 34   
AA2 2 3 N LEU A 31   ? N LEU A 31   O TYR A 42   ? O TYR A 42   
AA2 3 4 N VAL A 43   ? N VAL A 43   O ARG A 50   ? O ARG A 50   
AA2 4 5 N GLU A 54   ? N GLU A 54   O TYR D 35   ? O TYR E 35   
AA3 1 2 N PHE A 67   ? N PHE A 67   O LEU A 76   ? O LEU A 76   
AA3 2 3 N LEU A 77   ? N LEU A 77   O LEU A 89   ? O LEU A 89   
AA3 3 4 N GLU A 90   ? N GLU A 90   O ILE A 101  ? O ILE A 101  
AA3 4 5 N HIS A 105  ? N HIS A 105  O ILE D 47   ? O ILE E 47   
AA3 5 6 O VAL D 48   ? O VAL E 48   N ALA A 154  ? N ALA A 154  
AA3 6 7 O PHE A 155  ? O PHE A 155  N VAL A 142  ? N VAL A 142  
AA3 7 8 O ILE A 143  ? O ILE A 143  N ILE A 131  ? N ILE A 131  
AA3 8 9 O GLY A 132  ? O GLY A 132  N ILE A 123  ? N ILE A 123  
AA4 1 2 N ILE A 165  ? N ILE A 165  O VAL A 181  ? O VAL A 181  
AA4 2 3 N ASP A 184  ? N ASP A 184  O GLY A 187  ? O GLY A 187  
AA4 3 4 N GLU A 194  ? N GLU A 194  O ASN A 203  ? O ASN A 203  
AA5 1 2 N ILE A 165  ? N ILE A 165  O VAL A 181  ? O VAL A 181  
AA5 2 3 N ASP A 184  ? N ASP A 184  O GLY A 187  ? O GLY A 187  
AA5 3 4 N VAL A 190  ? N VAL A 190  O GLU A 210  ? O GLU A 210  
AA6 1 2 N ILE A 220  ? N ILE A 220  O ILE A 230  ? O ILE A 230  
AA6 2 3 N ILE A 231  ? N ILE A 231  O THR A 238  ? O THR A 238  
AA6 3 4 N TYR A 239  ? N TYR A 239  O LEU A 246  ? O LEU A 246  
AA7 1 2 N VAL A 259  ? N VAL A 259  O GLY A 274  ? O GLY A 274  
AA7 2 3 N TYR A 271  ? N TYR A 271  O LEU A 283  ? O LEU A 283  
AA7 3 4 N GLU A 286  ? N GLU A 286  O LYS A 298  ? O LYS A 298  
AA8 1 2 N THR A 315  ? N THR A 315  O PHE A 323  ? O PHE A 323  
AA8 2 3 N VAL A 322  ? N VAL A 322  O VAL A 334  ? O VAL A 334  
AA8 3 4 N SER A 331  ? N SER A 331  O PHE A 353  ? O PHE A 353  
AA9 1 2 N VAL A 365  ? N VAL A 365  O GLN A 374  ? O GLN A 374  
AA9 2 3 N LEU A 375  ? N LEU A 375  O ILE A 390  ? O ILE A 390  
AA9 3 4 N ARG A 391  ? N ARG A 391  O HIS A 711  ? O HIS A 711  
AB1 1 2 N HIS A 397  ? N HIS A 397  O THR A 703  ? O THR A 703  
AB1 2 3 O THR A 700  ? O THR A 700  N LEU A 693  ? N LEU A 693  
AB1 3 4 O SER A 690  ? O SER A 690  N LEU A 682  ? N LEU A 682  
AB2 1 2 N TRP A 411  ? N TRP A 411  O VAL A 426  ? O VAL A 426  
AB2 2 3 N LEU A 427  ? N LEU A 427  O ARG A 434  ? O ARG A 434  
AB2 3 4 N VAL A 435  ? N VAL A 435  O THR A 446  ? O THR A 446  
AB3 1 2 N PHE A 458  ? N PHE A 458  O ILE A 471  ? O ILE A 471  
AB3 2 3 N LEU A 468  ? N LEU A 468  O VAL A 479  ? O VAL A 479  
AB3 3 4 N LEU A 478  ? N LEU A 478  O VAL A 487  ? O VAL A 487  
AB4 1 2 N VAL A 500  ? N VAL A 500  O ALA A 511  ? O ALA A 511  
AB4 2 3 N VAL A 508  ? N VAL A 508  O LEU A 519  ? O LEU A 519  
AB4 3 4 N LEU A 516  ? N LEU A 516  O THR A 532  ? O THR A 532  
AB5 1 2 N ALA A 539  ? N ALA A 539  O GLY A 559  ? O GLY A 559  
AB5 2 3 N ILE A 558  ? N ILE A 558  O ARG A 567  ? O ARG A 567  
AB5 3 4 N ILE A 568  ? N ILE A 568  O LEU A 577  ? O LEU A 577  
AB6 1 2 N ARG A 589  ? N ARG A 589  O ALA A 605  ? O ALA A 605  
AB6 2 3 N CYS A 604  ? N CYS A 604  O PHE A 612  ? O PHE A 612  
AB6 3 4 N GLY A 615  ? N GLY A 615  O SER A 624  ? O SER A 624  
AB7 1 2 N ARG A 639  ? N ARG A 639  O PHE A 650  ? O PHE A 650  
AB7 2 3 N ALA A 651  ? N ALA A 651  O THR A 657  ? O THR A 657  
AB7 3 4 N TYR A 660  ? N TYR A 660  O VAL A 667  ? O VAL A 667  
AB8 1 2 N ARG A 722  ? N ARG A 722  O LEU A 736  ? O LEU A 736  
AB8 2 3 N VAL A 742  ? N VAL A 742  O THR A 750  ? O THR A 750  
AB9 1 2 N ARG A 722  ? N ARG A 722  O LEU A 736  ? O LEU A 736  
AB9 2 3 N VAL A 735  ? N VAL A 735  O LEU A 792  ? O LEU A 792  
AB9 3 4 N ILE A 793  ? N ILE A 793  O HIS A 803  ? O HIS A 803  
AB9 4 5 O GLN A 806  ? O GLN A 806  N SER A 764  ? N SER A 764  
AC1 1 2 N VAL A 817  ? N VAL A 817  O ILE A 830  ? O ILE A 830  
AC1 2 3 N PHE A 829  ? N PHE A 829  O PHE A 851  ? O PHE A 851  
AC1 3 4 N VAL A 850  ? N VAL A 850  O VAL A 861  ? O VAL A 861  
AC2 1 2 N PHE A 876  ? N PHE A 876  O LYS A 879  ? O LYS A 879  
AC2 2 3 N ALA A 882  ? N ALA A 882  O ARG A 889  ? O ARG A 889  
AC2 3 4 N LEU A 890  ? N LEU A 890  O GLU A 902  ? O GLU A 902  
AC3 1 2 N LYS A 915  ? N LYS A 915  O LEU A 922  ? O LEU A 922  
AC3 2 3 N ILE A 921  ? N ILE A 921  O LEU A 933  ? O LEU A 933  
AC3 3 4 N LEU A 932  ? N LEU A 932  O ALA A 946  ? O ALA A 946  
AC4 1 2 N SER A 955  ? N SER A 955  O ALA A 968  ? O ALA A 968  
AC4 2 3 N GLY A 967  ? N GLY A 967  O PHE A 975  ? O PHE A 975  
AC4 3 4 N LEU A 974  ? N LEU A 974  O PHE A 998  ? O PHE A 998  
AC5 1 2 N PHE A 1076 ? N PHE A 1076 O GLU A 1083 ? O GLU A 1083 
AC6 1 2 N VAL B 69   ? N VAL C 63   O VAL B 497  ? O VAL C 599  
AC6 2 3 O ILE B 496  ? O ILE C 598  N LEU B 487  ? N LEU C 589  
AC7 1 2 N LEU B 87   ? N LEU C 81   O LEU B 97   ? O LEU C 91   
AC7 2 3 N VAL B 96   ? N VAL C 90   O TRP B 118  ? O TRP C 112  
AC7 3 4 N TYR B 113  ? N TYR C 107  O LEU B 134  ? O LEU C 128  
AC8 1 2 O VAL B 316  ? O VAL C 418  N HIS B 225  ? N HIS C 219  
AC8 2 3 O LEU B 224  ? O LEU C 218  N THR B 190  ? N THR C 184  
AC8 3 4 O TYR B 187  ? O TYR C 181  N GLY B 162  ? N GLY C 156  
AC8 4 5 O ILE B 159  ? O ILE C 153  N CYS B 149  ? N CYS C 143  
AC8 5 6 N VAL B 148  ? N VAL C 142  O MET B 473  ? O MET C 575  
AC9 1 2 N LEU B 251  ? N LEU C 245  O VAL B 258  ? O VAL C 252  
AC9 2 3 N ALA B 259  ? N ALA C 253  O LEU B 344  ? O LEU C 446  
AC9 3 4 O VAL B 341  ? O VAL C 443  N LEU B 290  ? N LEU C 392  
AC9 4 5 N VAL B 293  ? N VAL C 395  O ARG B 326  ? O ARG C 428  
AD1 1 2 N SER B 370  ? N SER C 472  O LEU B 393  ? O LEU C 495  
AD1 2 3 N ILE B 390  ? N ILE C 492  O LEU B 415  ? O LEU C 517  
AD1 3 4 N LYS B 416  ? N LYS C 518  O SER B 430  ? O SER C 532  
AD2 1 2 N SER B 370  ? N SER C 472  O LEU B 393  ? O LEU C 495  
AD2 2 3 N ILE B 390  ? N ILE C 492  O LEU B 415  ? O LEU C 517  
AD2 3 4 N HIS B 412  ? N HIS C 514  O THR B 435  ? O THR C 537  
AD3 1 2 N MET C 52   ? N MET D 282  O LYS C 61   ? O LYS D 291  
AD3 2 3 O GLY C 64   ? O GLY D 294  N VAL C 24   ? N VAL D 254  
AD3 3 4 N TYR C 23   ? N TYR D 253  O GLY C 94   ? O GLY D 324  
AD3 4 5 O MET C 91   ? O MET D 321  N PHE C 84   ? N PHE D 314  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EPE 1301 ? 8  'binding site for residue EPE A 1301' 
AC2 Software A EPE 1302 ? 5  'binding site for residue EPE A 1302' 
AC3 Software C O6M 901  ? 13 'binding site for residue O6M C 901'  
AC4 Software C ZN  902  ? 4  'binding site for residue ZN C 902'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLY A 17  ? GLY A 17   . ? 1_555 ? 
2  AC1 8  CYS A 18  ? CYS A 18   . ? 1_555 ? 
3  AC1 8  GLU A 65  ? GLU A 65   . ? 1_555 ? 
4  AC1 8  HIS A 261 ? HIS A 261  . ? 1_555 ? 
5  AC1 8  ASN A 262 ? ASN A 262  . ? 1_555 ? 
6  AC1 8  ARG A 263 ? ARG A 263  . ? 1_555 ? 
7  AC1 8  TYR A 271 ? TYR A 271  . ? 1_555 ? 
8  AC1 8  EPE F .   ? EPE A 1302 . ? 1_555 ? 
9  AC2 5  CYS A 260 ? CYS A 260  . ? 1_555 ? 
10 AC2 5  HIS A 261 ? HIS A 261  . ? 1_555 ? 
11 AC2 5  GLU A 312 ? GLU A 312  . ? 1_555 ? 
12 AC2 5  ARG A 327 ? ARG A 327  . ? 1_555 ? 
13 AC2 5  EPE E .   ? EPE A 1301 . ? 1_555 ? 
14 AC3 13 THR B 236 ? THR C 230  . ? 1_555 ? 
15 AC3 13 PHE B 237 ? PHE C 231  . ? 1_555 ? 
16 AC3 13 GLN B 238 ? GLN C 232  . ? 1_555 ? 
17 AC3 13 PRO B 239 ? PRO C 233  . ? 1_555 ? 
18 AC3 13 ALA B 240 ? ALA C 234  . ? 1_555 ? 
19 AC3 13 PHE B 241 ? PHE C 235  . ? 1_555 ? 
20 AC3 13 VAL B 375 ? VAL C 477  . ? 1_555 ? 
21 AC3 13 ARG B 450 ? ARG C 552  . ? 1_555 ? 
22 AC3 13 CYS B 453 ? CYS C 555  . ? 1_555 ? 
23 AC3 13 VAL B 454 ? VAL C 556  . ? 1_555 ? 
24 AC3 13 LEU B 461 ? LEU C 563  . ? 1_555 ? 
25 AC3 13 ASP C 34  ? ASP D 264  . ? 1_555 ? 
26 AC3 13 MET C 35  ? MET D 265  . ? 1_555 ? 
27 AC4 4  CYS B 199 ? CYS C 193  . ? 1_555 ? 
28 AC4 4  CYS B 202 ? CYS C 196  . ? 1_555 ? 
29 AC4 4  CYS B 217 ? CYS C 211  . ? 1_555 ? 
30 AC4 4  HIS B 220 ? HIS C 214  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6PAI 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.012269 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001737 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010552 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006932 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 2    ? 48.135  27.104  21.041  1.00 88.60  ? 2    SER A N   1 
ATOM   2     C  CA  . SER A 1 2    ? 48.138  28.542  21.455  1.00 91.64  ? 2    SER A CA  1 
ATOM   3     C  C   . SER A 1 2    ? 46.899  29.265  20.930  1.00 91.44  ? 2    SER A C   1 
ATOM   4     O  O   . SER A 1 2    ? 46.286  30.044  21.654  1.00 92.26  ? 2    SER A O   1 
ATOM   5     C  CB  . SER A 1 2    ? 49.411  29.238  21.023  1.00 95.75  ? 2    SER A CB  1 
ATOM   6     O  OG  . SER A 1 2    ? 49.830  28.805  19.736  1.00 98.02  ? 2    SER A OG  1 
ATOM   7     N  N   . TYR A 1 3    ? 46.574  29.016  19.656  1.00 91.37  ? 3    TYR A N   1 
ATOM   8     C  CA  . TYR A 1 3    ? 45.402  29.568  18.996  1.00 90.55  ? 3    TYR A CA  1 
ATOM   9     C  C   . TYR A 1 3    ? 44.601  28.413  18.411  1.00 87.62  ? 3    TYR A C   1 
ATOM   10    O  O   . TYR A 1 3    ? 44.993  27.813  17.414  1.00 87.45  ? 3    TYR A O   1 
ATOM   11    C  CB  . TYR A 1 3    ? 45.807  30.572  17.912  1.00 93.78  ? 3    TYR A CB  1 
ATOM   12    C  CG  . TYR A 1 3    ? 46.546  31.781  18.427  1.00 95.72  ? 3    TYR A CG  1 
ATOM   13    C  CD1 . TYR A 1 3    ? 45.906  32.722  19.219  1.00 95.05  ? 3    TYR A CD1 1 
ATOM   14    C  CD2 . TYR A 1 3    ? 47.887  31.976  18.132  1.00 97.73  ? 3    TYR A CD2 1 
ATOM   15    C  CE1 . TYR A 1 3    ? 46.577  33.832  19.702  1.00 97.13  ? 3    TYR A CE1 1 
ATOM   16    C  CE2 . TYR A 1 3    ? 48.574  33.079  18.610  1.00 99.45  ? 3    TYR A CE2 1 
ATOM   17    C  CZ  . TYR A 1 3    ? 47.913  34.011  19.393  1.00 99.15  ? 3    TYR A CZ  1 
ATOM   18    O  OH  . TYR A 1 3    ? 48.556  35.108  19.879  1.00 101.16 ? 3    TYR A OH  1 
ATOM   19    N  N   . ASN A 1 4    ? 43.477  28.102  19.052  1.00 85.47  ? 4    ASN A N   1 
ATOM   20    C  CA  . ASN A 1 4    ? 42.766  26.892  18.686  1.00 84.17  ? 4    ASN A CA  1 
ATOM   21    C  C   . ASN A 1 4    ? 41.370  27.208  18.156  1.00 83.26  ? 4    ASN A C   1 
ATOM   22    O  O   . ASN A 1 4    ? 40.797  28.255  18.446  1.00 82.86  ? 4    ASN A O   1 
ATOM   23    C  CB  . ASN A 1 4    ? 42.837  25.836  19.791  1.00 81.85  ? 4    ASN A CB  1 
ATOM   24    C  CG  . ASN A 1 4    ? 44.242  25.306  19.954  1.00 82.97  ? 4    ASN A CG  1 
ATOM   25    O  OD1 . ASN A 1 4    ? 44.708  24.513  19.137  1.00 83.43  ? 4    ASN A OD1 1 
ATOM   26    N  ND2 . ASN A 1 4    ? 44.929  25.769  20.985  1.00 83.93  ? 4    ASN A ND2 1 
ATOM   27    N  N   . TYR A 1 5    ? 40.857  26.257  17.370  1.00 82.84  ? 5    TYR A N   1 
ATOM   28    C  CA  . TYR A 1 5    ? 39.572  26.328  16.696  1.00 82.86  ? 5    TYR A CA  1 
ATOM   29    C  C   . TYR A 1 5    ? 38.834  25.004  16.915  1.00 79.53  ? 5    TYR A C   1 
ATOM   30    O  O   . TYR A 1 5    ? 39.381  23.938  16.640  1.00 78.38  ? 5    TYR A O   1 
ATOM   31    C  CB  . TYR A 1 5    ? 39.831  26.656  15.224  1.00 86.04  ? 5    TYR A CB  1 
ATOM   32    C  CG  . TYR A 1 5    ? 38.621  26.732  14.329  1.00 86.74  ? 5    TYR A CG  1 
ATOM   33    C  CD1 . TYR A 1 5    ? 38.081  25.584  13.774  1.00 85.71  ? 5    TYR A CD1 1 
ATOM   34    C  CD2 . TYR A 1 5    ? 38.037  27.948  14.002  1.00 88.84  ? 5    TYR A CD2 1 
ATOM   35    C  CE1 . TYR A 1 5    ? 36.974  25.637  12.943  1.00 86.85  ? 5    TYR A CE1 1 
ATOM   36    C  CE2 . TYR A 1 5    ? 36.934  28.020  13.162  1.00 89.36  ? 5    TYR A CE2 1 
ATOM   37    C  CZ  . TYR A 1 5    ? 36.401  26.857  12.629  1.00 88.41  ? 5    TYR A CZ  1 
ATOM   38    O  OH  . TYR A 1 5    ? 35.313  26.872  11.803  1.00 88.72  ? 5    TYR A OH  1 
ATOM   39    N  N   . VAL A 1 6    ? 37.601  25.084  17.436  1.00 77.75  ? 6    VAL A N   1 
ATOM   40    C  CA  . VAL A 1 6    ? 36.833  23.916  17.842  1.00 75.57  ? 6    VAL A CA  1 
ATOM   41    C  C   . VAL A 1 6    ? 35.521  23.905  17.070  1.00 76.10  ? 6    VAL A C   1 
ATOM   42    O  O   . VAL A 1 6    ? 34.767  24.868  17.141  1.00 78.16  ? 6    VAL A O   1 
ATOM   43    C  CB  . VAL A 1 6    ? 36.534  23.930  19.354  1.00 73.22  ? 6    VAL A CB  1 
ATOM   44    C  CG1 . VAL A 1 6    ? 35.833  22.661  19.803  1.00 70.45  ? 6    VAL A CG1 1 
ATOM   45    C  CG2 . VAL A 1 6    ? 37.780  24.163  20.186  1.00 74.70  ? 6    VAL A CG2 1 
ATOM   46    N  N   . VAL A 1 7    ? 35.231  22.792  16.390  1.00 75.58  ? 7    VAL A N   1 
ATOM   47    C  CA  . VAL A 1 7    ? 33.997  22.670  15.630  1.00 75.70  ? 7    VAL A CA  1 
ATOM   48    C  C   . VAL A 1 7    ? 33.369  21.305  15.891  1.00 73.38  ? 7    VAL A C   1 
ATOM   49    O  O   . VAL A 1 7    ? 34.057  20.351  16.240  1.00 72.68  ? 7    VAL A O   1 
ATOM   50    C  CB  . VAL A 1 7    ? 34.233  22.920  14.126  1.00 78.42  ? 7    VAL A CB  1 
ATOM   51    C  CG1 . VAL A 1 7    ? 35.355  22.063  13.558  1.00 78.86  ? 7    VAL A CG1 1 
ATOM   52    C  CG2 . VAL A 1 7    ? 32.963  22.770  13.301  1.00 78.42  ? 7    VAL A CG2 1 
ATOM   53    N  N   . THR A 1 8    ? 32.047  21.239  15.716  1.00 73.22  ? 8    THR A N   1 
ATOM   54    C  CA  . THR A 1 8    ? 31.292  20.006  15.858  1.00 71.12  ? 8    THR A CA  1 
ATOM   55    C  C   . THR A 1 8    ? 31.382  19.215  14.555  1.00 72.70  ? 8    THR A C   1 
ATOM   56    O  O   . THR A 1 8    ? 31.115  19.753  13.483  1.00 75.42  ? 8    THR A O   1 
ATOM   57    C  CB  . THR A 1 8    ? 29.859  20.310  16.319  1.00 69.20  ? 8    THR A CB  1 
ATOM   58    O  OG1 . THR A 1 8    ? 29.993  21.104  17.496  1.00 68.45  ? 8    THR A OG1 1 
ATOM   59    C  CG2 . THR A 1 8    ? 29.046  19.079  16.651  1.00 66.69  ? 8    THR A CG2 1 
ATOM   60    N  N   . ALA A 1 9    ? 31.776  17.940  14.664  1.00 71.97  ? 9    ALA A N   1 
ATOM   61    C  CA  . ALA A 1 9    ? 31.743  17.008  13.546  1.00 73.11  ? 9    ALA A CA  1 
ATOM   62    C  C   . ALA A 1 9    ? 30.496  16.126  13.624  1.00 72.61  ? 9    ALA A C   1 
ATOM   63    O  O   . ALA A 1 9    ? 30.009  15.648  12.604  1.00 73.98  ? 9    ALA A O   1 
ATOM   64    C  CB  . ALA A 1 9    ? 33.004  16.184  13.516  1.00 72.19  ? 9    ALA A CB  1 
ATOM   65    N  N   . GLN A 1 10   ? 30.005  15.890  14.843  1.00 71.45  ? 10   GLN A N   1 
ATOM   66    C  CA  . GLN A 1 10   ? 28.764  15.169  15.051  1.00 71.55  ? 10   GLN A CA  1 
ATOM   67    C  C   . GLN A 1 10   ? 28.091  15.767  16.277  1.00 70.48  ? 10   GLN A C   1 
ATOM   68    O  O   . GLN A 1 10   ? 28.714  15.847  17.330  1.00 70.07  ? 10   GLN A O   1 
ATOM   69    C  CB  . GLN A 1 10   ? 29.037  13.672  15.221  1.00 72.73  ? 10   GLN A CB  1 
ATOM   70    C  CG  . GLN A 1 10   ? 27.871  12.888  15.818  1.00 74.11  ? 10   GLN A CG  1 
ATOM   71    C  CD  . GLN A 1 10   ? 26.706  12.733  14.868  1.00 76.97  ? 10   GLN A CD  1 
ATOM   72    O  OE1 . GLN A 1 10   ? 26.863  12.289  13.731  1.00 80.37  ? 10   GLN A OE1 1 
ATOM   73    N  NE2 . GLN A 1 10   ? 25.520  13.098  15.332  1.00 75.59  ? 10   GLN A NE2 1 
ATOM   74    N  N   . LYS A 1 11   ? 26.834  16.202  16.119  1.00 71.33  ? 11   LYS A N   1 
ATOM   75    C  CA  . LYS A 1 11   ? 26.085  16.804  17.212  1.00 70.05  ? 11   LYS A CA  1 
ATOM   76    C  C   . LYS A 1 11   ? 25.825  15.734  18.267  1.00 68.15  ? 11   LYS A C   1 
ATOM   77    O  O   . LYS A 1 11   ? 25.840  14.547  17.954  1.00 65.82  ? 11   LYS A O   1 
ATOM   78    C  CB  . LYS A 1 11   ? 24.836  17.533  16.704  1.00 71.03  ? 11   LYS A CB  1 
ATOM   79    C  CG  . LYS A 1 11   ? 25.140  18.710  15.782  1.00 74.81  ? 11   LYS A CG  1 
ATOM   80    C  CD  . LYS A 1 11   ? 24.100  19.809  15.750  1.00 76.33  ? 11   LYS A CD  1 
ATOM   81    C  CE  . LYS A 1 11   ? 23.039  19.599  14.691  1.00 78.44  ? 11   LYS A CE  1 
ATOM   82    N  NZ  . LYS A 1 11   ? 22.175  20.797  14.571  1.00 81.22  ? 11   LYS A NZ  1 
ATOM   83    N  N   . PRO A 1 12   ? 25.655  16.110  19.556  1.00 69.25  ? 12   PRO A N   1 
ATOM   84    C  CA  . PRO A 1 12   ? 25.354  15.135  20.607  1.00 68.19  ? 12   PRO A CA  1 
ATOM   85    C  C   . PRO A 1 12   ? 24.135  14.299  20.224  1.00 67.39  ? 12   PRO A C   1 
ATOM   86    O  O   . PRO A 1 12   ? 23.207  14.801  19.593  1.00 69.33  ? 12   PRO A O   1 
ATOM   87    C  CB  . PRO A 1 12   ? 25.069  15.984  21.859  1.00 69.00  ? 12   PRO A CB  1 
ATOM   88    C  CG  . PRO A 1 12   ? 24.929  17.415  21.353  1.00 71.12  ? 12   PRO A CG  1 
ATOM   89    C  CD  . PRO A 1 12   ? 25.749  17.482  20.079  1.00 71.90  ? 12   PRO A CD  1 
ATOM   90    N  N   . THR A 1 13   ? 24.159  13.014  20.587  1.00 65.45  ? 13   THR A N   1 
ATOM   91    C  CA  . THR A 1 13   ? 23.134  12.075  20.150  1.00 64.15  ? 13   THR A CA  1 
ATOM   92    C  C   . THR A 1 13   ? 22.380  11.484  21.341  1.00 63.30  ? 13   THR A C   1 
ATOM   93    O  O   . THR A 1 13   ? 21.338  10.861  21.162  1.00 63.92  ? 13   THR A O   1 
ATOM   94    C  CB  . THR A 1 13   ? 23.713  10.954  19.271  1.00 63.87  ? 13   THR A CB  1 
ATOM   95    O  OG1 . THR A 1 13   ? 24.651  10.180  20.020  1.00 62.82  ? 13   THR A OG1 1 
ATOM   96    C  CG2 . THR A 1 13   ? 24.381  11.448  18.006  1.00 65.11  ? 13   THR A CG2 1 
ATOM   97    N  N   . ALA A 1 14   ? 22.925  11.643  22.553  1.00 63.80  ? 14   ALA A N   1 
ATOM   98    C  CA  . ALA A 1 14   ? 22.263  11.169  23.759  1.00 63.46  ? 14   ALA A CA  1 
ATOM   99    C  C   . ALA A 1 14   ? 21.052  12.055  24.051  1.00 65.26  ? 14   ALA A C   1 
ATOM   100   O  O   . ALA A 1 14   ? 21.112  13.271  23.859  1.00 68.69  ? 14   ALA A O   1 
ATOM   101   C  CB  . ALA A 1 14   ? 23.229  11.165  24.919  1.00 61.77  ? 14   ALA A CB  1 
ATOM   102   N  N   . VAL A 1 15   ? 19.956  11.432  24.508  1.00 63.24  ? 15   VAL A N   1 
ATOM   103   C  CA  . VAL A 1 15   ? 18.778  12.169  24.926  1.00 62.05  ? 15   VAL A CA  1 
ATOM   104   C  C   . VAL A 1 15   ? 18.831  12.378  26.435  1.00 61.22  ? 15   VAL A C   1 
ATOM   105   O  O   . VAL A 1 15   ? 18.949  11.423  27.196  1.00 60.77  ? 15   VAL A O   1 
ATOM   106   C  CB  . VAL A 1 15   ? 17.478  11.479  24.469  1.00 62.64  ? 15   VAL A CB  1 
ATOM   107   C  CG1 . VAL A 1 15   ? 16.238  12.217  24.954  1.00 62.22  ? 15   VAL A CG1 1 
ATOM   108   C  CG2 . VAL A 1 15   ? 17.434  11.336  22.955  1.00 63.30  ? 15   VAL A CG2 1 
ATOM   109   N  N   . ASN A 1 16   ? 18.725  13.645  26.842  1.00 63.08  ? 16   ASN A N   1 
ATOM   110   C  CA  . ASN A 1 16   ? 18.846  14.053  28.230  1.00 64.76  ? 16   ASN A CA  1 
ATOM   111   C  C   . ASN A 1 16   ? 17.449  14.269  28.815  1.00 66.25  ? 16   ASN A C   1 
ATOM   112   O  O   . ASN A 1 16   ? 17.229  14.085  30.010  1.00 67.64  ? 16   ASN A O   1 
ATOM   113   C  CB  . ASN A 1 16   ? 19.836  15.216  28.359  1.00 66.07  ? 16   ASN A CB  1 
ATOM   114   C  CG  . ASN A 1 16   ? 21.236  14.817  27.927  1.00 67.38  ? 16   ASN A CG  1 
ATOM   115   O  OD1 . ASN A 1 16   ? 21.738  15.250  26.887  1.00 68.76  ? 16   ASN A OD1 1 
ATOM   116   N  ND2 . ASN A 1 16   ? 21.868  13.953  28.704  1.00 67.19  ? 16   ASN A ND2 1 
ATOM   117   N  N   . GLY A 1 17   ? 16.496  14.622  27.946  1.00 67.22  ? 17   GLY A N   1 
ATOM   118   C  CA  . GLY A 1 17   ? 15.114  14.839  28.342  1.00 67.57  ? 17   GLY A CA  1 
ATOM   119   C  C   . GLY A 1 17   ? 14.199  14.919  27.124  1.00 68.46  ? 17   GLY A C   1 
ATOM   120   O  O   . GLY A 1 17   ? 14.653  15.265  26.035  1.00 69.87  ? 17   GLY A O   1 
ATOM   121   N  N   . CYS A 1 18   ? 12.924  14.562  27.323  1.00 68.30  ? 18   CYS A N   1 
ATOM   122   C  CA  . CYS A 1 18   ? 11.886  14.683  26.308  1.00 69.50  ? 18   CYS A CA  1 
ATOM   123   C  C   . CYS A 1 18   ? 10.561  15.032  26.979  1.00 69.31  ? 18   CYS A C   1 
ATOM   124   O  O   . CYS A 1 18   ? 10.265  14.547  28.073  1.00 69.86  ? 18   CYS A O   1 
ATOM   125   C  CB  . CYS A 1 18   ? 11.716  13.407  25.487  1.00 70.77  ? 18   CYS A CB  1 
ATOM   126   S  SG  . CYS A 1 18   ? 11.333  11.923  26.459  1.00 72.02  ? 18   CYS A SG  1 
ATOM   127   N  N   . VAL A 1 19   ? 9.774   15.879  26.312  1.00 68.78  ? 19   VAL A N   1 
ATOM   128   C  CA  . VAL A 1 19   ? 8.505   16.323  26.862  1.00 68.45  ? 19   VAL A CA  1 
ATOM   129   C  C   . VAL A 1 19   ? 7.479   16.446  25.741  1.00 68.70  ? 19   VAL A C   1 
ATOM   130   O  O   . VAL A 1 19   ? 7.814   16.703  24.586  1.00 67.73  ? 19   VAL A O   1 
ATOM   131   C  CB  . VAL A 1 19   ? 8.640   17.621  27.685  1.00 68.75  ? 19   VAL A CB  1 
ATOM   132   C  CG1 . VAL A 1 19   ? 8.803   18.848  26.804  1.00 70.49  ? 19   VAL A CG1 1 
ATOM   133   C  CG2 . VAL A 1 19   ? 7.474   17.818  28.643  1.00 70.00  ? 19   VAL A CG2 1 
ATOM   134   N  N   . THR A 1 20   ? 6.216   16.253  26.124  1.00 70.49  ? 20   THR A N   1 
ATOM   135   C  CA  . THR A 1 20   ? 5.109   16.250  25.186  1.00 72.06  ? 20   THR A CA  1 
ATOM   136   C  C   . THR A 1 20   ? 4.079   17.302  25.599  1.00 73.70  ? 20   THR A C   1 
ATOM   137   O  O   . THR A 1 20   ? 3.888   17.564  26.787  1.00 73.57  ? 20   THR A O   1 
ATOM   138   C  CB  . THR A 1 20   ? 4.547   14.832  25.036  1.00 71.42  ? 20   THR A CB  1 
ATOM   139   O  OG1 . THR A 1 20   ? 3.773   14.847  23.839  1.00 75.08  ? 20   THR A OG1 1 
ATOM   140   C  CG2 . THR A 1 20   ? 3.723   14.387  26.225  1.00 69.98  ? 20   THR A CG2 1 
ATOM   141   N  N   . GLY A 1 21   ? 3.435   17.916  24.598  1.00 74.92  ? 21   GLY A N   1 
ATOM   142   C  CA  . GLY A 1 21   ? 2.440   18.950  24.830  1.00 75.43  ? 21   GLY A CA  1 
ATOM   143   C  C   . GLY A 1 21   ? 2.090   19.676  23.537  1.00 77.67  ? 21   GLY A C   1 
ATOM   144   O  O   . GLY A 1 21   ? 2.483   19.247  22.457  1.00 78.01  ? 21   GLY A O   1 
ATOM   145   N  N   . HIS A 1 22   ? 1.339   20.774  23.665  1.00 79.78  ? 22   HIS A N   1 
ATOM   146   C  CA  . HIS A 1 22   ? 0.922   21.563  22.517  1.00 82.03  ? 22   HIS A CA  1 
ATOM   147   C  C   . HIS A 1 22   ? 1.643   22.903  22.550  1.00 81.97  ? 22   HIS A C   1 
ATOM   148   O  O   . HIS A 1 22   ? 1.223   23.827  23.250  1.00 82.13  ? 22   HIS A O   1 
ATOM   149   C  CB  . HIS A 1 22   ? -0.603  21.722  22.486  1.00 84.88  ? 22   HIS A CB  1 
ATOM   150   C  CG  . HIS A 1 22   ? -1.308  20.475  22.881  1.00 84.39  ? 22   HIS A CG  1 
ATOM   151   N  ND1 . HIS A 1 22   ? -1.636  19.499  21.968  1.00 85.05  ? 22   HIS A ND1 1 
ATOM   152   C  CD2 . HIS A 1 22   ? -1.696  20.024  24.092  1.00 83.85  ? 22   HIS A CD2 1 
ATOM   153   C  CE1 . HIS A 1 22   ? -2.222  18.500  22.597  1.00 85.42  ? 22   HIS A CE1 1 
ATOM   154   N  NE2 . HIS A 1 22   ? -2.268  18.799  23.905  1.00 84.35  ? 22   HIS A NE2 1 
ATOM   155   N  N   . PHE A 1 23   ? 2.719   22.991  21.763  1.00 80.87  ? 23   PHE A N   1 
ATOM   156   C  CA  . PHE A 1 23   ? 3.693   24.053  21.935  1.00 80.44  ? 23   PHE A CA  1 
ATOM   157   C  C   . PHE A 1 23   ? 3.729   24.965  20.711  1.00 82.30  ? 23   PHE A C   1 
ATOM   158   O  O   . PHE A 1 23   ? 3.800   26.186  20.852  1.00 83.33  ? 23   PHE A O   1 
ATOM   159   C  CB  . PHE A 1 23   ? 5.068   23.468  22.270  1.00 77.28  ? 23   PHE A CB  1 
ATOM   160   C  CG  . PHE A 1 23   ? 6.154   24.509  22.302  1.00 77.39  ? 23   PHE A CG  1 
ATOM   161   C  CD1 . PHE A 1 23   ? 6.256   25.384  23.373  1.00 77.36  ? 23   PHE A CD1 1 
ATOM   162   C  CD2 . PHE A 1 23   ? 7.036   24.649  21.240  1.00 77.50  ? 23   PHE A CD2 1 
ATOM   163   C  CE1 . PHE A 1 23   ? 7.233   26.367  23.389  1.00 77.93  ? 23   PHE A CE1 1 
ATOM   164   C  CE2 . PHE A 1 23   ? 8.016   25.629  21.259  1.00 77.68  ? 23   PHE A CE2 1 
ATOM   165   C  CZ  . PHE A 1 23   ? 8.113   26.484  22.334  1.00 78.14  ? 23   PHE A CZ  1 
ATOM   166   N  N   . THR A 1 24   ? 3.736   24.353  19.523  1.00 82.66  ? 24   THR A N   1 
ATOM   167   C  CA  . THR A 1 24   ? 3.729   25.097  18.276  1.00 85.38  ? 24   THR A CA  1 
ATOM   168   C  C   . THR A 1 24   ? 2.341   25.711  18.104  1.00 89.05  ? 24   THR A C   1 
ATOM   169   O  O   . THR A 1 24   ? 2.202   26.930  18.049  1.00 91.44  ? 24   THR A O   1 
ATOM   170   C  CB  . THR A 1 24   ? 4.217   24.211  17.123  1.00 84.67  ? 24   THR A CB  1 
ATOM   171   O  OG1 . THR A 1 24   ? 3.507   22.977  17.206  1.00 83.70  ? 24   THR A OG1 1 
ATOM   172   C  CG2 . THR A 1 24   ? 5.689   23.882  17.212  1.00 82.15  ? 24   THR A CG2 1 
ATOM   173   N  N   . SER A 1 25   ? 1.318   24.848  18.071  1.00 90.12  ? 25   SER A N   1 
ATOM   174   C  CA  . SER A 1 25   ? -0.078  25.257  18.045  1.00 93.50  ? 25   SER A CA  1 
ATOM   175   C  C   . SER A 1 25   ? -0.822  24.642  19.231  1.00 92.87  ? 25   SER A C   1 
ATOM   176   O  O   . SER A 1 25   ? -0.276  23.797  19.935  1.00 91.28  ? 25   SER A O   1 
ATOM   177   C  CB  . SER A 1 25   ? -0.724  24.876  16.733  1.00 96.28  ? 25   SER A CB  1 
ATOM   178   O  OG  . SER A 1 25   ? -1.333  23.593  16.813  1.00 96.13  ? 25   SER A OG  1 
ATOM   179   N  N   . ALA A 1 26   ? -2.075  25.069  19.442  1.00 94.67  ? 26   ALA A N   1 
ATOM   180   C  CA  . ALA A 1 26   ? -2.895  24.522  20.512  1.00 93.66  ? 26   ALA A CA  1 
ATOM   181   C  C   . ALA A 1 26   ? -3.392  23.137  20.111  1.00 93.75  ? 26   ALA A C   1 
ATOM   182   O  O   . ALA A 1 26   ? -3.593  22.277  20.967  1.00 91.49  ? 26   ALA A O   1 
ATOM   183   C  CB  . ALA A 1 26   ? -4.035  25.456  20.827  1.00 94.24  ? 26   ALA A CB  1 
ATOM   184   N  N   . GLU A 1 27   ? -3.559  22.942  18.797  1.00 97.13  ? 27   GLU A N   1 
ATOM   185   C  CA  . GLU A 1 27   ? -4.146  21.727  18.258  1.00 99.70  ? 27   GLU A CA  1 
ATOM   186   C  C   . GLU A 1 27   ? -3.089  20.627  18.153  1.00 98.26  ? 27   GLU A C   1 
ATOM   187   O  O   . GLU A 1 27   ? -3.290  19.516  18.647  1.00 98.26  ? 27   GLU A O   1 
ATOM   188   C  CB  . GLU A 1 27   ? -4.846  21.996  16.923  1.00 103.77 ? 27   GLU A CB  1 
ATOM   189   C  CG  . GLU A 1 27   ? -6.223  22.628  17.071  1.00 108.47 ? 27   GLU A CG  1 
ATOM   190   C  CD  . GLU A 1 27   ? -6.277  24.145  17.208  1.00 111.95 ? 27   GLU A CD  1 
ATOM   191   O  OE1 . GLU A 1 27   ? -7.401  24.697  17.258  1.00 114.59 ? 27   GLU A OE1 1 
ATOM   192   O  OE2 . GLU A 1 27   ? -5.199  24.778  17.257  1.00 113.19 ? 27   GLU A OE2 1 
ATOM   193   N  N   . ASP A 1 28   ? -1.956  20.938  17.517  1.00 97.54  ? 28   ASP A N   1 
ATOM   194   C  CA  . ASP A 1 28   ? -0.983  19.904  17.205  1.00 95.38  ? 28   ASP A CA  1 
ATOM   195   C  C   . ASP A 1 28   ? -0.351  19.354  18.489  1.00 90.71  ? 28   ASP A C   1 
ATOM   196   O  O   . ASP A 1 28   ? -0.403  19.996  19.540  1.00 89.06  ? 28   ASP A O   1 
ATOM   197   C  CB  . ASP A 1 28   ? -0.036  20.340  16.077  1.00 98.61  ? 28   ASP A CB  1 
ATOM   198   C  CG  . ASP A 1 28   ? 0.739   21.625  16.339  1.00 100.07 ? 28   ASP A CG  1 
ATOM   199   O  OD1 . ASP A 1 28   ? 1.148   21.843  17.501  1.00 99.76  ? 28   ASP A OD1 1 
ATOM   200   O  OD2 . ASP A 1 28   ? 0.933   22.402  15.373  1.00 101.74 ? 28   ASP A OD2 1 
ATOM   201   N  N   . LEU A 1 29   ? 0.221   18.143  18.375  1.00 86.58  ? 29   LEU A N   1 
ATOM   202   C  CA  . LEU A 1 29   ? 0.818   17.393  19.470  1.00 81.58  ? 29   LEU A CA  1 
ATOM   203   C  C   . LEU A 1 29   ? 2.326   17.332  19.244  1.00 79.01  ? 29   LEU A C   1 
ATOM   204   O  O   . LEU A 1 29   ? 2.786   16.845  18.212  1.00 78.80  ? 29   LEU A O   1 
ATOM   205   C  CB  . LEU A 1 29   ? 0.189   15.992  19.490  1.00 80.80  ? 29   LEU A CB  1 
ATOM   206   C  CG  . LEU A 1 29   ? 0.771   14.972  20.471  1.00 78.03  ? 29   LEU A CG  1 
ATOM   207   C  CD1 . LEU A 1 29   ? 0.748   15.492  21.903  1.00 76.35  ? 29   LEU A CD1 1 
ATOM   208   C  CD2 . LEU A 1 29   ? 0.022   13.651  20.371  1.00 77.81  ? 29   LEU A CD2 1 
ATOM   209   N  N   . ASN A 1 30   ? 3.088   17.828  20.226  1.00 77.14  ? 30   ASN A N   1 
ATOM   210   C  CA  . ASN A 1 30   ? 4.521   18.025  20.064  1.00 74.16  ? 30   ASN A CA  1 
ATOM   211   C  C   . ASN A 1 30   ? 5.322   17.074  20.945  1.00 70.66  ? 30   ASN A C   1 
ATOM   212   O  O   . ASN A 1 30   ? 4.993   16.858  22.109  1.00 68.21  ? 30   ASN A O   1 
ATOM   213   C  CB  . ASN A 1 30   ? 4.946   19.453  20.401  1.00 74.28  ? 30   ASN A CB  1 
ATOM   214   C  CG  . ASN A 1 30   ? 4.515   20.463  19.362  1.00 77.73  ? 30   ASN A CG  1 
ATOM   215   O  OD1 . ASN A 1 30   ? 3.787   21.408  19.668  1.00 79.76  ? 30   ASN A OD1 1 
ATOM   216   N  ND2 . ASN A 1 30   ? 4.961   20.276  18.132  1.00 78.67  ? 30   ASN A ND2 1 
ATOM   217   N  N   . LEU A 1 31   ? 6.390   16.536  20.351  1.00 69.80  ? 31   LEU A N   1 
ATOM   218   C  CA  . LEU A 1 31   ? 7.500   15.948  21.076  1.00 68.16  ? 31   LEU A CA  1 
ATOM   219   C  C   . LEU A 1 31   ? 8.638   16.964  21.045  1.00 68.43  ? 31   LEU A C   1 
ATOM   220   O  O   . LEU A 1 31   ? 9.003   17.444  19.971  1.00 69.54  ? 31   LEU A O   1 
ATOM   221   C  CB  . LEU A 1 31   ? 7.883   14.636  20.379  1.00 67.54  ? 31   LEU A CB  1 
ATOM   222   C  CG  . LEU A 1 31   ? 8.988   13.797  21.023  1.00 65.10  ? 31   LEU A CG  1 
ATOM   223   C  CD1 . LEU A 1 31   ? 8.669   13.478  22.473  1.00 64.21  ? 31   LEU A CD1 1 
ATOM   224   C  CD2 . LEU A 1 31   ? 9.185   12.510  20.243  1.00 64.91  ? 31   LEU A CD2 1 
ATOM   225   N  N   . LEU A 1 32   ? 9.131   17.331  22.236  1.00 67.82  ? 32   LEU A N   1 
ATOM   226   C  CA  . LEU A 1 32   ? 10.325  18.153  22.390  1.00 68.27  ? 32   LEU A CA  1 
ATOM   227   C  C   . LEU A 1 32   ? 11.427  17.298  23.010  1.00 67.02  ? 32   LEU A C   1 
ATOM   228   O  O   . LEU A 1 32   ? 11.206  16.647  24.026  1.00 66.83  ? 32   LEU A O   1 
ATOM   229   C  CB  . LEU A 1 32   ? 10.018  19.358  23.287  1.00 68.24  ? 32   LEU A CB  1 
ATOM   230   C  CG  . LEU A 1 32   ? 9.475   20.614  22.604  1.00 70.42  ? 32   LEU A CG  1 
ATOM   231   C  CD1 . LEU A 1 32   ? 8.190   20.327  21.848  1.00 71.58  ? 32   LEU A CD1 1 
ATOM   232   C  CD2 . LEU A 1 32   ? 9.232   21.716  23.626  1.00 70.83  ? 32   LEU A CD2 1 
ATOM   233   N  N   . ILE A 1 33   ? 12.612  17.309  22.388  1.00 67.38  ? 33   ILE A N   1 
ATOM   234   C  CA  . ILE A 1 33   ? 13.730  16.482  22.815  1.00 65.18  ? 33   ILE A CA  1 
ATOM   235   C  C   . ILE A 1 33   ? 14.918  17.380  23.148  1.00 65.23  ? 33   ILE A C   1 
ATOM   236   O  O   . ILE A 1 33   ? 15.241  18.300  22.399  1.00 68.00  ? 33   ILE A O   1 
ATOM   237   C  CB  . ILE A 1 33   ? 14.089  15.447  21.732  1.00 64.74  ? 33   ILE A CB  1 
ATOM   238   C  CG1 . ILE A 1 33   ? 12.874  14.614  21.319  1.00 65.45  ? 33   ILE A CG1 1 
ATOM   239   C  CG2 . ILE A 1 33   ? 15.246  14.570  22.185  1.00 63.75  ? 33   ILE A CG2 1 
ATOM   240   C  CD1 . ILE A 1 33   ? 13.052  13.880  20.012  1.00 66.42  ? 33   ILE A CD1 1 
ATOM   241   N  N   . ALA A 1 34   ? 15.543  17.095  24.292  1.00 62.71  ? 34   ALA A N   1 
ATOM   242   C  CA  . ALA A 1 34   ? 16.734  17.783  24.738  1.00 61.82  ? 34   ALA A CA  1 
ATOM   243   C  C   . ALA A 1 34   ? 17.926  16.869  24.484  1.00 62.08  ? 34   ALA A C   1 
ATOM   244   O  O   . ALA A 1 34   ? 17.991  15.767  25.025  1.00 61.12  ? 34   ALA A O   1 
ATOM   245   C  CB  . ALA A 1 34   ? 16.579  18.121  26.198  1.00 60.36  ? 34   ALA A CB  1 
ATOM   246   N  N   . LYS A 1 35   ? 18.834  17.325  23.613  1.00 63.94  ? 35   LYS A N   1 
ATOM   247   C  CA  . LYS A 1 35   ? 20.122  16.687  23.385  1.00 63.58  ? 35   LYS A CA  1 
ATOM   248   C  C   . LYS A 1 35   ? 21.218  17.690  23.743  1.00 64.71  ? 35   LYS A C   1 
ATOM   249   O  O   . LYS A 1 35   ? 21.694  18.424  22.873  1.00 65.77  ? 35   LYS A O   1 
ATOM   250   C  CB  . LYS A 1 35   ? 20.278  16.280  21.916  1.00 64.32  ? 35   LYS A CB  1 
ATOM   251   C  CG  . LYS A 1 35   ? 19.465  15.084  21.447  1.00 64.40  ? 35   LYS A CG  1 
ATOM   252   C  CD  . LYS A 1 35   ? 19.539  14.909  19.949  1.00 66.58  ? 35   LYS A CD  1 
ATOM   253   C  CE  . LYS A 1 35   ? 18.871  13.642  19.458  1.00 69.24  ? 35   LYS A CE  1 
ATOM   254   N  NZ  . LYS A 1 35   ? 19.323  13.270  18.093  1.00 71.43  ? 35   LYS A NZ  1 
ATOM   255   N  N   . ASN A 1 36   ? 21.587  17.721  25.034  1.00 63.67  ? 36   ASN A N   1 
ATOM   256   C  CA  . ASN A 1 36   ? 22.581  18.643  25.560  1.00 63.56  ? 36   ASN A CA  1 
ATOM   257   C  C   . ASN A 1 36   ? 22.157  20.078  25.246  1.00 64.68  ? 36   ASN A C   1 
ATOM   258   O  O   . ASN A 1 36   ? 21.314  20.631  25.945  1.00 66.02  ? 36   ASN A O   1 
ATOM   259   C  CB  . ASN A 1 36   ? 24.001  18.270  25.116  1.00 64.98  ? 36   ASN A CB  1 
ATOM   260   C  CG  . ASN A 1 36   ? 25.098  18.940  25.925  1.00 66.08  ? 36   ASN A CG  1 
ATOM   261   O  OD1 . ASN A 1 36   ? 25.085  18.912  27.156  1.00 65.68  ? 36   ASN A OD1 1 
ATOM   262   N  ND2 . ASN A 1 36   ? 26.068  19.527  25.239  1.00 65.90  ? 36   ASN A ND2 1 
ATOM   263   N  N   . THR A 1 37   ? 22.740  20.677  24.200  1.00 65.27  ? 37   THR A N   1 
ATOM   264   C  CA  . THR A 1 37   ? 22.517  22.085  23.900  1.00 66.90  ? 37   THR A CA  1 
ATOM   265   C  C   . THR A 1 37   ? 21.352  22.248  22.927  1.00 69.36  ? 37   THR A C   1 
ATOM   266   O  O   . THR A 1 37   ? 20.786  23.332  22.807  1.00 70.95  ? 37   THR A O   1 
ATOM   267   C  CB  . THR A 1 37   ? 23.786  22.750  23.353  1.00 66.11  ? 37   THR A CB  1 
ATOM   268   O  OG1 . THR A 1 37   ? 24.326  21.869  22.370  1.00 65.06  ? 37   THR A OG1 1 
ATOM   269   C  CG2 . THR A 1 37   ? 24.810  22.986  24.438  1.00 65.09  ? 37   THR A CG2 1 
ATOM   270   N  N   . ARG A 1 38   ? 21.001  21.159  22.239  1.00 70.75  ? 38   ARG A N   1 
ATOM   271   C  CA  . ARG A 1 38   ? 20.017  21.209  21.173  1.00 72.03  ? 38   ARG A CA  1 
ATOM   272   C  C   . ARG A 1 38   ? 18.645  20.876  21.746  1.00 70.36  ? 38   ARG A C   1 
ATOM   273   O  O   . ARG A 1 38   ? 18.499  19.964  22.560  1.00 67.13  ? 38   ARG A O   1 
ATOM   274   C  CB  . ARG A 1 38   ? 20.362  20.211  20.063  1.00 75.54  ? 38   ARG A CB  1 
ATOM   275   C  CG  . ARG A 1 38   ? 21.849  20.032  19.781  1.00 79.43  ? 38   ARG A CG  1 
ATOM   276   C  CD  . ARG A 1 38   ? 22.540  21.244  19.181  1.00 84.02  ? 38   ARG A CD  1 
ATOM   277   N  NE  . ARG A 1 38   ? 21.686  21.877  18.184  1.00 90.70  ? 38   ARG A NE  1 
ATOM   278   C  CZ  . ARG A 1 38   ? 22.035  22.932  17.455  1.00 96.08  ? 38   ARG A CZ  1 
ATOM   279   N  NH1 . ARG A 1 38   ? 23.236  23.460  17.617  1.00 98.35  ? 38   ARG A NH1 1 
ATOM   280   N  NH2 . ARG A 1 38   ? 21.199  23.454  16.569  1.00 96.94  ? 38   ARG A NH2 1 
ATOM   281   N  N   . LEU A 1 39   ? 17.649  21.643  21.294  1.00 71.98  ? 39   LEU A N   1 
ATOM   282   C  CA  . LEU A 1 39   ? 16.245  21.357  21.532  1.00 72.18  ? 39   LEU A CA  1 
ATOM   283   C  C   . LEU A 1 39   ? 15.594  21.030  20.191  1.00 74.03  ? 39   LEU A C   1 
ATOM   284   O  O   . LEU A 1 39   ? 15.562  21.878  19.300  1.00 76.68  ? 39   LEU A O   1 
ATOM   285   C  CB  . LEU A 1 39   ? 15.593  22.591  22.168  1.00 72.27  ? 39   LEU A CB  1 
ATOM   286   C  CG  . LEU A 1 39   ? 14.076  22.514  22.325  1.00 72.55  ? 39   LEU A CG  1 
ATOM   287   C  CD1 . LEU A 1 39   ? 13.718  21.552  23.443  1.00 70.51  ? 39   LEU A CD1 1 
ATOM   288   C  CD2 . LEU A 1 39   ? 13.461  23.884  22.570  1.00 73.83  ? 39   LEU A CD2 1 
ATOM   289   N  N   . GLU A 1 40   ? 15.095  19.797  20.048  1.00 73.67  ? 40   GLU A N   1 
ATOM   290   C  CA  . GLU A 1 40   ? 14.430  19.401  18.817  1.00 76.49  ? 40   GLU A CA  1 
ATOM   291   C  C   . GLU A 1 40   ? 12.920  19.486  19.028  1.00 76.02  ? 40   GLU A C   1 
ATOM   292   O  O   . GLU A 1 40   ? 12.415  19.054  20.058  1.00 75.77  ? 40   GLU A O   1 
ATOM   293   C  CB  . GLU A 1 40   ? 14.932  18.033  18.349  1.00 78.69  ? 40   GLU A CB  1 
ATOM   294   C  CG  . GLU A 1 40   ? 16.392  18.059  17.909  1.00 84.35  ? 40   GLU A CG  1 
ATOM   295   C  CD  . GLU A 1 40   ? 17.047  16.773  17.413  1.00 89.43  ? 40   GLU A CD  1 
ATOM   296   O  OE1 . GLU A 1 40   ? 16.363  15.715  17.361  1.00 93.55  ? 40   GLU A OE1 1 
ATOM   297   O  OE2 . GLU A 1 40   ? 18.257  16.835  17.068  1.00 90.86  ? 40   GLU A OE2 1 
ATOM   298   N  N   . ILE A 1 41   ? 12.207  20.090  18.071  1.00 77.24  ? 41   ILE A N   1 
ATOM   299   C  CA  . ILE A 1 41   ? 10.757  20.209  18.152  1.00 77.71  ? 41   ILE A CA  1 
ATOM   300   C  C   . ILE A 1 41   ? 10.128  19.420  17.007  1.00 78.78  ? 41   ILE A C   1 
ATOM   301   O  O   . ILE A 1 41   ? 10.397  19.692  15.836  1.00 79.67  ? 41   ILE A O   1 
ATOM   302   C  CB  . ILE A 1 41   ? 10.274  21.677  18.151  1.00 78.88  ? 41   ILE A CB  1 
ATOM   303   C  CG1 . ILE A 1 41   ? 11.084  22.565  19.099  1.00 78.35  ? 41   ILE A CG1 1 
ATOM   304   C  CG2 . ILE A 1 41   ? 8.787   21.751  18.465  1.00 79.24  ? 41   ILE A CG2 1 
ATOM   305   C  CD1 . ILE A 1 41   ? 10.878  24.046  18.870  1.00 79.47  ? 41   ILE A CD1 1 
ATOM   306   N  N   . TYR A 1 42   ? 9.260   18.471  17.382  1.00 77.97  ? 42   TYR A N   1 
ATOM   307   C  CA  . TYR A 1 42   ? 8.575   17.601  16.445  1.00 78.07  ? 42   TYR A CA  1 
ATOM   308   C  C   . TYR A 1 42   ? 7.071   17.776  16.599  1.00 78.66  ? 42   TYR A C   1 
ATOM   309   O  O   . TYR A 1 42   ? 6.603   18.140  17.676  1.00 78.59  ? 42   TYR A O   1 
ATOM   310   C  CB  . TYR A 1 42   ? 9.018   16.156  16.677  1.00 77.34  ? 42   TYR A CB  1 
ATOM   311   C  CG  . TYR A 1 42   ? 10.314  15.833  15.985  1.00 77.34  ? 42   TYR A CG  1 
ATOM   312   C  CD1 . TYR A 1 42   ? 11.529  16.147  16.568  1.00 77.16  ? 42   TYR A CD1 1 
ATOM   313   C  CD2 . TYR A 1 42   ? 10.321  15.268  14.720  1.00 78.86  ? 42   TYR A CD2 1 
ATOM   314   C  CE1 . TYR A 1 42   ? 12.726  15.879  15.924  1.00 78.44  ? 42   TYR A CE1 1 
ATOM   315   C  CE2 . TYR A 1 42   ? 11.506  14.989  14.062  1.00 79.70  ? 42   TYR A CE2 1 
ATOM   316   C  CZ  . TYR A 1 42   ? 12.713  15.301  14.666  1.00 79.69  ? 42   TYR A CZ  1 
ATOM   317   O  OH  . TYR A 1 42   ? 13.893  15.039  14.032  1.00 81.24  ? 42   TYR A OH  1 
ATOM   318   N  N   . VAL A 1 43   ? 6.338   17.542  15.504  1.00 79.48  ? 43   VAL A N   1 
ATOM   319   C  CA  . VAL A 1 43   ? 4.890   17.424  15.537  1.00 79.85  ? 43   VAL A CA  1 
ATOM   320   C  C   . VAL A 1 43   ? 4.547   15.971  15.232  1.00 78.88  ? 43   VAL A C   1 
ATOM   321   O  O   . VAL A 1 43   ? 5.076   15.399  14.285  1.00 78.63  ? 43   VAL A O   1 
ATOM   322   C  CB  . VAL A 1 43   ? 4.199   18.393  14.551  1.00 82.86  ? 43   VAL A CB  1 
ATOM   323   C  CG1 . VAL A 1 43   ? 2.731   18.061  14.343  1.00 84.52  ? 43   VAL A CG1 1 
ATOM   324   C  CG2 . VAL A 1 43   ? 4.324   19.840  14.994  1.00 84.06  ? 43   VAL A CG2 1 
ATOM   325   N  N   . VAL A 1 44   ? 3.666   15.384  16.049  1.00 78.93  ? 44   VAL A N   1 
ATOM   326   C  CA  . VAL A 1 44   ? 3.118   14.059  15.783  1.00 79.71  ? 44   VAL A CA  1 
ATOM   327   C  C   . VAL A 1 44   ? 2.153   14.150  14.598  1.00 82.53  ? 44   VAL A C   1 
ATOM   328   O  O   . VAL A 1 44   ? 1.278   15.013  14.571  1.00 84.30  ? 44   VAL A O   1 
ATOM   329   C  CB  . VAL A 1 44   ? 2.433   13.453  17.029  1.00 78.45  ? 44   VAL A CB  1 
ATOM   330   C  CG1 . VAL A 1 44   ? 1.820   12.090  16.744  1.00 78.77  ? 44   VAL A CG1 1 
ATOM   331   C  CG2 . VAL A 1 44   ? 3.376   13.356  18.219  1.00 76.53  ? 44   VAL A CG2 1 
ATOM   332   N  N   . THR A 1 45   ? 2.320   13.259  13.614  1.00 83.81  ? 45   THR A N   1 
ATOM   333   C  CA  . THR A 1 45   ? 1.452   13.238  12.444  1.00 87.06  ? 45   THR A CA  1 
ATOM   334   C  C   . THR A 1 45   ? 0.922   11.827  12.197  1.00 87.84  ? 45   THR A C   1 
ATOM   335   O  O   . THR A 1 45   ? 1.087   10.935  13.030  1.00 85.73  ? 45   THR A O   1 
ATOM   336   C  CB  . THR A 1 45   ? 2.181   13.710  11.181  1.00 88.37  ? 45   THR A CB  1 
ATOM   337   O  OG1 . THR A 1 45   ? 3.035   12.655  10.736  1.00 87.97  ? 45   THR A OG1 1 
ATOM   338   C  CG2 . THR A 1 45   ? 2.987   14.970  11.394  1.00 88.96  ? 45   THR A CG2 1 
ATOM   339   N  N   . ALA A 1 46   ? 0.286   11.654  11.031  1.00 90.96  ? 46   ALA A N   1 
ATOM   340   C  CA  . ALA A 1 46   ? -0.207  10.368  10.566  1.00 92.30  ? 46   ALA A CA  1 
ATOM   341   C  C   . ALA A 1 46   ? 0.962   9.428   10.274  1.00 91.90  ? 46   ALA A C   1 
ATOM   342   O  O   . ALA A 1 46   ? 0.863   8.227   10.507  1.00 92.07  ? 46   ALA A O   1 
ATOM   343   C  CB  . ALA A 1 46   ? -1.056  10.568  9.338   1.00 94.98  ? 46   ALA A CB  1 
ATOM   344   N  N   . GLU A 1 47   ? 2.060   9.985   9.745   1.00 91.65  ? 47   GLU A N   1 
ATOM   345   C  CA  . GLU A 1 47   ? 3.199   9.188   9.315   1.00 89.98  ? 47   GLU A CA  1 
ATOM   346   C  C   . GLU A 1 47   ? 4.163   9.021   10.479  1.00 85.79  ? 47   GLU A C   1 
ATOM   347   O  O   . GLU A 1 47   ? 5.117   8.253   10.381  1.00 84.73  ? 47   GLU A O   1 
ATOM   348   C  CB  . GLU A 1 47   ? 3.971   9.836   8.159   1.00 92.16  ? 47   GLU A CB  1 
ATOM   349   C  CG  . GLU A 1 47   ? 3.109   10.289  6.996   1.00 96.69  ? 47   GLU A CG  1 
ATOM   350   C  CD  . GLU A 1 47   ? 2.308   11.552  7.270   1.00 98.92  ? 47   GLU A CD  1 
ATOM   351   O  OE1 . GLU A 1 47   ? 2.427   12.110  8.387   1.00 97.77  ? 47   GLU A OE1 1 
ATOM   352   O  OE2 . GLU A 1 47   ? 1.559   11.977  6.365   1.00 101.74 ? 47   GLU A OE2 1 
ATOM   353   N  N   . GLY A 1 48   ? 3.915   9.763   11.559  1.00 83.96  ? 48   GLY A N   1 
ATOM   354   C  CA  . GLY A 1 48   ? 4.788   9.717   12.719  1.00 80.93  ? 48   GLY A CA  1 
ATOM   355   C  C   . GLY A 1 48   ? 5.267   11.109  13.117  1.00 79.61  ? 48   GLY A C   1 
ATOM   356   O  O   . GLY A 1 48   ? 4.453   12.000  13.354  1.00 80.16  ? 48   GLY A O   1 
ATOM   357   N  N   . LEU A 1 49   ? 6.591   11.298  13.152  1.00 76.90  ? 49   LEU A N   1 
ATOM   358   C  CA  . LEU A 1 49   ? 7.144   12.551  13.635  1.00 76.26  ? 49   LEU A CA  1 
ATOM   359   C  C   . LEU A 1 49   ? 7.520   13.465  12.469  1.00 79.06  ? 49   LEU A C   1 
ATOM   360   O  O   . LEU A 1 49   ? 8.314   13.091  11.609  1.00 79.36  ? 49   LEU A O   1 
ATOM   361   C  CB  . LEU A 1 49   ? 8.360   12.244  14.510  1.00 73.14  ? 49   LEU A CB  1 
ATOM   362   C  CG  . LEU A 1 49   ? 8.118   11.336  15.715  1.00 71.29  ? 49   LEU A CG  1 
ATOM   363   C  CD1 . LEU A 1 49   ? 9.426   11.032  16.431  1.00 68.66  ? 49   LEU A CD1 1 
ATOM   364   C  CD2 . LEU A 1 49   ? 7.138   11.966  16.687  1.00 71.74  ? 49   LEU A CD2 1 
ATOM   365   N  N   . ARG A 1 50   ? 6.938   14.672  12.459  1.00 82.01  ? 50   ARG A N   1 
ATOM   366   C  CA  . ARG A 1 50   ? 7.307   15.717  11.516  1.00 84.76  ? 50   ARG A CA  1 
ATOM   367   C  C   . ARG A 1 50   ? 8.246   16.679  12.235  1.00 84.03  ? 50   ARG A C   1 
ATOM   368   O  O   . ARG A 1 50   ? 7.879   17.279  13.246  1.00 83.79  ? 50   ARG A O   1 
ATOM   369   C  CB  . ARG A 1 50   ? 6.064   16.432  10.970  1.00 88.62  ? 50   ARG A CB  1 
ATOM   370   C  CG  . ARG A 1 50   ? 6.325   17.449  9.865   1.00 92.02  ? 50   ARG A CG  1 
ATOM   371   C  CD  . ARG A 1 50   ? 5.051   18.146  9.399   1.00 95.50  ? 50   ARG A CD  1 
ATOM   372   N  NE  . ARG A 1 50   ? 4.627   19.260  10.251  1.00 97.19  ? 50   ARG A NE  1 
ATOM   373   C  CZ  . ARG A 1 50   ? 3.365   19.669  10.454  1.00 99.11  ? 50   ARG A CZ  1 
ATOM   374   N  NH1 . ARG A 1 50   ? 2.350   19.054  9.866   1.00 99.88  ? 50   ARG A NH1 1 
ATOM   375   N  NH2 . ARG A 1 50   ? 3.122   20.697  11.253  1.00 98.77  ? 50   ARG A NH2 1 
ATOM   376   N  N   . PRO A 1 51   ? 9.512   16.797  11.778  1.00 83.72  ? 51   PRO A N   1 
ATOM   377   C  CA  . PRO A 1 51   ? 10.412  17.842  12.258  1.00 82.86  ? 51   PRO A CA  1 
ATOM   378   C  C   . PRO A 1 51   ? 9.830   19.212  11.945  1.00 85.60  ? 51   PRO A C   1 
ATOM   379   O  O   . PRO A 1 51   ? 9.252   19.424  10.878  1.00 88.88  ? 51   PRO A O   1 
ATOM   380   C  CB  . PRO A 1 51   ? 11.705  17.639  11.455  1.00 82.58  ? 51   PRO A CB  1 
ATOM   381   C  CG  . PRO A 1 51   ? 11.303  16.760  10.291  1.00 84.26  ? 51   PRO A CG  1 
ATOM   382   C  CD  . PRO A 1 51   ? 10.154  15.913  10.795  1.00 83.96  ? 51   PRO A CD  1 
ATOM   383   N  N   . VAL A 1 52   ? 9.956   20.114  12.915  1.00 84.98  ? 52   VAL A N   1 
ATOM   384   C  CA  . VAL A 1 52   ? 9.540   21.482  12.697  1.00 88.23  ? 52   VAL A CA  1 
ATOM   385   C  C   . VAL A 1 52   ? 10.766  22.380  12.868  1.00 88.55  ? 52   VAL A C   1 
ATOM   386   O  O   . VAL A 1 52   ? 11.209  23.012  11.911  1.00 90.40  ? 52   VAL A O   1 
ATOM   387   C  CB  . VAL A 1 52   ? 8.294   21.861  13.532  1.00 88.02  ? 52   VAL A CB  1 
ATOM   388   C  CG1 . VAL A 1 52   ? 8.478   21.767  15.033  1.00 86.99  ? 52   VAL A CG1 1 
ATOM   389   C  CG2 . VAL A 1 52   ? 7.744   23.218  13.158  1.00 91.56  ? 52   VAL A CG2 1 
ATOM   390   N  N   . LYS A 1 53   ? 11.374  22.336  14.057  1.00 87.00  ? 53   LYS A N   1 
ATOM   391   C  CA  . LYS A 1 53   ? 12.405  23.295  14.411  1.00 87.61  ? 53   LYS A CA  1 
ATOM   392   C  C   . LYS A 1 53   ? 13.443  22.630  15.312  1.00 85.54  ? 53   LYS A C   1 
ATOM   393   O  O   . LYS A 1 53   ? 13.101  21.873  16.214  1.00 84.50  ? 53   LYS A O   1 
ATOM   394   C  CB  . LYS A 1 53   ? 11.730  24.488  15.100  1.00 88.45  ? 53   LYS A CB  1 
ATOM   395   C  CG  . LYS A 1 53   ? 12.612  25.689  15.404  1.00 88.36  ? 53   LYS A CG  1 
ATOM   396   C  CD  . LYS A 1 53   ? 13.326  26.223  14.191  1.00 90.16  ? 53   LYS A CD  1 
ATOM   397   C  CE  . LYS A 1 53   ? 12.416  26.502  13.016  1.00 92.79  ? 53   LYS A CE  1 
ATOM   398   N  NZ  . LYS A 1 53   ? 13.205  26.757  11.792  1.00 94.69  ? 53   LYS A NZ  1 
ATOM   399   N  N   . GLU A 1 54   ? 14.719  22.916  15.048  1.00 86.86  ? 54   GLU A N   1 
ATOM   400   C  CA  . GLU A 1 54   ? 15.780  22.621  15.997  1.00 85.01  ? 54   GLU A CA  1 
ATOM   401   C  C   . GLU A 1 54   ? 16.423  23.936  16.423  1.00 85.15  ? 54   GLU A C   1 
ATOM   402   O  O   . GLU A 1 54   ? 16.724  24.787  15.586  1.00 87.48  ? 54   GLU A O   1 
ATOM   403   C  CB  . GLU A 1 54   ? 16.845  21.711  15.385  1.00 86.17  ? 54   GLU A CB  1 
ATOM   404   C  CG  . GLU A 1 54   ? 17.678  20.998  16.433  1.00 86.44  ? 54   GLU A CG  1 
ATOM   405   C  CD  . GLU A 1 54   ? 19.078  20.584  16.008  1.00 88.54  ? 54   GLU A CD  1 
ATOM   406   O  OE1 . GLU A 1 54   ? 19.987  20.657  16.850  1.00 87.99  ? 54   GLU A OE1 1 
ATOM   407   O  OE2 . GLU A 1 54   ? 19.262  20.185  14.841  1.00 91.42  ? 54   GLU A OE2 1 
ATOM   408   N  N   . VAL A 1 55   ? 16.629  24.090  17.734  1.00 82.75  ? 55   VAL A N   1 
ATOM   409   C  CA  . VAL A 1 55   ? 17.272  25.280  18.267  1.00 82.01  ? 55   VAL A CA  1 
ATOM   410   C  C   . VAL A 1 55   ? 18.490  24.893  19.101  1.00 78.84  ? 55   VAL A C   1 
ATOM   411   O  O   . VAL A 1 55   ? 18.401  24.013  19.955  1.00 77.05  ? 55   VAL A O   1 
ATOM   412   C  CB  . VAL A 1 55   ? 16.293  26.159  19.069  1.00 83.20  ? 55   VAL A CB  1 
ATOM   413   C  CG1 . VAL A 1 55   ? 15.527  25.381  20.123  1.00 80.80  ? 55   VAL A CG1 1 
ATOM   414   C  CG2 . VAL A 1 55   ? 17.006  27.344  19.702  1.00 85.52  ? 55   VAL A CG2 1 
ATOM   415   N  N   . GLY A 1 56   ? 19.610  25.585  18.848  1.00 78.33  ? 56   GLY A N   1 
ATOM   416   C  CA  . GLY A 1 56   ? 20.814  25.436  19.645  1.00 74.80  ? 56   GLY A CA  1 
ATOM   417   C  C   . GLY A 1 56   ? 20.890  26.491  20.744  1.00 73.19  ? 56   GLY A C   1 
ATOM   418   O  O   . GLY A 1 56   ? 21.054  27.670  20.447  1.00 75.09  ? 56   GLY A O   1 
ATOM   419   N  N   . MET A 1 57   ? 20.781  26.051  22.005  1.00 69.84  ? 57   MET A N   1 
ATOM   420   C  CA  . MET A 1 57   ? 20.939  26.935  23.150  1.00 69.30  ? 57   MET A CA  1 
ATOM   421   C  C   . MET A 1 57   ? 22.420  27.176  23.450  1.00 68.82  ? 57   MET A C   1 
ATOM   422   O  O   . MET A 1 57   ? 23.262  26.299  23.253  1.00 67.11  ? 57   MET A O   1 
ATOM   423   C  CB  . MET A 1 57   ? 20.291  26.351  24.409  1.00 67.56  ? 57   MET A CB  1 
ATOM   424   C  CG  . MET A 1 57   ? 18.809  26.064  24.289  1.00 68.27  ? 57   MET A CG  1 
ATOM   425   S  SD  . MET A 1 57   ? 17.742  27.533  24.278  1.00 71.31  ? 57   MET A SD  1 
ATOM   426   C  CE  . MET A 1 57   ? 18.005  28.194  25.924  1.00 70.42  ? 57   MET A CE  1 
ATOM   427   N  N   . TYR A 1 58   ? 22.705  28.377  23.964  1.00 69.26  ? 58   TYR A N   1 
ATOM   428   C  CA  . TYR A 1 58   ? 23.986  28.707  24.559  1.00 68.82  ? 58   TYR A CA  1 
ATOM   429   C  C   . TYR A 1 58   ? 24.005  28.211  26.009  1.00 68.11  ? 58   TYR A C   1 
ATOM   430   O  O   . TYR A 1 58   ? 24.245  28.971  26.949  1.00 68.57  ? 58   TYR A O   1 
ATOM   431   C  CB  . TYR A 1 58   ? 24.268  30.207  24.411  1.00 70.32  ? 58   TYR A CB  1 
ATOM   432   C  CG  . TYR A 1 58   ? 24.437  30.708  22.997  1.00 71.49  ? 58   TYR A CG  1 
ATOM   433   C  CD1 . TYR A 1 58   ? 24.656  29.832  21.946  1.00 70.86  ? 58   TYR A CD1 1 
ATOM   434   C  CD2 . TYR A 1 58   ? 24.414  32.064  22.714  1.00 73.17  ? 58   TYR A CD2 1 
ATOM   435   C  CE1 . TYR A 1 58   ? 24.820  30.286  20.648  1.00 72.81  ? 58   TYR A CE1 1 
ATOM   436   C  CE2 . TYR A 1 58   ? 24.577  32.533  21.420  1.00 75.37  ? 58   TYR A CE2 1 
ATOM   437   C  CZ  . TYR A 1 58   ? 24.777  31.642  20.382  1.00 75.15  ? 58   TYR A CZ  1 
ATOM   438   O  OH  . TYR A 1 58   ? 24.947  32.086  19.103  1.00 77.53  ? 58   TYR A OH  1 
ATOM   439   N  N   . GLY A 1 59   ? 23.751  26.910  26.185  1.00 66.64  ? 59   GLY A N   1 
ATOM   440   C  CA  . GLY A 1 59   ? 23.778  26.289  27.499  1.00 66.31  ? 59   GLY A CA  1 
ATOM   441   C  C   . GLY A 1 59   ? 23.398  24.811  27.439  1.00 66.16  ? 59   GLY A C   1 
ATOM   442   O  O   . GLY A 1 59   ? 22.705  24.371  26.520  1.00 67.70  ? 59   GLY A O   1 
ATOM   443   N  N   . LYS A 1 60   ? 23.863  24.040  28.427  1.00 64.82  ? 60   LYS A N   1 
ATOM   444   C  CA  . LYS A 1 60   ? 23.402  22.674  28.600  1.00 62.68  ? 60   LYS A CA  1 
ATOM   445   C  C   . LYS A 1 60   ? 22.022  22.728  29.247  1.00 62.36  ? 60   LYS A C   1 
ATOM   446   O  O   . LYS A 1 60   ? 21.898  23.251  30.353  1.00 63.15  ? 60   LYS A O   1 
ATOM   447   C  CB  . LYS A 1 60   ? 24.332  21.908  29.543  1.00 62.46  ? 60   LYS A CB  1 
ATOM   448   C  CG  . LYS A 1 60   ? 25.768  21.719  29.067  1.00 64.68  ? 60   LYS A CG  1 
ATOM   449   C  CD  . LYS A 1 60   ? 26.729  21.206  30.138  1.00 64.30  ? 60   LYS A CD  1 
ATOM   450   C  CE  . LYS A 1 60   ? 26.477  19.768  30.549  1.00 63.15  ? 60   LYS A CE  1 
ATOM   451   N  NZ  . LYS A 1 60   ? 26.549  18.858  29.383  1.00 64.37  ? 60   LYS A NZ  1 
ATOM   452   N  N   . ILE A 1 61   ? 21.004  22.193  28.552  1.00 60.66  ? 61   ILE A N   1 
ATOM   453   C  CA  . ILE A 1 61   ? 19.628  22.176  29.036  1.00 59.54  ? 61   ILE A CA  1 
ATOM   454   C  C   . ILE A 1 61   ? 19.524  21.242  30.239  1.00 58.70  ? 61   ILE A C   1 
ATOM   455   O  O   . ILE A 1 61   ? 19.666  20.036  30.088  1.00 59.58  ? 61   ILE A O   1 
ATOM   456   C  CB  . ILE A 1 61   ? 18.661  21.728  27.923  1.00 58.65  ? 61   ILE A CB  1 
ATOM   457   C  CG1 . ILE A 1 61   ? 18.689  22.659  26.710  1.00 59.65  ? 61   ILE A CG1 1 
ATOM   458   C  CG2 . ILE A 1 61   ? 17.253  21.574  28.471  1.00 58.74  ? 61   ILE A CG2 1 
ATOM   459   C  CD1 . ILE A 1 61   ? 18.246  22.000  25.425  1.00 58.86  ? 61   ILE A CD1 1 
ATOM   460   N  N   . ALA A 1 62   ? 19.253  21.796  31.425  1.00 58.87  ? 62   ALA A N   1 
ATOM   461   C  CA  . ALA A 1 62   ? 19.101  20.984  32.623  1.00 57.73  ? 62   ALA A CA  1 
ATOM   462   C  C   . ALA A 1 62   ? 17.622  20.754  32.930  1.00 59.16  ? 62   ALA A C   1 
ATOM   463   O  O   . ALA A 1 62   ? 17.252  19.654  33.317  1.00 59.85  ? 62   ALA A O   1 
ATOM   464   C  CB  . ALA A 1 62   ? 19.827  21.608  33.784  1.00 57.17  ? 62   ALA A CB  1 
ATOM   465   N  N   . VAL A 1 63   ? 16.783  21.786  32.749  1.00 60.99  ? 63   VAL A N   1 
ATOM   466   C  CA  . VAL A 1 63   ? 15.352  21.679  32.995  1.00 62.20  ? 63   VAL A CA  1 
ATOM   467   C  C   . VAL A 1 63   ? 14.589  22.076  31.732  1.00 64.34  ? 63   VAL A C   1 
ATOM   468   O  O   . VAL A 1 63   ? 14.947  23.044  31.061  1.00 65.98  ? 63   VAL A O   1 
ATOM   469   C  CB  . VAL A 1 63   ? 14.919  22.519  34.213  1.00 62.70  ? 63   VAL A CB  1 
ATOM   470   C  CG1 . VAL A 1 63   ? 13.411  22.707  34.281  1.00 62.87  ? 63   VAL A CG1 1 
ATOM   471   C  CG2 . VAL A 1 63   ? 15.436  21.918  35.511  1.00 62.24  ? 63   VAL A CG2 1 
ATOM   472   N  N   . MET A 1 64   ? 13.519  21.327  31.437  1.00 64.63  ? 64   MET A N   1 
ATOM   473   C  CA  . MET A 1 64   ? 12.698  21.540  30.257  1.00 65.54  ? 64   MET A CA  1 
ATOM   474   C  C   . MET A 1 64   ? 11.262  21.150  30.591  1.00 66.59  ? 64   MET A C   1 
ATOM   475   O  O   . MET A 1 64   ? 10.946  19.968  30.673  1.00 65.46  ? 64   MET A O   1 
ATOM   476   C  CB  . MET A 1 64   ? 13.203  20.675  29.098  1.00 64.14  ? 64   MET A CB  1 
ATOM   477   C  CG  . MET A 1 64   ? 12.419  20.841  27.815  1.00 65.19  ? 64   MET A CG  1 
ATOM   478   S  SD  . MET A 1 64   ? 13.099  19.849  26.456  1.00 65.32  ? 64   MET A SD  1 
ATOM   479   C  CE  . MET A 1 64   ? 12.596  18.209  26.970  1.00 63.66  ? 64   MET A CE  1 
ATOM   480   N  N   . GLU A 1 65   ? 10.406  22.154  30.800  1.00 69.73  ? 65   GLU A N   1 
ATOM   481   C  CA  . GLU A 1 65   ? 9.027   21.901  31.187  1.00 71.39  ? 65   GLU A CA  1 
ATOM   482   C  C   . GLU A 1 65   ? 8.085   22.745  30.334  1.00 72.42  ? 65   GLU A C   1 
ATOM   483   O  O   . GLU A 1 65   ? 8.351   23.916  30.064  1.00 73.38  ? 65   GLU A O   1 
ATOM   484   C  CB  . GLU A 1 65   ? 8.813   22.171  32.680  1.00 73.53  ? 65   GLU A CB  1 
ATOM   485   C  CG  . GLU A 1 65   ? 9.546   21.212  33.604  1.00 74.75  ? 65   GLU A CG  1 
ATOM   486   C  CD  . GLU A 1 65   ? 9.094   19.758  33.582  1.00 76.79  ? 65   GLU A CD  1 
ATOM   487   O  OE1 . GLU A 1 65   ? 7.939   19.496  33.160  1.00 79.52  ? 65   GLU A OE1 1 
ATOM   488   O  OE2 . GLU A 1 65   ? 9.896   18.885  33.993  1.00 76.90  ? 65   GLU A OE2 1 
ATOM   489   N  N   . LEU A 1 66   ? 6.986   22.112  29.910  1.00 72.18  ? 66   LEU A N   1 
ATOM   490   C  CA  . LEU A 1 66   ? 5.877   22.794  29.266  1.00 73.73  ? 66   LEU A CA  1 
ATOM   491   C  C   . LEU A 1 66   ? 4.821   23.106  30.325  1.00 74.31  ? 66   LEU A C   1 
ATOM   492   O  O   . LEU A 1 66   ? 4.611   22.305  31.236  1.00 72.79  ? 66   LEU A O   1 
ATOM   493   C  CB  . LEU A 1 66   ? 5.309   21.877  28.177  1.00 72.90  ? 66   LEU A CB  1 
ATOM   494   C  CG  . LEU A 1 66   ? 6.073   21.868  26.856  1.00 72.48  ? 66   LEU A CG  1 
ATOM   495   C  CD1 . LEU A 1 66   ? 5.661   20.677  26.014  1.00 71.89  ? 66   LEU A CD1 1 
ATOM   496   C  CD2 . LEU A 1 66   ? 5.840   23.162  26.091  1.00 75.18  ? 66   LEU A CD2 1 
ATOM   497   N  N   . PHE A 1 67   ? 4.171   24.272  30.198  1.00 75.71  ? 67   PHE A N   1 
ATOM   498   C  CA  . PHE A 1 67   ? 3.135   24.699  31.130  1.00 77.47  ? 67   PHE A CA  1 
ATOM   499   C  C   . PHE A 1 67   ? 2.215   25.710  30.448  1.00 80.16  ? 67   PHE A C   1 
ATOM   500   O  O   . PHE A 1 67   ? 2.641   26.404  29.526  1.00 80.85  ? 67   PHE A O   1 
ATOM   501   C  CB  . PHE A 1 67   ? 3.761   25.233  32.426  1.00 76.99  ? 67   PHE A CB  1 
ATOM   502   C  CG  . PHE A 1 67   ? 4.524   26.528  32.294  1.00 77.76  ? 67   PHE A CG  1 
ATOM   503   C  CD1 . PHE A 1 67   ? 5.651   26.619  31.487  1.00 76.85  ? 67   PHE A CD1 1 
ATOM   504   C  CD2 . PHE A 1 67   ? 4.113   27.665  32.977  1.00 79.64  ? 67   PHE A CD2 1 
ATOM   505   C  CE1 . PHE A 1 67   ? 6.343   27.815  31.359  1.00 77.53  ? 67   PHE A CE1 1 
ATOM   506   C  CE2 . PHE A 1 67   ? 4.804   28.862  32.850  1.00 80.44  ? 67   PHE A CE2 1 
ATOM   507   C  CZ  . PHE A 1 67   ? 5.921   28.933  32.044  1.00 79.47  ? 67   PHE A CZ  1 
ATOM   508   N  N   . ARG A 1 68   ? 0.950   25.774  30.892  1.00 82.48  ? 68   ARG A N   1 
ATOM   509   C  CA  . ARG A 1 68   ? 0.006   26.730  30.328  1.00 85.66  ? 68   ARG A CA  1 
ATOM   510   C  C   . ARG A 1 68   ? -0.662  27.565  31.418  1.00 86.73  ? 68   ARG A C   1 
ATOM   511   O  O   . ARG A 1 68   ? -1.567  27.094  32.104  1.00 86.48  ? 68   ARG A O   1 
ATOM   512   C  CB  . ARG A 1 68   ? -1.044  26.069  29.431  1.00 87.25  ? 68   ARG A CB  1 
ATOM   513   C  CG  . ARG A 1 68   ? -1.568  27.008  28.354  1.00 90.94  ? 68   ARG A CG  1 
ATOM   514   C  CD  . ARG A 1 68   ? -2.865  26.501  27.778  1.00 94.68  ? 68   ARG A CD  1 
ATOM   515   N  NE  . ARG A 1 68   ? -2.650  25.175  27.224  1.00 94.14  ? 68   ARG A NE  1 
ATOM   516   C  CZ  . ARG A 1 68   ? -2.861  24.851  25.957  1.00 96.34  ? 68   ARG A CZ  1 
ATOM   517   N  NH1 . ARG A 1 68   ? -3.331  25.750  25.109  1.00 100.33 ? 68   ARG A NH1 1 
ATOM   518   N  NH2 . ARG A 1 68   ? -2.634  23.615  25.551  1.00 95.12  ? 68   ARG A NH2 1 
ATOM   519   N  N   . PRO A 1 69   ? -0.243  28.841  31.583  1.00 88.29  ? 69   PRO A N   1 
ATOM   520   C  CA  . PRO A 1 69   ? -0.894  29.765  32.513  1.00 91.55  ? 69   PRO A CA  1 
ATOM   521   C  C   . PRO A 1 69   ? -2.303  30.127  32.047  1.00 95.59  ? 69   PRO A C   1 
ATOM   522   O  O   . PRO A 1 69   ? -2.618  29.987  30.868  1.00 96.13  ? 69   PRO A O   1 
ATOM   523   C  CB  . PRO A 1 69   ? 0.008   31.013  32.497  1.00 91.60  ? 69   PRO A CB  1 
ATOM   524   C  CG  . PRO A 1 69   ? 1.293   30.571  31.831  1.00 88.80  ? 69   PRO A CG  1 
ATOM   525   C  CD  . PRO A 1 69   ? 0.898   29.455  30.891  1.00 87.91  ? 69   PRO A CD  1 
ATOM   526   N  N   . LYS A 1 70   ? -3.120  30.625  32.983  1.00 99.52  ? 70   LYS A N   1 
ATOM   527   C  CA  . LYS A 1 70   ? -4.559  30.764  32.824  1.00 104.97 ? 70   LYS A CA  1 
ATOM   528   C  C   . LYS A 1 70   ? -4.914  31.507  31.532  1.00 108.93 ? 70   LYS A C   1 
ATOM   529   O  O   . LYS A 1 70   ? -5.847  31.114  30.827  1.00 109.35 ? 70   LYS A O   1 
ATOM   530   C  CB  . LYS A 1 70   ? -5.151  31.429  34.074  1.00 108.19 ? 70   LYS A CB  1 
ATOM   531   C  CG  . LYS A 1 70   ? -6.645  31.227  34.310  1.00 111.70 ? 70   LYS A CG  1 
ATOM   532   C  CD  . LYS A 1 70   ? -7.073  29.776  34.500  1.00 111.74 ? 70   LYS A CD  1 
ATOM   533   C  CE  . LYS A 1 70   ? -8.572  29.635  34.692  1.00 114.50 ? 70   LYS A CE  1 
ATOM   534   N  NZ  . LYS A 1 70   ? -9.072  28.292  34.309  1.00 114.70 ? 70   LYS A NZ  1 
ATOM   535   N  N   . GLY A 1 71   ? -4.168  32.577  31.218  1.00 110.90 ? 71   GLY A N   1 
ATOM   536   C  CA  . GLY A 1 71   ? -4.503  33.406  30.066  1.00 113.67 ? 71   GLY A CA  1 
ATOM   537   C  C   . GLY A 1 71   ? -3.630  33.120  28.843  1.00 112.31 ? 71   GLY A C   1 
ATOM   538   O  O   . GLY A 1 71   ? -3.053  34.042  28.269  1.00 114.94 ? 71   GLY A O   1 
ATOM   539   N  N   . GLU A 1 72   ? -3.562  31.845  28.435  1.00 108.66 ? 72   GLU A N   1 
ATOM   540   C  CA  . GLU A 1 72   ? -2.666  31.407  27.373  1.00 103.39 ? 72   GLU A CA  1 
ATOM   541   C  C   . GLU A 1 72   ? -3.376  30.428  26.440  1.00 100.92 ? 72   GLU A C   1 
ATOM   542   O  O   . GLU A 1 72   ? -4.158  29.591  26.886  1.00 99.77  ? 72   GLU A O   1 
ATOM   543   C  CB  . GLU A 1 72   ? -1.411  30.764  27.966  1.00 100.80 ? 72   GLU A CB  1 
ATOM   544   C  CG  . GLU A 1 72   ? -0.473  31.758  28.629  1.00 101.62 ? 72   GLU A CG  1 
ATOM   545   C  CD  . GLU A 1 72   ? 0.465   32.519  27.705  1.00 102.67 ? 72   GLU A CD  1 
ATOM   546   O  OE1 . GLU A 1 72   ? 0.908   31.942  26.686  1.00 102.17 ? 72   GLU A OE1 1 
ATOM   547   O  OE2 . GLU A 1 72   ? 0.762   33.686  28.015  1.00 103.86 ? 72   GLU A OE2 1 
ATOM   548   N  N   . SER A 1 73   ? -3.039  30.516  25.147  1.00 99.13  ? 73   SER A N   1 
ATOM   549   C  CA  . SER A 1 73   ? -3.711  29.780  24.086  1.00 99.08  ? 73   SER A CA  1 
ATOM   550   C  C   . SER A 1 73   ? -3.000  28.465  23.776  1.00 96.25  ? 73   SER A C   1 
ATOM   551   O  O   . SER A 1 73   ? -3.632  27.534  23.269  1.00 97.09  ? 73   SER A O   1 
ATOM   552   C  CB  . SER A 1 73   ? -3.806  30.625  22.847  1.00 101.87 ? 73   SER A CB  1 
ATOM   553   O  OG  . SER A 1 73   ? -2.520  30.821  22.277  1.00 99.90  ? 73   SER A OG  1 
ATOM   554   N  N   . LYS A 1 74   ? -1.685  28.428  24.055  1.00 92.66  ? 74   LYS A N   1 
ATOM   555   C  CA  . LYS A 1 74   ? -0.807  27.285  23.844  1.00 87.58  ? 74   LYS A CA  1 
ATOM   556   C  C   . LYS A 1 74   ? 0.165   27.215  25.020  1.00 85.59  ? 74   LYS A C   1 
ATOM   557   O  O   . LYS A 1 74   ? 0.243   28.165  25.801  1.00 85.31  ? 74   LYS A O   1 
ATOM   558   C  CB  . LYS A 1 74   ? -0.088  27.419  22.497  1.00 86.02  ? 74   LYS A CB  1 
ATOM   559   C  CG  . LYS A 1 74   ? 0.663   28.724  22.306  1.00 86.23  ? 74   LYS A CG  1 
ATOM   560   C  CD  . LYS A 1 74   ? 1.096   28.947  20.892  1.00 87.34  ? 74   LYS A CD  1 
ATOM   561   C  CE  . LYS A 1 74   ? 1.813   30.271  20.762  1.00 89.70  ? 74   LYS A CE  1 
ATOM   562   N  NZ  . LYS A 1 74   ? 1.713   30.817  19.386  1.00 93.55  ? 74   LYS A NZ  1 
ATOM   563   N  N   . ASP A 1 75   ? 0.892   26.089  25.128  1.00 84.33  ? 75   ASP A N   1 
ATOM   564   C  CA  . ASP A 1 75   ? 1.883   25.870  26.175  1.00 81.73  ? 75   ASP A CA  1 
ATOM   565   C  C   . ASP A 1 75   ? 3.058   26.831  25.998  1.00 81.17  ? 75   ASP A C   1 
ATOM   566   O  O   . ASP A 1 75   ? 3.432   27.190  24.879  1.00 81.66  ? 75   ASP A O   1 
ATOM   567   C  CB  . ASP A 1 75   ? 2.339   24.406  26.254  1.00 80.43  ? 75   ASP A CB  1 
ATOM   568   C  CG  . ASP A 1 75   ? 1.222   23.403  26.523  1.00 81.87  ? 75   ASP A CG  1 
ATOM   569   O  OD1 . ASP A 1 75   ? 0.095   23.840  26.813  1.00 84.32  ? 75   ASP A OD1 1 
ATOM   570   O  OD2 . ASP A 1 75   ? 1.478   22.186  26.428  1.00 81.32  ? 75   ASP A OD2 1 
ATOM   571   N  N   . LEU A 1 76   ? 3.605   27.267  27.137  1.00 79.86  ? 76   LEU A N   1 
ATOM   572   C  CA  . LEU A 1 76   ? 4.895   27.934  27.183  1.00 79.08  ? 76   LEU A CA  1 
ATOM   573   C  C   . LEU A 1 76   ? 5.941   26.923  27.647  1.00 76.98  ? 76   LEU A C   1 
ATOM   574   O  O   . LEU A 1 76   ? 5.619   25.954  28.342  1.00 74.86  ? 76   LEU A O   1 
ATOM   575   C  CB  . LEU A 1 76   ? 4.815   29.123  28.145  1.00 79.31  ? 76   LEU A CB  1 
ATOM   576   C  CG  . LEU A 1 76   ? 3.845   30.243  27.770  1.00 81.35  ? 76   LEU A CG  1 
ATOM   577   C  CD1 . LEU A 1 76   ? 3.790   31.273  28.884  1.00 82.04  ? 76   LEU A CD1 1 
ATOM   578   C  CD2 . LEU A 1 76   ? 4.233   30.903  26.452  1.00 82.39  ? 76   LEU A CD2 1 
ATOM   579   N  N   . LEU A 1 77   ? 7.195   27.157  27.237  1.00 77.26  ? 77   LEU A N   1 
ATOM   580   C  CA  . LEU A 1 77   ? 8.309   26.276  27.559  1.00 74.33  ? 77   LEU A CA  1 
ATOM   581   C  C   . LEU A 1 77   ? 9.228   26.991  28.537  1.00 73.56  ? 77   LEU A C   1 
ATOM   582   O  O   . LEU A 1 77   ? 9.644   28.118  28.288  1.00 74.94  ? 77   LEU A O   1 
ATOM   583   C  CB  . LEU A 1 77   ? 9.064   25.919  26.274  1.00 73.54  ? 77   LEU A CB  1 
ATOM   584   C  CG  . LEU A 1 77   ? 10.203  24.910  26.404  1.00 71.39  ? 77   LEU A CG  1 
ATOM   585   C  CD1 . LEU A 1 77   ? 9.680   23.525  26.761  1.00 69.58  ? 77   LEU A CD1 1 
ATOM   586   C  CD2 . LEU A 1 77   ? 10.992  24.852  25.107  1.00 71.70  ? 77   LEU A CD2 1 
ATOM   587   N  N   . PHE A 1 78   ? 9.522   26.315  29.647  1.00 72.82  ? 78   PHE A N   1 
ATOM   588   C  CA  . PHE A 1 78   ? 10.501  26.811  30.596  1.00 73.75  ? 78   PHE A CA  1 
ATOM   589   C  C   . PHE A 1 78   ? 11.785  25.993  30.511  1.00 71.00  ? 78   PHE A C   1 
ATOM   590   O  O   . PHE A 1 78   ? 11.764  24.775  30.674  1.00 69.02  ? 78   PHE A O   1 
ATOM   591   C  CB  . PHE A 1 78   ? 9.980   26.731  32.030  1.00 74.89  ? 78   PHE A CB  1 
ATOM   592   C  CG  . PHE A 1 78   ? 11.048  27.019  33.051  1.00 74.26  ? 78   PHE A CG  1 
ATOM   593   C  CD1 . PHE A 1 78   ? 11.504  28.315  33.246  1.00 75.66  ? 78   PHE A CD1 1 
ATOM   594   C  CD2 . PHE A 1 78   ? 11.603  25.992  33.797  1.00 71.63  ? 78   PHE A CD2 1 
ATOM   595   C  CE1 . PHE A 1 78   ? 12.487  28.579  34.185  1.00 75.90  ? 78   PHE A CE1 1 
ATOM   596   C  CE2 . PHE A 1 78   ? 12.580  26.260  34.740  1.00 71.86  ? 78   PHE A CE2 1 
ATOM   597   C  CZ  . PHE A 1 78   ? 13.026  27.550  34.926  1.00 74.24  ? 78   PHE A CZ  1 
ATOM   598   N  N   . ILE A 1 79   ? 12.902  26.696  30.302  1.00 71.05  ? 79   ILE A N   1 
ATOM   599   C  CA  . ILE A 1 79   ? 14.216  26.081  30.184  1.00 69.24  ? 79   ILE A CA  1 
ATOM   600   C  C   . ILE A 1 79   ? 15.116  26.652  31.274  1.00 69.49  ? 79   ILE A C   1 
ATOM   601   O  O   . ILE A 1 79   ? 15.160  27.868  31.473  1.00 71.42  ? 79   ILE A O   1 
ATOM   602   C  CB  . ILE A 1 79   ? 14.827  26.341  28.791  1.00 68.67  ? 79   ILE A CB  1 
ATOM   603   C  CG1 . ILE A 1 79   ? 14.097  25.596  27.670  1.00 68.47  ? 79   ILE A CG1 1 
ATOM   604   C  CG2 . ILE A 1 79   ? 16.307  26.023  28.784  1.00 67.35  ? 79   ILE A CG2 1 
ATOM   605   C  CD1 . ILE A 1 79   ? 14.591  24.189  27.437  1.00 65.80  ? 79   ILE A CD1 1 
ATOM   606   N  N   . LEU A 1 80   ? 15.839  25.757  31.959  1.00 68.22  ? 80   LEU A N   1 
ATOM   607   C  CA  . LEU A 1 80   ? 16.985  26.154  32.765  1.00 68.32  ? 80   LEU A CA  1 
ATOM   608   C  C   . LEU A 1 80   ? 18.227  25.446  32.237  1.00 66.44  ? 80   LEU A C   1 
ATOM   609   O  O   . LEU A 1 80   ? 18.190  24.242  31.994  1.00 65.16  ? 80   LEU A O   1 
ATOM   610   C  CB  . LEU A 1 80   ? 16.745  25.806  34.241  1.00 67.58  ? 80   LEU A CB  1 
ATOM   611   C  CG  . LEU A 1 80   ? 17.811  26.308  35.217  1.00 67.15  ? 80   LEU A CG  1 
ATOM   612   C  CD1 . LEU A 1 80   ? 17.852  27.826  35.249  1.00 68.79  ? 80   LEU A CD1 1 
ATOM   613   C  CD2 . LEU A 1 80   ? 17.577  25.762  36.615  1.00 66.32  ? 80   LEU A CD2 1 
ATOM   614   N  N   . THR A 1 81   ? 19.311  26.212  32.058  1.00 66.37  ? 81   THR A N   1 
ATOM   615   C  CA  . THR A 1 81   ? 20.591  25.645  31.667  1.00 64.96  ? 81   THR A CA  1 
ATOM   616   C  C   . THR A 1 81   ? 21.430  25.371  32.909  1.00 64.98  ? 81   THR A C   1 
ATOM   617   O  O   . THR A 1 81   ? 21.134  25.887  33.987  1.00 65.51  ? 81   THR A O   1 
ATOM   618   C  CB  . THR A 1 81   ? 21.368  26.585  30.744  1.00 65.45  ? 81   THR A CB  1 
ATOM   619   O  OG1 . THR A 1 81   ? 21.605  27.769  31.505  1.00 66.49  ? 81   THR A OG1 1 
ATOM   620   C  CG2 . THR A 1 81   ? 20.644  26.896  29.452  1.00 66.35  ? 81   THR A CG2 1 
ATOM   621   N  N   . ALA A 1 82   ? 22.497  24.581  32.717  1.00 64.86  ? 82   ALA A N   1 
ATOM   622   C  CA  . ALA A 1 82   ? 23.402  24.182  33.782  1.00 64.17  ? 82   ALA A CA  1 
ATOM   623   C  C   . ALA A 1 82   ? 24.103  25.395  34.391  1.00 66.14  ? 82   ALA A C   1 
ATOM   624   O  O   . ALA A 1 82   ? 24.465  25.351  35.559  1.00 68.20  ? 82   ALA A O   1 
ATOM   625   C  CB  . ALA A 1 82   ? 24.365  23.145  33.271  1.00 62.14  ? 82   ALA A CB  1 
ATOM   626   N  N   . LYS A 1 83   ? 24.244  26.484  33.620  1.00 68.20  ? 83   LYS A N   1 
ATOM   627   C  CA  . LYS A 1 83   ? 24.842  27.721  34.107  1.00 70.55  ? 83   LYS A CA  1 
ATOM   628   C  C   . LYS A 1 83   ? 23.786  28.684  34.659  1.00 73.05  ? 83   LYS A C   1 
ATOM   629   O  O   . LYS A 1 83   ? 24.090  29.860  34.859  1.00 77.28  ? 83   LYS A O   1 
ATOM   630   C  CB  . LYS A 1 83   ? 25.681  28.381  33.006  1.00 71.41  ? 83   LYS A CB  1 
ATOM   631   C  CG  . LYS A 1 83   ? 27.062  27.781  32.778  1.00 71.07  ? 83   LYS A CG  1 
ATOM   632   C  CD  . LYS A 1 83   ? 27.860  28.525  31.721  1.00 73.31  ? 83   LYS A CD  1 
ATOM   633   C  CE  . LYS A 1 83   ? 29.313  28.107  31.607  1.00 73.87  ? 83   LYS A CE  1 
ATOM   634   N  NZ  . LYS A 1 83   ? 30.125  29.148  30.929  1.00 75.33  ? 83   LYS A NZ  1 
ATOM   635   N  N   . TYR A 1 84   ? 22.559  28.183  34.889  1.00 71.64  ? 84   TYR A N   1 
ATOM   636   C  CA  . TYR A 1 84   ? 21.488  28.869  35.606  1.00 71.87  ? 84   TYR A CA  1 
ATOM   637   C  C   . TYR A 1 84   ? 20.872  29.997  34.787  1.00 73.03  ? 84   TYR A C   1 
ATOM   638   O  O   . TYR A 1 84   ? 20.349  30.954  35.352  1.00 74.52  ? 84   TYR A O   1 
ATOM   639   C  CB  . TYR A 1 84   ? 21.950  29.369  36.976  1.00 72.88  ? 84   TYR A CB  1 
ATOM   640   C  CG  . TYR A 1 84   ? 22.594  28.291  37.802  1.00 71.76  ? 84   TYR A CG  1 
ATOM   641   C  CD1 . TYR A 1 84   ? 21.868  27.185  38.211  1.00 70.32  ? 84   TYR A CD1 1 
ATOM   642   C  CD2 . TYR A 1 84   ? 23.933  28.358  38.146  1.00 72.01  ? 84   TYR A CD2 1 
ATOM   643   C  CE1 . TYR A 1 84   ? 22.453  26.174  38.952  1.00 68.82  ? 84   TYR A CE1 1 
ATOM   644   C  CE2 . TYR A 1 84   ? 24.532  27.359  38.896  1.00 70.98  ? 84   TYR A CE2 1 
ATOM   645   C  CZ  . TYR A 1 84   ? 23.786  26.261  39.296  1.00 68.70  ? 84   TYR A CZ  1 
ATOM   646   O  OH  . TYR A 1 84   ? 24.301  25.244  40.041  1.00 67.29  ? 84   TYR A OH  1 
ATOM   647   N  N   . ASN A 1 85   ? 20.942  29.868  33.460  1.00 71.95  ? 85   ASN A N   1 
ATOM   648   C  CA  . ASN A 1 85   ? 20.143  30.690  32.572  1.00 72.28  ? 85   ASN A CA  1 
ATOM   649   C  C   . ASN A 1 85   ? 18.728  30.129  32.564  1.00 72.01  ? 85   ASN A C   1 
ATOM   650   O  O   . ASN A 1 85   ? 18.519  28.986  32.154  1.00 69.96  ? 85   ASN A O   1 
ATOM   651   C  CB  . ASN A 1 85   ? 20.740  30.730  31.169  1.00 72.04  ? 85   ASN A CB  1 
ATOM   652   C  CG  . ASN A 1 85   ? 22.207  31.095  31.193  1.00 72.54  ? 85   ASN A CG  1 
ATOM   653   O  OD1 . ASN A 1 85   ? 22.571  32.172  31.659  1.00 73.24  ? 85   ASN A OD1 1 
ATOM   654   N  ND2 . ASN A 1 85   ? 23.055  30.196  30.716  1.00 71.68  ? 85   ASN A ND2 1 
ATOM   655   N  N   . ALA A 1 86   ? 17.785  30.934  33.076  1.00 74.14  ? 86   ALA A N   1 
ATOM   656   C  CA  . ALA A 1 86   ? 16.366  30.624  33.051  1.00 73.46  ? 86   ALA A CA  1 
ATOM   657   C  C   . ALA A 1 86   ? 15.728  31.418  31.920  1.00 75.86  ? 86   ALA A C   1 
ATOM   658   O  O   . ALA A 1 86   ? 16.108  32.568  31.692  1.00 77.96  ? 86   ALA A O   1 
ATOM   659   C  CB  . ALA A 1 86   ? 15.743  30.966  34.383  1.00 72.72  ? 86   ALA A CB  1 
ATOM   660   N  N   . CYS A 1 87   ? 14.797  30.776  31.200  1.00 76.21  ? 87   CYS A N   1 
ATOM   661   C  CA  . CYS A 1 87   ? 13.949  31.472  30.238  1.00 78.38  ? 87   CYS A CA  1 
ATOM   662   C  C   . CYS A 1 87   ? 12.563  30.833  30.156  1.00 76.96  ? 87   CYS A C   1 
ATOM   663   O  O   . CYS A 1 87   ? 12.387  29.648  30.439  1.00 74.57  ? 87   CYS A O   1 
ATOM   664   C  CB  . CYS A 1 87   ? 14.584  31.545  28.851  1.00 79.86  ? 87   CYS A CB  1 
ATOM   665   S  SG  . CYS A 1 87   ? 15.150  29.944  28.215  1.00 79.94  ? 87   CYS A SG  1 
ATOM   666   N  N   . ILE A 1 88   ? 11.578  31.661  29.793  1.00 78.36  ? 88   ILE A N   1 
ATOM   667   C  CA  . ILE A 1 88   ? 10.279  31.186  29.347  1.00 77.81  ? 88   ILE A CA  1 
ATOM   668   C  C   . ILE A 1 88   ? 10.168  31.485  27.855  1.00 78.84  ? 88   ILE A C   1 
ATOM   669   O  O   . ILE A 1 88   ? 10.413  32.609  27.419  1.00 80.72  ? 88   ILE A O   1 
ATOM   670   C  CB  . ILE A 1 88   ? 9.127   31.808  30.163  1.00 78.69  ? 88   ILE A CB  1 
ATOM   671   C  CG1 . ILE A 1 88   ? 9.287   31.548  31.663  1.00 77.46  ? 88   ILE A CG1 1 
ATOM   672   C  CG2 . ILE A 1 88   ? 7.791   31.296  29.649  1.00 79.01  ? 88   ILE A CG2 1 
ATOM   673   C  CD1 . ILE A 1 88   ? 8.382   32.382  32.541  1.00 78.97  ? 88   ILE A CD1 1 
ATOM   674   N  N   . LEU A 1 89   ? 9.817   30.458  27.078  1.00 77.59  ? 89   LEU A N   1 
ATOM   675   C  CA  . LEU A 1 89   ? 9.861   30.557  25.630  1.00 79.15  ? 89   LEU A CA  1 
ATOM   676   C  C   . LEU A 1 89   ? 8.462   30.377  25.044  1.00 80.77  ? 89   LEU A C   1 
ATOM   677   O  O   . LEU A 1 89   ? 7.630   29.648  25.583  1.00 79.32  ? 89   LEU A O   1 
ATOM   678   C  CB  . LEU A 1 89   ? 10.829  29.500  25.084  1.00 76.45  ? 89   LEU A CB  1 
ATOM   679   C  CG  . LEU A 1 89   ? 12.308  29.683  25.422  1.00 74.69  ? 89   LEU A CG  1 
ATOM   680   C  CD1 . LEU A 1 89   ? 13.149  28.644  24.706  1.00 72.56  ? 89   LEU A CD1 1 
ATOM   681   C  CD2 . LEU A 1 89   ? 12.779  31.073  25.040  1.00 77.44  ? 89   LEU A CD2 1 
ATOM   682   N  N   . GLU A 1 90   ? 8.228   31.045  23.914  1.00 83.80  ? 90   GLU A N   1 
ATOM   683   C  CA  . GLU A 1 90   ? 6.985   30.904  23.184  1.00 86.90  ? 90   GLU A CA  1 
ATOM   684   C  C   . GLU A 1 90   ? 7.306   30.674  21.712  1.00 88.36  ? 90   GLU A C   1 
ATOM   685   O  O   . GLU A 1 90   ? 8.143   31.365  21.134  1.00 88.90  ? 90   GLU A O   1 
ATOM   686   C  CB  . GLU A 1 90   ? 6.110   32.144  23.379  1.00 90.74  ? 90   GLU A CB  1 
ATOM   687   C  CG  . GLU A 1 90   ? 4.700   31.979  22.839  1.00 93.04  ? 90   GLU A CG  1 
ATOM   688   C  CD  . GLU A 1 90   ? 3.732   33.111  23.138  1.00 96.29  ? 90   GLU A CD  1 
ATOM   689   O  OE1 . GLU A 1 90   ? 4.112   34.040  23.880  1.00 96.98  ? 90   GLU A OE1 1 
ATOM   690   O  OE2 . GLU A 1 90   ? 2.589   33.046  22.641  1.00 98.24  ? 90   GLU A OE2 1 
ATOM   691   N  N   . TYR A 1 91   ? 6.623   29.687  21.129  1.00 89.40  ? 91   TYR A N   1 
ATOM   692   C  CA  . TYR A 1 91   ? 6.631   29.466  19.695  1.00 91.57  ? 91   TYR A CA  1 
ATOM   693   C  C   . TYR A 1 91   ? 5.645   30.438  19.053  1.00 95.58  ? 91   TYR A C   1 
ATOM   694   O  O   . TYR A 1 91   ? 4.492   30.512  19.466  1.00 96.76  ? 91   TYR A O   1 
ATOM   695   C  CB  . TYR A 1 91   ? 6.194   28.028  19.415  1.00 90.55  ? 91   TYR A CB  1 
ATOM   696   C  CG  . TYR A 1 91   ? 6.534   27.519  18.041  1.00 91.69  ? 91   TYR A CG  1 
ATOM   697   C  CD1 . TYR A 1 91   ? 5.726   27.809  16.951  1.00 94.37  ? 91   TYR A CD1 1 
ATOM   698   C  CD2 . TYR A 1 91   ? 7.654   26.729  17.839  1.00 89.87  ? 91   TYR A CD2 1 
ATOM   699   C  CE1 . TYR A 1 91   ? 6.025   27.332  15.686  1.00 95.33  ? 91   TYR A CE1 1 
ATOM   700   C  CE2 . TYR A 1 91   ? 7.970   26.246  16.580  1.00 91.27  ? 91   TYR A CE2 1 
ATOM   701   C  CZ  . TYR A 1 91   ? 7.148   26.546  15.506  1.00 94.27  ? 91   TYR A CZ  1 
ATOM   702   O  OH  . TYR A 1 91   ? 7.435   26.091  14.254  1.00 96.48  ? 91   TYR A OH  1 
ATOM   703   N  N   . LYS A 1 92   ? 6.106   31.209  18.065  1.00 98.06  ? 92   LYS A N   1 
ATOM   704   C  CA  . LYS A 1 92   ? 5.198   32.079  17.338  1.00 101.09 ? 92   LYS A CA  1 
ATOM   705   C  C   . LYS A 1 92   ? 5.343   31.820  15.842  1.00 102.87 ? 92   LYS A C   1 
ATOM   706   O  O   . LYS A 1 92   ? 6.437   31.534  15.360  1.00 102.28 ? 92   LYS A O   1 
ATOM   707   C  CB  . LYS A 1 92   ? 5.435   33.547  17.702  1.00 103.34 ? 92   LYS A CB  1 
ATOM   708   C  CG  . LYS A 1 92   ? 4.365   34.504  17.192  1.00 107.85 ? 92   LYS A CG  1 
ATOM   709   C  CD  . LYS A 1 92   ? 4.783   35.962  17.155  1.00 111.01 ? 92   LYS A CD  1 
ATOM   710   C  CE  . LYS A 1 92   ? 3.798   36.854  16.425  1.00 115.02 ? 92   LYS A CE  1 
ATOM   711   N  NZ  . LYS A 1 92   ? 2.483   36.900  17.106  1.00 116.11 ? 92   LYS A NZ  1 
ATOM   712   N  N   . GLN A 1 93   ? 4.220   31.924  15.123  1.00 105.91 ? 93   GLN A N   1 
ATOM   713   C  CA  . GLN A 1 93   ? 4.189   31.685  13.691  1.00 108.87 ? 93   GLN A CA  1 
ATOM   714   C  C   . GLN A 1 93   ? 3.269   32.704  13.021  1.00 114.78 ? 93   GLN A C   1 
ATOM   715   O  O   . GLN A 1 93   ? 2.122   32.880  13.429  1.00 117.01 ? 93   GLN A O   1 
ATOM   716   C  CB  . GLN A 1 93   ? 3.737   30.250  13.412  1.00 106.27 ? 93   GLN A CB  1 
ATOM   717   C  CG  . GLN A 1 93   ? 3.982   29.804  11.980  1.00 107.82 ? 93   GLN A CG  1 
ATOM   718   C  CD  . GLN A 1 93   ? 4.326   28.340  11.876  1.00 105.58 ? 93   GLN A CD  1 
ATOM   719   O  OE1 . GLN A 1 93   ? 4.388   27.616  12.868  1.00 103.35 ? 93   GLN A OE1 1 
ATOM   720   N  NE2 . GLN A 1 93   ? 4.569   27.893  10.655  1.00 107.05 ? 93   GLN A NE2 1 
ATOM   721   N  N   . SER A 1 94   ? 3.798   33.384  11.999  1.00 118.60 ? 94   SER A N   1 
ATOM   722   C  CA  . SER A 1 94   ? 2.976   34.174  11.096  1.00 124.90 ? 94   SER A CA  1 
ATOM   723   C  C   . SER A 1 94   ? 3.362   33.827  9.661   1.00 127.61 ? 94   SER A C   1 
ATOM   724   O  O   . SER A 1 94   ? 4.521   33.989  9.276   1.00 128.39 ? 94   SER A O   1 
ATOM   725   C  CB  . SER A 1 94   ? 3.076   35.656  11.383  1.00 127.89 ? 94   SER A CB  1 
ATOM   726   O  OG  . SER A 1 94   ? 4.429   36.084  11.414  1.00 128.02 ? 94   SER A OG  1 
ATOM   727   N  N   . GLY A 1 95   ? 2.385   33.321  8.896   1.00 129.38 ? 95   GLY A N   1 
ATOM   728   C  CA  . GLY A 1 95   ? 2.647   32.722  7.597   1.00 129.87 ? 95   GLY A CA  1 
ATOM   729   C  C   . GLY A 1 95   ? 3.588   31.523  7.720   1.00 125.93 ? 95   GLY A C   1 
ATOM   730   O  O   . GLY A 1 95   ? 3.260   30.530  8.372   1.00 122.74 ? 95   GLY A O   1 
ATOM   731   N  N   . GLU A 1 96   ? 4.778   31.653  7.120   1.00 125.79 ? 96   GLU A N   1 
ATOM   732   C  CA  . GLU A 1 96   ? 5.726   30.554  7.029   1.00 122.69 ? 96   GLU A CA  1 
ATOM   733   C  C   . GLU A 1 96   ? 6.908   30.757  7.976   1.00 119.84 ? 96   GLU A C   1 
ATOM   734   O  O   . GLU A 1 96   ? 7.806   29.916  8.029   1.00 118.84 ? 96   GLU A O   1 
ATOM   735   C  CB  . GLU A 1 96   ? 6.225   30.403  5.591   1.00 125.42 ? 96   GLU A CB  1 
ATOM   736   C  CG  . GLU A 1 96   ? 5.406   29.426  4.766   1.00 127.00 ? 96   GLU A CG  1 
ATOM   737   C  CD  . GLU A 1 96   ? 6.219   28.490  3.884   1.00 126.56 ? 96   GLU A CD  1 
ATOM   738   O  OE1 . GLU A 1 96   ? 7.017   27.693  4.431   1.00 122.12 ? 96   GLU A OE1 1 
ATOM   739   O  OE2 . GLU A 1 96   ? 6.050   28.556  2.647   1.00 130.36 ? 96   GLU A OE2 1 
ATOM   740   N  N   . SER A 1 97   ? 6.893   31.854  8.742   1.00 120.11 ? 97   SER A N   1 
ATOM   741   C  CA  . SER A 1 97   ? 8.071   32.279  9.489   1.00 118.40 ? 97   SER A CA  1 
ATOM   742   C  C   . SER A 1 97   ? 8.006   31.807  10.939  1.00 113.57 ? 97   SER A C   1 
ATOM   743   O  O   . SER A 1 97   ? 7.045   32.089  11.651  1.00 115.26 ? 97   SER A O   1 
ATOM   744   C  CB  . SER A 1 97   ? 8.257   33.773  9.404   1.00 121.77 ? 97   SER A CB  1 
ATOM   745   O  OG  . SER A 1 97   ? 7.149   34.450  9.979   1.00 123.33 ? 97   SER A OG  1 
ATOM   746   N  N   . ILE A 1 98   ? 9.051   31.102  11.371  1.00 108.10 ? 98   ILE A N   1 
ATOM   747   C  CA  . ILE A 1 98   ? 9.052   30.527  12.701  1.00 103.77 ? 98   ILE A CA  1 
ATOM   748   C  C   . ILE A 1 98   ? 10.002  31.332  13.579  1.00 101.73 ? 98   ILE A C   1 
ATOM   749   O  O   . ILE A 1 98   ? 11.137  31.599  13.186  1.00 101.85 ? 98   ILE A O   1 
ATOM   750   C  CB  . ILE A 1 98   ? 9.437   29.040  12.626  1.00 101.96 ? 98   ILE A CB  1 
ATOM   751   C  CG1 . ILE A 1 98   ? 8.579   28.312  11.584  1.00 104.27 ? 98   ILE A CG1 1 
ATOM   752   C  CG2 . ILE A 1 98   ? 9.369   28.405  14.006  1.00 98.75  ? 98   ILE A CG2 1 
ATOM   753   C  CD1 . ILE A 1 98   ? 8.964   26.866  11.345  1.00 103.51 ? 98   ILE A CD1 1 
ATOM   754   N  N   . ASP A 1 99   ? 9.506   31.719  14.759  1.00 99.78  ? 99   ASP A N   1 
ATOM   755   C  CA  . ASP A 1 99   ? 10.301  32.433  15.745  1.00 98.37  ? 99   ASP A CA  1 
ATOM   756   C  C   . ASP A 1 99   ? 10.043  31.851  17.132  1.00 94.44  ? 99   ASP A C   1 
ATOM   757   O  O   . ASP A 1 99   ? 8.930   31.426  17.436  1.00 94.06  ? 99   ASP A O   1 
ATOM   758   C  CB  . ASP A 1 99   ? 10.029  33.937  15.691  1.00 101.91 ? 99   ASP A CB  1 
ATOM   759   C  CG  . ASP A 1 99   ? 10.607  34.617  14.460  1.00 105.83 ? 99   ASP A CG  1 
ATOM   760   O  OD1 . ASP A 1 99   ? 11.840  34.551  14.274  1.00 104.72 ? 99   ASP A OD1 1 
ATOM   761   O  OD2 . ASP A 1 99   ? 9.821   35.223  13.699  1.00 110.69 ? 99   ASP A OD2 1 
ATOM   762   N  N   . ILE A 1 100  ? 11.090  31.825  17.961  1.00 90.67  ? 100  ILE A N   1 
ATOM   763   C  CA  . ILE A 1 100  ? 10.917  31.480  19.359  1.00 88.00  ? 100  ILE A CA  1 
ATOM   764   C  C   . ILE A 1 100  ? 11.121  32.746  20.178  1.00 89.00  ? 100  ILE A C   1 
ATOM   765   O  O   . ILE A 1 100  ? 12.136  33.414  20.041  1.00 90.33  ? 100  ILE A O   1 
ATOM   766   C  CB  . ILE A 1 100  ? 11.842  30.318  19.772  1.00 84.67  ? 100  ILE A CB  1 
ATOM   767   C  CG1 . ILE A 1 100  ? 11.404  29.016  19.091  1.00 83.84  ? 100  ILE A CG1 1 
ATOM   768   C  CG2 . ILE A 1 100  ? 11.878  30.171  21.288  1.00 82.25  ? 100  ILE A CG2 1 
ATOM   769   C  CD1 . ILE A 1 100  ? 12.527  28.064  18.765  1.00 82.59  ? 100  ILE A CD1 1 
ATOM   770   N  N   . ILE A 1 101  ? 10.123  33.071  21.003  1.00 90.07  ? 101  ILE A N   1 
ATOM   771   C  CA  . ILE A 1 101  ? 10.056  34.344  21.701  1.00 91.94  ? 101  ILE A CA  1 
ATOM   772   C  C   . ILE A 1 101  ? 10.494  34.114  23.144  1.00 89.74  ? 101  ILE A C   1 
ATOM   773   O  O   . ILE A 1 101  ? 10.068  33.155  23.786  1.00 87.53  ? 101  ILE A O   1 
ATOM   774   C  CB  . ILE A 1 101  ? 8.629   34.933  21.611  1.00 94.71  ? 101  ILE A CB  1 
ATOM   775   C  CG1 . ILE A 1 101  ? 8.085   34.995  20.176  1.00 97.35  ? 101  ILE A CG1 1 
ATOM   776   C  CG2 . ILE A 1 101  ? 8.524   36.269  22.335  1.00 96.50  ? 101  ILE A CG2 1 
ATOM   777   C  CD1 . ILE A 1 101  ? 9.093   35.391  19.119  1.00 99.12  ? 101  ILE A CD1 1 
ATOM   778   N  N   . THR A 1 102  ? 11.373  34.991  23.636  1.00 90.28  ? 102  THR A N   1 
ATOM   779   C  CA  . THR A 1 102  ? 11.790  34.921  25.025  1.00 88.68  ? 102  THR A CA  1 
ATOM   780   C  C   . THR A 1 102  ? 10.828  35.771  25.850  1.00 89.97  ? 102  THR A C   1 
ATOM   781   O  O   . THR A 1 102  ? 10.972  36.987  25.915  1.00 92.08  ? 102  THR A O   1 
ATOM   782   C  CB  . THR A 1 102  ? 13.286  35.240  25.187  1.00 87.77  ? 102  THR A CB  1 
ATOM   783   O  OG1 . THR A 1 102  ? 14.036  34.393  24.314  1.00 85.61  ? 102  THR A OG1 1 
ATOM   784   C  CG2 . THR A 1 102  ? 13.781  35.072  26.608  1.00 85.25  ? 102  THR A CG2 1 
ATOM   785   N  N   . ARG A 1 103  ? 9.831   35.112  26.450  1.00 89.09  ? 103  ARG A N   1 
ATOM   786   C  CA  . ARG A 1 103  ? 8.807   35.796  27.224  1.00 91.46  ? 103  ARG A CA  1 
ATOM   787   C  C   . ARG A 1 103  ? 9.440   36.382  28.482  1.00 91.37  ? 103  ARG A C   1 
ATOM   788   O  O   . ARG A 1 103  ? 9.111   37.490  28.899  1.00 94.26  ? 103  ARG A O   1 
ATOM   789   C  CB  . ARG A 1 103  ? 7.649   34.848  27.559  1.00 90.39  ? 103  ARG A CB  1 
ATOM   790   C  CG  . ARG A 1 103  ? 6.777   34.474  26.368  1.00 92.36  ? 103  ARG A CG  1 
ATOM   791   C  CD  . ARG A 1 103  ? 5.930   35.624  25.841  1.00 96.78  ? 103  ARG A CD  1 
ATOM   792   N  NE  . ARG A 1 103  ? 4.502   35.668  26.161  1.00 98.57  ? 103  ARG A NE  1 
ATOM   793   C  CZ  . ARG A 1 103  ? 3.890   35.068  27.183  1.00 97.61  ? 103  ARG A CZ  1 
ATOM   794   N  NH1 . ARG A 1 103  ? 4.566   34.341  28.055  1.00 95.73  ? 103  ARG A NH1 1 
ATOM   795   N  NH2 . ARG A 1 103  ? 2.588   35.206  27.339  1.00 99.43  ? 103  ARG A NH2 1 
ATOM   796   N  N   . ALA A 1 104  ? 10.364  35.619  29.068  1.00 89.01  ? 104  ALA A N   1 
ATOM   797   C  CA  . ALA A 1 104  ? 11.043  36.011  30.290  1.00 89.07  ? 104  ALA A CA  1 
ATOM   798   C  C   . ALA A 1 104  ? 12.424  35.370  30.314  1.00 87.55  ? 104  ALA A C   1 
ATOM   799   O  O   . ALA A 1 104  ? 12.607  34.261  29.813  1.00 86.17  ? 104  ALA A O   1 
ATOM   800   C  CB  . ALA A 1 104  ? 10.233  35.582  31.485  1.00 88.19  ? 104  ALA A CB  1 
ATOM   801   N  N   . HIS A 1 105  ? 13.392  36.085  30.898  1.00 88.59  ? 105  HIS A N   1 
ATOM   802   C  CA  . HIS A 1 105  ? 14.736  35.555  31.058  1.00 86.36  ? 105  HIS A CA  1 
ATOM   803   C  C   . HIS A 1 105  ? 15.445  36.212  32.238  1.00 85.64  ? 105  HIS A C   1 
ATOM   804   O  O   . HIS A 1 105  ? 15.138  37.331  32.640  1.00 86.71  ? 105  HIS A O   1 
ATOM   805   C  CB  . HIS A 1 105  ? 15.553  35.713  29.770  1.00 87.77  ? 105  HIS A CB  1 
ATOM   806   C  CG  . HIS A 1 105  ? 16.091  37.089  29.590  1.00 91.66  ? 105  HIS A CG  1 
ATOM   807   N  ND1 . HIS A 1 105  ? 15.274  38.164  29.285  1.00 95.12  ? 105  HIS A ND1 1 
ATOM   808   C  CD2 . HIS A 1 105  ? 17.348  37.574  29.685  1.00 93.09  ? 105  HIS A CD2 1 
ATOM   809   C  CE1 . HIS A 1 105  ? 16.007  39.255  29.188  1.00 97.84  ? 105  HIS A CE1 1 
ATOM   810   N  NE2 . HIS A 1 105  ? 17.287  38.917  29.429  1.00 96.91  ? 105  HIS A NE2 1 
ATOM   811   N  N   . GLY A 1 106  ? 16.423  35.477  32.763  1.00 83.06  ? 106  GLY A N   1 
ATOM   812   C  CA  . GLY A 1 106  ? 17.296  35.935  33.825  1.00 82.73  ? 106  GLY A CA  1 
ATOM   813   C  C   . GLY A 1 106  ? 18.204  34.799  34.283  1.00 80.04  ? 106  GLY A C   1 
ATOM   814   O  O   . GLY A 1 106  ? 17.951  33.634  33.976  1.00 78.11  ? 106  GLY A O   1 
ATOM   815   N  N   . ASN A 1 107  ? 19.255  35.153  35.028  1.00 79.73  ? 107  ASN A N   1 
ATOM   816   C  CA  . ASN A 1 107  ? 20.174  34.165  35.560  1.00 77.55  ? 107  ASN A CA  1 
ATOM   817   C  C   . ASN A 1 107  ? 19.909  33.944  37.046  1.00 77.81  ? 107  ASN A C   1 
ATOM   818   O  O   . ASN A 1 107  ? 19.984  34.886  37.831  1.00 79.03  ? 107  ASN A O   1 
ATOM   819   C  CB  . ASN A 1 107  ? 21.623  34.590  35.353  1.00 77.58  ? 107  ASN A CB  1 
ATOM   820   C  CG  . ASN A 1 107  ? 22.566  33.424  35.523  1.00 75.24  ? 107  ASN A CG  1 
ATOM   821   O  OD1 . ASN A 1 107  ? 22.743  32.912  36.627  1.00 74.05  ? 107  ASN A OD1 1 
ATOM   822   N  ND2 . ASN A 1 107  ? 23.147  32.982  34.422  1.00 74.83  ? 107  ASN A ND2 1 
ATOM   823   N  N   . VAL A 1 108  ? 19.670  32.680  37.427  1.00 76.92  ? 108  VAL A N   1 
ATOM   824   C  CA  . VAL A 1 108  ? 19.185  32.342  38.759  1.00 77.82  ? 108  VAL A CA  1 
ATOM   825   C  C   . VAL A 1 108  ? 20.309  31.887  39.683  1.00 77.83  ? 108  VAL A C   1 
ATOM   826   O  O   . VAL A 1 108  ? 20.026  31.413  40.782  1.00 76.91  ? 108  VAL A O   1 
ATOM   827   C  CB  . VAL A 1 108  ? 18.072  31.282  38.726  1.00 76.44  ? 108  VAL A CB  1 
ATOM   828   C  CG1 . VAL A 1 108  ? 16.700  31.919  38.793  1.00 78.04  ? 108  VAL A CG1 1 
ATOM   829   C  CG2 . VAL A 1 108  ? 18.188  30.359  37.527  1.00 75.38  ? 108  VAL A CG2 1 
ATOM   830   N  N   . GLN A 1 109  ? 21.564  32.045  39.249  1.00 79.60  ? 109  GLN A N   1 
ATOM   831   C  CA  . GLN A 1 109  ? 22.694  31.599  40.045  1.00 80.82  ? 109  GLN A CA  1 
ATOM   832   C  C   . GLN A 1 109  ? 22.706  32.324  41.388  1.00 82.04  ? 109  GLN A C   1 
ATOM   833   O  O   . GLN A 1 109  ? 22.315  33.485  41.469  1.00 82.87  ? 109  GLN A O   1 
ATOM   834   C  CB  . GLN A 1 109  ? 24.000  31.858  39.306  1.00 83.50  ? 109  GLN A CB  1 
ATOM   835   C  CG  . GLN A 1 109  ? 25.174  31.113  39.917  1.00 87.55  ? 109  GLN A CG  1 
ATOM   836   C  CD  . GLN A 1 109  ? 26.475  31.447  39.233  1.00 90.37  ? 109  GLN A CD  1 
ATOM   837   O  OE1 . GLN A 1 109  ? 27.553  31.117  39.723  1.00 93.61  ? 109  GLN A OE1 1 
ATOM   838   N  NE2 . GLN A 1 109  ? 26.381  32.115  38.093  1.00 91.44  ? 109  GLN A NE2 1 
ATOM   839   N  N   . ASP A 1 110  ? 23.127  31.601  42.434  1.00 82.56  ? 110  ASP A N   1 
ATOM   840   C  CA  . ASP A 1 110  ? 23.394  32.164  43.749  1.00 86.21  ? 110  ASP A CA  1 
ATOM   841   C  C   . ASP A 1 110  ? 24.855  31.890  44.081  1.00 87.08  ? 110  ASP A C   1 
ATOM   842   O  O   . ASP A 1 110  ? 25.329  30.774  43.874  1.00 88.20  ? 110  ASP A O   1 
ATOM   843   C  CB  . ASP A 1 110  ? 22.540  31.506  44.838  1.00 86.95  ? 110  ASP A CB  1 
ATOM   844   C  CG  . ASP A 1 110  ? 21.042  31.721  44.706  1.00 88.08  ? 110  ASP A CG  1 
ATOM   845   O  OD1 . ASP A 1 110  ? 20.633  32.600  43.914  1.00 89.39  ? 110  ASP A OD1 1 
ATOM   846   O  OD2 . ASP A 1 110  ? 20.295  30.997  45.397  1.00 88.23  ? 110  ASP A OD2 1 
ATOM   847   N  N   . ARG A 1 111  ? 25.564  32.905  44.589  1.00 88.83  ? 111  ARG A N   1 
ATOM   848   C  CA  . ARG A 1 111  ? 26.968  32.716  44.919  1.00 90.19  ? 111  ARG A CA  1 
ATOM   849   C  C   . ARG A 1 111  ? 27.099  31.794  46.129  1.00 88.23  ? 111  ARG A C   1 
ATOM   850   O  O   . ARG A 1 111  ? 27.944  30.896  46.141  1.00 87.63  ? 111  ARG A O   1 
ATOM   851   C  CB  . ARG A 1 111  ? 27.699  34.052  45.110  1.00 96.17  ? 111  ARG A CB  1 
ATOM   852   C  CG  . ARG A 1 111  ? 28.225  34.664  43.818  1.00 100.33 ? 111  ARG A CG  1 
ATOM   853   C  CD  . ARG A 1 111  ? 28.329  33.647  42.686  1.00 101.54 ? 111  ARG A CD  1 
ATOM   854   N  NE  . ARG A 1 111  ? 28.447  34.246  41.361  1.00 104.15 ? 111  ARG A NE  1 
ATOM   855   C  CZ  . ARG A 1 111  ? 27.503  34.950  40.735  1.00 104.94 ? 111  ARG A CZ  1 
ATOM   856   N  NH1 . ARG A 1 111  ? 26.328  35.167  41.304  1.00 106.49 ? 111  ARG A NH1 1 
ATOM   857   N  NH2 . ARG A 1 111  ? 27.745  35.442  39.533  1.00 105.02 ? 111  ARG A NH2 1 
ATOM   858   N  N   . ILE A 1 112  ? 26.222  32.013  47.117  1.00 86.20  ? 112  ILE A N   1 
ATOM   859   C  CA  . ILE A 1 112  ? 26.260  31.341  48.407  1.00 85.10  ? 112  ILE A CA  1 
ATOM   860   C  C   . ILE A 1 112  ? 25.990  29.841  48.257  1.00 82.21  ? 112  ILE A C   1 
ATOM   861   O  O   . ILE A 1 112  ? 26.320  29.059  49.148  1.00 82.37  ? 112  ILE A O   1 
ATOM   862   C  CB  . ILE A 1 112  ? 25.259  31.999  49.379  1.00 86.68  ? 112  ILE A CB  1 
ATOM   863   C  CG1 . ILE A 1 112  ? 23.805  31.692  48.998  1.00 85.49  ? 112  ILE A CG1 1 
ATOM   864   C  CG2 . ILE A 1 112  ? 25.536  33.491  49.498  1.00 89.06  ? 112  ILE A CG2 1 
ATOM   865   C  CD1 . ILE A 1 112  ? 22.759  32.433  49.806  1.00 86.88  ? 112  ILE A CD1 1 
ATOM   866   N  N   . GLY A 1 113  ? 25.392  29.444  47.129  1.00 78.66  ? 113  GLY A N   1 
ATOM   867   C  CA  . GLY A 1 113  ? 24.853  28.102  46.986  1.00 75.73  ? 113  GLY A CA  1 
ATOM   868   C  C   . GLY A 1 113  ? 25.907  27.053  46.637  1.00 73.13  ? 113  GLY A C   1 
ATOM   869   O  O   . GLY A 1 113  ? 26.852  27.337  45.908  1.00 72.54  ? 113  GLY A O   1 
ATOM   870   N  N   . ARG A 1 114  ? 25.686  25.831  47.148  1.00 71.75  ? 114  ARG A N   1 
ATOM   871   C  CA  . ARG A 1 114  ? 26.484  24.641  46.890  1.00 70.04  ? 114  ARG A CA  1 
ATOM   872   C  C   . ARG A 1 114  ? 25.664  23.634  46.081  1.00 68.65  ? 114  ARG A C   1 
ATOM   873   O  O   . ARG A 1 114  ? 24.651  23.127  46.564  1.00 69.02  ? 114  ARG A O   1 
ATOM   874   C  CB  . ARG A 1 114  ? 26.826  23.989  48.233  1.00 70.52  ? 114  ARG A CB  1 
ATOM   875   C  CG  . ARG A 1 114  ? 27.534  22.648  48.118  1.00 68.98  ? 114  ARG A CG  1 
ATOM   876   C  CD  . ARG A 1 114  ? 26.886  21.539  48.932  1.00 69.21  ? 114  ARG A CD  1 
ATOM   877   N  NE  . ARG A 1 114  ? 27.426  21.323  50.271  1.00 70.52  ? 114  ARG A NE  1 
ATOM   878   C  CZ  . ARG A 1 114  ? 26.893  20.515  51.190  1.00 70.84  ? 114  ARG A CZ  1 
ATOM   879   N  NH1 . ARG A 1 114  ? 25.793  19.834  50.936  1.00 70.31  ? 114  ARG A NH1 1 
ATOM   880   N  NH2 . ARG A 1 114  ? 27.450  20.396  52.378  1.00 72.77  ? 114  ARG A NH2 1 
ATOM   881   N  N   . PRO A 1 115  ? 26.060  23.282  44.835  1.00 66.91  ? 115  PRO A N   1 
ATOM   882   C  CA  . PRO A 1 115  ? 25.300  22.316  44.037  1.00 65.76  ? 115  PRO A CA  1 
ATOM   883   C  C   . PRO A 1 115  ? 24.972  21.028  44.790  1.00 66.77  ? 115  PRO A C   1 
ATOM   884   O  O   . PRO A 1 115  ? 25.810  20.490  45.510  1.00 68.51  ? 115  PRO A O   1 
ATOM   885   C  CB  . PRO A 1 115  ? 26.249  22.044  42.864  1.00 64.14  ? 115  PRO A CB  1 
ATOM   886   C  CG  . PRO A 1 115  ? 26.969  23.360  42.691  1.00 64.48  ? 115  PRO A CG  1 
ATOM   887   C  CD  . PRO A 1 115  ? 27.220  23.825  44.111  1.00 66.46  ? 115  PRO A CD  1 
ATOM   888   N  N   . SER A 1 116  ? 23.742  20.542  44.603  1.00 67.74  ? 116  SER A N   1 
ATOM   889   C  CA  . SER A 1 116  ? 23.210  19.410  45.342  1.00 68.96  ? 116  SER A CA  1 
ATOM   890   C  C   . SER A 1 116  ? 23.712  18.096  44.754  1.00 69.40  ? 116  SER A C   1 
ATOM   891   O  O   . SER A 1 116  ? 24.122  18.044  43.599  1.00 68.35  ? 116  SER A O   1 
ATOM   892   C  CB  . SER A 1 116  ? 21.709  19.447  45.354  1.00 69.00  ? 116  SER A CB  1 
ATOM   893   O  OG  . SER A 1 116  ? 21.237  20.472  46.213  1.00 69.79  ? 116  SER A OG  1 
ATOM   894   N  N   . GLU A 1 117  ? 23.648  17.042  45.574  1.00 73.01  ? 117  GLU A N   1 
ATOM   895   C  CA  . GLU A 1 117  ? 24.009  15.684  45.202  1.00 73.68  ? 117  GLU A CA  1 
ATOM   896   C  C   . GLU A 1 117  ? 23.302  15.294  43.902  1.00 72.47  ? 117  GLU A C   1 
ATOM   897   O  O   . GLU A 1 117  ? 23.978  15.058  42.902  1.00 72.06  ? 117  GLU A O   1 
ATOM   898   C  CB  . GLU A 1 117  ? 23.619  14.736  46.340  1.00 79.36  ? 117  GLU A CB  1 
ATOM   899   C  CG  . GLU A 1 117  ? 24.114  13.310  46.173  1.00 83.30  ? 117  GLU A CG  1 
ATOM   900   C  CD  . GLU A 1 117  ? 25.488  13.067  46.776  1.00 89.77  ? 117  GLU A CD  1 
ATOM   901   O  OE1 . GLU A 1 117  ? 26.020  13.995  47.434  1.00 92.89  ? 117  GLU A OE1 1 
ATOM   902   O  OE2 . GLU A 1 117  ? 26.032  11.949  46.593  1.00 93.82  ? 117  GLU A OE2 1 
ATOM   903   N  N   . THR A 1 118  ? 21.954  15.253  43.924  1.00 69.68  ? 118  THR A N   1 
ATOM   904   C  CA  . THR A 1 118  ? 21.156  14.703  42.835  1.00 66.35  ? 118  THR A CA  1 
ATOM   905   C  C   . THR A 1 118  ? 20.893  15.759  41.760  1.00 64.36  ? 118  THR A C   1 
ATOM   906   O  O   . THR A 1 118  ? 20.045  15.559  40.893  1.00 64.12  ? 118  THR A O   1 
ATOM   907   C  CB  . THR A 1 118  ? 19.839  14.084  43.329  1.00 66.58  ? 118  THR A CB  1 
ATOM   908   O  OG1 . THR A 1 118  ? 19.000  15.116  43.843  1.00 68.41  ? 118  THR A OG1 1 
ATOM   909   C  CG2 . THR A 1 118  ? 20.036  13.030  44.395  1.00 67.94  ? 118  THR A CG2 1 
ATOM   910   N  N   . GLY A 1 119  ? 21.598  16.891  41.837  1.00 62.90  ? 119  GLY A N   1 
ATOM   911   C  CA  . GLY A 1 119  ? 21.599  17.873  40.762  1.00 62.86  ? 119  GLY A CA  1 
ATOM   912   C  C   . GLY A 1 119  ? 20.399  18.828  40.753  1.00 64.12  ? 119  GLY A C   1 
ATOM   913   O  O   . GLY A 1 119  ? 19.603  18.890  41.698  1.00 65.58  ? 119  GLY A O   1 
ATOM   914   N  N   . ILE A 1 120  ? 20.287  19.570  39.640  1.00 61.88  ? 120  ILE A N   1 
ATOM   915   C  CA  . ILE A 1 120  ? 19.294  20.613  39.429  1.00 60.93  ? 120  ILE A CA  1 
ATOM   916   C  C   . ILE A 1 120  ? 17.915  19.995  39.203  1.00 60.45  ? 120  ILE A C   1 
ATOM   917   O  O   . ILE A 1 120  ? 17.736  19.158  38.323  1.00 58.31  ? 120  ILE A O   1 
ATOM   918   C  CB  . ILE A 1 120  ? 19.713  21.495  38.236  1.00 60.65  ? 120  ILE A CB  1 
ATOM   919   C  CG1 . ILE A 1 120  ? 20.844  22.457  38.615  1.00 61.03  ? 120  ILE A CG1 1 
ATOM   920   C  CG2 . ILE A 1 120  ? 18.511  22.227  37.655  1.00 61.17  ? 120  ILE A CG2 1 
ATOM   921   C  CD1 . ILE A 1 120  ? 21.379  23.279  37.463  1.00 60.91  ? 120  ILE A CD1 1 
ATOM   922   N  N   . ILE A 1 121  ? 16.934  20.456  39.987  1.00 62.04  ? 121  ILE A N   1 
ATOM   923   C  CA  . ILE A 1 121  ? 15.549  20.031  39.849  1.00 61.85  ? 121  ILE A CA  1 
ATOM   924   C  C   . ILE A 1 121  ? 14.666  21.260  39.640  1.00 63.53  ? 121  ILE A C   1 
ATOM   925   O  O   . ILE A 1 121  ? 14.703  22.192  40.441  1.00 65.29  ? 121  ILE A O   1 
ATOM   926   C  CB  . ILE A 1 121  ? 15.107  19.220  41.079  1.00 61.65  ? 121  ILE A CB  1 
ATOM   927   C  CG1 . ILE A 1 121  ? 15.780  17.848  41.100  1.00 60.27  ? 121  ILE A CG1 1 
ATOM   928   C  CG2 . ILE A 1 121  ? 13.589  19.111  41.141  1.00 63.19  ? 121  ILE A CG2 1 
ATOM   929   C  CD1 . ILE A 1 121  ? 15.507  17.049  42.352  1.00 61.32  ? 121  ILE A CD1 1 
ATOM   930   N  N   . GLY A 1 122  ? 13.870  21.234  38.562  1.00 62.66  ? 122  GLY A N   1 
ATOM   931   C  CA  . GLY A 1 122  ? 12.987  22.335  38.215  1.00 63.64  ? 122  GLY A CA  1 
ATOM   932   C  C   . GLY A 1 122  ? 11.536  21.880  38.084  1.00 63.99  ? 122  GLY A C   1 
ATOM   933   O  O   . GLY A 1 122  ? 11.209  21.045  37.247  1.00 62.62  ? 122  GLY A O   1 
ATOM   934   N  N   . ILE A 1 123  ? 10.661  22.457  38.913  1.00 65.86  ? 123  ILE A N   1 
ATOM   935   C  CA  . ILE A 1 123  ? 9.277   22.019  38.983  1.00 66.07  ? 123  ILE A CA  1 
ATOM   936   C  C   . ILE A 1 123  ? 8.347   23.226  38.895  1.00 69.06  ? 123  ILE A C   1 
ATOM   937   O  O   . ILE A 1 123  ? 8.654   24.306  39.399  1.00 70.05  ? 123  ILE A O   1 
ATOM   938   C  CB  . ILE A 1 123  ? 9.028   21.191  40.259  1.00 65.29  ? 123  ILE A CB  1 
ATOM   939   C  CG1 . ILE A 1 123  ? 9.386   21.978  41.524  1.00 65.42  ? 123  ILE A CG1 1 
ATOM   940   C  CG2 . ILE A 1 123  ? 9.750   19.847  40.194  1.00 62.97  ? 123  ILE A CG2 1 
ATOM   941   C  CD1 . ILE A 1 123  ? 8.996   21.294  42.812  1.00 65.87  ? 123  ILE A CD1 1 
ATOM   942   N  N   . ILE A 1 124  ? 7.193   23.015  38.252  1.00 71.50  ? 124  ILE A N   1 
ATOM   943   C  CA  . ILE A 1 124  ? 6.200   24.064  38.085  1.00 73.37  ? 124  ILE A CA  1 
ATOM   944   C  C   . ILE A 1 124  ? 4.927   23.643  38.802  1.00 73.62  ? 124  ILE A C   1 
ATOM   945   O  O   . ILE A 1 124  ? 4.475   22.518  38.646  1.00 73.32  ? 124  ILE A O   1 
ATOM   946   C  CB  . ILE A 1 124  ? 5.955   24.377  36.595  1.00 73.62  ? 124  ILE A CB  1 
ATOM   947   C  CG1 . ILE A 1 124  ? 7.269   24.727  35.887  1.00 73.28  ? 124  ILE A CG1 1 
ATOM   948   C  CG2 . ILE A 1 124  ? 4.918   25.482  36.449  1.00 75.17  ? 124  ILE A CG2 1 
ATOM   949   C  CD1 . ILE A 1 124  ? 7.140   24.937  34.399  1.00 74.83  ? 124  ILE A CD1 1 
ATOM   950   N  N   . ASP A 1 125  ? 4.378   24.562  39.597  1.00 76.33  ? 125  ASP A N   1 
ATOM   951   C  CA  . ASP A 1 125  ? 3.086   24.371  40.230  1.00 78.84  ? 125  ASP A CA  1 
ATOM   952   C  C   . ASP A 1 125  ? 2.045   24.066  39.151  1.00 79.22  ? 125  ASP A C   1 
ATOM   953   O  O   . ASP A 1 125  ? 2.048   24.705  38.100  1.00 78.98  ? 125  ASP A O   1 
ATOM   954   C  CB  . ASP A 1 125  ? 2.711   25.600  41.060  1.00 82.02  ? 125  ASP A CB  1 
ATOM   955   C  CG  . ASP A 1 125  ? 1.251   25.601  41.483  1.00 85.92  ? 125  ASP A CG  1 
ATOM   956   O  OD1 . ASP A 1 125  ? 0.879   24.739  42.314  1.00 86.48  ? 125  ASP A OD1 1 
ATOM   957   O  OD2 . ASP A 1 125  ? 0.488   26.443  40.963  1.00 88.05  ? 125  ASP A OD2 1 
ATOM   958   N  N   . PRO A 1 126  ? 1.142   23.072  39.358  1.00 79.17  ? 126  PRO A N   1 
ATOM   959   C  CA  . PRO A 1 126  ? 0.111   22.736  38.369  1.00 79.80  ? 126  PRO A CA  1 
ATOM   960   C  C   . PRO A 1 126  ? -0.854  23.872  38.013  1.00 81.56  ? 126  PRO A C   1 
ATOM   961   O  O   . PRO A 1 126  ? -1.475  23.854  36.953  1.00 80.56  ? 126  PRO A O   1 
ATOM   962   C  CB  . PRO A 1 126  ? -0.656  21.562  39.006  1.00 79.56  ? 126  PRO A CB  1 
ATOM   963   C  CG  . PRO A 1 126  ? 0.285   20.996  40.043  1.00 77.93  ? 126  PRO A CG  1 
ATOM   964   C  CD  . PRO A 1 126  ? 1.093   22.182  40.531  1.00 78.84  ? 126  PRO A CD  1 
ATOM   965   N  N   . GLU A 1 127  ? -0.956  24.871  38.891  1.00 83.40  ? 127  GLU A N   1 
ATOM   966   C  CA  . GLU A 1 127  ? -1.845  25.994  38.658  1.00 86.76  ? 127  GLU A CA  1 
ATOM   967   C  C   . GLU A 1 127  ? -1.045  27.189  38.141  1.00 85.85  ? 127  GLU A C   1 
ATOM   968   O  O   . GLU A 1 127  ? -1.557  28.303  38.067  1.00 87.82  ? 127  GLU A O   1 
ATOM   969   C  CB  . GLU A 1 127  ? -2.608  26.290  39.946  1.00 91.17  ? 127  GLU A CB  1 
ATOM   970   C  CG  . GLU A 1 127  ? -3.278  25.058  40.520  1.00 93.84  ? 127  GLU A CG  1 
ATOM   971   C  CD  . GLU A 1 127  ? -4.484  25.406  41.368  1.00 100.10 ? 127  GLU A CD  1 
ATOM   972   O  OE1 . GLU A 1 127  ? -4.487  26.507  41.964  1.00 103.30 ? 127  GLU A OE1 1 
ATOM   973   O  OE2 . GLU A 1 127  ? -5.425  24.588  41.410  1.00 104.31 ? 127  GLU A OE2 1 
ATOM   974   N  N   . CYS A 1 128  ? 0.219   26.925  37.786  1.00 83.03  ? 128  CYS A N   1 
ATOM   975   C  CA  . CYS A 1 128  ? 1.176   27.882  37.245  1.00 82.09  ? 128  CYS A CA  1 
ATOM   976   C  C   . CYS A 1 128  ? 1.326   29.114  38.133  1.00 83.64  ? 128  CYS A C   1 
ATOM   977   O  O   . CYS A 1 128  ? 1.413   30.228  37.629  1.00 85.25  ? 128  CYS A O   1 
ATOM   978   C  CB  . CYS A 1 128  ? 0.779   28.334  35.846  1.00 82.24  ? 128  CYS A CB  1 
ATOM   979   S  SG  . CYS A 1 128  ? 0.653   26.968  34.669  1.00 81.29  ? 128  CYS A SG  1 
ATOM   980   N  N   . ARG A 1 129  ? 1.387   28.905  39.450  1.00 84.18  ? 129  ARG A N   1 
ATOM   981   C  CA  . ARG A 1 129  ? 1.463   30.013  40.387  1.00 86.11  ? 129  ARG A CA  1 
ATOM   982   C  C   . ARG A 1 129  ? 2.916   30.399  40.632  1.00 84.84  ? 129  ARG A C   1 
ATOM   983   O  O   . ARG A 1 129  ? 3.172   31.508  41.099  1.00 86.52  ? 129  ARG A O   1 
ATOM   984   C  CB  . ARG A 1 129  ? 0.785   29.660  41.712  1.00 87.62  ? 129  ARG A CB  1 
ATOM   985   C  CG  . ARG A 1 129  ? -0.735  29.668  41.652  1.00 89.42  ? 129  ARG A CG  1 
ATOM   986   C  CD  . ARG A 1 129  ? -1.380  28.996  42.848  1.00 89.73  ? 129  ARG A CD  1 
ATOM   987   N  NE  . ARG A 1 129  ? -1.208  27.550  42.812  1.00 87.33  ? 129  ARG A NE  1 
ATOM   988   C  CZ  . ARG A 1 129  ? -1.807  26.688  43.630  1.00 87.63  ? 129  ARG A CZ  1 
ATOM   989   N  NH1 . ARG A 1 129  ? -1.570  25.394  43.514  1.00 85.92  ? 129  ARG A NH1 1 
ATOM   990   N  NH2 . ARG A 1 129  ? -2.640  27.111  44.563  1.00 89.63  ? 129  ARG A NH2 1 
ATOM   991   N  N   . MET A 1 130  ? 3.842   29.478  40.320  1.00 82.32  ? 130  MET A N   1 
ATOM   992   C  CA  . MET A 1 130  ? 5.265   29.690  40.544  1.00 80.83  ? 130  MET A CA  1 
ATOM   993   C  C   . MET A 1 130  ? 6.089   28.576  39.907  1.00 78.22  ? 130  MET A C   1 
ATOM   994   O  O   . MET A 1 130  ? 5.582   27.487  39.650  1.00 77.79  ? 130  MET A O   1 
ATOM   995   C  CB  . MET A 1 130  ? 5.586   29.709  42.042  1.00 80.88  ? 130  MET A CB  1 
ATOM   996   C  CG  . MET A 1 130  ? 5.133   28.455  42.756  1.00 80.17  ? 130  MET A CG  1 
ATOM   997   S  SD  . MET A 1 130  ? 5.453   28.516  44.528  1.00 81.46  ? 130  MET A SD  1 
ATOM   998   C  CE  . MET A 1 130  ? 4.192   29.668  45.064  1.00 84.28  ? 130  MET A CE  1 
ATOM   999   N  N   . ILE A 1 131  ? 7.372   28.880  39.673  1.00 77.54  ? 131  ILE A N   1 
ATOM   1000  C  CA  . ILE A 1 131  ? 8.386   27.879  39.383  1.00 74.68  ? 131  ILE A CA  1 
ATOM   1001  C  C   . ILE A 1 131  ? 9.243   27.698  40.634  1.00 73.90  ? 131  ILE A C   1 
ATOM   1002  O  O   . ILE A 1 131  ? 9.653   28.677  41.261  1.00 74.70  ? 131  ILE A O   1 
ATOM   1003  C  CB  . ILE A 1 131  ? 9.223   28.280  38.153  1.00 74.12  ? 131  ILE A CB  1 
ATOM   1004  C  CG1 . ILE A 1 131  ? 8.359   28.335  36.891  1.00 74.61  ? 131  ILE A CG1 1 
ATOM   1005  C  CG2 . ILE A 1 131  ? 10.415  27.349  37.978  1.00 71.90  ? 131  ILE A CG2 1 
ATOM   1006  C  CD1 . ILE A 1 131  ? 9.040   28.983  35.714  1.00 75.65  ? 131  ILE A CD1 1 
ATOM   1007  N  N   . GLY A 1 132  ? 9.465   26.428  40.994  1.00 71.95  ? 132  GLY A N   1 
ATOM   1008  C  CA  . GLY A 1 132  ? 10.345  26.039  42.084  1.00 71.10  ? 132  GLY A CA  1 
ATOM   1009  C  C   . GLY A 1 132  ? 11.614  25.369  41.560  1.00 69.20  ? 132  GLY A C   1 
ATOM   1010  O  O   . GLY A 1 132  ? 11.560  24.514  40.678  1.00 67.09  ? 132  GLY A O   1 
ATOM   1011  N  N   . LEU A 1 133  ? 12.757  25.794  42.102  1.00 69.51  ? 133  LEU A N   1 
ATOM   1012  C  CA  . LEU A 1 133  ? 14.043  25.242  41.723  1.00 67.88  ? 133  LEU A CA  1 
ATOM   1013  C  C   . LEU A 1 133  ? 14.711  24.698  42.980  1.00 67.85  ? 133  LEU A C   1 
ATOM   1014  O  O   . LEU A 1 133  ? 14.624  25.308  44.045  1.00 70.24  ? 133  LEU A O   1 
ATOM   1015  C  CB  . LEU A 1 133  ? 14.891  26.340  41.069  1.00 68.37  ? 133  LEU A CB  1 
ATOM   1016  C  CG  . LEU A 1 133  ? 14.341  26.960  39.782  1.00 68.44  ? 133  LEU A CG  1 
ATOM   1017  C  CD1 . LEU A 1 133  ? 15.189  28.153  39.379  1.00 70.16  ? 133  LEU A CD1 1 
ATOM   1018  C  CD2 . LEU A 1 133  ? 14.290  25.955  38.644  1.00 66.62  ? 133  LEU A CD2 1 
ATOM   1019  N  N   . ARG A 1 134  ? 15.313  23.513  42.845  1.00 65.79  ? 134  ARG A N   1 
ATOM   1020  C  CA  . ARG A 1 134  ? 16.268  23.004  43.813  1.00 65.32  ? 134  ARG A CA  1 
ATOM   1021  C  C   . ARG A 1 134  ? 17.648  23.041  43.165  1.00 64.07  ? 134  ARG A C   1 
ATOM   1022  O  O   . ARG A 1 134  ? 17.975  22.180  42.347  1.00 61.73  ? 134  ARG A O   1 
ATOM   1023  C  CB  . ARG A 1 134  ? 15.880  21.595  44.266  1.00 64.33  ? 134  ARG A CB  1 
ATOM   1024  C  CG  . ARG A 1 134  ? 16.460  21.209  45.619  1.00 64.91  ? 134  ARG A CG  1 
ATOM   1025  C  CD  . ARG A 1 134  ? 17.966  21.022  45.580  1.00 64.36  ? 134  ARG A CD  1 
ATOM   1026  N  NE  . ARG A 1 134  ? 18.357  19.959  44.658  1.00 62.19  ? 134  ARG A NE  1 
ATOM   1027  C  CZ  . ARG A 1 134  ? 18.496  18.678  44.983  1.00 60.62  ? 134  ARG A CZ  1 
ATOM   1028  N  NH1 . ARG A 1 134  ? 18.300  18.275  46.227  1.00 61.07  ? 134  ARG A NH1 1 
ATOM   1029  N  NH2 . ARG A 1 134  ? 18.838  17.804  44.059  1.00 59.13  ? 134  ARG A NH2 1 
ATOM   1030  N  N   . LEU A 1 135  ? 18.430  24.066  43.524  1.00 65.29  ? 135  LEU A N   1 
ATOM   1031  C  CA  . LEU A 1 135  ? 19.725  24.289  42.904  1.00 64.78  ? 135  LEU A CA  1 
ATOM   1032  C  C   . LEU A 1 135  ? 20.843  23.930  43.877  1.00 64.66  ? 135  LEU A C   1 
ATOM   1033  O  O   . LEU A 1 135  ? 21.871  23.394  43.467  1.00 63.59  ? 135  LEU A O   1 
ATOM   1034  C  CB  . LEU A 1 135  ? 19.837  25.751  42.467  1.00 66.27  ? 135  LEU A CB  1 
ATOM   1035  C  CG  . LEU A 1 135  ? 18.831  26.210  41.413  1.00 67.03  ? 135  LEU A CG  1 
ATOM   1036  C  CD1 . LEU A 1 135  ? 19.251  27.556  40.844  1.00 69.12  ? 135  LEU A CD1 1 
ATOM   1037  C  CD2 . LEU A 1 135  ? 18.691  25.185  40.293  1.00 64.31  ? 135  LEU A CD2 1 
ATOM   1038  N  N   . TYR A 1 136  ? 20.629  24.241  45.160  1.00 65.90  ? 136  TYR A N   1 
ATOM   1039  C  CA  . TYR A 1 136  ? 21.656  24.067  46.169  1.00 66.63  ? 136  TYR A CA  1 
ATOM   1040  C  C   . TYR A 1 136  ? 21.062  23.482  47.438  1.00 68.42  ? 136  TYR A C   1 
ATOM   1041  O  O   . TYR A 1 136  ? 19.892  23.705  47.745  1.00 70.16  ? 136  TYR A O   1 
ATOM   1042  C  CB  . TYR A 1 136  ? 22.283  25.409  46.534  1.00 67.41  ? 136  TYR A CB  1 
ATOM   1043  C  CG  . TYR A 1 136  ? 22.640  26.248  45.339  1.00 67.13  ? 136  TYR A CG  1 
ATOM   1044  C  CD1 . TYR A 1 136  ? 23.655  25.871  44.474  1.00 66.18  ? 136  TYR A CD1 1 
ATOM   1045  C  CD2 . TYR A 1 136  ? 21.950  27.414  45.061  1.00 68.60  ? 136  TYR A CD2 1 
ATOM   1046  C  CE1 . TYR A 1 136  ? 23.984  26.642  43.370  1.00 66.36  ? 136  TYR A CE1 1 
ATOM   1047  C  CE2 . TYR A 1 136  ? 22.262  28.195  43.961  1.00 68.76  ? 136  TYR A CE2 1 
ATOM   1048  C  CZ  . TYR A 1 136  ? 23.284  27.811  43.114  1.00 68.17  ? 136  TYR A CZ  1 
ATOM   1049  O  OH  . TYR A 1 136  ? 23.566  28.614  42.044  1.00 68.84  ? 136  TYR A OH  1 
ATOM   1050  N  N   . ASP A 1 137  ? 21.911  22.753  48.168  1.00 69.66  ? 137  ASP A N   1 
ATOM   1051  C  CA  . ASP A 1 137  ? 21.570  22.225  49.476  1.00 72.01  ? 137  ASP A CA  1 
ATOM   1052  C  C   . ASP A 1 137  ? 21.169  23.383  50.388  1.00 73.46  ? 137  ASP A C   1 
ATOM   1053  O  O   . ASP A 1 137  ? 21.928  24.333  50.562  1.00 74.87  ? 137  ASP A O   1 
ATOM   1054  C  CB  . ASP A 1 137  ? 22.727  21.411  50.067  1.00 73.50  ? 137  ASP A CB  1 
ATOM   1055  C  CG  . ASP A 1 137  ? 23.053  20.119  49.332  1.00 73.97  ? 137  ASP A CG  1 
ATOM   1056  O  OD1 . ASP A 1 137  ? 22.150  19.540  48.691  1.00 74.01  ? 137  ASP A OD1 1 
ATOM   1057  O  OD2 . ASP A 1 137  ? 24.212  19.686  49.418  1.00 76.05  ? 137  ASP A OD2 1 
ATOM   1058  N  N   . GLY A 1 138  ? 19.956  23.304  50.939  1.00 73.90  ? 138  GLY A N   1 
ATOM   1059  C  CA  . GLY A 1 138  ? 19.535  24.212  51.991  1.00 76.18  ? 138  GLY A CA  1 
ATOM   1060  C  C   . GLY A 1 138  ? 18.731  25.407  51.484  1.00 76.48  ? 138  GLY A C   1 
ATOM   1061  O  O   . GLY A 1 138  ? 18.338  26.254  52.281  1.00 78.99  ? 138  GLY A O   1 
ATOM   1062  N  N   . LEU A 1 139  ? 18.489  25.470  50.168  1.00 74.32  ? 139  LEU A N   1 
ATOM   1063  C  CA  . LEU A 1 139  ? 17.778  26.589  49.570  1.00 74.51  ? 139  LEU A CA  1 
ATOM   1064  C  C   . LEU A 1 139  ? 16.812  26.101  48.497  1.00 73.56  ? 139  LEU A C   1 
ATOM   1065  O  O   . LEU A 1 139  ? 17.192  25.322  47.622  1.00 72.62  ? 139  LEU A O   1 
ATOM   1066  C  CB  . LEU A 1 139  ? 18.794  27.544  48.938  1.00 74.25  ? 139  LEU A CB  1 
ATOM   1067  C  CG  . LEU A 1 139  ? 19.690  28.319  49.900  1.00 76.09  ? 139  LEU A CG  1 
ATOM   1068  C  CD1 . LEU A 1 139  ? 20.863  28.924  49.150  1.00 75.71  ? 139  LEU A CD1 1 
ATOM   1069  C  CD2 . LEU A 1 139  ? 18.912  29.407  50.622  1.00 78.36  ? 139  LEU A CD2 1 
ATOM   1070  N  N   . PHE A 1 140  ? 15.583  26.630  48.543  1.00 74.64  ? 140  PHE A N   1 
ATOM   1071  C  CA  . PHE A 1 140  ? 14.578  26.409  47.515  1.00 73.80  ? 140  PHE A CA  1 
ATOM   1072  C  C   . PHE A 1 140  ? 14.245  27.747  46.856  1.00 74.43  ? 140  PHE A C   1 
ATOM   1073  O  O   . PHE A 1 140  ? 13.769  28.669  47.523  1.00 76.63  ? 140  PHE A O   1 
ATOM   1074  C  CB  . PHE A 1 140  ? 13.352  25.722  48.129  1.00 74.89  ? 140  PHE A CB  1 
ATOM   1075  C  CG  . PHE A 1 140  ? 12.302  25.281  47.142  1.00 74.49  ? 140  PHE A CG  1 
ATOM   1076  C  CD1 . PHE A 1 140  ? 12.487  24.145  46.370  1.00 72.87  ? 140  PHE A CD1 1 
ATOM   1077  C  CD2 . PHE A 1 140  ? 11.123  25.996  46.987  1.00 76.34  ? 140  PHE A CD2 1 
ATOM   1078  C  CE1 . PHE A 1 140  ? 11.520  23.742  45.460  1.00 72.83  ? 140  PHE A CE1 1 
ATOM   1079  C  CE2 . PHE A 1 140  ? 10.155  25.589  46.078  1.00 75.98  ? 140  PHE A CE2 1 
ATOM   1080  C  CZ  . PHE A 1 140  ? 10.355  24.462  45.313  1.00 73.88  ? 140  PHE A CZ  1 
ATOM   1081  N  N   . LYS A 1 141  ? 14.515  27.856  45.547  1.00 72.28  ? 141  LYS A N   1 
ATOM   1082  C  CA  . LYS A 1 141  ? 14.298  29.110  44.839  1.00 73.95  ? 141  LYS A CA  1 
ATOM   1083  C  C   . LYS A 1 141  ? 12.920  29.102  44.190  1.00 75.11  ? 141  LYS A C   1 
ATOM   1084  O  O   . LYS A 1 141  ? 12.572  28.152  43.494  1.00 74.63  ? 141  LYS A O   1 
ATOM   1085  C  CB  . LYS A 1 141  ? 15.347  29.359  43.751  1.00 72.44  ? 141  LYS A CB  1 
ATOM   1086  C  CG  . LYS A 1 141  ? 15.295  30.751  43.129  1.00 72.95  ? 141  LYS A CG  1 
ATOM   1087  C  CD  . LYS A 1 141  ? 16.505  31.132  42.297  1.00 72.62  ? 141  LYS A CD  1 
ATOM   1088  C  CE  . LYS A 1 141  ? 17.753  31.397  43.114  1.00 73.15  ? 141  LYS A CE  1 
ATOM   1089  N  NZ  . LYS A 1 141  ? 17.707  32.717  43.782  1.00 74.43  ? 141  LYS A NZ  1 
ATOM   1090  N  N   . VAL A 1 142  ? 12.162  30.186  44.405  1.00 77.49  ? 142  VAL A N   1 
ATOM   1091  C  CA  . VAL A 1 142  ? 10.811  30.326  43.882  1.00 78.05  ? 142  VAL A CA  1 
ATOM   1092  C  C   . VAL A 1 142  ? 10.780  31.490  42.897  1.00 79.54  ? 142  VAL A C   1 
ATOM   1093  O  O   . VAL A 1 142  ? 11.144  32.608  43.256  1.00 81.50  ? 142  VAL A O   1 
ATOM   1094  C  CB  . VAL A 1 142  ? 9.791   30.556  45.016  1.00 79.27  ? 142  VAL A CB  1 
ATOM   1095  C  CG1 . VAL A 1 142  ? 8.374   30.673  44.485  1.00 80.36  ? 142  VAL A CG1 1 
ATOM   1096  C  CG2 . VAL A 1 142  ? 9.856   29.486  46.090  1.00 78.55  ? 142  VAL A CG2 1 
ATOM   1097  N  N   . ILE A 1 143  ? 10.333  31.212  41.665  1.00 79.00  ? 143  ILE A N   1 
ATOM   1098  C  CA  . ILE A 1 143  ? 10.055  32.256  40.692  1.00 80.77  ? 143  ILE A CA  1 
ATOM   1099  C  C   . ILE A 1 143  ? 8.541   32.397  40.573  1.00 82.63  ? 143  ILE A C   1 
ATOM   1100  O  O   . ILE A 1 143  ? 7.907   31.561  39.929  1.00 81.96  ? 143  ILE A O   1 
ATOM   1101  C  CB  . ILE A 1 143  ? 10.683  31.927  39.320  1.00 79.03  ? 143  ILE A CB  1 
ATOM   1102  C  CG1 . ILE A 1 143  ? 12.168  31.563  39.425  1.00 76.32  ? 143  ILE A CG1 1 
ATOM   1103  C  CG2 . ILE A 1 143  ? 10.436  33.064  38.337  1.00 80.85  ? 143  ILE A CG2 1 
ATOM   1104  C  CD1 . ILE A 1 143  ? 12.715  30.834  38.219  1.00 73.48  ? 143  ILE A CD1 1 
ATOM   1105  N  N   . PRO A 1 144  ? 7.921   33.444  41.173  1.00 85.75  ? 144  PRO A N   1 
ATOM   1106  C  CA  . PRO A 1 144  ? 6.480   33.677  41.026  1.00 87.40  ? 144  PRO A CA  1 
ATOM   1107  C  C   . PRO A 1 144  ? 6.167   33.960  39.561  1.00 87.70  ? 144  PRO A C   1 
ATOM   1108  O  O   . PRO A 1 144  ? 6.890   34.717  38.918  1.00 88.73  ? 144  PRO A O   1 
ATOM   1109  C  CB  . PRO A 1 144  ? 6.209   34.969  41.813  1.00 89.86  ? 144  PRO A CB  1 
ATOM   1110  C  CG  . PRO A 1 144  ? 7.421   35.161  42.704  1.00 89.63  ? 144  PRO A CG  1 
ATOM   1111  C  CD  . PRO A 1 144  ? 8.573   34.464  42.009  1.00 86.86  ? 144  PRO A CD  1 
ATOM   1112  N  N   . LEU A 1 145  ? 5.104   33.339  39.041  1.00 87.34  ? 145  LEU A N   1 
ATOM   1113  C  CA  . LEU A 1 145  ? 4.681   33.578  37.670  1.00 88.33  ? 145  LEU A CA  1 
ATOM   1114  C  C   . LEU A 1 145  ? 3.565   34.620  37.656  1.00 92.63  ? 145  LEU A C   1 
ATOM   1115  O  O   . LEU A 1 145  ? 2.473   34.379  38.171  1.00 93.08  ? 145  LEU A O   1 
ATOM   1116  C  CB  . LEU A 1 145  ? 4.207   32.262  37.051  1.00 85.62  ? 145  LEU A CB  1 
ATOM   1117  C  CG  . LEU A 1 145  ? 5.294   31.267  36.661  1.00 82.75  ? 145  LEU A CG  1 
ATOM   1118  C  CD1 . LEU A 1 145  ? 4.666   29.928  36.307  1.00 80.46  ? 145  LEU A CD1 1 
ATOM   1119  C  CD2 . LEU A 1 145  ? 6.121   31.799  35.498  1.00 82.91  ? 145  LEU A CD2 1 
ATOM   1120  N  N   . ASP A 1 146  ? 3.858   35.780  37.058  1.00 96.35  ? 146  ASP A N   1 
ATOM   1121  C  CA  . ASP A 1 146  ? 2.944   36.909  37.069  1.00 101.62 ? 146  ASP A CA  1 
ATOM   1122  C  C   . ASP A 1 146  ? 3.156   37.769  35.826  1.00 104.85 ? 146  ASP A C   1 
ATOM   1123  O  O   . ASP A 1 146  ? 4.212   38.373  35.646  1.00 105.65 ? 146  ASP A O   1 
ATOM   1124  C  CB  . ASP A 1 146  ? 3.073   37.734  38.352  1.00 103.49 ? 146  ASP A CB  1 
ATOM   1125  C  CG  . ASP A 1 146  ? 2.098   38.901  38.396  1.00 108.97 ? 146  ASP A CG  1 
ATOM   1126  O  OD1 . ASP A 1 146  ? 0.897   38.681  38.122  1.00 110.31 ? 146  ASP A OD1 1 
ATOM   1127  O  OD2 . ASP A 1 146  ? 2.539   40.027  38.693  1.00 112.02 ? 146  ASP A OD2 1 
ATOM   1128  N  N   . ARG A 1 147  ? 2.106   37.841  35.005  1.00 108.89 ? 147  ARG A N   1 
ATOM   1129  C  CA  . ARG A 1 147  ? 2.113   38.523  33.722  1.00 113.02 ? 147  ARG A CA  1 
ATOM   1130  C  C   . ARG A 1 147  ? 2.333   40.024  33.907  1.00 116.63 ? 147  ARG A C   1 
ATOM   1131  O  O   . ARG A 1 147  ? 3.090   40.628  33.151  1.00 118.55 ? 147  ARG A O   1 
ATOM   1132  C  CB  . ARG A 1 147  ? 0.798   38.225  32.996  1.00 118.04 ? 147  ARG A CB  1 
ATOM   1133  C  CG  . ARG A 1 147  ? 0.591   36.741  32.721  1.00 119.39 ? 147  ARG A CG  1 
ATOM   1134  C  CD  . ARG A 1 147  ? 1.591   36.206  31.706  1.00 120.54 ? 147  ARG A CD  1 
ATOM   1135  N  NE  . ARG A 1 147  ? 1.465   36.930  30.441  1.00 125.38 ? 147  ARG A NE  1 
ATOM   1136  C  CZ  . ARG A 1 147  ? 0.516   36.720  29.520  1.00 129.35 ? 147  ARG A CZ  1 
ATOM   1137  N  NH1 . ARG A 1 147  ? -0.409  35.787  29.698  1.00 129.86 ? 147  ARG A NH1 1 
ATOM   1138  N  NH2 . ARG A 1 147  ? 0.492   37.448  28.416  1.00 130.34 ? 147  ARG A NH2 1 
ATOM   1139  N  N   . ASP A 1 148  ? 1.681   40.616  34.918  1.00 117.99 ? 148  ASP A N   1 
ATOM   1140  C  CA  . ASP A 1 148  ? 1.620   42.063  35.058  1.00 120.92 ? 148  ASP A CA  1 
ATOM   1141  C  C   . ASP A 1 148  ? 2.764   42.579  35.931  1.00 120.55 ? 148  ASP A C   1 
ATOM   1142  O  O   . ASP A 1 148  ? 2.518   43.160  36.987  1.00 122.80 ? 148  ASP A O   1 
ATOM   1143  C  CB  . ASP A 1 148  ? 0.254   42.512  35.588  1.00 124.93 ? 148  ASP A CB  1 
ATOM   1144  C  CG  . ASP A 1 148  ? -0.916  42.123  34.698  1.00 126.38 ? 148  ASP A CG  1 
ATOM   1145  O  OD1 . ASP A 1 148  ? -0.695  41.366  33.721  1.00 124.75 ? 148  ASP A OD1 1 
ATOM   1146  O  OD2 . ASP A 1 148  ? -2.047  42.568  34.998  1.00 129.11 ? 148  ASP A OD2 1 
ATOM   1147  N  N   . ASN A 1 149  ? 4.002   42.394  35.448  1.00 118.80 ? 149  ASN A N   1 
ATOM   1148  C  CA  . ASN A 1 149  ? 5.230   42.806  36.117  1.00 117.43 ? 149  ASN A CA  1 
ATOM   1149  C  C   . ASN A 1 149  ? 6.357   42.879  35.089  1.00 115.84 ? 149  ASN A C   1 
ATOM   1150  O  O   . ASN A 1 149  ? 6.376   42.114  34.127  1.00 114.56 ? 149  ASN A O   1 
ATOM   1151  C  CB  . ASN A 1 149  ? 5.670   41.806  37.192  1.00 115.25 ? 149  ASN A CB  1 
ATOM   1152  C  CG  . ASN A 1 149  ? 4.873   41.883  38.476  1.00 116.40 ? 149  ASN A CG  1 
ATOM   1153  O  OD1 . ASN A 1 149  ? 4.316   42.924  38.812  1.00 119.10 ? 149  ASN A OD1 1 
ATOM   1154  N  ND2 . ASN A 1 149  ? 4.856   40.794  39.227  1.00 115.19 ? 149  ASN A ND2 1 
ATOM   1155  N  N   . LYS A 1 150  ? 7.311   43.786  35.314  1.00 115.71 ? 150  LYS A N   1 
ATOM   1156  C  CA  . LYS A 1 150  ? 8.476   43.849  34.447  1.00 115.03 ? 150  LYS A CA  1 
ATOM   1157  C  C   . LYS A 1 150  ? 9.605   43.019  35.055  1.00 111.49 ? 150  LYS A C   1 
ATOM   1158  O  O   . LYS A 1 150  ? 10.615  42.759  34.402  1.00 110.56 ? 150  LYS A O   1 
ATOM   1159  C  CB  . LYS A 1 150  ? 8.878   45.303  34.183  1.00 118.93 ? 150  LYS A CB  1 
ATOM   1160  C  CG  . LYS A 1 150  ? 8.162   45.989  33.024  1.00 123.22 ? 150  LYS A CG  1 
ATOM   1161  C  CD  . LYS A 1 150  ? 8.443   45.363  31.663  1.00 123.34 ? 150  LYS A CD  1 
ATOM   1162  C  CE  . LYS A 1 150  ? 7.821   46.125  30.507  1.00 127.67 ? 150  LYS A CE  1 
ATOM   1163  N  NZ  . LYS A 1 150  ? 7.691   45.287  29.289  1.00 126.48 ? 150  LYS A NZ  1 
ATOM   1164  N  N   . GLU A 1 151  ? 9.397   42.592  36.306  1.00 109.49 ? 151  GLU A N   1 
ATOM   1165  C  CA  . GLU A 1 151  ? 10.402  41.881  37.076  1.00 105.82 ? 151  GLU A CA  1 
ATOM   1166  C  C   . GLU A 1 151  ? 9.759   40.653  37.709  1.00 103.03 ? 151  GLU A C   1 
ATOM   1167  O  O   . GLU A 1 151  ? 8.897   40.775  38.580  1.00 104.25 ? 151  GLU A O   1 
ATOM   1168  C  CB  . GLU A 1 151  ? 11.013  42.789  38.145  1.00 107.20 ? 151  GLU A CB  1 
ATOM   1169  C  CG  . GLU A 1 151  ? 12.153  43.649  37.635  1.00 108.59 ? 151  GLU A CG  1 
ATOM   1170  C  CD  . GLU A 1 151  ? 12.944  44.327  38.739  1.00 109.91 ? 151  GLU A CD  1 
ATOM   1171  O  OE1 . GLU A 1 151  ? 12.320  44.752  39.735  1.00 111.80 ? 151  GLU A OE1 1 
ATOM   1172  O  OE2 . GLU A 1 151  ? 14.179  44.415  38.610  1.00 109.63 ? 151  GLU A OE2 1 
ATOM   1173  N  N   . LEU A 1 152  ? 10.161  39.482  37.205  1.00 99.21  ? 152  LEU A N   1 
ATOM   1174  C  CA  . LEU A 1 152  ? 9.864   38.206  37.830  1.00 95.84  ? 152  LEU A CA  1 
ATOM   1175  C  C   . LEU A 1 152  ? 10.932  37.966  38.888  1.00 94.47  ? 152  LEU A C   1 
ATOM   1176  O  O   . LEU A 1 152  ? 11.953  37.352  38.598  1.00 93.88  ? 152  LEU A O   1 
ATOM   1177  C  CB  . LEU A 1 152  ? 9.911   37.104  36.765  1.00 92.89  ? 152  LEU A CB  1 
ATOM   1178  C  CG  . LEU A 1 152  ? 8.670   36.950  35.888  1.00 93.53  ? 152  LEU A CG  1 
ATOM   1179  C  CD1 . LEU A 1 152  ? 8.977   36.110  34.660  1.00 90.85  ? 152  LEU A CD1 1 
ATOM   1180  C  CD2 . LEU A 1 152  ? 7.537   36.323  36.676  1.00 94.07  ? 152  LEU A CD2 1 
ATOM   1181  N  N   . LYS A 1 153  ? 10.700  38.479  40.100  1.00 95.63  ? 153  LYS A N   1 
ATOM   1182  C  CA  . LYS A 1 153  ? 11.697  38.428  41.156  1.00 96.50  ? 153  LYS A CA  1 
ATOM   1183  C  C   . LYS A 1 153  ? 11.671  37.075  41.861  1.00 93.47  ? 153  LYS A C   1 
ATOM   1184  O  O   . LYS A 1 153  ? 10.696  36.750  42.538  1.00 93.17  ? 153  LYS A O   1 
ATOM   1185  C  CB  . LYS A 1 153  ? 11.404  39.481  42.223  1.00 101.92 ? 153  LYS A CB  1 
ATOM   1186  C  CG  . LYS A 1 153  ? 11.793  40.909  41.861  1.00 108.46 ? 153  LYS A CG  1 
ATOM   1187  C  CD  . LYS A 1 153  ? 11.357  41.937  42.895  1.00 112.85 ? 153  LYS A CD  1 
ATOM   1188  C  CE  . LYS A 1 153  ? 12.181  41.873  44.166  1.00 113.34 ? 153  LYS A CE  1 
ATOM   1189  N  NZ  . LYS A 1 153  ? 11.765  42.917  45.131  1.00 116.91 ? 153  LYS A NZ  1 
ATOM   1190  N  N   . ALA A 1 154  ? 12.779  36.331  41.737  1.00 90.24  ? 154  ALA A N   1 
ATOM   1191  C  CA  . ALA A 1 154  ? 12.966  35.067  42.423  1.00 86.64  ? 154  ALA A CA  1 
ATOM   1192  C  C   . ALA A 1 154  ? 13.370  35.339  43.869  1.00 86.93  ? 154  ALA A C   1 
ATOM   1193  O  O   . ALA A 1 154  ? 14.039  36.329  44.153  1.00 88.19  ? 154  ALA A O   1 
ATOM   1194  C  CB  . ALA A 1 154  ? 14.012  34.259  41.697  1.00 84.15  ? 154  ALA A CB  1 
ATOM   1195  N  N   . PHE A 1 155  ? 12.946  34.456  44.776  1.00 85.79  ? 155  PHE A N   1 
ATOM   1196  C  CA  . PHE A 1 155  ? 13.403  34.522  46.154  1.00 86.97  ? 155  PHE A CA  1 
ATOM   1197  C  C   . PHE A 1 155  ? 13.779  33.126  46.646  1.00 84.67  ? 155  PHE A C   1 
ATOM   1198  O  O   . PHE A 1 155  ? 13.284  32.127  46.132  1.00 82.86  ? 155  PHE A O   1 
ATOM   1199  C  CB  . PHE A 1 155  ? 12.375  35.232  47.041  1.00 90.28  ? 155  PHE A CB  1 
ATOM   1200  C  CG  . PHE A 1 155  ? 11.032  34.556  47.133  1.00 90.32  ? 155  PHE A CG  1 
ATOM   1201  C  CD1 . PHE A 1 155  ? 10.799  33.569  48.077  1.00 89.91  ? 155  PHE A CD1 1 
ATOM   1202  C  CD2 . PHE A 1 155  ? 9.999   34.916  46.280  1.00 91.45  ? 155  PHE A CD2 1 
ATOM   1203  C  CE1 . PHE A 1 155  ? 9.563   32.945  48.154  1.00 91.15  ? 155  PHE A CE1 1 
ATOM   1204  C  CE2 . PHE A 1 155  ? 8.762   34.295  46.361  1.00 92.07  ? 155  PHE A CE2 1 
ATOM   1205  C  CZ  . PHE A 1 155  ? 8.546   33.308  47.298  1.00 91.88  ? 155  PHE A CZ  1 
ATOM   1206  N  N   . ASN A 1 156  ? 14.676  33.076  47.637  1.00 85.22  ? 156  ASN A N   1 
ATOM   1207  C  CA  . ASN A 1 156  ? 15.092  31.823  48.244  1.00 83.35  ? 156  ASN A CA  1 
ATOM   1208  C  C   . ASN A 1 156  ? 14.311  31.620  49.538  1.00 84.28  ? 156  ASN A C   1 
ATOM   1209  O  O   . ASN A 1 156  ? 14.052  32.573  50.273  1.00 86.69  ? 156  ASN A O   1 
ATOM   1210  C  CB  . ASN A 1 156  ? 16.603  31.765  48.501  1.00 83.35  ? 156  ASN A CB  1 
ATOM   1211  C  CG  . ASN A 1 156  ? 17.431  31.505  47.258  1.00 81.87  ? 156  ASN A CG  1 
ATOM   1212  O  OD1 . ASN A 1 156  ? 18.380  32.235  46.976  1.00 83.09  ? 156  ASN A OD1 1 
ATOM   1213  N  ND2 . ASN A 1 156  ? 17.090  30.468  46.511  1.00 79.84  ? 156  ASN A ND2 1 
ATOM   1214  N  N   . ILE A 1 157  ? 13.922  30.366  49.790  1.00 81.94  ? 157  ILE A N   1 
ATOM   1215  C  CA  . ILE A 1 157  ? 13.392  29.976  51.086  1.00 82.80  ? 157  ILE A CA  1 
ATOM   1216  C  C   . ILE A 1 157  ? 14.340  28.949  51.698  1.00 82.38  ? 157  ILE A C   1 
ATOM   1217  O  O   . ILE A 1 157  ? 14.640  27.932  51.076  1.00 79.21  ? 157  ILE A O   1 
ATOM   1218  C  CB  . ILE A 1 157  ? 11.956  29.420  50.977  1.00 81.36  ? 157  ILE A CB  1 
ATOM   1219  C  CG1 . ILE A 1 157  ? 11.023  30.340  50.189  1.00 81.14  ? 157  ILE A CG1 1 
ATOM   1220  C  CG2 . ILE A 1 157  ? 11.391  29.116  52.355  1.00 82.36  ? 157  ILE A CG2 1 
ATOM   1221  C  CD1 . ILE A 1 157  ? 9.688   29.716  49.877  1.00 80.33  ? 157  ILE A CD1 1 
ATOM   1222  N  N   . ARG A 1 158  ? 14.791  29.229  52.925  1.00 85.54  ? 158  ARG A N   1 
ATOM   1223  C  CA  . ARG A 1 158  ? 15.678  28.343  53.658  1.00 86.80  ? 158  ARG A CA  1 
ATOM   1224  C  C   . ARG A 1 158  ? 14.991  26.994  53.836  1.00 85.95  ? 158  ARG A C   1 
ATOM   1225  O  O   . ARG A 1 158  ? 13.820  26.935  54.201  1.00 87.19  ? 158  ARG A O   1 
ATOM   1226  C  CB  . ARG A 1 158  ? 16.013  28.982  55.009  1.00 91.84  ? 158  ARG A CB  1 
ATOM   1227  C  CG  . ARG A 1 158  ? 16.429  28.010  56.103  1.00 93.93  ? 158  ARG A CG  1 
ATOM   1228  C  CD  . ARG A 1 158  ? 17.917  27.743  56.118  1.00 95.13  ? 158  ARG A CD  1 
ATOM   1229  N  NE  . ARG A 1 158  ? 18.184  26.718  57.113  1.00 98.26  ? 158  ARG A NE  1 
ATOM   1230  C  CZ  . ARG A 1 158  ? 19.237  25.911  57.104  1.00 97.99  ? 158  ARG A CZ  1 
ATOM   1231  N  NH1 . ARG A 1 158  ? 20.133  26.013  56.138  1.00 96.78  ? 158  ARG A NH1 1 
ATOM   1232  N  NH2 . ARG A 1 158  ? 19.388  25.004  58.056  1.00 99.10  ? 158  ARG A NH2 1 
ATOM   1233  N  N   . LEU A 1 159  ? 15.728  25.915  53.559  1.00 84.72  ? 159  LEU A N   1 
ATOM   1234  C  CA  . LEU A 1 159  ? 15.214  24.565  53.714  1.00 83.81  ? 159  LEU A CA  1 
ATOM   1235  C  C   . LEU A 1 159  ? 16.065  23.835  54.750  1.00 85.08  ? 159  LEU A C   1 
ATOM   1236  O  O   . LEU A 1 159  ? 17.267  23.676  54.563  1.00 84.40  ? 159  LEU A O   1 
ATOM   1237  C  CB  . LEU A 1 159  ? 15.257  23.866  52.350  1.00 80.41  ? 159  LEU A CB  1 
ATOM   1238  C  CG  . LEU A 1 159  ? 14.429  22.587  52.223  1.00 79.78  ? 159  LEU A CG  1 
ATOM   1239  C  CD1 . LEU A 1 159  ? 13.138  22.683  53.018  1.00 82.20  ? 159  LEU A CD1 1 
ATOM   1240  C  CD2 . LEU A 1 159  ? 14.116  22.289  50.767  1.00 77.20  ? 159  LEU A CD2 1 
ATOM   1241  N  N   . GLU A 1 160  ? 15.425  23.404  55.842  1.00 87.47  ? 160  GLU A N   1 
ATOM   1242  C  CA  . GLU A 1 160  ? 16.107  22.756  56.950  1.00 89.09  ? 160  GLU A CA  1 
ATOM   1243  C  C   . GLU A 1 160  ? 16.615  21.381  56.516  1.00 86.85  ? 160  GLU A C   1 
ATOM   1244  O  O   . GLU A 1 160  ? 17.643  20.913  56.996  1.00 87.77  ? 160  GLU A O   1 
ATOM   1245  C  CB  . GLU A 1 160  ? 15.164  22.665  58.149  1.00 93.34  ? 160  GLU A CB  1 
ATOM   1246  C  CG  . GLU A 1 160  ? 15.863  22.359  59.457  1.00 98.16  ? 160  GLU A CG  1 
ATOM   1247  C  CD  . GLU A 1 160  ? 14.922  21.855  60.535  1.00 102.48 ? 160  GLU A CD  1 
ATOM   1248  O  OE1 . GLU A 1 160  ? 14.766  20.621  60.643  1.00 103.35 ? 160  GLU A OE1 1 
ATOM   1249  O  OE2 . GLU A 1 160  ? 14.347  22.695  61.263  1.00 106.22 ? 160  GLU A OE2 1 
ATOM   1250  N  N   . GLU A 1 161  ? 15.886  20.736  55.601  1.00 84.59  ? 161  GLU A N   1 
ATOM   1251  C  CA  . GLU A 1 161  ? 16.310  19.463  55.043  1.00 81.93  ? 161  GLU A CA  1 
ATOM   1252  C  C   . GLU A 1 161  ? 17.388  19.738  53.995  1.00 79.56  ? 161  GLU A C   1 
ATOM   1253  O  O   . GLU A 1 161  ? 17.117  20.353  52.963  1.00 77.76  ? 161  GLU A O   1 
ATOM   1254  C  CB  . GLU A 1 161  ? 15.101  18.684  54.516  1.00 80.87  ? 161  GLU A CB  1 
ATOM   1255  C  CG  . GLU A 1 161  ? 14.138  18.240  55.611  1.00 83.64  ? 161  GLU A CG  1 
ATOM   1256  C  CD  . GLU A 1 161  ? 13.230  19.306  56.214  1.00 86.23  ? 161  GLU A CD  1 
ATOM   1257  O  OE1 . GLU A 1 161  ? 12.891  20.277  55.504  1.00 85.50  ? 161  GLU A OE1 1 
ATOM   1258  O  OE2 . GLU A 1 161  ? 12.856  19.166  57.397  1.00 88.68  ? 161  GLU A OE2 1 
ATOM   1259  N  N   . LEU A 1 162  ? 18.617  19.292  54.290  1.00 79.30  ? 162  LEU A N   1 
ATOM   1260  C  CA  . LEU A 1 162  ? 19.803  19.705  53.550  1.00 77.78  ? 162  LEU A CA  1 
ATOM   1261  C  C   . LEU A 1 162  ? 20.138  18.718  52.432  1.00 75.72  ? 162  LEU A C   1 
ATOM   1262  O  O   . LEU A 1 162  ? 21.014  18.987  51.616  1.00 74.88  ? 162  LEU A O   1 
ATOM   1263  C  CB  . LEU A 1 162  ? 20.990  19.859  54.514  1.00 78.11  ? 162  LEU A CB  1 
ATOM   1264  C  CG  . LEU A 1 162  ? 21.005  21.134  55.359  1.00 79.88  ? 162  LEU A CG  1 
ATOM   1265  C  CD1 . LEU A 1 162  ? 21.965  21.005  56.528  1.00 82.03  ? 162  LEU A CD1 1 
ATOM   1266  C  CD2 . LEU A 1 162  ? 21.357  22.352  54.522  1.00 78.57  ? 162  LEU A CD2 1 
ATOM   1267  N  N   . HIS A 1 163  ? 19.467  17.565  52.411  1.00 76.35  ? 163  HIS A N   1 
ATOM   1268  C  CA  . HIS A 1 163  ? 19.795  16.528  51.448  1.00 74.85  ? 163  HIS A CA  1 
ATOM   1269  C  C   . HIS A 1 163  ? 18.503  16.031  50.823  1.00 72.47  ? 163  HIS A C   1 
ATOM   1270  O  O   . HIS A 1 163  ? 17.909  15.083  51.327  1.00 73.33  ? 163  HIS A O   1 
ATOM   1271  C  CB  . HIS A 1 163  ? 20.600  15.411  52.132  1.00 78.49  ? 163  HIS A CB  1 
ATOM   1272  C  CG  . HIS A 1 163  ? 21.079  14.321  51.228  1.00 80.36  ? 163  HIS A CG  1 
ATOM   1273  N  ND1 . HIS A 1 163  ? 21.887  14.554  50.131  1.00 80.67  ? 163  HIS A ND1 1 
ATOM   1274  C  CD2 . HIS A 1 163  ? 20.910  12.982  51.278  1.00 82.54  ? 163  HIS A CD2 1 
ATOM   1275  C  CE1 . HIS A 1 163  ? 22.172  13.411  49.534  1.00 80.19  ? 163  HIS A CE1 1 
ATOM   1276  N  NE2 . HIS A 1 163  ? 21.586  12.432  50.221  1.00 81.63  ? 163  HIS A NE2 1 
ATOM   1277  N  N   . VAL A 1 164  ? 18.072  16.712  49.756  1.00 69.69  ? 164  VAL A N   1 
ATOM   1278  C  CA  . VAL A 1 164  ? 16.797  16.425  49.112  1.00 69.20  ? 164  VAL A CA  1 
ATOM   1279  C  C   . VAL A 1 164  ? 17.056  15.486  47.939  1.00 67.38  ? 164  VAL A C   1 
ATOM   1280  O  O   . VAL A 1 164  ? 17.994  15.682  47.171  1.00 65.90  ? 164  VAL A O   1 
ATOM   1281  C  CB  . VAL A 1 164  ? 16.054  17.709  48.675  1.00 68.42  ? 164  VAL A CB  1 
ATOM   1282  C  CG1 . VAL A 1 164  ? 15.047  17.464  47.564  1.00 66.02  ? 164  VAL A CG1 1 
ATOM   1283  C  CG2 . VAL A 1 164  ? 15.392  18.414  49.844  1.00 69.76  ? 164  VAL A CG2 1 
ATOM   1284  N  N   . ILE A 1 165  ? 16.200  14.475  47.803  1.00 67.61  ? 165  ILE A N   1 
ATOM   1285  C  CA  . ILE A 1 165  ? 16.424  13.455  46.797  1.00 67.48  ? 165  ILE A CA  1 
ATOM   1286  C  C   . ILE A 1 165  ? 15.630  13.785  45.532  1.00 67.62  ? 165  ILE A C   1 
ATOM   1287  O  O   . ILE A 1 165  ? 16.192  13.748  44.439  1.00 67.31  ? 165  ILE A O   1 
ATOM   1288  C  CB  . ILE A 1 165  ? 16.162  12.052  47.377  1.00 68.54  ? 165  ILE A CB  1 
ATOM   1289  C  CG1 . ILE A 1 165  ? 17.420  11.497  48.034  1.00 68.58  ? 165  ILE A CG1 1 
ATOM   1290  C  CG2 . ILE A 1 165  ? 15.719  11.078  46.307  1.00 68.66  ? 165  ILE A CG2 1 
ATOM   1291  C  CD1 . ILE A 1 165  ? 17.804  12.173  49.320  1.00 71.38  ? 165  ILE A CD1 1 
ATOM   1292  N  N   . ASP A 1 166  ? 14.339  14.108  45.693  1.00 68.54  ? 166  ASP A N   1 
ATOM   1293  C  CA  . ASP A 1 166  ? 13.481  14.563  44.612  1.00 67.69  ? 166  ASP A CA  1 
ATOM   1294  C  C   . ASP A 1 166  ? 12.360  15.397  45.225  1.00 69.47  ? 166  ASP A C   1 
ATOM   1295  O  O   . ASP A 1 166  ? 11.979  15.168  46.371  1.00 70.43  ? 166  ASP A O   1 
ATOM   1296  C  CB  . ASP A 1 166  ? 12.937  13.378  43.808  1.00 67.93  ? 166  ASP A CB  1 
ATOM   1297  C  CG  . ASP A 1 166  ? 12.314  13.754  42.468  1.00 69.03  ? 166  ASP A CG  1 
ATOM   1298  O  OD1 . ASP A 1 166  ? 12.464  14.932  42.050  1.00 69.09  ? 166  ASP A OD1 1 
ATOM   1299  O  OD2 . ASP A 1 166  ? 11.677  12.862  41.838  1.00 69.40  ? 166  ASP A OD2 1 
ATOM   1300  N  N   . VAL A 1 167  ? 11.850  16.368  44.455  1.00 69.94  ? 167  VAL A N   1 
ATOM   1301  C  CA  . VAL A 1 167  ? 10.721  17.190  44.867  1.00 70.37  ? 167  VAL A CA  1 
ATOM   1302  C  C   . VAL A 1 167  ? 9.753   17.344  43.693  1.00 68.98  ? 167  VAL A C   1 
ATOM   1303  O  O   . VAL A 1 167  ? 10.171  17.460  42.537  1.00 67.20  ? 167  VAL A O   1 
ATOM   1304  C  CB  . VAL A 1 167  ? 11.182  18.572  45.371  1.00 72.43  ? 167  VAL A CB  1 
ATOM   1305  C  CG1 . VAL A 1 167  ? 10.024  19.391  45.913  1.00 75.50  ? 167  VAL A CG1 1 
ATOM   1306  C  CG2 . VAL A 1 167  ? 12.267  18.486  46.423  1.00 73.51  ? 167  VAL A CG2 1 
ATOM   1307  N  N   . LYS A 1 168  ? 8.452   17.364  44.022  1.00 69.83  ? 168  LYS A N   1 
ATOM   1308  C  CA  . LYS A 1 168  ? 7.373   17.705  43.099  1.00 68.59  ? 168  LYS A CA  1 
ATOM   1309  C  C   . LYS A 1 168  ? 6.400   18.677  43.768  1.00 69.61  ? 168  LYS A C   1 
ATOM   1310  O  O   . LYS A 1 168  ? 6.334   18.764  44.995  1.00 69.89  ? 168  LYS A O   1 
ATOM   1311  C  CB  . LYS A 1 168  ? 6.597   16.459  42.652  1.00 66.62  ? 168  LYS A CB  1 
ATOM   1312  C  CG  . LYS A 1 168  ? 7.301   15.548  41.658  1.00 65.05  ? 168  LYS A CG  1 
ATOM   1313  C  CD  . LYS A 1 168  ? 7.678   16.235  40.366  1.00 64.73  ? 168  LYS A CD  1 
ATOM   1314  C  CE  . LYS A 1 168  ? 8.043   15.277  39.250  1.00 64.37  ? 168  LYS A CE  1 
ATOM   1315  N  NZ  . LYS A 1 168  ? 9.240   14.459  39.565  1.00 64.32  ? 168  LYS A NZ  1 
ATOM   1316  N  N   . PHE A 1 169  ? 5.646   19.410  42.938  1.00 69.87  ? 169  PHE A N   1 
ATOM   1317  C  CA  . PHE A 1 169  ? 4.454   20.111  43.399  1.00 71.44  ? 169  PHE A CA  1 
ATOM   1318  C  C   . PHE A 1 169  ? 3.247   19.177  43.333  1.00 71.51  ? 169  PHE A C   1 
ATOM   1319  O  O   . PHE A 1 169  ? 3.062   18.464  42.346  1.00 69.92  ? 169  PHE A O   1 
ATOM   1320  C  CB  . PHE A 1 169  ? 4.171   21.343  42.536  1.00 71.99  ? 169  PHE A CB  1 
ATOM   1321  C  CG  . PHE A 1 169  ? 4.933   22.588  42.915  1.00 72.33  ? 169  PHE A CG  1 
ATOM   1322  C  CD1 . PHE A 1 169  ? 4.629   23.285  44.075  1.00 73.93  ? 169  PHE A CD1 1 
ATOM   1323  C  CD2 . PHE A 1 169  ? 5.941   23.078  42.099  1.00 71.00  ? 169  PHE A CD2 1 
ATOM   1324  C  CE1 . PHE A 1 169  ? 5.323   24.434  44.418  1.00 73.99  ? 169  PHE A CE1 1 
ATOM   1325  C  CE2 . PHE A 1 169  ? 6.638   24.226  42.442  1.00 71.30  ? 169  PHE A CE2 1 
ATOM   1326  C  CZ  . PHE A 1 169  ? 6.329   24.900  43.602  1.00 73.05  ? 169  PHE A CZ  1 
ATOM   1327  N  N   . LEU A 1 170  ? 2.420   19.207  44.386  1.00 73.24  ? 170  LEU A N   1 
ATOM   1328  C  CA  . LEU A 1 170  ? 1.202   18.410  44.453  1.00 73.82  ? 170  LEU A CA  1 
ATOM   1329  C  C   . LEU A 1 170  ? 0.077   19.089  43.675  1.00 74.94  ? 170  LEU A C   1 
ATOM   1330  O  O   . LEU A 1 170  ? 0.024   20.314  43.573  1.00 76.00  ? 170  LEU A O   1 
ATOM   1331  C  CB  . LEU A 1 170  ? 0.800   18.207  45.917  1.00 74.79  ? 170  LEU A CB  1 
ATOM   1332  C  CG  . LEU A 1 170  ? 1.736   17.344  46.762  1.00 73.91  ? 170  LEU A CG  1 
ATOM   1333  C  CD1 . LEU A 1 170  ? 1.154   17.127  48.148  1.00 75.79  ? 170  LEU A CD1 1 
ATOM   1334  C  CD2 . LEU A 1 170  ? 2.018   16.006  46.093  1.00 72.12  ? 170  LEU A CD2 1 
ATOM   1335  N  N   . TYR A 1 171  ? -0.815  18.256  43.133  1.00 75.27  ? 171  TYR A N   1 
ATOM   1336  C  CA  . TYR A 1 171  ? -2.039  18.694  42.484  1.00 77.00  ? 171  TYR A CA  1 
ATOM   1337  C  C   . TYR A 1 171  ? -3.151  18.843  43.526  1.00 79.66  ? 171  TYR A C   1 
ATOM   1338  O  O   . TYR A 1 171  ? -3.091  18.227  44.588  1.00 79.41  ? 171  TYR A O   1 
ATOM   1339  C  CB  . TYR A 1 171  ? -2.451  17.649  41.447  1.00 75.48  ? 171  TYR A CB  1 
ATOM   1340  C  CG  . TYR A 1 171  ? -1.615  17.588  40.194  1.00 73.01  ? 171  TYR A CG  1 
ATOM   1341  C  CD1 . TYR A 1 171  ? -0.475  16.804  40.122  1.00 70.94  ? 171  TYR A CD1 1 
ATOM   1342  C  CD2 . TYR A 1 171  ? -2.006  18.271  39.055  1.00 73.01  ? 171  TYR A CD2 1 
ATOM   1343  C  CE1 . TYR A 1 171  ? 0.268   16.728  38.953  1.00 69.36  ? 171  TYR A CE1 1 
ATOM   1344  C  CE2 . TYR A 1 171  ? -1.281  18.202  37.880  1.00 71.33  ? 171  TYR A CE2 1 
ATOM   1345  C  CZ  . TYR A 1 171  ? -0.139  17.429  37.828  1.00 69.67  ? 171  TYR A CZ  1 
ATOM   1346  O  OH  . TYR A 1 171  ? 0.553   17.386  36.653  1.00 68.44  ? 171  TYR A OH  1 
ATOM   1347  N  N   . GLY A 1 172  ? -4.154  19.678  43.219  1.00 81.98  ? 172  GLY A N   1 
ATOM   1348  C  CA  . GLY A 1 172  ? -5.387  19.735  43.989  1.00 86.41  ? 172  GLY A CA  1 
ATOM   1349  C  C   . GLY A 1 172  ? -5.204  20.359  45.370  1.00 89.63  ? 172  GLY A C   1 
ATOM   1350  O  O   . GLY A 1 172  ? -5.815  19.923  46.343  1.00 90.88  ? 172  GLY A O   1 
ATOM   1351  N  N   . CYS A 1 173  ? -4.366  21.397  45.434  1.00 91.83  ? 173  CYS A N   1 
ATOM   1352  C  CA  . CYS A 1 173  ? -4.080  22.080  46.686  1.00 95.27  ? 173  CYS A CA  1 
ATOM   1353  C  C   . CYS A 1 173  ? -4.484  23.552  46.591  1.00 97.82  ? 173  CYS A C   1 
ATOM   1354  O  O   . CYS A 1 173  ? -4.336  24.184  45.547  1.00 97.30  ? 173  CYS A O   1 
ATOM   1355  C  CB  . CYS A 1 173  ? -2.602  21.956  47.040  1.00 93.46  ? 173  CYS A CB  1 
ATOM   1356  S  SG  . CYS A 1 173  ? -2.068  20.249  47.326  1.00 92.05  ? 173  CYS A SG  1 
ATOM   1357  N  N   . GLN A 1 174  ? -4.990  24.088  47.705  1.00 101.69 ? 174  GLN A N   1 
ATOM   1358  C  CA  . GLN A 1 174  ? -5.445  25.469  47.768  1.00 105.49 ? 174  GLN A CA  1 
ATOM   1359  C  C   . GLN A 1 174  ? -4.234  26.403  47.723  1.00 103.06 ? 174  GLN A C   1 
ATOM   1360  O  O   . GLN A 1 174  ? -4.263  27.420  47.031  1.00 103.69 ? 174  GLN A O   1 
ATOM   1361  C  CB  . GLN A 1 174  ? -6.402  25.688  48.952  1.00 112.07 ? 174  GLN A CB  1 
ATOM   1362  C  CG  . GLN A 1 174  ? -5.771  25.575  50.341  1.00 116.55 ? 174  GLN A CG  1 
ATOM   1363  C  CD  . GLN A 1 174  ? -5.287  24.201  50.760  1.00 117.77 ? 174  GLN A CD  1 
ATOM   1364  O  OE1 . GLN A 1 174  ? -5.502  23.190  50.086  1.00 117.26 ? 174  GLN A OE1 1 
ATOM   1365  N  NE2 . GLN A 1 174  ? -4.611  24.157  51.899  1.00 119.17 ? 174  GLN A NE2 1 
ATOM   1366  N  N   . ALA A 1 175  ? -3.176  26.045  48.467  1.00 99.69  ? 175  ALA A N   1 
ATOM   1367  C  CA  . ALA A 1 175  ? -1.890  26.724  48.396  1.00 95.69  ? 175  ALA A CA  1 
ATOM   1368  C  C   . ALA A 1 175  ? -0.923  25.834  47.626  1.00 91.50  ? 175  ALA A C   1 
ATOM   1369  O  O   . ALA A 1 175  ? -1.071  24.615  47.641  1.00 91.09  ? 175  ALA A O   1 
ATOM   1370  C  CB  . ALA A 1 175  ? -1.363  27.024  49.779  1.00 95.35  ? 175  ALA A CB  1 
ATOM   1371  N  N   . PRO A 1 176  ? 0.067   26.412  46.906  1.00 89.00  ? 176  PRO A N   1 
ATOM   1372  C  CA  . PRO A 1 176  ? 1.130   25.623  46.275  1.00 84.82  ? 176  PRO A CA  1 
ATOM   1373  C  C   . PRO A 1 176  ? 1.869   24.782  47.313  1.00 82.85  ? 176  PRO A C   1 
ATOM   1374  O  O   . PRO A 1 176  ? 2.306   25.297  48.340  1.00 83.25  ? 176  PRO A O   1 
ATOM   1375  C  CB  . PRO A 1 176  ? 2.069   26.684  45.687  1.00 84.24  ? 176  PRO A CB  1 
ATOM   1376  C  CG  . PRO A 1 176  ? 1.177   27.886  45.485  1.00 87.39  ? 176  PRO A CG  1 
ATOM   1377  C  CD  . PRO A 1 176  ? 0.187   27.852  46.632  1.00 89.78  ? 176  PRO A CD  1 
ATOM   1378  N  N   . THR A 1 177  ? 1.989   23.481  47.038  1.00 80.74  ? 177  THR A N   1 
ATOM   1379  C  CA  . THR A 1 177  ? 2.492   22.546  48.031  1.00 80.69  ? 177  THR A CA  1 
ATOM   1380  C  C   . THR A 1 177  ? 3.549   21.635  47.413  1.00 78.13  ? 177  THR A C   1 
ATOM   1381  O  O   . THR A 1 177  ? 3.269   20.921  46.454  1.00 77.41  ? 177  THR A O   1 
ATOM   1382  C  CB  . THR A 1 177  ? 1.345   21.732  48.644  1.00 81.98  ? 177  THR A CB  1 
ATOM   1383  O  OG1 . THR A 1 177  ? 0.425   22.619  49.285  1.00 84.23  ? 177  THR A OG1 1 
ATOM   1384  C  CG2 . THR A 1 177  ? 1.835   20.693  49.629  1.00 81.85  ? 177  THR A CG2 1 
ATOM   1385  N  N   . ILE A 1 178  ? 4.762   21.661  47.978  1.00 77.45  ? 178  ILE A N   1 
ATOM   1386  C  CA  . ILE A 1 178  ? 5.814   20.759  47.535  1.00 75.40  ? 178  ILE A CA  1 
ATOM   1387  C  C   . ILE A 1 178  ? 5.760   19.488  48.378  1.00 75.74  ? 178  ILE A C   1 
ATOM   1388  O  O   . ILE A 1 178  ? 5.426   19.531  49.563  1.00 77.11  ? 178  ILE A O   1 
ATOM   1389  C  CB  . ILE A 1 178  ? 7.221   21.399  47.573  1.00 73.86  ? 178  ILE A CB  1 
ATOM   1390  C  CG1 . ILE A 1 178  ? 7.521   22.054  48.922  1.00 75.84  ? 178  ILE A CG1 1 
ATOM   1391  C  CG2 . ILE A 1 178  ? 7.432   22.362  46.416  1.00 72.73  ? 178  ILE A CG2 1 
ATOM   1392  C  CD1 . ILE A 1 178  ? 8.988   22.145  49.254  1.00 75.18  ? 178  ILE A CD1 1 
ATOM   1393  N  N   . CYS A 1 179  ? 6.094   18.370  47.726  1.00 73.91  ? 179  CYS A N   1 
ATOM   1394  C  CA  . CYS A 1 179  ? 6.328   17.090  48.373  1.00 73.95  ? 179  CYS A CA  1 
ATOM   1395  C  C   . CYS A 1 179  ? 7.739   16.625  48.009  1.00 72.46  ? 179  CYS A C   1 
ATOM   1396  O  O   . CYS A 1 179  ? 8.155   16.742  46.855  1.00 70.57  ? 179  CYS A O   1 
ATOM   1397  C  CB  . CYS A 1 179  ? 5.275   16.086  47.918  1.00 73.17  ? 179  CYS A CB  1 
ATOM   1398  S  SG  . CYS A 1 179  ? 5.450   14.439  48.652  1.00 72.07  ? 179  CYS A SG  1 
ATOM   1399  N  N   . PHE A 1 180  ? 8.485   16.124  49.003  1.00 72.81  ? 180  PHE A N   1 
ATOM   1400  C  CA  . PHE A 1 180  ? 9.874   15.775  48.760  1.00 71.49  ? 180  PHE A CA  1 
ATOM   1401  C  C   . PHE A 1 180  ? 10.343  14.632  49.658  1.00 71.90  ? 180  PHE A C   1 
ATOM   1402  O  O   . PHE A 1 180  ? 9.786   14.410  50.732  1.00 73.05  ? 180  PHE A O   1 
ATOM   1403  C  CB  . PHE A 1 180  ? 10.763  17.019  48.862  1.00 71.74  ? 180  PHE A CB  1 
ATOM   1404  C  CG  . PHE A 1 180  ? 10.876  17.638  50.231  1.00 73.10  ? 180  PHE A CG  1 
ATOM   1405  C  CD1 . PHE A 1 180  ? 9.925   18.541  50.681  1.00 74.59  ? 180  PHE A CD1 1 
ATOM   1406  C  CD2 . PHE A 1 180  ? 11.948  17.338  51.059  1.00 73.38  ? 180  PHE A CD2 1 
ATOM   1407  C  CE1 . PHE A 1 180  ? 10.033  19.115  51.939  1.00 76.36  ? 180  PHE A CE1 1 
ATOM   1408  C  CE2 . PHE A 1 180  ? 12.055  17.912  52.317  1.00 75.53  ? 180  PHE A CE2 1 
ATOM   1409  C  CZ  . PHE A 1 180  ? 11.097  18.799  52.754  1.00 77.08  ? 180  PHE A CZ  1 
ATOM   1410  N  N   . VAL A 1 181  ? 11.381  13.928  49.177  1.00 70.40  ? 181  VAL A N   1 
ATOM   1411  C  CA  . VAL A 1 181  ? 12.116  12.912  49.915  1.00 70.75  ? 181  VAL A CA  1 
ATOM   1412  C  C   . VAL A 1 181  ? 13.448  13.506  50.367  1.00 71.02  ? 181  VAL A C   1 
ATOM   1413  O  O   . VAL A 1 181  ? 14.127  14.180  49.598  1.00 70.18  ? 181  VAL A O   1 
ATOM   1414  C  CB  . VAL A 1 181  ? 12.321  11.654  49.052  1.00 69.40  ? 181  VAL A CB  1 
ATOM   1415  C  CG1 . VAL A 1 181  ? 13.268  10.656  49.701  1.00 70.21  ? 181  VAL A CG1 1 
ATOM   1416  C  CG2 . VAL A 1 181  ? 10.995  10.990  48.718  1.00 69.81  ? 181  VAL A CG2 1 
ATOM   1417  N  N   . TYR A 1 182  ? 13.817  13.255  51.625  1.00 73.09  ? 182  TYR A N   1 
ATOM   1418  C  CA  . TYR A 1 182  ? 15.096  13.735  52.122  1.00 74.09  ? 182  TYR A CA  1 
ATOM   1419  C  C   . TYR A 1 182  ? 15.824  12.640  52.903  1.00 75.20  ? 182  TYR A C   1 
ATOM   1420  O  O   . TYR A 1 182  ? 15.211  11.694  53.387  1.00 75.63  ? 182  TYR A O   1 
ATOM   1421  C  CB  . TYR A 1 182  ? 14.919  15.045  52.894  1.00 75.27  ? 182  TYR A CB  1 
ATOM   1422  C  CG  . TYR A 1 182  ? 14.119  14.944  54.166  1.00 77.79  ? 182  TYR A CG  1 
ATOM   1423  C  CD1 . TYR A 1 182  ? 12.735  15.046  54.151  1.00 78.39  ? 182  TYR A CD1 1 
ATOM   1424  C  CD2 . TYR A 1 182  ? 14.750  14.772  55.389  1.00 79.32  ? 182  TYR A CD2 1 
ATOM   1425  C  CE1 . TYR A 1 182  ? 11.996  14.971  55.321  1.00 80.57  ? 182  TYR A CE1 1 
ATOM   1426  C  CE2 . TYR A 1 182  ? 14.027  14.696  56.567  1.00 81.51  ? 182  TYR A CE2 1 
ATOM   1427  C  CZ  . TYR A 1 182  ? 12.649  14.795  56.530  1.00 82.37  ? 182  TYR A CZ  1 
ATOM   1428  O  OH  . TYR A 1 182  ? 11.968  14.709  57.704  1.00 85.17  ? 182  TYR A OH  1 
ATOM   1429  N  N   . GLN A 1 183  ? 17.150  12.786  53.009  1.00 76.64  ? 183  GLN A N   1 
ATOM   1430  C  CA  . GLN A 1 183  ? 17.987  11.836  53.728  1.00 79.32  ? 183  GLN A CA  1 
ATOM   1431  C  C   . GLN A 1 183  ? 18.629  12.515  54.937  1.00 81.33  ? 183  GLN A C   1 
ATOM   1432  O  O   . GLN A 1 183  ? 19.147  13.625  54.830  1.00 81.05  ? 183  GLN A O   1 
ATOM   1433  C  CB  . GLN A 1 183  ? 19.047  11.247  52.796  1.00 78.28  ? 183  GLN A CB  1 
ATOM   1434  C  CG  . GLN A 1 183  ? 19.815  10.070  53.381  1.00 80.88  ? 183  GLN A CG  1 
ATOM   1435  C  CD  . GLN A 1 183  ? 20.407  9.198   52.299  1.00 81.11  ? 183  GLN A CD  1 
ATOM   1436  O  OE1 . GLN A 1 183  ? 19.708  8.483   51.582  1.00 82.37  ? 183  GLN A OE1 1 
ATOM   1437  N  NE2 . GLN A 1 183  ? 21.723  9.235   52.180  1.00 80.34  ? 183  GLN A NE2 1 
ATOM   1438  N  N   . ASP A 1 184  ? 18.571  11.830  56.083  1.00 83.40  ? 184  ASP A N   1 
ATOM   1439  C  CA  . ASP A 1 184  ? 19.259  12.249  57.291  1.00 86.77  ? 184  ASP A CA  1 
ATOM   1440  C  C   . ASP A 1 184  ? 19.805  11.000  57.983  1.00 89.85  ? 184  ASP A C   1 
ATOM   1441  O  O   . ASP A 1 184  ? 19.512  9.888   57.546  1.00 90.62  ? 184  ASP A O   1 
ATOM   1442  C  CB  . ASP A 1 184  ? 18.378  13.164  58.150  1.00 88.10  ? 184  ASP A CB  1 
ATOM   1443  C  CG  . ASP A 1 184  ? 17.185  12.471  58.784  1.00 90.18  ? 184  ASP A CG  1 
ATOM   1444  O  OD1 . ASP A 1 184  ? 17.278  11.257  59.035  1.00 91.45  ? 184  ASP A OD1 1 
ATOM   1445  O  OD2 . ASP A 1 184  ? 16.174  13.157  59.029  1.00 90.26  ? 184  ASP A OD2 1 
ATOM   1446  N  N   . PRO A 1 185  ? 20.641  11.132  59.042  1.00 92.70  ? 185  PRO A N   1 
ATOM   1447  C  CA  . PRO A 1 185  ? 21.134  9.978   59.795  1.00 94.59  ? 185  PRO A CA  1 
ATOM   1448  C  C   . PRO A 1 185  ? 20.035  8.955   60.078  1.00 95.50  ? 185  PRO A C   1 
ATOM   1449  O  O   . PRO A 1 185  ? 20.252  7.754   59.936  1.00 96.24  ? 185  PRO A O   1 
ATOM   1450  C  CB  . PRO A 1 185  ? 21.689  10.586  61.097  1.00 97.86  ? 185  PRO A CB  1 
ATOM   1451  C  CG  . PRO A 1 185  ? 21.308  12.060  61.040  1.00 97.90  ? 185  PRO A CG  1 
ATOM   1452  C  CD  . PRO A 1 185  ? 21.177  12.394  59.570  1.00 94.02  ? 185  PRO A CD  1 
ATOM   1453  N  N   . GLN A 1 186  ? 18.843  9.456   60.427  1.00 95.87  ? 186  GLN A N   1 
ATOM   1454  C  CA  . GLN A 1 186  ? 17.714  8.618   60.794  1.00 96.51  ? 186  GLN A CA  1 
ATOM   1455  C  C   . GLN A 1 186  ? 17.228  7.794   59.595  1.00 92.88  ? 186  GLN A C   1 
ATOM   1456  O  O   . GLN A 1 186  ? 16.659  6.723   59.784  1.00 94.43  ? 186  GLN A O   1 
ATOM   1457  C  CB  . GLN A 1 186  ? 16.633  9.470   61.467  1.00 99.45  ? 186  GLN A CB  1 
ATOM   1458  C  CG  . GLN A 1 186  ? 15.427  8.674   61.945  1.00 104.08 ? 186  GLN A CG  1 
ATOM   1459  C  CD  . GLN A 1 186  ? 15.755  7.756   63.098  1.00 108.99 ? 186  GLN A CD  1 
ATOM   1460  O  OE1 . GLN A 1 186  ? 15.958  6.553   62.933  1.00 110.84 ? 186  GLN A OE1 1 
ATOM   1461  N  NE2 . GLN A 1 186  ? 15.812  8.330   64.289  1.00 112.13 ? 186  GLN A NE2 1 
ATOM   1462  N  N   . GLY A 1 187  ? 17.460  8.274   58.366  1.00 88.43  ? 187  GLY A N   1 
ATOM   1463  C  CA  . GLY A 1 187  ? 17.098  7.513   57.178  1.00 85.44  ? 187  GLY A CA  1 
ATOM   1464  C  C   . GLY A 1 187  ? 16.548  8.401   56.066  1.00 82.82  ? 187  GLY A C   1 
ATOM   1465  O  O   . GLY A 1 187  ? 16.967  9.547   55.937  1.00 83.47  ? 187  GLY A O   1 
ATOM   1466  N  N   . ARG A 1 188  ? 15.637  7.845   55.256  1.00 80.96  ? 188  ARG A N   1 
ATOM   1467  C  CA  . ARG A 1 188  ? 14.915  8.584   54.228  1.00 78.80  ? 188  ARG A CA  1 
ATOM   1468  C  C   . ARG A 1 188  ? 13.506  8.885   54.751  1.00 79.99  ? 188  ARG A C   1 
ATOM   1469  O  O   . ARG A 1 188  ? 12.996  8.163   55.608  1.00 81.98  ? 188  ARG A O   1 
ATOM   1470  C  CB  . ARG A 1 188  ? 15.008  7.865   52.873  1.00 76.73  ? 188  ARG A CB  1 
ATOM   1471  C  CG  . ARG A 1 188  ? 15.975  8.516   51.887  1.00 75.05  ? 188  ARG A CG  1 
ATOM   1472  C  CD  . ARG A 1 188  ? 16.649  7.697   50.789  1.00 74.28  ? 188  ARG A CD  1 
ATOM   1473  N  NE  . ARG A 1 188  ? 17.610  8.484   50.017  1.00 73.84  ? 188  ARG A NE  1 
ATOM   1474  C  CZ  . ARG A 1 188  ? 18.022  8.224   48.774  1.00 73.80  ? 188  ARG A CZ  1 
ATOM   1475  N  NH1 . ARG A 1 188  ? 17.566  7.172   48.120  1.00 73.54  ? 188  ARG A NH1 1 
ATOM   1476  N  NH2 . ARG A 1 188  ? 18.898  9.018   48.185  1.00 74.63  ? 188  ARG A NH2 1 
ATOM   1477  N  N   . HIS A 1 189  ? 12.914  9.993   54.287  1.00 78.52  ? 189  HIS A N   1 
ATOM   1478  C  CA  . HIS A 1 189  ? 11.617  10.446  54.768  1.00 79.94  ? 189  HIS A CA  1 
ATOM   1479  C  C   . HIS A 1 189  ? 10.934  11.220  53.650  1.00 77.99  ? 189  HIS A C   1 
ATOM   1480  O  O   . HIS A 1 189  ? 11.598  11.617  52.696  1.00 75.78  ? 189  HIS A O   1 
ATOM   1481  C  CB  . HIS A 1 189  ? 11.760  11.326  56.019  1.00 82.88  ? 189  HIS A CB  1 
ATOM   1482  C  CG  . HIS A 1 189  ? 12.809  10.868  56.978  1.00 85.00  ? 189  HIS A CG  1 
ATOM   1483  N  ND1 . HIS A 1 189  ? 12.524  10.032  58.041  1.00 87.45  ? 189  HIS A ND1 1 
ATOM   1484  C  CD2 . HIS A 1 189  ? 14.135  11.118  57.033  1.00 84.49  ? 189  HIS A CD2 1 
ATOM   1485  C  CE1 . HIS A 1 189  ? 13.630  9.790   58.712  1.00 88.59  ? 189  HIS A CE1 1 
ATOM   1486  N  NE2 . HIS A 1 189  ? 14.633  10.442  58.110  1.00 86.90  ? 189  HIS A NE2 1 
ATOM   1487  N  N   . VAL A 1 190  ? 9.613   11.406  53.774  1.00 78.89  ? 190  VAL A N   1 
ATOM   1488  C  CA  . VAL A 1 190  ? 8.845   12.248  52.869  1.00 77.19  ? 190  VAL A CA  1 
ATOM   1489  C  C   . VAL A 1 190  ? 8.164   13.337  53.696  1.00 79.10  ? 190  VAL A C   1 
ATOM   1490  O  O   . VAL A 1 190  ? 7.629   13.062  54.767  1.00 82.38  ? 190  VAL A O   1 
ATOM   1491  C  CB  . VAL A 1 190  ? 7.851   11.424  52.026  1.00 76.02  ? 190  VAL A CB  1 
ATOM   1492  C  CG1 . VAL A 1 190  ? 6.916   10.594  52.890  1.00 77.83  ? 190  VAL A CG1 1 
ATOM   1493  C  CG2 . VAL A 1 190  ? 7.063   12.287  51.055  1.00 74.78  ? 190  VAL A CG2 1 
ATOM   1494  N  N   . LYS A 1 191  ? 8.226   14.580  53.206  1.00 77.93  ? 191  LYS A N   1 
ATOM   1495  C  CA  . LYS A 1 191  ? 7.696   15.736  53.916  1.00 78.85  ? 191  LYS A CA  1 
ATOM   1496  C  C   . LYS A 1 191  ? 6.985   16.655  52.923  1.00 77.30  ? 191  LYS A C   1 
ATOM   1497  O  O   . LYS A 1 191  ? 7.237   16.603  51.723  1.00 73.89  ? 191  LYS A O   1 
ATOM   1498  C  CB  . LYS A 1 191  ? 8.830   16.469  54.644  1.00 79.32  ? 191  LYS A CB  1 
ATOM   1499  C  CG  . LYS A 1 191  ? 8.421   17.253  55.885  1.00 81.82  ? 191  LYS A CG  1 
ATOM   1500  C  CD  . LYS A 1 191  ? 9.558   17.968  56.589  1.00 81.69  ? 191  LYS A CD  1 
ATOM   1501  C  CE  . LYS A 1 191  ? 9.098   18.728  57.816  1.00 83.94  ? 191  LYS A CE  1 
ATOM   1502  N  NZ  . LYS A 1 191  ? 10.130  19.671  58.299  1.00 83.83  ? 191  LYS A NZ  1 
ATOM   1503  N  N   . THR A 1 192  ? 6.077   17.491  53.437  1.00 79.77  ? 192  THR A N   1 
ATOM   1504  C  CA  . THR A 1 192  ? 5.374   18.462  52.613  1.00 79.90  ? 192  THR A CA  1 
ATOM   1505  C  C   . THR A 1 192  ? 5.543   19.850  53.221  1.00 80.84  ? 192  THR A C   1 
ATOM   1506  O  O   . THR A 1 192  ? 5.676   19.984  54.436  1.00 81.91  ? 192  THR A O   1 
ATOM   1507  C  CB  . THR A 1 192  ? 3.877   18.135  52.464  1.00 80.98  ? 192  THR A CB  1 
ATOM   1508  O  OG1 . THR A 1 192  ? 3.354   17.815  53.754  1.00 82.83  ? 192  THR A OG1 1 
ATOM   1509  C  CG2 . THR A 1 192  ? 3.576   17.015  51.489  1.00 78.90  ? 192  THR A CG2 1 
ATOM   1510  N  N   . TYR A 1 193  ? 5.545   20.868  52.352  1.00 80.38  ? 193  TYR A N   1 
ATOM   1511  C  CA  . TYR A 1 193  ? 5.422   22.255  52.772  1.00 82.61  ? 193  TYR A CA  1 
ATOM   1512  C  C   . TYR A 1 193  ? 4.508   23.004  51.814  1.00 82.85  ? 193  TYR A C   1 
ATOM   1513  O  O   . TYR A 1 193  ? 4.468   22.705  50.623  1.00 80.92  ? 193  TYR A O   1 
ATOM   1514  C  CB  . TYR A 1 193  ? 6.747   23.014  52.682  1.00 81.55  ? 193  TYR A CB  1 
ATOM   1515  C  CG  . TYR A 1 193  ? 7.810   22.621  53.670  1.00 81.90  ? 193  TYR A CG  1 
ATOM   1516  C  CD1 . TYR A 1 193  ? 7.635   22.798  55.033  1.00 84.23  ? 193  TYR A CD1 1 
ATOM   1517  C  CD2 . TYR A 1 193  ? 9.019   22.112  53.230  1.00 80.17  ? 193  TYR A CD2 1 
ATOM   1518  C  CE1 . TYR A 1 193  ? 8.625   22.450  55.937  1.00 84.59  ? 193  TYR A CE1 1 
ATOM   1519  C  CE2 . TYR A 1 193  ? 10.022  21.768  54.119  1.00 80.63  ? 193  TYR A CE2 1 
ATOM   1520  C  CZ  . TYR A 1 193  ? 9.823   21.935  55.477  1.00 83.07  ? 193  TYR A CZ  1 
ATOM   1521  O  OH  . TYR A 1 193  ? 10.810  21.588  56.353  1.00 84.18  ? 193  TYR A OH  1 
ATOM   1522  N  N   . GLU A 1 194  ? 3.806   23.998  52.363  1.00 85.90  ? 194  GLU A N   1 
ATOM   1523  C  CA  . GLU A 1 194  ? 3.095   24.985  51.572  1.00 87.00  ? 194  GLU A CA  1 
ATOM   1524  C  C   . GLU A 1 194  ? 4.050   26.135  51.288  1.00 86.50  ? 194  GLU A C   1 
ATOM   1525  O  O   . GLU A 1 194  ? 4.864   26.493  52.134  1.00 87.36  ? 194  GLU A O   1 
ATOM   1526  C  CB  . GLU A 1 194  ? 1.884   25.509  52.338  1.00 90.96  ? 194  GLU A CB  1 
ATOM   1527  C  CG  . GLU A 1 194  ? 0.798   24.468  52.532  1.00 92.85  ? 194  GLU A CG  1 
ATOM   1528  C  CD  . GLU A 1 194  ? -0.515  25.035  53.038  1.00 96.21  ? 194  GLU A CD  1 
ATOM   1529  O  OE1 . GLU A 1 194  ? -0.598  26.273  53.218  1.00 97.48  ? 194  GLU A OE1 1 
ATOM   1530  O  OE2 . GLU A 1 194  ? -1.450  24.235  53.249  1.00 97.69  ? 194  GLU A OE2 1 
ATOM   1531  N  N   . VAL A 1 195  ? 3.936   26.705  50.088  1.00 85.42  ? 195  VAL A N   1 
ATOM   1532  C  CA  . VAL A 1 195  ? 4.792   27.800  49.669  1.00 85.01  ? 195  VAL A CA  1 
ATOM   1533  C  C   . VAL A 1 195  ? 3.937   29.060  49.547  1.00 88.32  ? 195  VAL A C   1 
ATOM   1534  O  O   . VAL A 1 195  ? 3.139   29.182  48.621  1.00 89.02  ? 195  VAL A O   1 
ATOM   1535  C  CB  . VAL A 1 195  ? 5.480   27.462  48.334  1.00 81.21  ? 195  VAL A CB  1 
ATOM   1536  C  CG1 . VAL A 1 195  ? 6.508   28.508  47.948  1.00 81.06  ? 195  VAL A CG1 1 
ATOM   1537  C  CG2 . VAL A 1 195  ? 6.105   26.081  48.359  1.00 79.10  ? 195  VAL A CG2 1 
ATOM   1538  N  N   . SER A 1 196  ? 4.100   29.998  50.486  1.00 90.96  ? 196  SER A N   1 
ATOM   1539  C  CA  . SER A 1 196  ? 3.325   31.226  50.426  1.00 94.29  ? 196  SER A CA  1 
ATOM   1540  C  C   . SER A 1 196  ? 4.159   32.358  49.830  1.00 94.27  ? 196  SER A C   1 
ATOM   1541  O  O   . SER A 1 196  ? 5.244   32.665  50.319  1.00 93.96  ? 196  SER A O   1 
ATOM   1542  C  CB  . SER A 1 196  ? 2.758   31.589  51.770  1.00 97.99  ? 196  SER A CB  1 
ATOM   1543  O  OG  . SER A 1 196  ? 3.787   31.641  52.741  1.00 99.44  ? 196  SER A OG  1 
ATOM   1544  N  N   . LEU A 1 197  ? 3.626   32.966  48.764  1.00 94.98  ? 197  LEU A N   1 
ATOM   1545  C  CA  . LEU A 1 197  ? 4.282   34.055  48.060  1.00 96.42  ? 197  LEU A CA  1 
ATOM   1546  C  C   . LEU A 1 197  ? 4.272   35.313  48.922  1.00 101.39 ? 197  LEU A C   1 
ATOM   1547  O  O   . LEU A 1 197  ? 5.235   36.076  48.902  1.00 103.00 ? 197  LEU A O   1 
ATOM   1548  C  CB  . LEU A 1 197  ? 3.561   34.321  46.735  1.00 95.94  ? 197  LEU A CB  1 
ATOM   1549  C  CG  . LEU A 1 197  ? 3.841   33.343  45.596  1.00 93.37  ? 197  LEU A CG  1 
ATOM   1550  C  CD1 . LEU A 1 197  ? 2.823   33.520  44.475  1.00 93.82  ? 197  LEU A CD1 1 
ATOM   1551  C  CD2 . LEU A 1 197  ? 5.248   33.536  45.059  1.00 92.22  ? 197  LEU A CD2 1 
ATOM   1552  N  N   . ARG A 1 198  ? 3.180   35.527  49.670  1.00 105.66 ? 198  ARG A N   1 
ATOM   1553  C  CA  . ARG A 1 198  ? 3.042   36.735  50.470  1.00 110.20 ? 198  ARG A CA  1 
ATOM   1554  C  C   . ARG A 1 198  ? 4.011   36.702  51.645  1.00 110.65 ? 198  ARG A C   1 
ATOM   1555  O  O   . ARG A 1 198  ? 4.478   37.748  52.077  1.00 112.31 ? 198  ARG A O   1 
ATOM   1556  C  CB  . ARG A 1 198  ? 1.605   36.962  50.951  1.00 114.77 ? 198  ARG A CB  1 
ATOM   1557  C  CG  . ARG A 1 198  ? 0.717   37.639  49.917  1.00 118.25 ? 198  ARG A CG  1 
ATOM   1558  C  CD  . ARG A 1 198  ? -0.613  38.165  50.430  1.00 125.34 ? 198  ARG A CD  1 
ATOM   1559  N  NE  . ARG A 1 198  ? -1.694  37.863  49.492  1.00 128.95 ? 198  ARG A NE  1 
ATOM   1560  C  CZ  . ARG A 1 198  ? -1.962  38.530  48.368  1.00 131.09 ? 198  ARG A CZ  1 
ATOM   1561  N  NH1 . ARG A 1 198  ? -1.232  39.578  48.019  1.00 133.73 ? 198  ARG A NH1 1 
ATOM   1562  N  NH2 . ARG A 1 198  ? -2.967  38.143  47.599  1.00 131.33 ? 198  ARG A NH2 1 
ATOM   1563  N  N   . GLU A 1 199  ? 4.302   35.505  52.160  1.00 111.07 ? 199  GLU A N   1 
ATOM   1564  C  CA  . GLU A 1 199  ? 5.180   35.392  53.314  1.00 113.25 ? 199  GLU A CA  1 
ATOM   1565  C  C   . GLU A 1 199  ? 6.626   35.118  52.882  1.00 108.16 ? 199  GLU A C   1 
ATOM   1566  O  O   . GLU A 1 199  ? 7.542   35.233  53.695  1.00 108.01 ? 199  GLU A O   1 
ATOM   1567  C  CB  . GLU A 1 199  ? 4.602   34.381  54.309  1.00 118.61 ? 199  GLU A CB  1 
ATOM   1568  C  CG  . GLU A 1 199  ? 5.414   34.243  55.588  1.00 125.32 ? 199  GLU A CG  1 
ATOM   1569  C  CD  . GLU A 1 199  ? 4.974   33.167  56.572  1.00 129.04 ? 199  GLU A CD  1 
ATOM   1570  O  OE1 . GLU A 1 199  ? 3.836   32.652  56.430  1.00 130.24 ? 199  GLU A OE1 1 
ATOM   1571  O  OE2 . GLU A 1 199  ? 5.773   32.847  57.484  1.00 131.84 ? 199  GLU A OE2 1 
ATOM   1572  N  N   . LYS A 1 200  ? 6.828   34.791  51.596  1.00 103.31 ? 200  LYS A N   1 
ATOM   1573  C  CA  . LYS A 1 200  ? 8.114   34.333  51.090  1.00 98.91  ? 200  LYS A CA  1 
ATOM   1574  C  C   . LYS A 1 200  ? 8.689   33.332  52.086  1.00 97.70  ? 200  LYS A C   1 
ATOM   1575  O  O   . LYS A 1 200  ? 9.755   33.561  52.656  1.00 97.36  ? 200  LYS A O   1 
ATOM   1576  C  CB  . LYS A 1 200  ? 9.071   35.506  50.839  1.00 98.72  ? 200  LYS A CB  1 
ATOM   1577  C  CG  . LYS A 1 200  ? 8.613   36.501  49.780  1.00 98.87  ? 200  LYS A CG  1 
ATOM   1578  C  CD  . LYS A 1 200  ? 9.702   37.414  49.254  1.00 98.52  ? 200  LYS A CD  1 
ATOM   1579  C  CE  . LYS A 1 200  ? 9.143   38.715  48.712  1.00 100.35 ? 200  LYS A CE  1 
ATOM   1580  N  NZ  . LYS A 1 200  ? 9.881   39.202  47.522  1.00 99.39  ? 200  LYS A NZ  1 
ATOM   1581  N  N   . GLU A 1 201  ? 7.934   32.249  52.315  1.00 97.25  ? 201  GLU A N   1 
ATOM   1582  C  CA  . GLU A 1 201  ? 8.237   31.302  53.375  1.00 97.21  ? 201  GLU A CA  1 
ATOM   1583  C  C   . GLU A 1 201  ? 7.410   30.028  53.207  1.00 94.38  ? 201  GLU A C   1 
ATOM   1584  O  O   . GLU A 1 201  ? 6.418   30.004  52.481  1.00 93.83  ? 201  GLU A O   1 
ATOM   1585  C  CB  . GLU A 1 201  ? 7.985   31.950  54.741  1.00 102.19 ? 201  GLU A CB  1 
ATOM   1586  C  CG  . GLU A 1 201  ? 8.613   31.206  55.914  1.00 105.96 ? 201  GLU A CG  1 
ATOM   1587  C  CD  . GLU A 1 201  ? 10.095  30.859  55.812  1.00 107.02 ? 201  GLU A CD  1 
ATOM   1588  O  OE1 . GLU A 1 201  ? 10.940  31.741  56.129  1.00 108.67 ? 201  GLU A OE1 1 
ATOM   1589  O  OE2 . GLU A 1 201  ? 10.402  29.700  55.427  1.00 105.94 ? 201  GLU A OE2 1 
ATOM   1590  N  N   . PHE A 1 202  ? 7.846   28.973  53.901  1.00 92.38  ? 202  PHE A N   1 
ATOM   1591  C  CA  . PHE A 1 202  ? 7.131   27.713  53.945  1.00 90.84  ? 202  PHE A CA  1 
ATOM   1592  C  C   . PHE A 1 202  ? 6.066   27.762  55.032  1.00 93.33  ? 202  PHE A C   1 
ATOM   1593  O  O   . PHE A 1 202  ? 6.143   28.569  55.954  1.00 95.61  ? 202  PHE A O   1 
ATOM   1594  C  CB  . PHE A 1 202  ? 8.088   26.549  54.209  1.00 88.68  ? 202  PHE A CB  1 
ATOM   1595  C  CG  . PHE A 1 202  ? 8.949   26.186  53.031  1.00 85.21  ? 202  PHE A CG  1 
ATOM   1596  C  CD1 . PHE A 1 202  ? 8.412   26.126  51.756  1.00 83.91  ? 202  PHE A CD1 1 
ATOM   1597  C  CD2 . PHE A 1 202  ? 10.292  25.901  53.197  1.00 84.72  ? 202  PHE A CD2 1 
ATOM   1598  C  CE1 . PHE A 1 202  ? 9.198   25.798  50.663  1.00 81.51  ? 202  PHE A CE1 1 
ATOM   1599  C  CE2 . PHE A 1 202  ? 11.079  25.571  52.104  1.00 83.07  ? 202  PHE A CE2 1 
ATOM   1600  C  CZ  . PHE A 1 202  ? 10.532  25.520  50.839  1.00 81.14  ? 202  PHE A CZ  1 
ATOM   1601  N  N   . ASN A 1 203  ? 5.072   26.884  54.885  1.00 93.47  ? 203  ASN A N   1 
ATOM   1602  C  CA  . ASN A 1 203  ? 4.078   26.601  55.903  1.00 95.77  ? 203  ASN A CA  1 
ATOM   1603  C  C   . ASN A 1 203  ? 3.894   25.091  55.996  1.00 95.00  ? 203  ASN A C   1 
ATOM   1604  O  O   . ASN A 1 203  ? 4.065   24.381  55.008  1.00 93.48  ? 203  ASN A O   1 
ATOM   1605  C  CB  . ASN A 1 203  ? 2.724   27.216  55.555  1.00 97.46  ? 203  ASN A CB  1 
ATOM   1606  C  CG  . ASN A 1 203  ? 2.734   28.725  55.638  1.00 98.95  ? 203  ASN A CG  1 
ATOM   1607  O  OD1 . ASN A 1 203  ? 3.103   29.291  56.666  1.00 100.23 ? 203  ASN A OD1 1 
ATOM   1608  N  ND2 . ASN A 1 203  ? 2.331   29.385  54.563  1.00 98.70  ? 203  ASN A ND2 1 
ATOM   1609  N  N   . LYS A 1 204  ? 3.527   24.623  57.193  1.00 96.73  ? 204  LYS A N   1 
ATOM   1610  C  CA  . LYS A 1 204  ? 3.218   23.225  57.440  1.00 96.65  ? 204  LYS A CA  1 
ATOM   1611  C  C   . LYS A 1 204  ? 2.371   22.695  56.286  1.00 95.11  ? 204  LYS A C   1 
ATOM   1612  O  O   . LYS A 1 204  ? 1.383   23.313  55.909  1.00 96.37  ? 204  LYS A O   1 
ATOM   1613  C  CB  . LYS A 1 204  ? 2.491   23.115  58.784  1.00 99.77  ? 204  LYS A CB  1 
ATOM   1614  C  CG  . LYS A 1 204  ? 2.274   21.710  59.328  1.00 100.58 ? 204  LYS A CG  1 
ATOM   1615  C  CD  . LYS A 1 204  ? 1.988   21.726  60.820  1.00 104.69 ? 204  LYS A CD  1 
ATOM   1616  C  CE  . LYS A 1 204  ? 1.577   20.384  61.394  1.00 106.01 ? 204  LYS A CE  1 
ATOM   1617  N  NZ  . LYS A 1 204  ? 0.120   20.130  61.283  1.00 106.84 ? 204  LYS A NZ  1 
ATOM   1618  N  N   . GLY A 1 205  ? 2.779   21.554  55.722  1.00 93.63  ? 205  GLY A N   1 
ATOM   1619  C  CA  . GLY A 1 205  ? 2.139   20.996  54.539  1.00 93.00  ? 205  GLY A CA  1 
ATOM   1620  C  C   . GLY A 1 205  ? 0.846   20.249  54.867  1.00 95.10  ? 205  GLY A C   1 
ATOM   1621  O  O   . GLY A 1 205  ? 0.538   20.037  56.040  1.00 97.44  ? 205  GLY A O   1 
ATOM   1622  N  N   . PRO A 1 206  ? 0.043   19.840  53.851  1.00 94.05  ? 206  PRO A N   1 
ATOM   1623  C  CA  . PRO A 1 206  ? -1.235  19.167  54.086  1.00 95.42  ? 206  PRO A CA  1 
ATOM   1624  C  C   . PRO A 1 206  ? -1.199  17.952  55.011  1.00 96.32  ? 206  PRO A C   1 
ATOM   1625  O  O   . PRO A 1 206  ? -2.169  17.689  55.718  1.00 99.36  ? 206  PRO A O   1 
ATOM   1626  C  CB  . PRO A 1 206  ? -1.737  18.774  52.684  1.00 93.64  ? 206  PRO A CB  1 
ATOM   1627  C  CG  . PRO A 1 206  ? -0.544  18.954  51.775  1.00 90.70  ? 206  PRO A CG  1 
ATOM   1628  C  CD  . PRO A 1 206  ? 0.295   20.039  52.416  1.00 91.74  ? 206  PRO A CD  1 
ATOM   1629  N  N   . TRP A 1 207  ? -0.082  17.219  55.013  1.00 94.87  ? 207  TRP A N   1 
ATOM   1630  C  CA  . TRP A 1 207  ? 0.006   16.016  55.826  1.00 96.55  ? 207  TRP A CA  1 
ATOM   1631  C  C   . TRP A 1 207  ? 1.425   15.791  56.343  1.00 96.84  ? 207  TRP A C   1 
ATOM   1632  O  O   . TRP A 1 207  ? 2.374   16.435  55.896  1.00 95.50  ? 207  TRP A O   1 
ATOM   1633  C  CB  . TRP A 1 207  ? -0.547  14.799  55.075  1.00 95.47  ? 207  TRP A CB  1 
ATOM   1634  C  CG  . TRP A 1 207  ? -0.339  14.825  53.592  1.00 92.14  ? 207  TRP A CG  1 
ATOM   1635  C  CD1 . TRP A 1 207  ? -1.157  15.393  52.659  1.00 91.71  ? 207  TRP A CD1 1 
ATOM   1636  C  CD2 . TRP A 1 207  ? 0.748   14.231  52.858  1.00 89.34  ? 207  TRP A CD2 1 
ATOM   1637  N  NE1 . TRP A 1 207  ? -0.654  15.204  51.399  1.00 89.00  ? 207  TRP A NE1 1 
ATOM   1638  C  CE2 . TRP A 1 207  ? 0.517   14.499  51.489  1.00 87.53  ? 207  TRP A CE2 1 
ATOM   1639  C  CE3 . TRP A 1 207  ? 1.889   13.505  53.220  1.00 88.46  ? 207  TRP A CE3 1 
ATOM   1640  C  CZ2 . TRP A 1 207  ? 1.388   14.069  50.488  1.00 84.04  ? 207  TRP A CZ2 1 
ATOM   1641  C  CZ3 . TRP A 1 207  ? 2.748   13.079  52.230  1.00 84.98  ? 207  TRP A CZ3 1 
ATOM   1642  C  CH2 . TRP A 1 207  ? 2.498   13.359  50.886  1.00 83.05  ? 207  TRP A CH2 1 
ATOM   1643  N  N   . LYS A 1 208  ? 1.544   14.834  57.273  1.00 99.20  ? 208  LYS A N   1 
ATOM   1644  C  CA  . LYS A 1 208  ? 2.695   14.721  58.154  1.00 99.93  ? 208  LYS A CA  1 
ATOM   1645  C  C   . LYS A 1 208  ? 3.843   13.990  57.462  1.00 97.70  ? 208  LYS A C   1 
ATOM   1646  O  O   . LYS A 1 208  ? 3.747   13.595  56.301  1.00 95.96  ? 208  LYS A O   1 
ATOM   1647  C  CB  . LYS A 1 208  ? 2.294   14.035  59.465  1.00 103.01 ? 208  LYS A CB  1 
ATOM   1648  C  CG  . LYS A 1 208  ? 1.940   12.559  59.344  1.00 103.74 ? 208  LYS A CG  1 
ATOM   1649  C  CD  . LYS A 1 208  ? 1.737   11.866  60.675  1.00 107.18 ? 208  LYS A CD  1 
ATOM   1650  C  CE  . LYS A 1 208  ? 1.983   10.374  60.582  1.00 106.98 ? 208  LYS A CE  1 
ATOM   1651  N  NZ  . LYS A 1 208  ? 1.254   9.616   61.625  1.00 110.29 ? 208  LYS A NZ  1 
ATOM   1652  N  N   . GLN A 1 209  ? 4.927   13.825  58.223  1.00 98.39  ? 209  GLN A N   1 
ATOM   1653  C  CA  . GLN A 1 209  ? 6.150   13.186  57.779  1.00 97.18  ? 209  GLN A CA  1 
ATOM   1654  C  C   . GLN A 1 209  ? 6.053   11.693  58.072  1.00 98.51  ? 209  GLN A C   1 
ATOM   1655  O  O   . GLN A 1 209  ? 5.451   11.304  59.070  1.00 102.33 ? 209  GLN A O   1 
ATOM   1656  C  CB  . GLN A 1 209  ? 7.289   13.823  58.570  1.00 98.61  ? 209  GLN A CB  1 
ATOM   1657  C  CG  . GLN A 1 209  ? 8.678   13.305  58.242  1.00 97.39  ? 209  GLN A CG  1 
ATOM   1658  C  CD  . GLN A 1 209  ? 9.661   14.121  59.039  1.00 99.18  ? 209  GLN A CD  1 
ATOM   1659  O  OE1 . GLN A 1 209  ? 9.532   15.343  59.147  1.00 99.84  ? 209  GLN A OE1 1 
ATOM   1660  N  NE2 . GLN A 1 209  ? 10.636  13.446  59.627  1.00 100.62 ? 209  GLN A NE2 1 
ATOM   1661  N  N   . GLU A 1 210  ? 6.649   10.872  57.195  1.00 96.47  ? 210  GLU A N   1 
ATOM   1662  C  CA  . GLU A 1 210  ? 6.714   9.430   57.384  1.00 97.56  ? 210  GLU A CA  1 
ATOM   1663  C  C   . GLU A 1 210  ? 8.094   8.913   56.977  1.00 95.29  ? 210  GLU A C   1 
ATOM   1664  O  O   . GLU A 1 210  ? 8.617   9.314   55.938  1.00 92.55  ? 210  GLU A O   1 
ATOM   1665  C  CB  . GLU A 1 210  ? 5.599   8.742   56.587  1.00 98.00  ? 210  GLU A CB  1 
ATOM   1666  C  CG  . GLU A 1 210  ? 4.255   8.710   57.306  1.00 101.72 ? 210  GLU A CG  1 
ATOM   1667  C  CD  . GLU A 1 210  ? 4.203   7.871   58.578  1.00 105.32 ? 210  GLU A CD  1 
ATOM   1668  O  OE1 . GLU A 1 210  ? 4.475   6.652   58.506  1.00 106.17 ? 210  GLU A OE1 1 
ATOM   1669  O  OE2 . GLU A 1 210  ? 3.903   8.437   59.648  1.00 107.38 ? 210  GLU A OE2 1 
ATOM   1670  N  N   . ASN A 1 211  ? 8.673   8.032   57.812  1.00 95.88  ? 211  ASN A N   1 
ATOM   1671  C  CA  . ASN A 1 211  ? 9.836   7.237   57.444  1.00 94.22  ? 211  ASN A CA  1 
ATOM   1672  C  C   . ASN A 1 211  ? 9.480   6.382   56.230  1.00 92.46  ? 211  ASN A C   1 
ATOM   1673  O  O   . ASN A 1 211  ? 8.437   5.728   56.213  1.00 93.39  ? 211  ASN A O   1 
ATOM   1674  C  CB  . ASN A 1 211  ? 10.291  6.315   58.576  1.00 96.63  ? 211  ASN A CB  1 
ATOM   1675  C  CG  . ASN A 1 211  ? 10.647  7.060   59.844  1.00 100.43 ? 211  ASN A CG  1 
ATOM   1676  O  OD1 . ASN A 1 211  ? 11.670  7.741   59.909  1.00 101.02 ? 211  ASN A OD1 1 
ATOM   1677  N  ND2 . ASN A 1 211  ? 9.811   6.928   60.861  1.00 103.65 ? 211  ASN A ND2 1 
ATOM   1678  N  N   . VAL A 1 212  ? 10.344  6.418   55.206  1.00 89.60  ? 212  VAL A N   1 
ATOM   1679  C  CA  . VAL A 1 212  ? 10.128  5.665   53.977  1.00 86.93  ? 212  VAL A CA  1 
ATOM   1680  C  C   . VAL A 1 212  ? 11.346  4.783   53.710  1.00 87.49  ? 212  VAL A C   1 
ATOM   1681  O  O   . VAL A 1 212  ? 12.224  4.651   54.564  1.00 89.25  ? 212  VAL A O   1 
ATOM   1682  C  CB  . VAL A 1 212  ? 9.817   6.567   52.765  1.00 82.48  ? 212  VAL A CB  1 
ATOM   1683  C  CG1 . VAL A 1 212  ? 8.570   7.407   52.970  1.00 83.58  ? 212  VAL A CG1 1 
ATOM   1684  C  CG2 . VAL A 1 212  ? 10.995  7.442   52.374  1.00 79.45  ? 212  VAL A CG2 1 
ATOM   1685  N  N   . GLU A 1 213  ? 11.373  4.186   52.508  1.00 86.35  ? 213  GLU A N   1 
ATOM   1686  C  CA  . GLU A 1 213  ? 12.423  3.283   52.061  1.00 84.99  ? 213  GLU A CA  1 
ATOM   1687  C  C   . GLU A 1 213  ? 13.763  4.016   51.968  1.00 82.88  ? 213  GLU A C   1 
ATOM   1688  O  O   . GLU A 1 213  ? 13.828  5.164   51.532  1.00 80.57  ? 213  GLU A O   1 
ATOM   1689  C  CB  . GLU A 1 213  ? 12.035  2.688   50.709  1.00 84.33  ? 213  GLU A CB  1 
ATOM   1690  C  CG  . GLU A 1 213  ? 13.092  1.768   50.140  1.00 85.69  ? 213  GLU A CG  1 
ATOM   1691  C  CD  . GLU A 1 213  ? 12.691  1.105   48.839  1.00 86.37  ? 213  GLU A CD  1 
ATOM   1692  O  OE1 . GLU A 1 213  ? 11.477  1.073   48.546  1.00 88.08  ? 213  GLU A OE1 1 
ATOM   1693  O  OE2 . GLU A 1 213  ? 13.591  0.619   48.127  1.00 86.10  ? 213  GLU A OE2 1 
ATOM   1694  N  N   . ALA A 1 214  ? 14.836  3.311   52.353  1.00 82.90  ? 214  ALA A N   1 
ATOM   1695  C  CA  . ALA A 1 214  ? 16.183  3.861   52.406  1.00 81.61  ? 214  ALA A CA  1 
ATOM   1696  C  C   . ALA A 1 214  ? 16.707  4.159   51.002  1.00 79.22  ? 214  ALA A C   1 
ATOM   1697  O  O   . ALA A 1 214  ? 17.622  4.963   50.834  1.00 76.95  ? 214  ALA A O   1 
ATOM   1698  C  CB  . ALA A 1 214  ? 17.086  2.905   53.143  1.00 82.32  ? 214  ALA A CB  1 
ATOM   1699  N  N   . GLU A 1 215  ? 16.109  3.503   50.004  1.00 80.25  ? 215  GLU A N   1 
ATOM   1700  C  CA  . GLU A 1 215  ? 16.507  3.633   48.613  1.00 78.73  ? 215  GLU A CA  1 
ATOM   1701  C  C   . GLU A 1 215  ? 15.451  4.409   47.828  1.00 75.94  ? 215  GLU A C   1 
ATOM   1702  O  O   . GLU A 1 215  ? 15.521  4.472   46.600  1.00 73.78  ? 215  GLU A O   1 
ATOM   1703  C  CB  . GLU A 1 215  ? 16.686  2.240   48.011  1.00 82.87  ? 215  GLU A CB  1 
ATOM   1704  C  CG  . GLU A 1 215  ? 18.007  1.588   48.362  1.00 89.63  ? 215  GLU A CG  1 
ATOM   1705  C  CD  . GLU A 1 215  ? 19.203  2.193   47.644  1.00 93.98  ? 215  GLU A CD  1 
ATOM   1706  O  OE1 . GLU A 1 215  ? 19.708  1.543   46.698  1.00 96.34  ? 215  GLU A OE1 1 
ATOM   1707  O  OE2 . GLU A 1 215  ? 19.643  3.304   48.043  1.00 96.62  ? 215  GLU A OE2 1 
ATOM   1708  N  N   . ALA A 1 216  ? 14.472  4.992   48.535  1.00 74.60  ? 216  ALA A N   1 
ATOM   1709  C  CA  . ALA A 1 216  ? 13.442  5.792   47.890  1.00 72.69  ? 216  ALA A CA  1 
ATOM   1710  C  C   . ALA A 1 216  ? 14.101  6.917   47.096  1.00 71.01  ? 216  ALA A C   1 
ATOM   1711  O  O   . ALA A 1 216  ? 14.890  7.683   47.646  1.00 72.62  ? 216  ALA A O   1 
ATOM   1712  C  CB  . ALA A 1 216  ? 12.496  6.336   48.927  1.00 73.55  ? 216  ALA A CB  1 
ATOM   1713  N  N   . SER A 1 217  ? 13.785  7.024   45.802  1.00 69.12  ? 217  SER A N   1 
ATOM   1714  C  CA  . SER A 1 217  ? 14.532  7.968   44.990  1.00 66.89  ? 217  SER A CA  1 
ATOM   1715  C  C   . SER A 1 217  ? 13.652  8.826   44.083  1.00 65.92  ? 217  SER A C   1 
ATOM   1716  O  O   . SER A 1 217  ? 14.146  9.790   43.509  1.00 66.26  ? 217  SER A O   1 
ATOM   1717  C  CB  . SER A 1 217  ? 15.626  7.289   44.219  1.00 65.89  ? 217  SER A CB  1 
ATOM   1718  O  OG  . SER A 1 217  ? 15.080  6.462   43.203  1.00 65.85  ? 217  SER A OG  1 
ATOM   1719  N  N   . MET A 1 218  ? 12.365  8.509   43.924  1.00 66.12  ? 218  MET A N   1 
ATOM   1720  C  CA  . MET A 1 218  ? 11.601  9.341   43.001  1.00 66.43  ? 218  MET A CA  1 
ATOM   1721  C  C   . MET A 1 218  ? 10.242  9.765   43.555  1.00 67.01  ? 218  MET A C   1 
ATOM   1722  O  O   . MET A 1 218  ? 9.573   9.007   44.252  1.00 68.60  ? 218  MET A O   1 
ATOM   1723  C  CB  . MET A 1 218  ? 11.432  8.677   41.634  1.00 66.66  ? 218  MET A CB  1 
ATOM   1724  C  CG  . MET A 1 218  ? 12.671  8.829   40.760  1.00 66.40  ? 218  MET A CG  1 
ATOM   1725  S  SD  . MET A 1 218  ? 12.587  7.968   39.165  1.00 67.26  ? 218  MET A SD  1 
ATOM   1726  C  CE  . MET A 1 218  ? 12.248  6.293   39.706  1.00 67.86  ? 218  MET A CE  1 
ATOM   1727  N  N   . VAL A 1 219  ? 9.841   10.993  43.212  1.00 66.13  ? 219  VAL A N   1 
ATOM   1728  C  CA  . VAL A 1 219  ? 8.559   11.524  43.642  1.00 67.76  ? 219  VAL A CA  1 
ATOM   1729  C  C   . VAL A 1 219  ? 7.686   11.795  42.419  1.00 67.21  ? 219  VAL A C   1 
ATOM   1730  O  O   . VAL A 1 219  ? 8.102   12.495  41.499  1.00 66.65  ? 219  VAL A O   1 
ATOM   1731  C  CB  . VAL A 1 219  ? 8.738   12.783  44.511  1.00 68.47  ? 219  VAL A CB  1 
ATOM   1732  C  CG1 . VAL A 1 219  ? 7.401   13.393  44.912  1.00 70.83  ? 219  VAL A CG1 1 
ATOM   1733  C  CG2 . VAL A 1 219  ? 9.570   12.478  45.747  1.00 68.87  ? 219  VAL A CG2 1 
ATOM   1734  N  N   . ILE A 1 220  ? 6.472   11.232  42.429  1.00 68.30  ? 220  ILE A N   1 
ATOM   1735  C  CA  . ILE A 1 220  ? 5.476   11.483  41.395  1.00 68.68  ? 220  ILE A CA  1 
ATOM   1736  C  C   . ILE A 1 220  ? 4.266   12.173  42.021  1.00 70.02  ? 220  ILE A C   1 
ATOM   1737  O  O   . ILE A 1 220  ? 3.661   11.642  42.952  1.00 71.16  ? 220  ILE A O   1 
ATOM   1738  C  CB  . ILE A 1 220  ? 5.040   10.181  40.687  1.00 68.37  ? 220  ILE A CB  1 
ATOM   1739  C  CG1 . ILE A 1 220  ? 6.223   9.400   40.108  1.00 66.45  ? 220  ILE A CG1 1 
ATOM   1740  C  CG2 . ILE A 1 220  ? 3.993   10.486  39.627  1.00 67.76  ? 220  ILE A CG2 1 
ATOM   1741  C  CD1 . ILE A 1 220  ? 5.898   7.970   39.739  1.00 65.55  ? 220  ILE A CD1 1 
ATOM   1742  N  N   . ALA A 1 221  ? 3.916   13.344  41.476  1.00 70.03  ? 221  ALA A N   1 
ATOM   1743  C  CA  . ALA A 1 221  ? 2.707   14.051  41.870  1.00 71.62  ? 221  ALA A CA  1 
ATOM   1744  C  C   . ALA A 1 221  ? 1.524   13.528  41.052  1.00 72.64  ? 221  ALA A C   1 
ATOM   1745  O  O   . ALA A 1 221  ? 1.428   13.753  39.841  1.00 71.92  ? 221  ALA A O   1 
ATOM   1746  C  CB  . ALA A 1 221  ? 2.908   15.541  41.714  1.00 70.81  ? 221  ALA A CB  1 
ATOM   1747  N  N   . VAL A 1 222  ? 0.627   12.797  41.723  1.00 74.23  ? 222  VAL A N   1 
ATOM   1748  C  CA  . VAL A 1 222  ? -0.532  12.227  41.053  1.00 74.76  ? 222  VAL A CA  1 
ATOM   1749  C  C   . VAL A 1 222  ? -1.590  13.312  40.867  1.00 76.05  ? 222  VAL A C   1 
ATOM   1750  O  O   . VAL A 1 222  ? -1.905  14.052  41.801  1.00 76.63  ? 222  VAL A O   1 
ATOM   1751  C  CB  . VAL A 1 222  ? -1.092  11.009  41.807  1.00 75.14  ? 222  VAL A CB  1 
ATOM   1752  C  CG1 . VAL A 1 222  ? -2.051  10.234  40.927  1.00 75.46  ? 222  VAL A CG1 1 
ATOM   1753  C  CG2 . VAL A 1 222  ? 0.022   10.101  42.303  1.00 73.91  ? 222  VAL A CG2 1 
ATOM   1754  N  N   . PRO A 1 223  ? -2.131  13.464  39.639  1.00 76.38  ? 223  PRO A N   1 
ATOM   1755  C  CA  . PRO A 1 223  ? -3.181  14.448  39.373  1.00 79.37  ? 223  PRO A CA  1 
ATOM   1756  C  C   . PRO A 1 223  ? -4.534  14.030  39.948  1.00 82.06  ? 223  PRO A C   1 
ATOM   1757  O  O   . PRO A 1 223  ? -4.665  12.943  40.511  1.00 82.85  ? 223  PRO A O   1 
ATOM   1758  C  CB  . PRO A 1 223  ? -3.223  14.515  37.838  1.00 78.75  ? 223  PRO A CB  1 
ATOM   1759  C  CG  . PRO A 1 223  ? -2.749  13.155  37.395  1.00 77.57  ? 223  PRO A CG  1 
ATOM   1760  C  CD  . PRO A 1 223  ? -1.732  12.726  38.434  1.00 75.68  ? 223  PRO A CD  1 
ATOM   1761  N  N   . GLU A 1 224  ? -5.530  14.919  39.818  1.00 83.57  ? 224  GLU A N   1 
ATOM   1762  C  CA  . GLU A 1 224  ? -6.887  14.628  40.252  1.00 84.89  ? 224  GLU A CA  1 
ATOM   1763  C  C   . GLU A 1 224  ? -7.522  13.646  39.276  1.00 83.87  ? 224  GLU A C   1 
ATOM   1764  O  O   . GLU A 1 224  ? -7.302  13.751  38.070  1.00 82.05  ? 224  GLU A O   1 
ATOM   1765  C  CB  . GLU A 1 224  ? -7.716  15.905  40.356  1.00 87.11  ? 224  GLU A CB  1 
ATOM   1766  C  CG  . GLU A 1 224  ? -7.601  16.583  41.703  1.00 89.11  ? 224  GLU A CG  1 
ATOM   1767  C  CD  . GLU A 1 224  ? -7.669  18.094  41.596  1.00 91.49  ? 224  GLU A CD  1 
ATOM   1768  O  OE1 . GLU A 1 224  ? -8.489  18.710  42.316  1.00 95.54  ? 224  GLU A OE1 1 
ATOM   1769  O  OE2 . GLU A 1 224  ? -6.901  18.650  40.791  1.00 91.07  ? 224  GLU A OE2 1 
ATOM   1770  N  N   . PRO A 1 225  ? -8.380  12.716  39.757  1.00 84.60  ? 225  PRO A N   1 
ATOM   1771  C  CA  . PRO A 1 225  ? -9.010  12.837  41.073  1.00 86.51  ? 225  PRO A CA  1 
ATOM   1772  C  C   . PRO A 1 225  ? -8.304  12.167  42.253  1.00 85.88  ? 225  PRO A C   1 
ATOM   1773  O  O   . PRO A 1 225  ? -8.860  12.070  43.345  1.00 87.37  ? 225  PRO A O   1 
ATOM   1774  C  CB  . PRO A 1 225  ? -10.349 12.153  40.776  1.00 88.96  ? 225  PRO A CB  1 
ATOM   1775  C  CG  . PRO A 1 225  ? -9.968  11.006  39.858  1.00 87.69  ? 225  PRO A CG  1 
ATOM   1776  C  CD  . PRO A 1 225  ? -8.793  11.500  39.044  1.00 84.31  ? 225  PRO A CD  1 
ATOM   1777  N  N   . PHE A 1 226  ? -7.063  11.719  42.041  1.00 84.26  ? 226  PHE A N   1 
ATOM   1778  C  CA  . PHE A 1 226  ? -6.331  11.022  43.087  1.00 83.98  ? 226  PHE A CA  1 
ATOM   1779  C  C   . PHE A 1 226  ? -5.649  11.996  44.042  1.00 84.34  ? 226  PHE A C   1 
ATOM   1780  O  O   . PHE A 1 226  ? -5.747  11.834  45.256  1.00 86.17  ? 226  PHE A O   1 
ATOM   1781  C  CB  . PHE A 1 226  ? -5.257  10.113  42.495  1.00 80.92  ? 226  PHE A CB  1 
ATOM   1782  C  CG  . PHE A 1 226  ? -5.772  8.892   41.782  1.00 81.18  ? 226  PHE A CG  1 
ATOM   1783  C  CD1 . PHE A 1 226  ? -6.326  7.833   42.489  1.00 83.14  ? 226  PHE A CD1 1 
ATOM   1784  C  CD2 . PHE A 1 226  ? -5.681  8.797   40.402  1.00 79.46  ? 226  PHE A CD2 1 
ATOM   1785  C  CE1 . PHE A 1 226  ? -6.795  6.709   41.825  1.00 83.61  ? 226  PHE A CE1 1 
ATOM   1786  C  CE2 . PHE A 1 226  ? -6.141  7.671   39.739  1.00 80.14  ? 226  PHE A CE2 1 
ATOM   1787  C  CZ  . PHE A 1 226  ? -6.700  6.630   40.451  1.00 82.19  ? 226  PHE A CZ  1 
ATOM   1788  N  N   . GLY A 1 227  ? -4.922  12.974  43.490  1.00 83.04  ? 227  GLY A N   1 
ATOM   1789  C  CA  . GLY A 1 227  ? -4.058  13.812  44.304  1.00 84.08  ? 227  GLY A CA  1 
ATOM   1790  C  C   . GLY A 1 227  ? -2.978  12.975  44.989  1.00 84.19  ? 227  GLY A C   1 
ATOM   1791  O  O   . GLY A 1 227  ? -2.841  11.783  44.717  1.00 84.80  ? 227  GLY A O   1 
ATOM   1792  N  N   . GLY A 1 228  ? -2.204  13.602  45.878  1.00 83.79  ? 228  GLY A N   1 
ATOM   1793  C  CA  . GLY A 1 228  ? -1.180  12.876  46.611  1.00 82.90  ? 228  GLY A CA  1 
ATOM   1794  C  C   . GLY A 1 228  ? 0.039   12.574  45.743  1.00 80.22  ? 228  GLY A C   1 
ATOM   1795  O  O   . GLY A 1 228  ? 0.191   13.149  44.664  1.00 79.12  ? 228  GLY A O   1 
ATOM   1796  N  N   . ALA A 1 229  ? 0.898   11.666  46.232  1.00 79.36  ? 229  ALA A N   1 
ATOM   1797  C  CA  . ALA A 1 229  ? 2.186   11.400  45.604  1.00 76.48  ? 229  ALA A CA  1 
ATOM   1798  C  C   . ALA A 1 229  ? 2.535   9.913   45.647  1.00 75.42  ? 229  ALA A C   1 
ATOM   1799  O  O   . ALA A 1 229  ? 2.134   9.194   46.563  1.00 76.87  ? 229  ALA A O   1 
ATOM   1800  C  CB  . ALA A 1 229  ? 3.269   12.232  46.249  1.00 75.22  ? 229  ALA A CB  1 
ATOM   1801  N  N   . ILE A 1 230  ? 3.290   9.483   44.627  1.00 72.75  ? 230  ILE A N   1 
ATOM   1802  C  CA  . ILE A 1 230  ? 3.884   8.158   44.569  1.00 71.47  ? 230  ILE A CA  1 
ATOM   1803  C  C   . ILE A 1 230  ? 5.395   8.303   44.741  1.00 69.89  ? 230  ILE A C   1 
ATOM   1804  O  O   . ILE A 1 230  ? 6.026   9.154   44.115  1.00 67.72  ? 230  ILE A O   1 
ATOM   1805  C  CB  . ILE A 1 230  ? 3.487   7.415   43.275  1.00 70.72  ? 230  ILE A CB  1 
ATOM   1806  C  CG1 . ILE A 1 230  ? 2.035   6.935   43.339  1.00 71.87  ? 230  ILE A CG1 1 
ATOM   1807  C  CG2 . ILE A 1 230  ? 4.437   6.262   42.986  1.00 69.65  ? 230  ILE A CG2 1 
ATOM   1808  C  CD1 . ILE A 1 230  ? 1.481   6.492   42.014  1.00 71.53  ? 230  ILE A CD1 1 
ATOM   1809  N  N   . ILE A 1 231  ? 5.943   7.468   45.631  1.00 70.46  ? 231  ILE A N   1 
ATOM   1810  C  CA  . ILE A 1 231  ? 7.356   7.433   45.959  1.00 68.64  ? 231  ILE A CA  1 
ATOM   1811  C  C   . ILE A 1 231  ? 7.920   6.101   45.472  1.00 68.01  ? 231  ILE A C   1 
ATOM   1812  O  O   . ILE A 1 231  ? 7.518   5.040   45.952  1.00 68.09  ? 231  ILE A O   1 
ATOM   1813  C  CB  . ILE A 1 231  ? 7.544   7.591   47.482  1.00 70.31  ? 231  ILE A CB  1 
ATOM   1814  C  CG1 . ILE A 1 231  ? 6.747   8.762   48.068  1.00 70.98  ? 231  ILE A CG1 1 
ATOM   1815  C  CG2 . ILE A 1 231  ? 9.018   7.655   47.847  1.00 70.14  ? 231  ILE A CG2 1 
ATOM   1816  C  CD1 . ILE A 1 231  ? 7.067   10.110  47.458  1.00 69.54  ? 231  ILE A CD1 1 
ATOM   1817  N  N   . ILE A 1 232  ? 8.866   6.172   44.528  1.00 67.75  ? 232  ILE A N   1 
ATOM   1818  C  CA  . ILE A 1 232  ? 9.511   4.985   43.977  1.00 68.53  ? 232  ILE A CA  1 
ATOM   1819  C  C   . ILE A 1 232  ? 10.824  4.700   44.711  1.00 68.60  ? 232  ILE A C   1 
ATOM   1820  O  O   . ILE A 1 232  ? 11.722  5.539   44.741  1.00 66.42  ? 232  ILE A O   1 
ATOM   1821  C  CB  . ILE A 1 232  ? 9.755   5.129   42.459  1.00 66.95  ? 232  ILE A CB  1 
ATOM   1822  C  CG1 . ILE A 1 232  ? 8.531   5.655   41.700  1.00 66.16  ? 232  ILE A CG1 1 
ATOM   1823  C  CG2 . ILE A 1 232  ? 10.283  3.825   41.874  1.00 66.92  ? 232  ILE A CG2 1 
ATOM   1824  C  CD1 . ILE A 1 232  ? 7.446   4.632   41.473  1.00 66.49  ? 232  ILE A CD1 1 
ATOM   1825  N  N   . GLY A 1 233  ? 10.921  3.488   45.267  1.00 71.04  ? 233  GLY A N   1 
ATOM   1826  C  CA  . GLY A 1 233  ? 12.101  3.013   45.969  1.00 73.41  ? 233  GLY A CA  1 
ATOM   1827  C  C   . GLY A 1 233  ? 12.774  1.880   45.199  1.00 74.49  ? 233  GLY A C   1 
ATOM   1828  O  O   . GLY A 1 233  ? 12.388  1.598   44.068  1.00 73.77  ? 233  GLY A O   1 
ATOM   1829  N  N   . GLN A 1 234  ? 13.789  1.254   45.808  1.00 77.01  ? 234  GLN A N   1 
ATOM   1830  C  CA  . GLN A 1 234  ? 14.520  0.174   45.162  1.00 78.34  ? 234  GLN A CA  1 
ATOM   1831  C  C   . GLN A 1 234  ? 13.596  -1.028  44.988  1.00 79.28  ? 234  GLN A C   1 
ATOM   1832  O  O   . GLN A 1 234  ? 13.578  -1.655  43.930  1.00 78.44  ? 234  GLN A O   1 
ATOM   1833  C  CB  . GLN A 1 234  ? 15.746  -0.236  45.982  1.00 81.35  ? 234  GLN A CB  1 
ATOM   1834  C  CG  . GLN A 1 234  ? 16.668  -1.215  45.268  1.00 83.05  ? 234  GLN A CG  1 
ATOM   1835  C  CD  . GLN A 1 234  ? 17.500  -0.511  44.227  1.00 83.32  ? 234  GLN A CD  1 
ATOM   1836  O  OE1 . GLN A 1 234  ? 17.298  -0.699  43.028  1.00 83.98  ? 234  GLN A OE1 1 
ATOM   1837  N  NE2 . GLN A 1 234  ? 18.425  0.320   44.686  1.00 83.52  ? 234  GLN A NE2 1 
ATOM   1838  N  N   . GLU A 1 235  ? 12.836  -1.341  46.042  1.00 80.76  ? 235  GLU A N   1 
ATOM   1839  C  CA  . GLU A 1 235  ? 12.024  -2.545  46.044  1.00 83.50  ? 235  GLU A CA  1 
ATOM   1840  C  C   . GLU A 1 235  ? 10.614  -2.249  46.549  1.00 83.34  ? 235  GLU A C   1 
ATOM   1841  O  O   . GLU A 1 235  ? 9.853   -3.176  46.833  1.00 84.09  ? 235  GLU A O   1 
ATOM   1842  C  CB  . GLU A 1 235  ? 12.694  -3.633  46.883  1.00 88.18  ? 235  GLU A CB  1 
ATOM   1843  C  CG  . GLU A 1 235  ? 12.961  -3.226  48.320  1.00 92.87  ? 235  GLU A CG  1 
ATOM   1844  C  CD  . GLU A 1 235  ? 14.005  -4.090  49.011  1.00 97.89  ? 235  GLU A CD  1 
ATOM   1845  O  OE1 . GLU A 1 235  ? 14.241  -5.231  48.547  1.00 98.79  ? 235  GLU A OE1 1 
ATOM   1846  O  OE2 . GLU A 1 235  ? 14.584  -3.627  50.016  1.00 102.39 ? 235  GLU A OE2 1 
ATOM   1847  N  N   . SER A 1 236  ? 10.266  -0.959  46.642  1.00 81.01  ? 236  SER A N   1 
ATOM   1848  C  CA  . SER A 1 236  ? 8.963   -0.591  47.168  1.00 80.25  ? 236  SER A CA  1 
ATOM   1849  C  C   . SER A 1 236  ? 8.374   0.608   46.432  1.00 77.00  ? 236  SER A C   1 
ATOM   1850  O  O   . SER A 1 236  ? 9.087   1.543   46.081  1.00 75.78  ? 236  SER A O   1 
ATOM   1851  C  CB  . SER A 1 236  ? 9.036   -0.335  48.641  1.00 82.59  ? 236  SER A CB  1 
ATOM   1852  O  OG  . SER A 1 236  ? 7.728   -0.312  49.181  1.00 86.95  ? 236  SER A OG  1 
ATOM   1853  N  N   . ILE A 1 237  ? 7.055   0.566   46.217  1.00 75.72  ? 237  ILE A N   1 
ATOM   1854  C  CA  . ILE A 1 237  ? 6.319   1.702   45.681  1.00 74.10  ? 237  ILE A CA  1 
ATOM   1855  C  C   . ILE A 1 237  ? 5.205   2.079   46.658  1.00 76.50  ? 237  ILE A C   1 
ATOM   1856  O  O   . ILE A 1 237  ? 4.459   1.216   47.119  1.00 79.05  ? 237  ILE A O   1 
ATOM   1857  C  CB  . ILE A 1 237  ? 5.758   1.389   44.281  1.00 71.86  ? 237  ILE A CB  1 
ATOM   1858  C  CG1 . ILE A 1 237  ? 6.810   0.760   43.365  1.00 69.55  ? 237  ILE A CG1 1 
ATOM   1859  C  CG2 . ILE A 1 237  ? 5.142   2.634   43.665  1.00 71.00  ? 237  ILE A CG2 1 
ATOM   1860  C  CD1 . ILE A 1 237  ? 6.472   0.839   41.897  1.00 67.99  ? 237  ILE A CD1 1 
ATOM   1861  N  N   . THR A 1 238  ? 5.079   3.381   46.947  1.00 76.09  ? 238  THR A N   1 
ATOM   1862  C  CA  . THR A 1 238  ? 4.151   3.847   47.964  1.00 77.54  ? 238  THR A CA  1 
ATOM   1863  C  C   . THR A 1 238  ? 3.314   5.002   47.425  1.00 76.73  ? 238  THR A C   1 
ATOM   1864  O  O   . THR A 1 238  ? 3.837   5.854   46.713  1.00 75.20  ? 238  THR A O   1 
ATOM   1865  C  CB  . THR A 1 238  ? 4.905   4.280   49.227  1.00 78.59  ? 238  THR A CB  1 
ATOM   1866  O  OG1 . THR A 1 238  ? 5.679   3.169   49.672  1.00 78.77  ? 238  THR A OG1 1 
ATOM   1867  C  CG2 . THR A 1 238  ? 3.983   4.678   50.354  1.00 82.15  ? 238  THR A CG2 1 
ATOM   1868  N  N   . TYR A 1 239  ? 2.022   5.017   47.784  1.00 77.86  ? 239  TYR A N   1 
ATOM   1869  C  CA  . TYR A 1 239  ? 1.153   6.163   47.567  1.00 77.99  ? 239  TYR A CA  1 
ATOM   1870  C  C   . TYR A 1 239  ? 0.854   6.811   48.918  1.00 79.91  ? 239  TYR A C   1 
ATOM   1871  O  O   . TYR A 1 239  ? 0.612   6.104   49.894  1.00 81.47  ? 239  TYR A O   1 
ATOM   1872  C  CB  . TYR A 1 239  ? -0.115  5.745   46.812  1.00 78.89  ? 239  TYR A CB  1 
ATOM   1873  C  CG  . TYR A 1 239  ? -1.139  6.839   46.623  1.00 79.53  ? 239  TYR A CG  1 
ATOM   1874  C  CD1 . TYR A 1 239  ? -1.001  7.783   45.615  1.00 78.22  ? 239  TYR A CD1 1 
ATOM   1875  C  CD2 . TYR A 1 239  ? -2.241  6.944   47.458  1.00 81.58  ? 239  TYR A CD2 1 
ATOM   1876  C  CE1 . TYR A 1 239  ? -1.920  8.806   45.447  1.00 78.82  ? 239  TYR A CE1 1 
ATOM   1877  C  CE2 . TYR A 1 239  ? -3.170  7.960   47.303  1.00 82.62  ? 239  TYR A CE2 1 
ATOM   1878  C  CZ  . TYR A 1 239  ? -3.008  8.894   46.294  1.00 81.16  ? 239  TYR A CZ  1 
ATOM   1879  O  OH  . TYR A 1 239  ? -3.912  9.900   46.120  1.00 82.60  ? 239  TYR A OH  1 
ATOM   1880  N  N   . HIS A 1 240  ? 0.887   8.152   48.965  1.00 80.60  ? 240  HIS A N   1 
ATOM   1881  C  CA  . HIS A 1 240  ? 0.475   8.904   50.143  1.00 84.96  ? 240  HIS A CA  1 
ATOM   1882  C  C   . HIS A 1 240  ? -0.484  10.028  49.751  1.00 86.70  ? 240  HIS A C   1 
ATOM   1883  O  O   . HIS A 1 240  ? -0.216  10.740  48.781  1.00 84.92  ? 240  HIS A O   1 
ATOM   1884  C  CB  . HIS A 1 240  ? 1.674   9.582   50.818  1.00 85.67  ? 240  HIS A CB  1 
ATOM   1885  C  CG  . HIS A 1 240  ? 2.853   8.707   51.083  1.00 86.07  ? 240  HIS A CG  1 
ATOM   1886  N  ND1 . HIS A 1 240  ? 3.170   8.259   52.359  1.00 88.19  ? 240  HIS A ND1 1 
ATOM   1887  C  CD2 . HIS A 1 240  ? 3.823   8.239   50.264  1.00 84.38  ? 240  HIS A CD2 1 
ATOM   1888  C  CE1 . HIS A 1 240  ? 4.267   7.528   52.310  1.00 86.94  ? 240  HIS A CE1 1 
ATOM   1889  N  NE2 . HIS A 1 240  ? 4.688   7.501   51.031  1.00 84.97  ? 240  HIS A NE2 1 
ATOM   1890  N  N   . ASN A 1 241  ? -1.560  10.208  50.540  1.00 89.85  ? 241  ASN A N   1 
ATOM   1891  C  CA  . ASN A 1 241  ? -2.463  11.340  50.383  1.00 90.88  ? 241  ASN A CA  1 
ATOM   1892  C  C   . ASN A 1 241  ? -2.969  11.825  51.741  1.00 94.01  ? 241  ASN A C   1 
ATOM   1893  O  O   . ASN A 1 241  ? -4.019  12.452  51.826  1.00 96.37  ? 241  ASN A O   1 
ATOM   1894  C  CB  . ASN A 1 241  ? -3.602  11.051  49.401  1.00 91.87  ? 241  ASN A CB  1 
ATOM   1895  C  CG  . ASN A 1 241  ? -4.125  12.301  48.721  1.00 92.49  ? 241  ASN A CG  1 
ATOM   1896  O  OD1 . ASN A 1 241  ? -3.791  13.418  49.108  1.00 93.86  ? 241  ASN A OD1 1 
ATOM   1897  N  ND2 . ASN A 1 241  ? -4.949  12.129  47.702  1.00 92.42  ? 241  ASN A ND2 1 
ATOM   1898  N  N   . GLY A 1 242  ? -2.197  11.564  52.797  1.00 95.35  ? 242  GLY A N   1 
ATOM   1899  C  CA  . GLY A 1 242  ? -2.567  12.015  54.127  1.00 98.87  ? 242  GLY A CA  1 
ATOM   1900  C  C   . GLY A 1 242  ? -2.965  10.838  55.007  1.00 102.25 ? 242  GLY A C   1 
ATOM   1901  O  O   . GLY A 1 242  ? -2.103  10.106  55.488  1.00 102.13 ? 242  GLY A O   1 
ATOM   1902  N  N   . ASP A 1 243  ? -4.276  10.652  55.183  1.00 105.89 ? 243  ASP A N   1 
ATOM   1903  C  CA  . ASP A 1 243  ? -4.785  9.542   55.972  1.00 109.68 ? 243  ASP A CA  1 
ATOM   1904  C  C   . ASP A 1 243  ? -4.549  8.230   55.224  1.00 108.49 ? 243  ASP A C   1 
ATOM   1905  O  O   . ASP A 1 243  ? -4.252  7.205   55.836  1.00 109.77 ? 243  ASP A O   1 
ATOM   1906  C  CB  . ASP A 1 243  ? -6.240  9.775   56.393  1.00 113.94 ? 243  ASP A CB  1 
ATOM   1907  C  CG  . ASP A 1 243  ? -6.402  10.872  57.437  1.00 117.36 ? 243  ASP A CG  1 
ATOM   1908  O  OD1 . ASP A 1 243  ? -5.433  11.121  58.194  1.00 117.24 ? 243  ASP A OD1 1 
ATOM   1909  O  OD2 . ASP A 1 243  ? -7.501  11.471  57.492  1.00 120.12 ? 243  ASP A OD2 1 
ATOM   1910  N  N   . LYS A 1 244  ? -4.664  8.281   53.891  1.00 106.30 ? 244  LYS A N   1 
ATOM   1911  C  CA  . LYS A 1 244  ? -4.451  7.109   53.055  1.00 104.73 ? 244  LYS A CA  1 
ATOM   1912  C  C   . LYS A 1 244  ? -2.951  6.879   52.889  1.00 101.74 ? 244  LYS A C   1 
ATOM   1913  O  O   . LYS A 1 244  ? -2.206  7.803   52.562  1.00 100.83 ? 244  LYS A O   1 
ATOM   1914  C  CB  . LYS A 1 244  ? -5.106  7.264   51.675  1.00 104.20 ? 244  LYS A CB  1 
ATOM   1915  C  CG  . LYS A 1 244  ? -6.615  7.489   51.650  1.00 108.68 ? 244  LYS A CG  1 
ATOM   1916  C  CD  . LYS A 1 244  ? -7.440  6.239   51.881  1.00 110.18 ? 244  LYS A CD  1 
ATOM   1917  C  CE  . LYS A 1 244  ? -8.923  6.526   52.003  1.00 110.89 ? 244  LYS A CE  1 
ATOM   1918  N  NZ  . LYS A 1 244  ? -9.681  5.293   52.311  1.00 112.67 ? 244  LYS A NZ  1 
ATOM   1919  N  N   . TYR A 1 245  ? -2.526  5.634   53.136  1.00 100.14 ? 245  TYR A N   1 
ATOM   1920  C  CA  . TYR A 1 245  ? -1.175  5.168   52.865  1.00 95.65  ? 245  TYR A CA  1 
ATOM   1921  C  C   . TYR A 1 245  ? -1.253  3.778   52.239  1.00 94.86  ? 245  TYR A C   1 
ATOM   1922  O  O   . TYR A 1 245  ? -1.832  2.861   52.821  1.00 97.66  ? 245  TYR A O   1 
ATOM   1923  C  CB  . TYR A 1 245  ? -0.351  5.110   54.154  1.00 96.03  ? 245  TYR A CB  1 
ATOM   1924  C  CG  . TYR A 1 245  ? 0.907   4.287   54.041  1.00 94.12  ? 245  TYR A CG  1 
ATOM   1925  C  CD1 . TYR A 1 245  ? 2.011   4.784   53.371  1.00 91.34  ? 245  TYR A CD1 1 
ATOM   1926  C  CD2 . TYR A 1 245  ? 0.994   3.013   54.584  1.00 95.08  ? 245  TYR A CD2 1 
ATOM   1927  C  CE1 . TYR A 1 245  ? 3.173   4.043   53.246  1.00 90.60  ? 245  TYR A CE1 1 
ATOM   1928  C  CE2 . TYR A 1 245  ? 2.148   2.255   54.463  1.00 94.54  ? 245  TYR A CE2 1 
ATOM   1929  C  CZ  . TYR A 1 245  ? 3.244   2.773   53.788  1.00 92.85  ? 245  TYR A CZ  1 
ATOM   1930  O  OH  . TYR A 1 245  ? 4.408   2.065   53.649  1.00 92.36  ? 245  TYR A OH  1 
ATOM   1931  N  N   . LEU A 1 246  ? -0.664  3.624   51.052  1.00 91.39  ? 246  LEU A N   1 
ATOM   1932  C  CA  . LEU A 1 246  ? -0.692  2.339   50.375  1.00 90.75  ? 246  LEU A CA  1 
ATOM   1933  C  C   . LEU A 1 246  ? 0.719   1.999   49.914  1.00 88.10  ? 246  LEU A C   1 
ATOM   1934  O  O   . LEU A 1 246  ? 1.388   2.841   49.324  1.00 86.66  ? 246  LEU A O   1 
ATOM   1935  C  CB  . LEU A 1 246  ? -1.656  2.434   49.190  1.00 90.72  ? 246  LEU A CB  1 
ATOM   1936  C  CG  . LEU A 1 246  ? -2.368  1.139   48.793  1.00 92.86  ? 246  LEU A CG  1 
ATOM   1937  C  CD1 . LEU A 1 246  ? -2.677  0.268   50.007  1.00 95.68  ? 246  LEU A CD1 1 
ATOM   1938  C  CD2 . LEU A 1 246  ? -3.646  1.452   48.027  1.00 92.92  ? 246  LEU A CD2 1 
ATOM   1939  N  N   . ALA A 1 247  ? 1.159   0.768   50.203  1.00 88.19  ? 247  ALA A N   1 
ATOM   1940  C  CA  . ALA A 1 247  ? 2.493   0.323   49.830  1.00 85.44  ? 247  ALA A CA  1 
ATOM   1941  C  C   . ALA A 1 247  ? 2.439   -1.067  49.202  1.00 84.96  ? 247  ALA A C   1 
ATOM   1942  O  O   . ALA A 1 247  ? 1.737   -1.951  49.685  1.00 87.67  ? 247  ALA A O   1 
ATOM   1943  C  CB  . ALA A 1 247  ? 3.411   0.351   51.027  1.00 86.64  ? 247  ALA A CB  1 
ATOM   1944  N  N   . ILE A 1 248  ? 3.185   -1.231  48.106  1.00 82.12  ? 248  ILE A N   1 
ATOM   1945  C  CA  . ILE A 1 248  ? 3.376   -2.523  47.467  1.00 82.25  ? 248  ILE A CA  1 
ATOM   1946  C  C   . ILE A 1 248  ? 4.875   -2.777  47.341  1.00 81.79  ? 248  ILE A C   1 
ATOM   1947  O  O   . ILE A 1 248  ? 5.657   -1.855  47.106  1.00 80.45  ? 248  ILE A O   1 
ATOM   1948  C  CB  . ILE A 1 248  ? 2.687   -2.591  46.088  1.00 80.92  ? 248  ILE A CB  1 
ATOM   1949  C  CG1 . ILE A 1 248  ? 3.199   -1.510  45.130  1.00 77.83  ? 248  ILE A CG1 1 
ATOM   1950  C  CG2 . ILE A 1 248  ? 1.172   -2.554  46.232  1.00 82.94  ? 248  ILE A CG2 1 
ATOM   1951  C  CD1 . ILE A 1 248  ? 3.129   -1.896  43.671  1.00 75.89  ? 248  ILE A CD1 1 
ATOM   1952  N  N   . ALA A 1 249  ? 5.262   -4.046  47.501  1.00 83.29  ? 249  ALA A N   1 
ATOM   1953  C  CA  . ALA A 1 249  ? 6.637   -4.473  47.308  1.00 81.73  ? 249  ALA A CA  1 
ATOM   1954  C  C   . ALA A 1 249  ? 6.645   -5.620  46.305  1.00 82.14  ? 249  ALA A C   1 
ATOM   1955  O  O   . ALA A 1 249  ? 6.769   -6.782  46.692  1.00 83.58  ? 249  ALA A O   1 
ATOM   1956  C  CB  . ALA A 1 249  ? 7.250   -4.874  48.628  1.00 82.93  ? 249  ALA A CB  1 
ATOM   1957  N  N   . PRO A 1 250  ? 6.467   -5.330  44.993  1.00 81.37  ? 250  PRO A N   1 
ATOM   1958  C  CA  . PRO A 1 250  ? 6.448   -6.377  43.968  1.00 82.41  ? 250  PRO A CA  1 
ATOM   1959  C  C   . PRO A 1 250  ? 7.830   -6.962  43.657  1.00 82.37  ? 250  PRO A C   1 
ATOM   1960  O  O   . PRO A 1 250  ? 8.797   -6.231  43.422  1.00 78.97  ? 250  PRO A O   1 
ATOM   1961  C  CB  . PRO A 1 250  ? 5.790   -5.710  42.746  1.00 80.54  ? 250  PRO A CB  1 
ATOM   1962  C  CG  . PRO A 1 250  ? 5.991   -4.214  42.952  1.00 78.11  ? 250  PRO A CG  1 
ATOM   1963  C  CD  . PRO A 1 250  ? 6.246   -3.988  44.430  1.00 78.93  ? 250  PRO A CD  1 
ATOM   1964  N  N   . PRO A 1 251  ? 7.959   -8.311  43.656  1.00 84.37  ? 251  PRO A N   1 
ATOM   1965  C  CA  . PRO A 1 251  ? 9.249   -8.965  43.441  1.00 84.35  ? 251  PRO A CA  1 
ATOM   1966  C  C   . PRO A 1 251  ? 9.874   -8.555  42.113  1.00 83.34  ? 251  PRO A C   1 
ATOM   1967  O  O   . PRO A 1 251  ? 11.100  -8.502  41.996  1.00 83.88  ? 251  PRO A O   1 
ATOM   1968  C  CB  . PRO A 1 251  ? 8.873   -10.451 43.394  1.00 86.29  ? 251  PRO A CB  1 
ATOM   1969  C  CG  . PRO A 1 251  ? 7.622   -10.533 44.227  1.00 88.09  ? 251  PRO A CG  1 
ATOM   1970  C  CD  . PRO A 1 251  ? 6.865   -9.274  43.865  1.00 86.39  ? 251  PRO A CD  1 
ATOM   1971  N  N   . ILE A 1 252  ? 9.016   -8.232  41.136  1.00 83.02  ? 252  ILE A N   1 
ATOM   1972  C  CA  . ILE A 1 252  ? 9.448   -7.977  39.771  1.00 81.75  ? 252  ILE A CA  1 
ATOM   1973  C  C   . ILE A 1 252  ? 10.452  -6.823  39.731  1.00 80.62  ? 252  ILE A C   1 
ATOM   1974  O  O   . ILE A 1 252  ? 11.440  -6.904  39.001  1.00 80.52  ? 252  ILE A O   1 
ATOM   1975  C  CB  . ILE A 1 252  ? 8.249   -7.801  38.813  1.00 81.91  ? 252  ILE A CB  1 
ATOM   1976  C  CG1 . ILE A 1 252  ? 8.671   -7.844  37.342  1.00 80.75  ? 252  ILE A CG1 1 
ATOM   1977  C  CG2 . ILE A 1 252  ? 7.434   -6.558  39.137  1.00 81.92  ? 252  ILE A CG2 1 
ATOM   1978  C  CD1 . ILE A 1 252  ? 9.217   -9.183  36.901  1.00 81.68  ? 252  ILE A CD1 1 
ATOM   1979  N  N   . ILE A 1 253  ? 10.232  -5.793  40.565  1.00 80.48  ? 253  ILE A N   1 
ATOM   1980  C  CA  . ILE A 1 253  ? 11.043  -4.580  40.535  1.00 78.95  ? 253  ILE A CA  1 
ATOM   1981  C  C   . ILE A 1 253  ? 12.315  -4.713  41.383  1.00 80.43  ? 253  ILE A C   1 
ATOM   1982  O  O   . ILE A 1 253  ? 13.150  -3.808  41.371  1.00 79.01  ? 253  ILE A O   1 
ATOM   1983  C  CB  . ILE A 1 253  ? 10.224  -3.317  40.899  1.00 75.70  ? 253  ILE A CB  1 
ATOM   1984  C  CG1 . ILE A 1 253  ? 9.706   -3.342  42.338  1.00 76.17  ? 253  ILE A CG1 1 
ATOM   1985  C  CG2 . ILE A 1 253  ? 9.104   -3.085  39.899  1.00 74.53  ? 253  ILE A CG2 1 
ATOM   1986  C  CD1 . ILE A 1 253  ? 9.916   -2.040  43.066  1.00 74.95  ? 253  ILE A CD1 1 
ATOM   1987  N  N   . LYS A 1 254  ? 12.483  -5.836  42.097  1.00 84.15  ? 254  LYS A N   1 
ATOM   1988  C  CA  . LYS A 1 254  ? 13.577  -5.945  43.057  1.00 88.04  ? 254  LYS A CA  1 
ATOM   1989  C  C   . LYS A 1 254  ? 14.919  -6.170  42.358  1.00 87.47  ? 254  LYS A C   1 
ATOM   1990  O  O   . LYS A 1 254  ? 15.966  -5.891  42.935  1.00 85.82  ? 254  LYS A O   1 
ATOM   1991  C  CB  . LYS A 1 254  ? 13.278  -6.976  44.153  1.00 92.99  ? 254  LYS A CB  1 
ATOM   1992  C  CG  . LYS A 1 254  ? 12.181  -6.558  45.129  1.00 96.40  ? 254  LYS A CG  1 
ATOM   1993  C  CD  . LYS A 1 254  ? 11.901  -7.530  46.258  1.00 100.05 ? 254  LYS A CD  1 
ATOM   1994  C  CE  . LYS A 1 254  ? 10.811  -7.029  47.183  1.00 101.35 ? 254  LYS A CE  1 
ATOM   1995  N  NZ  . LYS A 1 254  ? 10.475  -8.020  48.233  1.00 105.05 ? 254  LYS A NZ  1 
ATOM   1996  N  N   . GLN A 1 255  ? 14.879  -6.658  41.112  1.00 88.67  ? 255  GLN A N   1 
ATOM   1997  C  CA  . GLN A 1 255  ? 16.079  -7.022  40.373  1.00 87.50  ? 255  GLN A CA  1 
ATOM   1998  C  C   . GLN A 1 255  ? 16.879  -5.784  39.973  1.00 83.20  ? 255  GLN A C   1 
ATOM   1999  O  O   . GLN A 1 255  ? 18.103  -5.814  40.017  1.00 83.79  ? 255  GLN A O   1 
ATOM   2000  C  CB  . GLN A 1 255  ? 15.729  -7.847  39.133  1.00 91.10  ? 255  GLN A CB  1 
ATOM   2001  C  CG  . GLN A 1 255  ? 15.115  -9.202  39.457  1.00 97.27  ? 255  GLN A CG  1 
ATOM   2002  C  CD  . GLN A 1 255  ? 14.645  -9.927  38.220  1.00 101.13 ? 255  GLN A CD  1 
ATOM   2003  O  OE1 . GLN A 1 255  ? 14.237  -9.318  37.235  1.00 103.31 ? 255  GLN A OE1 1 
ATOM   2004  N  NE2 . GLN A 1 255  ? 14.689  -11.249 38.272  1.00 104.77 ? 255  GLN A NE2 1 
ATOM   2005  N  N   . SER A 1 256  ? 16.196  -4.712  39.557  1.00 80.20  ? 256  SER A N   1 
ATOM   2006  C  CA  . SER A 1 256  ? 16.884  -3.542  39.028  1.00 75.91  ? 256  SER A CA  1 
ATOM   2007  C  C   . SER A 1 256  ? 16.212  -2.252  39.498  1.00 74.95  ? 256  SER A C   1 
ATOM   2008  O  O   . SER A 1 256  ? 15.052  -2.262  39.915  1.00 77.40  ? 256  SER A O   1 
ATOM   2009  C  CB  . SER A 1 256  ? 16.985  -3.603  37.523  1.00 74.02  ? 256  SER A CB  1 
ATOM   2010  O  OG  . SER A 1 256  ? 17.507  -2.388  37.005  1.00 73.79  ? 256  SER A OG  1 
ATOM   2011  N  N   . THR A 1 257  ? 16.955  -1.141  39.398  1.00 71.03  ? 257  THR A N   1 
ATOM   2012  C  CA  . THR A 1 257  ? 16.511  0.167   39.852  1.00 69.43  ? 257  THR A CA  1 
ATOM   2013  C  C   . THR A 1 257  ? 15.742  0.885   38.745  1.00 69.16  ? 257  THR A C   1 
ATOM   2014  O  O   . THR A 1 257  ? 16.204  0.940   37.603  1.00 68.92  ? 257  THR A O   1 
ATOM   2015  C  CB  . THR A 1 257  ? 17.711  1.034   40.249  1.00 68.18  ? 257  THR A CB  1 
ATOM   2016  O  OG1 . THR A 1 257  ? 18.314  0.426   41.387  1.00 70.24  ? 257  THR A OG1 1 
ATOM   2017  C  CG2 . THR A 1 257  ? 17.347  2.464   40.580  1.00 66.65  ? 257  THR A CG2 1 
ATOM   2018  N  N   . ILE A 1 258  ? 14.597  1.476   39.123  1.00 67.59  ? 258  ILE A N   1 
ATOM   2019  C  CA  . ILE A 1 258  ? 13.774  2.300   38.250  1.00 64.24  ? 258  ILE A CA  1 
ATOM   2020  C  C   . ILE A 1 258  ? 14.362  3.714   38.185  1.00 61.97  ? 258  ILE A C   1 
ATOM   2021  O  O   . ILE A 1 258  ? 14.622  4.342   39.210  1.00 61.64  ? 258  ILE A O   1 
ATOM   2022  C  CB  . ILE A 1 258  ? 12.307  2.254   38.733  1.00 65.79  ? 258  ILE A CB  1 
ATOM   2023  C  CG1 . ILE A 1 258  ? 11.760  0.823   38.680  1.00 66.68  ? 258  ILE A CG1 1 
ATOM   2024  C  CG2 . ILE A 1 258  ? 11.424  3.225   37.954  1.00 65.26  ? 258  ILE A CG2 1 
ATOM   2025  C  CD1 . ILE A 1 258  ? 10.409  0.636   39.336  1.00 67.86  ? 258  ILE A CD1 1 
ATOM   2026  N  N   . VAL A 1 259  ? 14.584  4.207   36.963  1.00 60.26  ? 259  VAL A N   1 
ATOM   2027  C  CA  . VAL A 1 259  ? 15.359  5.424   36.774  1.00 59.50  ? 259  VAL A CA  1 
ATOM   2028  C  C   . VAL A 1 259  ? 14.518  6.519   36.120  1.00 59.82  ? 259  VAL A C   1 
ATOM   2029  O  O   . VAL A 1 259  ? 14.885  7.690   36.200  1.00 61.62  ? 259  VAL A O   1 
ATOM   2030  C  CB  . VAL A 1 259  ? 16.672  5.171   36.004  1.00 58.19  ? 259  VAL A CB  1 
ATOM   2031  C  CG1 . VAL A 1 259  ? 17.473  4.048   36.645  1.00 59.30  ? 259  VAL A CG1 1 
ATOM   2032  C  CG2 . VAL A 1 259  ? 16.445  4.884   34.523  1.00 56.98  ? 259  VAL A CG2 1 
ATOM   2033  N  N   . CYS A 1 260  ? 13.418  6.146   35.454  1.00 59.00  ? 260  CYS A N   1 
ATOM   2034  C  CA  . CYS A 1 260  ? 12.538  7.146   34.869  1.00 59.22  ? 260  CYS A CA  1 
ATOM   2035  C  C   . CYS A 1 260  ? 11.089  6.662   34.856  1.00 61.20  ? 260  CYS A C   1 
ATOM   2036  O  O   . CYS A 1 260  ? 10.822  5.462   34.923  1.00 61.97  ? 260  CYS A O   1 
ATOM   2037  C  CB  . CYS A 1 260  ? 12.995  7.560   33.476  1.00 56.62  ? 260  CYS A CB  1 
ATOM   2038  S  SG  . CYS A 1 260  ? 13.027  6.178   32.312  1.00 55.46  ? 260  CYS A SG  1 
ATOM   2039  N  N   . HIS A 1 261  ? 10.174  7.633   34.770  1.00 62.21  ? 261  HIS A N   1 
ATOM   2040  C  CA  . HIS A 1 261  ? 8.740   7.411   34.778  1.00 64.86  ? 261  HIS A CA  1 
ATOM   2041  C  C   . HIS A 1 261  ? 8.077   8.461   33.888  1.00 65.37  ? 261  HIS A C   1 
ATOM   2042  O  O   . HIS A 1 261  ? 8.679   9.492   33.591  1.00 64.07  ? 261  HIS A O   1 
ATOM   2043  C  CB  . HIS A 1 261  ? 8.216   7.477   36.219  1.00 66.70  ? 261  HIS A CB  1 
ATOM   2044  C  CG  . HIS A 1 261  ? 8.532   8.775   36.882  1.00 67.84  ? 261  HIS A CG  1 
ATOM   2045  N  ND1 . HIS A 1 261  ? 8.155   9.983   36.332  1.00 68.19  ? 261  HIS A ND1 1 
ATOM   2046  C  CD2 . HIS A 1 261  ? 9.195   9.064   38.024  1.00 67.89  ? 261  HIS A CD2 1 
ATOM   2047  C  CE1 . HIS A 1 261  ? 8.568   10.962  37.108  1.00 68.74  ? 261  HIS A CE1 1 
ATOM   2048  N  NE2 . HIS A 1 261  ? 9.208   10.425  38.154  1.00 68.46  ? 261  HIS A NE2 1 
ATOM   2049  N  N   . ASN A 1 262  ? 6.846   8.171   33.448  1.00 67.02  ? 262  ASN A N   1 
ATOM   2050  C  CA  . ASN A 1 262  ? 6.012   9.141   32.754  1.00 67.70  ? 262  ASN A CA  1 
ATOM   2051  C  C   . ASN A 1 262  ? 4.542   8.741   32.893  1.00 68.74  ? 262  ASN A C   1 
ATOM   2052  O  O   . ASN A 1 262  ? 4.227   7.569   33.089  1.00 68.71  ? 262  ASN A O   1 
ATOM   2053  C  CB  . ASN A 1 262  ? 6.471   9.373   31.310  1.00 67.52  ? 262  ASN A CB  1 
ATOM   2054  C  CG  . ASN A 1 262  ? 6.297   10.814  30.872  1.00 67.96  ? 262  ASN A CG  1 
ATOM   2055  O  OD1 . ASN A 1 262  ? 5.926   11.669  31.673  1.00 67.44  ? 262  ASN A OD1 1 
ATOM   2056  N  ND2 . ASN A 1 262  ? 6.566   11.108  29.612  1.00 68.27  ? 262  ASN A ND2 1 
ATOM   2057  N  N   . ARG A 1 263  ? 3.653   9.739   32.813  1.00 69.33  ? 263  ARG A N   1 
ATOM   2058  C  CA  . ARG A 1 263  ? 2.220   9.545   32.957  1.00 69.99  ? 263  ARG A CA  1 
ATOM   2059  C  C   . ARG A 1 263  ? 1.654   9.158   31.595  1.00 70.42  ? 263  ARG A C   1 
ATOM   2060  O  O   . ARG A 1 263  ? 1.959   9.809   30.600  1.00 70.93  ? 263  ARG A O   1 
ATOM   2061  C  CB  . ARG A 1 263  ? 1.596   10.854  33.447  1.00 70.73  ? 263  ARG A CB  1 
ATOM   2062  C  CG  . ARG A 1 263  ? 0.288   10.689  34.204  1.00 73.07  ? 263  ARG A CG  1 
ATOM   2063  C  CD  . ARG A 1 263  ? -0.204  11.985  34.814  1.00 74.16  ? 263  ARG A CD  1 
ATOM   2064  N  NE  . ARG A 1 263  ? -0.404  13.024  33.816  1.00 75.61  ? 263  ARG A NE  1 
ATOM   2065  C  CZ  . ARG A 1 263  ? -0.434  14.328  34.082  1.00 77.42  ? 263  ARG A CZ  1 
ATOM   2066  N  NH1 . ARG A 1 263  ? -0.277  14.757  35.324  1.00 77.26  ? 263  ARG A NH1 1 
ATOM   2067  N  NH2 . ARG A 1 263  ? -0.620  15.202  33.107  1.00 79.33  ? 263  ARG A NH2 1 
ATOM   2068  N  N   . VAL A 1 264  ? 0.863   8.081   31.557  1.00 70.66  ? 264  VAL A N   1 
ATOM   2069  C  CA  . VAL A 1 264  ? 0.214   7.655   30.327  1.00 71.86  ? 264  VAL A CA  1 
ATOM   2070  C  C   . VAL A 1 264  ? -1.167  8.305   30.256  1.00 74.05  ? 264  VAL A C   1 
ATOM   2071  O  O   . VAL A 1 264  ? -1.455  9.058   29.327  1.00 75.03  ? 264  VAL A O   1 
ATOM   2072  C  CB  . VAL A 1 264  ? 0.145   6.118   30.223  1.00 72.59  ? 264  VAL A CB  1 
ATOM   2073  C  CG1 . VAL A 1 264  ? -0.736  5.653   29.070  1.00 73.66  ? 264  VAL A CG1 1 
ATOM   2074  C  CG2 . VAL A 1 264  ? 1.530   5.496   30.129  1.00 70.02  ? 264  VAL A CG2 1 
ATOM   2075  N  N   . ASP A 1 265  ? -1.999  8.020   31.265  1.00 75.12  ? 265  ASP A N   1 
ATOM   2076  C  CA  . ASP A 1 265  ? -3.351  8.548   31.362  1.00 76.32  ? 265  ASP A CA  1 
ATOM   2077  C  C   . ASP A 1 265  ? -3.297  9.930   32.010  1.00 76.00  ? 265  ASP A C   1 
ATOM   2078  O  O   . ASP A 1 265  ? -2.603  10.111  33.008  1.00 75.60  ? 265  ASP A O   1 
ATOM   2079  C  CB  . ASP A 1 265  ? -4.253  7.598   32.157  1.00 77.62  ? 265  ASP A CB  1 
ATOM   2080  C  CG  . ASP A 1 265  ? -4.653  6.337   31.411  1.00 78.78  ? 265  ASP A CG  1 
ATOM   2081  O  OD1 . ASP A 1 265  ? -5.486  6.429   30.487  1.00 80.44  ? 265  ASP A OD1 1 
ATOM   2082  O  OD2 . ASP A 1 265  ? -4.137  5.272   31.770  1.00 79.21  ? 265  ASP A OD2 1 
ATOM   2083  N  N   . PRO A 1 266  ? -4.004  10.954  31.469  1.00 76.39  ? 266  PRO A N   1 
ATOM   2084  C  CA  . PRO A 1 266  ? -3.972  12.304  32.040  1.00 75.93  ? 266  PRO A CA  1 
ATOM   2085  C  C   . PRO A 1 266  ? -4.418  12.416  33.498  1.00 76.48  ? 266  PRO A C   1 
ATOM   2086  O  O   . PRO A 1 266  ? -3.961  13.303  34.213  1.00 75.37  ? 266  PRO A O   1 
ATOM   2087  C  CB  . PRO A 1 266  ? -4.907  13.099  31.117  1.00 77.48  ? 266  PRO A CB  1 
ATOM   2088  C  CG  . PRO A 1 266  ? -4.875  12.335  29.816  1.00 77.39  ? 266  PRO A CG  1 
ATOM   2089  C  CD  . PRO A 1 266  ? -4.827  10.887  30.251  1.00 77.50  ? 266  PRO A CD  1 
ATOM   2090  N  N   . ASN A 1 267  ? -5.295  11.502  33.930  1.00 78.75  ? 267  ASN A N   1 
ATOM   2091  C  CA  . ASN A 1 267  ? -5.813  11.480  35.289  1.00 81.16  ? 267  ASN A CA  1 
ATOM   2092  C  C   . ASN A 1 267  ? -4.906  10.658  36.206  1.00 80.45  ? 267  ASN A C   1 
ATOM   2093  O  O   . ASN A 1 267  ? -5.197  10.523  37.395  1.00 81.91  ? 267  ASN A O   1 
ATOM   2094  C  CB  . ASN A 1 267  ? -7.233  10.918  35.328  1.00 84.54  ? 267  ASN A CB  1 
ATOM   2095  C  CG  . ASN A 1 267  ? -7.360  9.644   34.524  1.00 86.49  ? 267  ASN A CG  1 
ATOM   2096  O  OD1 . ASN A 1 267  ? -6.943  9.600   33.368  1.00 86.74  ? 267  ASN A OD1 1 
ATOM   2097  N  ND2 . ASN A 1 267  ? -7.938  8.613   35.120  1.00 89.18  ? 267  ASN A ND2 1 
ATOM   2098  N  N   . GLY A 1 268  ? -3.830  10.089  35.639  1.00 78.55  ? 268  GLY A N   1 
ATOM   2099  C  CA  . GLY A 1 268  ? -2.800  9.371   36.379  1.00 76.14  ? 268  GLY A CA  1 
ATOM   2100  C  C   . GLY A 1 268  ? -3.221  7.967   36.817  1.00 77.00  ? 268  GLY A C   1 
ATOM   2101  O  O   . GLY A 1 268  ? -2.784  7.483   37.856  1.00 76.91  ? 268  GLY A O   1 
ATOM   2102  N  N   . SER A 1 269  ? -4.071  7.313   36.026  1.00 77.95  ? 269  SER A N   1 
ATOM   2103  C  CA  . SER A 1 269  ? -4.447  5.945   36.333  1.00 77.79  ? 269  SER A CA  1 
ATOM   2104  C  C   . SER A 1 269  ? -3.299  5.006   35.973  1.00 75.23  ? 269  SER A C   1 
ATOM   2105  O  O   . SER A 1 269  ? -3.112  3.990   36.634  1.00 75.72  ? 269  SER A O   1 
ATOM   2106  C  CB  . SER A 1 269  ? -5.728  5.570   35.649  1.00 80.00  ? 269  SER A CB  1 
ATOM   2107  O  OG  . SER A 1 269  ? -5.880  6.323   34.459  1.00 80.61  ? 269  SER A OG  1 
ATOM   2108  N  N   . ARG A 1 270  ? -2.523  5.369   34.942  1.00 72.51  ? 270  ARG A N   1 
ATOM   2109  C  CA  . ARG A 1 270  ? -1.428  4.527   34.484  1.00 71.04  ? 270  ARG A CA  1 
ATOM   2110  C  C   . ARG A 1 270  ? -0.145  5.335   34.277  1.00 69.59  ? 270  ARG A C   1 
ATOM   2111  O  O   . ARG A 1 270  ? -0.186  6.486   33.851  1.00 70.03  ? 270  ARG A O   1 
ATOM   2112  C  CB  . ARG A 1 270  ? -1.818  3.801   33.196  1.00 70.59  ? 270  ARG A CB  1 
ATOM   2113  C  CG  . ARG A 1 270  ? -2.670  2.560   33.419  1.00 71.90  ? 270  ARG A CG  1 
ATOM   2114  C  CD  . ARG A 1 270  ? -3.059  1.885   32.118  1.00 71.72  ? 270  ARG A CD  1 
ATOM   2115  N  NE  . ARG A 1 270  ? -3.735  2.848   31.269  1.00 71.52  ? 270  ARG A NE  1 
ATOM   2116  C  CZ  . ARG A 1 270  ? -4.418  2.557   30.176  1.00 72.35  ? 270  ARG A CZ  1 
ATOM   2117  N  NH1 . ARG A 1 270  ? -4.522  1.300   29.781  1.00 73.14  ? 270  ARG A NH1 1 
ATOM   2118  N  NH2 . ARG A 1 270  ? -4.997  3.525   29.487  1.00 72.41  ? 270  ARG A NH2 1 
ATOM   2119  N  N   . TYR A 1 271  ? 0.998   4.693   34.560  1.00 68.72  ? 271  TYR A N   1 
ATOM   2120  C  CA  . TYR A 1 271  ? 2.330   5.260   34.386  1.00 66.39  ? 271  TYR A CA  1 
ATOM   2121  C  C   . TYR A 1 271  ? 3.277   4.210   33.809  1.00 65.38  ? 271  TYR A C   1 
ATOM   2122  O  O   . TYR A 1 271  ? 3.203   3.035   34.176  1.00 65.56  ? 271  TYR A O   1 
ATOM   2123  C  CB  . TYR A 1 271  ? 2.937   5.679   35.730  1.00 65.45  ? 271  TYR A CB  1 
ATOM   2124  C  CG  . TYR A 1 271  ? 2.376   6.947   36.317  1.00 65.90  ? 271  TYR A CG  1 
ATOM   2125  C  CD1 . TYR A 1 271  ? 1.229   6.925   37.094  1.00 67.26  ? 271  TYR A CD1 1 
ATOM   2126  C  CD2 . TYR A 1 271  ? 2.983   8.172   36.088  1.00 65.04  ? 271  TYR A CD2 1 
ATOM   2127  C  CE1 . TYR A 1 271  ? 0.693   8.084   37.631  1.00 67.36  ? 271  TYR A CE1 1 
ATOM   2128  C  CE2 . TYR A 1 271  ? 2.462   9.342   36.619  1.00 65.72  ? 271  TYR A CE2 1 
ATOM   2129  C  CZ  . TYR A 1 271  ? 1.312   9.295   37.392  1.00 66.93  ? 271  TYR A CZ  1 
ATOM   2130  O  OH  . TYR A 1 271  ? 0.770   10.426  37.926  1.00 68.09  ? 271  TYR A OH  1 
ATOM   2131  N  N   . LEU A 1 272  ? 4.186   4.667   32.934  1.00 63.69  ? 272  LEU A N   1 
ATOM   2132  C  CA  . LEU A 1 272  ? 5.316   3.882   32.453  1.00 61.56  ? 272  LEU A CA  1 
ATOM   2133  C  C   . LEU A 1 272  ? 6.502   4.080   33.395  1.00 60.40  ? 272  LEU A C   1 
ATOM   2134  O  O   . LEU A 1 272  ? 6.753   5.192   33.848  1.00 59.01  ? 272  LEU A O   1 
ATOM   2135  C  CB  . LEU A 1 272  ? 5.684   4.340   31.039  1.00 60.06  ? 272  LEU A CB  1 
ATOM   2136  C  CG  . LEU A 1 272  ? 4.659   4.028   29.951  1.00 60.87  ? 272  LEU A CG  1 
ATOM   2137  C  CD1 . LEU A 1 272  ? 5.001   4.748   28.661  1.00 60.08  ? 272  LEU A CD1 1 
ATOM   2138  C  CD2 . LEU A 1 272  ? 4.559   2.534   29.709  1.00 61.68  ? 272  LEU A CD2 1 
ATOM   2139  N  N   . LEU A 1 273  ? 7.212   2.985   33.687  1.00 60.58  ? 273  LEU A N   1 
ATOM   2140  C  CA  . LEU A 1 273  ? 8.438   3.023   34.467  1.00 60.63  ? 273  LEU A CA  1 
ATOM   2141  C  C   . LEU A 1 273  ? 9.537   2.286   33.706  1.00 61.45  ? 273  LEU A C   1 
ATOM   2142  O  O   . LEU A 1 273  ? 9.294   1.219   33.140  1.00 62.13  ? 273  LEU A O   1 
ATOM   2143  C  CB  . LEU A 1 273  ? 8.208   2.343   35.822  1.00 60.82  ? 273  LEU A CB  1 
ATOM   2144  C  CG  . LEU A 1 273  ? 7.017   2.808   36.658  1.00 61.14  ? 273  LEU A CG  1 
ATOM   2145  C  CD1 . LEU A 1 273  ? 6.905   1.970   37.924  1.00 61.27  ? 273  LEU A CD1 1 
ATOM   2146  C  CD2 . LEU A 1 273  ? 7.135   4.282   37.014  1.00 60.43  ? 273  LEU A CD2 1 
ATOM   2147  N  N   . GLY A 1 274  ? 10.753  2.851   33.726  1.00 62.29  ? 274  GLY A N   1 
ATOM   2148  C  CA  . GLY A 1 274  ? 11.915  2.227   33.105  1.00 63.58  ? 274  GLY A CA  1 
ATOM   2149  C  C   . GLY A 1 274  ? 13.012  1.928   34.124  1.00 64.29  ? 274  GLY A C   1 
ATOM   2150  O  O   . GLY A 1 274  ? 13.249  2.722   35.035  1.00 63.97  ? 274  GLY A O   1 
ATOM   2151  N  N   . ASP A 1 275  ? 13.680  0.782   33.960  1.00 65.42  ? 275  ASP A N   1 
ATOM   2152  C  CA  . ASP A 1 275  ? 14.721  0.390   34.896  1.00 66.95  ? 275  ASP A CA  1 
ATOM   2153  C  C   . ASP A 1 275  ? 16.067  0.357   34.174  1.00 66.97  ? 275  ASP A C   1 
ATOM   2154  O  O   . ASP A 1 275  ? 16.113  0.596   32.967  1.00 66.20  ? 275  ASP A O   1 
ATOM   2155  C  CB  . ASP A 1 275  ? 14.337  -0.879  35.665  1.00 68.42  ? 275  ASP A CB  1 
ATOM   2156  C  CG  . ASP A 1 275  ? 14.599  -2.178  34.926  1.00 69.62  ? 275  ASP A CG  1 
ATOM   2157  O  OD1 . ASP A 1 275  ? 15.303  -2.146  33.893  1.00 68.87  ? 275  ASP A OD1 1 
ATOM   2158  O  OD2 . ASP A 1 275  ? 14.109  -3.216  35.414  1.00 72.13  ? 275  ASP A OD2 1 
ATOM   2159  N  N   . MET A 1 276  ? 17.133  0.045   34.929  1.00 68.32  ? 276  MET A N   1 
ATOM   2160  C  CA  . MET A 1 276  ? 18.510  0.113   34.460  1.00 68.92  ? 276  MET A CA  1 
ATOM   2161  C  C   . MET A 1 276  ? 18.786  -0.976  33.427  1.00 67.82  ? 276  MET A C   1 
ATOM   2162  O  O   . MET A 1 276  ? 19.689  -0.819  32.614  1.00 67.92  ? 276  MET A O   1 
ATOM   2163  C  CB  . MET A 1 276  ? 19.503  -0.024  35.618  1.00 72.36  ? 276  MET A CB  1 
ATOM   2164  C  CG  . MET A 1 276  ? 20.011  1.309   36.173  1.00 76.08  ? 276  MET A CG  1 
ATOM   2165  S  SD  . MET A 1 276  ? 20.660  1.126   37.883  1.00 83.41  ? 276  MET A SD  1 
ATOM   2166  C  CE  . MET A 1 276  ? 21.394  2.743   38.128  1.00 81.15  ? 276  MET A CE  1 
ATOM   2167  N  N   . GLU A 1 277  ? 17.995  -2.056  33.446  1.00 67.79  ? 277  GLU A N   1 
ATOM   2168  C  CA  . GLU A 1 277  ? 18.241  -3.186  32.565  1.00 67.72  ? 277  GLU A CA  1 
ATOM   2169  C  C   . GLU A 1 277  ? 17.425  -3.048  31.285  1.00 65.83  ? 277  GLU A C   1 
ATOM   2170  O  O   . GLU A 1 277  ? 17.434  -3.946  30.449  1.00 66.79  ? 277  GLU A O   1 
ATOM   2171  C  CB  . GLU A 1 277  ? 17.919  -4.500  33.270  1.00 72.08  ? 277  GLU A CB  1 
ATOM   2172  C  CG  . GLU A 1 277  ? 19.086  -5.086  34.041  1.00 79.02  ? 277  GLU A CG  1 
ATOM   2173  C  CD  . GLU A 1 277  ? 18.749  -6.376  34.780  1.00 88.12  ? 277  GLU A CD  1 
ATOM   2174  O  OE1 . GLU A 1 277  ? 17.569  -6.821  34.703  1.00 93.49  ? 277  GLU A OE1 1 
ATOM   2175  O  OE2 . GLU A 1 277  ? 19.658  -6.945  35.441  1.00 92.01  ? 277  GLU A OE2 1 
ATOM   2176  N  N   . GLY A 1 278  ? 16.696  -1.935  31.151  1.00 64.32  ? 278  GLY A N   1 
ATOM   2177  C  CA  . GLY A 1 278  ? 15.890  -1.674  29.967  1.00 62.38  ? 278  GLY A CA  1 
ATOM   2178  C  C   . GLY A 1 278  ? 14.507  -2.331  29.998  1.00 62.54  ? 278  GLY A C   1 
ATOM   2179  O  O   . GLY A 1 278  ? 13.855  -2.428  28.961  1.00 63.20  ? 278  GLY A O   1 
ATOM   2180  N  N   . ARG A 1 279  ? 14.052  -2.773  31.181  1.00 62.11  ? 279  ARG A N   1 
ATOM   2181  C  CA  . ARG A 1 279  ? 12.706  -3.304  31.343  1.00 63.11  ? 279  ARG A CA  1 
ATOM   2182  C  C   . ARG A 1 279  ? 11.715  -2.143  31.393  1.00 63.70  ? 279  ARG A C   1 
ATOM   2183  O  O   . ARG A 1 279  ? 12.038  -1.059  31.883  1.00 63.67  ? 279  ARG A O   1 
ATOM   2184  C  CB  . ARG A 1 279  ? 12.599  -4.167  32.604  1.00 63.71  ? 279  ARG A CB  1 
ATOM   2185  C  CG  . ARG A 1 279  ? 13.297  -5.514  32.488  1.00 65.74  ? 279  ARG A CG  1 
ATOM   2186  C  CD  . ARG A 1 279  ? 13.930  -6.014  33.776  1.00 67.11  ? 279  ARG A CD  1 
ATOM   2187  N  NE  . ARG A 1 279  ? 13.063  -6.962  34.454  1.00 70.15  ? 279  ARG A NE  1 
ATOM   2188  C  CZ  . ARG A 1 279  ? 12.891  -7.036  35.771  1.00 72.27  ? 279  ARG A CZ  1 
ATOM   2189  N  NH1 . ARG A 1 279  ? 13.534  -6.203  36.577  1.00 71.50  ? 279  ARG A NH1 1 
ATOM   2190  N  NH2 . ARG A 1 279  ? 12.074  -7.949  36.275  1.00 74.51  ? 279  ARG A NH2 1 
ATOM   2191  N  N   . LEU A 1 280  ? 10.510  -2.371  30.857  1.00 64.90  ? 280  LEU A N   1 
ATOM   2192  C  CA  . LEU A 1 280  ? 9.471   -1.353  30.837  1.00 64.29  ? 280  LEU A CA  1 
ATOM   2193  C  C   . LEU A 1 280  ? 8.263   -1.878  31.601  1.00 65.76  ? 280  LEU A C   1 
ATOM   2194  O  O   . LEU A 1 280  ? 7.805   -2.985  31.332  1.00 66.96  ? 280  LEU A O   1 
ATOM   2195  C  CB  . LEU A 1 280  ? 9.105   -1.025  29.385  1.00 63.81  ? 280  LEU A CB  1 
ATOM   2196  C  CG  . LEU A 1 280  ? 8.109   0.122   29.217  1.00 64.14  ? 280  LEU A CG  1 
ATOM   2197  C  CD1 . LEU A 1 280  ? 8.644   1.397   29.848  1.00 62.38  ? 280  LEU A CD1 1 
ATOM   2198  C  CD2 . LEU A 1 280  ? 7.765   0.359   27.753  1.00 64.38  ? 280  LEU A CD2 1 
ATOM   2199  N  N   . PHE A 1 281  ? 7.771   -1.077  32.557  1.00 66.21  ? 281  PHE A N   1 
ATOM   2200  C  CA  . PHE A 1 281  ? 6.622   -1.456  33.371  1.00 67.13  ? 281  PHE A CA  1 
ATOM   2201  C  C   . PHE A 1 281  ? 5.473   -0.472  33.192  1.00 66.91  ? 281  PHE A C   1 
ATOM   2202  O  O   . PHE A 1 281  ? 5.679   0.697   32.869  1.00 65.74  ? 281  PHE A O   1 
ATOM   2203  C  CB  . PHE A 1 281  ? 6.958   -1.488  34.866  1.00 67.07  ? 281  PHE A CB  1 
ATOM   2204  C  CG  . PHE A 1 281  ? 8.065   -2.436  35.245  1.00 67.19  ? 281  PHE A CG  1 
ATOM   2205  C  CD1 . PHE A 1 281  ? 7.808   -3.779  35.488  1.00 68.29  ? 281  PHE A CD1 1 
ATOM   2206  C  CD2 . PHE A 1 281  ? 9.371   -1.983  35.348  1.00 65.47  ? 281  PHE A CD2 1 
ATOM   2207  C  CE1 . PHE A 1 281  ? 8.834   -4.645  35.836  1.00 68.36  ? 281  PHE A CE1 1 
ATOM   2208  C  CE2 . PHE A 1 281  ? 10.394  -2.852  35.694  1.00 65.43  ? 281  PHE A CE2 1 
ATOM   2209  C  CZ  . PHE A 1 281  ? 10.125  -4.179  35.939  1.00 66.83  ? 281  PHE A CZ  1 
ATOM   2210  N  N   . MET A 1 282  ? 4.262   -0.983  33.431  1.00 68.31  ? 282  MET A N   1 
ATOM   2211  C  CA  . MET A 1 282  ? 3.082   -0.163  33.641  1.00 69.11  ? 282  MET A CA  1 
ATOM   2212  C  C   . MET A 1 282  ? 2.758   -0.163  35.135  1.00 69.54  ? 282  MET A C   1 
ATOM   2213  O  O   . MET A 1 282  ? 2.689   -1.225  35.754  1.00 69.88  ? 282  MET A O   1 
ATOM   2214  C  CB  . MET A 1 282  ? 1.887   -0.728  32.867  1.00 70.76  ? 282  MET A CB  1 
ATOM   2215  C  CG  . MET A 1 282  ? 0.711   0.222   32.795  1.00 72.46  ? 282  MET A CG  1 
ATOM   2216  S  SD  . MET A 1 282  ? 1.064   1.615   31.704  1.00 73.11  ? 282  MET A SD  1 
ATOM   2217  C  CE  . MET A 1 282  ? 0.646   0.912   30.110  1.00 72.47  ? 282  MET A CE  1 
ATOM   2218  N  N   . LEU A 1 283  ? 2.595   1.033   35.717  1.00 68.94  ? 283  LEU A N   1 
ATOM   2219  C  CA  . LEU A 1 283  ? 2.083   1.147   37.074  1.00 69.81  ? 283  LEU A CA  1 
ATOM   2220  C  C   . LEU A 1 283  ? 0.625   1.589   37.008  1.00 72.34  ? 283  LEU A C   1 
ATOM   2221  O  O   . LEU A 1 283  ? 0.339   2.704   36.579  1.00 71.92  ? 283  LEU A O   1 
ATOM   2222  C  CB  . LEU A 1 283  ? 2.925   2.149   37.869  1.00 67.52  ? 283  LEU A CB  1 
ATOM   2223  C  CG  . LEU A 1 283  ? 2.427   2.458   39.282  1.00 67.90  ? 283  LEU A CG  1 
ATOM   2224  C  CD1 . LEU A 1 283  ? 2.416   1.213   40.154  1.00 68.37  ? 283  LEU A CD1 1 
ATOM   2225  C  CD2 . LEU A 1 283  ? 3.260   3.555   39.930  1.00 66.36  ? 283  LEU A CD2 1 
ATOM   2226  N  N   . LEU A 1 284  ? -0.279  0.694   37.430  1.00 76.20  ? 284  LEU A N   1 
ATOM   2227  C  CA  . LEU A 1 284  ? -1.713  0.941   37.434  1.00 79.49  ? 284  LEU A CA  1 
ATOM   2228  C  C   . LEU A 1 284  ? -2.150  1.431   38.815  1.00 81.30  ? 284  LEU A C   1 
ATOM   2229  O  O   . LEU A 1 284  ? -1.769  0.858   39.837  1.00 80.84  ? 284  LEU A O   1 
ATOM   2230  C  CB  . LEU A 1 284  ? -2.452  -0.353  37.073  1.00 81.82  ? 284  LEU A CB  1 
ATOM   2231  C  CG  . LEU A 1 284  ? -2.645  -0.650  35.588  1.00 82.79  ? 284  LEU A CG  1 
ATOM   2232  C  CD1 . LEU A 1 284  ? -1.360  -1.201  34.991  1.00 82.38  ? 284  LEU A CD1 1 
ATOM   2233  C  CD2 . LEU A 1 284  ? -3.760  -1.666  35.412  1.00 86.36  ? 284  LEU A CD2 1 
ATOM   2234  N  N   . LEU A 1 285  ? -2.960  2.500   38.823  1.00 82.97  ? 285  LEU A N   1 
ATOM   2235  C  CA  . LEU A 1 285  ? -3.690  2.954   39.999  1.00 84.93  ? 285  LEU A CA  1 
ATOM   2236  C  C   . LEU A 1 285  ? -5.157  2.547   39.857  1.00 87.32  ? 285  LEU A C   1 
ATOM   2237  O  O   . LEU A 1 285  ? -5.842  3.023   38.953  1.00 87.48  ? 285  LEU A O   1 
ATOM   2238  C  CB  . LEU A 1 285  ? -3.599  4.482   40.095  1.00 83.69  ? 285  LEU A CB  1 
ATOM   2239  C  CG  . LEU A 1 285  ? -2.227  5.106   40.364  1.00 81.71  ? 285  LEU A CG  1 
ATOM   2240  C  CD1 . LEU A 1 285  ? -2.366  6.603   40.568  1.00 80.75  ? 285  LEU A CD1 1 
ATOM   2241  C  CD2 . LEU A 1 285  ? -1.574  4.505   41.591  1.00 82.70  ? 285  LEU A CD2 1 
ATOM   2242  N  N   . GLU A 1 286  ? -5.640  1.692   40.767  1.00 90.60  ? 286  GLU A N   1 
ATOM   2243  C  CA  . GLU A 1 286  ? -7.027  1.244   40.734  1.00 94.86  ? 286  GLU A CA  1 
ATOM   2244  C  C   . GLU A 1 286  ? -7.929  2.296   41.378  1.00 94.63  ? 286  GLU A C   1 
ATOM   2245  O  O   . GLU A 1 286  ? -7.827  2.553   42.574  1.00 94.98  ? 286  GLU A O   1 
ATOM   2246  C  CB  . GLU A 1 286  ? -7.199  -0.116  41.418  1.00 99.73  ? 286  GLU A CB  1 
ATOM   2247  C  CG  . GLU A 1 286  ? -6.264  -1.196  40.888  1.00 102.89 ? 286  GLU A CG  1 
ATOM   2248  C  CD  . GLU A 1 286  ? -6.807  -2.618  40.922  1.00 107.25 ? 286  GLU A CD  1 
ATOM   2249  O  OE1 . GLU A 1 286  ? -7.914  -2.832  41.491  1.00 108.71 ? 286  GLU A OE1 1 
ATOM   2250  O  OE2 . GLU A 1 286  ? -6.124  -3.514  40.366  1.00 108.87 ? 286  GLU A OE2 1 
ATOM   2251  N  N   . LYS A 1 287  ? -8.821  2.881   40.570  1.00 94.87  ? 287  LYS A N   1 
ATOM   2252  C  CA  . LYS A 1 287  ? -9.763  3.898   41.019  1.00 96.43  ? 287  LYS A CA  1 
ATOM   2253  C  C   . LYS A 1 287  ? -10.823 3.273   41.920  1.00 96.68  ? 287  LYS A C   1 
ATOM   2254  O  O   . LYS A 1 287  ? -11.165 2.105   41.771  1.00 96.32  ? 287  LYS A O   1 
ATOM   2255  C  CB  . LYS A 1 287  ? -10.544 4.474   39.835  1.00 100.09 ? 287  LYS A CB  1 
ATOM   2256  C  CG  . LYS A 1 287  ? -9.743  5.292   38.836  1.00 103.23 ? 287  LYS A CG  1 
ATOM   2257  C  CD  . LYS A 1 287  ? -10.573 5.715   37.643  1.00 107.54 ? 287  LYS A CD  1 
ATOM   2258  C  CE  . LYS A 1 287  ? -9.736  6.433   36.605  1.00 108.21 ? 287  LYS A CE  1 
ATOM   2259  N  NZ  . LYS A 1 287  ? -10.566 7.008   35.522  1.00 113.41 ? 287  LYS A NZ  1 
ATOM   2260  N  N   . GLU A 1 288  ? -11.361 4.078   42.838  1.00 96.97  ? 288  GLU A N   1 
ATOM   2261  C  CA  . GLU A 1 288  ? -12.548 3.696   43.584  1.00 99.66  ? 288  GLU A CA  1 
ATOM   2262  C  C   . GLU A 1 288  ? -13.536 4.861   43.557  1.00 100.15 ? 288  GLU A C   1 
ATOM   2263  O  O   . GLU A 1 288  ? -13.250 5.927   44.103  1.00 98.84  ? 288  GLU A O   1 
ATOM   2264  C  CB  . GLU A 1 288  ? -12.169 3.226   44.994  1.00 101.32 ? 288  GLU A CB  1 
ATOM   2265  C  CG  . GLU A 1 288  ? -13.344 2.782   45.853  1.00 105.13 ? 288  GLU A CG  1 
ATOM   2266  C  CD  . GLU A 1 288  ? -13.702 1.304   45.828  1.00 107.51 ? 288  GLU A CD  1 
ATOM   2267  O  OE1 . GLU A 1 288  ? -13.361 0.622   44.839  1.00 107.01 ? 288  GLU A OE1 1 
ATOM   2268  O  OE2 . GLU A 1 288  ? -14.328 0.832   46.802  1.00 110.48 ? 288  GLU A OE2 1 
ATOM   2269  N  N   . GLU A 1 289  ? -14.679 4.644   42.886  1.00 101.65 ? 289  GLU A N   1 
ATOM   2270  C  CA  . GLU A 1 289  ? -15.771 5.607   42.820  1.00 103.51 ? 289  GLU A CA  1 
ATOM   2271  C  C   . GLU A 1 289  ? -16.493 5.658   44.165  1.00 104.41 ? 289  GLU A C   1 
ATOM   2272  O  O   . GLU A 1 289  ? -16.610 4.648   44.850  1.00 104.64 ? 289  GLU A O   1 
ATOM   2273  C  CB  . GLU A 1 289  ? -16.772 5.243   41.720  1.00 106.80 ? 289  GLU A CB  1 
ATOM   2274  C  CG  . GLU A 1 289  ? -16.322 5.599   40.306  1.00 106.39 ? 289  GLU A CG  1 
ATOM   2275  C  CD  . GLU A 1 289  ? -17.426 5.567   39.249  1.00 108.79 ? 289  GLU A CD  1 
ATOM   2276  O  OE1 . GLU A 1 289  ? -17.268 6.256   38.212  1.00 108.78 ? 289  GLU A OE1 1 
ATOM   2277  O  OE2 . GLU A 1 289  ? -18.445 4.856   39.457  1.00 109.15 ? 289  GLU A OE2 1 
ATOM   2278  N  N   . GLN A 1 290  ? -16.976 6.848   44.529  1.00 104.81 ? 290  GLN A N   1 
ATOM   2279  C  CA  . GLN A 1 290  ? -17.634 7.049   45.809  1.00 108.12 ? 290  GLN A CA  1 
ATOM   2280  C  C   . GLN A 1 290  ? -19.045 7.582   45.568  1.00 111.02 ? 290  GLN A C   1 
ATOM   2281  O  O   . GLN A 1 290  ? -19.337 8.088   44.487  1.00 110.57 ? 290  GLN A O   1 
ATOM   2282  C  CB  . GLN A 1 290  ? -16.801 7.997   46.675  1.00 107.29 ? 290  GLN A CB  1 
ATOM   2283  C  CG  . GLN A 1 290  ? -15.373 7.525   46.922  1.00 104.76 ? 290  GLN A CG  1 
ATOM   2284  C  CD  . GLN A 1 290  ? -15.300 6.220   47.679  1.00 106.26 ? 290  GLN A CD  1 
ATOM   2285  O  OE1 . GLN A 1 290  ? -15.875 6.064   48.754  1.00 109.54 ? 290  GLN A OE1 1 
ATOM   2286  N  NE2 . GLN A 1 290  ? -14.577 5.264   47.121  1.00 104.24 ? 290  GLN A NE2 1 
ATOM   2287  N  N   . MET A 1 291  ? -19.918 7.456   46.575  1.00 114.46 ? 291  MET A N   1 
ATOM   2288  C  CA  . MET A 1 291  ? -21.261 8.009   46.484  1.00 118.19 ? 291  MET A CA  1 
ATOM   2289  C  C   . MET A 1 291  ? -21.135 9.501   46.187  1.00 116.84 ? 291  MET A C   1 
ATOM   2290  O  O   . MET A 1 291  ? -21.755 10.025  45.265  1.00 117.19 ? 291  MET A O   1 
ATOM   2291  C  CB  . MET A 1 291  ? -22.020 7.807   47.799  1.00 122.51 ? 291  MET A CB  1 
ATOM   2292  C  CG  . MET A 1 291  ? -23.516 7.755   47.623  1.00 127.29 ? 291  MET A CG  1 
ATOM   2293  S  SD  . MET A 1 291  ? -24.020 6.168   46.935  1.00 130.45 ? 291  MET A SD  1 
ATOM   2294  C  CE  . MET A 1 291  ? -24.737 5.390   48.384  1.00 133.77 ? 291  MET A CE  1 
ATOM   2295  N  N   . ASP A 1 292  ? -20.299 10.157  46.991  1.00 115.35 ? 292  ASP A N   1 
ATOM   2296  C  CA  . ASP A 1 292  ? -19.789 11.488  46.734  1.00 114.34 ? 292  ASP A CA  1 
ATOM   2297  C  C   . ASP A 1 292  ? -19.015 11.456  45.414  1.00 111.29 ? 292  ASP A C   1 
ATOM   2298  O  O   . ASP A 1 292  ? -18.419 10.440  45.070  1.00 110.00 ? 292  ASP A O   1 
ATOM   2299  C  CB  . ASP A 1 292  ? -18.977 11.908  47.959  1.00 114.55 ? 292  ASP A CB  1 
ATOM   2300  C  CG  . ASP A 1 292  ? -18.004 13.042  47.728  1.00 113.01 ? 292  ASP A CG  1 
ATOM   2301  O  OD1 . ASP A 1 292  ? -18.421 14.058  47.127  1.00 114.13 ? 292  ASP A OD1 1 
ATOM   2302  O  OD2 . ASP A 1 292  ? -16.842 12.897  48.164  1.00 110.84 ? 292  ASP A OD2 1 
ATOM   2303  N  N   . GLY A 1 293  ? -19.020 12.569  44.674  1.00 110.37 ? 293  GLY A N   1 
ATOM   2304  C  CA  . GLY A 1 293  ? -18.524 12.586  43.304  1.00 107.90 ? 293  GLY A CA  1 
ATOM   2305  C  C   . GLY A 1 293  ? -17.101 12.051  43.126  1.00 104.83 ? 293  GLY A C   1 
ATOM   2306  O  O   . GLY A 1 293  ? -16.670 11.841  41.996  1.00 103.61 ? 293  GLY A O   1 
ATOM   2307  N  N   . THR A 1 294  ? -16.394 11.799  44.237  1.00 104.26 ? 294  THR A N   1 
ATOM   2308  C  CA  . THR A 1 294  ? -14.938 11.719  44.264  1.00 101.12 ? 294  THR A CA  1 
ATOM   2309  C  C   . THR A 1 294  ? -14.436 10.307  43.947  1.00 99.20  ? 294  THR A C   1 
ATOM   2310  O  O   . THR A 1 294  ? -15.228 9.419   43.646  1.00 100.19 ? 294  THR A O   1 
ATOM   2311  C  CB  . THR A 1 294  ? -14.410 12.250  45.604  1.00 101.70 ? 294  THR A CB  1 
ATOM   2312  O  OG1 . THR A 1 294  ? -14.979 11.434  46.627  1.00 104.61 ? 294  THR A OG1 1 
ATOM   2313  C  CG2 . THR A 1 294  ? -14.779 13.696  45.852  1.00 102.39 ? 294  THR A CG2 1 
ATOM   2314  N  N   . VAL A 1 295  ? -13.104 10.125  44.019  1.00 96.89  ? 295  VAL A N   1 
ATOM   2315  C  CA  . VAL A 1 295  ? -12.400 8.898   43.659  1.00 95.09  ? 295  VAL A CA  1 
ATOM   2316  C  C   . VAL A 1 295  ? -11.210 8.709   44.605  1.00 94.11  ? 295  VAL A C   1 
ATOM   2317  O  O   . VAL A 1 295  ? -10.418 9.629   44.794  1.00 93.37  ? 295  VAL A O   1 
ATOM   2318  C  CB  . VAL A 1 295  ? -11.911 8.928   42.194  1.00 92.20  ? 295  VAL A CB  1 
ATOM   2319  C  CG1 . VAL A 1 295  ? -11.438 7.568   41.712  1.00 90.59  ? 295  VAL A CG1 1 
ATOM   2320  C  CG2 . VAL A 1 295  ? -12.933 9.503   41.227  1.00 93.58  ? 295  VAL A CG2 1 
ATOM   2321  N  N   . THR A 1 296  ? -11.073 7.499   45.168  1.00 94.89  ? 296  THR A N   1 
ATOM   2322  C  CA  . THR A 1 296  ? -9.958  7.151   46.042  1.00 94.45  ? 296  THR A CA  1 
ATOM   2323  C  C   . THR A 1 296  ? -9.122  6.042   45.402  1.00 93.06  ? 296  THR A C   1 
ATOM   2324  O  O   . THR A 1 296  ? -9.642  5.268   44.602  1.00 93.70  ? 296  THR A O   1 
ATOM   2325  C  CB  . THR A 1 296  ? -10.449 6.685   47.421  1.00 97.17  ? 296  THR A CB  1 
ATOM   2326  O  OG1 . THR A 1 296  ? -11.356 5.593   47.253  1.00 98.66  ? 296  THR A OG1 1 
ATOM   2327  C  CG2 . THR A 1 296  ? -11.093 7.788   48.234  1.00 99.01  ? 296  THR A CG2 1 
ATOM   2328  N  N   . LEU A 1 297  ? -7.837  5.948   45.778  1.00 91.21  ? 297  LEU A N   1 
ATOM   2329  C  CA  . LEU A 1 297  ? -6.989  4.874   45.282  1.00 89.52  ? 297  LEU A CA  1 
ATOM   2330  C  C   . LEU A 1 297  ? -7.281  3.585   46.045  1.00 91.28  ? 297  LEU A C   1 
ATOM   2331  O  O   . LEU A 1 297  ? -7.145  3.539   47.265  1.00 91.90  ? 297  LEU A O   1 
ATOM   2332  C  CB  . LEU A 1 297  ? -5.515  5.254   45.425  1.00 87.45  ? 297  LEU A CB  1 
ATOM   2333  C  CG  . LEU A 1 297  ? -4.552  4.236   44.824  1.00 86.23  ? 297  LEU A CG  1 
ATOM   2334  C  CD1 . LEU A 1 297  ? -4.378  4.495   43.341  1.00 84.64  ? 297  LEU A CD1 1 
ATOM   2335  C  CD2 . LEU A 1 297  ? -3.209  4.280   45.526  1.00 85.82  ? 297  LEU A CD2 1 
ATOM   2336  N  N   . LYS A 1 298  ? -7.663  2.539   45.305  1.00 92.41  ? 298  LYS A N   1 
ATOM   2337  C  CA  . LYS A 1 298  ? -7.954  1.245   45.899  1.00 95.33  ? 298  LYS A CA  1 
ATOM   2338  C  C   . LYS A 1 298  ? -6.678  0.414   46.025  1.00 94.65  ? 298  LYS A C   1 
ATOM   2339  O  O   . LYS A 1 298  ? -6.425  -0.161  47.084  1.00 95.49  ? 298  LYS A O   1 
ATOM   2340  C  CB  . LYS A 1 298  ? -9.035  0.487   45.120  1.00 97.51  ? 298  LYS A CB  1 
ATOM   2341  C  CG  . LYS A 1 298  ? -9.254  -0.949  45.586  1.00 100.12 ? 298  LYS A CG  1 
ATOM   2342  C  CD  . LYS A 1 298  ? -10.579 -1.550  45.191  1.00 102.41 ? 298  LYS A CD  1 
ATOM   2343  C  CE  . LYS A 1 298  ? -10.784 -2.911  45.820  1.00 105.23 ? 298  LYS A CE  1 
ATOM   2344  N  NZ  . LYS A 1 298  ? -12.127 -3.465  45.520  1.00 108.65 ? 298  LYS A NZ  1 
ATOM   2345  N  N   . ASP A 1 299  ? -5.896  0.335   44.938  1.00 93.52  ? 299  ASP A N   1 
ATOM   2346  C  CA  . ASP A 1 299  ? -4.736  -0.546  44.896  1.00 93.39  ? 299  ASP A CA  1 
ATOM   2347  C  C   . ASP A 1 299  ? -3.691  -0.044  43.893  1.00 89.99  ? 299  ASP A C   1 
ATOM   2348  O  O   . ASP A 1 299  ? -3.963  0.855   43.098  1.00 89.53  ? 299  ASP A O   1 
ATOM   2349  C  CB  . ASP A 1 299  ? -5.167  -1.996  44.640  1.00 96.18  ? 299  ASP A CB  1 
ATOM   2350  C  CG  . ASP A 1 299  ? -4.170  -3.036  45.124  1.00 97.78  ? 299  ASP A CG  1 
ATOM   2351  O  OD1 . ASP A 1 299  ? -3.135  -2.644  45.707  1.00 97.49  ? 299  ASP A OD1 1 
ATOM   2352  O  OD2 . ASP A 1 299  ? -4.441  -4.237  44.914  1.00 100.08 ? 299  ASP A OD2 1 
ATOM   2353  N  N   . LEU A 1 300  ? -2.485  -0.635  43.960  1.00 87.43  ? 300  LEU A N   1 
ATOM   2354  C  CA  . LEU A 1 300  ? -1.382  -0.405  43.037  1.00 83.50  ? 300  LEU A CA  1 
ATOM   2355  C  C   . LEU A 1 300  ? -0.929  -1.735  42.440  1.00 83.25  ? 300  LEU A C   1 
ATOM   2356  O  O   . LEU A 1 300  ? -0.683  -2.691  43.172  1.00 84.16  ? 300  LEU A O   1 
ATOM   2357  C  CB  . LEU A 1 300  ? -0.201  0.162   43.828  1.00 82.24  ? 300  LEU A CB  1 
ATOM   2358  C  CG  . LEU A 1 300  ? -0.283  1.619   44.265  1.00 82.01  ? 300  LEU A CG  1 
ATOM   2359  C  CD1 . LEU A 1 300  ? 0.928   1.974   45.112  1.00 81.36  ? 300  LEU A CD1 1 
ATOM   2360  C  CD2 . LEU A 1 300  ? -0.337  2.525   43.054  1.00 80.55  ? 300  LEU A CD2 1 
ATOM   2361  N  N   . ARG A 1 301  ? -0.751  -1.772  41.118  1.00 81.95  ? 301  ARG A N   1 
ATOM   2362  C  CA  . ARG A 1 301  ? -0.207  -2.958  40.479  1.00 82.24  ? 301  ARG A CA  1 
ATOM   2363  C  C   . ARG A 1 301  ? 0.935   -2.534  39.562  1.00 78.86  ? 301  ARG A C   1 
ATOM   2364  O  O   . ARG A 1 301  ? 0.904   -1.439  39.007  1.00 78.15  ? 301  ARG A O   1 
ATOM   2365  C  CB  . ARG A 1 301  ? -1.315  -3.723  39.748  1.00 85.99  ? 301  ARG A CB  1 
ATOM   2366  C  CG  . ARG A 1 301  ? -0.968  -5.167  39.404  1.00 89.75  ? 301  ARG A CG  1 
ATOM   2367  C  CD  . ARG A 1 301  ? -2.159  -6.111  39.466  1.00 95.13  ? 301  ARG A CD  1 
ATOM   2368  N  NE  . ARG A 1 301  ? -3.422  -5.478  39.094  1.00 97.59  ? 301  ARG A NE  1 
ATOM   2369  C  CZ  . ARG A 1 301  ? -3.830  -5.258  37.845  1.00 98.11  ? 301  ARG A CZ  1 
ATOM   2370  N  NH1 . ARG A 1 301  ? -3.077  -5.625  36.820  1.00 98.22  ? 301  ARG A NH1 1 
ATOM   2371  N  NH2 . ARG A 1 301  ? -4.991  -4.667  37.629  1.00 99.22  ? 301  ARG A NH2 1 
ATOM   2372  N  N   . VAL A 1 302  ? 1.950   -3.398  39.440  1.00 76.85  ? 302  VAL A N   1 
ATOM   2373  C  CA  . VAL A 1 302  ? 3.034   -3.178  38.497  1.00 74.22  ? 302  VAL A CA  1 
ATOM   2374  C  C   . VAL A 1 302  ? 3.030   -4.341  37.513  1.00 74.13  ? 302  VAL A C   1 
ATOM   2375  O  O   . VAL A 1 302  ? 2.882   -5.484  37.930  1.00 75.61  ? 302  VAL A O   1 
ATOM   2376  C  CB  . VAL A 1 302  ? 4.391   -3.044  39.214  1.00 73.19  ? 302  VAL A CB  1 
ATOM   2377  C  CG1 . VAL A 1 302  ? 5.551   -3.114  38.240  1.00 72.35  ? 302  VAL A CG1 1 
ATOM   2378  C  CG2 . VAL A 1 302  ? 4.479   -1.762  40.022  1.00 72.49  ? 302  VAL A CG2 1 
ATOM   2379  N  N   . GLU A 1 303  ? 3.185   -4.037  36.217  1.00 73.02  ? 303  GLU A N   1 
ATOM   2380  C  CA  . GLU A 1 303  ? 3.131   -5.057  35.180  1.00 73.66  ? 303  GLU A CA  1 
ATOM   2381  C  C   . GLU A 1 303  ? 4.278   -4.884  34.181  1.00 71.46  ? 303  GLU A C   1 
ATOM   2382  O  O   . GLU A 1 303  ? 4.438   -3.816  33.595  1.00 70.88  ? 303  GLU A O   1 
ATOM   2383  C  CB  . GLU A 1 303  ? 1.764   -5.044  34.495  1.00 75.07  ? 303  GLU A CB  1 
ATOM   2384  C  CG  . GLU A 1 303  ? 1.284   -6.437  34.141  1.00 78.90  ? 303  GLU A CG  1 
ATOM   2385  C  CD  . GLU A 1 303  ? 0.700   -7.259  35.283  1.00 82.20  ? 303  GLU A CD  1 
ATOM   2386  O  OE1 . GLU A 1 303  ? 1.273   -8.334  35.568  1.00 83.33  ? 303  GLU A OE1 1 
ATOM   2387  O  OE2 . GLU A 1 303  ? -0.331  -6.837  35.880  1.00 83.18  ? 303  GLU A OE2 1 
ATOM   2388  N  N   . LEU A 1 304  ? 5.062   -5.952  33.979  1.00 69.81  ? 304  LEU A N   1 
ATOM   2389  C  CA  . LEU A 1 304  ? 6.167   -5.937  33.034  1.00 67.66  ? 304  LEU A CA  1 
ATOM   2390  C  C   . LEU A 1 304  ? 5.637   -5.968  31.600  1.00 68.25  ? 304  LEU A C   1 
ATOM   2391  O  O   . LEU A 1 304  ? 4.993   -6.931  31.193  1.00 71.13  ? 304  LEU A O   1 
ATOM   2392  C  CB  . LEU A 1 304  ? 7.083   -7.132  33.323  1.00 67.20  ? 304  LEU A CB  1 
ATOM   2393  C  CG  . LEU A 1 304  ? 8.170   -7.406  32.284  1.00 64.82  ? 304  LEU A CG  1 
ATOM   2394  C  CD1 . LEU A 1 304  ? 9.214   -6.304  32.271  1.00 62.62  ? 304  LEU A CD1 1 
ATOM   2395  C  CD2 . LEU A 1 304  ? 8.818   -8.748  32.537  1.00 65.41  ? 304  LEU A CD2 1 
ATOM   2396  N  N   . LEU A 1 305  ? 5.940   -4.915  30.833  1.00 67.26  ? 305  LEU A N   1 
ATOM   2397  C  CA  . LEU A 1 305  ? 5.462   -4.775  29.465  1.00 67.57  ? 305  LEU A CA  1 
ATOM   2398  C  C   . LEU A 1 305  ? 6.441   -5.424  28.484  1.00 67.69  ? 305  LEU A C   1 
ATOM   2399  O  O   . LEU A 1 305  ? 6.023   -5.974  27.467  1.00 68.25  ? 305  LEU A O   1 
ATOM   2400  C  CB  . LEU A 1 305  ? 5.227   -3.294  29.134  1.00 66.75  ? 305  LEU A CB  1 
ATOM   2401  C  CG  . LEU A 1 305  ? 4.203   -2.567  30.011  1.00 67.38  ? 305  LEU A CG  1 
ATOM   2402  C  CD1 . LEU A 1 305  ? 3.842   -1.200  29.444  1.00 66.60  ? 305  LEU A CD1 1 
ATOM   2403  C  CD2 . LEU A 1 305  ? 2.951   -3.409  30.197  1.00 68.76  ? 305  LEU A CD2 1 
ATOM   2404  N  N   . GLY A 1 306  ? 7.744   -5.359  28.793  1.00 67.42  ? 306  GLY A N   1 
ATOM   2405  C  CA  . GLY A 1 306  ? 8.776   -5.903  27.922  1.00 67.50  ? 306  GLY A CA  1 
ATOM   2406  C  C   . GLY A 1 306  ? 10.080  -5.126  28.047  1.00 66.68  ? 306  GLY A C   1 
ATOM   2407  O  O   . GLY A 1 306  ? 10.334  -4.517  29.081  1.00 66.58  ? 306  GLY A O   1 
ATOM   2408  N  N   . GLU A 1 307  ? 10.882  -5.129  26.976  1.00 67.75  ? 307  GLU A N   1 
ATOM   2409  C  CA  . GLU A 1 307  ? 12.225  -4.570  27.015  1.00 66.78  ? 307  GLU A CA  1 
ATOM   2410  C  C   . GLU A 1 307  ? 12.377  -3.465  25.966  1.00 64.79  ? 307  GLU A C   1 
ATOM   2411  O  O   . GLU A 1 307  ? 11.954  -3.616  24.822  1.00 64.52  ? 307  GLU A O   1 
ATOM   2412  C  CB  . GLU A 1 307  ? 13.250  -5.696  26.854  1.00 69.46  ? 307  GLU A CB  1 
ATOM   2413  C  CG  . GLU A 1 307  ? 14.684  -5.220  26.889  1.00 72.98  ? 307  GLU A CG  1 
ATOM   2414  C  CD  . GLU A 1 307  ? 15.718  -6.285  26.582  1.00 77.44  ? 307  GLU A CD  1 
ATOM   2415  O  OE1 . GLU A 1 307  ? 15.724  -7.306  27.296  1.00 80.88  ? 307  GLU A OE1 1 
ATOM   2416  O  OE2 . GLU A 1 307  ? 16.523  -6.085  25.638  1.00 79.51  ? 307  GLU A OE2 1 
ATOM   2417  N  N   . THR A 1 308  ? 12.979  -2.346  26.384  1.00 62.34  ? 308  THR A N   1 
ATOM   2418  C  CA  . THR A 1 308  ? 13.384  -1.267  25.498  1.00 61.61  ? 308  THR A CA  1 
ATOM   2419  C  C   . THR A 1 308  ? 14.877  -1.010  25.686  1.00 61.16  ? 308  THR A C   1 
ATOM   2420  O  O   . THR A 1 308  ? 15.527  -1.686  26.483  1.00 62.40  ? 308  THR A O   1 
ATOM   2421  C  CB  . THR A 1 308  ? 12.612  0.018   25.818  1.00 60.87  ? 308  THR A CB  1 
ATOM   2422  O  OG1 . THR A 1 308  ? 12.775  0.296   27.210  1.00 60.34  ? 308  THR A OG1 1 
ATOM   2423  C  CG2 . THR A 1 308  ? 11.142  -0.075  25.475  1.00 61.66  ? 308  THR A CG2 1 
ATOM   2424  N  N   . SER A 1 309  ? 15.416  -0.025  24.956  1.00 59.71  ? 309  SER A N   1 
ATOM   2425  C  CA  . SER A 1 309  ? 16.723  0.506   25.296  1.00 58.52  ? 309  SER A CA  1 
ATOM   2426  C  C   . SER A 1 309  ? 16.693  0.943   26.758  1.00 57.86  ? 309  SER A C   1 
ATOM   2427  O  O   . SER A 1 309  ? 15.620  1.104   27.330  1.00 59.19  ? 309  SER A O   1 
ATOM   2428  C  CB  . SER A 1 309  ? 17.094  1.653   24.401  1.00 58.16  ? 309  SER A CB  1 
ATOM   2429  O  OG  . SER A 1 309  ? 17.221  1.227   23.055  1.00 59.06  ? 309  SER A OG  1 
ATOM   2430  N  N   . ILE A 1 310  ? 17.869  1.110   27.369  1.00 57.14  ? 310  ILE A N   1 
ATOM   2431  C  CA  . ILE A 1 310  ? 17.935  1.676   28.707  1.00 56.34  ? 310  ILE A CA  1 
ATOM   2432  C  C   . ILE A 1 310  ? 17.515  3.134   28.588  1.00 57.13  ? 310  ILE A C   1 
ATOM   2433  O  O   . ILE A 1 310  ? 18.184  3.905   27.911  1.00 59.71  ? 310  ILE A O   1 
ATOM   2434  C  CB  . ILE A 1 310  ? 19.341  1.532   29.332  1.00 54.27  ? 310  ILE A CB  1 
ATOM   2435  C  CG1 . ILE A 1 310  ? 19.822  0.078   29.341  1.00 53.91  ? 310  ILE A CG1 1 
ATOM   2436  C  CG2 . ILE A 1 310  ? 19.374  2.147   30.726  1.00 52.85  ? 310  ILE A CG2 1 
ATOM   2437  C  CD1 . ILE A 1 310  ? 21.304  -0.072  29.517  1.00 53.18  ? 310  ILE A CD1 1 
ATOM   2438  N  N   . ALA A 1 311  ? 16.407  3.491   29.242  1.00 57.59  ? 311  ALA A N   1 
ATOM   2439  C  CA  . ALA A 1 311  ? 15.778  4.784   29.036  1.00 57.45  ? 311  ALA A CA  1 
ATOM   2440  C  C   . ALA A 1 311  ? 16.301  5.799   30.042  1.00 56.93  ? 311  ALA A C   1 
ATOM   2441  O  O   . ALA A 1 311  ? 16.390  5.515   31.234  1.00 56.37  ? 311  ALA A O   1 
ATOM   2442  C  CB  . ALA A 1 311  ? 14.282  4.636   29.172  1.00 60.24  ? 311  ALA A CB  1 
ATOM   2443  N  N   . GLU A 1 312  ? 16.629  6.989   29.536  1.00 58.10  ? 312  GLU A N   1 
ATOM   2444  C  CA  . GLU A 1 312  ? 16.926  8.138   30.374  1.00 60.17  ? 312  GLU A CA  1 
ATOM   2445  C  C   . GLU A 1 312  ? 15.598  8.799   30.742  1.00 61.19  ? 312  GLU A C   1 
ATOM   2446  O  O   . GLU A 1 312  ? 15.396  9.265   31.866  1.00 60.23  ? 312  GLU A O   1 
ATOM   2447  C  CB  . GLU A 1 312  ? 17.853  9.102   29.623  1.00 60.21  ? 312  GLU A CB  1 
ATOM   2448  C  CG  . GLU A 1 312  ? 18.190  10.366  30.398  1.00 62.02  ? 312  GLU A CG  1 
ATOM   2449  C  CD  . GLU A 1 312  ? 18.884  10.179  31.740  1.00 65.17  ? 312  GLU A CD  1 
ATOM   2450  O  OE1 . GLU A 1 312  ? 19.292  9.039   32.067  1.00 66.18  ? 312  GLU A OE1 1 
ATOM   2451  O  OE2 . GLU A 1 312  ? 19.022  11.179  32.463  1.00 68.86  ? 312  GLU A OE2 1 
ATOM   2452  N  N   . CYS A 1 313  ? 14.700  8.812   29.753  1.00 62.11  ? 313  CYS A N   1 
ATOM   2453  C  CA  . CYS A 1 313  ? 13.367  9.366   29.882  1.00 63.18  ? 313  CYS A CA  1 
ATOM   2454  C  C   . CYS A 1 313  ? 12.422  8.625   28.940  1.00 64.44  ? 313  CYS A C   1 
ATOM   2455  O  O   . CYS A 1 313  ? 12.836  8.090   27.908  1.00 64.37  ? 313  CYS A O   1 
ATOM   2456  C  CB  . CYS A 1 313  ? 13.384  10.847  29.535  1.00 63.53  ? 313  CYS A CB  1 
ATOM   2457  S  SG  . CYS A 1 313  ? 14.311  11.190  28.020  1.00 62.15  ? 313  CYS A SG  1 
ATOM   2458  N  N   . LEU A 1 314  ? 11.147  8.604   29.335  1.00 64.74  ? 314  LEU A N   1 
ATOM   2459  C  CA  . LEU A 1 314  ? 10.059  8.014   28.576  1.00 65.37  ? 314  LEU A CA  1 
ATOM   2460  C  C   . LEU A 1 314  ? 9.000   9.094   28.345  1.00 67.53  ? 314  LEU A C   1 
ATOM   2461  O  O   . LEU A 1 314  ? 8.852   10.000  29.167  1.00 68.66  ? 314  LEU A O   1 
ATOM   2462  C  CB  . LEU A 1 314  ? 9.461   6.894   29.429  1.00 64.12  ? 314  LEU A CB  1 
ATOM   2463  C  CG  . LEU A 1 314  ? 10.317  5.650   29.598  1.00 63.64  ? 314  LEU A CG  1 
ATOM   2464  C  CD1 . LEU A 1 314  ? 9.631   4.681   30.548  1.00 64.57  ? 314  LEU A CD1 1 
ATOM   2465  C  CD2 . LEU A 1 314  ? 10.560  5.002   28.245  1.00 64.52  ? 314  LEU A CD2 1 
ATOM   2466  N  N   . THR A 1 315  ? 8.278   9.007   27.219  1.00 67.81  ? 315  THR A N   1 
ATOM   2467  C  CA  . THR A 1 315  ? 7.024   9.727   27.066  1.00 68.59  ? 315  THR A CA  1 
ATOM   2468  C  C   . THR A 1 315  ? 6.080   8.931   26.179  1.00 68.65  ? 315  THR A C   1 
ATOM   2469  O  O   . THR A 1 315  ? 6.471   8.438   25.121  1.00 68.41  ? 315  THR A O   1 
ATOM   2470  C  CB  . THR A 1 315  ? 7.165   11.120  26.435  1.00 70.99  ? 315  THR A CB  1 
ATOM   2471  O  OG1 . THR A 1 315  ? 7.432   10.936  25.044  1.00 71.49  ? 315  THR A OG1 1 
ATOM   2472  C  CG2 . THR A 1 315  ? 8.223   11.992  27.075  1.00 73.15  ? 315  THR A CG2 1 
ATOM   2473  N  N   . TYR A 1 316  ? 4.827   8.838   26.629  1.00 68.24  ? 316  TYR A N   1 
ATOM   2474  C  CA  . TYR A 1 316  ? 3.766   8.304   25.798  1.00 67.26  ? 316  TYR A CA  1 
ATOM   2475  C  C   . TYR A 1 316  ? 3.443   9.339   24.728  1.00 67.37  ? 316  TYR A C   1 
ATOM   2476  O  O   . TYR A 1 316  ? 3.382   10.525  25.027  1.00 68.10  ? 316  TYR A O   1 
ATOM   2477  C  CB  . TYR A 1 316  ? 2.532   7.995   26.646  1.00 67.65  ? 316  TYR A CB  1 
ATOM   2478  C  CG  . TYR A 1 316  ? 1.407   7.365   25.869  1.00 69.35  ? 316  TYR A CG  1 
ATOM   2479  C  CD1 . TYR A 1 316  ? 1.397   6.004   25.605  1.00 69.01  ? 316  TYR A CD1 1 
ATOM   2480  C  CD2 . TYR A 1 316  ? 0.366   8.134   25.370  1.00 70.64  ? 316  TYR A CD2 1 
ATOM   2481  C  CE1 . TYR A 1 316  ? 0.380   5.422   24.869  1.00 70.79  ? 316  TYR A CE1 1 
ATOM   2482  C  CE2 . TYR A 1 316  ? -0.665  7.565   24.642  1.00 72.07  ? 316  TYR A CE2 1 
ATOM   2483  C  CZ  . TYR A 1 316  ? -0.661  6.204   24.393  1.00 72.62  ? 316  TYR A CZ  1 
ATOM   2484  O  OH  . TYR A 1 316  ? -1.687  5.654   23.674  1.00 73.85  ? 316  TYR A OH  1 
ATOM   2485  N  N   . LEU A 1 317  ? 3.243   8.886   23.488  1.00 67.77  ? 317  LEU A N   1 
ATOM   2486  C  CA  . LEU A 1 317  ? 2.907   9.805   22.412  1.00 69.20  ? 317  LEU A CA  1 
ATOM   2487  C  C   . LEU A 1 317  ? 1.419   9.732   22.075  1.00 71.95  ? 317  LEU A C   1 
ATOM   2488  O  O   . LEU A 1 317  ? 0.651   10.553  22.566  1.00 73.43  ? 317  LEU A O   1 
ATOM   2489  C  CB  . LEU A 1 317  ? 3.820   9.570   21.205  1.00 68.31  ? 317  LEU A CB  1 
ATOM   2490  C  CG  . LEU A 1 317  ? 5.276   9.988   21.426  1.00 65.96  ? 317  LEU A CG  1 
ATOM   2491  C  CD1 . LEU A 1 317  ? 6.116   9.766   20.179  1.00 65.20  ? 317  LEU A CD1 1 
ATOM   2492  C  CD2 . LEU A 1 317  ? 5.360   11.437  21.881  1.00 65.77  ? 317  LEU A CD2 1 
ATOM   2493  N  N   . ASP A 1 318  ? 1.019   8.760   21.244  1.00 74.27  ? 318  ASP A N   1 
ATOM   2494  C  CA  . ASP A 1 318  ? -0.373  8.588   20.847  1.00 76.51  ? 318  ASP A CA  1 
ATOM   2495  C  C   . ASP A 1 318  ? -0.549  7.201   20.230  1.00 76.55  ? 318  ASP A C   1 
ATOM   2496  O  O   . ASP A 1 318  ? 0.399   6.668   19.648  1.00 75.20  ? 318  ASP A O   1 
ATOM   2497  C  CB  . ASP A 1 318  ? -0.817  9.702   19.888  1.00 79.92  ? 318  ASP A CB  1 
ATOM   2498  C  CG  . ASP A 1 318  ? -2.322  9.923   19.823  1.00 84.17  ? 318  ASP A CG  1 
ATOM   2499  O  OD1 . ASP A 1 318  ? -3.025  9.491   20.758  1.00 85.78  ? 318  ASP A OD1 1 
ATOM   2500  O  OD2 . ASP A 1 318  ? -2.786  10.522  18.828  1.00 86.52  ? 318  ASP A OD2 1 
ATOM   2501  N  N   . ASN A 1 319  ? -1.761  6.632   20.376  1.00 76.84  ? 319  ASN A N   1 
ATOM   2502  C  CA  . ASN A 1 319  ? -2.154  5.364   19.772  1.00 77.33  ? 319  ASN A CA  1 
ATOM   2503  C  C   . ASN A 1 319  ? -1.165  4.265   20.146  1.00 75.92  ? 319  ASN A C   1 
ATOM   2504  O  O   . ASN A 1 319  ? -0.693  3.531   19.278  1.00 76.47  ? 319  ASN A O   1 
ATOM   2505  C  CB  . ASN A 1 319  ? -2.266  5.444   18.246  1.00 78.64  ? 319  ASN A CB  1 
ATOM   2506  C  CG  . ASN A 1 319  ? -3.124  6.595   17.767  1.00 80.72  ? 319  ASN A CG  1 
ATOM   2507  O  OD1 . ASN A 1 319  ? -4.187  6.864   18.319  1.00 81.63  ? 319  ASN A OD1 1 
ATOM   2508  N  ND2 . ASN A 1 319  ? -2.665  7.287   16.741  1.00 81.38  ? 319  ASN A ND2 1 
ATOM   2509  N  N   . GLY A 1 320  ? -0.846  4.181   21.441  1.00 74.41  ? 320  GLY A N   1 
ATOM   2510  C  CA  . GLY A 1 320  ? -0.006  3.124   21.976  1.00 73.07  ? 320  GLY A CA  1 
ATOM   2511  C  C   . GLY A 1 320  ? 1.467   3.296   21.615  1.00 72.09  ? 320  GLY A C   1 
ATOM   2512  O  O   . GLY A 1 320  ? 2.252   2.355   21.739  1.00 72.31  ? 320  GLY A O   1 
ATOM   2513  N  N   . VAL A 1 321  ? 1.853   4.503   21.193  1.00 71.25  ? 321  VAL A N   1 
ATOM   2514  C  CA  . VAL A 1 321  ? 3.236   4.721   20.801  1.00 70.10  ? 321  VAL A CA  1 
ATOM   2515  C  C   . VAL A 1 321  ? 3.974   5.452   21.921  1.00 67.79  ? 321  VAL A C   1 
ATOM   2516  O  O   . VAL A 1 321  ? 3.526   6.499   22.375  1.00 68.27  ? 321  VAL A O   1 
ATOM   2517  C  CB  . VAL A 1 321  ? 3.330   5.451   19.446  1.00 71.45  ? 321  VAL A CB  1 
ATOM   2518  C  CG1 . VAL A 1 321  ? 4.767   5.670   19.000  1.00 68.98  ? 321  VAL A CG1 1 
ATOM   2519  C  CG2 . VAL A 1 321  ? 2.543   4.718   18.365  1.00 73.48  ? 321  VAL A CG2 1 
ATOM   2520  N  N   . VAL A 1 322  ? 5.099   4.867   22.356  1.00 66.38  ? 322  VAL A N   1 
ATOM   2521  C  CA  . VAL A 1 322  ? 5.966   5.408   23.394  1.00 64.86  ? 322  VAL A CA  1 
ATOM   2522  C  C   . VAL A 1 322  ? 7.333   5.748   22.791  1.00 63.48  ? 322  VAL A C   1 
ATOM   2523  O  O   . VAL A 1 322  ? 7.915   4.925   22.085  1.00 62.29  ? 322  VAL A O   1 
ATOM   2524  C  CB  . VAL A 1 322  ? 6.119   4.395   24.545  1.00 64.25  ? 322  VAL A CB  1 
ATOM   2525  C  CG1 . VAL A 1 322  ? 6.983   4.939   25.669  1.00 63.14  ? 322  VAL A CG1 1 
ATOM   2526  C  CG2 . VAL A 1 322  ? 4.775   3.930   25.079  1.00 65.35  ? 322  VAL A CG2 1 
ATOM   2527  N  N   . PHE A 1 323  ? 7.827   6.965   23.079  1.00 62.89  ? 323  PHE A N   1 
ATOM   2528  C  CA  . PHE A 1 323  ? 9.184   7.375   22.746  1.00 62.77  ? 323  PHE A CA  1 
ATOM   2529  C  C   . PHE A 1 323  ? 10.117  7.077   23.914  1.00 61.16  ? 323  PHE A C   1 
ATOM   2530  O  O   . PHE A 1 323  ? 9.913   7.576   25.017  1.00 60.26  ? 323  PHE A O   1 
ATOM   2531  C  CB  . PHE A 1 323  ? 9.269   8.874   22.443  1.00 63.93  ? 323  PHE A CB  1 
ATOM   2532  C  CG  . PHE A 1 323  ? 10.676  9.377   22.254  1.00 63.30  ? 323  PHE A CG  1 
ATOM   2533  C  CD1 . PHE A 1 323  ? 11.368  9.120   21.079  1.00 64.73  ? 323  PHE A CD1 1 
ATOM   2534  C  CD2 . PHE A 1 323  ? 11.325  10.082  23.257  1.00 63.49  ? 323  PHE A CD2 1 
ATOM   2535  C  CE1 . PHE A 1 323  ? 12.677  9.551   20.907  1.00 64.13  ? 323  PHE A CE1 1 
ATOM   2536  C  CE2 . PHE A 1 323  ? 12.636  10.511  23.087  1.00 63.18  ? 323  PHE A CE2 1 
ATOM   2537  C  CZ  . PHE A 1 323  ? 13.307  10.250  21.912  1.00 63.14  ? 323  PHE A CZ  1 
ATOM   2538  N  N   . VAL A 1 324  ? 11.151  6.273   23.646  1.00 61.51  ? 324  VAL A N   1 
ATOM   2539  C  CA  . VAL A 1 324  ? 12.164  5.954   24.641  1.00 60.88  ? 324  VAL A CA  1 
ATOM   2540  C  C   . VAL A 1 324  ? 13.423  6.752   24.318  1.00 61.07  ? 324  VAL A C   1 
ATOM   2541  O  O   . VAL A 1 324  ? 14.068  6.505   23.300  1.00 61.70  ? 324  VAL A O   1 
ATOM   2542  C  CB  . VAL A 1 324  ? 12.468  4.446   24.669  1.00 60.19  ? 324  VAL A CB  1 
ATOM   2543  C  CG1 . VAL A 1 324  ? 13.462  4.101   25.764  1.00 58.68  ? 324  VAL A CG1 1 
ATOM   2544  C  CG2 . VAL A 1 324  ? 11.200  3.617   24.807  1.00 60.11  ? 324  VAL A CG2 1 
ATOM   2545  N  N   . GLY A 1 325  ? 13.752  7.707   25.193  1.00 60.80  ? 325  GLY A N   1 
ATOM   2546  C  CA  . GLY A 1 325  ? 14.982  8.468   25.064  1.00 61.36  ? 325  GLY A CA  1 
ATOM   2547  C  C   . GLY A 1 325  ? 16.110  7.811   25.854  1.00 61.10  ? 325  GLY A C   1 
ATOM   2548  O  O   . GLY A 1 325  ? 16.011  7.678   27.074  1.00 60.66  ? 325  GLY A O   1 
ATOM   2549  N  N   . SER A 1 326  ? 17.165  7.393   25.141  1.00 61.24  ? 326  SER A N   1 
ATOM   2550  C  CA  . SER A 1 326  ? 18.271  6.695   25.776  1.00 61.13  ? 326  SER A CA  1 
ATOM   2551  C  C   . SER A 1 326  ? 19.548  7.531   25.769  1.00 60.58  ? 326  SER A C   1 
ATOM   2552  O  O   . SER A 1 326  ? 19.865  8.194   24.779  1.00 60.77  ? 326  SER A O   1 
ATOM   2553  C  CB  . SER A 1 326  ? 18.507  5.343   25.171  1.00 61.04  ? 326  SER A CB  1 
ATOM   2554  O  OG  . SER A 1 326  ? 19.571  4.706   25.862  1.00 61.12  ? 326  SER A OG  1 
ATOM   2555  N  N   . ARG A 1 327  ? 20.266  7.461   26.899  1.00 61.10  ? 327  ARG A N   1 
ATOM   2556  C  CA  . ARG A 1 327  ? 21.565  8.088   27.106  1.00 60.63  ? 327  ARG A CA  1 
ATOM   2557  C  C   . ARG A 1 327  ? 22.659  7.079   26.744  1.00 59.58  ? 327  ARG A C   1 
ATOM   2558  O  O   . ARG A 1 327  ? 23.640  7.427   26.093  1.00 59.86  ? 327  ARG A O   1 
ATOM   2559  C  CB  . ARG A 1 327  ? 21.697  8.471   28.584  1.00 61.60  ? 327  ARG A CB  1 
ATOM   2560  C  CG  . ARG A 1 327  ? 22.093  9.911   28.875  1.00 64.44  ? 327  ARG A CG  1 
ATOM   2561  C  CD  . ARG A 1 327  ? 22.389  10.095  30.365  1.00 69.00  ? 327  ARG A CD  1 
ATOM   2562  N  NE  . ARG A 1 327  ? 23.503  9.329   30.962  1.00 74.67  ? 327  ARG A NE  1 
ATOM   2563  C  CZ  . ARG A 1 327  ? 23.401  8.181   31.660  1.00 73.52  ? 327  ARG A CZ  1 
ATOM   2564  N  NH1 . ARG A 1 327  ? 22.224  7.609   31.862  1.00 72.31  ? 327  ARG A NH1 1 
ATOM   2565  N  NH2 . ARG A 1 327  ? 24.485  7.607   32.155  1.00 71.49  ? 327  ARG A NH2 1 
ATOM   2566  N  N   . LEU A 1 328  ? 22.448  5.817   27.146  1.00 58.20  ? 328  LEU A N   1 
ATOM   2567  C  CA  . LEU A 1 328  ? 23.434  4.748   27.098  1.00 56.44  ? 328  LEU A CA  1 
ATOM   2568  C  C   . LEU A 1 328  ? 23.254  3.889   25.849  1.00 57.66  ? 328  LEU A C   1 
ATOM   2569  O  O   . LEU A 1 328  ? 24.069  3.007   25.599  1.00 60.26  ? 328  LEU A O   1 
ATOM   2570  C  CB  . LEU A 1 328  ? 23.275  3.868   28.344  1.00 54.25  ? 328  LEU A CB  1 
ATOM   2571  C  CG  . LEU A 1 328  ? 23.542  4.556   29.680  1.00 52.98  ? 328  LEU A CG  1 
ATOM   2572  C  CD1 . LEU A 1 328  ? 23.254  3.621   30.841  1.00 51.99  ? 328  LEU A CD1 1 
ATOM   2573  C  CD2 . LEU A 1 328  ? 24.969  5.068   29.747  1.00 53.18  ? 328  LEU A CD2 1 
ATOM   2574  N  N   . GLY A 1 329  ? 22.176  4.116   25.090  1.00 57.25  ? 329  GLY A N   1 
ATOM   2575  C  CA  . GLY A 1 329  ? 21.872  3.298   23.925  1.00 56.66  ? 329  GLY A CA  1 
ATOM   2576  C  C   . GLY A 1 329  ? 21.097  4.090   22.876  1.00 56.89  ? 329  GLY A C   1 
ATOM   2577  O  O   . GLY A 1 329  ? 20.860  5.281   23.054  1.00 56.03  ? 329  GLY A O   1 
ATOM   2578  N  N   . ASP A 1 330  ? 20.710  3.416   21.787  1.00 57.91  ? 330  ASP A N   1 
ATOM   2579  C  CA  . ASP A 1 330  ? 19.883  4.026   20.759  1.00 59.45  ? 330  ASP A CA  1 
ATOM   2580  C  C   . ASP A 1 330  ? 18.528  4.417   21.347  1.00 59.06  ? 330  ASP A C   1 
ATOM   2581  O  O   . ASP A 1 330  ? 17.980  3.708   22.186  1.00 58.55  ? 330  ASP A O   1 
ATOM   2582  C  CB  . ASP A 1 330  ? 19.666  3.056   19.599  1.00 62.03  ? 330  ASP A CB  1 
ATOM   2583  C  CG  . ASP A 1 330  ? 20.876  2.860   18.706  1.00 65.51  ? 330  ASP A CG  1 
ATOM   2584  O  OD1 . ASP A 1 330  ? 21.907  3.556   18.916  1.00 67.08  ? 330  ASP A OD1 1 
ATOM   2585  O  OD2 . ASP A 1 330  ? 20.780  2.011   17.799  1.00 67.70  ? 330  ASP A OD2 1 
ATOM   2586  N  N   . SER A 1 331  ? 17.987  5.550   20.893  1.00 58.87  ? 331  SER A N   1 
ATOM   2587  C  CA  . SER A 1 331  ? 16.633  5.951   21.241  1.00 58.76  ? 331  SER A CA  1 
ATOM   2588  C  C   . SER A 1 331  ? 15.637  5.217   20.342  1.00 60.88  ? 331  SER A C   1 
ATOM   2589  O  O   . SER A 1 331  ? 16.022  4.702   19.290  1.00 61.04  ? 331  SER A O   1 
ATOM   2590  C  CB  . SER A 1 331  ? 16.484  7.444   21.142  1.00 58.15  ? 331  SER A CB  1 
ATOM   2591  O  OG  . SER A 1 331  ? 16.863  8.064   22.359  1.00 56.42  ? 331  SER A OG  1 
ATOM   2592  N  N   . GLN A 1 332  ? 14.358  5.177   20.758  1.00 61.33  ? 332  GLN A N   1 
ATOM   2593  C  CA  . GLN A 1 332  ? 13.386  4.324   20.093  1.00 62.08  ? 332  GLN A CA  1 
ATOM   2594  C  C   . GLN A 1 332  ? 11.986  4.932   20.092  1.00 62.54  ? 332  GLN A C   1 
ATOM   2595  O  O   . GLN A 1 332  ? 11.624  5.691   20.989  1.00 60.90  ? 332  GLN A O   1 
ATOM   2596  C  CB  . GLN A 1 332  ? 13.278  2.991   20.830  1.00 61.84  ? 332  GLN A CB  1 
ATOM   2597  C  CG  . GLN A 1 332  ? 14.541  2.151   20.814  1.00 62.15  ? 332  GLN A CG  1 
ATOM   2598  C  CD  . GLN A 1 332  ? 14.321  0.911   21.641  1.00 62.82  ? 332  GLN A CD  1 
ATOM   2599  O  OE1 . GLN A 1 332  ? 14.121  0.974   22.851  1.00 62.33  ? 332  GLN A OE1 1 
ATOM   2600  N  NE2 . GLN A 1 332  ? 14.328  -0.234  20.984  1.00 64.88  ? 332  GLN A NE2 1 
ATOM   2601  N  N   . LEU A 1 333  ? 11.209  4.540   19.071  1.00 64.07  ? 333  LEU A N   1 
ATOM   2602  C  CA  . LEU A 1 333  ? 9.756   4.513   19.109  1.00 65.29  ? 333  LEU A CA  1 
ATOM   2603  C  C   . LEU A 1 333  ? 9.323   3.062   19.315  1.00 65.83  ? 333  LEU A C   1 
ATOM   2604  O  O   . LEU A 1 333  ? 9.722   2.192   18.545  1.00 66.38  ? 333  LEU A O   1 
ATOM   2605  C  CB  . LEU A 1 333  ? 9.216   5.010   17.763  1.00 66.84  ? 333  LEU A CB  1 
ATOM   2606  C  CG  . LEU A 1 333  ? 9.381   6.493   17.435  1.00 66.80  ? 333  LEU A CG  1 
ATOM   2607  C  CD1 . LEU A 1 333  ? 8.650   6.825   16.137  1.00 68.90  ? 333  LEU A CD1 1 
ATOM   2608  C  CD2 . LEU A 1 333  ? 8.865   7.357   18.575  1.00 65.43  ? 333  LEU A CD2 1 
ATOM   2609  N  N   . VAL A 1 334  ? 8.499   2.799   20.337  1.00 65.76  ? 334  VAL A N   1 
ATOM   2610  C  CA  . VAL A 1 334  ? 7.936   1.464   20.492  1.00 66.69  ? 334  VAL A CA  1 
ATOM   2611  C  C   . VAL A 1 334  ? 6.413   1.538   20.540  1.00 67.72  ? 334  VAL A C   1 
ATOM   2612  O  O   . VAL A 1 334  ? 5.847   2.534   20.980  1.00 67.69  ? 334  VAL A O   1 
ATOM   2613  C  CB  . VAL A 1 334  ? 8.494   0.693   21.706  1.00 65.36  ? 334  VAL A CB  1 
ATOM   2614  C  CG1 . VAL A 1 334  ? 9.962   0.358   21.543  1.00 64.59  ? 334  VAL A CG1 1 
ATOM   2615  C  CG2 . VAL A 1 334  ? 8.223   1.385   23.033  1.00 64.50  ? 334  VAL A CG2 1 
ATOM   2616  N  N   . LYS A 1 335  ? 5.774   0.446   20.102  1.00 69.17  ? 335  LYS A N   1 
ATOM   2617  C  CA  . LYS A 1 335  ? 4.339   0.258   20.215  1.00 70.45  ? 335  LYS A CA  1 
ATOM   2618  C  C   . LYS A 1 335  ? 4.052   -0.672  21.393  1.00 69.22  ? 335  LYS A C   1 
ATOM   2619  O  O   . LYS A 1 335  ? 4.720   -1.688  21.574  1.00 67.56  ? 335  LYS A O   1 
ATOM   2620  C  CB  . LYS A 1 335  ? 3.778   -0.274  18.890  1.00 73.30  ? 335  LYS A CB  1 
ATOM   2621  C  CG  . LYS A 1 335  ? 2.293   -0.037  18.648  1.00 76.44  ? 335  LYS A CG  1 
ATOM   2622  C  CD  . LYS A 1 335  ? 1.895   -0.330  17.215  1.00 79.75  ? 335  LYS A CD  1 
ATOM   2623  C  CE  . LYS A 1 335  ? 0.435   -0.705  17.065  1.00 82.50  ? 335  LYS A CE  1 
ATOM   2624  N  NZ  . LYS A 1 335  ? 0.230   -1.711  15.993  1.00 84.75  ? 335  LYS A NZ  1 
ATOM   2625  N  N   . LEU A 1 336  ? 3.076   -0.278  22.215  1.00 69.41  ? 336  LEU A N   1 
ATOM   2626  C  CA  . LEU A 1 336  ? 2.459   -1.165  23.187  1.00 70.08  ? 336  LEU A CA  1 
ATOM   2627  C  C   . LEU A 1 336  ? 1.198   -1.751  22.563  1.00 72.76  ? 336  LEU A C   1 
ATOM   2628  O  O   . LEU A 1 336  ? 0.332   -1.007  22.107  1.00 74.24  ? 336  LEU A O   1 
ATOM   2629  C  CB  . LEU A 1 336  ? 2.088   -0.364  24.436  1.00 69.26  ? 336  LEU A CB  1 
ATOM   2630  C  CG  . LEU A 1 336  ? 3.216   0.407   25.113  1.00 67.26  ? 336  LEU A CG  1 
ATOM   2631  C  CD1 . LEU A 1 336  ? 2.704   1.045   26.391  1.00 67.35  ? 336  LEU A CD1 1 
ATOM   2632  C  CD2 . LEU A 1 336  ? 4.386   -0.511  25.423  1.00 66.95  ? 336  LEU A CD2 1 
ATOM   2633  N  N   . ASN A 1 337  ? 1.113   -3.086  22.550  1.00 74.69  ? 337  ASN A N   1 
ATOM   2634  C  CA  . ASN A 1 337  ? -0.029  -3.815  22.016  1.00 77.72  ? 337  ASN A CA  1 
ATOM   2635  C  C   . ASN A 1 337  ? -0.920  -4.294  23.154  1.00 78.88  ? 337  ASN A C   1 
ATOM   2636  O  O   . ASN A 1 337  ? -0.527  -4.260  24.314  1.00 78.97  ? 337  ASN A O   1 
ATOM   2637  C  CB  . ASN A 1 337  ? 0.398   -5.085  21.284  1.00 78.54  ? 337  ASN A CB  1 
ATOM   2638  C  CG  . ASN A 1 337  ? 1.036   -4.819  19.941  1.00 78.99  ? 337  ASN A CG  1 
ATOM   2639  O  OD1 . ASN A 1 337  ? 1.052   -3.688  19.459  1.00 78.41  ? 337  ASN A OD1 1 
ATOM   2640  N  ND2 . ASN A 1 337  ? 1.559   -5.864  19.326  1.00 80.69  ? 337  ASN A ND2 1 
ATOM   2641  N  N   . VAL A 1 338  ? -2.110  -4.783  22.811  1.00 81.07  ? 338  VAL A N   1 
ATOM   2642  C  CA  . VAL A 1 338  ? -2.954  -5.378  23.831  1.00 81.63  ? 338  VAL A CA  1 
ATOM   2643  C  C   . VAL A 1 338  ? -2.549  -6.841  23.991  1.00 81.88  ? 338  VAL A C   1 
ATOM   2644  O  O   . VAL A 1 338  ? -2.370  -7.309  25.112  1.00 81.52  ? 338  VAL A O   1 
ATOM   2645  C  CB  . VAL A 1 338  ? -4.456  -5.164  23.550  1.00 83.51  ? 338  VAL A CB  1 
ATOM   2646  C  CG1 . VAL A 1 338  ? -4.848  -3.711  23.772  1.00 82.28  ? 338  VAL A CG1 1 
ATOM   2647  C  CG2 . VAL A 1 338  ? -4.860  -5.608  22.152  1.00 84.95  ? 338  VAL A CG2 1 
ATOM   2648  N  N   . ASP A 1 339  ? -2.348  -7.526  22.857  1.00 82.32  ? 339  ASP A N   1 
ATOM   2649  C  CA  . ASP A 1 339  ? -1.887  -8.903  22.842  1.00 83.11  ? 339  ASP A CA  1 
ATOM   2650  C  C   . ASP A 1 339  ? -0.371  -8.926  22.978  1.00 81.24  ? 339  ASP A C   1 
ATOM   2651  O  O   . ASP A 1 339  ? 0.325   -8.119  22.367  1.00 80.35  ? 339  ASP A O   1 
ATOM   2652  C  CB  . ASP A 1 339  ? -2.240  -9.593  21.526  1.00 85.64  ? 339  ASP A CB  1 
ATOM   2653  C  CG  . ASP A 1 339  ? -3.664  -9.357  21.063  1.00 88.89  ? 339  ASP A CG  1 
ATOM   2654  O  OD1 . ASP A 1 339  ? -4.557  -9.246  21.932  1.00 89.95  ? 339  ASP A OD1 1 
ATOM   2655  O  OD2 . ASP A 1 339  ? -3.870  -9.296  19.832  1.00 90.55  ? 339  ASP A OD2 1 
ATOM   2656  N  N   . SER A 1 340  ? 0.131   -9.876  23.769  1.00 81.17  ? 340  SER A N   1 
ATOM   2657  C  CA  . SER A 1 340  ? 1.559   -10.131 23.842  1.00 78.94  ? 340  SER A CA  1 
ATOM   2658  C  C   . SER A 1 340  ? 1.991   -10.909 22.604  1.00 79.96  ? 340  SER A C   1 
ATOM   2659  O  O   . SER A 1 340  ? 1.152   -11.364 21.832  1.00 80.85  ? 340  SER A O   1 
ATOM   2660  C  CB  . SER A 1 340  ? 1.903   -10.878 25.099  1.00 78.63  ? 340  SER A CB  1 
ATOM   2661  O  OG  . SER A 1 340  ? 1.296   -12.161 25.099  1.00 80.36  ? 340  SER A OG  1 
ATOM   2662  N  N   . ASN A 1 341  ? 3.308   -11.037 22.418  1.00 79.95  ? 341  ASN A N   1 
ATOM   2663  C  CA  . ASN A 1 341  ? 3.846   -11.925 21.404  1.00 82.06  ? 341  ASN A CA  1 
ATOM   2664  C  C   . ASN A 1 341  ? 4.151   -13.265 22.065  1.00 84.35  ? 341  ASN A C   1 
ATOM   2665  O  O   . ASN A 1 341  ? 3.860   -13.448 23.243  1.00 84.89  ? 341  ASN A O   1 
ATOM   2666  C  CB  . ASN A 1 341  ? 5.079   -11.324 20.733  1.00 80.78  ? 341  ASN A CB  1 
ATOM   2667  C  CG  . ASN A 1 341  ? 6.194   -11.058 21.718  1.00 78.94  ? 341  ASN A CG  1 
ATOM   2668  O  OD1 . ASN A 1 341  ? 6.378   -11.810 22.675  1.00 78.86  ? 341  ASN A OD1 1 
ATOM   2669  N  ND2 . ASN A 1 341  ? 6.927   -9.979  21.499  1.00 77.53  ? 341  ASN A ND2 1 
ATOM   2670  N  N   . GLU A 1 342  ? 4.765   -14.181 21.306  1.00 87.08  ? 342  GLU A N   1 
ATOM   2671  C  CA  . GLU A 1 342  ? 5.003   -15.547 21.752  1.00 89.48  ? 342  GLU A CA  1 
ATOM   2672  C  C   . GLU A 1 342  ? 5.898   -15.580 22.992  1.00 88.08  ? 342  GLU A C   1 
ATOM   2673  O  O   . GLU A 1 342  ? 5.765   -16.479 23.818  1.00 88.76  ? 342  GLU A O   1 
ATOM   2674  C  CB  . GLU A 1 342  ? 5.567   -16.403 20.614  1.00 92.05  ? 342  GLU A CB  1 
ATOM   2675  C  CG  . GLU A 1 342  ? 4.572   -16.669 19.493  1.00 95.41  ? 342  GLU A CG  1 
ATOM   2676  C  CD  . GLU A 1 342  ? 3.403   -17.589 19.821  1.00 99.36  ? 342  GLU A CD  1 
ATOM   2677  O  OE1 . GLU A 1 342  ? 2.393   -17.093 20.390  1.00 101.21 ? 342  GLU A OE1 1 
ATOM   2678  O  OE2 . GLU A 1 342  ? 3.494   -18.797 19.496  1.00 100.58 ? 342  GLU A OE2 1 
ATOM   2679  N  N   . GLN A 1 343  ? 6.792   -14.594 23.135  1.00 86.23  ? 343  GLN A N   1 
ATOM   2680  C  CA  . GLN A 1 343  ? 7.741   -14.596 24.239  1.00 85.97  ? 343  GLN A CA  1 
ATOM   2681  C  C   . GLN A 1 343  ? 7.100   -13.990 25.487  1.00 84.13  ? 343  GLN A C   1 
ATOM   2682  O  O   . GLN A 1 343  ? 7.692   -13.994 26.563  1.00 84.24  ? 343  GLN A O   1 
ATOM   2683  C  CB  . GLN A 1 343  ? 9.055   -13.912 23.844  1.00 86.57  ? 343  GLN A CB  1 
ATOM   2684  C  CG  . GLN A 1 343  ? 9.896   -14.724 22.865  1.00 90.17  ? 343  GLN A CG  1 
ATOM   2685  C  CD  . GLN A 1 343  ? 9.152   -15.019 21.583  1.00 94.27  ? 343  GLN A CD  1 
ATOM   2686  O  OE1 . GLN A 1 343  ? 8.530   -14.140 20.984  1.00 95.35  ? 343  GLN A OE1 1 
ATOM   2687  N  NE2 . GLN A 1 343  ? 9.186   -16.275 21.162  1.00 96.87  ? 343  GLN A NE2 1 
ATOM   2688  N  N   . GLY A 1 344  ? 5.872   -13.489 25.331  1.00 82.79  ? 344  GLY A N   1 
ATOM   2689  C  CA  . GLY A 1 344  ? 5.141   -12.896 26.434  1.00 80.18  ? 344  GLY A CA  1 
ATOM   2690  C  C   . GLY A 1 344  ? 5.346   -11.388 26.462  1.00 76.96  ? 344  GLY A C   1 
ATOM   2691  O  O   . GLY A 1 344  ? 4.981   -10.732 27.436  1.00 75.86  ? 344  GLY A O   1 
ATOM   2692  N  N   . SER A 1 345  ? 5.933   -10.855 25.383  1.00 75.31  ? 345  SER A N   1 
ATOM   2693  C  CA  . SER A 1 345  ? 6.229   -9.431  25.328  1.00 73.04  ? 345  SER A CA  1 
ATOM   2694  C  C   . SER A 1 345  ? 5.103   -8.638  24.665  1.00 74.08  ? 345  SER A C   1 
ATOM   2695  O  O   . SER A 1 345  ? 4.547   -9.025  23.631  1.00 75.38  ? 345  SER A O   1 
ATOM   2696  C  CB  . SER A 1 345  ? 7.539   -9.130  24.677  1.00 70.67  ? 345  SER A CB  1 
ATOM   2697  O  OG  . SER A 1 345  ? 7.676   -7.724  24.537  1.00 68.36  ? 345  SER A OG  1 
ATOM   2698  N  N   . TYR A 1 346  ? 4.823   -7.482  25.274  1.00 71.58  ? 346  TYR A N   1 
ATOM   2699  C  CA  . TYR A 1 346  ? 3.792   -6.574  24.817  1.00 70.73  ? 346  TYR A CA  1 
ATOM   2700  C  C   . TYR A 1 346  ? 4.402   -5.427  24.009  1.00 69.58  ? 346  TYR A C   1 
ATOM   2701  O  O   . TYR A 1 346  ? 3.657   -4.637  23.437  1.00 70.15  ? 346  TYR A O   1 
ATOM   2702  C  CB  . TYR A 1 346  ? 3.042   -5.980  26.013  1.00 70.20  ? 346  TYR A CB  1 
ATOM   2703  C  CG  . TYR A 1 346  ? 2.290   -6.947  26.893  1.00 71.46  ? 346  TYR A CG  1 
ATOM   2704  C  CD1 . TYR A 1 346  ? 1.114   -7.541  26.463  1.00 73.45  ? 346  TYR A CD1 1 
ATOM   2705  C  CD2 . TYR A 1 346  ? 2.723   -7.228  28.179  1.00 71.00  ? 346  TYR A CD2 1 
ATOM   2706  C  CE1 . TYR A 1 346  ? 0.405   -8.414  27.271  1.00 74.98  ? 346  TYR A CE1 1 
ATOM   2707  C  CE2 . TYR A 1 346  ? 2.027   -8.099  29.001  1.00 72.77  ? 346  TYR A CE2 1 
ATOM   2708  C  CZ  . TYR A 1 346  ? 0.867   -8.695  28.543  1.00 74.54  ? 346  TYR A CZ  1 
ATOM   2709  O  OH  . TYR A 1 346  ? 0.188   -9.550  29.354  1.00 76.78  ? 346  TYR A OH  1 
ATOM   2710  N  N   . VAL A 1 347  ? 5.743   -5.324  23.969  1.00 68.22  ? 347  VAL A N   1 
ATOM   2711  C  CA  . VAL A 1 347  ? 6.430   -4.184  23.364  1.00 65.76  ? 347  VAL A CA  1 
ATOM   2712  C  C   . VAL A 1 347  ? 6.953   -4.565  21.980  1.00 66.62  ? 347  VAL A C   1 
ATOM   2713  O  O   . VAL A 1 347  ? 7.527   -5.636  21.817  1.00 68.05  ? 347  VAL A O   1 
ATOM   2714  C  CB  . VAL A 1 347  ? 7.574   -3.675  24.264  1.00 62.79  ? 347  VAL A CB  1 
ATOM   2715  C  CG1 . VAL A 1 347  ? 8.488   -2.698  23.544  1.00 60.85  ? 347  VAL A CG1 1 
ATOM   2716  C  CG2 . VAL A 1 347  ? 7.057   -3.067  25.555  1.00 62.12  ? 347  VAL A CG2 1 
ATOM   2717  N  N   . VAL A 1 348  ? 6.761   -3.675  20.996  1.00 67.06  ? 348  VAL A N   1 
ATOM   2718  C  CA  . VAL A 1 348  ? 7.248   -3.876  19.639  1.00 68.28  ? 348  VAL A CA  1 
ATOM   2719  C  C   . VAL A 1 348  ? 7.957   -2.605  19.180  1.00 67.97  ? 348  VAL A C   1 
ATOM   2720  O  O   . VAL A 1 348  ? 7.380   -1.525  19.220  1.00 68.53  ? 348  VAL A O   1 
ATOM   2721  C  CB  . VAL A 1 348  ? 6.109   -4.252  18.669  1.00 70.57  ? 348  VAL A CB  1 
ATOM   2722  C  CG1 . VAL A 1 348  ? 6.607   -4.402  17.241  1.00 71.76  ? 348  VAL A CG1 1 
ATOM   2723  C  CG2 . VAL A 1 348  ? 5.358   -5.504  19.096  1.00 72.26  ? 348  VAL A CG2 1 
ATOM   2724  N  N   . ALA A 1 349  ? 9.203   -2.752  18.725  1.00 68.67  ? 349  ALA A N   1 
ATOM   2725  C  CA  . ALA A 1 349  ? 9.997   -1.619  18.274  1.00 69.30  ? 349  ALA A CA  1 
ATOM   2726  C  C   . ALA A 1 349  ? 9.526   -1.170  16.890  1.00 70.97  ? 349  ALA A C   1 
ATOM   2727  O  O   . ALA A 1 349  ? 9.337   -2.002  16.004  1.00 72.21  ? 349  ALA A O   1 
ATOM   2728  C  CB  . ALA A 1 349  ? 11.466  -1.979  18.275  1.00 68.19  ? 349  ALA A CB  1 
ATOM   2729  N  N   . MET A 1 350  ? 9.353   0.148   16.723  1.00 70.61  ? 350  MET A N   1 
ATOM   2730  C  CA  . MET A 1 350  ? 8.920   0.728   15.464  1.00 72.06  ? 350  MET A CA  1 
ATOM   2731  C  C   . MET A 1 350  ? 10.083  1.447   14.785  1.00 71.73  ? 350  MET A C   1 
ATOM   2732  O  O   . MET A 1 350  ? 10.252  1.344   13.574  1.00 73.73  ? 350  MET A O   1 
ATOM   2733  C  CB  . MET A 1 350  ? 7.794   1.734   15.702  1.00 72.65  ? 350  MET A CB  1 
ATOM   2734  C  CG  . MET A 1 350  ? 6.566   1.139   16.339  1.00 73.00  ? 350  MET A CG  1 
ATOM   2735  S  SD  . MET A 1 350  ? 5.577   2.457   17.060  1.00 73.49  ? 350  MET A SD  1 
ATOM   2736  C  CE  . MET A 1 350  ? 5.078   3.354   15.589  1.00 74.90  ? 350  MET A CE  1 
ATOM   2737  N  N   . GLU A 1 351  ? 10.851  2.204   15.571  1.00 70.33  ? 351  GLU A N   1 
ATOM   2738  C  CA  . GLU A 1 351  ? 11.970  2.967   15.052  1.00 70.90  ? 351  GLU A CA  1 
ATOM   2739  C  C   . GLU A 1 351  ? 13.094  2.983   16.085  1.00 69.21  ? 351  GLU A C   1 
ATOM   2740  O  O   . GLU A 1 351  ? 12.840  2.926   17.288  1.00 68.46  ? 351  GLU A O   1 
ATOM   2741  C  CB  . GLU A 1 351  ? 11.504  4.393   14.763  1.00 72.62  ? 351  GLU A CB  1 
ATOM   2742  C  CG  . GLU A 1 351  ? 12.449  5.165   13.862  1.00 74.04  ? 351  GLU A CG  1 
ATOM   2743  C  CD  . GLU A 1 351  ? 11.931  6.521   13.417  1.00 75.26  ? 351  GLU A CD  1 
ATOM   2744  O  OE1 . GLU A 1 351  ? 10.826  6.916   13.848  1.00 75.32  ? 351  GLU A OE1 1 
ATOM   2745  O  OE2 . GLU A 1 351  ? 12.632  7.172   12.633  1.00 76.13  ? 351  GLU A OE2 1 
ATOM   2746  N  N   . THR A 1 352  ? 14.342  3.051   15.602  1.00 68.09  ? 352  THR A N   1 
ATOM   2747  C  CA  . THR A 1 352  ? 15.502  3.266   16.457  1.00 65.54  ? 352  THR A CA  1 
ATOM   2748  C  C   . THR A 1 352  ? 16.267  4.495   15.964  1.00 64.82  ? 352  THR A C   1 
ATOM   2749  O  O   . THR A 1 352  ? 16.363  4.731   14.762  1.00 65.17  ? 352  THR A O   1 
ATOM   2750  C  CB  . THR A 1 352  ? 16.379  2.007   16.557  1.00 65.57  ? 352  THR A CB  1 
ATOM   2751  O  OG1 . THR A 1 352  ? 17.078  1.796   15.333  1.00 66.75  ? 352  THR A OG1 1 
ATOM   2752  C  CG2 . THR A 1 352  ? 15.606  0.749   16.891  1.00 67.03  ? 352  THR A CG2 1 
ATOM   2753  N  N   . PHE A 1 353  ? 16.783  5.297   16.900  1.00 63.33  ? 353  PHE A N   1 
ATOM   2754  C  CA  . PHE A 1 353  ? 17.606  6.442   16.547  1.00 64.22  ? 353  PHE A CA  1 
ATOM   2755  C  C   . PHE A 1 353  ? 19.028  6.215   17.063  1.00 63.39  ? 353  PHE A C   1 
ATOM   2756  O  O   . PHE A 1 353  ? 19.216  5.873   18.231  1.00 61.49  ? 353  PHE A O   1 
ATOM   2757  C  CB  . PHE A 1 353  ? 17.012  7.732   17.122  1.00 64.65  ? 353  PHE A CB  1 
ATOM   2758  C  CG  . PHE A 1 353  ? 15.558  7.974   16.796  1.00 66.65  ? 353  PHE A CG  1 
ATOM   2759  C  CD1 . PHE A 1 353  ? 14.552  7.416   17.576  1.00 66.34  ? 353  PHE A CD1 1 
ATOM   2760  C  CD2 . PHE A 1 353  ? 15.189  8.774   15.721  1.00 68.14  ? 353  PHE A CD2 1 
ATOM   2761  C  CE1 . PHE A 1 353  ? 13.217  7.638   17.275  1.00 67.23  ? 353  PHE A CE1 1 
ATOM   2762  C  CE2 . PHE A 1 353  ? 13.853  9.005   15.426  1.00 68.23  ? 353  PHE A CE2 1 
ATOM   2763  C  CZ  . PHE A 1 353  ? 12.870  8.430   16.200  1.00 68.73  ? 353  PHE A CZ  1 
ATOM   2764  N  N   . THR A 1 354  ? 20.026  6.424   16.189  1.00 64.03  ? 354  THR A N   1 
ATOM   2765  C  CA  . THR A 1 354  ? 21.429  6.171   16.504  1.00 62.99  ? 354  THR A CA  1 
ATOM   2766  C  C   . THR A 1 354  ? 21.941  7.122   17.583  1.00 61.93  ? 354  THR A C   1 
ATOM   2767  O  O   . THR A 1 354  ? 21.867  8.342   17.428  1.00 63.96  ? 354  THR A O   1 
ATOM   2768  C  CB  . THR A 1 354  ? 22.332  6.325   15.275  1.00 64.12  ? 354  THR A CB  1 
ATOM   2769  O  OG1 . THR A 1 354  ? 22.007  5.302   14.338  1.00 65.53  ? 354  THR A OG1 1 
ATOM   2770  C  CG2 . THR A 1 354  ? 23.802  6.192   15.596  1.00 63.51  ? 354  THR A CG2 1 
ATOM   2771  N  N   . ASN A 1 355  ? 22.481  6.518   18.654  1.00 59.40  ? 355  ASN A N   1 
ATOM   2772  C  CA  . ASN A 1 355  ? 23.160  7.202   19.740  1.00 57.83  ? 355  ASN A CA  1 
ATOM   2773  C  C   . ASN A 1 355  ? 24.578  6.642   19.840  1.00 59.32  ? 355  ASN A C   1 
ATOM   2774  O  O   . ASN A 1 355  ? 24.764  5.452   20.116  1.00 59.99  ? 355  ASN A O   1 
ATOM   2775  C  CB  . ASN A 1 355  ? 22.435  7.005   21.070  1.00 56.29  ? 355  ASN A CB  1 
ATOM   2776  C  CG  . ASN A 1 355  ? 23.163  7.612   22.252  1.00 55.71  ? 355  ASN A CG  1 
ATOM   2777  O  OD1 . ASN A 1 355  ? 23.878  8.603   22.108  1.00 56.45  ? 355  ASN A OD1 1 
ATOM   2778  N  ND2 . ASN A 1 355  ? 22.979  7.029   23.428  1.00 54.50  ? 355  ASN A ND2 1 
ATOM   2779  N  N   . LEU A 1 356  ? 25.574  7.513   19.614  1.00 58.90  ? 356  LEU A N   1 
ATOM   2780  C  CA  . LEU A 1 356  ? 26.978  7.144   19.695  1.00 57.61  ? 356  LEU A CA  1 
ATOM   2781  C  C   . LEU A 1 356  ? 27.432  7.110   21.147  1.00 55.54  ? 356  LEU A C   1 
ATOM   2782  O  O   . LEU A 1 356  ? 28.485  6.563   21.440  1.00 56.04  ? 356  LEU A O   1 
ATOM   2783  C  CB  . LEU A 1 356  ? 27.836  8.181   18.961  1.00 59.19  ? 356  LEU A CB  1 
ATOM   2784  C  CG  . LEU A 1 356  ? 27.796  8.177   17.435  1.00 61.09  ? 356  LEU A CG  1 
ATOM   2785  C  CD1 . LEU A 1 356  ? 28.762  9.211   16.891  1.00 61.16  ? 356  LEU A CD1 1 
ATOM   2786  C  CD2 . LEU A 1 356  ? 28.126  6.805   16.874  1.00 62.24  ? 356  LEU A CD2 1 
ATOM   2787  N  N   . GLY A 1 357  ? 26.667  7.744   22.036  1.00 54.57  ? 357  GLY A N   1 
ATOM   2788  C  CA  . GLY A 1 357  ? 27.114  8.010   23.393  1.00 54.67  ? 357  GLY A CA  1 
ATOM   2789  C  C   . GLY A 1 357  ? 26.872  6.856   24.364  1.00 54.86  ? 357  GLY A C   1 
ATOM   2790  O  O   . GLY A 1 357  ? 25.997  6.018   24.164  1.00 56.27  ? 357  GLY A O   1 
ATOM   2791  N  N   . PRO A 1 358  ? 27.663  6.769   25.452  1.00 54.63  ? 358  PRO A N   1 
ATOM   2792  C  CA  . PRO A 1 358  ? 28.875  7.575   25.577  1.00 54.91  ? 358  PRO A CA  1 
ATOM   2793  C  C   . PRO A 1 358  ? 30.005  6.956   24.762  1.00 56.14  ? 358  PRO A C   1 
ATOM   2794  O  O   . PRO A 1 358  ? 30.166  5.736   24.736  1.00 56.78  ? 358  PRO A O   1 
ATOM   2795  C  CB  . PRO A 1 358  ? 29.179  7.547   27.078  1.00 54.78  ? 358  PRO A CB  1 
ATOM   2796  C  CG  . PRO A 1 358  ? 28.494  6.291   27.600  1.00 54.77  ? 358  PRO A CG  1 
ATOM   2797  C  CD  . PRO A 1 358  ? 27.379  5.945   26.635  1.00 53.95  ? 358  PRO A CD  1 
ATOM   2798  N  N   . ILE A 1 359  ? 30.752  7.814   24.063  1.00 57.13  ? 359  ILE A N   1 
ATOM   2799  C  CA  . ILE A 1 359  ? 31.986  7.378   23.434  1.00 57.91  ? 359  ILE A CA  1 
ATOM   2800  C  C   . ILE A 1 359  ? 33.026  7.271   24.541  1.00 57.71  ? 359  ILE A C   1 
ATOM   2801  O  O   . ILE A 1 359  ? 33.347  8.260   25.193  1.00 56.95  ? 359  ILE A O   1 
ATOM   2802  C  CB  . ILE A 1 359  ? 32.414  8.323   22.294  1.00 58.57  ? 359  ILE A CB  1 
ATOM   2803  C  CG1 . ILE A 1 359  ? 31.323  8.425   21.223  1.00 57.97  ? 359  ILE A CG1 1 
ATOM   2804  C  CG2 . ILE A 1 359  ? 33.744  7.872   21.701  1.00 59.41  ? 359  ILE A CG2 1 
ATOM   2805  C  CD1 . ILE A 1 359  ? 31.489  9.584   20.267  1.00 58.84  ? 359  ILE A CD1 1 
ATOM   2806  N  N   . VAL A 1 360  ? 33.499  6.045   24.766  1.00 58.26  ? 360  VAL A N   1 
ATOM   2807  C  CA  . VAL A 1 360  ? 34.306  5.735   25.931  1.00 57.54  ? 360  VAL A CA  1 
ATOM   2808  C  C   . VAL A 1 360  ? 35.756  5.628   25.483  1.00 58.14  ? 360  VAL A C   1 
ATOM   2809  O  O   . VAL A 1 360  ? 36.660  5.880   26.266  1.00 60.39  ? 360  VAL A O   1 
ATOM   2810  C  CB  . VAL A 1 360  ? 33.770  4.478   26.644  1.00 57.09  ? 360  VAL A CB  1 
ATOM   2811  C  CG1 . VAL A 1 360  ? 34.737  3.927   27.666  1.00 59.43  ? 360  VAL A CG1 1 
ATOM   2812  C  CG2 . VAL A 1 360  ? 32.450  4.781   27.332  1.00 56.99  ? 360  VAL A CG2 1 
ATOM   2813  N  N   . ASP A 1 361  ? 35.949  5.292   24.207  1.00 58.12  ? 361  ASP A N   1 
ATOM   2814  C  CA  . ASP A 1 361  ? 37.247  5.266   23.566  1.00 59.42  ? 361  ASP A CA  1 
ATOM   2815  C  C   . ASP A 1 361  ? 37.001  5.300   22.065  1.00 59.53  ? 361  ASP A C   1 
ATOM   2816  O  O   . ASP A 1 361  ? 35.859  5.166   21.640  1.00 58.95  ? 361  ASP A O   1 
ATOM   2817  C  CB  . ASP A 1 361  ? 38.047  4.032   23.985  1.00 61.79  ? 361  ASP A CB  1 
ATOM   2818  C  CG  . ASP A 1 361  ? 39.534  4.154   23.692  1.00 65.12  ? 361  ASP A CG  1 
ATOM   2819  O  OD1 . ASP A 1 361  ? 40.040  5.304   23.694  1.00 65.44  ? 361  ASP A OD1 1 
ATOM   2820  O  OD2 . ASP A 1 361  ? 40.180  3.100   23.466  1.00 67.25  ? 361  ASP A OD2 1 
ATOM   2821  N  N   . MET A 1 362  ? 38.064  5.478   21.274  1.00 60.16  ? 362  MET A N   1 
ATOM   2822  C  CA  . MET A 1 362  ? 37.916  5.465   19.831  1.00 60.84  ? 362  MET A CA  1 
ATOM   2823  C  C   . MET A 1 362  ? 39.285  5.522   19.175  1.00 61.77  ? 362  MET A C   1 
ATOM   2824  O  O   . MET A 1 362  ? 40.249  5.884   19.824  1.00 62.21  ? 362  MET A O   1 
ATOM   2825  C  CB  . MET A 1 362  ? 37.076  6.654   19.358  1.00 60.68  ? 362  MET A CB  1 
ATOM   2826  C  CG  . MET A 1 362  ? 37.797  7.977   19.421  1.00 61.22  ? 362  MET A CG  1 
ATOM   2827  S  SD  . MET A 1 362  ? 36.697  9.310   18.904  1.00 60.83  ? 362  MET A SD  1 
ATOM   2828  C  CE  . MET A 1 362  ? 37.817  10.709  18.914  1.00 61.78  ? 362  MET A CE  1 
ATOM   2829  N  N   . CYS A 1 363  ? 39.345  5.164   17.890  1.00 63.05  ? 363  CYS A N   1 
ATOM   2830  C  CA  . CYS A 1 363  ? 40.566  5.294   17.119  1.00 65.26  ? 363  CYS A CA  1 
ATOM   2831  C  C   . CYS A 1 363  ? 40.247  5.564   15.647  1.00 67.34  ? 363  CYS A C   1 
ATOM   2832  O  O   . CYS A 1 363  ? 39.172  5.210   15.157  1.00 66.25  ? 363  CYS A O   1 
ATOM   2833  C  CB  . CYS A 1 363  ? 41.465  4.080   17.308  1.00 65.59  ? 363  CYS A CB  1 
ATOM   2834  S  SG  . CYS A 1 363  ? 40.731  2.517   16.766  1.00 65.08  ? 363  CYS A SG  1 
ATOM   2835  N  N   . VAL A 1 364  ? 41.203  6.223   14.976  1.00 69.87  ? 364  VAL A N   1 
ATOM   2836  C  CA  . VAL A 1 364  ? 41.146  6.545   13.560  1.00 72.15  ? 364  VAL A CA  1 
ATOM   2837  C  C   . VAL A 1 364  ? 41.945  5.491   12.801  1.00 74.30  ? 364  VAL A C   1 
ATOM   2838  O  O   . VAL A 1 364  ? 43.070  5.190   13.170  1.00 74.89  ? 364  VAL A O   1 
ATOM   2839  C  CB  . VAL A 1 364  ? 41.688  7.961   13.294  1.00 72.15  ? 364  VAL A CB  1 
ATOM   2840  C  CG1 . VAL A 1 364  ? 41.404  8.411   11.870  1.00 74.48  ? 364  VAL A CG1 1 
ATOM   2841  C  CG2 . VAL A 1 364  ? 41.137  8.962   14.300  1.00 69.41  ? 364  VAL A CG2 1 
ATOM   2842  N  N   . VAL A 1 365  ? 41.334  4.922   11.760  1.00 77.14  ? 365  VAL A N   1 
ATOM   2843  C  CA  . VAL A 1 365  ? 41.954  3.922   10.909  1.00 81.40  ? 365  VAL A CA  1 
ATOM   2844  C  C   . VAL A 1 365  ? 41.632  4.281   9.460   1.00 85.63  ? 365  VAL A C   1 
ATOM   2845  O  O   . VAL A 1 365  ? 40.542  4.777   9.176   1.00 84.91  ? 365  VAL A O   1 
ATOM   2846  C  CB  . VAL A 1 365  ? 41.452  2.504   11.250  1.00 80.27  ? 365  VAL A CB  1 
ATOM   2847  C  CG1 . VAL A 1 365  ? 42.139  1.429   10.419  1.00 82.21  ? 365  VAL A CG1 1 
ATOM   2848  C  CG2 . VAL A 1 365  ? 41.575  2.193   12.732  1.00 78.52  ? 365  VAL A CG2 1 
ATOM   2849  N  N   . ASP A 1 366  ? 42.590  4.021   8.555   1.00 90.69  ? 366  ASP A N   1 
ATOM   2850  C  CA  . ASP A 1 366  ? 42.387  4.174   7.120   1.00 94.73  ? 366  ASP A CA  1 
ATOM   2851  C  C   . ASP A 1 366  ? 41.870  2.865   6.526   1.00 95.43  ? 366  ASP A C   1 
ATOM   2852  O  O   . ASP A 1 366  ? 42.628  2.120   5.907   1.00 96.53  ? 366  ASP A O   1 
ATOM   2853  C  CB  . ASP A 1 366  ? 43.675  4.573   6.393   1.00 99.24  ? 366  ASP A CB  1 
ATOM   2854  C  CG  . ASP A 1 366  ? 44.235  5.932   6.788   1.00 101.41 ? 366  ASP A CG  1 
ATOM   2855  O  OD1 . ASP A 1 366  ? 43.436  6.820   7.192   1.00 99.52  ? 366  ASP A OD1 1 
ATOM   2856  O  OD2 . ASP A 1 366  ? 45.477  6.096   6.693   1.00 104.52 ? 366  ASP A OD2 1 
ATOM   2857  N  N   . LEU A 1 367  ? 40.569  2.604   6.690   1.00 95.23  ? 367  LEU A N   1 
ATOM   2858  C  CA  . LEU A 1 367  ? 39.981  1.355   6.225   1.00 96.86  ? 367  LEU A CA  1 
ATOM   2859  C  C   . LEU A 1 367  ? 39.687  1.435   4.718   1.00 100.76 ? 367  LEU A C   1 
ATOM   2860  O  O   . LEU A 1 367  ? 40.498  0.869   3.942   1.00 104.06 ? 367  LEU A O   1 
ATOM   2861  C  CB  . LEU A 1 367  ? 38.712  1.053   7.031   1.00 93.80  ? 367  LEU A CB  1 
ATOM   2862  C  CG  . LEU A 1 367  ? 38.936  0.575   8.467   1.00 90.83  ? 367  LEU A CG  1 
ATOM   2863  C  CD1 . LEU A 1 367  ? 37.716  0.859   9.331   1.00 87.57  ? 367  LEU A CD1 1 
ATOM   2864  C  CD2 . LEU A 1 367  ? 39.298  -0.905  8.506   1.00 91.06  ? 367  LEU A CD2 1 
ATOM   2865  N  N   . GLY A 1 371  ? 42.453  6.599   1.259   1.00 107.35 ? 371  GLY A N   1 
ATOM   2866  C  CA  . GLY A 1 371  ? 43.043  7.806   1.873   1.00 107.95 ? 371  GLY A CA  1 
ATOM   2867  C  C   . GLY A 1 371  ? 42.055  8.555   2.768   1.00 106.42 ? 371  GLY A C   1 
ATOM   2868  O  O   . GLY A 1 371  ? 42.356  9.645   3.253   1.00 105.81 ? 371  GLY A O   1 
ATOM   2869  N  N   . GLN A 1 372  ? 40.877  7.951   2.973   1.00 105.55 ? 372  GLN A N   1 
ATOM   2870  C  CA  . GLN A 1 372  ? 39.817  8.499   3.803   1.00 103.28 ? 372  GLN A CA  1 
ATOM   2871  C  C   . GLN A 1 372  ? 39.844  7.764   5.142   1.00 99.89  ? 372  GLN A C   1 
ATOM   2872  O  O   . GLN A 1 372  ? 39.811  6.535   5.162   1.00 98.67  ? 372  GLN A O   1 
ATOM   2873  C  CB  . GLN A 1 372  ? 38.480  8.302   3.079   1.00 105.94 ? 372  GLN A CB  1 
ATOM   2874  C  CG  . GLN A 1 372  ? 37.408  9.339   3.410   1.00 107.99 ? 372  GLN A CG  1 
ATOM   2875  C  CD  . GLN A 1 372  ? 37.645  10.667  2.731   1.00 111.75 ? 372  GLN A CD  1 
ATOM   2876  O  OE1 . GLN A 1 372  ? 38.563  10.812  1.926   1.00 115.82 ? 372  GLN A OE1 1 
ATOM   2877  N  NE2 . GLN A 1 372  ? 36.811  11.645  3.053   1.00 112.11 ? 372  GLN A NE2 1 
ATOM   2878  N  N   . GLY A 1 373  ? 39.917  8.515   6.252   1.00 97.52  ? 373  GLY A N   1 
ATOM   2879  C  CA  . GLY A 1 373  ? 40.003  7.937   7.587   1.00 94.94  ? 373  GLY A CA  1 
ATOM   2880  C  C   . GLY A 1 373  ? 38.635  7.577   8.171   1.00 94.48  ? 373  GLY A C   1 
ATOM   2881  O  O   . GLY A 1 373  ? 37.701  8.382   8.139   1.00 94.93  ? 373  GLY A O   1 
ATOM   2882  N  N   . GLN A 1 374  ? 38.528  6.351   8.704   1.00 92.90  ? 374  GLN A N   1 
ATOM   2883  C  CA  . GLN A 1 374  ? 37.320  5.869   9.357   1.00 87.96  ? 374  GLN A CA  1 
ATOM   2884  C  C   . GLN A 1 374  ? 37.586  5.845   10.861  1.00 82.58  ? 374  GLN A C   1 
ATOM   2885  O  O   . GLN A 1 374  ? 38.693  5.552   11.298  1.00 81.95  ? 374  GLN A O   1 
ATOM   2886  C  CB  . GLN A 1 374  ? 36.892  4.509   8.790   1.00 91.99  ? 374  GLN A CB  1 
ATOM   2887  C  CG  . GLN A 1 374  ? 36.487  4.526   7.312   1.00 100.08 ? 374  GLN A CG  1 
ATOM   2888  C  CD  . GLN A 1 374  ? 37.621  4.651   6.311   1.00 107.45 ? 374  GLN A CD  1 
ATOM   2889  O  OE1 . GLN A 1 374  ? 38.804  4.546   6.646   1.00 109.75 ? 374  GLN A OE1 1 
ATOM   2890  N  NE2 . GLN A 1 374  ? 37.267  4.885   5.053   1.00 110.62 ? 374  GLN A NE2 1 
ATOM   2891  N  N   . LEU A 1 375  ? 36.566  6.199   11.642  1.00 77.91  ? 375  LEU A N   1 
ATOM   2892  C  CA  . LEU A 1 375  ? 36.668  6.355   13.083  1.00 73.51  ? 375  LEU A CA  1 
ATOM   2893  C  C   . LEU A 1 375  ? 35.876  5.230   13.742  1.00 70.52  ? 375  LEU A C   1 
ATOM   2894  O  O   . LEU A 1 375  ? 34.694  5.074   13.461  1.00 71.09  ? 375  LEU A O   1 
ATOM   2895  C  CB  . LEU A 1 375  ? 36.067  7.723   13.431  1.00 72.26  ? 375  LEU A CB  1 
ATOM   2896  C  CG  . LEU A 1 375  ? 36.174  8.184   14.884  1.00 71.01  ? 375  LEU A CG  1 
ATOM   2897  C  CD1 . LEU A 1 375  ? 37.626  8.344   15.299  1.00 72.15  ? 375  LEU A CD1 1 
ATOM   2898  C  CD2 . LEU A 1 375  ? 35.431  9.495   15.090  1.00 70.14  ? 375  LEU A CD2 1 
ATOM   2899  N  N   . VAL A 1 376  ? 36.522  4.447   14.615  1.00 67.80  ? 376  VAL A N   1 
ATOM   2900  C  CA  . VAL A 1 376  ? 35.828  3.351   15.272  1.00 64.70  ? 376  VAL A CA  1 
ATOM   2901  C  C   . VAL A 1 376  ? 35.754  3.636   16.767  1.00 62.23  ? 376  VAL A C   1 
ATOM   2902  O  O   . VAL A 1 376  ? 36.783  3.818   17.397  1.00 62.20  ? 376  VAL A O   1 
ATOM   2903  C  CB  . VAL A 1 376  ? 36.499  1.997   14.986  1.00 65.15  ? 376  VAL A CB  1 
ATOM   2904  C  CG1 . VAL A 1 376  ? 35.554  0.844   15.282  1.00 64.03  ? 376  VAL A CG1 1 
ATOM   2905  C  CG2 . VAL A 1 376  ? 37.009  1.911   13.557  1.00 66.79  ? 376  VAL A CG2 1 
ATOM   2906  N  N   . THR A 1 377  ? 34.535  3.662   17.317  1.00 60.70  ? 377  THR A N   1 
ATOM   2907  C  CA  . THR A 1 377  ? 34.310  4.042   18.702  1.00 59.22  ? 377  THR A CA  1 
ATOM   2908  C  C   . THR A 1 377  ? 33.965  2.811   19.533  1.00 58.80  ? 377  THR A C   1 
ATOM   2909  O  O   . THR A 1 377  ? 33.495  1.803   19.008  1.00 58.90  ? 377  THR A O   1 
ATOM   2910  C  CB  . THR A 1 377  ? 33.170  5.066   18.872  1.00 58.22  ? 377  THR A CB  1 
ATOM   2911  O  OG1 . THR A 1 377  ? 31.919  4.493   18.488  1.00 56.99  ? 377  THR A OG1 1 
ATOM   2912  C  CG2 . THR A 1 377  ? 33.392  6.373   18.141  1.00 58.54  ? 377  THR A CG2 1 
ATOM   2913  N  N   . CYS A 1 378  ? 34.238  2.925   20.837  1.00 57.91  ? 378  CYS A N   1 
ATOM   2914  C  CA  . CYS A 1 378  ? 33.584  2.147   21.874  1.00 56.87  ? 378  CYS A CA  1 
ATOM   2915  C  C   . CYS A 1 378  ? 32.385  2.946   22.380  1.00 55.96  ? 378  CYS A C   1 
ATOM   2916  O  O   . CYS A 1 378  ? 32.539  4.019   22.967  1.00 54.58  ? 378  CYS A O   1 
ATOM   2917  C  CB  . CYS A 1 378  ? 34.551  1.854   23.014  1.00 56.07  ? 378  CYS A CB  1 
ATOM   2918  S  SG  . CYS A 1 378  ? 35.741  0.557   22.596  1.00 56.72  ? 378  CYS A SG  1 
ATOM   2919  N  N   . SER A 1 379  ? 31.183  2.421   22.121  1.00 56.69  ? 379  SER A N   1 
ATOM   2920  C  CA  . SER A 1 379  ? 29.958  3.179   22.346  1.00 56.37  ? 379  SER A CA  1 
ATOM   2921  C  C   . SER A 1 379  ? 29.046  2.448   23.319  1.00 55.69  ? 379  SER A C   1 
ATOM   2922  O  O   . SER A 1 379  ? 28.989  1.221   23.332  1.00 57.08  ? 379  SER A O   1 
ATOM   2923  C  CB  . SER A 1 379  ? 29.222  3.455   21.055  1.00 56.37  ? 379  SER A CB  1 
ATOM   2924  O  OG  . SER A 1 379  ? 29.739  4.601   20.397  1.00 57.26  ? 379  SER A OG  1 
ATOM   2925  N  N   . GLY A 1 380  ? 28.322  3.231   24.117  1.00 54.46  ? 380  GLY A N   1 
ATOM   2926  C  CA  . GLY A 1 380  ? 27.230  2.683   24.900  1.00 54.48  ? 380  GLY A CA  1 
ATOM   2927  C  C   . GLY A 1 380  ? 27.727  2.006   26.172  1.00 54.32  ? 380  GLY A C   1 
ATOM   2928  O  O   . GLY A 1 380  ? 28.885  2.177   26.559  1.00 55.16  ? 380  GLY A O   1 
ATOM   2929  N  N   . ALA A 1 381  ? 26.828  1.241   26.801  1.00 52.99  ? 381  ALA A N   1 
ATOM   2930  C  CA  . ALA A 1 381  ? 27.074  0.611   28.085  1.00 52.24  ? 381  ALA A CA  1 
ATOM   2931  C  C   . ALA A 1 381  ? 26.092  -0.541  28.287  1.00 52.82  ? 381  ALA A C   1 
ATOM   2932  O  O   . ALA A 1 381  ? 24.955  -0.488  27.831  1.00 54.12  ? 381  ALA A O   1 
ATOM   2933  C  CB  . ALA A 1 381  ? 26.917  1.647   29.168  1.00 50.42  ? 381  ALA A CB  1 
ATOM   2934  N  N   . PHE A 1 382  ? 26.532  -1.586  28.985  1.00 53.10  ? 382  PHE A N   1 
ATOM   2935  C  CA  . PHE A 1 382  ? 25.652  -2.692  29.320  1.00 53.58  ? 382  PHE A CA  1 
ATOM   2936  C  C   . PHE A 1 382  ? 25.123  -3.325  28.035  1.00 54.55  ? 382  PHE A C   1 
ATOM   2937  O  O   . PHE A 1 382  ? 25.857  -3.407  27.055  1.00 55.49  ? 382  PHE A O   1 
ATOM   2938  C  CB  . PHE A 1 382  ? 24.590  -2.208  30.305  1.00 52.60  ? 382  PHE A CB  1 
ATOM   2939  C  CG  . PHE A 1 382  ? 25.174  -1.423  31.447  1.00 52.19  ? 382  PHE A CG  1 
ATOM   2940  C  CD1 . PHE A 1 382  ? 26.072  -2.011  32.327  1.00 53.00  ? 382  PHE A CD1 1 
ATOM   2941  C  CD2 . PHE A 1 382  ? 24.847  -0.090  31.631  1.00 51.30  ? 382  PHE A CD2 1 
ATOM   2942  C  CE1 . PHE A 1 382  ? 26.623  -1.289  33.376  1.00 52.22  ? 382  PHE A CE1 1 
ATOM   2943  C  CE2 . PHE A 1 382  ? 25.392  0.628   32.687  1.00 51.31  ? 382  PHE A CE2 1 
ATOM   2944  C  CZ  . PHE A 1 382  ? 26.279  0.028   33.556  1.00 51.33  ? 382  PHE A CZ  1 
ATOM   2945  N  N   . LYS A 1 383  ? 23.858  -3.759  28.027  1.00 54.66  ? 383  LYS A N   1 
ATOM   2946  C  CA  . LYS A 1 383  ? 23.328  -4.459  26.868  1.00 56.10  ? 383  LYS A CA  1 
ATOM   2947  C  C   . LYS A 1 383  ? 23.380  -3.587  25.612  1.00 56.09  ? 383  LYS A C   1 
ATOM   2948  O  O   . LYS A 1 383  ? 23.311  -4.112  24.502  1.00 56.53  ? 383  LYS A O   1 
ATOM   2949  C  CB  . LYS A 1 383  ? 21.919  -4.991  27.142  1.00 57.87  ? 383  LYS A CB  1 
ATOM   2950  C  CG  . LYS A 1 383  ? 20.786  -3.974  27.095  1.00 57.09  ? 383  LYS A CG  1 
ATOM   2951  C  CD  . LYS A 1 383  ? 19.464  -4.574  27.489  1.00 57.83  ? 383  LYS A CD  1 
ATOM   2952  C  CE  . LYS A 1 383  ? 18.336  -3.570  27.444  1.00 58.67  ? 383  LYS A CE  1 
ATOM   2953  N  NZ  . LYS A 1 383  ? 17.907  -3.283  26.055  1.00 59.45  ? 383  LYS A NZ  1 
ATOM   2954  N  N   . GLU A 1 384  ? 23.539  -2.266  25.789  1.00 55.30  ? 384  GLU A N   1 
ATOM   2955  C  CA  . GLU A 1 384  ? 23.549  -1.311  24.689  1.00 55.67  ? 384  GLU A CA  1 
ATOM   2956  C  C   . GLU A 1 384  ? 24.945  -1.134  24.083  1.00 56.29  ? 384  GLU A C   1 
ATOM   2957  O  O   . GLU A 1 384  ? 25.118  -0.367  23.131  1.00 55.15  ? 384  GLU A O   1 
ATOM   2958  C  CB  . GLU A 1 384  ? 23.072  0.060   25.168  1.00 55.38  ? 384  GLU A CB  1 
ATOM   2959  C  CG  . GLU A 1 384  ? 21.756  0.044   25.924  1.00 57.19  ? 384  GLU A CG  1 
ATOM   2960  C  CD  . GLU A 1 384  ? 20.523  -0.484  25.200  1.00 59.34  ? 384  GLU A CD  1 
ATOM   2961  O  OE1 . GLU A 1 384  ? 19.583  -0.932  25.893  1.00 59.93  ? 384  GLU A OE1 1 
ATOM   2962  O  OE2 . GLU A 1 384  ? 20.489  -0.445  23.947  1.00 60.58  ? 384  GLU A OE2 1 
ATOM   2963  N  N   . GLY A 1 385  ? 25.947  -1.812  24.660  1.00 57.11  ? 385  GLY A N   1 
ATOM   2964  C  CA  . GLY A 1 385  ? 27.329  -1.643  24.241  1.00 57.52  ? 385  GLY A CA  1 
ATOM   2965  C  C   . GLY A 1 385  ? 27.492  -1.986  22.765  1.00 59.12  ? 385  GLY A C   1 
ATOM   2966  O  O   . GLY A 1 385  ? 26.795  -2.864  22.260  1.00 61.79  ? 385  GLY A O   1 
ATOM   2967  N  N   . SER A 1 386  ? 28.393  -1.274  22.082  1.00 58.91  ? 386  SER A N   1 
ATOM   2968  C  CA  . SER A 1 386  ? 28.540  -1.415  20.643  1.00 60.38  ? 386  SER A CA  1 
ATOM   2969  C  C   . SER A 1 386  ? 29.863  -0.823  20.172  1.00 61.07  ? 386  SER A C   1 
ATOM   2970  O  O   . SER A 1 386  ? 30.487  -0.034  20.884  1.00 60.47  ? 386  SER A O   1 
ATOM   2971  C  CB  . SER A 1 386  ? 27.395  -0.746  19.926  1.00 61.34  ? 386  SER A CB  1 
ATOM   2972  O  OG  . SER A 1 386  ? 27.201  0.591   20.387  1.00 61.04  ? 386  SER A OG  1 
ATOM   2973  N  N   . LEU A 1 387  ? 30.277  -1.233  18.967  1.00 61.78  ? 387  LEU A N   1 
ATOM   2974  C  CA  . LEU A 1 387  ? 31.209  -0.448  18.176  1.00 62.23  ? 387  LEU A CA  1 
ATOM   2975  C  C   . LEU A 1 387  ? 30.400  0.314   17.129  1.00 62.79  ? 387  LEU A C   1 
ATOM   2976  O  O   . LEU A 1 387  ? 29.387  -0.188  16.647  1.00 64.09  ? 387  LEU A O   1 
ATOM   2977  C  CB  . LEU A 1 387  ? 32.244  -1.357  17.506  1.00 62.68  ? 387  LEU A CB  1 
ATOM   2978  C  CG  . LEU A 1 387  ? 32.963  -2.353  18.409  1.00 62.08  ? 387  LEU A CG  1 
ATOM   2979  C  CD1 . LEU A 1 387  ? 33.998  -3.138  17.621  1.00 63.00  ? 387  LEU A CD1 1 
ATOM   2980  C  CD2 . LEU A 1 387  ? 33.584  -1.664  19.612  1.00 60.63  ? 387  LEU A CD2 1 
ATOM   2981  N  N   . ARG A 1 388  ? 30.833  1.542   16.830  1.00 62.26  ? 388  ARG A N   1 
ATOM   2982  C  CA  . ARG A 1 388  ? 30.288  2.315   15.731  1.00 63.03  ? 388  ARG A CA  1 
ATOM   2983  C  C   . ARG A 1 388  ? 31.447  2.684   14.812  1.00 65.36  ? 388  ARG A C   1 
ATOM   2984  O  O   . ARG A 1 388  ? 32.482  3.141   15.283  1.00 65.76  ? 388  ARG A O   1 
ATOM   2985  C  CB  . ARG A 1 388  ? 29.560  3.562   16.248  1.00 61.51  ? 388  ARG A CB  1 
ATOM   2986  C  CG  . ARG A 1 388  ? 28.577  3.319   17.386  1.00 59.88  ? 388  ARG A CG  1 
ATOM   2987  C  CD  . ARG A 1 388  ? 27.326  2.565   16.960  1.00 61.26  ? 388  ARG A CD  1 
ATOM   2988  N  NE  . ARG A 1 388  ? 26.399  2.214   18.033  1.00 59.89  ? 388  ARG A NE  1 
ATOM   2989  C  CZ  . ARG A 1 388  ? 25.117  2.568   18.093  1.00 59.10  ? 388  ARG A CZ  1 
ATOM   2990  N  NH1 . ARG A 1 388  ? 24.572  3.287   17.132  1.00 60.49  ? 388  ARG A NH1 1 
ATOM   2991  N  NH2 . ARG A 1 388  ? 24.373  2.198   19.115  1.00 57.75  ? 388  ARG A NH2 1 
ATOM   2992  N  N   . ILE A 1 389  ? 31.270  2.459   13.507  1.00 67.75  ? 389  ILE A N   1 
ATOM   2993  C  CA  . ILE A 1 389  ? 32.262  2.819   12.505  1.00 70.28  ? 389  ILE A CA  1 
ATOM   2994  C  C   . ILE A 1 389  ? 31.742  4.038   11.745  1.00 72.44  ? 389  ILE A C   1 
ATOM   2995  O  O   . ILE A 1 389  ? 30.680  3.974   11.134  1.00 73.45  ? 389  ILE A O   1 
ATOM   2996  C  CB  . ILE A 1 389  ? 32.540  1.618   11.575  1.00 71.00  ? 389  ILE A CB  1 
ATOM   2997  C  CG1 . ILE A 1 389  ? 32.958  0.380   12.367  1.00 69.37  ? 389  ILE A CG1 1 
ATOM   2998  C  CG2 . ILE A 1 389  ? 33.565  1.969   10.507  1.00 73.33  ? 389  ILE A CG2 1 
ATOM   2999  C  CD1 . ILE A 1 389  ? 31.820  -0.533  12.700  1.00 68.93  ? 389  ILE A CD1 1 
ATOM   3000  N  N   . ILE A 1 390  ? 32.499  5.144   11.780  1.00 74.06  ? 390  ILE A N   1 
ATOM   3001  C  CA  . ILE A 1 390  ? 32.016  6.424   11.278  1.00 76.41  ? 390  ILE A CA  1 
ATOM   3002  C  C   . ILE A 1 390  ? 32.882  6.890   10.111  1.00 80.68  ? 390  ILE A C   1 
ATOM   3003  O  O   . ILE A 1 390  ? 34.091  7.011   10.250  1.00 81.66  ? 390  ILE A O   1 
ATOM   3004  C  CB  . ILE A 1 390  ? 31.952  7.472   12.405  1.00 73.94  ? 390  ILE A CB  1 
ATOM   3005  C  CG1 . ILE A 1 390  ? 31.048  7.003   13.548  1.00 72.10  ? 390  ILE A CG1 1 
ATOM   3006  C  CG2 . ILE A 1 390  ? 31.510  8.819   11.856  1.00 73.98  ? 390  ILE A CG2 1 
ATOM   3007  C  CD1 . ILE A 1 390  ? 31.329  7.668   14.870  1.00 70.29  ? 390  ILE A CD1 1 
ATOM   3008  N  N   . ARG A 1 391  ? 32.222  7.197   8.985   1.00 86.35  ? 391  ARG A N   1 
ATOM   3009  C  CA  . ARG A 1 391  ? 32.834  7.484   7.693   1.00 90.80  ? 391  ARG A CA  1 
ATOM   3010  C  C   . ARG A 1 391  ? 32.144  8.706   7.074   1.00 94.73  ? 391  ARG A C   1 
ATOM   3011  O  O   . ARG A 1 391  ? 30.984  8.994   7.372   1.00 93.30  ? 391  ARG A O   1 
ATOM   3012  C  CB  . ARG A 1 391  ? 32.707  6.220   6.829   1.00 91.07  ? 391  ARG A CB  1 
ATOM   3013  C  CG  . ARG A 1 391  ? 33.162  6.350   5.384   1.00 95.38  ? 391  ARG A CG  1 
ATOM   3014  C  CD  . ARG A 1 391  ? 32.910  5.099   4.556   1.00 99.20  ? 391  ARG A CD  1 
ATOM   3015  N  NE  . ARG A 1 391  ? 33.692  5.110   3.314   1.00 104.82 ? 391  ARG A NE  1 
ATOM   3016  C  CZ  . ARG A 1 391  ? 33.944  4.064   2.515   1.00 106.35 ? 391  ARG A CZ  1 
ATOM   3017  N  NH1 . ARG A 1 391  ? 33.467  2.861   2.792   1.00 106.23 ? 391  ARG A NH1 1 
ATOM   3018  N  NH2 . ARG A 1 391  ? 34.681  4.226   1.430   1.00 108.39 ? 391  ARG A NH2 1 
ATOM   3019  N  N   . ASN A 1 392  ? 32.873  9.454   6.234   1.00 100.49 ? 392  ASN A N   1 
ATOM   3020  C  CA  . ASN A 1 392  ? 32.244  10.425  5.348   1.00 103.08 ? 392  ASN A CA  1 
ATOM   3021  C  C   . ASN A 1 392  ? 31.749  9.679   4.108   1.00 106.09 ? 392  ASN A C   1 
ATOM   3022  O  O   . ASN A 1 392  ? 32.434  8.791   3.599   1.00 109.37 ? 392  ASN A O   1 
ATOM   3023  C  CB  . ASN A 1 392  ? 33.175  11.596  4.995   1.00 105.19 ? 392  ASN A CB  1 
ATOM   3024  C  CG  . ASN A 1 392  ? 33.140  12.754  5.977   1.00 104.21 ? 392  ASN A CG  1 
ATOM   3025  O  OD1 . ASN A 1 392  ? 32.812  12.578  7.152   1.00 101.74 ? 392  ASN A OD1 1 
ATOM   3026  N  ND2 . ASN A 1 392  ? 33.501  13.941  5.512   1.00 106.29 ? 392  ASN A ND2 1 
ATOM   3027  N  N   . GLY A 1 393  ? 30.554  10.043  3.630   1.00 106.09 ? 393  GLY A N   1 
ATOM   3028  C  CA  . GLY A 1 393  ? 29.929  9.343   2.519   1.00 107.25 ? 393  GLY A CA  1 
ATOM   3029  C  C   . GLY A 1 393  ? 28.583  8.759   2.939   1.00 106.03 ? 393  GLY A C   1 
ATOM   3030  O  O   . GLY A 1 393  ? 28.189  8.885   4.100   1.00 103.16 ? 393  GLY A O   1 
ATOM   3031  N  N   . ILE A 1 394  ? 27.859  8.172   1.976   1.00 107.06 ? 394  ILE A N   1 
ATOM   3032  C  CA  . ILE A 1 394  ? 26.575  7.547   2.260   1.00 104.36 ? 394  ILE A CA  1 
ATOM   3033  C  C   . ILE A 1 394  ? 26.618  6.098   1.784   1.00 104.53 ? 394  ILE A C   1 
ATOM   3034  O  O   . ILE A 1 394  ? 27.159  5.800   0.717   1.00 106.27 ? 394  ILE A O   1 
ATOM   3035  C  CB  . ILE A 1 394  ? 25.390  8.332   1.657   1.00 106.21 ? 394  ILE A CB  1 
ATOM   3036  C  CG1 . ILE A 1 394  ? 25.306  9.755   2.221   1.00 105.69 ? 394  ILE A CG1 1 
ATOM   3037  C  CG2 . ILE A 1 394  ? 24.091  7.572   1.886   1.00 106.42 ? 394  ILE A CG2 1 
ATOM   3038  C  CD1 . ILE A 1 394  ? 24.397  10.688  1.447   1.00 107.28 ? 394  ILE A CD1 1 
ATOM   3039  N  N   . GLY A 1 395  ? 26.036  5.213   2.605   1.00 102.13 ? 395  GLY A N   1 
ATOM   3040  C  CA  . GLY A 1 395  ? 26.071  3.779   2.368   1.00 102.35 ? 395  GLY A CA  1 
ATOM   3041  C  C   . GLY A 1 395  ? 24.738  3.217   1.873   1.00 102.87 ? 395  GLY A C   1 
ATOM   3042  O  O   . GLY A 1 395  ? 23.664  3.739   2.176   1.00 101.41 ? 395  GLY A O   1 
ATOM   3043  N  N   . ILE A 1 396  ? 24.833  2.124   1.113   1.00 103.93 ? 396  ILE A N   1 
ATOM   3044  C  CA  . ILE A 1 396  ? 23.666  1.383   0.672   1.00 105.70 ? 396  ILE A CA  1 
ATOM   3045  C  C   . ILE A 1 396  ? 23.628  0.049   1.418   1.00 106.04 ? 396  ILE A C   1 
ATOM   3046  O  O   . ILE A 1 396  ? 24.577  -0.734  1.358   1.00 109.93 ? 396  ILE A O   1 
ATOM   3047  C  CB  . ILE A 1 396  ? 23.689  1.206   -0.861  1.00 108.72 ? 396  ILE A CB  1 
ATOM   3048  C  CG1 . ILE A 1 396  ? 23.557  2.549   -1.587  1.00 110.08 ? 396  ILE A CG1 1 
ATOM   3049  C  CG2 . ILE A 1 396  ? 22.635  0.206   -1.322  1.00 109.18 ? 396  ILE A CG2 1 
ATOM   3050  C  CD1 . ILE A 1 396  ? 22.220  3.238   -1.395  1.00 108.84 ? 396  ILE A CD1 1 
ATOM   3051  N  N   . HIS A 1 397  ? 22.520  -0.193  2.126   1.00 132.45 ? 397  HIS A N   1 
ATOM   3052  C  CA  . HIS A 1 397  ? 22.267  -1.480  2.748   1.00 134.54 ? 397  HIS A CA  1 
ATOM   3053  C  C   . HIS A 1 397  ? 21.605  -2.395  1.719   1.00 132.18 ? 397  HIS A C   1 
ATOM   3054  O  O   . HIS A 1 397  ? 20.386  -2.360  1.557   1.00 129.76 ? 397  HIS A O   1 
ATOM   3055  C  CB  . HIS A 1 397  ? 21.429  -1.294  4.023   1.00 136.86 ? 397  HIS A CB  1 
ATOM   3056  C  CG  . HIS A 1 397  ? 22.093  -0.493  5.096   1.00 138.57 ? 397  HIS A CG  1 
ATOM   3057  N  ND1 . HIS A 1 397  ? 21.393  0.019   6.173   1.00 140.01 ? 397  HIS A ND1 1 
ATOM   3058  C  CD2 . HIS A 1 397  ? 23.378  -0.113  5.270   1.00 139.27 ? 397  HIS A CD2 1 
ATOM   3059  C  CE1 . HIS A 1 397  ? 22.218  0.665   6.972   1.00 140.64 ? 397  HIS A CE1 1 
ATOM   3060  N  NE2 . HIS A 1 397  ? 23.440  0.604   6.435   1.00 141.06 ? 397  HIS A NE2 1 
ATOM   3061  N  N   . GLU A 1 398  ? 22.431  -3.176  1.006   1.00 132.41 ? 398  GLU A N   1 
ATOM   3062  C  CA  . GLU A 1 398  ? 21.984  -4.044  -0.076  1.00 131.34 ? 398  GLU A CA  1 
ATOM   3063  C  C   . GLU A 1 398  ? 21.116  -5.167  0.485   1.00 134.37 ? 398  GLU A C   1 
ATOM   3064  O  O   . GLU A 1 398  ? 21.508  -5.852  1.429   1.00 138.87 ? 398  GLU A O   1 
ATOM   3065  C  CB  . GLU A 1 398  ? 23.171  -4.659  -0.821  1.00 133.22 ? 398  GLU A CB  1 
ATOM   3066  C  CG  . GLU A 1 398  ? 24.008  -3.649  -1.584  1.00 130.37 ? 398  GLU A CG  1 
ATOM   3067  C  CD  . GLU A 1 398  ? 25.228  -4.212  -2.294  1.00 133.38 ? 398  GLU A CD  1 
ATOM   3068  O  OE1 . GLU A 1 398  ? 25.552  -5.402  -2.071  1.00 139.11 ? 398  GLU A OE1 1 
ATOM   3069  O  OE2 . GLU A 1 398  ? 25.848  -3.454  -3.075  1.00 130.12 ? 398  GLU A OE2 1 
ATOM   3070  N  N   . HIS A 1 399  ? 19.939  -5.356  -0.117  1.00 131.97 ? 399  HIS A N   1 
ATOM   3071  C  CA  . HIS A 1 399  ? 19.053  -6.429  0.298   1.00 134.91 ? 399  HIS A CA  1 
ATOM   3072  C  C   . HIS A 1 399  ? 18.963  -7.481  -0.803  1.00 135.88 ? 399  HIS A C   1 
ATOM   3073  O  O   . HIS A 1 399  ? 18.519  -8.597  -0.547  1.00 139.52 ? 399  HIS A O   1 
ATOM   3074  C  CB  . HIS A 1 399  ? 17.675  -5.889  0.715   1.00 133.56 ? 399  HIS A CB  1 
ATOM   3075  C  CG  . HIS A 1 399  ? 17.714  -4.797  1.734   1.00 132.70 ? 399  HIS A CG  1 
ATOM   3076  N  ND1 . HIS A 1 399  ? 17.428  -3.481  1.412   1.00 127.71 ? 399  HIS A ND1 1 
ATOM   3077  C  CD2 . HIS A 1 399  ? 17.989  -4.815  3.058   1.00 135.80 ? 399  HIS A CD2 1 
ATOM   3078  C  CE1 . HIS A 1 399  ? 17.532  -2.737  2.494   1.00 127.79 ? 399  HIS A CE1 1 
ATOM   3079  N  NE2 . HIS A 1 399  ? 17.877  -3.530  3.518   1.00 133.16 ? 399  HIS A NE2 1 
ATOM   3080  N  N   . ALA A 1 400  ? 19.402  -7.122  -2.015  1.00 132.79 ? 400  ALA A N   1 
ATOM   3081  C  CA  . ALA A 1 400  ? 19.269  -7.989  -3.176  1.00 134.44 ? 400  ALA A CA  1 
ATOM   3082  C  C   . ALA A 1 400  ? 20.282  -7.594  -4.246  1.00 133.00 ? 400  ALA A C   1 
ATOM   3083  O  O   . ALA A 1 400  ? 20.621  -6.417  -4.386  1.00 130.21 ? 400  ALA A O   1 
ATOM   3084  C  CB  . ALA A 1 400  ? 17.856  -7.926  -3.708  1.00 132.21 ? 400  ALA A CB  1 
ATOM   3085  N  N   . SER A 1 401  ? 20.756  -8.602  -4.990  1.00 135.94 ? 401  SER A N   1 
ATOM   3086  C  CA  . SER A 1 401  ? 21.665  -8.404  -6.109  1.00 135.02 ? 401  SER A CA  1 
ATOM   3087  C  C   . SER A 1 401  ? 21.361  -9.440  -7.190  1.00 137.53 ? 401  SER A C   1 
ATOM   3088  O  O   . SER A 1 401  ? 21.358  -10.638 -6.915  1.00 143.22 ? 401  SER A O   1 
ATOM   3089  C  CB  . SER A 1 401  ? 23.103  -8.471  -5.649  1.00 137.64 ? 401  SER A CB  1 
ATOM   3090  O  OG  . SER A 1 401  ? 23.950  -7.735  -6.518  1.00 135.21 ? 401  SER A OG  1 
ATOM   3091  N  N   . ILE A 1 402  ? 21.098  -8.963  -8.413  1.00 134.30 ? 402  ILE A N   1 
ATOM   3092  C  CA  . ILE A 1 402  ? 20.610  -9.806  -9.496  1.00 136.48 ? 402  ILE A CA  1 
ATOM   3093  C  C   . ILE A 1 402  ? 21.497  -9.612  -10.726 1.00 136.75 ? 402  ILE A C   1 
ATOM   3094  O  O   . ILE A 1 402  ? 21.840  -8.485  -11.081 1.00 133.02 ? 402  ILE A O   1 
ATOM   3095  C  CB  . ILE A 1 402  ? 19.118  -9.517  -9.788  1.00 132.81 ? 402  ILE A CB  1 
ATOM   3096  C  CG1 . ILE A 1 402  ? 18.228  -9.670  -8.548  1.00 132.67 ? 402  ILE A CG1 1 
ATOM   3097  C  CG2 . ILE A 1 402  ? 18.607  -10.343 -10.961 1.00 135.44 ? 402  ILE A CG2 1 
ATOM   3098  C  CD1 . ILE A 1 402  ? 18.164  -11.074 -7.970  1.00 139.16 ? 402  ILE A CD1 1 
ATOM   3099  N  N   . ASP A 1 403  ? 21.853  -10.733 -11.365 1.00 141.88 ? 403  ASP A N   1 
ATOM   3100  C  CA  . ASP A 1 403  ? 22.706  -10.762 -12.541 1.00 143.29 ? 403  ASP A CA  1 
ATOM   3101  C  C   . ASP A 1 403  ? 21.890  -10.357 -13.770 1.00 140.76 ? 403  ASP A C   1 
ATOM   3102  O  O   . ASP A 1 403  ? 21.250  -11.201 -14.393 1.00 143.96 ? 403  ASP A O   1 
ATOM   3103  C  CB  . ASP A 1 403  ? 23.332  -12.153 -12.688 1.00 150.79 ? 403  ASP A CB  1 
ATOM   3104  C  CG  . ASP A 1 403  ? 24.381  -12.267 -13.781 1.00 153.56 ? 403  ASP A CG  1 
ATOM   3105  O  OD1 . ASP A 1 403  ? 24.140  -11.741 -14.891 1.00 151.09 ? 403  ASP A OD1 1 
ATOM   3106  O  OD2 . ASP A 1 403  ? 25.434  -12.891 -13.513 1.00 158.50 ? 403  ASP A OD2 1 
ATOM   3107  N  N   . LEU A 1 404  ? 21.915  -9.059  -14.108 1.00 135.90 ? 404  LEU A N   1 
ATOM   3108  C  CA  . LEU A 1 404  ? 21.176  -8.546  -15.254 1.00 133.52 ? 404  LEU A CA  1 
ATOM   3109  C  C   . LEU A 1 404  ? 21.985  -7.465  -15.972 1.00 129.96 ? 404  LEU A C   1 
ATOM   3110  O  O   . LEU A 1 404  ? 22.001  -6.306  -15.550 1.00 124.23 ? 404  LEU A O   1 
ATOM   3111  C  CB  . LEU A 1 404  ? 19.803  -8.023  -14.810 1.00 130.16 ? 404  LEU A CB  1 
ATOM   3112  C  CG  . LEU A 1 404  ? 18.817  -9.072  -14.292 1.00 133.32 ? 404  LEU A CG  1 
ATOM   3113  C  CD1 . LEU A 1 404  ? 17.535  -8.403  -13.827 1.00 129.44 ? 404  LEU A CD1 1 
ATOM   3114  C  CD2 . LEU A 1 404  ? 18.515  -10.131 -15.345 1.00 137.87 ? 404  LEU A CD2 1 
ATOM   3115  N  N   . PRO A 1 405  ? 22.696  -7.835  -17.068 1.00 132.72 ? 405  PRO A N   1 
ATOM   3116  C  CA  . PRO A 1 405  ? 23.483  -6.886  -17.858 1.00 130.23 ? 405  PRO A CA  1 
ATOM   3117  C  C   . PRO A 1 405  ? 22.661  -6.079  -18.860 1.00 126.32 ? 405  PRO A C   1 
ATOM   3118  O  O   . PRO A 1 405  ? 21.610  -6.530  -19.312 1.00 127.62 ? 405  PRO A O   1 
ATOM   3119  C  CB  . PRO A 1 405  ? 24.463  -7.784  -18.641 1.00 135.72 ? 405  PRO A CB  1 
ATOM   3120  C  CG  . PRO A 1 405  ? 24.262  -9.188  -18.092 1.00 140.59 ? 405  PRO A CG  1 
ATOM   3121  C  CD  . PRO A 1 405  ? 22.842  -9.211  -17.568 1.00 138.36 ? 405  PRO A CD  1 
ATOM   3122  N  N   . GLY A 1 406  ? 23.166  -4.883  -19.191 1.00 122.12 ? 406  GLY A N   1 
ATOM   3123  C  CA  . GLY A 1 406  ? 22.705  -4.106  -20.331 1.00 119.48 ? 406  GLY A CA  1 
ATOM   3124  C  C   . GLY A 1 406  ? 21.482  -3.245  -20.025 1.00 113.92 ? 406  GLY A C   1 
ATOM   3125  O  O   . GLY A 1 406  ? 20.828  -2.767  -20.947 1.00 112.17 ? 406  GLY A O   1 
ATOM   3126  N  N   . ILE A 1 407  ? 21.195  -3.049  -18.733 1.00 111.79 ? 407  ILE A N   1 
ATOM   3127  C  CA  . ILE A 1 407  ? 20.062  -2.244  -18.303 1.00 108.27 ? 407  ILE A CA  1 
ATOM   3128  C  C   . ILE A 1 407  ? 20.292  -0.798  -18.748 1.00 105.09 ? 407  ILE A C   1 
ATOM   3129  O  O   . ILE A 1 407  ? 21.366  -0.240  -18.528 1.00 104.84 ? 407  ILE A O   1 
ATOM   3130  C  CB  . ILE A 1 407  ? 19.823  -2.385  -16.783 1.00 107.12 ? 407  ILE A CB  1 
ATOM   3131  C  CG1 . ILE A 1 407  ? 19.533  -3.839  -16.393 1.00 112.13 ? 407  ILE A CG1 1 
ATOM   3132  C  CG2 . ILE A 1 407  ? 18.718  -1.449  -16.316 1.00 102.80 ? 407  ILE A CG2 1 
ATOM   3133  C  CD1 . ILE A 1 407  ? 19.500  -4.100  -14.900 1.00 112.75 ? 407  ILE A CD1 1 
ATOM   3134  N  N   . LYS A 1 408  ? 19.273  -0.212  -19.394 1.00 103.50 ? 408  LYS A N   1 
ATOM   3135  C  CA  . LYS A 1 408  ? 19.372  1.087   -20.045 1.00 100.34 ? 408  LYS A CA  1 
ATOM   3136  C  C   . LYS A 1 408  ? 18.339  2.054   -19.460 1.00 96.43  ? 408  LYS A C   1 
ATOM   3137  O  O   . LYS A 1 408  ? 18.161  3.163   -19.963 1.00 94.33  ? 408  LYS A O   1 
ATOM   3138  C  CB  . LYS A 1 408  ? 19.203  0.932   -21.563 1.00 102.60 ? 408  LYS A CB  1 
ATOM   3139  C  CG  . LYS A 1 408  ? 20.380  0.311   -22.309 1.00 106.89 ? 408  LYS A CG  1 
ATOM   3140  C  CD  . LYS A 1 408  ? 21.277  1.324   -23.000 1.00 106.12 ? 408  LYS A CD  1 
ATOM   3141  C  CE  . LYS A 1 408  ? 22.602  0.744   -23.449 1.00 110.57 ? 408  LYS A CE  1 
ATOM   3142  N  NZ  . LYS A 1 408  ? 23.360  0.168   -22.311 1.00 112.17 ? 408  LYS A NZ  1 
ATOM   3143  N  N   . GLY A 1 409  ? 17.664  1.626   -18.386 1.00 95.87  ? 409  GLY A N   1 
ATOM   3144  C  CA  . GLY A 1 409  ? 16.639  2.425   -17.733 1.00 92.69  ? 409  GLY A CA  1 
ATOM   3145  C  C   . GLY A 1 409  ? 15.848  1.598   -16.720 1.00 94.33  ? 409  GLY A C   1 
ATOM   3146  O  O   . GLY A 1 409  ? 15.916  0.370   -16.740 1.00 97.28  ? 409  GLY A O   1 
ATOM   3147  N  N   . LEU A 1 410  ? 15.078  2.283   -15.858 1.00 92.28  ? 410  LEU A N   1 
ATOM   3148  C  CA  . LEU A 1 410  ? 14.559  1.683   -14.636 1.00 93.20  ? 410  LEU A CA  1 
ATOM   3149  C  C   . LEU A 1 410  ? 13.372  2.483   -14.092 1.00 90.03  ? 410  LEU A C   1 
ATOM   3150  O  O   . LEU A 1 410  ? 13.529  3.657   -13.759 1.00 86.61  ? 410  LEU A O   1 
ATOM   3151  C  CB  . LEU A 1 410  ? 15.714  1.696   -13.631 1.00 94.51  ? 410  LEU A CB  1 
ATOM   3152  C  CG  . LEU A 1 410  ? 15.433  1.059   -12.275 1.00 97.47  ? 410  LEU A CG  1 
ATOM   3153  C  CD1 . LEU A 1 410  ? 15.109  -0.417  -12.441 1.00 102.45 ? 410  LEU A CD1 1 
ATOM   3154  C  CD2 . LEU A 1 410  ? 16.640  1.216   -11.373 1.00 98.35  ? 410  LEU A CD2 1 
ATOM   3155  N  N   . TRP A 1 411  ? 12.193  1.843   -13.972 1.00 90.95  ? 411  TRP A N   1 
ATOM   3156  C  CA  . TRP A 1 411  ? 11.000  2.548   -13.505 1.00 89.63  ? 411  TRP A CA  1 
ATOM   3157  C  C   . TRP A 1 411  ? 10.191  1.750   -12.482 1.00 92.14  ? 411  TRP A C   1 
ATOM   3158  O  O   . TRP A 1 411  ? 9.973   0.549   -12.649 1.00 95.56  ? 411  TRP A O   1 
ATOM   3159  C  CB  . TRP A 1 411  ? 10.109  3.021   -14.661 1.00 88.53  ? 411  TRP A CB  1 
ATOM   3160  C  CG  . TRP A 1 411  ? 10.848  3.857   -15.658 1.00 86.54  ? 411  TRP A CG  1 
ATOM   3161  C  CD1 . TRP A 1 411  ? 10.958  5.218   -15.686 1.00 83.39  ? 411  TRP A CD1 1 
ATOM   3162  C  CD2 . TRP A 1 411  ? 11.632  3.365   -16.758 1.00 87.37  ? 411  TRP A CD2 1 
ATOM   3163  N  NE1 . TRP A 1 411  ? 11.744  5.606   -16.740 1.00 82.28  ? 411  TRP A NE1 1 
ATOM   3164  C  CE2 . TRP A 1 411  ? 12.176  4.493   -17.413 1.00 84.54  ? 411  TRP A CE2 1 
ATOM   3165  C  CE3 . TRP A 1 411  ? 11.926  2.088   -17.248 1.00 90.25  ? 411  TRP A CE3 1 
ATOM   3166  C  CZ2 . TRP A 1 411  ? 12.990  4.377   -18.539 1.00 84.59  ? 411  TRP A CZ2 1 
ATOM   3167  C  CZ3 . TRP A 1 411  ? 12.731  1.977   -18.360 1.00 91.08  ? 411  TRP A CZ3 1 
ATOM   3168  C  CH2 . TRP A 1 411  ? 13.255  3.105   -18.994 1.00 88.04  ? 411  TRP A CH2 1 
ATOM   3169  N  N   . PRO A 1 412  ? 9.691   2.422   -11.412 1.00 90.96  ? 412  PRO A N   1 
ATOM   3170  C  CA  . PRO A 1 412  ? 8.804   1.804   -10.426 1.00 93.91  ? 412  PRO A CA  1 
ATOM   3171  C  C   . PRO A 1 412  ? 7.329   2.028   -10.759 1.00 94.68  ? 412  PRO A C   1 
ATOM   3172  O  O   . PRO A 1 412  ? 6.954   3.036   -11.360 1.00 91.66  ? 412  PRO A O   1 
ATOM   3173  C  CB  . PRO A 1 412  ? 9.167   2.593   -9.159  1.00 91.79  ? 412  PRO A CB  1 
ATOM   3174  C  CG  . PRO A 1 412  ? 9.437   3.997   -9.662  1.00 87.44  ? 412  PRO A CG  1 
ATOM   3175  C  CD  . PRO A 1 412  ? 9.976   3.826   -11.070 1.00 87.34  ? 412  PRO A CD  1 
ATOM   3176  N  N   . LEU A 1 413  ? 6.489   1.088   -10.326 1.00 98.96  ? 413  LEU A N   1 
ATOM   3177  C  CA  . LEU A 1 413  ? 5.138   1.015   -10.850 1.00 100.63 ? 413  LEU A CA  1 
ATOM   3178  C  C   . LEU A 1 413  ? 4.213   0.354   -9.835  1.00 102.41 ? 413  LEU A C   1 
ATOM   3179  O  O   . LEU A 1 413  ? 4.574   -0.640  -9.205  1.00 104.02 ? 413  LEU A O   1 
ATOM   3180  C  CB  . LEU A 1 413  ? 5.194   0.214   -12.153 1.00 104.08 ? 413  LEU A CB  1 
ATOM   3181  C  CG  . LEU A 1 413  ? 3.873   0.016   -12.885 1.00 107.40 ? 413  LEU A CG  1 
ATOM   3182  C  CD1 . LEU A 1 413  ? 3.298   1.357   -13.305 1.00 105.20 ? 413  LEU A CD1 1 
ATOM   3183  C  CD2 . LEU A 1 413  ? 4.106   -0.850  -14.107 1.00 110.70 ? 413  LEU A CD2 1 
ATOM   3184  N  N   . ARG A 1 414  ? 3.019   0.936   -9.706  1.00 101.88 ? 414  ARG A N   1 
ATOM   3185  C  CA  . ARG A 1 414  ? 1.939   0.343   -8.937  1.00 106.33 ? 414  ARG A CA  1 
ATOM   3186  C  C   . ARG A 1 414  ? 0.953   -0.313  -9.906  1.00 108.67 ? 414  ARG A C   1 
ATOM   3187  O  O   . ARG A 1 414  ? 0.390   0.368   -10.760 1.00 107.75 ? 414  ARG A O   1 
ATOM   3188  C  CB  . ARG A 1 414  ? 1.306   1.418   -8.046  1.00 105.06 ? 414  ARG A CB  1 
ATOM   3189  C  CG  . ARG A 1 414  ? 2.200   1.870   -6.901  1.00 102.70 ? 414  ARG A CG  1 
ATOM   3190  C  CD  . ARG A 1 414  ? 1.598   2.967   -6.045  1.00 102.38 ? 414  ARG A CD  1 
ATOM   3191  N  NE  . ARG A 1 414  ? 1.688   4.279   -6.676  1.00 99.02  ? 414  ARG A NE  1 
ATOM   3192  C  CZ  . ARG A 1 414  ? 0.657   5.036   -7.051  1.00 99.61  ? 414  ARG A CZ  1 
ATOM   3193  N  NH1 . ARG A 1 414  ? -0.590  4.627   -6.866  1.00 103.41 ? 414  ARG A NH1 1 
ATOM   3194  N  NH2 . ARG A 1 414  ? 0.885   6.209   -7.615  1.00 96.53  ? 414  ARG A NH2 1 
ATOM   3195  N  N   . SER A 1 415  ? 0.790   -1.641  -9.797  1.00 112.03 ? 415  SER A N   1 
ATOM   3196  C  CA  . SER A 1 415  ? -0.084  -2.389  -10.690 1.00 116.52 ? 415  SER A CA  1 
ATOM   3197  C  C   . SER A 1 415  ? -1.535  -2.262  -10.231 1.00 119.36 ? 415  SER A C   1 
ATOM   3198  O  O   . SER A 1 415  ? -2.441  -2.050  -11.039 1.00 118.84 ? 415  SER A O   1 
ATOM   3199  C  CB  . SER A 1 415  ? 0.336   -3.834  -10.800 1.00 119.80 ? 415  SER A CB  1 
ATOM   3200  O  OG  . SER A 1 415  ? -0.494  -4.528  -11.722 1.00 122.88 ? 415  SER A OG  1 
ATOM   3201  N  N   . ASP A 1 416  ? -1.727  -2.384  -8.916  1.00 121.92 ? 416  ASP A N   1 
ATOM   3202  C  CA  . ASP A 1 416  ? -3.031  -2.228  -8.300  1.00 125.84 ? 416  ASP A CA  1 
ATOM   3203  C  C   . ASP A 1 416  ? -3.203  -0.767  -7.889  1.00 123.72 ? 416  ASP A C   1 
ATOM   3204  O  O   . ASP A 1 416  ? -2.331  -0.209  -7.220  1.00 122.28 ? 416  ASP A O   1 
ATOM   3205  C  CB  . ASP A 1 416  ? -3.179  -3.228  -7.152  1.00 129.78 ? 416  ASP A CB  1 
ATOM   3206  C  CG  . ASP A 1 416  ? -4.526  -3.205  -6.459  1.00 133.67 ? 416  ASP A CG  1 
ATOM   3207  O  OD1 . ASP A 1 416  ? -5.364  -2.354  -6.809  1.00 133.60 ? 416  ASP A OD1 1 
ATOM   3208  O  OD2 . ASP A 1 416  ? -4.708  -4.028  -5.551  1.00 138.18 ? 416  ASP A OD2 1 
ATOM   3209  N  N   . PRO A 1 417  ? -4.301  -0.096  -8.319  1.00 124.74 ? 417  PRO A N   1 
ATOM   3210  C  CA  . PRO A 1 417  ? -4.560  1.302   -7.959  1.00 122.60 ? 417  PRO A CA  1 
ATOM   3211  C  C   . PRO A 1 417  ? -4.817  1.545   -6.472  1.00 124.25 ? 417  PRO A C   1 
ATOM   3212  O  O   . PRO A 1 417  ? -4.507  2.622   -5.963  1.00 122.07 ? 417  PRO A O   1 
ATOM   3213  C  CB  . PRO A 1 417  ? -5.825  1.647   -8.760  1.00 124.43 ? 417  PRO A CB  1 
ATOM   3214  C  CG  . PRO A 1 417  ? -6.494  0.307   -8.990  1.00 128.36 ? 417  PRO A CG  1 
ATOM   3215  C  CD  . PRO A 1 417  ? -5.338  -0.644  -9.210  1.00 127.67 ? 417  PRO A CD  1 
ATOM   3216  N  N   . ASN A 1 418  ? -5.384  0.544   -5.786  1.00 128.26 ? 418  ASN A N   1 
ATOM   3217  C  CA  . ASN A 1 418  ? -5.691  0.679   -4.370  1.00 130.97 ? 418  ASN A CA  1 
ATOM   3218  C  C   . ASN A 1 418  ? -4.423  0.547   -3.524  1.00 129.99 ? 418  ASN A C   1 
ATOM   3219  O  O   . ASN A 1 418  ? -4.322  1.200   -2.488  1.00 130.50 ? 418  ASN A O   1 
ATOM   3220  C  CB  . ASN A 1 418  ? -6.867  -0.194  -3.928  1.00 136.90 ? 418  ASN A CB  1 
ATOM   3221  C  CG  . ASN A 1 418  ? -8.203  0.341   -4.397  1.00 138.84 ? 418  ASN A CG  1 
ATOM   3222  O  OD1 . ASN A 1 418  ? -8.697  1.340   -3.878  1.00 139.11 ? 418  ASN A OD1 1 
ATOM   3223  N  ND2 . ASN A 1 418  ? -8.798  -0.322  -5.375  1.00 141.08 ? 418  ASN A ND2 1 
ATOM   3224  N  N   . ARG A 1 419  ? -3.471  -0.296  -3.963  1.00 129.89 ? 419  ARG A N   1 
ATOM   3225  C  CA  . ARG A 1 419  ? -2.116  -0.310  -3.418  1.00 126.91 ? 419  ARG A CA  1 
ATOM   3226  C  C   . ARG A 1 419  ? -1.508  1.082   -3.552  1.00 121.10 ? 419  ARG A C   1 
ATOM   3227  O  O   . ARG A 1 419  ? -1.498  1.648   -4.648  1.00 117.87 ? 419  ARG A O   1 
ATOM   3228  C  CB  . ARG A 1 419  ? -1.195  -1.252  -4.205  1.00 127.07 ? 419  ARG A CB  1 
ATOM   3229  C  CG  . ARG A 1 419  ? -0.839  -2.545  -3.486  1.00 132.39 ? 419  ARG A CG  1 
ATOM   3230  C  CD  . ARG A 1 419  ? -0.072  -3.504  -4.381  1.00 133.88 ? 419  ARG A CD  1 
ATOM   3231  N  NE  . ARG A 1 419  ? -0.318  -4.895  -4.002  1.00 139.68 ? 419  ARG A NE  1 
ATOM   3232  C  CZ  . ARG A 1 419  ? 0.067   -5.973  -4.687  1.00 141.47 ? 419  ARG A CZ  1 
ATOM   3233  N  NH1 . ARG A 1 419  ? 0.735   -5.853  -5.822  1.00 139.35 ? 419  ARG A NH1 1 
ATOM   3234  N  NH2 . ARG A 1 419  ? -0.222  -7.176  -4.226  1.00 146.14 ? 419  ARG A NH2 1 
ATOM   3235  N  N   . GLU A 1 420  ? -0.998  1.624   -2.438  1.00 119.63 ? 420  GLU A N   1 
ATOM   3236  C  CA  . GLU A 1 420  ? -0.283  2.890   -2.502  1.00 114.57 ? 420  GLU A CA  1 
ATOM   3237  C  C   . GLU A 1 420  ? 1.225   2.650   -2.460  1.00 110.94 ? 420  GLU A C   1 
ATOM   3238  O  O   . GLU A 1 420  ? 1.991   3.586   -2.251  1.00 107.46 ? 420  GLU A O   1 
ATOM   3239  C  CB  . GLU A 1 420  ? -0.821  3.924   -1.504  1.00 115.91 ? 420  GLU A CB  1 
ATOM   3240  C  CG  . GLU A 1 420  ? -0.531  3.635   -0.040  1.00 120.07 ? 420  GLU A CG  1 
ATOM   3241  C  CD  . GLU A 1 420  ? -1.008  4.727   0.909   1.00 121.86 ? 420  GLU A CD  1 
ATOM   3242  O  OE1 . GLU A 1 420  ? -0.562  4.740   2.079   1.00 124.04 ? 420  GLU A OE1 1 
ATOM   3243  O  OE2 . GLU A 1 420  ? -1.829  5.566   0.481   1.00 121.67 ? 420  GLU A OE2 1 
ATOM   3244  N  N   . THR A 1 421  ? 1.629   1.396   -2.706  1.00 112.19 ? 421  THR A N   1 
ATOM   3245  C  CA  . THR A 1 421  ? 3.026   0.991   -2.742  1.00 110.85 ? 421  THR A CA  1 
ATOM   3246  C  C   . THR A 1 421  ? 3.337   0.276   -4.057  1.00 110.63 ? 421  THR A C   1 
ATOM   3247  O  O   . THR A 1 421  ? 2.500   -0.458  -4.586  1.00 113.28 ? 421  THR A O   1 
ATOM   3248  C  CB  . THR A 1 421  ? 3.384   0.085   -1.556  1.00 113.95 ? 421  THR A CB  1 
ATOM   3249  O  OG1 . THR A 1 421  ? 2.583   -1.098  -1.612  1.00 118.18 ? 421  THR A OG1 1 
ATOM   3250  C  CG2 . THR A 1 421  ? 3.232   0.767   -0.214  1.00 114.57 ? 421  THR A CG2 1 
ATOM   3251  N  N   . ASP A 1 422  ? 4.565   0.492   -4.550  1.00 107.99 ? 422  ASP A N   1 
ATOM   3252  C  CA  . ASP A 1 422  ? 5.080   -0.113  -5.769  1.00 107.28 ? 422  ASP A CA  1 
ATOM   3253  C  C   . ASP A 1 422  ? 5.152   -1.629  -5.616  1.00 110.97 ? 422  ASP A C   1 
ATOM   3254  O  O   . ASP A 1 422  ? 5.568   -2.139  -4.575  1.00 112.92 ? 422  ASP A O   1 
ATOM   3255  C  CB  . ASP A 1 422  ? 6.473   0.420   -6.116  1.00 104.19 ? 422  ASP A CB  1 
ATOM   3256  C  CG  . ASP A 1 422  ? 6.582   1.935   -6.105  1.00 100.35 ? 422  ASP A CG  1 
ATOM   3257  O  OD1 . ASP A 1 422  ? 5.669   2.603   -6.644  1.00 97.78  ? 422  ASP A OD1 1 
ATOM   3258  O  OD2 . ASP A 1 422  ? 7.580   2.439   -5.546  1.00 100.29 ? 422  ASP A OD2 1 
ATOM   3259  N  N   . ASP A 1 423  ? 4.772   -2.330  -6.688  1.00 111.62 ? 423  ASP A N   1 
ATOM   3260  C  CA  . ASP A 1 423  ? 4.798   -3.782  -6.717  1.00 115.57 ? 423  ASP A CA  1 
ATOM   3261  C  C   . ASP A 1 423  ? 5.582   -4.257  -7.940  1.00 114.59 ? 423  ASP A C   1 
ATOM   3262  O  O   . ASP A 1 423  ? 5.927   -5.434  -8.039  1.00 117.69 ? 423  ASP A O   1 
ATOM   3263  C  CB  . ASP A 1 423  ? 3.376   -4.351  -6.643  1.00 119.83 ? 423  ASP A CB  1 
ATOM   3264  C  CG  . ASP A 1 423  ? 2.438   -3.850  -7.733  1.00 119.44 ? 423  ASP A CG  1 
ATOM   3265  O  OD1 . ASP A 1 423  ? 2.885   -3.051  -8.578  1.00 116.43 ? 423  ASP A OD1 1 
ATOM   3266  O  OD2 . ASP A 1 423  ? 1.259   -4.261  -7.725  1.00 122.70 ? 423  ASP A OD2 1 
ATOM   3267  N  N   . THR A 1 424  ? 5.874   -3.319  -8.850  1.00 110.42 ? 424  THR A N   1 
ATOM   3268  C  CA  . THR A 1 424  ? 6.438   -3.631  -10.153 1.00 110.49 ? 424  THR A CA  1 
ATOM   3269  C  C   . THR A 1 424  ? 7.713   -2.828  -10.390 1.00 107.00 ? 424  THR A C   1 
ATOM   3270  O  O   . THR A 1 424  ? 7.819   -1.676  -9.979  1.00 103.61 ? 424  THR A O   1 
ATOM   3271  C  CB  . THR A 1 424  ? 5.455   -3.289  -11.281 1.00 109.94 ? 424  THR A CB  1 
ATOM   3272  O  OG1 . THR A 1 424  ? 4.154   -3.781  -10.961 1.00 113.09 ? 424  THR A OG1 1 
ATOM   3273  C  CG2 . THR A 1 424  ? 5.876   -3.841  -12.625 1.00 111.07 ? 424  THR A CG2 1 
ATOM   3274  N  N   . LEU A 1 425  ? 8.665   -3.458  -11.085 1.00 108.48 ? 425  LEU A N   1 
ATOM   3275  C  CA  . LEU A 1 425  ? 9.860   -2.797  -11.575 1.00 105.80 ? 425  LEU A CA  1 
ATOM   3276  C  C   . LEU A 1 425  ? 9.979   -3.077  -13.073 1.00 106.85 ? 425  LEU A C   1 
ATOM   3277  O  O   . LEU A 1 425  ? 10.104  -4.227  -13.494 1.00 110.73 ? 425  LEU A O   1 
ATOM   3278  C  CB  . LEU A 1 425  ? 11.065  -3.337  -10.796 1.00 107.13 ? 425  LEU A CB  1 
ATOM   3279  C  CG  . LEU A 1 425  ? 12.338  -2.494  -10.839 1.00 103.58 ? 425  LEU A CG  1 
ATOM   3280  C  CD1 . LEU A 1 425  ? 12.164  -1.212  -10.041 1.00 100.14 ? 425  LEU A CD1 1 
ATOM   3281  C  CD2 . LEU A 1 425  ? 13.519  -3.290  -10.306 1.00 106.22 ? 425  LEU A CD2 1 
ATOM   3282  N  N   . VAL A 1 426  ? 9.905   -2.010  -13.873 1.00 104.06 ? 426  VAL A N   1 
ATOM   3283  C  CA  . VAL A 1 426  ? 10.031  -2.120  -15.317 1.00 105.32 ? 426  VAL A CA  1 
ATOM   3284  C  C   . VAL A 1 426  ? 11.468  -1.781  -15.708 1.00 104.11 ? 426  VAL A C   1 
ATOM   3285  O  O   . VAL A 1 426  ? 12.000  -0.744  -15.307 1.00 101.09 ? 426  VAL A O   1 
ATOM   3286  C  CB  . VAL A 1 426  ? 9.019   -1.217  -16.054 1.00 103.82 ? 426  VAL A CB  1 
ATOM   3287  C  CG1 . VAL A 1 426  ? 9.231   -1.240  -17.562 1.00 104.77 ? 426  VAL A CG1 1 
ATOM   3288  C  CG2 . VAL A 1 426  ? 7.575   -1.555  -15.707 1.00 105.85 ? 426  VAL A CG2 1 
ATOM   3289  N  N   . LEU A 1 427  ? 12.074  -2.660  -16.514 1.00 106.65 ? 427  LEU A N   1 
ATOM   3290  C  CA  . LEU A 1 427  ? 13.464  -2.514  -16.915 1.00 105.93 ? 427  LEU A CA  1 
ATOM   3291  C  C   . LEU A 1 427  ? 13.559  -2.299  -18.424 1.00 106.42 ? 427  LEU A C   1 
ATOM   3292  O  O   . LEU A 1 427  ? 12.747  -2.824  -19.184 1.00 108.30 ? 427  LEU A O   1 
ATOM   3293  C  CB  . LEU A 1 427  ? 14.226  -3.773  -16.490 1.00 109.63 ? 427  LEU A CB  1 
ATOM   3294  C  CG  . LEU A 1 427  ? 14.922  -3.720  -15.129 1.00 109.09 ? 427  LEU A CG  1 
ATOM   3295  C  CD1 . LEU A 1 427  ? 13.922  -3.638  -13.985 1.00 107.99 ? 427  LEU A CD1 1 
ATOM   3296  C  CD2 . LEU A 1 427  ? 15.818  -4.936  -14.950 1.00 113.70 ? 427  LEU A CD2 1 
ATOM   3297  N  N   . SER A 1 428  ? 14.576  -1.529  -18.837 1.00 105.24 ? 428  SER A N   1 
ATOM   3298  C  CA  . SER A 1 428  ? 14.830  -1.198  -20.233 1.00 105.88 ? 428  SER A CA  1 
ATOM   3299  C  C   . SER A 1 428  ? 16.164  -1.781  -20.692 1.00 108.38 ? 428  SER A C   1 
ATOM   3300  O  O   . SER A 1 428  ? 17.106  -1.889  -19.911 1.00 108.53 ? 428  SER A O   1 
ATOM   3301  C  CB  . SER A 1 428  ? 14.797  0.294   -20.461 1.00 101.88 ? 428  SER A CB  1 
ATOM   3302  O  OG  . SER A 1 428  ? 15.277  0.621   -21.758 1.00 102.82 ? 428  SER A OG  1 
ATOM   3303  N  N   . PHE A 1 429  ? 16.214  -2.140  -21.980 1.00 111.44 ? 429  PHE A N   1 
ATOM   3304  C  CA  . PHE A 1 429  ? 17.371  -2.710  -22.653 1.00 115.28 ? 429  PHE A CA  1 
ATOM   3305  C  C   . PHE A 1 429  ? 17.396  -2.125  -24.063 1.00 115.64 ? 429  PHE A C   1 
ATOM   3306  O  O   . PHE A 1 429  ? 16.519  -1.332  -24.398 1.00 113.47 ? 429  PHE A O   1 
ATOM   3307  C  CB  . PHE A 1 429  ? 17.315  -4.244  -22.593 1.00 121.01 ? 429  PHE A CB  1 
ATOM   3308  C  CG  . PHE A 1 429  ? 17.201  -4.811  -21.197 1.00 121.62 ? 429  PHE A CG  1 
ATOM   3309  C  CD1 . PHE A 1 429  ? 16.056  -4.608  -20.434 1.00 119.54 ? 429  PHE A CD1 1 
ATOM   3310  C  CD2 . PHE A 1 429  ? 18.238  -5.541  -20.633 1.00 124.48 ? 429  PHE A CD2 1 
ATOM   3311  C  CE1 . PHE A 1 429  ? 15.956  -5.097  -19.140 1.00 119.85 ? 429  PHE A CE1 1 
ATOM   3312  C  CE2 . PHE A 1 429  ? 18.131  -6.046  -19.343 1.00 125.29 ? 429  PHE A CE2 1 
ATOM   3313  C  CZ  . PHE A 1 429  ? 16.992  -5.823  -18.598 1.00 122.93 ? 429  PHE A CZ  1 
ATOM   3314  N  N   . VAL A 1 430  ? 18.378  -2.520  -24.885 1.00 119.13 ? 430  VAL A N   1 
ATOM   3315  C  CA  . VAL A 1 430  ? 18.677  -1.812  -26.126 1.00 119.60 ? 430  VAL A CA  1 
ATOM   3316  C  C   . VAL A 1 430  ? 17.410  -1.621  -26.964 1.00 120.25 ? 430  VAL A C   1 
ATOM   3317  O  O   . VAL A 1 430  ? 17.106  -0.507  -27.389 1.00 117.82 ? 430  VAL A O   1 
ATOM   3318  C  CB  . VAL A 1 430  ? 19.823  -2.471  -26.925 1.00 124.14 ? 430  VAL A CB  1 
ATOM   3319  C  CG1 . VAL A 1 430  ? 20.149  -1.711  -28.204 1.00 124.56 ? 430  VAL A CG1 1 
ATOM   3320  C  CG2 . VAL A 1 430  ? 21.079  -2.644  -26.082 1.00 123.89 ? 430  VAL A CG2 1 
ATOM   3321  N  N   . GLY A 1 431  ? 16.677  -2.711  -27.205 1.00 123.83 ? 431  GLY A N   1 
ATOM   3322  C  CA  . GLY A 1 431  ? 15.468  -2.626  -28.003 1.00 124.75 ? 431  GLY A CA  1 
ATOM   3323  C  C   . GLY A 1 431  ? 14.297  -3.329  -27.329 1.00 125.59 ? 431  GLY A C   1 
ATOM   3324  O  O   . GLY A 1 431  ? 13.262  -3.538  -27.955 1.00 128.21 ? 431  GLY A O   1 
ATOM   3325  N  N   . GLN A 1 432  ? 14.479  -3.687  -26.052 1.00 123.84 ? 432  GLN A N   1 
ATOM   3326  C  CA  . GLN A 1 432  ? 13.538  -4.554  -25.359 1.00 125.47 ? 432  GLN A CA  1 
ATOM   3327  C  C   . GLN A 1 432  ? 13.146  -3.947  -24.014 1.00 120.55 ? 432  GLN A C   1 
ATOM   3328  O  O   . GLN A 1 432  ? 13.764  -2.991  -23.551 1.00 115.77 ? 432  GLN A O   1 
ATOM   3329  C  CB  . GLN A 1 432  ? 14.115  -5.964  -25.206 1.00 130.40 ? 432  GLN A CB  1 
ATOM   3330  C  CG  . GLN A 1 432  ? 14.232  -6.711  -26.526 1.00 136.85 ? 432  GLN A CG  1 
ATOM   3331  C  CD  . GLN A 1 432  ? 14.843  -8.083  -26.376 1.00 142.93 ? 432  GLN A CD  1 
ATOM   3332  O  OE1 . GLN A 1 432  ? 15.595  -8.350  -25.440 1.00 142.94 ? 432  GLN A OE1 1 
ATOM   3333  N  NE2 . GLN A 1 432  ? 14.519  -8.970  -27.304 1.00 148.46 ? 432  GLN A NE2 1 
ATOM   3334  N  N   . THR A 1 433  ? 12.091  -4.520  -23.418 1.00 121.76 ? 433  THR A N   1 
ATOM   3335  C  CA  . THR A 1 433  ? 11.571  -4.134  -22.115 1.00 118.11 ? 433  THR A CA  1 
ATOM   3336  C  C   . THR A 1 433  ? 11.115  -5.395  -21.379 1.00 121.27 ? 433  THR A C   1 
ATOM   3337  O  O   . THR A 1 433  ? 10.529  -6.290  -21.985 1.00 125.39 ? 433  THR A O   1 
ATOM   3338  C  CB  . THR A 1 433  ? 10.462  -3.077  -22.254 1.00 114.90 ? 433  THR A CB  1 
ATOM   3339  O  OG1 . THR A 1 433  ? 11.013  -1.924  -22.895 1.00 110.57 ? 433  THR A OG1 1 
ATOM   3340  C  CG2 . THR A 1 433  ? 9.863   -2.655  -20.930 1.00 112.07 ? 433  THR A CG2 1 
ATOM   3341  N  N   . ARG A 1 434  ? 11.412  -5.465  -20.075 1.00 120.29 ? 434  ARG A N   1 
ATOM   3342  C  CA  . ARG A 1 434  ? 10.976  -6.565  -19.225 1.00 124.13 ? 434  ARG A CA  1 
ATOM   3343  C  C   . ARG A 1 434  ? 10.367  -6.016  -17.935 1.00 121.40 ? 434  ARG A C   1 
ATOM   3344  O  O   . ARG A 1 434  ? 10.849  -5.033  -17.368 1.00 116.96 ? 434  ARG A O   1 
ATOM   3345  C  CB  . ARG A 1 434  ? 12.134  -7.496  -18.850 1.00 127.32 ? 434  ARG A CB  1 
ATOM   3346  C  CG  . ARG A 1 434  ? 12.991  -7.973  -20.013 1.00 130.75 ? 434  ARG A CG  1 
ATOM   3347  C  CD  . ARG A 1 434  ? 14.182  -8.744  -19.483 1.00 133.89 ? 434  ARG A CD  1 
ATOM   3348  N  NE  . ARG A 1 434  ? 14.789  -9.555  -20.529 1.00 139.20 ? 434  ARG A NE  1 
ATOM   3349  C  CZ  . ARG A 1 434  ? 15.818  -10.381 -20.363 1.00 142.69 ? 434  ARG A CZ  1 
ATOM   3350  N  NH1 . ARG A 1 434  ? 16.377  -10.529 -19.174 1.00 142.25 ? 434  ARG A NH1 1 
ATOM   3351  N  NH2 . ARG A 1 434  ? 16.278  -11.070 -21.392 1.00 147.18 ? 434  ARG A NH2 1 
ATOM   3352  N  N   . VAL A 1 435  ? 9.320   -6.704  -17.468 1.00 124.53 ? 435  VAL A N   1 
ATOM   3353  C  CA  . VAL A 1 435  ? 8.528   -6.297  -16.318 1.00 123.10 ? 435  VAL A CA  1 
ATOM   3354  C  C   . VAL A 1 435  ? 8.797   -7.276  -15.179 1.00 126.16 ? 435  VAL A C   1 
ATOM   3355  O  O   . VAL A 1 435  ? 8.833   -8.487  -15.396 1.00 130.80 ? 435  VAL A O   1 
ATOM   3356  C  CB  . VAL A 1 435  ? 7.028   -6.271  -16.679 1.00 124.45 ? 435  VAL A CB  1 
ATOM   3357  C  CG1 . VAL A 1 435  ? 6.145   -5.938  -15.486 1.00 123.28 ? 435  VAL A CG1 1 
ATOM   3358  C  CG2 . VAL A 1 435  ? 6.728   -5.339  -17.843 1.00 122.51 ? 435  VAL A CG2 1 
ATOM   3359  N  N   . LEU A 1 436  ? 8.966   -6.739  -13.963 1.00 123.74 ? 436  LEU A N   1 
ATOM   3360  C  CA  . LEU A 1 436  ? 9.278   -7.547  -12.792 1.00 127.19 ? 436  LEU A CA  1 
ATOM   3361  C  C   . LEU A 1 436  ? 8.313   -7.209  -11.652 1.00 126.93 ? 436  LEU A C   1 
ATOM   3362  O  O   . LEU A 1 436  ? 7.895   -6.060  -11.517 1.00 121.79 ? 436  LEU A O   1 
ATOM   3363  C  CB  . LEU A 1 436  ? 10.737  -7.289  -12.392 1.00 125.36 ? 436  LEU A CB  1 
ATOM   3364  C  CG  . LEU A 1 436  ? 11.811  -8.118  -13.107 1.00 128.34 ? 436  LEU A CG  1 
ATOM   3365  C  CD1 . LEU A 1 436  ? 11.884  -7.815  -14.601 1.00 127.87 ? 436  LEU A CD1 1 
ATOM   3366  C  CD2 . LEU A 1 436  ? 13.173  -7.886  -12.472 1.00 126.53 ? 436  LEU A CD2 1 
ATOM   3367  N  N   . MET A 1 437  ? 7.980   -8.222  -10.830 1.00 132.78 ? 437  MET A N   1 
ATOM   3368  C  CA  . MET A 1 437  ? 6.998   -8.118  -9.754  1.00 134.37 ? 437  MET A CA  1 
ATOM   3369  C  C   . MET A 1 437  ? 7.579   -8.686  -8.460  1.00 134.63 ? 437  MET A C   1 
ATOM   3370  O  O   . MET A 1 437  ? 8.237   -9.726  -8.486  1.00 137.23 ? 437  MET A O   1 
ATOM   3371  C  CB  . MET A 1 437  ? 5.724   -8.911  -10.080 1.00 142.30 ? 437  MET A CB  1 
ATOM   3372  C  CG  . MET A 1 437  ? 4.958   -8.417  -11.299 1.00 145.47 ? 437  MET A CG  1 
ATOM   3373  S  SD  . MET A 1 437  ? 4.292   -6.736  -11.137 1.00 147.50 ? 437  MET A SD  1 
ATOM   3374  C  CE  . MET A 1 437  ? 2.995   -7.019  -9.934  1.00 145.79 ? 437  MET A CE  1 
ATOM   3375  N  N   . LEU A 1 438  ? 7.296   -8.019  -7.329  1.00 131.80 ? 438  LEU A N   1 
ATOM   3376  C  CA  . LEU A 1 438  ? 7.833   -8.427  -6.036  1.00 133.60 ? 438  LEU A CA  1 
ATOM   3377  C  C   . LEU A 1 438  ? 6.761   -9.198  -5.262  1.00 137.77 ? 438  LEU A C   1 
ATOM   3378  O  O   . LEU A 1 438  ? 5.662   -8.682  -5.061  1.00 137.08 ? 438  LEU A O   1 
ATOM   3379  C  CB  . LEU A 1 438  ? 8.342   -7.209  -5.242  1.00 129.53 ? 438  LEU A CB  1 
ATOM   3380  C  CG  . LEU A 1 438  ? 8.809   -5.969  -6.026  1.00 124.06 ? 438  LEU A CG  1 
ATOM   3381  C  CD1 . LEU A 1 438  ? 9.062   -4.782  -5.108  1.00 120.05 ? 438  LEU A CD1 1 
ATOM   3382  C  CD2 . LEU A 1 438  ? 10.053  -6.236  -6.865  1.00 122.80 ? 438  LEU A CD2 1 
ATOM   3383  N  N   . ASN A 1 439  ? 7.094   -10.432 -4.847  1.00 142.33 ? 439  ASN A N   1 
ATOM   3384  C  CA  . ASN A 1 439  ? 6.228   -11.299 -4.057  1.00 147.14 ? 439  ASN A CA  1 
ATOM   3385  C  C   . ASN A 1 439  ? 5.217   -10.455 -3.268  1.00 145.91 ? 439  ASN A C   1 
ATOM   3386  O  O   . ASN A 1 439  ? 5.663   -9.738  -2.351  1.00 144.84 ? 439  ASN A O   1 
ATOM   3387  C  CB  . ASN A 1 439  ? 7.033   -12.204 -3.115  1.00 150.96 ? 439  ASN A CB  1 
ATOM   3388  C  CG  . ASN A 1 439  ? 6.220   -13.249 -2.374  1.00 156.84 ? 439  ASN A CG  1 
ATOM   3389  O  OD1 . ASN A 1 439  ? 6.758   -13.973 -1.539  1.00 160.42 ? 439  ASN A OD1 1 
ATOM   3390  N  ND2 . ASN A 1 439  ? 4.934   -13.359 -2.677  1.00 157.90 ? 439  ASN A ND2 1 
ATOM   3391  N  N   . GLU A 1 442  ? 9.935   -10.467 -2.991  1.00 143.14 ? 442  GLU A N   1 
ATOM   3392  C  CA  . GLU A 1 442  ? 10.675  -11.618 -3.579  1.00 146.75 ? 442  GLU A CA  1 
ATOM   3393  C  C   . GLU A 1 442  ? 10.890  -11.375 -5.073  1.00 144.63 ? 442  GLU A C   1 
ATOM   3394  O  O   . GLU A 1 442  ? 10.470  -10.349 -5.605  1.00 140.78 ? 442  GLU A O   1 
ATOM   3395  C  CB  . GLU A 1 442  ? 9.924   -12.923 -3.314  1.00 152.51 ? 442  GLU A CB  1 
ATOM   3396  C  CG  . GLU A 1 442  ? 10.829  -14.140 -3.255  1.00 157.42 ? 442  GLU A CG  1 
ATOM   3397  C  CD  . GLU A 1 442  ? 10.433  -15.257 -4.205  1.00 161.14 ? 442  GLU A CD  1 
ATOM   3398  O  OE1 . GLU A 1 442  ? 10.191  -14.963 -5.395  1.00 158.45 ? 442  GLU A OE1 1 
ATOM   3399  O  OE2 . GLU A 1 442  ? 10.367  -16.417 -3.756  1.00 166.91 ? 442  GLU A OE2 1 
ATOM   3400  N  N   . VAL A 1 443  ? 11.533  -12.345 -5.739  1.00 147.83 ? 443  VAL A N   1 
ATOM   3401  C  CA  . VAL A 1 443  ? 12.080  -12.198 -7.083  1.00 145.84 ? 443  VAL A CA  1 
ATOM   3402  C  C   . VAL A 1 443  ? 11.046  -12.596 -8.146  1.00 146.87 ? 443  VAL A C   1 
ATOM   3403  O  O   . VAL A 1 443  ? 9.890   -12.863 -7.821  1.00 148.72 ? 443  VAL A O   1 
ATOM   3404  C  CB  . VAL A 1 443  ? 13.397  -12.995 -7.218  1.00 149.34 ? 443  VAL A CB  1 
ATOM   3405  C  CG1 . VAL A 1 443  ? 14.537  -12.344 -6.445  1.00 146.96 ? 443  VAL A CG1 1 
ATOM   3406  C  CG2 . VAL A 1 443  ? 13.241  -14.457 -6.807  1.00 155.58 ? 443  VAL A CG2 1 
ATOM   3407  N  N   . GLU A 1 444  ? 11.484  -12.566 -9.420  1.00 145.86 ? 444  GLU A N   1 
ATOM   3408  C  CA  . GLU A 1 444  ? 10.859  -13.151 -10.609 1.00 148.59 ? 444  GLU A CA  1 
ATOM   3409  C  C   . GLU A 1 444  ? 10.008  -12.142 -11.388 1.00 144.04 ? 444  GLU A C   1 
ATOM   3410  O  O   . GLU A 1 444  ? 9.422   -11.233 -10.801 1.00 140.27 ? 444  GLU A O   1 
ATOM   3411  C  CB  . GLU A 1 444  ? 10.195  -14.511 -10.364 1.00 155.88 ? 444  GLU A CB  1 
ATOM   3412  C  CG  . GLU A 1 444  ? 11.145  -15.696 -10.536 1.00 161.57 ? 444  GLU A CG  1 
ATOM   3413  C  CD  . GLU A 1 444  ? 12.060  -15.725 -11.758 1.00 162.10 ? 444  GLU A CD  1 
ATOM   3414  O  OE1 . GLU A 1 444  ? 12.128  -14.711 -12.498 1.00 157.72 ? 444  GLU A OE1 1 
ATOM   3415  O  OE2 . GLU A 1 444  ? 12.718  -16.766 -11.962 1.00 166.79 ? 444  GLU A OE2 1 
ATOM   3416  N  N   . GLU A 1 445  ? 9.947   -12.340 -12.719 1.00 144.86 ? 445  GLU A N   1 
ATOM   3417  C  CA  . GLU A 1 445  ? 9.405   -11.387 -13.685 1.00 140.96 ? 445  GLU A CA  1 
ATOM   3418  C  C   . GLU A 1 445  ? 7.980   -11.773 -14.091 1.00 143.66 ? 445  GLU A C   1 
ATOM   3419  O  O   . GLU A 1 445  ? 7.413   -12.718 -13.543 1.00 147.42 ? 445  GLU A O   1 
ATOM   3420  C  CB  . GLU A 1 445  ? 10.323  -11.278 -14.908 1.00 140.09 ? 445  GLU A CB  1 
ATOM   3421  C  CG  . GLU A 1 445  ? 10.476  -12.578 -15.683 1.00 146.03 ? 445  GLU A CG  1 
ATOM   3422  C  CD  . GLU A 1 445  ? 11.419  -12.523 -16.872 1.00 146.33 ? 445  GLU A CD  1 
ATOM   3423  O  OE1 . GLU A 1 445  ? 11.705  -11.405 -17.352 1.00 141.67 ? 445  GLU A OE1 1 
ATOM   3424  O  OE2 . GLU A 1 445  ? 11.862  -13.600 -17.319 1.00 151.86 ? 445  GLU A OE2 1 
ATOM   3425  N  N   . THR A 1 446  ? 7.421   -11.027 -15.062 1.00 141.69 ? 446  THR A N   1 
ATOM   3426  C  CA  . THR A 1 446  ? 6.049   -11.165 -15.541 1.00 143.22 ? 446  THR A CA  1 
ATOM   3427  C  C   . THR A 1 446  ? 5.871   -10.400 -16.856 1.00 141.59 ? 446  THR A C   1 
ATOM   3428  O  O   . THR A 1 446  ? 6.844   -9.988  -17.488 1.00 139.83 ? 446  THR A O   1 
ATOM   3429  C  CB  . THR A 1 446  ? 5.031   -10.581 -14.545 1.00 140.67 ? 446  THR A CB  1 
ATOM   3430  O  OG1 . THR A 1 446  ? 5.409   -9.238  -14.239 1.00 133.97 ? 446  THR A OG1 1 
ATOM   3431  C  CG2 . THR A 1 446  ? 4.856   -11.379 -13.269 1.00 143.34 ? 446  THR A CG2 1 
ATOM   3432  N  N   . GLU A 1 447  ? 4.602   -10.195 -17.240 1.00 142.33 ? 447  GLU A N   1 
ATOM   3433  C  CA  . GLU A 1 447  ? 4.222   -9.367  -18.374 1.00 140.12 ? 447  GLU A CA  1 
ATOM   3434  C  C   . GLU A 1 447  ? 3.055   -8.474  -17.952 1.00 137.35 ? 447  GLU A C   1 
ATOM   3435  O  O   . GLU A 1 447  ? 2.156   -8.923  -17.243 1.00 139.77 ? 447  GLU A O   1 
ATOM   3436  C  CB  . GLU A 1 447  ? 3.871   -10.248 -19.578 1.00 145.82 ? 447  GLU A CB  1 
ATOM   3437  C  CG  . GLU A 1 447  ? 5.082   -10.886 -20.246 1.00 148.32 ? 447  GLU A CG  1 
ATOM   3438  C  CD  . GLU A 1 447  ? 4.855   -12.258 -20.865 1.00 156.09 ? 447  GLU A CD  1 
ATOM   3439  O  OE1 . GLU A 1 447  ? 5.629   -13.187 -20.543 1.00 159.32 ? 447  GLU A OE1 1 
ATOM   3440  O  OE2 . GLU A 1 447  ? 3.911   -12.399 -21.670 1.00 159.24 ? 447  GLU A OE2 1 
ATOM   3441  N  N   . LEU A 1 448  ? 3.088   -7.206  -18.376 1.00 132.91 ? 448  LEU A N   1 
ATOM   3442  C  CA  . LEU A 1 448  ? 2.018   -6.275  -18.053 1.00 131.23 ? 448  LEU A CA  1 
ATOM   3443  C  C   . LEU A 1 448  ? 1.210   -5.960  -19.310 1.00 133.20 ? 448  LEU A C   1 
ATOM   3444  O  O   . LEU A 1 448  ? 1.759   -5.444  -20.283 1.00 131.95 ? 448  LEU A O   1 
ATOM   3445  C  CB  . LEU A 1 448  ? 2.623   -5.005  -17.447 1.00 125.83 ? 448  LEU A CB  1 
ATOM   3446  C  CG  . LEU A 1 448  ? 1.797   -4.359  -16.337 1.00 124.50 ? 448  LEU A CG  1 
ATOM   3447  C  CD1 . LEU A 1 448  ? 1.498   -5.357  -15.222 1.00 127.85 ? 448  LEU A CD1 1 
ATOM   3448  C  CD2 . LEU A 1 448  ? 2.508   -3.132  -15.787 1.00 118.27 ? 448  LEU A CD2 1 
ATOM   3449  N  N   . MET A 1 449  ? -0.097  -6.273  -19.267 1.00 136.99 ? 449  MET A N   1 
ATOM   3450  C  CA  . MET A 1 449  ? -1.000  -6.047  -20.387 1.00 139.37 ? 449  MET A CA  1 
ATOM   3451  C  C   . MET A 1 449  ? -1.026  -4.557  -20.722 1.00 134.30 ? 449  MET A C   1 
ATOM   3452  O  O   . MET A 1 449  ? -1.052  -3.716  -19.825 1.00 130.18 ? 449  MET A O   1 
ATOM   3453  C  CB  . MET A 1 449  ? -2.430  -6.514  -20.088 1.00 145.10 ? 449  MET A CB  1 
ATOM   3454  C  CG  . MET A 1 449  ? -2.591  -8.018  -19.864 1.00 153.23 ? 449  MET A CG  1 
ATOM   3455  S  SD  . MET A 1 449  ? -2.069  -9.133  -21.213 1.00 161.59 ? 449  MET A SD  1 
ATOM   3456  C  CE  . MET A 1 449  ? -3.502  -9.136  -22.290 1.00 163.94 ? 449  MET A CE  1 
ATOM   3457  N  N   . GLY A 1 450  ? -1.004  -4.257  -22.028 1.00 134.81 ? 450  GLY A N   1 
ATOM   3458  C  CA  . GLY A 1 450  ? -0.979  -2.892  -22.532 1.00 131.14 ? 450  GLY A CA  1 
ATOM   3459  C  C   . GLY A 1 450  ? 0.433   -2.403  -22.861 1.00 126.98 ? 450  GLY A C   1 
ATOM   3460  O  O   . GLY A 1 450  ? 0.605   -1.484  -23.663 1.00 123.99 ? 450  GLY A O   1 
ATOM   3461  N  N   . PHE A 1 451  ? 1.434   -3.027  -22.224 1.00 126.49 ? 451  PHE A N   1 
ATOM   3462  C  CA  . PHE A 1 451  ? 2.837   -2.690  -22.410 1.00 123.89 ? 451  PHE A CA  1 
ATOM   3463  C  C   . PHE A 1 451  ? 3.453   -3.570  -23.499 1.00 127.62 ? 451  PHE A C   1 
ATOM   3464  O  O   . PHE A 1 451  ? 3.187   -4.770  -23.565 1.00 132.15 ? 451  PHE A O   1 
ATOM   3465  C  CB  . PHE A 1 451  ? 3.594   -2.828  -21.085 1.00 121.89 ? 451  PHE A CB  1 
ATOM   3466  C  CG  . PHE A 1 451  ? 3.489   -1.655  -20.140 1.00 118.18 ? 451  PHE A CG  1 
ATOM   3467  C  CD1 . PHE A 1 451  ? 2.284   -0.991  -19.941 1.00 117.93 ? 451  PHE A CD1 1 
ATOM   3468  C  CD2 . PHE A 1 451  ? 4.597   -1.225  -19.422 1.00 115.69 ? 451  PHE A CD2 1 
ATOM   3469  C  CE1 . PHE A 1 451  ? 2.194   0.084   -19.067 1.00 114.44 ? 451  PHE A CE1 1 
ATOM   3470  C  CE2 . PHE A 1 451  ? 4.506   -0.151  -18.545 1.00 112.32 ? 451  PHE A CE2 1 
ATOM   3471  C  CZ  . PHE A 1 451  ? 3.304   0.501   -18.367 1.00 111.53 ? 451  PHE A CZ  1 
ATOM   3472  N  N   . VAL A 1 452  ? 4.279   -2.946  -24.348 1.00 125.88 ? 452  VAL A N   1 
ATOM   3473  C  CA  . VAL A 1 452  ? 5.052   -3.624  -25.378 1.00 128.86 ? 452  VAL A CA  1 
ATOM   3474  C  C   . VAL A 1 452  ? 6.352   -4.112  -24.738 1.00 127.80 ? 452  VAL A C   1 
ATOM   3475  O  O   . VAL A 1 452  ? 6.778   -3.565  -23.722 1.00 123.53 ? 452  VAL A O   1 
ATOM   3476  C  CB  . VAL A 1 452  ? 5.319   -2.674  -26.565 1.00 127.74 ? 452  VAL A CB  1 
ATOM   3477  C  CG1 . VAL A 1 452  ? 6.219   -3.291  -27.622 1.00 131.14 ? 452  VAL A CG1 1 
ATOM   3478  C  CG2 . VAL A 1 452  ? 4.028   -2.199  -27.204 1.00 129.35 ? 452  VAL A CG2 1 
ATOM   3479  N  N   . ASP A 1 453  ? 6.977   -5.135  -25.341 1.00 131.89 ? 453  ASP A N   1 
ATOM   3480  C  CA  . ASP A 1 453  ? 8.205   -5.709  -24.805 1.00 131.71 ? 453  ASP A CA  1 
ATOM   3481  C  C   . ASP A 1 453  ? 9.317   -5.739  -25.859 1.00 132.76 ? 453  ASP A C   1 
ATOM   3482  O  O   . ASP A 1 453  ? 10.455  -6.093  -25.551 1.00 132.67 ? 453  ASP A O   1 
ATOM   3483  C  CB  . ASP A 1 453  ? 7.948   -7.080  -24.168 1.00 136.01 ? 453  ASP A CB  1 
ATOM   3484  C  CG  . ASP A 1 453  ? 7.484   -8.154  -25.142 1.00 143.28 ? 453  ASP A CG  1 
ATOM   3485  O  OD1 . ASP A 1 453  ? 8.108   -8.291  -26.217 1.00 145.97 ? 453  ASP A OD1 1 
ATOM   3486  O  OD2 . ASP A 1 453  ? 6.509   -8.861  -24.811 1.00 146.77 ? 453  ASP A OD2 1 
ATOM   3487  N  N   . ASP A 1 454  ? 8.980   -5.358  -27.098 1.00 133.76 ? 454  ASP A N   1 
ATOM   3488  C  CA  . ASP A 1 454  ? 9.884   -5.489  -28.231 1.00 135.92 ? 454  ASP A CA  1 
ATOM   3489  C  C   . ASP A 1 454  ? 10.381  -4.119  -28.697 1.00 131.97 ? 454  ASP A C   1 
ATOM   3490  O  O   . ASP A 1 454  ? 10.977  -4.006  -29.767 1.00 134.06 ? 454  ASP A O   1 
ATOM   3491  C  CB  . ASP A 1 454  ? 9.267   -6.336  -29.353 1.00 141.82 ? 454  ASP A CB  1 
ATOM   3492  C  CG  . ASP A 1 454  ? 7.840   -5.973  -29.742 1.00 141.88 ? 454  ASP A CG  1 
ATOM   3493  O  OD1 . ASP A 1 454  ? 7.525   -4.769  -29.811 1.00 137.79 ? 454  ASP A OD1 1 
ATOM   3494  O  OD2 . ASP A 1 454  ? 7.054   -6.907  -29.993 1.00 146.04 ? 454  ASP A OD2 1 
ATOM   3495  N  N   . GLN A 1 455  ? 10.128  -3.084  -27.886 1.00 126.87 ? 455  GLN A N   1 
ATOM   3496  C  CA  . GLN A 1 455  ? 10.690  -1.757  -28.096 1.00 123.23 ? 455  GLN A CA  1 
ATOM   3497  C  C   . GLN A 1 455  ? 11.361  -1.294  -26.803 1.00 118.74 ? 455  GLN A C   1 
ATOM   3498  O  O   . GLN A 1 455  ? 11.085  -1.835  -25.733 1.00 119.09 ? 455  GLN A O   1 
ATOM   3499  C  CB  . GLN A 1 455  ? 9.610   -0.767  -28.546 1.00 122.18 ? 455  GLN A CB  1 
ATOM   3500  C  CG  . GLN A 1 455  ? 8.995   -1.081  -29.907 1.00 127.67 ? 455  GLN A CG  1 
ATOM   3501  C  CD  . GLN A 1 455  ? 9.980   -1.045  -31.052 1.00 130.49 ? 455  GLN A CD  1 
ATOM   3502  O  OE1 . GLN A 1 455  ? 10.880  -0.207  -31.107 1.00 128.14 ? 455  GLN A OE1 1 
ATOM   3503  N  NE2 . GLN A 1 455  ? 9.803   -1.963  -31.989 1.00 136.16 ? 455  GLN A NE2 1 
ATOM   3504  N  N   . GLN A 1 456  ? 12.244  -0.291  -26.905 1.00 115.24 ? 456  GLN A N   1 
ATOM   3505  C  CA  . GLN A 1 456  ? 12.910  0.255   -25.731 1.00 110.60 ? 456  GLN A CA  1 
ATOM   3506  C  C   . GLN A 1 456  ? 11.990  1.259   -25.038 1.00 105.95 ? 456  GLN A C   1 
ATOM   3507  O  O   . GLN A 1 456  ? 11.520  2.205   -25.668 1.00 104.00 ? 456  GLN A O   1 
ATOM   3508  C  CB  . GLN A 1 456  ? 14.251  0.899   -26.100 1.00 109.23 ? 456  GLN A CB  1 
ATOM   3509  C  CG  . GLN A 1 456  ? 15.023  1.401   -24.884 1.00 105.80 ? 456  GLN A CG  1 
ATOM   3510  C  CD  . GLN A 1 456  ? 16.402  1.956   -25.155 1.00 105.65 ? 456  GLN A CD  1 
ATOM   3511  O  OE1 . GLN A 1 456  ? 17.066  2.470   -24.255 1.00 102.81 ? 456  GLN A OE1 1 
ATOM   3512  N  NE2 . GLN A 1 456  ? 16.844  1.870   -26.401 1.00 108.59 ? 456  GLN A NE2 1 
ATOM   3513  N  N   . THR A 1 457  ? 11.754  1.046   -23.735 1.00 104.11 ? 457  THR A N   1 
ATOM   3514  C  CA  . THR A 1 457  ? 10.999  1.979   -22.912 1.00 100.54 ? 457  THR A CA  1 
ATOM   3515  C  C   . THR A 1 457  ? 11.895  3.158   -22.541 1.00 96.84  ? 457  THR A C   1 
ATOM   3516  O  O   . THR A 1 457  ? 13.028  2.968   -22.103 1.00 96.60  ? 457  THR A O   1 
ATOM   3517  C  CB  . THR A 1 457  ? 10.414  1.303   -21.664 1.00 100.89 ? 457  THR A CB  1 
ATOM   3518  O  OG1 . THR A 1 457  ? 9.529   0.271   -22.100 1.00 106.79 ? 457  THR A OG1 1 
ATOM   3519  C  CG2 . THR A 1 457  ? 9.651   2.255   -20.769 1.00 96.46  ? 457  THR A CG2 1 
ATOM   3520  N  N   . PHE A 1 458  ? 11.367  4.373   -22.732 1.00 94.53  ? 458  PHE A N   1 
ATOM   3521  C  CA  . PHE A 1 458  ? 12.077  5.609   -22.440 1.00 90.49  ? 458  PHE A CA  1 
ATOM   3522  C  C   . PHE A 1 458  ? 11.495  6.240   -21.177 1.00 87.02  ? 458  PHE A C   1 
ATOM   3523  O  O   . PHE A 1 458  ? 12.148  7.057   -20.534 1.00 84.88  ? 458  PHE A O   1 
ATOM   3524  C  CB  . PHE A 1 458  ? 11.935  6.610   -23.591 1.00 91.91  ? 458  PHE A CB  1 
ATOM   3525  C  CG  . PHE A 1 458  ? 12.729  6.339   -24.847 1.00 95.70  ? 458  PHE A CG  1 
ATOM   3526  C  CD1 . PHE A 1 458  ? 13.011  5.045   -25.269 1.00 100.26 ? 458  PHE A CD1 1 
ATOM   3527  C  CD2 . PHE A 1 458  ? 13.153  7.393   -25.644 1.00 94.99  ? 458  PHE A CD2 1 
ATOM   3528  C  CE1 . PHE A 1 458  ? 13.726  4.816   -26.438 1.00 103.03 ? 458  PHE A CE1 1 
ATOM   3529  C  CE2 . PHE A 1 458  ? 13.863  7.164   -26.814 1.00 97.79  ? 458  PHE A CE2 1 
ATOM   3530  C  CZ  . PHE A 1 458  ? 14.151  5.876   -27.208 1.00 101.75 ? 458  PHE A CZ  1 
ATOM   3531  N  N   . PHE A 1 459  ? 10.244  5.884   -20.864 1.00 86.86  ? 459  PHE A N   1 
ATOM   3532  C  CA  . PHE A 1 459  ? 9.610   6.202   -19.594 1.00 84.67  ? 459  PHE A CA  1 
ATOM   3533  C  C   . PHE A 1 459  ? 8.384   5.314   -19.426 1.00 87.03  ? 459  PHE A C   1 
ATOM   3534  O  O   . PHE A 1 459  ? 7.769   4.931   -20.417 1.00 89.74  ? 459  PHE A O   1 
ATOM   3535  C  CB  . PHE A 1 459  ? 9.175   7.669   -19.527 1.00 81.65  ? 459  PHE A CB  1 
ATOM   3536  C  CG  . PHE A 1 459  ? 8.518   8.058   -18.225 1.00 80.48  ? 459  PHE A CG  1 
ATOM   3537  C  CD1 . PHE A 1 459  ? 9.276   8.502   -17.152 1.00 78.38  ? 459  PHE A CD1 1 
ATOM   3538  C  CD2 . PHE A 1 459  ? 7.141   7.971   -18.063 1.00 81.93  ? 459  PHE A CD2 1 
ATOM   3539  C  CE1 . PHE A 1 459  ? 8.672   8.855   -15.952 1.00 78.18  ? 459  PHE A CE1 1 
ATOM   3540  C  CE2 . PHE A 1 459  ? 6.537   8.315   -16.861 1.00 81.25  ? 459  PHE A CE2 1 
ATOM   3541  C  CZ  . PHE A 1 459  ? 7.304   8.761   -15.808 1.00 79.58  ? 459  PHE A CZ  1 
ATOM   3542  N  N   . CYS A 1 460  ? 8.046   4.995   -18.169 1.00 86.86  ? 460  CYS A N   1 
ATOM   3543  C  CA  . CYS A 1 460  ? 6.745   4.425   -17.854 1.00 89.43  ? 460  CYS A CA  1 
ATOM   3544  C  C   . CYS A 1 460  ? 6.397   4.659   -16.383 1.00 87.84  ? 460  CYS A C   1 
ATOM   3545  O  O   . CYS A 1 460  ? 7.264   5.043   -15.594 1.00 84.31  ? 460  CYS A O   1 
ATOM   3546  C  CB  . CYS A 1 460  ? 6.684   2.946   -18.211 1.00 94.11  ? 460  CYS A CB  1 
ATOM   3547  S  SG  . CYS A 1 460  ? 7.555   1.904   -17.020 1.00 98.59  ? 460  CYS A SG  1 
ATOM   3548  N  N   . GLY A 1 461  ? 5.112   4.438   -16.042 1.00 89.33  ? 461  GLY A N   1 
ATOM   3549  C  CA  . GLY A 1 461  ? 4.624   4.533   -14.671 1.00 89.44  ? 461  GLY A CA  1 
ATOM   3550  C  C   . GLY A 1 461  ? 3.210   5.105   -14.551 1.00 90.02  ? 461  GLY A C   1 
ATOM   3551  O  O   . GLY A 1 461  ? 2.515   5.263   -15.551 1.00 91.22  ? 461  GLY A O   1 
ATOM   3552  N  N   . ASN A 1 462  ? 2.823   5.445   -13.309 1.00 90.42  ? 462  ASN A N   1 
ATOM   3553  C  CA  . ASN A 1 462  ? 1.470   5.817   -12.907 1.00 92.90  ? 462  ASN A CA  1 
ATOM   3554  C  C   . ASN A 1 462  ? 1.120   7.231   -13.371 1.00 91.07  ? 462  ASN A C   1 
ATOM   3555  O  O   . ASN A 1 462  ? 1.905   8.154   -13.172 1.00 89.07  ? 462  ASN A O   1 
ATOM   3556  C  CB  . ASN A 1 462  ? 1.303   5.727   -11.386 1.00 93.85  ? 462  ASN A CB  1 
ATOM   3557  C  CG  . ASN A 1 462  ? 1.236   4.301   -10.877 1.00 97.12  ? 462  ASN A CG  1 
ATOM   3558  O  OD1 . ASN A 1 462  ? 2.257   3.694   -10.558 1.00 97.03  ? 462  ASN A OD1 1 
ATOM   3559  N  ND2 . ASN A 1 462  ? 0.038   3.743   -10.818 1.00 99.84  ? 462  ASN A ND2 1 
ATOM   3560  N  N   . VAL A 1 463  ? -0.078  7.396   -13.953 1.00 93.25  ? 463  VAL A N   1 
ATOM   3561  C  CA  . VAL A 1 463  ? -0.556  8.691   -14.422 1.00 92.70  ? 463  VAL A CA  1 
ATOM   3562  C  C   . VAL A 1 463  ? -1.938  8.986   -13.835 1.00 96.60  ? 463  VAL A C   1 
ATOM   3563  O  O   . VAL A 1 463  ? -2.401  8.278   -12.942 1.00 100.35 ? 463  VAL A O   1 
ATOM   3564  C  CB  . VAL A 1 463  ? -0.559  8.806   -15.962 1.00 92.60  ? 463  VAL A CB  1 
ATOM   3565  C  CG1 . VAL A 1 463  ? 0.839   8.747   -16.556 1.00 89.51  ? 463  VAL A CG1 1 
ATOM   3566  C  CG2 . VAL A 1 463  ? -1.495  7.816   -16.642 1.00 95.88  ? 463  VAL A CG2 1 
ATOM   3567  N  N   . ALA A 1 464  ? -2.588  10.030  -14.371 1.00 97.21  ? 464  ALA A N   1 
ATOM   3568  C  CA  . ALA A 1 464  ? -3.872  10.527  -13.900 1.00 100.13 ? 464  ALA A CA  1 
ATOM   3569  C  C   . ALA A 1 464  ? -5.002  9.568   -14.273 1.00 104.09 ? 464  ALA A C   1 
ATOM   3570  O  O   . ALA A 1 464  ? -4.865  8.783   -15.210 1.00 104.92 ? 464  ALA A O   1 
ATOM   3571  C  CB  . ALA A 1 464  ? -4.117  11.903  -14.469 1.00 99.80  ? 464  ALA A CB  1 
ATOM   3572  N  N   . HIS A 1 465  ? -6.106  9.658   -13.516 1.00 107.41 ? 465  HIS A N   1 
ATOM   3573  C  CA  . HIS A 1 465  ? -7.352  8.931   -13.734 1.00 113.22 ? 465  HIS A CA  1 
ATOM   3574  C  C   . HIS A 1 465  ? -7.160  7.420   -13.636 1.00 114.76 ? 465  HIS A C   1 
ATOM   3575  O  O   . HIS A 1 465  ? -7.807  6.672   -14.363 1.00 117.89 ? 465  HIS A O   1 
ATOM   3576  C  CB  . HIS A 1 465  ? -8.010  9.329   -15.062 1.00 115.84 ? 465  HIS A CB  1 
ATOM   3577  C  CG  . HIS A 1 465  ? -7.983  10.796  -15.308 1.00 115.55 ? 465  HIS A CG  1 
ATOM   3578  N  ND1 . HIS A 1 465  ? -8.804  11.671  -14.626 1.00 117.86 ? 465  HIS A ND1 1 
ATOM   3579  C  CD2 . HIS A 1 465  ? -7.223  11.547  -16.135 1.00 113.47 ? 465  HIS A CD2 1 
ATOM   3580  C  CE1 . HIS A 1 465  ? -8.558  12.901  -15.030 1.00 116.89 ? 465  HIS A CE1 1 
ATOM   3581  N  NE2 . HIS A 1 465  ? -7.585  12.853  -15.953 1.00 113.81 ? 465  HIS A NE2 1 
ATOM   3582  N  N   . GLN A 1 466  ? -6.286  6.982   -12.721 1.00 113.55 ? 466  GLN A N   1 
ATOM   3583  C  CA  . GLN A 1 466  ? -6.017  5.571   -12.478 1.00 114.36 ? 466  GLN A CA  1 
ATOM   3584  C  C   . GLN A 1 466  ? -5.632  4.864   -13.777 1.00 113.49 ? 466  GLN A C   1 
ATOM   3585  O  O   . GLN A 1 466  ? -6.119  3.774   -14.069 1.00 115.65 ? 466  GLN A O   1 
ATOM   3586  C  CB  . GLN A 1 466  ? -7.193  4.903   -11.764 1.00 119.18 ? 466  GLN A CB  1 
ATOM   3587  C  CG  . GLN A 1 466  ? -7.032  4.875   -10.251 1.00 120.59 ? 466  GLN A CG  1 
ATOM   3588  C  CD  . GLN A 1 466  ? -8.366  4.816   -9.546  1.00 126.50 ? 466  GLN A CD  1 
ATOM   3589  O  OE1 . GLN A 1 466  ? -9.235  5.658   -9.763  1.00 129.44 ? 466  GLN A OE1 1 
ATOM   3590  N  NE2 . GLN A 1 466  ? -8.541  3.820   -8.690  1.00 129.17 ? 466  GLN A NE2 1 
ATOM   3591  N  N   . GLN A 1 467  ? -4.729  5.500   -14.532 1.00 109.53 ? 467  GLN A N   1 
ATOM   3592  C  CA  . GLN A 1 467  ? -4.197  4.938   -15.762 1.00 109.11 ? 467  GLN A CA  1 
ATOM   3593  C  C   . GLN A 1 467  ? -2.682  4.756   -15.625 1.00 106.44 ? 467  GLN A C   1 
ATOM   3594  O  O   . GLN A 1 467  ? -2.069  5.263   -14.683 1.00 103.48 ? 467  GLN A O   1 
ATOM   3595  C  CB  . GLN A 1 467  ? -4.544  5.849   -16.939 1.00 107.66 ? 467  GLN A CB  1 
ATOM   3596  C  CG  . GLN A 1 467  ? -5.984  6.326   -16.941 1.00 109.42 ? 467  GLN A CG  1 
ATOM   3597  C  CD  . GLN A 1 467  ? -6.211  7.251   -18.106 1.00 109.27 ? 467  GLN A CD  1 
ATOM   3598  O  OE1 . GLN A 1 467  ? -6.436  6.813   -19.232 1.00 111.72 ? 467  GLN A OE1 1 
ATOM   3599  N  NE2 . GLN A 1 467  ? -6.143  8.543   -17.835 1.00 107.00 ? 467  GLN A NE2 1 
ATOM   3600  N  N   . LEU A 1 468  ? -2.090  4.010   -16.572 1.00 106.91 ? 468  LEU A N   1 
ATOM   3601  C  CA  . LEU A 1 468  ? -0.651  3.798   -16.653 1.00 103.49 ? 468  LEU A CA  1 
ATOM   3602  C  C   . LEU A 1 468  ? -0.159  4.228   -18.034 1.00 102.01 ? 468  LEU A C   1 
ATOM   3603  O  O   . LEU A 1 468  ? -0.935  4.260   -18.988 1.00 103.92 ? 468  LEU A O   1 
ATOM   3604  C  CB  . LEU A 1 468  ? -0.336  2.315   -16.413 1.00 106.66 ? 468  LEU A CB  1 
ATOM   3605  C  CG  . LEU A 1 468  ? -0.668  1.760   -15.028 1.00 108.45 ? 468  LEU A CG  1 
ATOM   3606  C  CD1 . LEU A 1 468  ? -0.333  0.276   -14.953 1.00 111.47 ? 468  LEU A CD1 1 
ATOM   3607  C  CD2 . LEU A 1 468  ? 0.063   2.529   -13.937 1.00 104.29 ? 468  LEU A CD2 1 
ATOM   3608  N  N   . ILE A 1 469  ? 1.142   4.537   -18.139 1.00 98.88  ? 469  ILE A N   1 
ATOM   3609  C  CA  . ILE A 1 469  ? 1.723   4.966   -19.406 1.00 97.61  ? 469  ILE A CA  1 
ATOM   3610  C  C   . ILE A 1 469  ? 3.032   4.232   -19.701 1.00 96.57  ? 469  ILE A C   1 
ATOM   3611  O  O   . ILE A 1 469  ? 3.769   3.862   -18.791 1.00 94.79  ? 469  ILE A O   1 
ATOM   3612  C  CB  . ILE A 1 469  ? 1.906   6.500   -19.470 1.00 93.75  ? 469  ILE A CB  1 
ATOM   3613  C  CG1 . ILE A 1 469  ? 2.143   6.987   -20.903 1.00 93.23  ? 469  ILE A CG1 1 
ATOM   3614  C  CG2 . ILE A 1 469  ? 3.009   6.970   -18.532 1.00 89.34  ? 469  ILE A CG2 1 
ATOM   3615  C  CD1 . ILE A 1 469  ? 1.777   8.436   -21.126 1.00 91.35  ? 469  ILE A CD1 1 
ATOM   3616  N  N   . GLN A 1 470  ? 3.305   4.054   -20.999 1.00 97.46  ? 470  GLN A N   1 
ATOM   3617  C  CA  . GLN A 1 470  ? 4.582   3.568   -21.489 1.00 97.30  ? 470  GLN A CA  1 
ATOM   3618  C  C   . GLN A 1 470  ? 4.939   4.338   -22.755 1.00 96.71  ? 470  GLN A C   1 
ATOM   3619  O  O   . GLN A 1 470  ? 4.185   4.329   -23.720 1.00 98.99  ? 470  GLN A O   1 
ATOM   3620  C  CB  . GLN A 1 470  ? 4.522   2.066   -21.766 1.00 101.96 ? 470  GLN A CB  1 
ATOM   3621  C  CG  . GLN A 1 470  ? 5.871   1.474   -22.155 1.00 103.57 ? 470  GLN A CG  1 
ATOM   3622  C  CD  . GLN A 1 470  ? 5.768   0.139   -22.855 1.00 109.26 ? 470  GLN A CD  1 
ATOM   3623  O  OE1 . GLN A 1 470  ? 4.829   -0.127  -23.603 1.00 112.80 ? 470  GLN A OE1 1 
ATOM   3624  N  NE2 . GLN A 1 470  ? 6.751   -0.718  -22.624 1.00 110.59 ? 470  GLN A NE2 1 
ATOM   3625  N  N   . ILE A 1 471  ? 6.096   5.009   -22.727 1.00 95.21  ? 471  ILE A N   1 
ATOM   3626  C  CA  . ILE A 1 471  ? 6.626   5.733   -23.874 1.00 95.29  ? 471  ILE A CA  1 
ATOM   3627  C  C   . ILE A 1 471  ? 7.843   4.978   -24.400 1.00 97.61  ? 471  ILE A C   1 
ATOM   3628  O  O   . ILE A 1 471  ? 8.848   4.860   -23.701 1.00 95.46  ? 471  ILE A O   1 
ATOM   3629  C  CB  . ILE A 1 471  ? 7.008   7.184   -23.506 1.00 90.02  ? 471  ILE A CB  1 
ATOM   3630  C  CG1 . ILE A 1 471  ? 5.922   7.885   -22.686 1.00 88.80  ? 471  ILE A CG1 1 
ATOM   3631  C  CG2 . ILE A 1 471  ? 7.370   7.976   -24.755 1.00 89.82  ? 471  ILE A CG2 1 
ATOM   3632  C  CD1 . ILE A 1 471  ? 6.406   9.092   -21.910 1.00 84.74  ? 471  ILE A CD1 1 
ATOM   3633  N  N   . THR A 1 472  ? 7.750   4.491   -25.642 1.00 102.12 ? 472  THR A N   1 
ATOM   3634  C  CA  . THR A 1 472  ? 8.871   3.815   -26.273 1.00 105.02 ? 472  THR A CA  1 
ATOM   3635  C  C   . THR A 1 472  ? 9.426   4.688   -27.396 1.00 105.19 ? 472  THR A C   1 
ATOM   3636  O  O   . THR A 1 472  ? 9.078   5.863   -27.499 1.00 104.51 ? 472  THR A O   1 
ATOM   3637  C  CB  . THR A 1 472  ? 8.466   2.422   -26.767 1.00 110.68 ? 472  THR A CB  1 
ATOM   3638  O  OG1 . THR A 1 472  ? 7.792   2.580   -28.018 1.00 114.16 ? 472  THR A OG1 1 
ATOM   3639  C  CG2 . THR A 1 472  ? 7.607   1.671   -25.771 1.00 111.62 ? 472  THR A CG2 1 
ATOM   3640  N  N   . SER A 1 473  ? 10.284  4.100   -28.238 1.00 107.02 ? 473  SER A N   1 
ATOM   3641  C  CA  . SER A 1 473  ? 10.850  4.812   -29.372 1.00 106.63 ? 473  SER A CA  1 
ATOM   3642  C  C   . SER A 1 473  ? 9.818   4.922   -30.492 1.00 109.58 ? 473  SER A C   1 
ATOM   3643  O  O   . SER A 1 473  ? 10.038  5.642   -31.462 1.00 110.57 ? 473  SER A O   1 
ATOM   3644  C  CB  . SER A 1 473  ? 12.107  4.145   -29.855 1.00 108.72 ? 473  SER A CB  1 
ATOM   3645  O  OG  . SER A 1 473  ? 11.831  2.822   -30.289 1.00 113.64 ? 473  SER A OG  1 
ATOM   3646  N  N   . ALA A 1 474  ? 8.688   4.218   -30.332 1.00 111.32 ? 474  ALA A N   1 
ATOM   3647  C  CA  . ALA A 1 474  ? 7.695   4.074   -31.386 1.00 114.89 ? 474  ALA A CA  1 
ATOM   3648  C  C   . ALA A 1 474  ? 6.435   4.885   -31.085 1.00 113.06 ? 474  ALA A C   1 
ATOM   3649  O  O   . ALA A 1 474  ? 5.899   5.538   -31.979 1.00 114.17 ? 474  ALA A O   1 
ATOM   3650  C  CB  . ALA A 1 474  ? 7.375   2.614   -31.592 1.00 119.22 ? 474  ALA A CB  1 
ATOM   3651  N  N   . SER A 1 475  ? 5.957   4.821   -29.833 1.00 110.64 ? 475  SER A N   1 
ATOM   3652  C  CA  . SER A 1 475  ? 4.666   5.396   -29.483 1.00 109.80 ? 475  SER A CA  1 
ATOM   3653  C  C   . SER A 1 475  ? 4.558   5.684   -27.987 1.00 105.72 ? 475  SER A C   1 
ATOM   3654  O  O   . SER A 1 475  ? 5.364   5.212   -27.184 1.00 103.66 ? 475  SER A O   1 
ATOM   3655  C  CB  . SER A 1 475  ? 3.545   4.488   -29.909 1.00 114.64 ? 475  SER A CB  1 
ATOM   3656  O  OG  . SER A 1 475  ? 3.328   3.480   -28.930 1.00 115.36 ? 475  SER A OG  1 
ATOM   3657  N  N   . VAL A 1 476  ? 3.516   6.455   -27.648 1.00 104.76 ? 476  VAL A N   1 
ATOM   3658  C  CA  . VAL A 1 476  ? 3.066   6.695   -26.286 1.00 101.99 ? 476  VAL A CA  1 
ATOM   3659  C  C   . VAL A 1 476  ? 1.796   5.872   -26.064 1.00 104.80 ? 476  VAL A C   1 
ATOM   3660  O  O   . VAL A 1 476  ? 0.825   6.029   -26.800 1.00 107.91 ? 476  VAL A O   1 
ATOM   3661  C  CB  . VAL A 1 476  ? 2.805   8.198   -26.053 1.00 99.28  ? 476  VAL A CB  1 
ATOM   3662  C  CG1 . VAL A 1 476  ? 2.430   8.500   -24.611 1.00 96.65  ? 476  VAL A CG1 1 
ATOM   3663  C  CG2 . VAL A 1 476  ? 3.981   9.057   -26.491 1.00 96.79  ? 476  VAL A CG2 1 
ATOM   3664  N  N   . ARG A 1 477  ? 1.806   5.010   -25.037 1.00 104.11 ? 477  ARG A N   1 
ATOM   3665  C  CA  . ARG A 1 477  ? 0.716   4.080   -24.777 1.00 106.94 ? 477  ARG A CA  1 
ATOM   3666  C  C   . ARG A 1 477  ? 0.049   4.389   -23.439 1.00 105.09 ? 477  ARG A C   1 
ATOM   3667  O  O   . ARG A 1 477  ? 0.672   4.280   -22.386 1.00 102.27 ? 477  ARG A O   1 
ATOM   3668  C  CB  . ARG A 1 477  ? 1.232   2.639   -24.734 1.00 109.14 ? 477  ARG A CB  1 
ATOM   3669  C  CG  . ARG A 1 477  ? 1.832   2.143   -26.040 1.00 112.00 ? 477  ARG A CG  1 
ATOM   3670  C  CD  . ARG A 1 477  ? 2.486   0.785   -25.870 1.00 114.45 ? 477  ARG A CD  1 
ATOM   3671  N  NE  . ARG A 1 477  ? 1.549   -0.331  -25.873 1.00 119.39 ? 477  ARG A NE  1 
ATOM   3672  C  CZ  . ARG A 1 477  ? 1.077   -0.921  -26.968 1.00 124.71 ? 477  ARG A CZ  1 
ATOM   3673  N  NH1 . ARG A 1 477  ? 1.444   -0.496  -28.166 1.00 125.57 ? 477  ARG A NH1 1 
ATOM   3674  N  NH2 . ARG A 1 477  ? 0.235   -1.932  -26.862 1.00 129.65 ? 477  ARG A NH2 1 
ATOM   3675  N  N   . LEU A 1 478  ? -1.238  4.745   -23.492 1.00 106.85 ? 478  LEU A N   1 
ATOM   3676  C  CA  . LEU A 1 478  ? -2.025  4.920   -22.284 1.00 106.57 ? 478  LEU A CA  1 
ATOM   3677  C  C   . LEU A 1 478  ? -2.765  3.617   -21.987 1.00 111.49 ? 478  LEU A C   1 
ATOM   3678  O  O   . LEU A 1 478  ? -3.400  3.037   -22.866 1.00 115.31 ? 478  LEU A O   1 
ATOM   3679  C  CB  . LEU A 1 478  ? -2.991  6.091   -22.493 1.00 106.02 ? 478  LEU A CB  1 
ATOM   3680  C  CG  . LEU A 1 478  ? -3.665  6.641   -21.238 1.00 104.44 ? 478  LEU A CG  1 
ATOM   3681  C  CD1 . LEU A 1 478  ? -2.635  7.058   -20.199 1.00 99.64  ? 478  LEU A CD1 1 
ATOM   3682  C  CD2 . LEU A 1 478  ? -4.566  7.813   -21.594 1.00 104.79 ? 478  LEU A CD2 1 
ATOM   3683  N  N   . VAL A 1 479  ? -2.658  3.159   -20.736 1.00 111.44 ? 479  VAL A N   1 
ATOM   3684  C  CA  . VAL A 1 479  ? -3.188  1.865   -20.337 1.00 115.61 ? 479  VAL A CA  1 
ATOM   3685  C  C   . VAL A 1 479  ? -4.062  2.045   -19.097 1.00 116.28 ? 479  VAL A C   1 
ATOM   3686  O  O   . VAL A 1 479  ? -3.676  2.727   -18.151 1.00 113.38 ? 479  VAL A O   1 
ATOM   3687  C  CB  . VAL A 1 479  ? -2.054  0.846   -20.108 1.00 115.53 ? 479  VAL A CB  1 
ATOM   3688  C  CG1 . VAL A 1 479  ? -2.560  -0.450  -19.491 1.00 119.72 ? 479  VAL A CG1 1 
ATOM   3689  C  CG2 . VAL A 1 479  ? -1.286  0.565   -21.392 1.00 115.93 ? 479  VAL A CG2 1 
ATOM   3690  N  N   . SER A 1 480  ? -5.250  1.432   -19.116 1.00 120.91 ? 480  SER A N   1 
ATOM   3691  C  CA  . SER A 1 480  ? -6.135  1.474   -17.964 1.00 122.24 ? 480  SER A CA  1 
ATOM   3692  C  C   . SER A 1 480  ? -5.656  0.455   -16.921 1.00 122.52 ? 480  SER A C   1 
ATOM   3693  O  O   . SER A 1 480  ? -6.110  0.547   -15.762 1.00 122.87 ? 480  SER A O   1 
ATOM   3694  C  CB  . SER A 1 480  ? -7.571  1.250   -18.364 1.00 126.95 ? 480  SER A CB  1 
ATOM   3695  O  OG  . SER A 1 480  ? -7.751  -0.061  -18.877 1.00 132.53 ? 480  SER A OG  1 
ATOM   3696  N  N   . PRO A 1 483  ? -8.145  -3.578  -14.538 1.00 138.99 ? 483  PRO A N   1 
ATOM   3697  C  CA  . PRO A 1 483  ? -8.422  -3.960  -15.932 1.00 142.31 ? 483  PRO A CA  1 
ATOM   3698  C  C   . PRO A 1 483  ? -7.458  -3.261  -16.893 1.00 138.54 ? 483  PRO A C   1 
ATOM   3699  O  O   . PRO A 1 483  ? -7.672  -2.109  -17.267 1.00 136.71 ? 483  PRO A O   1 
ATOM   3700  C  CB  . PRO A 1 483  ? -9.883  -3.533  -16.149 1.00 144.96 ? 483  PRO A CB  1 
ATOM   3701  C  CG  . PRO A 1 483  ? -10.081 -2.357  -15.208 1.00 141.63 ? 483  PRO A CG  1 
ATOM   3702  C  CD  . PRO A 1 483  ? -8.954  -2.406  -14.189 1.00 137.74 ? 483  PRO A CD  1 
ATOM   3703  N  N   . LYS A 1 484  ? -6.398  -3.977  -17.294 1.00 138.05 ? 484  LYS A N   1 
ATOM   3704  C  CA  . LYS A 1 484  ? -5.271  -3.385  -18.001 1.00 133.21 ? 484  LYS A CA  1 
ATOM   3705  C  C   . LYS A 1 484  ? -5.378  -3.610  -19.507 1.00 135.71 ? 484  LYS A C   1 
ATOM   3706  O  O   . LYS A 1 484  ? -5.290  -4.741  -19.985 1.00 140.06 ? 484  LYS A O   1 
ATOM   3707  C  CB  . LYS A 1 484  ? -3.951  -3.940  -17.460 1.00 131.26 ? 484  LYS A CB  1 
ATOM   3708  C  CG  . LYS A 1 484  ? -3.349  -3.127  -16.325 1.00 127.24 ? 484  LYS A CG  1 
ATOM   3709  C  CD  . LYS A 1 484  ? -2.333  -3.880  -15.498 1.00 126.97 ? 484  LYS A CD  1 
ATOM   3710  C  CE  . LYS A 1 484  ? -1.850  -3.083  -14.304 1.00 123.10 ? 484  LYS A CE  1 
ATOM   3711  N  NZ  . LYS A 1 484  ? -2.970  -2.534  -13.502 1.00 124.39 ? 484  LYS A NZ  1 
ATOM   3712  N  N   . ALA A 1 485  ? -5.534  -2.503  -20.241 1.00 133.14 ? 485  ALA A N   1 
ATOM   3713  C  CA  . ALA A 1 485  ? -5.667  -2.529  -21.687 1.00 135.23 ? 485  ALA A CA  1 
ATOM   3714  C  C   . ALA A 1 485  ? -5.143  -1.220  -22.270 1.00 130.48 ? 485  ALA A C   1 
ATOM   3715  O  O   . ALA A 1 485  ? -5.074  -0.206  -21.580 1.00 126.15 ? 485  ALA A O   1 
ATOM   3716  C  CB  . ALA A 1 485  ? -7.109  -2.769  -22.071 1.00 140.42 ? 485  ALA A CB  1 
ATOM   3717  N  N   . LEU A 1 486  ? -4.763  -1.273  -23.549 1.00 131.55 ? 486  LEU A N   1 
ATOM   3718  C  CA  . LEU A 1 486  ? -4.417  -0.090  -24.317 1.00 128.78 ? 486  LEU A CA  1 
ATOM   3719  C  C   . LEU A 1 486  ? -5.685  0.726   -24.554 1.00 131.10 ? 486  LEU A C   1 
ATOM   3720  O  O   . LEU A 1 486  ? -6.645  0.232   -25.144 1.00 137.80 ? 486  LEU A O   1 
ATOM   3721  C  CB  . LEU A 1 486  ? -3.785  -0.561  -25.631 1.00 130.36 ? 486  LEU A CB  1 
ATOM   3722  C  CG  . LEU A 1 486  ? -3.245  0.529   -26.554 1.00 127.62 ? 486  LEU A CG  1 
ATOM   3723  C  CD1 . LEU A 1 486  ? -2.149  1.328   -25.863 1.00 122.43 ? 486  LEU A CD1 1 
ATOM   3724  C  CD2 . LEU A 1 486  ? -2.725  -0.084  -27.845 1.00 130.68 ? 486  LEU A CD2 1 
ATOM   3725  N  N   . VAL A 1 487  ? -5.679  1.976   -24.081 1.00 127.39 ? 487  VAL A N   1 
ATOM   3726  C  CA  . VAL A 1 487  ? -6.873  2.803   -24.123 1.00 129.56 ? 487  VAL A CA  1 
ATOM   3727  C  C   . VAL A 1 487  ? -6.630  4.049   -24.982 1.00 128.26 ? 487  VAL A C   1 
ATOM   3728  O  O   . VAL A 1 487  ? -7.579  4.731   -25.368 1.00 130.63 ? 487  VAL A O   1 
ATOM   3729  C  CB  . VAL A 1 487  ? -7.390  3.109   -22.702 1.00 127.85 ? 487  VAL A CB  1 
ATOM   3730  C  CG1 . VAL A 1 487  ? -6.581  4.187   -21.992 1.00 121.80 ? 487  VAL A CG1 1 
ATOM   3731  C  CG2 . VAL A 1 487  ? -8.877  3.417   -22.692 1.00 132.04 ? 487  VAL A CG2 1 
ATOM   3732  N  N   . SER A 1 488  ? -5.354  4.330   -25.287 1.00 124.85 ? 488  SER A N   1 
ATOM   3733  C  CA  . SER A 1 488  ? -4.973  5.361   -26.245 1.00 123.99 ? 488  SER A CA  1 
ATOM   3734  C  C   . SER A 1 488  ? -3.526  5.147   -26.688 1.00 122.75 ? 488  SER A C   1 
ATOM   3735  O  O   . SER A 1 488  ? -2.719  4.613   -25.928 1.00 121.58 ? 488  SER A O   1 
ATOM   3736  C  CB  . SER A 1 488  ? -5.176  6.753   -25.681 1.00 119.97 ? 488  SER A CB  1 
ATOM   3737  O  OG  . SER A 1 488  ? -5.082  7.740   -26.703 1.00 118.77 ? 488  SER A OG  1 
ATOM   3738  N  N   . GLU A 1 489  ? -3.208  5.577   -27.920 1.00 124.07 ? 489  GLU A N   1 
ATOM   3739  C  CA  . GLU A 1 489  ? -1.856  5.481   -28.455 1.00 121.88 ? 489  GLU A CA  1 
ATOM   3740  C  C   . GLU A 1 489  ? -1.551  6.674   -29.361 1.00 120.60 ? 489  GLU A C   1 
ATOM   3741  O  O   . GLU A 1 489  ? -2.256  6.912   -30.343 1.00 123.97 ? 489  GLU A O   1 
ATOM   3742  C  CB  . GLU A 1 489  ? -1.656  4.154   -29.191 1.00 126.48 ? 489  GLU A CB  1 
ATOM   3743  C  CG  . GLU A 1 489  ? -0.199  3.838   -29.477 1.00 125.83 ? 489  GLU A CG  1 
ATOM   3744  C  CD  . GLU A 1 489  ? 0.086   2.435   -29.988 1.00 131.63 ? 489  GLU A CD  1 
ATOM   3745  O  OE1 . GLU A 1 489  ? -0.467  1.467   -29.421 1.00 134.74 ? 489  GLU A OE1 1 
ATOM   3746  O  OE2 . GLU A 1 489  ? 0.865   2.311   -30.956 1.00 133.95 ? 489  GLU A OE2 1 
ATOM   3747  N  N   . TRP A 1 490  ? -0.484  7.413   -29.019 1.00 115.56 ? 490  TRP A N   1 
ATOM   3748  C  CA  . TRP A 1 490  ? -0.010  8.520   -29.836 1.00 114.22 ? 490  TRP A CA  1 
ATOM   3749  C  C   . TRP A 1 490  ? 1.228   8.103   -30.628 1.00 114.27 ? 490  TRP A C   1 
ATOM   3750  O  O   . TRP A 1 490  ? 2.118   7.439   -30.102 1.00 112.20 ? 490  TRP A O   1 
ATOM   3751  C  CB  . TRP A 1 490  ? 0.254   9.774   -28.991 1.00 109.02 ? 490  TRP A CB  1 
ATOM   3752  C  CG  . TRP A 1 490  ? 0.668   10.972  -29.794 1.00 108.73 ? 490  TRP A CG  1 
ATOM   3753  C  CD1 . TRP A 1 490  ? -0.133  11.986  -30.233 1.00 109.81 ? 490  TRP A CD1 1 
ATOM   3754  C  CD2 . TRP A 1 490  ? 1.997   11.293  -30.254 1.00 107.77 ? 490  TRP A CD2 1 
ATOM   3755  N  NE1 . TRP A 1 490  ? 0.599   12.908  -30.933 1.00 109.03 ? 490  TRP A NE1 1 
ATOM   3756  C  CE2 . TRP A 1 490  ? 1.910   12.513  -30.963 1.00 107.62 ? 490  TRP A CE2 1 
ATOM   3757  C  CE3 . TRP A 1 490  ? 3.250   10.678  -30.130 1.00 107.31 ? 490  TRP A CE3 1 
ATOM   3758  C  CZ2 . TRP A 1 490  ? 3.022   13.121  -31.550 1.00 106.41 ? 490  TRP A CZ2 1 
ATOM   3759  C  CZ3 . TRP A 1 490  ? 4.349   11.276  -30.713 1.00 106.22 ? 490  TRP A CZ3 1 
ATOM   3760  C  CH2 . TRP A 1 490  ? 4.234   12.481  -31.412 1.00 105.94 ? 490  TRP A CH2 1 
ATOM   3761  N  N   . LYS A 1 491  ? 1.259   8.506   -31.903 1.00 117.67 ? 491  LYS A N   1 
ATOM   3762  C  CA  . LYS A 1 491  ? 2.420   8.356   -32.763 1.00 118.65 ? 491  LYS A CA  1 
ATOM   3763  C  C   . LYS A 1 491  ? 2.674   9.678   -33.481 1.00 118.41 ? 491  LYS A C   1 
ATOM   3764  O  O   . LYS A 1 491  ? 1.767   10.495  -33.631 1.00 119.73 ? 491  LYS A O   1 
ATOM   3765  C  CB  . LYS A 1 491  ? 2.213   7.222   -33.773 1.00 124.23 ? 491  LYS A CB  1 
ATOM   3766  C  CG  . LYS A 1 491  ? 2.427   5.818   -33.227 1.00 125.50 ? 491  LYS A CG  1 
ATOM   3767  C  CD  . LYS A 1 491  ? 1.988   4.721   -34.185 1.00 131.92 ? 491  LYS A CD  1 
ATOM   3768  C  CE  . LYS A 1 491  ? 2.147   3.327   -33.612 1.00 132.78 ? 491  LYS A CE  1 
ATOM   3769  N  NZ  . LYS A 1 491  ? 1.648   2.286   -34.539 1.00 139.18 ? 491  LYS A NZ  1 
ATOM   3770  N  N   . GLU A 1 492  ? 3.926   9.879   -33.903 1.00 117.62 ? 492  GLU A N   1 
ATOM   3771  C  CA  . GLU A 1 492  ? 4.301   11.023  -34.717 1.00 117.93 ? 492  GLU A CA  1 
ATOM   3772  C  C   . GLU A 1 492  ? 3.678   10.841  -36.102 1.00 123.13 ? 492  GLU A C   1 
ATOM   3773  O  O   . GLU A 1 492  ? 3.699   9.734   -36.634 1.00 126.47 ? 492  GLU A O   1 
ATOM   3774  C  CB  . GLU A 1 492  ? 5.828   11.147  -34.731 1.00 116.91 ? 492  GLU A CB  1 
ATOM   3775  C  CG  . GLU A 1 492  ? 6.363   12.351  -35.490 1.00 118.25 ? 492  GLU A CG  1 
ATOM   3776  C  CD  . GLU A 1 492  ? 6.490   12.175  -36.997 1.00 124.94 ? 492  GLU A CD  1 
ATOM   3777  O  OE1 . GLU A 1 492  ? 6.373   11.028  -37.483 1.00 128.63 ? 492  GLU A OE1 1 
ATOM   3778  O  OE2 . GLU A 1 492  ? 6.703   13.189  -37.688 1.00 127.15 ? 492  GLU A OE2 1 
ATOM   3779  N  N   . PRO A 1 493  ? 3.095   11.905  -36.710 1.00 124.44 ? 493  PRO A N   1 
ATOM   3780  C  CA  . PRO A 1 493  ? 2.367   11.800  -37.982 1.00 130.20 ? 493  PRO A CA  1 
ATOM   3781  C  C   . PRO A 1 493  ? 2.925   10.848  -39.042 1.00 134.49 ? 493  PRO A C   1 
ATOM   3782  O  O   . PRO A 1 493  ? 2.164   10.123  -39.682 1.00 139.35 ? 493  PRO A O   1 
ATOM   3783  C  CB  . PRO A 1 493  ? 2.400   13.247  -38.499 1.00 130.00 ? 493  PRO A CB  1 
ATOM   3784  C  CG  . PRO A 1 493  ? 2.329   14.082  -37.234 1.00 124.62 ? 493  PRO A CG  1 
ATOM   3785  C  CD  . PRO A 1 493  ? 3.084   13.283  -36.188 1.00 120.84 ? 493  PRO A CD  1 
ATOM   3786  N  N   . GLN A 1 494  ? 4.254   10.853  -39.206 1.00 132.99 ? 494  GLN A N   1 
ATOM   3787  C  CA  . GLN A 1 494  ? 4.938   10.086  -40.236 1.00 137.43 ? 494  GLN A CA  1 
ATOM   3788  C  C   . GLN A 1 494  ? 5.519   8.809   -39.623 1.00 136.42 ? 494  GLN A C   1 
ATOM   3789  O  O   . GLN A 1 494  ? 6.288   8.098   -40.269 1.00 139.88 ? 494  GLN A O   1 
ATOM   3790  C  CB  . GLN A 1 494  ? 5.986   10.994  -40.888 1.00 137.67 ? 494  GLN A CB  1 
ATOM   3791  C  CG  . GLN A 1 494  ? 6.846   10.348  -41.968 1.00 142.49 ? 494  GLN A CG  1 
ATOM   3792  C  CD  . GLN A 1 494  ? 7.982   11.252  -42.388 1.00 141.79 ? 494  GLN A CD  1 
ATOM   3793  O  OE1 . GLN A 1 494  ? 8.095   12.394  -41.945 1.00 138.44 ? 494  GLN A OE1 1 
ATOM   3794  N  NE2 . GLN A 1 494  ? 8.839   10.744  -43.258 1.00 145.43 ? 494  GLN A NE2 1 
ATOM   3795  N  N   . ALA A 1 495  ? 5.128   8.522   -38.374 1.00 132.08 ? 495  ALA A N   1 
ATOM   3796  C  CA  . ALA A 1 495  ? 5.584   7.359   -37.622 1.00 130.19 ? 495  ALA A CA  1 
ATOM   3797  C  C   . ALA A 1 495  ? 7.107   7.371   -37.466 1.00 126.91 ? 495  ALA A C   1 
ATOM   3798  O  O   . ALA A 1 495  ? 7.738   6.315   -37.447 1.00 128.02 ? 495  ALA A O   1 
ATOM   3799  C  CB  . ALA A 1 495  ? 5.076   6.080   -38.254 1.00 135.17 ? 495  ALA A CB  1 
ATOM   3800  N  N   . LYS A 1 496  ? 7.689   8.573   -37.349 1.00 122.81 ? 496  LYS A N   1 
ATOM   3801  C  CA  . LYS A 1 496  ? 9.106   8.718   -37.051 1.00 120.17 ? 496  LYS A CA  1 
ATOM   3802  C  C   . LYS A 1 496  ? 9.338   8.349   -35.589 1.00 115.83 ? 496  LYS A C   1 
ATOM   3803  O  O   . LYS A 1 496  ? 8.411   8.409   -34.787 1.00 114.32 ? 496  LYS A O   1 
ATOM   3804  C  CB  . LYS A 1 496  ? 9.599   10.135  -37.370 1.00 118.10 ? 496  LYS A CB  1 
ATOM   3805  C  CG  . LYS A 1 496  ? 9.991   10.370  -38.824 1.00 122.89 ? 496  LYS A CG  1 
ATOM   3806  C  CD  . LYS A 1 496  ? 10.672  11.703  -39.091 1.00 121.03 ? 496  LYS A CD  1 
ATOM   3807  C  CE  . LYS A 1 496  ? 9.705   12.850  -39.310 1.00 120.40 ? 496  LYS A CE  1 
ATOM   3808  N  NZ  . LYS A 1 496  ? 10.266  13.886  -40.209 1.00 120.84 ? 496  LYS A NZ  1 
ATOM   3809  N  N   . ASN A 1 497  ? 10.580  7.969   -35.262 1.00 114.98 ? 497  ASN A N   1 
ATOM   3810  C  CA  . ASN A 1 497  ? 10.951  7.513   -33.929 1.00 111.65 ? 497  ASN A CA  1 
ATOM   3811  C  C   . ASN A 1 497  ? 10.913  8.672   -32.930 1.00 106.10 ? 497  ASN A C   1 
ATOM   3812  O  O   . ASN A 1 497  ? 11.326  9.786   -33.243 1.00 104.39 ? 497  ASN A O   1 
ATOM   3813  C  CB  . ASN A 1 497  ? 12.326  6.834   -33.923 1.00 112.89 ? 497  ASN A CB  1 
ATOM   3814  C  CG  . ASN A 1 497  ? 12.284  5.361   -34.277 1.00 118.07 ? 497  ASN A CG  1 
ATOM   3815  O  OD1 . ASN A 1 497  ? 11.431  4.920   -35.043 1.00 122.68 ? 497  ASN A OD1 1 
ATOM   3816  N  ND2 . ASN A 1 497  ? 13.208  4.592   -33.725 1.00 118.35 ? 497  ASN A ND2 1 
ATOM   3817  N  N   . ILE A 1 498  ? 10.402  8.390   -31.724 1.00 103.63 ? 498  ILE A N   1 
ATOM   3818  C  CA  . ILE A 1 498  ? 10.552  9.269   -30.574 1.00 99.42  ? 498  ILE A CA  1 
ATOM   3819  C  C   . ILE A 1 498  ? 11.979  9.105   -30.050 1.00 98.50  ? 498  ILE A C   1 
ATOM   3820  O  O   . ILE A 1 498  ? 12.440  7.977   -29.858 1.00 101.06 ? 498  ILE A O   1 
ATOM   3821  C  CB  . ILE A 1 498  ? 9.507   8.932   -29.489 1.00 98.46  ? 498  ILE A CB  1 
ATOM   3822  C  CG1 . ILE A 1 498  ? 8.086   9.326   -29.908 1.00 99.57  ? 498  ILE A CG1 1 
ATOM   3823  C  CG2 . ILE A 1 498  ? 9.889   9.551   -28.147 1.00 95.08  ? 498  ILE A CG2 1 
ATOM   3824  C  CD1 . ILE A 1 498  ? 6.990   8.564   -29.188 1.00 99.79  ? 498  ILE A CD1 1 
ATOM   3825  N  N   . SER A 1 499  ? 12.661  10.233  -29.803 1.00 95.15  ? 499  SER A N   1 
ATOM   3826  C  CA  . SER A 1 499  ? 14.086  10.216  -29.502 1.00 94.38  ? 499  SER A CA  1 
ATOM   3827  C  C   . SER A 1 499  ? 14.369  10.571  -28.043 1.00 90.67  ? 499  SER A C   1 
ATOM   3828  O  O   . SER A 1 499  ? 15.319  10.051  -27.461 1.00 91.05  ? 499  SER A O   1 
ATOM   3829  C  CB  . SER A 1 499  ? 14.858  11.095  -30.451 1.00 95.06  ? 499  SER A CB  1 
ATOM   3830  O  OG  . SER A 1 499  ? 14.508  12.457  -30.276 1.00 92.97  ? 499  SER A OG  1 
ATOM   3831  N  N   . VAL A 1 500  ? 13.572  11.490  -27.483 1.00 87.59  ? 500  VAL A N   1 
ATOM   3832  C  CA  . VAL A 1 500  ? 13.654  11.866  -26.078 1.00 83.99  ? 500  VAL A CA  1 
ATOM   3833  C  C   . VAL A 1 500  ? 12.228  11.907  -25.542 1.00 82.68  ? 500  VAL A C   1 
ATOM   3834  O  O   . VAL A 1 500  ? 11.299  12.179  -26.300 1.00 83.66  ? 500  VAL A O   1 
ATOM   3835  C  CB  . VAL A 1 500  ? 14.371  13.220  -25.877 1.00 81.63  ? 500  VAL A CB  1 
ATOM   3836  C  CG1 . VAL A 1 500  ? 14.582  13.553  -24.404 1.00 78.45  ? 500  VAL A CG1 1 
ATOM   3837  C  CG2 . VAL A 1 500  ? 15.688  13.306  -26.640 1.00 81.87  ? 500  VAL A CG2 1 
ATOM   3838  N  N   . ALA A 1 501  ? 12.065  11.631  -24.244 1.00 80.50  ? 501  ALA A N   1 
ATOM   3839  C  CA  . ALA A 1 501  ? 10.733  11.547  -23.670 1.00 81.18  ? 501  ALA A CA  1 
ATOM   3840  C  C   . ALA A 1 501  ? 10.745  12.032  -22.227 1.00 77.93  ? 501  ALA A C   1 
ATOM   3841  O  O   . ALA A 1 501  ? 11.664  11.730  -21.475 1.00 77.34  ? 501  ALA A O   1 
ATOM   3842  C  CB  . ALA A 1 501  ? 10.234  10.126  -23.754 1.00 84.29  ? 501  ALA A CB  1 
ATOM   3843  N  N   . SER A 1 502  ? 9.698   12.767  -21.850 1.00 76.85  ? 502  SER A N   1 
ATOM   3844  C  CA  . SER A 1 502  ? 9.483   13.119  -20.459 1.00 75.34  ? 502  SER A CA  1 
ATOM   3845  C  C   . SER A 1 502  ? 7.988   13.095  -20.167 1.00 75.59  ? 502  SER A C   1 
ATOM   3846  O  O   . SER A 1 502  ? 7.171   13.237  -21.071 1.00 76.97  ? 502  SER A O   1 
ATOM   3847  C  CB  . SER A 1 502  ? 10.092  14.451  -20.138 1.00 73.90  ? 502  SER A CB  1 
ATOM   3848  O  OG  . SER A 1 502  ? 9.413   15.479  -20.841 1.00 76.43  ? 502  SER A OG  1 
ATOM   3849  N  N   . CYS A 1 503  ? 7.651   12.931  -18.890 1.00 74.75  ? 503  CYS A N   1 
ATOM   3850  C  CA  . CYS A 1 503  ? 6.281   12.656  -18.517 1.00 76.99  ? 503  CYS A CA  1 
ATOM   3851  C  C   . CYS A 1 503  ? 6.091   12.957  -17.039 1.00 75.96  ? 503  CYS A C   1 
ATOM   3852  O  O   . CYS A 1 503  ? 6.936   12.601  -16.225 1.00 76.64  ? 503  CYS A O   1 
ATOM   3853  C  CB  . CYS A 1 503  ? 5.991   11.181  -18.756 1.00 80.54  ? 503  CYS A CB  1 
ATOM   3854  S  SG  . CYS A 1 503  ? 4.247   10.745  -18.550 1.00 85.59  ? 503  CYS A SG  1 
ATOM   3855  N  N   . ASN A 1 504  ? 4.992   13.637  -16.712 1.00 76.36  ? 504  ASN A N   1 
ATOM   3856  C  CA  . ASN A 1 504  ? 4.506   13.637  -15.345 1.00 77.60  ? 504  ASN A CA  1 
ATOM   3857  C  C   . ASN A 1 504  ? 3.187   12.878  -15.338 1.00 81.38  ? 504  ASN A C   1 
ATOM   3858  O  O   . ASN A 1 504  ? 2.937   12.086  -16.243 1.00 83.25  ? 504  ASN A O   1 
ATOM   3859  C  CB  . ASN A 1 504  ? 4.446   15.044  -14.747 1.00 76.46  ? 504  ASN A CB  1 
ATOM   3860  C  CG  . ASN A 1 504  ? 3.644   16.005  -15.591 1.00 77.15  ? 504  ASN A CG  1 
ATOM   3861  O  OD1 . ASN A 1 504  ? 2.508   15.718  -15.949 1.00 79.78  ? 504  ASN A OD1 1 
ATOM   3862  N  ND2 . ASN A 1 504  ? 4.227   17.145  -15.912 1.00 76.01  ? 504  ASN A ND2 1 
ATOM   3863  N  N   . SER A 1 505  ? 2.343   13.147  -14.337 1.00 83.85  ? 505  SER A N   1 
ATOM   3864  C  CA  . SER A 1 505  ? 1.101   12.405  -14.183 1.00 86.95  ? 505  SER A CA  1 
ATOM   3865  C  C   . SER A 1 505  ? 0.036   12.888  -15.171 1.00 88.33  ? 505  SER A C   1 
ATOM   3866  O  O   . SER A 1 505  ? -0.931  12.172  -15.430 1.00 92.07  ? 505  SER A O   1 
ATOM   3867  C  CB  . SER A 1 505  ? 0.611   12.444  -12.755 1.00 87.73  ? 505  SER A CB  1 
ATOM   3868  O  OG  . SER A 1 505  ? -0.012  13.688  -12.471 1.00 88.63  ? 505  SER A OG  1 
ATOM   3869  N  N   . SER A 1 506  ? 0.230   14.089  -15.734 1.00 85.86  ? 506  SER A N   1 
ATOM   3870  C  CA  . SER A 1 506  ? -0.814  14.740  -16.510 1.00 87.20  ? 506  SER A CA  1 
ATOM   3871  C  C   . SER A 1 506  ? -0.357  15.036  -17.935 1.00 85.90  ? 506  SER A C   1 
ATOM   3872  O  O   . SER A 1 506  ? -1.180  15.081  -18.845 1.00 88.55  ? 506  SER A O   1 
ATOM   3873  C  CB  . SER A 1 506  ? -1.288  15.992  -15.827 1.00 87.39  ? 506  SER A CB  1 
ATOM   3874  O  OG  . SER A 1 506  ? -2.189  15.672  -14.777 1.00 90.41  ? 506  SER A OG  1 
ATOM   3875  N  N   . GLN A 1 507  ? 0.953   15.228  -18.110 1.00 82.83  ? 507  GLN A N   1 
ATOM   3876  C  CA  . GLN A 1 507  ? 1.495   15.769  -19.345 1.00 81.57  ? 507  GLN A CA  1 
ATOM   3877  C  C   . GLN A 1 507  ? 2.538   14.818  -19.921 1.00 80.10  ? 507  GLN A C   1 
ATOM   3878  O  O   . GLN A 1 507  ? 3.122   14.007  -19.206 1.00 79.17  ? 507  GLN A O   1 
ATOM   3879  C  CB  . GLN A 1 507  ? 2.116   17.147  -19.101 1.00 79.73  ? 507  GLN A CB  1 
ATOM   3880  C  CG  . GLN A 1 507  ? 1.125   18.173  -18.571 1.00 81.43  ? 507  GLN A CG  1 
ATOM   3881  C  CD  . GLN A 1 507  ? 1.809   19.343  -17.910 1.00 79.42  ? 507  GLN A CD  1 
ATOM   3882  O  OE1 . GLN A 1 507  ? 1.599   20.492  -18.281 1.00 80.47  ? 507  GLN A OE1 1 
ATOM   3883  N  NE2 . GLN A 1 507  ? 2.656   19.053  -16.936 1.00 77.03  ? 507  GLN A NE2 1 
ATOM   3884  N  N   . VAL A 1 508  ? 2.739   14.930  -21.235 1.00 80.22  ? 508  VAL A N   1 
ATOM   3885  C  CA  . VAL A 1 508  ? 3.821   14.260  -21.928 1.00 79.97  ? 508  VAL A CA  1 
ATOM   3886  C  C   . VAL A 1 508  ? 4.432   15.251  -22.908 1.00 79.81  ? 508  VAL A C   1 
ATOM   3887  O  O   . VAL A 1 508  ? 3.719   15.915  -23.656 1.00 82.08  ? 508  VAL A O   1 
ATOM   3888  C  CB  . VAL A 1 508  ? 3.335   13.002  -22.671 1.00 83.46  ? 508  VAL A CB  1 
ATOM   3889  C  CG1 . VAL A 1 508  ? 4.429   12.397  -23.539 1.00 83.58  ? 508  VAL A CG1 1 
ATOM   3890  C  CG2 . VAL A 1 508  ? 2.791   11.960  -21.713 1.00 85.40  ? 508  VAL A CG2 1 
ATOM   3891  N  N   . VAL A 1 509  ? 5.761   15.354  -22.873 1.00 78.10  ? 509  VAL A N   1 
ATOM   3892  C  CA  . VAL A 1 509  ? 6.508   16.023  -23.922 1.00 77.88  ? 509  VAL A CA  1 
ATOM   3893  C  C   . VAL A 1 509  ? 7.499   14.999  -24.462 1.00 78.49  ? 509  VAL A C   1 
ATOM   3894  O  O   . VAL A 1 509  ? 8.224   14.370  -23.696 1.00 76.76  ? 509  VAL A O   1 
ATOM   3895  C  CB  . VAL A 1 509  ? 7.201   17.317  -23.433 1.00 74.99  ? 509  VAL A CB  1 
ATOM   3896  C  CG1 . VAL A 1 509  ? 8.005   17.989  -24.537 1.00 74.20  ? 509  VAL A CG1 1 
ATOM   3897  C  CG2 . VAL A 1 509  ? 6.221   18.315  -22.826 1.00 75.06  ? 509  VAL A CG2 1 
ATOM   3898  N  N   . VAL A 1 510  ? 7.480   14.804  -25.781 1.00 81.83  ? 510  VAL A N   1 
ATOM   3899  C  CA  . VAL A 1 510  ? 8.422   13.904  -26.426 1.00 83.99  ? 510  VAL A CA  1 
ATOM   3900  C  C   . VAL A 1 510  ? 9.137   14.676  -27.529 1.00 85.28  ? 510  VAL A C   1 
ATOM   3901  O  O   . VAL A 1 510  ? 8.586   15.627  -28.080 1.00 87.10  ? 510  VAL A O   1 
ATOM   3902  C  CB  . VAL A 1 510  ? 7.732   12.638  -26.981 1.00 87.17  ? 510  VAL A CB  1 
ATOM   3903  C  CG1 . VAL A 1 510  ? 7.354   11.639  -25.895 1.00 85.87  ? 510  VAL A CG1 1 
ATOM   3904  C  CG2 . VAL A 1 510  ? 6.529   12.978  -27.850 1.00 89.73  ? 510  VAL A CG2 1 
ATOM   3905  N  N   . ALA A 1 511  ? 10.366  14.252  -27.839 1.00 85.41  ? 511  ALA A N   1 
ATOM   3906  C  CA  . ALA A 1 511  ? 11.133  14.855  -28.914 1.00 85.97  ? 511  ALA A CA  1 
ATOM   3907  C  C   . ALA A 1 511  ? 11.283  13.850  -30.048 1.00 90.04  ? 511  ALA A C   1 
ATOM   3908  O  O   . ALA A 1 511  ? 11.500  12.663  -29.806 1.00 91.48  ? 511  ALA A O   1 
ATOM   3909  C  CB  . ALA A 1 511  ? 12.474  15.309  -28.404 1.00 83.00  ? 511  ALA A CB  1 
ATOM   3910  N  N   . VAL A 1 512  ? 11.137  14.355  -31.278 1.00 92.75  ? 512  VAL A N   1 
ATOM   3911  C  CA  . VAL A 1 512  ? 11.417  13.613  -32.495 1.00 96.60  ? 512  VAL A CA  1 
ATOM   3912  C  C   . VAL A 1 512  ? 12.445  14.428  -33.272 1.00 97.25  ? 512  VAL A C   1 
ATOM   3913  O  O   . VAL A 1 512  ? 12.076  15.310  -34.041 1.00 99.33  ? 512  VAL A O   1 
ATOM   3914  C  CB  . VAL A 1 512  ? 10.137  13.366  -33.324 1.00 99.84  ? 512  VAL A CB  1 
ATOM   3915  C  CG1 . VAL A 1 512  ? 10.423  12.598  -34.607 1.00 104.56 ? 512  VAL A CG1 1 
ATOM   3916  C  CG2 . VAL A 1 512  ? 9.051   12.663  -32.520 1.00 99.55  ? 512  VAL A CG2 1 
ATOM   3917  N  N   . GLY A 1 513  ? 13.730  14.136  -33.045 1.00 96.58  ? 513  GLY A N   1 
ATOM   3918  C  CA  . GLY A 1 513  ? 14.795  14.961  -33.584 1.00 97.62  ? 513  GLY A CA  1 
ATOM   3919  C  C   . GLY A 1 513  ? 14.702  16.371  -33.009 1.00 95.56  ? 513  GLY A C   1 
ATOM   3920  O  O   . GLY A 1 513  ? 14.843  16.547  -31.802 1.00 93.00  ? 513  GLY A O   1 
ATOM   3921  N  N   . ARG A 1 514  ? 14.418  17.351  -33.878 1.00 97.77  ? 514  ARG A N   1 
ATOM   3922  C  CA  . ARG A 1 514  ? 14.255  18.746  -33.490 1.00 96.03  ? 514  ARG A CA  1 
ATOM   3923  C  C   . ARG A 1 514  ? 12.779  19.069  -33.264 1.00 95.49  ? 514  ARG A C   1 
ATOM   3924  O  O   . ARG A 1 514  ? 12.427  20.211  -32.974 1.00 95.69  ? 514  ARG A O   1 
ATOM   3925  C  CB  . ARG A 1 514  ? 14.774  19.672  -34.592 1.00 99.06  ? 514  ARG A CB  1 
ATOM   3926  C  CG  . ARG A 1 514  ? 16.288  19.761  -34.684 1.00 100.19 ? 514  ARG A CG  1 
ATOM   3927  C  CD  . ARG A 1 514  ? 16.666  19.947  -36.136 1.00 105.01 ? 514  ARG A CD  1 
ATOM   3928  N  NE  . ARG A 1 514  ? 17.875  20.731  -36.326 1.00 106.03 ? 514  ARG A NE  1 
ATOM   3929  C  CZ  . ARG A 1 514  ? 18.170  21.380  -37.448 1.00 109.87 ? 514  ARG A CZ  1 
ATOM   3930  N  NH1 . ARG A 1 514  ? 17.337  21.345  -38.477 1.00 112.76 ? 514  ARG A NH1 1 
ATOM   3931  N  NH2 . ARG A 1 514  ? 19.295  22.070  -37.535 1.00 109.88 ? 514  ARG A NH2 1 
ATOM   3932  N  N   . ALA A 1 515  ? 11.914  18.062  -33.412 1.00 95.87  ? 515  ALA A N   1 
ATOM   3933  C  CA  . ALA A 1 515  ? 10.483  18.265  -33.264 1.00 94.80  ? 515  ALA A CA  1 
ATOM   3934  C  C   . ALA A 1 515  ? 10.084  18.019  -31.812 1.00 90.22  ? 515  ALA A C   1 
ATOM   3935  O  O   . ALA A 1 515  ? 10.583  17.093  -31.175 1.00 88.92  ? 515  ALA A O   1 
ATOM   3936  C  CB  . ALA A 1 515  ? 9.724   17.369  -34.218 1.00 98.68  ? 515  ALA A CB  1 
ATOM   3937  N  N   . LEU A 1 516  ? 9.187   18.868  -31.300 1.00 87.84  ? 516  LEU A N   1 
ATOM   3938  C  CA  . LEU A 1 516  ? 8.692   18.758  -29.938 1.00 84.29  ? 516  LEU A CA  1 
ATOM   3939  C  C   . LEU A 1 516  ? 7.166   18.670  -29.972 1.00 86.56  ? 516  LEU A C   1 
ATOM   3940  O  O   . LEU A 1 516  ? 6.520   19.447  -30.669 1.00 88.99  ? 516  LEU A O   1 
ATOM   3941  C  CB  . LEU A 1 516  ? 9.164   19.994  -29.168 1.00 79.97  ? 516  LEU A CB  1 
ATOM   3942  C  CG  . LEU A 1 516  ? 9.795   19.745  -27.801 1.00 75.86  ? 516  LEU A CG  1 
ATOM   3943  C  CD1 . LEU A 1 516  ? 10.850  18.652  -27.867 1.00 75.17  ? 516  LEU A CD1 1 
ATOM   3944  C  CD2 . LEU A 1 516  ? 10.402  21.031  -27.272 1.00 73.86  ? 516  LEU A CD2 1 
ATOM   3945  N  N   . TYR A 1 517  ? 6.598   17.712  -29.226 1.00 86.56  ? 517  TYR A N   1 
ATOM   3946  C  CA  . TYR A 1 517  ? 5.156   17.522  -29.190 1.00 89.07  ? 517  TYR A CA  1 
ATOM   3947  C  C   . TYR A 1 517  ? 4.661   17.394  -27.750 1.00 86.29  ? 517  TYR A C   1 
ATOM   3948  O  O   . TYR A 1 517  ? 5.203   16.610  -26.974 1.00 85.37  ? 517  TYR A O   1 
ATOM   3949  C  CB  . TYR A 1 517  ? 4.761   16.330  -30.065 1.00 94.43  ? 517  TYR A CB  1 
ATOM   3950  C  CG  . TYR A 1 517  ? 5.059   16.511  -31.532 1.00 99.31  ? 517  TYR A CG  1 
ATOM   3951  C  CD1 . TYR A 1 517  ? 4.503   17.558  -32.253 1.00 102.11 ? 517  TYR A CD1 1 
ATOM   3952  C  CD2 . TYR A 1 517  ? 5.898   15.636  -32.206 1.00 101.12 ? 517  TYR A CD2 1 
ATOM   3953  C  CE1 . TYR A 1 517  ? 4.780   17.742  -33.600 1.00 105.19 ? 517  TYR A CE1 1 
ATOM   3954  C  CE2 . TYR A 1 517  ? 6.174   15.797  -33.555 1.00 104.49 ? 517  TYR A CE2 1 
ATOM   3955  C  CZ  . TYR A 1 517  ? 5.618   16.855  -34.252 1.00 106.19 ? 517  TYR A CZ  1 
ATOM   3956  O  OH  . TYR A 1 517  ? 5.897   17.008  -35.576 1.00 109.83 ? 517  TYR A OH  1 
ATOM   3957  N  N   . TYR A 1 518  ? 3.606   18.154  -27.420 1.00 85.44  ? 518  TYR A N   1 
ATOM   3958  C  CA  . TYR A 1 518  ? 3.038   18.228  -26.081 1.00 83.63  ? 518  TYR A CA  1 
ATOM   3959  C  C   . TYR A 1 518  ? 1.675   17.533  -26.039 1.00 87.99  ? 518  TYR A C   1 
ATOM   3960  O  O   . TYR A 1 518  ? 0.740   17.930  -26.737 1.00 92.97  ? 518  TYR A O   1 
ATOM   3961  C  CB  . TYR A 1 518  ? 2.960   19.693  -25.635 1.00 81.28  ? 518  TYR A CB  1 
ATOM   3962  C  CG  . TYR A 1 518  ? 2.142   19.991  -24.400 1.00 80.13  ? 518  TYR A CG  1 
ATOM   3963  C  CD1 . TYR A 1 518  ? 2.076   19.109  -23.330 1.00 78.84  ? 518  TYR A CD1 1 
ATOM   3964  C  CD2 . TYR A 1 518  ? 1.461   21.190  -24.278 1.00 81.14  ? 518  TYR A CD2 1 
ATOM   3965  C  CE1 . TYR A 1 518  ? 1.331   19.393  -22.193 1.00 78.56  ? 518  TYR A CE1 1 
ATOM   3966  C  CE2 . TYR A 1 518  ? 0.712   21.490  -23.148 1.00 81.34  ? 518  TYR A CE2 1 
ATOM   3967  C  CZ  . TYR A 1 518  ? 0.645   20.592  -22.098 1.00 79.75  ? 518  TYR A CZ  1 
ATOM   3968  O  OH  . TYR A 1 518  ? -0.102  20.895  -20.996 1.00 79.76  ? 518  TYR A OH  1 
ATOM   3969  N  N   . LEU A 1 519  ? 1.568   16.498  -25.193 1.00 87.16  ? 519  LEU A N   1 
ATOM   3970  C  CA  . LEU A 1 519  ? 0.359   15.700  -25.042 1.00 88.78  ? 519  LEU A CA  1 
ATOM   3971  C  C   . LEU A 1 519  ? -0.181  15.884  -23.627 1.00 88.61  ? 519  LEU A C   1 
ATOM   3972  O  O   . LEU A 1 519  ? 0.589   16.105  -22.692 1.00 86.01  ? 519  LEU A O   1 
ATOM   3973  C  CB  . LEU A 1 519  ? 0.721   14.226  -25.251 1.00 88.18  ? 519  LEU A CB  1 
ATOM   3974  C  CG  . LEU A 1 519  ? 0.982   13.754  -26.681 1.00 90.07  ? 519  LEU A CG  1 
ATOM   3975  C  CD1 . LEU A 1 519  ? 2.102   14.535  -27.349 1.00 88.67  ? 519  LEU A CD1 1 
ATOM   3976  C  CD2 . LEU A 1 519  ? 1.327   12.276  -26.682 1.00 90.88  ? 519  LEU A CD2 1 
ATOM   3977  N  N   . GLN A 1 520  ? -1.503  15.763  -23.474 1.00 92.30  ? 520  GLN A N   1 
ATOM   3978  C  CA  . GLN A 1 520  ? -2.123  15.741  -22.157 1.00 93.30  ? 520  GLN A CA  1 
ATOM   3979  C  C   . GLN A 1 520  ? -2.769  14.374  -21.915 1.00 96.37  ? 520  GLN A C   1 
ATOM   3980  O  O   . GLN A 1 520  ? -3.158  13.691  -22.864 1.00 99.45  ? 520  GLN A O   1 
ATOM   3981  C  CB  . GLN A 1 520  ? -3.137  16.878  -22.023 1.00 95.69  ? 520  GLN A CB  1 
ATOM   3982  C  CG  . GLN A 1 520  ? -2.541  18.193  -21.542 1.00 93.41  ? 520  GLN A CG  1 
ATOM   3983  C  CD  . GLN A 1 520  ? -3.616  19.205  -21.224 1.00 96.46  ? 520  GLN A CD  1 
ATOM   3984  O  OE1 . GLN A 1 520  ? -4.749  18.859  -20.886 1.00 98.83  ? 520  GLN A OE1 1 
ATOM   3985  N  NE2 . GLN A 1 520  ? -3.265  20.476  -21.324 1.00 96.31  ? 520  GLN A NE2 1 
ATOM   3986  N  N   . ILE A 1 521  ? -2.874  13.988  -20.633 1.00 95.69  ? 521  ILE A N   1 
ATOM   3987  C  CA  . ILE A 1 521  ? -3.445  12.709  -20.228 1.00 97.87  ? 521  ILE A CA  1 
ATOM   3988  C  C   . ILE A 1 521  ? -4.845  12.938  -19.652 1.00 100.70 ? 521  ILE A C   1 
ATOM   3989  O  O   . ILE A 1 521  ? -5.015  13.642  -18.659 1.00 100.22 ? 521  ILE A O   1 
ATOM   3990  C  CB  . ILE A 1 521  ? -2.503  11.952  -19.261 1.00 94.95  ? 521  ILE A CB  1 
ATOM   3991  C  CG1 . ILE A 1 521  ? -1.230  11.486  -19.975 1.00 92.96  ? 521  ILE A CG1 1 
ATOM   3992  C  CG2 . ILE A 1 521  ? -3.212  10.788  -18.577 1.00 97.01  ? 521  ILE A CG2 1 
ATOM   3993  C  CD1 . ILE A 1 521  ? -0.003  11.454  -19.095 1.00 89.26  ? 521  ILE A CD1 1 
ATOM   3994  N  N   . HIS A 1 522  ? -5.843  12.326  -20.298 1.00 104.17 ? 522  HIS A N   1 
ATOM   3995  C  CA  . HIS A 1 522  ? -7.239  12.443  -19.905 1.00 107.61 ? 522  HIS A CA  1 
ATOM   3996  C  C   . HIS A 1 522  ? -7.813  11.050  -19.688 1.00 109.90 ? 522  HIS A C   1 
ATOM   3997  O  O   . HIS A 1 522  ? -7.130  10.065  -19.959 1.00 109.84 ? 522  HIS A O   1 
ATOM   3998  C  CB  . HIS A 1 522  ? -8.027  13.213  -20.972 1.00 110.53 ? 522  HIS A CB  1 
ATOM   3999  C  CG  . HIS A 1 522  ? -7.523  14.602  -21.140 1.00 108.40 ? 522  HIS A CG  1 
ATOM   4000  N  ND1 . HIS A 1 522  ? -7.886  15.620  -20.283 1.00 107.94 ? 522  HIS A ND1 1 
ATOM   4001  C  CD2 . HIS A 1 522  ? -6.649  15.130  -22.023 1.00 106.39 ? 522  HIS A CD2 1 
ATOM   4002  C  CE1 . HIS A 1 522  ? -7.272  16.727  -20.645 1.00 106.35 ? 522  HIS A CE1 1 
ATOM   4003  N  NE2 . HIS A 1 522  ? -6.507  16.452  -21.712 1.00 105.19 ? 522  HIS A NE2 1 
ATOM   4004  N  N   . PRO A 1 523  ? -9.068  10.915  -19.195 1.00 112.54 ? 523  PRO A N   1 
ATOM   4005  C  CA  . PRO A 1 523  ? -9.687  9.599   -19.070 1.00 115.27 ? 523  PRO A CA  1 
ATOM   4006  C  C   . PRO A 1 523  ? -9.659  8.942   -20.448 1.00 116.70 ? 523  PRO A C   1 
ATOM   4007  O  O   . PRO A 1 523  ? -10.296 9.423   -21.384 1.00 118.27 ? 523  PRO A O   1 
ATOM   4008  C  CB  . PRO A 1 523  ? -11.121 9.909   -18.620 1.00 119.94 ? 523  PRO A CB  1 
ATOM   4009  C  CG  . PRO A 1 523  ? -11.026 11.271  -17.967 1.00 117.81 ? 523  PRO A CG  1 
ATOM   4010  C  CD  . PRO A 1 523  ? -9.946  12.003  -18.734 1.00 113.67 ? 523  PRO A CD  1 
ATOM   4011  N  N   . GLN A 1 524  ? -8.839  7.890   -20.561 1.00 115.61 ? 524  GLN A N   1 
ATOM   4012  C  CA  . GLN A 1 524  ? -8.752  7.028   -21.730 1.00 118.36 ? 524  GLN A CA  1 
ATOM   4013  C  C   . GLN A 1 524  ? -8.379  7.811   -22.990 1.00 117.34 ? 524  GLN A C   1 
ATOM   4014  O  O   . GLN A 1 524  ? -8.824  7.465   -24.079 1.00 119.90 ? 524  GLN A O   1 
ATOM   4015  C  CB  . GLN A 1 524  ? -10.068 6.276   -21.954 1.00 124.72 ? 524  GLN A CB  1 
ATOM   4016  C  CG  . GLN A 1 524  ? -10.532 5.451   -20.761 1.00 126.67 ? 524  GLN A CG  1 
ATOM   4017  C  CD  . GLN A 1 524  ? -11.439 6.223   -19.833 1.00 127.66 ? 524  GLN A CD  1 
ATOM   4018  O  OE1 . GLN A 1 524  ? -12.306 6.981   -20.264 1.00 129.60 ? 524  GLN A OE1 1 
ATOM   4019  N  NE2 . GLN A 1 524  ? -11.235 6.043   -18.538 1.00 126.40 ? 524  GLN A NE2 1 
ATOM   4020  N  N   . GLU A 1 525  ? -7.527  8.836   -22.859 1.00 114.25 ? 525  GLU A N   1 
ATOM   4021  C  CA  . GLU A 1 525  ? -7.215  9.678   -24.005 1.00 113.95 ? 525  GLU A CA  1 
ATOM   4022  C  C   . GLU A 1 525  ? -5.856  10.363  -23.839 1.00 107.89 ? 525  GLU A C   1 
ATOM   4023  O  O   . GLU A 1 525  ? -5.549  10.874  -22.766 1.00 104.05 ? 525  GLU A O   1 
ATOM   4024  C  CB  . GLU A 1 525  ? -8.356  10.678  -24.215 1.00 116.81 ? 525  GLU A CB  1 
ATOM   4025  C  CG  . GLU A 1 525  ? -8.264  11.465  -25.510 1.00 117.63 ? 525  GLU A CG  1 
ATOM   4026  C  CD  . GLU A 1 525  ? -8.879  12.852  -25.450 1.00 117.84 ? 525  GLU A CD  1 
ATOM   4027  O  OE1 . GLU A 1 525  ? -9.517  13.178  -24.424 1.00 117.97 ? 525  GLU A OE1 1 
ATOM   4028  O  OE2 . GLU A 1 525  ? -8.705  13.608  -26.427 1.00 117.98 ? 525  GLU A OE2 1 
ATOM   4029  N  N   . LEU A 1 526  ? -5.064  10.352  -24.926 1.00 107.58 ? 526  LEU A N   1 
ATOM   4030  C  CA  . LEU A 1 526  ? -3.839  11.128  -25.084 1.00 104.04 ? 526  LEU A CA  1 
ATOM   4031  C  C   . LEU A 1 526  ? -4.104  12.274  -26.059 1.00 104.95 ? 526  LEU A C   1 
ATOM   4032  O  O   . LEU A 1 526  ? -4.119  12.060  -27.270 1.00 108.10 ? 526  LEU A O   1 
ATOM   4033  C  CB  . LEU A 1 526  ? -2.732  10.229  -25.654 1.00 103.18 ? 526  LEU A CB  1 
ATOM   4034  C  CG  . LEU A 1 526  ? -2.133  9.184   -24.713 1.00 101.56 ? 526  LEU A CG  1 
ATOM   4035  C  CD1 . LEU A 1 526  ? -1.323  8.161   -25.498 1.00 102.63 ? 526  LEU A CD1 1 
ATOM   4036  C  CD2 . LEU A 1 526  ? -1.277  9.841   -23.638 1.00 96.13  ? 526  LEU A CD2 1 
ATOM   4037  N  N   . ARG A 1 527  ? -4.276  13.490  -25.529 1.00 102.90 ? 527  ARG A N   1 
ATOM   4038  C  CA  . ARG A 1 527  ? -4.711  14.627  -26.325 1.00 104.57 ? 527  ARG A CA  1 
ATOM   4039  C  C   . ARG A 1 527  ? -3.507  15.476  -26.727 1.00 101.37 ? 527  ARG A C   1 
ATOM   4040  O  O   . ARG A 1 527  ? -2.860  16.066  -25.862 1.00 98.32  ? 527  ARG A O   1 
ATOM   4041  C  CB  . ARG A 1 527  ? -5.731  15.442  -25.522 1.00 105.40 ? 527  ARG A CB  1 
ATOM   4042  C  CG  . ARG A 1 527  ? -6.346  16.619  -26.266 1.00 107.79 ? 527  ARG A CG  1 
ATOM   4043  C  CD  . ARG A 1 527  ? -7.297  17.363  -25.351 1.00 109.03 ? 527  ARG A CD  1 
ATOM   4044  N  NE  . ARG A 1 527  ? -8.426  16.516  -24.988 1.00 113.35 ? 527  ARG A NE  1 
ATOM   4045  C  CZ  . ARG A 1 527  ? -9.309  16.780  -24.028 1.00 114.78 ? 527  ARG A CZ  1 
ATOM   4046  N  NH1 . ARG A 1 527  ? -9.197  17.879  -23.300 1.00 113.02 ? 527  ARG A NH1 1 
ATOM   4047  N  NH2 . ARG A 1 527  ? -10.295 15.935  -23.788 1.00 118.05 ? 527  ARG A NH2 1 
ATOM   4048  N  N   . GLN A 1 528  ? -3.223  15.541  -28.039 1.00 102.83 ? 528  GLN A N   1 
ATOM   4049  C  CA  . GLN A 1 528  ? -2.161  16.408  -28.532 1.00 100.66 ? 528  GLN A CA  1 
ATOM   4050  C  C   . GLN A 1 528  ? -2.593  17.862  -28.357 1.00 100.25 ? 528  GLN A C   1 
ATOM   4051  O  O   . GLN A 1 528  ? -3.681  18.237  -28.789 1.00 102.85 ? 528  GLN A O   1 
ATOM   4052  C  CB  . GLN A 1 528  ? -1.748  16.091  -29.973 1.00 103.15 ? 528  GLN A CB  1 
ATOM   4053  C  CG  . GLN A 1 528  ? -0.661  17.035  -30.482 1.00 101.94 ? 528  GLN A CG  1 
ATOM   4054  C  CD  . GLN A 1 528  ? -0.023  16.622  -31.784 1.00 104.55 ? 528  GLN A CD  1 
ATOM   4055  O  OE1 . GLN A 1 528  ? 0.239   15.446  -32.020 1.00 106.07 ? 528  GLN A OE1 1 
ATOM   4056  N  NE2 . GLN A 1 528  ? 0.252   17.600  -32.633 1.00 105.64 ? 528  GLN A NE2 1 
ATOM   4057  N  N   . ILE A 1 529  ? -1.732  18.661  -27.706 1.00 96.36  ? 529  ILE A N   1 
ATOM   4058  C  CA  . ILE A 1 529  ? -2.079  20.023  -27.329 1.00 96.19  ? 529  ILE A CA  1 
ATOM   4059  C  C   . ILE A 1 529  ? -1.355  21.021  -28.228 1.00 96.38  ? 529  ILE A C   1 
ATOM   4060  O  O   . ILE A 1 529  ? -1.966  21.973  -28.701 1.00 99.61  ? 529  ILE A O   1 
ATOM   4061  C  CB  . ILE A 1 529  ? -1.844  20.293  -25.825 1.00 92.43  ? 529  ILE A CB  1 
ATOM   4062  C  CG1 . ILE A 1 529  ? -2.737  19.420  -24.929 1.00 93.28  ? 529  ILE A CG1 1 
ATOM   4063  C  CG2 . ILE A 1 529  ? -1.965  21.779  -25.499 1.00 91.54  ? 529  ILE A CG2 1 
ATOM   4064  C  CD1 . ILE A 1 529  ? -4.170  19.887  -24.770 1.00 96.16  ? 529  ILE A CD1 1 
ATOM   4065  N  N   . SER A 1 530  ? -0.055  20.814  -28.454 1.00 94.91  ? 530  SER A N   1 
ATOM   4066  C  CA  . SER A 1 530  ? 0.719   21.721  -29.293 1.00 96.10  ? 530  SER A CA  1 
ATOM   4067  C  C   . SER A 1 530  ? 2.030   21.075  -29.736 1.00 94.89  ? 530  SER A C   1 
ATOM   4068  O  O   . SER A 1 530  ? 2.493   20.099  -29.148 1.00 92.58  ? 530  SER A O   1 
ATOM   4069  C  CB  . SER A 1 530  ? 0.969   23.044  -28.609 1.00 94.42  ? 530  SER A CB  1 
ATOM   4070  O  OG  . SER A 1 530  ? 1.796   22.872  -27.466 1.00 90.90  ? 530  SER A OG  1 
ATOM   4071  N  N   . HIS A 1 531  ? 2.639   21.676  -30.761 1.00 96.80  ? 531  HIS A N   1 
ATOM   4072  C  CA  . HIS A 1 531  ? 3.811   21.143  -31.435 1.00 97.66  ? 531  HIS A CA  1 
ATOM   4073  C  C   . HIS A 1 531  ? 4.747   22.295  -31.785 1.00 97.20  ? 531  HIS A C   1 
ATOM   4074  O  O   . HIS A 1 531  ? 4.284   23.406  -32.036 1.00 99.25  ? 531  HIS A O   1 
ATOM   4075  C  CB  . HIS A 1 531  ? 3.370   20.442  -32.723 1.00 102.98 ? 531  HIS A CB  1 
ATOM   4076  C  CG  . HIS A 1 531  ? 2.212   21.110  -33.389 1.00 108.64 ? 531  HIS A CG  1 
ATOM   4077  N  ND1 . HIS A 1 531  ? 2.316   21.724  -34.626 1.00 112.36 ? 531  HIS A ND1 1 
ATOM   4078  C  CD2 . HIS A 1 531  ? 0.929   21.275  -32.991 1.00 110.99 ? 531  HIS A CD2 1 
ATOM   4079  C  CE1 . HIS A 1 531  ? 1.144   22.228  -34.966 1.00 116.00 ? 531  HIS A CE1 1 
ATOM   4080  N  NE2 . HIS A 1 531  ? 0.276   21.969  -33.975 1.00 115.54 ? 531  HIS A NE2 1 
ATOM   4081  N  N   . THR A 1 532  ? 6.060   22.028  -31.808 1.00 95.54  ? 532  THR A N   1 
ATOM   4082  C  CA  . THR A 1 532  ? 7.037   23.011  -32.262 1.00 95.98  ? 532  THR A CA  1 
ATOM   4083  C  C   . THR A 1 532  ? 8.313   22.337  -32.759 1.00 96.44  ? 532  THR A C   1 
ATOM   4084  O  O   . THR A 1 532  ? 8.561   21.159  -32.506 1.00 96.26  ? 532  THR A O   1 
ATOM   4085  C  CB  . THR A 1 532  ? 7.431   24.033  -31.184 1.00 93.23  ? 532  THR A CB  1 
ATOM   4086  O  OG1 . THR A 1 532  ? 8.207   25.036  -31.839 1.00 94.15  ? 532  THR A OG1 1 
ATOM   4087  C  CG2 . THR A 1 532  ? 8.279   23.454  -30.072 1.00 89.08  ? 532  THR A CG2 1 
ATOM   4088  N  N   . GLU A 1 533  ? 9.137   23.130  -33.444 1.00 98.01  ? 533  GLU A N   1 
ATOM   4089  C  CA  . GLU A 1 533  ? 10.396  22.662  -33.991 1.00 98.94  ? 533  GLU A CA  1 
ATOM   4090  C  C   . GLU A 1 533  ? 11.528  23.491  -33.393 1.00 96.12  ? 533  GLU A C   1 
ATOM   4091  O  O   . GLU A 1 533  ? 11.543  24.712  -33.533 1.00 97.14  ? 533  GLU A O   1 
ATOM   4092  C  CB  . GLU A 1 533  ? 10.359  22.776  -35.516 1.00 104.59 ? 533  GLU A CB  1 
ATOM   4093  C  CG  . GLU A 1 533  ? 9.613   21.637  -36.194 1.00 108.73 ? 533  GLU A CG  1 
ATOM   4094  C  CD  . GLU A 1 533  ? 10.521  20.500  -36.628 1.00 111.01 ? 533  GLU A CD  1 
ATOM   4095  O  OE1 . GLU A 1 533  ? 9.993   19.425  -36.990 1.00 113.84 ? 533  GLU A OE1 1 
ATOM   4096  O  OE2 . GLU A 1 533  ? 11.757  20.695  -36.602 1.00 110.64 ? 533  GLU A OE2 1 
ATOM   4097  N  N   . MET A 1 534  ? 12.467  22.808  -32.728 1.00 93.24  ? 534  MET A N   1 
ATOM   4098  C  CA  . MET A 1 534  ? 13.608  23.445  -32.092 1.00 90.60  ? 534  MET A CA  1 
ATOM   4099  C  C   . MET A 1 534  ? 14.694  23.726  -33.128 1.00 93.12  ? 534  MET A C   1 
ATOM   4100  O  O   . MET A 1 534  ? 14.759  23.080  -34.173 1.00 96.42  ? 534  MET A O   1 
ATOM   4101  C  CB  . MET A 1 534  ? 14.192  22.561  -30.986 1.00 88.11  ? 534  MET A CB  1 
ATOM   4102  C  CG  . MET A 1 534  ? 13.262  22.352  -29.805 1.00 87.13  ? 534  MET A CG  1 
ATOM   4103  S  SD  . MET A 1 534  ? 12.699  23.883  -29.000 1.00 87.07  ? 534  MET A SD  1 
ATOM   4104  C  CE  . MET A 1 534  ? 14.246  24.526  -28.366 1.00 84.48  ? 534  MET A CE  1 
ATOM   4105  N  N   . GLU A 1 535  ? 15.560  24.684  -32.783 1.00 92.19  ? 535  GLU A N   1 
ATOM   4106  C  CA  . GLU A 1 535  ? 16.659  25.169  -33.599 1.00 94.62  ? 535  GLU A CA  1 
ATOM   4107  C  C   . GLU A 1 535  ? 17.711  24.075  -33.800 1.00 95.31  ? 535  GLU A C   1 
ATOM   4108  O  O   . GLU A 1 535  ? 18.341  24.005  -34.851 1.00 97.50  ? 535  GLU A O   1 
ATOM   4109  C  CB  . GLU A 1 535  ? 17.261  26.356  -32.850 1.00 94.24  ? 535  GLU A CB  1 
ATOM   4110  C  CG  . GLU A 1 535  ? 17.672  27.524  -33.720 1.00 98.35  ? 535  GLU A CG  1 
ATOM   4111  C  CD  . GLU A 1 535  ? 18.300  28.643  -32.901 1.00 97.80  ? 535  GLU A CD  1 
ATOM   4112  O  OE1 . GLU A 1 535  ? 17.899  28.817  -31.721 1.00 94.59  ? 535  GLU A OE1 1 
ATOM   4113  O  OE2 . GLU A 1 535  ? 19.204  29.327  -33.433 1.00 99.83  ? 535  GLU A OE2 1 
ATOM   4114  N  N   . HIS A 1 536  ? 17.918  23.242  -32.770 1.00 94.12  ? 536  HIS A N   1 
ATOM   4115  C  CA  . HIS A 1 536  ? 18.877  22.145  -32.808 1.00 95.32  ? 536  HIS A CA  1 
ATOM   4116  C  C   . HIS A 1 536  ? 18.212  20.853  -32.329 1.00 95.04  ? 536  HIS A C   1 
ATOM   4117  O  O   . HIS A 1 536  ? 17.056  20.859  -31.909 1.00 95.12  ? 536  HIS A O   1 
ATOM   4118  C  CB  . HIS A 1 536  ? 20.114  22.483  -31.962 1.00 93.33  ? 536  HIS A CB  1 
ATOM   4119  C  CG  . HIS A 1 536  ? 20.772  23.769  -32.333 1.00 93.54  ? 536  HIS A CG  1 
ATOM   4120  N  ND1 . HIS A 1 536  ? 21.426  23.938  -33.537 1.00 96.55  ? 536  HIS A ND1 1 
ATOM   4121  C  CD2 . HIS A 1 536  ? 20.879  24.943  -31.672 1.00 91.74  ? 536  HIS A CD2 1 
ATOM   4122  C  CE1 . HIS A 1 536  ? 21.911  25.161  -33.601 1.00 96.90  ? 536  HIS A CE1 1 
ATOM   4123  N  NE2 . HIS A 1 536  ? 21.591  25.798  -32.467 1.00 94.00  ? 536  HIS A NE2 1 
ATOM   4124  N  N   . GLU A 1 537  ? 18.951  19.739  -32.399 1.00 96.13  ? 537  GLU A N   1 
ATOM   4125  C  CA  . GLU A 1 537  ? 18.436  18.459  -31.938 1.00 95.55  ? 537  GLU A CA  1 
ATOM   4126  C  C   . GLU A 1 537  ? 18.258  18.515  -30.426 1.00 89.01  ? 537  GLU A C   1 
ATOM   4127  O  O   . GLU A 1 537  ? 19.038  19.161  -29.733 1.00 86.67  ? 537  GLU A O   1 
ATOM   4128  C  CB  . GLU A 1 537  ? 19.364  17.308  -32.337 1.00 101.98 ? 537  GLU A CB  1 
ATOM   4129  C  CG  . GLU A 1 537  ? 19.406  17.046  -33.838 1.00 110.70 ? 537  GLU A CG  1 
ATOM   4130  C  CD  . GLU A 1 537  ? 20.458  16.058  -34.329 1.00 116.78 ? 537  GLU A CD  1 
ATOM   4131  O  OE1 . GLU A 1 537  ? 21.245  15.554  -33.495 1.00 118.19 ? 537  GLU A OE1 1 
ATOM   4132  O  OE2 . GLU A 1 537  ? 20.490  15.791  -35.553 1.00 121.92 ? 537  GLU A OE2 1 
ATOM   4133  N  N   . VAL A 1 538  ? 17.214  17.841  -29.936 1.00 86.40  ? 538  VAL A N   1 
ATOM   4134  C  CA  . VAL A 1 538  ? 16.874  17.848  -28.523 1.00 82.78  ? 538  VAL A CA  1 
ATOM   4135  C  C   . VAL A 1 538  ? 17.709  16.782  -27.827 1.00 81.79  ? 538  VAL A C   1 
ATOM   4136  O  O   . VAL A 1 538  ? 17.725  15.635  -28.265 1.00 83.09  ? 538  VAL A O   1 
ATOM   4137  C  CB  . VAL A 1 538  ? 15.369  17.598  -28.295 1.00 82.81  ? 538  VAL A CB  1 
ATOM   4138  C  CG1 . VAL A 1 538  ? 15.030  17.422  -26.820 1.00 80.15  ? 538  VAL A CG1 1 
ATOM   4139  C  CG2 . VAL A 1 538  ? 14.497  18.677  -28.925 1.00 83.60  ? 538  VAL A CG2 1 
ATOM   4140  N  N   . ALA A 1 539  ? 18.353  17.171  -26.718 1.00 79.52  ? 539  ALA A N   1 
ATOM   4141  C  CA  . ALA A 1 539  ? 19.284  16.305  -26.013 1.00 79.04  ? 539  ALA A CA  1 
ATOM   4142  C  C   . ALA A 1 539  ? 18.622  15.663  -24.794 1.00 77.25  ? 539  ALA A C   1 
ATOM   4143  O  O   . ALA A 1 539  ? 18.826  14.476  -24.551 1.00 79.61  ? 539  ALA A O   1 
ATOM   4144  C  CB  . ALA A 1 539  ? 20.536  17.065  -25.651 1.00 78.08  ? 539  ALA A CB  1 
ATOM   4145  N  N   . CYS A 1 540  ? 17.848  16.443  -24.028 1.00 74.08  ? 540  CYS A N   1 
ATOM   4146  C  CA  . CYS A 1 540  ? 17.169  15.921  -22.849 1.00 72.99  ? 540  CYS A CA  1 
ATOM   4147  C  C   . CYS A 1 540  ? 15.995  16.825  -22.468 1.00 70.95  ? 540  CYS A C   1 
ATOM   4148  O  O   . CYS A 1 540  ? 15.961  17.991  -22.858 1.00 70.89  ? 540  CYS A O   1 
ATOM   4149  C  CB  . CYS A 1 540  ? 18.125  15.766  -21.674 1.00 73.05  ? 540  CYS A CB  1 
ATOM   4150  S  SG  . CYS A 1 540  ? 19.007  17.295  -21.280 1.00 76.45  ? 540  CYS A SG  1 
ATOM   4151  N  N   . LEU A 1 541  ? 15.042  16.267  -21.700 1.00 69.08  ? 541  LEU A N   1 
ATOM   4152  C  CA  . LEU A 1 541  ? 13.766  16.905  -21.411 1.00 66.92  ? 541  LEU A CA  1 
ATOM   4153  C  C   . LEU A 1 541  ? 13.386  16.706  -19.948 1.00 65.42  ? 541  LEU A C   1 
ATOM   4154  O  O   . LEU A 1 541  ? 13.775  15.718  -19.339 1.00 65.82  ? 541  LEU A O   1 
ATOM   4155  C  CB  . LEU A 1 541  ? 12.694  16.266  -22.294 1.00 68.55  ? 541  LEU A CB  1 
ATOM   4156  C  CG  . LEU A 1 541  ? 12.604  16.796  -23.723 1.00 70.40  ? 541  LEU A CG  1 
ATOM   4157  C  CD1 . LEU A 1 541  ? 11.819  15.837  -24.601 1.00 73.45  ? 541  LEU A CD1 1 
ATOM   4158  C  CD2 . LEU A 1 541  ? 11.968  18.178  -23.754 1.00 69.62  ? 541  LEU A CD2 1 
ATOM   4159  N  N   . ASP A 1 542  ? 12.596  17.639  -19.406 1.00 64.96  ? 542  ASP A N   1 
ATOM   4160  C  CA  . ASP A 1 542  ? 11.967  17.460  -18.107 1.00 65.59  ? 542  ASP A CA  1 
ATOM   4161  C  C   . ASP A 1 542  ? 10.735  18.356  -17.995 1.00 65.77  ? 542  ASP A C   1 
ATOM   4162  O  O   . ASP A 1 542  ? 10.744  19.486  -18.484 1.00 65.78  ? 542  ASP A O   1 
ATOM   4163  C  CB  . ASP A 1 542  ? 12.928  17.728  -16.945 1.00 66.19  ? 542  ASP A CB  1 
ATOM   4164  C  CG  . ASP A 1 542  ? 12.387  17.236  -15.611 1.00 68.25  ? 542  ASP A CG  1 
ATOM   4165  O  OD1 . ASP A 1 542  ? 11.303  17.685  -15.203 1.00 69.79  ? 542  ASP A OD1 1 
ATOM   4166  O  OD2 . ASP A 1 542  ? 13.045  16.384  -15.002 1.00 70.97  ? 542  ASP A OD2 1 
ATOM   4167  N  N   . ILE A 1 543  ? 9.691   17.837  -17.323 1.00 65.96  ? 543  ILE A N   1 
ATOM   4168  C  CA  . ILE A 1 543  ? 8.469   18.589  -17.070 1.00 66.17  ? 543  ILE A CA  1 
ATOM   4169  C  C   . ILE A 1 543  ? 7.936   18.309  -15.666 1.00 66.65  ? 543  ILE A C   1 
ATOM   4170  O  O   . ILE A 1 543  ? 6.727   18.247  -15.477 1.00 67.84  ? 543  ILE A O   1 
ATOM   4171  C  CB  . ILE A 1 543  ? 7.401   18.323  -18.154 1.00 67.11  ? 543  ILE A CB  1 
ATOM   4172  C  CG1 . ILE A 1 543  ? 7.214   16.829  -18.429 1.00 68.38  ? 543  ILE A CG1 1 
ATOM   4173  C  CG2 . ILE A 1 543  ? 7.730   19.080  -19.430 1.00 67.26  ? 543  ILE A CG2 1 
ATOM   4174  C  CD1 . ILE A 1 543  ? 5.872   16.462  -19.017 1.00 70.91  ? 543  ILE A CD1 1 
ATOM   4175  N  N   . THR A 1 544  ? 8.830   18.174  -14.681 1.00 67.26  ? 544  THR A N   1 
ATOM   4176  C  CA  . THR A 1 544  ? 8.419   18.033  -13.291 1.00 70.14  ? 544  THR A CA  1 
ATOM   4177  C  C   . THR A 1 544  ? 7.603   19.253  -12.861 1.00 72.57  ? 544  THR A C   1 
ATOM   4178  O  O   . THR A 1 544  ? 8.087   20.385  -12.886 1.00 73.00  ? 544  THR A O   1 
ATOM   4179  C  CB  . THR A 1 544  ? 9.606   17.759  -12.358 1.00 69.51  ? 544  THR A CB  1 
ATOM   4180  O  OG1 . THR A 1 544  ? 10.335  16.632  -12.853 1.00 70.11  ? 544  THR A OG1 1 
ATOM   4181  C  CG2 . THR A 1 544  ? 9.183   17.536  -10.921 1.00 69.89  ? 544  THR A CG2 1 
ATOM   4182  N  N   . PRO A 1 545  ? 6.328   19.057  -12.460 1.00 75.49  ? 545  PRO A N   1 
ATOM   4183  C  CA  . PRO A 1 545  ? 5.500   20.160  -11.975 1.00 78.33  ? 545  PRO A CA  1 
ATOM   4184  C  C   . PRO A 1 545  ? 5.926   20.545  -10.562 1.00 80.38  ? 545  PRO A C   1 
ATOM   4185  O  O   . PRO A 1 545  ? 5.960   19.706  -9.666  1.00 83.16  ? 545  PRO A O   1 
ATOM   4186  C  CB  . PRO A 1 545  ? 4.087   19.565  -11.985 1.00 80.81  ? 545  PRO A CB  1 
ATOM   4187  C  CG  . PRO A 1 545  ? 4.313   18.082  -11.764 1.00 80.87  ? 545  PRO A CG  1 
ATOM   4188  C  CD  . PRO A 1 545  ? 5.625   17.766  -12.453 1.00 77.30  ? 545  PRO A CD  1 
ATOM   4189  N  N   . LEU A 1 546  ? 6.274   21.819  -10.378 1.00 81.38  ? 546  LEU A N   1 
ATOM   4190  C  CA  . LEU A 1 546  ? 6.779   22.261  -9.091  1.00 83.21  ? 546  LEU A CA  1 
ATOM   4191  C  C   . LEU A 1 546  ? 5.683   23.022  -8.352  1.00 87.51  ? 546  LEU A C   1 
ATOM   4192  O  O   . LEU A 1 546  ? 4.826   23.640  -8.982  1.00 89.14  ? 546  LEU A O   1 
ATOM   4193  C  CB  . LEU A 1 546  ? 8.058   23.078  -9.302  1.00 81.61  ? 546  LEU A CB  1 
ATOM   4194  C  CG  . LEU A 1 546  ? 9.198   22.308  -9.972  1.00 78.96  ? 546  LEU A CG  1 
ATOM   4195  C  CD1 . LEU A 1 546  ? 10.469  23.138  -10.012 1.00 78.95  ? 546  LEU A CD1 1 
ATOM   4196  C  CD2 . LEU A 1 546  ? 9.454   20.983  -9.267  1.00 78.48  ? 546  LEU A CD2 1 
ATOM   4197  N  N   . GLY A 1 547  ? 5.727   22.936  -7.015  1.00 90.93  ? 547  GLY A N   1 
ATOM   4198  C  CA  . GLY A 1 547  ? 4.658   23.361  -6.121  1.00 95.25  ? 547  GLY A CA  1 
ATOM   4199  C  C   . GLY A 1 547  ? 4.157   24.762  -6.424  1.00 97.59  ? 547  GLY A C   1 
ATOM   4200  O  O   . GLY A 1 547  ? 3.108   24.845  -7.097  1.00 98.99  ? 547  GLY A O   1 
ATOM   4201  N  N   . GLY A 1 551  ? -0.405  19.457  -10.202 1.00 117.40 ? 551  GLY A N   1 
ATOM   4202  C  CA  . GLY A 1 551  ? 0.469   18.513  -10.926 1.00 111.35 ? 551  GLY A CA  1 
ATOM   4203  C  C   . GLY A 1 551  ? 0.382   18.692  -12.444 1.00 108.90 ? 551  GLY A C   1 
ATOM   4204  O  O   . GLY A 1 551  ? 0.343   17.712  -13.188 1.00 109.94 ? 551  GLY A O   1 
ATOM   4205  N  N   . LEU A 1 552  ? 0.350   19.958  -12.884 1.00 103.90 ? 552  LEU A N   1 
ATOM   4206  C  CA  . LEU A 1 552  ? 0.393   20.336  -14.290 1.00 98.36  ? 552  LEU A CA  1 
ATOM   4207  C  C   . LEU A 1 552  ? 1.423   21.452  -14.456 1.00 94.75  ? 552  LEU A C   1 
ATOM   4208  O  O   . LEU A 1 552  ? 1.225   22.555  -13.952 1.00 97.15  ? 552  LEU A O   1 
ATOM   4209  C  CB  . LEU A 1 552  ? -1.002  20.823  -14.694 1.00 100.34 ? 552  LEU A CB  1 
ATOM   4210  C  CG  . LEU A 1 552  ? -1.207  21.196  -16.164 1.00 100.67 ? 552  LEU A CG  1 
ATOM   4211  C  CD1 . LEU A 1 552  ? -1.630  19.981  -16.980 1.00 100.39 ? 552  LEU A CD1 1 
ATOM   4212  C  CD2 . LEU A 1 552  ? -2.251  22.298  -16.295 1.00 101.92 ? 552  LEU A CD2 1 
ATOM   4213  N  N   . SER A 1 553  ? 2.508   21.166  -15.182 1.00 88.74  ? 553  SER A N   1 
ATOM   4214  C  CA  . SER A 1 553  ? 3.616   22.098  -15.297 1.00 83.43  ? 553  SER A CA  1 
ATOM   4215  C  C   . SER A 1 553  ? 3.293   23.193  -16.311 1.00 82.45  ? 553  SER A C   1 
ATOM   4216  O  O   . SER A 1 553  ? 2.809   22.910  -17.400 1.00 83.56  ? 553  SER A O   1 
ATOM   4217  C  CB  . SER A 1 553  ? 4.878   21.379  -15.669 1.00 81.63  ? 553  SER A CB  1 
ATOM   4218  O  OG  . SER A 1 553  ? 5.970   22.284  -15.716 1.00 82.36  ? 553  SER A OG  1 
ATOM   4219  N  N   . PRO A 1 554  ? 3.568   24.478  -16.002 1.00 81.17  ? 554  PRO A N   1 
ATOM   4220  C  CA  . PRO A 1 554  ? 3.536   25.524  -17.021 1.00 81.19  ? 554  PRO A CA  1 
ATOM   4221  C  C   . PRO A 1 554  ? 4.864   25.642  -17.780 1.00 79.65  ? 554  PRO A C   1 
ATOM   4222  O  O   . PRO A 1 554  ? 4.993   26.486  -18.669 1.00 80.63  ? 554  PRO A O   1 
ATOM   4223  C  CB  . PRO A 1 554  ? 3.213   26.792  -16.211 1.00 82.88  ? 554  PRO A CB  1 
ATOM   4224  C  CG  . PRO A 1 554  ? 3.488   26.446  -14.742 1.00 83.10  ? 554  PRO A CG  1 
ATOM   4225  C  CD  . PRO A 1 554  ? 3.908   24.994  -14.670 1.00 81.49  ? 554  PRO A CD  1 
ATOM   4226  N  N   . LEU A 1 555  ? 5.832   24.761  -17.457 1.00 76.68  ? 555  LEU A N   1 
ATOM   4227  C  CA  . LEU A 1 555  ? 7.226   24.884  -17.874 1.00 72.79  ? 555  LEU A CA  1 
ATOM   4228  C  C   . LEU A 1 555  ? 7.740   23.583  -18.484 1.00 71.15  ? 555  LEU A C   1 
ATOM   4229  O  O   . LEU A 1 555  ? 7.489   22.500  -17.962 1.00 70.70  ? 555  LEU A O   1 
ATOM   4230  C  CB  . LEU A 1 555  ? 8.093   25.201  -16.650 1.00 71.11  ? 555  LEU A CB  1 
ATOM   4231  C  CG  . LEU A 1 555  ? 7.853   26.536  -15.952 1.00 72.02  ? 555  LEU A CG  1 
ATOM   4232  C  CD1 . LEU A 1 555  ? 8.734   26.643  -14.717 1.00 70.80  ? 555  LEU A CD1 1 
ATOM   4233  C  CD2 . LEU A 1 555  ? 8.119   27.697  -16.895 1.00 72.17  ? 555  LEU A CD2 1 
ATOM   4234  N  N   . CYS A 1 556  ? 8.542   23.710  -19.544 1.00 70.41  ? 556  CYS A N   1 
ATOM   4235  C  CA  . CYS A 1 556  ? 9.313   22.582  -20.045 1.00 69.55  ? 556  CYS A CA  1 
ATOM   4236  C  C   . CYS A 1 556  ? 10.804  22.934  -20.113 1.00 68.37  ? 556  CYS A C   1 
ATOM   4237  O  O   . CYS A 1 556  ? 11.196  23.923  -20.737 1.00 68.73  ? 556  CYS A O   1 
ATOM   4238  C  CB  . CYS A 1 556  ? 8.804   22.135  -21.409 1.00 70.55  ? 556  CYS A CB  1 
ATOM   4239  S  SG  . CYS A 1 556  ? 9.903   20.933  -22.200 1.00 70.11  ? 556  CYS A SG  1 
ATOM   4240  N  N   . ALA A 1 557  ? 11.630  22.095  -19.473 1.00 66.54  ? 557  ALA A N   1 
ATOM   4241  C  CA  . ALA A 1 557  ? 13.074  22.275  -19.431 1.00 65.20  ? 557  ALA A CA  1 
ATOM   4242  C  C   . ALA A 1 557  ? 13.730  21.393  -20.489 1.00 65.40  ? 557  ALA A C   1 
ATOM   4243  O  O   . ALA A 1 557  ? 13.440  20.204  -20.563 1.00 65.93  ? 557  ALA A O   1 
ATOM   4244  C  CB  . ALA A 1 557  ? 13.590  21.960  -18.050 1.00 63.51  ? 557  ALA A CB  1 
ATOM   4245  N  N   . ILE A 1 558  ? 14.617  21.984  -21.298 1.00 65.97  ? 558  ILE A N   1 
ATOM   4246  C  CA  . ILE A 1 558  ? 15.177  21.285  -22.443 1.00 67.33  ? 558  ILE A CA  1 
ATOM   4247  C  C   . ILE A 1 558  ? 16.668  21.594  -22.573 1.00 67.43  ? 558  ILE A C   1 
ATOM   4248  O  O   . ILE A 1 558  ? 17.107  22.710  -22.293 1.00 66.62  ? 558  ILE A O   1 
ATOM   4249  C  CB  . ILE A 1 558  ? 14.382  21.609  -23.728 1.00 69.73  ? 558  ILE A CB  1 
ATOM   4250  C  CG1 . ILE A 1 558  ? 14.596  20.559  -24.822 1.00 71.67  ? 558  ILE A CG1 1 
ATOM   4251  C  CG2 . ILE A 1 558  ? 14.652  23.022  -24.232 1.00 70.49  ? 558  ILE A CG2 1 
ATOM   4252  C  CD1 . ILE A 1 558  ? 14.150  21.010  -26.197 1.00 73.29  ? 558  ILE A CD1 1 
ATOM   4253  N  N   . GLY A 1 559  ? 17.425  20.574  -22.991 1.00 67.89  ? 559  GLY A N   1 
ATOM   4254  C  CA  . GLY A 1 559  ? 18.826  20.708  -23.346 1.00 69.46  ? 559  GLY A CA  1 
ATOM   4255  C  C   . GLY A 1 559  ? 19.024  20.340  -24.810 1.00 72.21  ? 559  GLY A C   1 
ATOM   4256  O  O   . GLY A 1 559  ? 18.416  19.384  -25.287 1.00 73.07  ? 559  GLY A O   1 
ATOM   4257  N  N   . LEU A 1 560  ? 19.862  21.114  -25.510 1.00 73.84  ? 560  LEU A N   1 
ATOM   4258  C  CA  . LEU A 1 560  ? 20.021  20.947  -26.946 1.00 77.13  ? 560  LEU A CA  1 
ATOM   4259  C  C   . LEU A 1 560  ? 21.428  20.459  -27.291 1.00 79.64  ? 560  LEU A C   1 
ATOM   4260  O  O   . LEU A 1 560  ? 22.382  20.639  -26.532 1.00 79.03  ? 560  LEU A O   1 
ATOM   4261  C  CB  . LEU A 1 560  ? 19.733  22.276  -27.651 1.00 77.89  ? 560  LEU A CB  1 
ATOM   4262  C  CG  . LEU A 1 560  ? 18.289  22.767  -27.657 1.00 77.76  ? 560  LEU A CG  1 
ATOM   4263  C  CD1 . LEU A 1 560  ? 18.205  24.042  -28.476 1.00 79.86  ? 560  LEU A CD1 1 
ATOM   4264  C  CD2 . LEU A 1 560  ? 17.353  21.716  -28.237 1.00 79.43  ? 560  LEU A CD2 1 
ATOM   4265  N  N   . TRP A 1 561  ? 21.527  19.833  -28.466 1.00 82.46  ? 561  TRP A N   1 
ATOM   4266  C  CA  . TRP A 1 561  ? 22.786  19.579  -29.141 1.00 85.45  ? 561  TRP A CA  1 
ATOM   4267  C  C   . TRP A 1 561  ? 23.327  20.904  -29.671 1.00 86.55  ? 561  TRP A C   1 
ATOM   4268  O  O   . TRP A 1 561  ? 22.652  21.924  -29.573 1.00 85.98  ? 561  TRP A O   1 
ATOM   4269  C  CB  . TRP A 1 561  ? 22.541  18.594  -30.291 1.00 89.11  ? 561  TRP A CB  1 
ATOM   4270  C  CG  . TRP A 1 561  ? 22.350  17.166  -29.875 1.00 89.77  ? 561  TRP A CG  1 
ATOM   4271  C  CD1 . TRP A 1 561  ? 21.262  16.607  -29.264 1.00 88.10  ? 561  TRP A CD1 1 
ATOM   4272  C  CD2 . TRP A 1 561  ? 23.285  16.092  -30.081 1.00 91.94  ? 561  TRP A CD2 1 
ATOM   4273  N  NE1 . TRP A 1 561  ? 21.464  15.267  -29.060 1.00 88.96  ? 561  TRP A NE1 1 
ATOM   4274  C  CE2 . TRP A 1 561  ? 22.694  14.922  -29.553 1.00 91.49  ? 561  TRP A CE2 1 
ATOM   4275  C  CE3 . TRP A 1 561  ? 24.562  16.013  -30.652 1.00 94.42  ? 561  TRP A CE3 1 
ATOM   4276  C  CZ2 . TRP A 1 561  ? 23.342  13.687  -29.582 1.00 94.01  ? 561  TRP A CZ2 1 
ATOM   4277  C  CZ3 . TRP A 1 561  ? 25.204  14.794  -30.676 1.00 97.14  ? 561  TRP A CZ3 1 
ATOM   4278  C  CH2 . TRP A 1 561  ? 24.598  13.649  -30.149 1.00 97.08  ? 561  TRP A CH2 1 
ATOM   4279  N  N   . THR A 1 562  ? 24.550  20.877  -30.217 1.00 89.02  ? 562  THR A N   1 
ATOM   4280  C  CA  . THR A 1 562  ? 25.091  21.952  -31.037 1.00 90.78  ? 562  THR A CA  1 
ATOM   4281  C  C   . THR A 1 562  ? 25.462  23.167  -30.190 1.00 88.99  ? 562  THR A C   1 
ATOM   4282  O  O   . THR A 1 562  ? 26.635  23.522  -30.110 1.00 92.05  ? 562  THR A O   1 
ATOM   4283  C  CB  . THR A 1 562  ? 24.144  22.346  -32.178 1.00 92.48  ? 562  THR A CB  1 
ATOM   4284  O  OG1 . THR A 1 562  ? 23.692  21.158  -32.829 1.00 94.98  ? 562  THR A OG1 1 
ATOM   4285  C  CG2 . THR A 1 562  ? 24.784  23.284  -33.178 1.00 95.30  ? 562  THR A CG2 1 
ATOM   4286  N  N   . ASP A 1 563  ? 24.464  23.828  -29.598 1.00 85.59  ? 563  ASP A N   1 
ATOM   4287  C  CA  . ASP A 1 563  ? 24.741  25.056  -28.875 1.00 84.10  ? 563  ASP A CA  1 
ATOM   4288  C  C   . ASP A 1 563  ? 25.046  24.763  -27.405 1.00 81.42  ? 563  ASP A C   1 
ATOM   4289  O  O   . ASP A 1 563  ? 25.517  25.642  -26.689 1.00 81.07  ? 563  ASP A O   1 
ATOM   4290  C  CB  . ASP A 1 563  ? 23.705  26.149  -29.170 1.00 85.30  ? 563  ASP A CB  1 
ATOM   4291  C  CG  . ASP A 1 563  ? 22.312  25.954  -28.582 1.00 84.50  ? 563  ASP A CG  1 
ATOM   4292  O  OD1 . ASP A 1 563  ? 22.019  24.848  -28.071 1.00 83.23  ? 563  ASP A OD1 1 
ATOM   4293  O  OD2 . ASP A 1 563  ? 21.520  26.923  -28.638 1.00 85.35  ? 563  ASP A OD2 1 
ATOM   4294  N  N   . ILE A 1 564  ? 24.815  23.518  -26.973 1.00 79.83  ? 564  ILE A N   1 
ATOM   4295  C  CA  . ILE A 1 564  ? 25.038  23.115  -25.590 1.00 77.91  ? 564  ILE A CA  1 
ATOM   4296  C  C   . ILE A 1 564  ? 24.315  24.103  -24.671 1.00 75.64  ? 564  ILE A C   1 
ATOM   4297  O  O   . ILE A 1 564  ? 24.931  24.799  -23.862 1.00 76.00  ? 564  ILE A O   1 
ATOM   4298  C  CB  . ILE A 1 564  ? 26.543  22.934  -25.265 1.00 78.89  ? 564  ILE A CB  1 
ATOM   4299  C  CG1 . ILE A 1 564  ? 27.203  21.871  -26.146 1.00 80.27  ? 564  ILE A CG1 1 
ATOM   4300  C  CG2 . ILE A 1 564  ? 26.744  22.598  -23.796 1.00 78.08  ? 564  ILE A CG2 1 
ATOM   4301  C  CD1 . ILE A 1 564  ? 27.765  22.394  -27.440 1.00 83.11  ? 564  ILE A CD1 1 
ATOM   4302  N  N   . SER A 1 565  ? 22.987  24.159  -24.828 1.00 73.85  ? 565  SER A N   1 
ATOM   4303  C  CA  . SER A 1 565  ? 22.151  25.128  -24.140 1.00 72.06  ? 565  SER A CA  1 
ATOM   4304  C  C   . SER A 1 565  ? 21.093  24.434  -23.284 1.00 68.96  ? 565  SER A C   1 
ATOM   4305  O  O   . SER A 1 565  ? 20.639  23.339  -23.604 1.00 68.05  ? 565  SER A O   1 
ATOM   4306  C  CB  . SER A 1 565  ? 21.504  26.072  -25.128 1.00 73.78  ? 565  SER A CB  1 
ATOM   4307  O  OG  . SER A 1 565  ? 20.608  25.376  -25.990 1.00 73.61  ? 565  SER A OG  1 
ATOM   4308  N  N   . ALA A 1 566  ? 20.707  25.107  -22.198 1.00 66.94  ? 566  ALA A N   1 
ATOM   4309  C  CA  . ALA A 1 566  ? 19.604  24.708  -21.346 1.00 65.04  ? 566  ALA A CA  1 
ATOM   4310  C  C   . ALA A 1 566  ? 18.514  25.765  -21.479 1.00 65.51  ? 566  ALA A C   1 
ATOM   4311  O  O   . ALA A 1 566  ? 18.806  26.952  -21.353 1.00 66.43  ? 566  ALA A O   1 
ATOM   4312  C  CB  . ALA A 1 566  ? 20.098  24.635  -19.926 1.00 63.77  ? 566  ALA A CB  1 
ATOM   4313  N  N   . ARG A 1 567  ? 17.272  25.342  -21.742 1.00 65.05  ? 567  ARG A N   1 
ATOM   4314  C  CA  . ARG A 1 567  ? 16.212  26.313  -21.962 1.00 65.24  ? 567  ARG A CA  1 
ATOM   4315  C  C   . ARG A 1 567  ? 14.978  25.958  -21.144 1.00 64.93  ? 567  ARG A C   1 
ATOM   4316  O  O   . ARG A 1 567  ? 14.690  24.784  -20.936 1.00 65.25  ? 567  ARG A O   1 
ATOM   4317  C  CB  . ARG A 1 567  ? 15.836  26.389  -23.442 1.00 66.14  ? 567  ARG A CB  1 
ATOM   4318  C  CG  . ARG A 1 567  ? 17.015  26.633  -24.368 1.00 66.96  ? 567  ARG A CG  1 
ATOM   4319  C  CD  . ARG A 1 567  ? 16.534  26.817  -25.789 1.00 68.74  ? 567  ARG A CD  1 
ATOM   4320  N  NE  . ARG A 1 567  ? 17.649  26.991  -26.704 1.00 69.87  ? 567  ARG A NE  1 
ATOM   4321  C  CZ  . ARG A 1 567  ? 17.537  27.315  -27.984 1.00 71.91  ? 567  ARG A CZ  1 
ATOM   4322  N  NH1 . ARG A 1 567  ? 16.350  27.506  -28.533 1.00 73.64  ? 567  ARG A NH1 1 
ATOM   4323  N  NH2 . ARG A 1 567  ? 18.623  27.440  -28.718 1.00 73.74  ? 567  ARG A NH2 1 
ATOM   4324  N  N   . ILE A 1 568  ? 14.266  27.000  -20.701 1.00 65.36  ? 568  ILE A N   1 
ATOM   4325  C  CA  . ILE A 1 568  ? 12.962  26.904  -20.070 1.00 64.35  ? 568  ILE A CA  1 
ATOM   4326  C  C   . ILE A 1 568  ? 11.953  27.488  -21.055 1.00 66.83  ? 568  ILE A C   1 
ATOM   4327  O  O   . ILE A 1 568  ? 12.118  28.620  -21.512 1.00 67.63  ? 568  ILE A O   1 
ATOM   4328  C  CB  . ILE A 1 568  ? 12.960  27.669  -18.730 1.00 63.36  ? 568  ILE A CB  1 
ATOM   4329  C  CG1 . ILE A 1 568  ? 14.100  27.247  -17.794 1.00 61.41  ? 568  ILE A CG1 1 
ATOM   4330  C  CG2 . ILE A 1 568  ? 11.599  27.618  -18.054 1.00 63.76  ? 568  ILE A CG2 1 
ATOM   4331  C  CD1 . ILE A 1 568  ? 13.984  25.858  -17.214 1.00 59.69  ? 568  ILE A CD1 1 
ATOM   4332  N  N   . LEU A 1 569  ? 10.932  26.682  -21.381 1.00 68.23  ? 569  LEU A N   1 
ATOM   4333  C  CA  . LEU A 1 569  ? 9.888   27.033  -22.332 1.00 70.25  ? 569  LEU A CA  1 
ATOM   4334  C  C   . LEU A 1 569  ? 8.553   27.046  -21.597 1.00 71.82  ? 569  LEU A C   1 
ATOM   4335  O  O   . LEU A 1 569  ? 8.352   26.207  -20.718 1.00 71.41  ? 569  LEU A O   1 
ATOM   4336  C  CB  . LEU A 1 569  ? 9.874   25.981  -23.447 1.00 69.88  ? 569  LEU A CB  1 
ATOM   4337  C  CG  . LEU A 1 569  ? 11.224  25.645  -24.078 1.00 69.28  ? 569  LEU A CG  1 
ATOM   4338  C  CD1 . LEU A 1 569  ? 11.064  24.563  -25.132 1.00 70.34  ? 569  LEU A CD1 1 
ATOM   4339  C  CD2 . LEU A 1 569  ? 11.870  26.880  -24.686 1.00 70.47  ? 569  LEU A CD2 1 
ATOM   4340  N  N   . LYS A 1 570  ? 7.675   28.006  -21.952 1.00 74.54  ? 570  LYS A N   1 
ATOM   4341  C  CA  . LYS A 1 570  ? 6.295   28.082  -21.475 1.00 76.09  ? 570  LYS A CA  1 
ATOM   4342  C  C   . LYS A 1 570  ? 5.484   26.954  -22.114 1.00 76.25  ? 570  LYS A C   1 
ATOM   4343  O  O   . LYS A 1 570  ? 5.698   26.629  -23.280 1.00 76.06  ? 570  LYS A O   1 
ATOM   4344  C  CB  . LYS A 1 570  ? 5.691   29.453  -21.816 1.00 79.99  ? 570  LYS A CB  1 
ATOM   4345  C  CG  . LYS A 1 570  ? 4.271   29.766  -21.333 1.00 83.71  ? 570  LYS A CG  1 
ATOM   4346  C  CD  . LYS A 1 570  ? 4.113   29.986  -19.830 1.00 84.24  ? 570  LYS A CD  1 
ATOM   4347  C  CE  . LYS A 1 570  ? 3.584   31.354  -19.446 1.00 86.97  ? 570  LYS A CE  1 
ATOM   4348  N  NZ  . LYS A 1 570  ? 4.643   32.201  -18.837 1.00 86.56  ? 570  LYS A NZ  1 
ATOM   4349  N  N   . LEU A 1 571  ? 4.569   26.355  -21.340 1.00 76.65  ? 571  LEU A N   1 
ATOM   4350  C  CA  . LEU A 1 571  ? 3.648   25.353  -21.864 1.00 78.09  ? 571  LEU A CA  1 
ATOM   4351  C  C   . LEU A 1 571  ? 2.240   25.937  -21.918 1.00 81.17  ? 571  LEU A C   1 
ATOM   4352  O  O   . LEU A 1 571  ? 1.787   26.544  -20.951 1.00 81.77  ? 571  LEU A O   1 
ATOM   4353  C  CB  . LEU A 1 571  ? 3.686   24.101  -20.982 1.00 76.70  ? 571  LEU A CB  1 
ATOM   4354  C  CG  . LEU A 1 571  ? 4.729   23.054  -21.372 1.00 74.86  ? 571  LEU A CG  1 
ATOM   4355  C  CD1 . LEU A 1 571  ? 4.529   21.765  -20.585 1.00 73.24  ? 571  LEU A CD1 1 
ATOM   4356  C  CD2 . LEU A 1 571  ? 4.692   22.784  -22.869 1.00 75.88  ? 571  LEU A CD2 1 
ATOM   4357  N  N   . PRO A 1 572  ? 1.486   25.755  -23.029 1.00 84.01  ? 572  PRO A N   1 
ATOM   4358  C  CA  . PRO A 1 572  ? 1.906   24.916  -24.154 1.00 83.90  ? 572  PRO A CA  1 
ATOM   4359  C  C   . PRO A 1 572  ? 2.486   25.633  -25.372 1.00 84.47  ? 572  PRO A C   1 
ATOM   4360  O  O   . PRO A 1 572  ? 2.717   25.003  -26.403 1.00 84.97  ? 572  PRO A O   1 
ATOM   4361  C  CB  . PRO A 1 572  ? 0.541   24.362  -24.591 1.00 87.34  ? 572  PRO A CB  1 
ATOM   4362  C  CG  . PRO A 1 572  ? -0.429  25.509  -24.379 1.00 88.94  ? 572  PRO A CG  1 
ATOM   4363  C  CD  . PRO A 1 572  ? 0.138   26.314  -23.227 1.00 87.03  ? 572  PRO A CD  1 
ATOM   4364  N  N   . SER A 1 573  ? 2.707   26.948  -25.247 1.00 84.54  ? 573  SER A N   1 
ATOM   4365  C  CA  . SER A 1 573  ? 3.091   27.788  -26.373 1.00 86.16  ? 573  SER A CA  1 
ATOM   4366  C  C   . SER A 1 573  ? 4.462   27.388  -26.912 1.00 84.42  ? 573  SER A C   1 
ATOM   4367  O  O   . SER A 1 573  ? 4.715   27.516  -28.106 1.00 86.21  ? 573  SER A O   1 
ATOM   4368  C  CB  . SER A 1 573  ? 3.047   29.254  -26.016 1.00 87.17  ? 573  SER A CB  1 
ATOM   4369  O  OG  . SER A 1 573  ? 3.772   29.526  -24.823 1.00 85.24  ? 573  SER A OG  1 
ATOM   4370  N  N   . PHE A 1 574  ? 5.330   26.912  -26.008 1.00 81.61  ? 574  PHE A N   1 
ATOM   4371  C  CA  . PHE A 1 574  ? 6.720   26.572  -26.276 1.00 79.98  ? 574  PHE A CA  1 
ATOM   4372  C  C   . PHE A 1 574  ? 7.578   27.830  -26.413 1.00 80.15  ? 574  PHE A C   1 
ATOM   4373  O  O   . PHE A 1 574  ? 8.716   27.760  -26.873 1.00 79.11  ? 574  PHE A O   1 
ATOM   4374  C  CB  . PHE A 1 574  ? 6.853   25.611  -27.460 1.00 81.26  ? 574  PHE A CB  1 
ATOM   4375  C  CG  . PHE A 1 574  ? 6.610   24.158  -27.138 1.00 81.20  ? 574  PHE A CG  1 
ATOM   4376  C  CD1 . PHE A 1 574  ? 7.094   23.583  -25.965 1.00 78.65  ? 574  PHE A CD1 1 
ATOM   4377  C  CD2 . PHE A 1 574  ? 5.912   23.356  -28.029 1.00 83.15  ? 574  PHE A CD2 1 
ATOM   4378  C  CE1 . PHE A 1 574  ? 6.875   22.242  -25.691 1.00 77.99  ? 574  PHE A CE1 1 
ATOM   4379  C  CE2 . PHE A 1 574  ? 5.700   22.014  -27.759 1.00 82.94  ? 574  PHE A CE2 1 
ATOM   4380  C  CZ  . PHE A 1 574  ? 6.179   21.462  -26.590 1.00 80.60  ? 574  PHE A CZ  1 
ATOM   4381  N  N   . GLU A 1 575  ? 7.027   28.967  -25.975 1.00 82.01  ? 575  GLU A N   1 
ATOM   4382  C  CA  . GLU A 1 575  ? 7.736   30.236  -25.923 1.00 82.81  ? 575  GLU A CA  1 
ATOM   4383  C  C   . GLU A 1 575  ? 8.962   30.090  -25.023 1.00 79.07  ? 575  GLU A C   1 
ATOM   4384  O  O   . GLU A 1 575  ? 8.887   29.481  -23.956 1.00 76.57  ? 575  GLU A O   1 
ATOM   4385  C  CB  . GLU A 1 575  ? 6.785   31.333  -25.432 1.00 86.90  ? 575  GLU A CB  1 
ATOM   4386  C  CG  . GLU A 1 575  ? 7.476   32.594  -24.928 1.00 88.70  ? 575  GLU A CG  1 
ATOM   4387  C  CD  . GLU A 1 575  ? 6.568   33.805  -24.766 1.00 93.55  ? 575  GLU A CD  1 
ATOM   4388  O  OE1 . GLU A 1 575  ? 5.474   33.662  -24.164 1.00 94.04  ? 575  GLU A OE1 1 
ATOM   4389  O  OE2 . GLU A 1 575  ? 6.954   34.894  -25.251 1.00 96.45  ? 575  GLU A OE2 1 
ATOM   4390  N  N   . LEU A 1 576  ? 10.089  30.657  -25.473 1.00 77.61  ? 576  LEU A N   1 
ATOM   4391  C  CA  . LEU A 1 576  ? 11.317  30.652  -24.701 1.00 74.04  ? 576  LEU A CA  1 
ATOM   4392  C  C   . LEU A 1 576  ? 11.210  31.671  -23.571 1.00 74.27  ? 576  LEU A C   1 
ATOM   4393  O  O   . LEU A 1 576  ? 10.910  32.841  -23.806 1.00 76.12  ? 576  LEU A O   1 
ATOM   4394  C  CB  . LEU A 1 576  ? 12.491  30.972  -25.628 1.00 74.39  ? 576  LEU A CB  1 
ATOM   4395  C  CG  . LEU A 1 576  ? 13.857  31.049  -24.949 1.00 72.99  ? 576  LEU A CG  1 
ATOM   4396  C  CD1 . LEU A 1 576  ? 14.365  29.662  -24.586 1.00 70.67  ? 576  LEU A CD1 1 
ATOM   4397  C  CD2 . LEU A 1 576  ? 14.862  31.753  -25.840 1.00 74.31  ? 576  LEU A CD2 1 
ATOM   4398  N  N   . LEU A 1 577  ? 11.456  31.201  -22.343 1.00 72.57  ? 577  LEU A N   1 
ATOM   4399  C  CA  . LEU A 1 577  ? 11.479  32.068  -21.179 1.00 73.49  ? 577  LEU A CA  1 
ATOM   4400  C  C   . LEU A 1 577  ? 12.925  32.324  -20.762 1.00 73.38  ? 577  LEU A C   1 
ATOM   4401  O  O   . LEU A 1 577  ? 13.237  33.390  -20.232 1.00 74.29  ? 577  LEU A O   1 
ATOM   4402  C  CB  . LEU A 1 577  ? 10.672  31.423  -20.047 1.00 72.20  ? 577  LEU A CB  1 
ATOM   4403  C  CG  . LEU A 1 577  ? 9.198   31.173  -20.353 1.00 73.63  ? 577  LEU A CG  1 
ATOM   4404  C  CD1 . LEU A 1 577  ? 8.569   30.322  -19.268 1.00 73.30  ? 577  LEU A CD1 1 
ATOM   4405  C  CD2 . LEU A 1 577  ? 8.437   32.481  -20.515 1.00 76.40  ? 577  LEU A CD2 1 
ATOM   4406  N  N   . HIS A 1 578  ? 13.804  31.342  -21.015 1.00 72.94  ? 578  HIS A N   1 
ATOM   4407  C  CA  . HIS A 1 578  ? 15.200  31.466  -20.618 1.00 72.79  ? 578  HIS A CA  1 
ATOM   4408  C  C   . HIS A 1 578  ? 16.116  30.528  -21.401 1.00 70.95  ? 578  HIS A C   1 
ATOM   4409  O  O   . HIS A 1 578  ? 15.854  29.334  -21.494 1.00 70.22  ? 578  HIS A O   1 
ATOM   4410  C  CB  . HIS A 1 578  ? 15.341  31.193  -19.121 1.00 72.54  ? 578  HIS A CB  1 
ATOM   4411  C  CG  . HIS A 1 578  ? 16.557  31.824  -18.537 1.00 74.44  ? 578  HIS A CG  1 
ATOM   4412  N  ND1 . HIS A 1 578  ? 17.815  31.275  -18.682 1.00 73.84  ? 578  HIS A ND1 1 
ATOM   4413  C  CD2 . HIS A 1 578  ? 16.713  32.953  -17.816 1.00 76.22  ? 578  HIS A CD2 1 
ATOM   4414  C  CE1 . HIS A 1 578  ? 18.694  32.034  -18.064 1.00 74.76  ? 578  HIS A CE1 1 
ATOM   4415  N  NE2 . HIS A 1 578  ? 18.044  33.070  -17.528 1.00 76.29  ? 578  HIS A NE2 1 
ATOM   4416  N  N   . LYS A 1 579  ? 17.220  31.077  -21.922 1.00 70.64  ? 579  LYS A N   1 
ATOM   4417  C  CA  . LYS A 1 579  ? 18.249  30.266  -22.554 1.00 69.95  ? 579  LYS A CA  1 
ATOM   4418  C  C   . LYS A 1 579  ? 19.543  30.435  -21.764 1.00 70.50  ? 579  LYS A C   1 
ATOM   4419  O  O   . LYS A 1 579  ? 19.857  31.542  -21.338 1.00 72.19  ? 579  LYS A O   1 
ATOM   4420  C  CB  . LYS A 1 579  ? 18.428  30.660  -24.024 1.00 70.32  ? 579  LYS A CB  1 
ATOM   4421  C  CG  . LYS A 1 579  ? 19.565  29.954  -24.747 1.00 69.82  ? 579  LYS A CG  1 
ATOM   4422  C  CD  . LYS A 1 579  ? 19.410  29.880  -26.248 1.00 70.76  ? 579  LYS A CD  1 
ATOM   4423  C  CE  . LYS A 1 579  ? 19.970  31.084  -26.970 1.00 72.10  ? 579  LYS A CE  1 
ATOM   4424  N  NZ  . LYS A 1 579  ? 20.272  30.760  -28.383 1.00 73.35  ? 579  LYS A NZ  1 
ATOM   4425  N  N   . GLU A 1 580  ? 20.269  29.326  -21.554 1.00 70.20  ? 580  GLU A N   1 
ATOM   4426  C  CA  . GLU A 1 580  ? 21.577  29.349  -20.912 1.00 70.84  ? 580  GLU A CA  1 
ATOM   4427  C  C   . GLU A 1 580  ? 22.587  28.595  -21.771 1.00 70.63  ? 580  GLU A C   1 
ATOM   4428  O  O   . GLU A 1 580  ? 22.421  27.409  -22.040 1.00 68.42  ? 580  GLU A O   1 
ATOM   4429  C  CB  . GLU A 1 580  ? 21.532  28.719  -19.517 1.00 70.59  ? 580  GLU A CB  1 
ATOM   4430  C  CG  . GLU A 1 580  ? 21.069  29.670  -18.430 1.00 72.82  ? 580  GLU A CG  1 
ATOM   4431  C  CD  . GLU A 1 580  ? 22.077  30.742  -18.059 1.00 76.37  ? 580  GLU A CD  1 
ATOM   4432  O  OE1 . GLU A 1 580  ? 23.222  30.364  -17.721 1.00 78.40  ? 580  GLU A OE1 1 
ATOM   4433  O  OE2 . GLU A 1 580  ? 21.723  31.945  -18.122 1.00 78.08  ? 580  GLU A OE2 1 
ATOM   4434  N  N   . MET A 1 581  ? 23.647  29.288  -22.184 1.00 72.91  ? 581  MET A N   1 
ATOM   4435  C  CA  . MET A 1 581  ? 24.740  28.613  -22.862 1.00 75.22  ? 581  MET A CA  1 
ATOM   4436  C  C   . MET A 1 581  ? 25.646  27.968  -21.814 1.00 75.55  ? 581  MET A C   1 
ATOM   4437  O  O   . MET A 1 581  ? 26.269  28.671  -21.018 1.00 75.62  ? 581  MET A O   1 
ATOM   4438  C  CB  . MET A 1 581  ? 25.552  29.602  -23.703 1.00 77.85  ? 581  MET A CB  1 
ATOM   4439  C  CG  . MET A 1 581  ? 24.699  30.565  -24.508 1.00 78.36  ? 581  MET A CG  1 
ATOM   4440  S  SD  . MET A 1 581  ? 23.528  29.731  -25.602 1.00 77.61  ? 581  MET A SD  1 
ATOM   4441  C  CE  . MET A 1 581  ? 24.654  28.874  -26.700 1.00 78.85  ? 581  MET A CE  1 
ATOM   4442  N  N   . LEU A 1 582  ? 25.706  26.628  -21.822 1.00 75.19  ? 582  LEU A N   1 
ATOM   4443  C  CA  . LEU A 1 582  ? 26.464  25.885  -20.826 1.00 74.90  ? 582  LEU A CA  1 
ATOM   4444  C  C   . LEU A 1 582  ? 27.938  25.887  -21.216 1.00 78.01  ? 582  LEU A C   1 
ATOM   4445  O  O   . LEU A 1 582  ? 28.805  25.921  -20.345 1.00 79.86  ? 582  LEU A O   1 
ATOM   4446  C  CB  . LEU A 1 582  ? 25.928  24.454  -20.698 1.00 73.19  ? 582  LEU A CB  1 
ATOM   4447  C  CG  . LEU A 1 582  ? 24.432  24.306  -20.410 1.00 70.05  ? 582  LEU A CG  1 
ATOM   4448  C  CD1 . LEU A 1 582  ? 23.981  22.883  -20.681 1.00 68.62  ? 582  LEU A CD1 1 
ATOM   4449  C  CD2 . LEU A 1 582  ? 24.092  24.711  -18.982 1.00 68.46  ? 582  LEU A CD2 1 
ATOM   4450  N  N   . GLY A 1 583  ? 28.197  25.875  -22.530 1.00 79.54  ? 583  GLY A N   1 
ATOM   4451  C  CA  . GLY A 1 583  ? 29.546  25.982  -23.060 1.00 81.63  ? 583  GLY A CA  1 
ATOM   4452  C  C   . GLY A 1 583  ? 30.193  24.609  -23.173 1.00 83.03  ? 583  GLY A C   1 
ATOM   4453  O  O   . GLY A 1 583  ? 29.706  23.642  -22.592 1.00 81.31  ? 583  GLY A O   1 
ATOM   4454  N  N   . GLY A 1 584  ? 31.297  24.544  -23.922 1.00 86.92  ? 584  GLY A N   1 
ATOM   4455  C  CA  . GLY A 1 584  ? 31.964  23.286  -24.210 1.00 89.13  ? 584  GLY A CA  1 
ATOM   4456  C  C   . GLY A 1 584  ? 31.436  22.658  -25.497 1.00 90.64  ? 584  GLY A C   1 
ATOM   4457  O  O   . GLY A 1 584  ? 30.614  23.253  -26.194 1.00 89.42  ? 584  GLY A O   1 
ATOM   4458  N  N   . GLU A 1 585  ? 31.938  21.455  -25.802 1.00 93.80  ? 585  GLU A N   1 
ATOM   4459  C  CA  . GLU A 1 585  ? 31.521  20.706  -26.976 1.00 95.76  ? 585  GLU A CA  1 
ATOM   4460  C  C   . GLU A 1 585  ? 30.816  19.422  -26.544 1.00 94.02  ? 585  GLU A C   1 
ATOM   4461  O  O   . GLU A 1 585  ? 30.746  18.470  -27.319 1.00 96.48  ? 585  GLU A O   1 
ATOM   4462  C  CB  . GLU A 1 585  ? 32.726  20.390  -27.868 1.00 101.23 ? 585  GLU A CB  1 
ATOM   4463  C  CG  . GLU A 1 585  ? 33.037  21.474  -28.887 1.00 105.27 ? 585  GLU A CG  1 
ATOM   4464  C  CD  . GLU A 1 585  ? 34.010  22.559  -28.444 1.00 108.23 ? 585  GLU A CD  1 
ATOM   4465  O  OE1 . GLU A 1 585  ? 35.037  22.216  -27.811 1.00 111.50 ? 585  GLU A OE1 1 
ATOM   4466  O  OE2 . GLU A 1 585  ? 33.750  23.748  -28.744 1.00 107.70 ? 585  GLU A OE2 1 
ATOM   4467  N  N   . ILE A 1 586  ? 30.301  19.402  -25.305 1.00 89.77  ? 586  ILE A N   1 
ATOM   4468  C  CA  . ILE A 1 586  ? 29.663  18.216  -24.752 1.00 87.86  ? 586  ILE A CA  1 
ATOM   4469  C  C   . ILE A 1 586  ? 28.214  18.544  -24.416 1.00 83.76  ? 586  ILE A C   1 
ATOM   4470  O  O   . ILE A 1 586  ? 27.950  19.527  -23.726 1.00 81.67  ? 586  ILE A O   1 
ATOM   4471  C  CB  . ILE A 1 586  ? 30.414  17.694  -23.508 1.00 88.99  ? 586  ILE A CB  1 
ATOM   4472  C  CG1 . ILE A 1 586  ? 31.898  17.416  -23.776 1.00 92.52  ? 586  ILE A CG1 1 
ATOM   4473  C  CG2 . ILE A 1 586  ? 29.715  16.476  -22.926 1.00 88.25  ? 586  ILE A CG2 1 
ATOM   4474  C  CD1 . ILE A 1 586  ? 32.171  16.280  -24.738 1.00 94.74  ? 586  ILE A CD1 1 
ATOM   4475  N  N   . ILE A 1 587  ? 27.305  17.670  -24.867 1.00 82.85  ? 587  ILE A N   1 
ATOM   4476  C  CA  . ILE A 1 587  ? 25.871  17.889  -24.772 1.00 79.79  ? 587  ILE A CA  1 
ATOM   4477  C  C   . ILE A 1 587  ? 25.387  17.637  -23.345 1.00 77.75  ? 587  ILE A C   1 
ATOM   4478  O  O   . ILE A 1 587  ? 25.959  16.829  -22.615 1.00 79.58  ? 587  ILE A O   1 
ATOM   4479  C  CB  . ILE A 1 587  ? 25.105  17.025  -25.794 1.00 80.55  ? 587  ILE A CB  1 
ATOM   4480  C  CG1 . ILE A 1 587  ? 25.160  15.533  -25.455 1.00 81.64  ? 587  ILE A CG1 1 
ATOM   4481  C  CG2 . ILE A 1 587  ? 25.598  17.303  -27.204 1.00 83.56  ? 587  ILE A CG2 1 
ATOM   4482  C  CD1 . ILE A 1 587  ? 23.879  14.789  -25.765 1.00 81.77  ? 587  ILE A CD1 1 
ATOM   4483  N  N   . PRO A 1 588  ? 24.303  18.316  -22.915 1.00 74.62  ? 588  PRO A N   1 
ATOM   4484  C  CA  . PRO A 1 588  ? 23.674  18.003  -21.636 1.00 73.24  ? 588  PRO A CA  1 
ATOM   4485  C  C   . PRO A 1 588  ? 23.185  16.565  -21.781 1.00 74.85  ? 588  PRO A C   1 
ATOM   4486  O  O   . PRO A 1 588  ? 22.756  16.161  -22.858 1.00 76.80  ? 588  PRO A O   1 
ATOM   4487  C  CB  . PRO A 1 588  ? 22.485  18.968  -21.558 1.00 71.53  ? 588  PRO A CB  1 
ATOM   4488  C  CG  . PRO A 1 588  ? 22.785  20.047  -22.581 1.00 72.23  ? 588  PRO A CG  1 
ATOM   4489  C  CD  . PRO A 1 588  ? 23.615  19.382  -23.655 1.00 73.79  ? 588  PRO A CD  1 
ATOM   4490  N  N   . ARG A 1 589  ? 23.297  15.780  -20.709 1.00 75.06  ? 589  ARG A N   1 
ATOM   4491  C  CA  . ARG A 1 589  ? 22.900  14.384  -20.760 1.00 76.68  ? 589  ARG A CA  1 
ATOM   4492  C  C   . ARG A 1 589  ? 21.553  14.232  -20.059 1.00 73.67  ? 589  ARG A C   1 
ATOM   4493  O  O   . ARG A 1 589  ? 20.665  13.531  -20.539 1.00 73.87  ? 589  ARG A O   1 
ATOM   4494  C  CB  . ARG A 1 589  ? 24.013  13.523  -20.150 1.00 80.62  ? 589  ARG A CB  1 
ATOM   4495  C  CG  . ARG A 1 589  ? 23.614  12.097  -19.794 1.00 84.45  ? 589  ARG A CG  1 
ATOM   4496  C  CD  . ARG A 1 589  ? 23.851  11.064  -20.883 1.00 89.46  ? 589  ARG A CD  1 
ATOM   4497  N  NE  . ARG A 1 589  ? 23.593  9.701   -20.424 1.00 93.04  ? 589  ARG A NE  1 
ATOM   4498  C  CZ  . ARG A 1 589  ? 22.444  9.038   -20.575 1.00 94.30  ? 589  ARG A CZ  1 
ATOM   4499  N  NH1 . ARG A 1 589  ? 21.415  9.608   -21.181 1.00 93.79  ? 589  ARG A NH1 1 
ATOM   4500  N  NH2 . ARG A 1 589  ? 22.329  7.803   -20.117 1.00 96.38  ? 589  ARG A NH2 1 
ATOM   4501  N  N   . SER A 1 590  ? 21.428  14.920  -18.925 1.00 70.19  ? 590  SER A N   1 
ATOM   4502  C  CA  . SER A 1 590  ? 20.254  14.846  -18.084 1.00 68.35  ? 590  SER A CA  1 
ATOM   4503  C  C   . SER A 1 590  ? 19.890  16.257  -17.631 1.00 65.93  ? 590  SER A C   1 
ATOM   4504  O  O   . SER A 1 590  ? 20.763  17.098  -17.461 1.00 66.85  ? 590  SER A O   1 
ATOM   4505  C  CB  . SER A 1 590  ? 20.533  13.926  -16.931 1.00 69.90  ? 590  SER A CB  1 
ATOM   4506  O  OG  . SER A 1 590  ? 19.733  14.258  -15.811 1.00 70.82  ? 590  SER A OG  1 
ATOM   4507  N  N   . ILE A 1 591  ? 18.592  16.518  -17.472 1.00 64.21  ? 591  ILE A N   1 
ATOM   4508  C  CA  . ILE A 1 591  ? 18.113  17.801  -16.989 1.00 62.48  ? 591  ILE A CA  1 
ATOM   4509  C  C   . ILE A 1 591  ? 16.891  17.533  -16.114 1.00 62.25  ? 591  ILE A C   1 
ATOM   4510  O  O   . ILE A 1 591  ? 16.161  16.568  -16.342 1.00 63.90  ? 591  ILE A O   1 
ATOM   4511  C  CB  . ILE A 1 591  ? 17.830  18.757  -18.168 1.00 61.96  ? 591  ILE A CB  1 
ATOM   4512  C  CG1 . ILE A 1 591  ? 17.821  20.226  -17.739 1.00 60.62  ? 591  ILE A CG1 1 
ATOM   4513  C  CG2 . ILE A 1 591  ? 16.563  18.372  -18.920 1.00 62.70  ? 591  ILE A CG2 1 
ATOM   4514  C  CD1 . ILE A 1 591  ? 17.931  21.194  -18.893 1.00 60.67  ? 591  ILE A CD1 1 
ATOM   4515  N  N   . LEU A 1 592  ? 16.690  18.370  -15.095 1.00 60.57  ? 592  LEU A N   1 
ATOM   4516  C  CA  . LEU A 1 592  ? 15.686  18.067  -14.096 1.00 60.71  ? 592  LEU A CA  1 
ATOM   4517  C  C   . LEU A 1 592  ? 15.304  19.360  -13.388 1.00 60.72  ? 592  LEU A C   1 
ATOM   4518  O  O   . LEU A 1 592  ? 16.155  20.206  -13.161 1.00 60.07  ? 592  LEU A O   1 
ATOM   4519  C  CB  . LEU A 1 592  ? 16.290  17.037  -13.138 1.00 61.77  ? 592  LEU A CB  1 
ATOM   4520  C  CG  . LEU A 1 592  ? 15.423  16.562  -11.975 1.00 63.18  ? 592  LEU A CG  1 
ATOM   4521  C  CD1 . LEU A 1 592  ? 14.479  15.458  -12.419 1.00 63.47  ? 592  LEU A CD1 1 
ATOM   4522  C  CD2 . LEU A 1 592  ? 16.309  16.050  -10.846 1.00 64.84  ? 592  LEU A CD2 1 
ATOM   4523  N  N   . MET A 1 593  ? 14.004  19.526  -13.120 1.00 62.63  ? 593  MET A N   1 
ATOM   4524  C  CA  . MET A 1 593  ? 13.501  20.582  -12.257 1.00 63.67  ? 593  MET A CA  1 
ATOM   4525  C  C   . MET A 1 593  ? 13.099  19.937  -10.931 1.00 64.75  ? 593  MET A C   1 
ATOM   4526  O  O   . MET A 1 593  ? 12.584  18.818  -10.935 1.00 64.43  ? 593  MET A O   1 
ATOM   4527  C  CB  . MET A 1 593  ? 12.301  21.292  -12.897 1.00 64.39  ? 593  MET A CB  1 
ATOM   4528  C  CG  . MET A 1 593  ? 12.619  21.875  -14.266 1.00 64.40  ? 593  MET A CG  1 
ATOM   4529  S  SD  . MET A 1 593  ? 11.313  22.876  -15.033 1.00 65.26  ? 593  MET A SD  1 
ATOM   4530  C  CE  . MET A 1 593  ? 10.054  21.641  -15.343 1.00 65.53  ? 593  MET A CE  1 
ATOM   4531  N  N   . THR A 1 594  ? 13.395  20.614  -9.807  1.00 65.40  ? 594  THR A N   1 
ATOM   4532  C  CA  . THR A 1 594  ? 13.216  20.021  -8.488  1.00 66.16  ? 594  THR A CA  1 
ATOM   4533  C  C   . THR A 1 594  ? 13.023  21.096  -7.427  1.00 67.46  ? 594  THR A C   1 
ATOM   4534  O  O   . THR A 1 594  ? 13.498  22.218  -7.583  1.00 67.01  ? 594  THR A O   1 
ATOM   4535  C  CB  . THR A 1 594  ? 14.420  19.157  -8.099  1.00 65.95  ? 594  THR A CB  1 
ATOM   4536  O  OG1 . THR A 1 594  ? 14.723  18.313  -9.207  1.00 65.77  ? 594  THR A OG1 1 
ATOM   4537  C  CG2 . THR A 1 594  ? 14.151  18.286  -6.894  1.00 67.68  ? 594  THR A CG2 1 
ATOM   4538  N  N   . THR A 1 595  ? 12.313  20.721  -6.356  1.00 69.33  ? 595  THR A N   1 
ATOM   4539  C  CA  . THR A 1 595  ? 12.181  21.521  -5.150  1.00 72.13  ? 595  THR A CA  1 
ATOM   4540  C  C   . THR A 1 595  ? 13.044  20.882  -4.064  1.00 74.77  ? 595  THR A C   1 
ATOM   4541  O  O   . THR A 1 595  ? 13.209  19.663  -4.038  1.00 76.12  ? 595  THR A O   1 
ATOM   4542  C  CB  . THR A 1 595  ? 10.703  21.660  -4.759  1.00 73.01  ? 595  THR A CB  1 
ATOM   4543  O  OG1 . THR A 1 595  ? 10.020  22.214  -5.884  1.00 72.23  ? 595  THR A OG1 1 
ATOM   4544  C  CG2 . THR A 1 595  ? 10.479  22.524  -3.537  1.00 74.77  ? 595  THR A CG2 1 
ATOM   4545  N  N   . PHE A 1 596  ? 13.642  21.701  -3.193  1.00 77.10  ? 596  PHE A N   1 
ATOM   4546  C  CA  . PHE A 1 596  ? 14.443  21.124  -2.125  1.00 79.76  ? 596  PHE A CA  1 
ATOM   4547  C  C   . PHE A 1 596  ? 13.893  21.524  -0.760  1.00 85.06  ? 596  PHE A C   1 
ATOM   4548  O  O   . PHE A 1 596  ? 13.475  20.672  0.025   1.00 87.04  ? 596  PHE A O   1 
ATOM   4549  C  CB  . PHE A 1 596  ? 15.940  21.367  -2.336  1.00 77.82  ? 596  PHE A CB  1 
ATOM   4550  C  CG  . PHE A 1 596  ? 16.584  20.304  -3.187  1.00 74.98  ? 596  PHE A CG  1 
ATOM   4551  C  CD1 . PHE A 1 596  ? 16.572  18.975  -2.786  1.00 75.15  ? 596  PHE A CD1 1 
ATOM   4552  C  CD2 . PHE A 1 596  ? 17.174  20.622  -4.402  1.00 72.41  ? 596  PHE A CD2 1 
ATOM   4553  C  CE1 . PHE A 1 596  ? 17.139  17.989  -3.580  1.00 73.74  ? 596  PHE A CE1 1 
ATOM   4554  C  CE2 . PHE A 1 596  ? 17.748  19.635  -5.192  1.00 70.77  ? 596  PHE A CE2 1 
ATOM   4555  C  CZ  . PHE A 1 596  ? 17.727  18.321  -4.781  1.00 71.47  ? 596  PHE A CZ  1 
ATOM   4556  N  N   . GLU A 1 597  ? 13.903  22.831  -0.494  1.00 88.44  ? 597  GLU A N   1 
ATOM   4557  C  CA  . GLU A 1 597  ? 13.344  23.373  0.732   1.00 93.73  ? 597  GLU A CA  1 
ATOM   4558  C  C   . GLU A 1 597  ? 12.382  24.497  0.360   1.00 94.38  ? 597  GLU A C   1 
ATOM   4559  O  O   . GLU A 1 597  ? 12.627  25.661  0.685   1.00 96.21  ? 597  GLU A O   1 
ATOM   4560  C  CB  . GLU A 1 597  ? 14.462  23.896  1.639   1.00 97.30  ? 597  GLU A CB  1 
ATOM   4561  C  CG  . GLU A 1 597  ? 15.051  22.849  2.565   1.00 99.08  ? 597  GLU A CG  1 
ATOM   4562  C  CD  . GLU A 1 597  ? 15.797  23.447  3.746   1.00 103.85 ? 597  GLU A CD  1 
ATOM   4563  O  OE1 . GLU A 1 597  ? 15.744  22.848  4.834   1.00 107.73 ? 597  GLU A OE1 1 
ATOM   4564  O  OE2 . GLU A 1 597  ? 16.428  24.508  3.577   1.00 104.08 ? 597  GLU A OE2 1 
ATOM   4565  N  N   . SER A 1 598  ? 11.299  24.124  -0.337  1.00 93.33  ? 598  SER A N   1 
ATOM   4566  C  CA  . SER A 1 598  ? 10.358  25.060  -0.937  1.00 93.90  ? 598  SER A CA  1 
ATOM   4567  C  C   . SER A 1 598  ? 11.094  26.084  -1.806  1.00 92.35  ? 598  SER A C   1 
ATOM   4568  O  O   . SER A 1 598  ? 10.658  27.231  -1.935  1.00 93.96  ? 598  SER A O   1 
ATOM   4569  C  CB  . SER A 1 598  ? 9.472   25.711  0.101   1.00 98.51  ? 598  SER A CB  1 
ATOM   4570  O  OG  . SER A 1 598  ? 10.170  26.744  0.783   1.00 102.23 ? 598  SER A OG  1 
ATOM   4571  N  N   . SER A 1 599  ? 12.207  25.631  -2.403  1.00 89.11  ? 599  SER A N   1 
ATOM   4572  C  CA  . SER A 1 599  ? 13.032  26.403  -3.318  1.00 85.96  ? 599  SER A CA  1 
ATOM   4573  C  C   . SER A 1 599  ? 13.214  25.603  -4.608  1.00 81.15  ? 599  SER A C   1 
ATOM   4574  O  O   . SER A 1 599  ? 13.535  24.417  -4.555  1.00 79.26  ? 599  SER A O   1 
ATOM   4575  C  CB  . SER A 1 599  ? 14.349  26.724  -2.660  1.00 88.03  ? 599  SER A CB  1 
ATOM   4576  O  OG  . SER A 1 599  ? 15.116  27.615  -3.454  1.00 90.15  ? 599  SER A OG  1 
ATOM   4577  N  N   . HIS A 1 600  ? 12.988  26.254  -5.757  1.00 78.94  ? 600  HIS A N   1 
ATOM   4578  C  CA  . HIS A 1 600  ? 12.991  25.562  -7.039  1.00 76.47  ? 600  HIS A CA  1 
ATOM   4579  C  C   . HIS A 1 600  ? 14.357  25.705  -7.711  1.00 75.06  ? 600  HIS A C   1 
ATOM   4580  O  O   . HIS A 1 600  ? 14.970  26.772  -7.644  1.00 77.46  ? 600  HIS A O   1 
ATOM   4581  C  CB  . HIS A 1 600  ? 11.798  26.018  -7.897  1.00 75.85  ? 600  HIS A CB  1 
ATOM   4582  C  CG  . HIS A 1 600  ? 10.548  26.170  -7.095  1.00 78.20  ? 600  HIS A CG  1 
ATOM   4583  N  ND1 . HIS A 1 600  ? 9.834   25.084  -6.628  1.00 78.03  ? 600  HIS A ND1 1 
ATOM   4584  C  CD2 . HIS A 1 600  ? 9.910   27.269  -6.635  1.00 80.60  ? 600  HIS A CD2 1 
ATOM   4585  C  CE1 . HIS A 1 600  ? 8.804   25.509  -5.925  1.00 80.80  ? 600  HIS A CE1 1 
ATOM   4586  N  NE2 . HIS A 1 600  ? 8.829   26.847  -5.912  1.00 81.77  ? 600  HIS A NE2 1 
ATOM   4587  N  N   . TYR A 1 601  ? 14.830  24.611  -8.329  1.00 71.25  ? 601  TYR A N   1 
ATOM   4588  C  CA  . TYR A 1 601  ? 16.100  24.600  -9.037  1.00 68.69  ? 601  TYR A CA  1 
ATOM   4589  C  C   . TYR A 1 601  ? 15.959  23.906  -10.388 1.00 65.21  ? 601  TYR A C   1 
ATOM   4590  O  O   . TYR A 1 601  ? 15.152  22.994  -10.544 1.00 64.34  ? 601  TYR A O   1 
ATOM   4591  C  CB  . TYR A 1 601  ? 17.168  23.836  -8.248  1.00 70.11  ? 601  TYR A CB  1 
ATOM   4592  C  CG  . TYR A 1 601  ? 17.494  24.383  -6.881  1.00 72.86  ? 601  TYR A CG  1 
ATOM   4593  C  CD1 . TYR A 1 601  ? 16.739  24.018  -5.777  1.00 74.21  ? 601  TYR A CD1 1 
ATOM   4594  C  CD2 . TYR A 1 601  ? 18.565  25.242  -6.687  1.00 73.38  ? 601  TYR A CD2 1 
ATOM   4595  C  CE1 . TYR A 1 601  ? 17.022  24.506  -4.513  1.00 76.78  ? 601  TYR A CE1 1 
ATOM   4596  C  CE2 . TYR A 1 601  ? 18.862  25.740  -5.429  1.00 76.36  ? 601  TYR A CE2 1 
ATOM   4597  C  CZ  . TYR A 1 601  ? 18.086  25.373  -4.342  1.00 78.19  ? 601  TYR A CZ  1 
ATOM   4598  O  OH  . TYR A 1 601  ? 18.361  25.843  -3.092  1.00 81.79  ? 601  TYR A OH  1 
ATOM   4599  N  N   . LEU A 1 602  ? 16.776  24.341  -11.350 1.00 63.19  ? 602  LEU A N   1 
ATOM   4600  C  CA  . LEU A 1 602  ? 17.084  23.528  -12.512 1.00 60.86  ? 602  LEU A CA  1 
ATOM   4601  C  C   . LEU A 1 602  ? 18.460  22.906  -12.312 1.00 60.51  ? 602  LEU A C   1 
ATOM   4602  O  O   . LEU A 1 602  ? 19.423  23.602  -12.005 1.00 62.09  ? 602  LEU A O   1 
ATOM   4603  C  CB  . LEU A 1 602  ? 17.044  24.369  -13.792 1.00 59.96  ? 602  LEU A CB  1 
ATOM   4604  C  CG  . LEU A 1 602  ? 17.436  23.614  -15.061 1.00 58.87  ? 602  LEU A CG  1 
ATOM   4605  C  CD1 . LEU A 1 602  ? 16.399  22.566  -15.410 1.00 58.65  ? 602  LEU A CD1 1 
ATOM   4606  C  CD2 . LEU A 1 602  ? 17.614  24.562  -16.224 1.00 59.50  ? 602  LEU A CD2 1 
ATOM   4607  N  N   . LEU A 1 603  ? 18.520  21.585  -12.473 1.00 59.33  ? 603  LEU A N   1 
ATOM   4608  C  CA  . LEU A 1 603  ? 19.763  20.839  -12.443 1.00 59.63  ? 603  LEU A CA  1 
ATOM   4609  C  C   . LEU A 1 603  ? 20.063  20.380  -13.862 1.00 60.11  ? 603  LEU A C   1 
ATOM   4610  O  O   . LEU A 1 603  ? 19.164  19.939  -14.569 1.00 60.16  ? 603  LEU A O   1 
ATOM   4611  C  CB  . LEU A 1 603  ? 19.586  19.649  -11.501 1.00 59.08  ? 603  LEU A CB  1 
ATOM   4612  C  CG  . LEU A 1 603  ? 19.951  19.907  -10.041 1.00 60.63  ? 603  LEU A CG  1 
ATOM   4613  C  CD1 . LEU A 1 603  ? 19.394  21.227  -9.539  1.00 60.56  ? 603  LEU A CD1 1 
ATOM   4614  C  CD2 . LEU A 1 603  ? 19.472  18.772  -9.157  1.00 61.94  ? 603  LEU A CD2 1 
ATOM   4615  N  N   . CYS A 1 604  ? 21.322  20.524  -14.284 1.00 61.99  ? 604  CYS A N   1 
ATOM   4616  C  CA  . CYS A 1 604  ? 21.702  20.105  -15.620 1.00 62.88  ? 604  CYS A CA  1 
ATOM   4617  C  C   . CYS A 1 604  ? 23.089  19.471  -15.592 1.00 64.45  ? 604  CYS A C   1 
ATOM   4618  O  O   . CYS A 1 604  ? 24.031  20.061  -15.073 1.00 65.33  ? 604  CYS A O   1 
ATOM   4619  C  CB  . CYS A 1 604  ? 21.660  21.279  -16.585 1.00 63.36  ? 604  CYS A CB  1 
ATOM   4620  S  SG  . CYS A 1 604  ? 21.845  20.748  -18.304 1.00 67.51  ? 604  CYS A SG  1 
ATOM   4621  N  N   . ALA A 1 605  ? 23.188  18.261  -16.151 1.00 65.42  ? 605  ALA A N   1 
ATOM   4622  C  CA  . ALA A 1 605  ? 24.405  17.472  -16.111 1.00 67.88  ? 605  ALA A CA  1 
ATOM   4623  C  C   . ALA A 1 605  ? 24.931  17.267  -17.527 1.00 69.68  ? 605  ALA A C   1 
ATOM   4624  O  O   . ALA A 1 605  ? 24.190  16.854  -18.413 1.00 69.58  ? 605  ALA A O   1 
ATOM   4625  C  CB  . ALA A 1 605  ? 24.126  16.157  -15.433 1.00 68.79  ? 605  ALA A CB  1 
ATOM   4626  N  N   . LEU A 1 606  ? 26.227  17.546  -17.706 1.00 72.87  ? 606  LEU A N   1 
ATOM   4627  C  CA  . LEU A 1 606  ? 26.920  17.412  -18.977 1.00 75.13  ? 606  LEU A CA  1 
ATOM   4628  C  C   . LEU A 1 606  ? 27.559  16.029  -19.083 1.00 78.22  ? 606  LEU A C   1 
ATOM   4629  O  O   . LEU A 1 606  ? 27.765  15.341  -18.079 1.00 77.28  ? 606  LEU A O   1 
ATOM   4630  C  CB  . LEU A 1 606  ? 28.000  18.492  -19.052 1.00 76.24  ? 606  LEU A CB  1 
ATOM   4631  C  CG  . LEU A 1 606  ? 27.507  19.937  -19.065 1.00 75.08  ? 606  LEU A CG  1 
ATOM   4632  C  CD1 . LEU A 1 606  ? 28.660  20.885  -19.356 1.00 77.54  ? 606  LEU A CD1 1 
ATOM   4633  C  CD2 . LEU A 1 606  ? 26.408  20.120  -20.099 1.00 74.39  ? 606  LEU A CD2 1 
ATOM   4634  N  N   . GLY A 1 607  ? 27.899  15.656  -20.321 1.00 81.25  ? 607  GLY A N   1 
ATOM   4635  C  CA  . GLY A 1 607  ? 28.405  14.330  -20.631 1.00 85.31  ? 607  GLY A CA  1 
ATOM   4636  C  C   . GLY A 1 607  ? 29.864  14.150  -20.217 1.00 89.37  ? 607  GLY A C   1 
ATOM   4637  O  O   . GLY A 1 607  ? 30.423  13.068  -20.406 1.00 93.16  ? 607  GLY A O   1 
ATOM   4638  N  N   . ASP A 1 608  ? 30.462  15.217  -19.659 1.00 88.66  ? 608  ASP A N   1 
ATOM   4639  C  CA  . ASP A 1 608  ? 31.846  15.213  -19.204 1.00 90.27  ? 608  ASP A CA  1 
ATOM   4640  C  C   . ASP A 1 608  ? 31.925  15.017  -17.689 1.00 88.67  ? 608  ASP A C   1 
ATOM   4641  O  O   . ASP A 1 608  ? 33.000  14.771  -17.156 1.00 92.25  ? 608  ASP A O   1 
ATOM   4642  C  CB  . ASP A 1 608  ? 32.584  16.479  -19.646 1.00 91.43  ? 608  ASP A CB  1 
ATOM   4643  C  CG  . ASP A 1 608  ? 32.134  17.732  -18.913 1.00 89.53  ? 608  ASP A CG  1 
ATOM   4644  O  OD1 . ASP A 1 608  ? 31.153  17.648  -18.152 1.00 87.11  ? 608  ASP A OD1 1 
ATOM   4645  O  OD2 . ASP A 1 608  ? 32.773  18.782  -19.105 1.00 91.12  ? 608  ASP A OD2 1 
ATOM   4646  N  N   . GLY A 1 609  ? 30.788  15.149  -17.003 1.00 84.74  ? 609  GLY A N   1 
ATOM   4647  C  CA  . GLY A 1 609  ? 30.711  14.835  -15.587 1.00 83.28  ? 609  GLY A CA  1 
ATOM   4648  C  C   . GLY A 1 609  ? 30.488  16.081  -14.740 1.00 80.37  ? 609  GLY A C   1 
ATOM   4649  O  O   . GLY A 1 609  ? 30.440  15.993  -13.516 1.00 81.05  ? 609  GLY A O   1 
ATOM   4650  N  N   . ALA A 1 610  ? 30.355  17.232  -15.409 1.00 77.59  ? 610  ALA A N   1 
ATOM   4651  C  CA  . ALA A 1 610  ? 30.096  18.495  -14.738 1.00 75.24  ? 610  ALA A CA  1 
ATOM   4652  C  C   . ALA A 1 610  ? 28.594  18.680  -14.525 1.00 71.98  ? 610  ALA A C   1 
ATOM   4653  O  O   . ALA A 1 610  ? 27.788  18.258  -15.352 1.00 70.86  ? 610  ALA A O   1 
ATOM   4654  C  CB  . ALA A 1 610  ? 30.681  19.625  -15.545 1.00 75.62  ? 610  ALA A CB  1 
ATOM   4655  N  N   . LEU A 1 611  ? 28.230  19.324  -13.410 1.00 70.88  ? 611  LEU A N   1 
ATOM   4656  C  CA  . LEU A 1 611  ? 26.842  19.630  -13.106 1.00 68.56  ? 611  LEU A CA  1 
ATOM   4657  C  C   . LEU A 1 611  ? 26.662  21.121  -12.843 1.00 68.38  ? 611  LEU A C   1 
ATOM   4658  O  O   . LEU A 1 611  ? 27.409  21.711  -12.066 1.00 69.57  ? 611  LEU A O   1 
ATOM   4659  C  CB  . LEU A 1 611  ? 26.395  18.845  -11.873 1.00 68.70  ? 611  LEU A CB  1 
ATOM   4660  C  CG  . LEU A 1 611  ? 24.968  19.158  -11.426 1.00 66.57  ? 611  LEU A CG  1 
ATOM   4661  C  CD1 . LEU A 1 611  ? 23.983  18.220  -12.100 1.00 65.23  ? 611  LEU A CD1 1 
ATOM   4662  C  CD2 . LEU A 1 611  ? 24.829  19.089  -9.915  1.00 67.81  ? 611  LEU A CD2 1 
ATOM   4663  N  N   . PHE A 1 612  ? 25.626  21.698  -13.464 1.00 67.23  ? 612  PHE A N   1 
ATOM   4664  C  CA  . PHE A 1 612  ? 25.200  23.068  -13.232 1.00 67.22  ? 612  PHE A CA  1 
ATOM   4665  C  C   . PHE A 1 612  ? 23.869  23.061  -12.493 1.00 67.18  ? 612  PHE A C   1 
ATOM   4666  O  O   . PHE A 1 612  ? 22.991  22.253  -12.801 1.00 66.29  ? 612  PHE A O   1 
ATOM   4667  C  CB  . PHE A 1 612  ? 24.971  23.790  -14.561 1.00 65.97  ? 612  PHE A CB  1 
ATOM   4668  C  CG  . PHE A 1 612  ? 26.225  24.081  -15.340 1.00 67.64  ? 612  PHE A CG  1 
ATOM   4669  C  CD1 . PHE A 1 612  ? 26.752  23.148  -16.219 1.00 67.79  ? 612  PHE A CD1 1 
ATOM   4670  C  CD2 . PHE A 1 612  ? 26.883  25.291  -15.185 1.00 68.97  ? 612  PHE A CD2 1 
ATOM   4671  C  CE1 . PHE A 1 612  ? 27.909  23.426  -16.927 1.00 69.93  ? 612  PHE A CE1 1 
ATOM   4672  C  CE2 . PHE A 1 612  ? 28.043  25.564  -15.891 1.00 70.62  ? 612  PHE A CE2 1 
ATOM   4673  C  CZ  . PHE A 1 612  ? 28.553  24.632  -16.761 1.00 71.04  ? 612  PHE A CZ  1 
ATOM   4674  N  N   . TYR A 1 613  ? 23.726  23.966  -11.520 1.00 68.52  ? 613  TYR A N   1 
ATOM   4675  C  CA  . TYR A 1 613  ? 22.439  24.132  -10.866 1.00 68.02  ? 613  TYR A CA  1 
ATOM   4676  C  C   . TYR A 1 613  ? 22.075  25.607  -10.756 1.00 68.36  ? 613  TYR A C   1 
ATOM   4677  O  O   . TYR A 1 613  ? 22.924  26.442  -10.466 1.00 70.30  ? 613  TYR A O   1 
ATOM   4678  C  CB  . TYR A 1 613  ? 22.339  23.307  -9.578  1.00 69.42  ? 613  TYR A CB  1 
ATOM   4679  C  CG  . TYR A 1 613  ? 23.279  23.648  -8.449  1.00 72.01  ? 613  TYR A CG  1 
ATOM   4680  C  CD1 . TYR A 1 613  ? 24.550  23.103  -8.377  1.00 73.49  ? 613  TYR A CD1 1 
ATOM   4681  C  CD2 . TYR A 1 613  ? 22.867  24.465  -7.410  1.00 74.18  ? 613  TYR A CD2 1 
ATOM   4682  C  CE1 . TYR A 1 613  ? 25.400  23.395  -7.320  1.00 76.61  ? 613  TYR A CE1 1 
ATOM   4683  C  CE2 . TYR A 1 613  ? 23.701  24.765  -6.344  1.00 77.08  ? 613  TYR A CE2 1 
ATOM   4684  C  CZ  . TYR A 1 613  ? 24.972  24.228  -6.299  1.00 78.41  ? 613  TYR A CZ  1 
ATOM   4685  O  OH  . TYR A 1 613  ? 25.765  24.531  -5.231  1.00 82.46  ? 613  TYR A OH  1 
ATOM   4686  N  N   . PHE A 1 614  ? 20.798  25.901  -11.017 1.00 67.40  ? 614  PHE A N   1 
ATOM   4687  C  CA  . PHE A 1 614  ? 20.283  27.258  -10.992 1.00 67.89  ? 614  PHE A CA  1 
ATOM   4688  C  C   . PHE A 1 614  ? 19.103  27.343  -10.033 1.00 68.24  ? 614  PHE A C   1 
ATOM   4689  O  O   . PHE A 1 614  ? 18.418  26.357  -9.794  1.00 66.61  ? 614  PHE A O   1 
ATOM   4690  C  CB  . PHE A 1 614  ? 19.788  27.648  -12.383 1.00 66.91  ? 614  PHE A CB  1 
ATOM   4691  C  CG  . PHE A 1 614  ? 20.794  27.477  -13.492 1.00 67.21  ? 614  PHE A CG  1 
ATOM   4692  C  CD1 . PHE A 1 614  ? 21.082  26.223  -14.010 1.00 66.46  ? 614  PHE A CD1 1 
ATOM   4693  C  CD2 . PHE A 1 614  ? 21.443  28.574  -14.040 1.00 68.84  ? 614  PHE A CD2 1 
ATOM   4694  C  CE1 . PHE A 1 614  ? 22.001  26.072  -15.040 1.00 66.99  ? 614  PHE A CE1 1 
ATOM   4695  C  CE2 . PHE A 1 614  ? 22.358  28.423  -15.074 1.00 69.15  ? 614  PHE A CE2 1 
ATOM   4696  C  CZ  . PHE A 1 614  ? 22.635  27.171  -15.575 1.00 67.93  ? 614  PHE A CZ  1 
ATOM   4697  N  N   . GLY A 1 615  ? 18.893  28.535  -9.475  1.00 71.10  ? 615  GLY A N   1 
ATOM   4698  C  CA  . GLY A 1 615  ? 17.607  28.870  -8.894  1.00 72.55  ? 615  GLY A CA  1 
ATOM   4699  C  C   . GLY A 1 615  ? 16.611  29.115  -10.020 1.00 72.05  ? 615  GLY A C   1 
ATOM   4700  O  O   . GLY A 1 615  ? 16.968  29.693  -11.047 1.00 72.07  ? 615  GLY A O   1 
ATOM   4701  N  N   . LEU A 1 616  ? 15.378  28.642  -9.829  1.00 72.23  ? 616  LEU A N   1 
ATOM   4702  C  CA  . LEU A 1 616  ? 14.369  28.717  -10.870 1.00 71.44  ? 616  LEU A CA  1 
ATOM   4703  C  C   . LEU A 1 616  ? 13.102  29.335  -10.291 1.00 74.84  ? 616  LEU A C   1 
ATOM   4704  O  O   . LEU A 1 616  ? 12.673  28.971  -9.198  1.00 76.12  ? 616  LEU A O   1 
ATOM   4705  C  CB  . LEU A 1 616  ? 14.129  27.300  -11.396 1.00 67.80  ? 616  LEU A CB  1 
ATOM   4706  C  CG  . LEU A 1 616  ? 12.944  27.102  -12.340 1.00 66.57  ? 616  LEU A CG  1 
ATOM   4707  C  CD1 . LEU A 1 616  ? 13.028  28.025  -13.543 1.00 66.21  ? 616  LEU A CD1 1 
ATOM   4708  C  CD2 . LEU A 1 616  ? 12.875  25.656  -12.802 1.00 64.96  ? 616  LEU A CD2 1 
ATOM   4709  N  N   . ASN A 1 617  ? 12.535  30.288  -11.036 1.00 78.26  ? 617  ASN A N   1 
ATOM   4710  C  CA  . ASN A 1 617  ? 11.295  30.946  -10.663 1.00 82.67  ? 617  ASN A CA  1 
ATOM   4711  C  C   . ASN A 1 617  ? 10.168  30.376  -11.527 1.00 82.82  ? 617  ASN A C   1 
ATOM   4712  O  O   . ASN A 1 617  ? 10.198  30.507  -12.751 1.00 81.75  ? 617  ASN A O   1 
ATOM   4713  C  CB  . ASN A 1 617  ? 11.453  32.468  -10.755 1.00 86.37  ? 617  ASN A CB  1 
ATOM   4714  C  CG  . ASN A 1 617  ? 10.278  33.255  -10.215 1.00 91.86  ? 617  ASN A CG  1 
ATOM   4715  O  OD1 . ASN A 1 617  ? 9.289   32.689  -9.752  1.00 94.83  ? 617  ASN A OD1 1 
ATOM   4716  N  ND2 . ASN A 1 617  ? 10.384  34.573  -10.279 1.00 94.91  ? 617  ASN A ND2 1 
ATOM   4717  N  N   . ILE A 1 618  ? 9.186   29.737  -10.875 1.00 84.30  ? 618  ILE A N   1 
ATOM   4718  C  CA  . ILE A 1 618  ? 8.081   29.076  -11.559 1.00 87.30  ? 618  ILE A CA  1 
ATOM   4719  C  C   . ILE A 1 618  ? 7.353   30.050  -12.484 1.00 90.20  ? 618  ILE A C   1 
ATOM   4720  O  O   . ILE A 1 618  ? 6.906   29.671  -13.567 1.00 92.40  ? 618  ILE A O   1 
ATOM   4721  C  CB  . ILE A 1 618  ? 7.065   28.496  -10.555 1.00 90.43  ? 618  ILE A CB  1 
ATOM   4722  C  CG1 . ILE A 1 618  ? 7.673   27.420  -9.652  1.00 89.40  ? 618  ILE A CG1 1 
ATOM   4723  C  CG2 . ILE A 1 618  ? 5.815   27.995  -11.278 1.00 93.13  ? 618  ILE A CG2 1 
ATOM   4724  C  CD1 . ILE A 1 618  ? 6.686   26.841  -8.655  1.00 90.74  ? 618  ILE A CD1 1 
ATOM   4725  N  N   . GLU A 1 619  ? 7.148   31.277  -12.000 1.00 92.49  ? 619  GLU A N   1 
ATOM   4726  C  CA  . GLU A 1 619  ? 6.275   32.218  -12.678 1.00 94.04  ? 619  GLU A CA  1 
ATOM   4727  C  C   . GLU A 1 619  ? 6.986   32.788  -13.899 1.00 92.19  ? 619  GLU A C   1 
ATOM   4728  O  O   . GLU A 1 619  ? 6.392   32.852  -14.976 1.00 93.86  ? 619  GLU A O   1 
ATOM   4729  C  CB  . GLU A 1 619  ? 5.866   33.337  -11.723 1.00 99.22  ? 619  GLU A CB  1 
ATOM   4730  C  CG  . GLU A 1 619  ? 5.495   32.845  -10.336 1.00 101.45 ? 619  GLU A CG  1 
ATOM   4731  C  CD  . GLU A 1 619  ? 5.059   33.960  -9.406  1.00 107.27 ? 619  GLU A CD  1 
ATOM   4732  O  OE1 . GLU A 1 619  ? 5.740   35.011  -9.376  1.00 109.43 ? 619  GLU A OE1 1 
ATOM   4733  O  OE2 . GLU A 1 619  ? 4.028   33.784  -8.725  1.00 111.41 ? 619  GLU A OE2 1 
ATOM   4734  N  N   . THR A 1 620  ? 8.254   33.180  -13.704 1.00 88.41  ? 620  THR A N   1 
ATOM   4735  C  CA  . THR A 1 620  ? 9.038   33.860  -14.722 1.00 87.06  ? 620  THR A CA  1 
ATOM   4736  C  C   . THR A 1 620  ? 9.649   32.849  -15.692 1.00 83.08  ? 620  THR A C   1 
ATOM   4737  O  O   . THR A 1 620  ? 9.610   33.054  -16.905 1.00 81.53  ? 620  THR A O   1 
ATOM   4738  C  CB  . THR A 1 620  ? 10.093  34.777  -14.086 1.00 89.39  ? 620  THR A CB  1 
ATOM   4739  O  OG1 . THR A 1 620  ? 10.853  34.054  -13.115 1.00 89.94  ? 620  THR A OG1 1 
ATOM   4740  C  CG2 . THR A 1 620  ? 9.500   36.019  -13.457 1.00 92.40  ? 620  THR A CG2 1 
ATOM   4741  N  N   . GLY A 1 621  ? 10.203  31.761  -15.137 1.00 80.51  ? 621  GLY A N   1 
ATOM   4742  C  CA  . GLY A 1 621  ? 11.017  30.813  -15.878 1.00 78.19  ? 621  GLY A CA  1 
ATOM   4743  C  C   . GLY A 1 621  ? 12.499  31.182  -15.843 1.00 78.41  ? 621  GLY A C   1 
ATOM   4744  O  O   . GLY A 1 621  ? 13.306  30.568  -16.537 1.00 78.93  ? 621  GLY A O   1 
ATOM   4745  N  N   . LEU A 1 622  ? 12.854  32.175  -15.019 1.00 79.83  ? 622  LEU A N   1 
ATOM   4746  C  CA  . LEU A 1 622  ? 14.207  32.706  -15.028 1.00 80.46  ? 622  LEU A CA  1 
ATOM   4747  C  C   . LEU A 1 622  ? 15.137  31.777  -14.252 1.00 78.65  ? 622  LEU A C   1 
ATOM   4748  O  O   . LEU A 1 622  ? 14.780  31.278  -13.184 1.00 79.38  ? 622  LEU A O   1 
ATOM   4749  C  CB  . LEU A 1 622  ? 14.204  34.125  -14.446 1.00 84.18  ? 622  LEU A CB  1 
ATOM   4750  C  CG  . LEU A 1 622  ? 13.366  35.155  -15.207 1.00 87.03  ? 622  LEU A CG  1 
ATOM   4751  C  CD1 . LEU A 1 622  ? 13.458  36.530  -14.554 1.00 90.19  ? 622  LEU A CD1 1 
ATOM   4752  C  CD2 . LEU A 1 622  ? 13.769  35.226  -16.676 1.00 86.48  ? 622  LEU A CD2 1 
ATOM   4753  N  N   . LEU A 1 623  ? 16.317  31.536  -14.835 1.00 76.08  ? 623  LEU A N   1 
ATOM   4754  C  CA  . LEU A 1 623  ? 17.399  30.844  -14.157 1.00 74.55  ? 623  LEU A CA  1 
ATOM   4755  C  C   . LEU A 1 623  ? 18.375  31.878  -13.594 1.00 76.54  ? 623  LEU A C   1 
ATOM   4756  O  O   . LEU A 1 623  ? 18.740  32.838  -14.274 1.00 78.50  ? 623  LEU A O   1 
ATOM   4757  C  CB  . LEU A 1 623  ? 18.082  29.908  -15.157 1.00 71.82  ? 623  LEU A CB  1 
ATOM   4758  C  CG  . LEU A 1 623  ? 17.177  28.862  -15.798 1.00 69.04  ? 623  LEU A CG  1 
ATOM   4759  C  CD1 . LEU A 1 623  ? 17.975  28.015  -16.772 1.00 67.38  ? 623  LEU A CD1 1 
ATOM   4760  C  CD2 . LEU A 1 623  ? 16.523  27.993  -14.737 1.00 67.85  ? 623  LEU A CD2 1 
ATOM   4761  N  N   . SER A 1 624  ? 18.774  31.680  -12.333 1.00 76.10  ? 624  SER A N   1 
ATOM   4762  C  CA  . SER A 1 624  ? 19.737  32.555  -11.686 1.00 78.23  ? 624  SER A CA  1 
ATOM   4763  C  C   . SER A 1 624  ? 20.782  31.719  -10.950 1.00 77.82  ? 624  SER A C   1 
ATOM   4764  O  O   . SER A 1 624  ? 20.474  30.629  -10.473 1.00 76.12  ? 624  SER A O   1 
ATOM   4765  C  CB  . SER A 1 624  ? 19.033  33.495  -10.749 1.00 80.40  ? 624  SER A CB  1 
ATOM   4766  O  OG  . SER A 1 624  ? 18.263  32.763  -9.806  1.00 79.95  ? 624  SER A OG  1 
ATOM   4767  N  N   . ASP A 1 625  ? 22.017  32.238  -10.891 1.00 78.86  ? 625  ASP A N   1 
ATOM   4768  C  CA  . ASP A 1 625  ? 23.060  31.733  -10.012 1.00 80.10  ? 625  ASP A CA  1 
ATOM   4769  C  C   . ASP A 1 625  ? 23.739  30.494  -10.582 1.00 77.46  ? 625  ASP A C   1 
ATOM   4770  O  O   . ASP A 1 625  ? 24.012  29.566  -9.818  1.00 76.69  ? 625  ASP A O   1 
ATOM   4771  C  CB  . ASP A 1 625  ? 22.507  31.280  -8.656  1.00 82.50  ? 625  ASP A CB  1 
ATOM   4772  C  CG  . ASP A 1 625  ? 22.061  32.392  -7.723  1.00 86.64  ? 625  ASP A CG  1 
ATOM   4773  O  OD1 . ASP A 1 625  ? 21.738  33.499  -8.221  1.00 87.40  ? 625  ASP A OD1 1 
ATOM   4774  O  OD2 . ASP A 1 625  ? 22.038  32.141  -6.497  1.00 89.04  ? 625  ASP A OD2 1 
ATOM   4775  N  N   . ARG A 1 626  ? 24.047  30.475  -11.885 1.00 75.92  ? 626  ARG A N   1 
ATOM   4776  C  CA  . ARG A 1 626  ? 24.812  29.335  -12.363 1.00 74.92  ? 626  ARG A CA  1 
ATOM   4777  C  C   . ARG A 1 626  ? 25.895  29.026  -11.331 1.00 75.83  ? 626  ARG A C   1 
ATOM   4778  O  O   . ARG A 1 626  ? 26.811  29.816  -11.109 1.00 78.70  ? 626  ARG A O   1 
ATOM   4779  C  CB  . ARG A 1 626  ? 25.415  29.543  -13.754 1.00 76.00  ? 626  ARG A CB  1 
ATOM   4780  C  CG  . ARG A 1 626  ? 26.603  28.627  -14.002 1.00 79.11  ? 626  ARG A CG  1 
ATOM   4781  C  CD  . ARG A 1 626  ? 27.617  29.212  -14.957 1.00 82.69  ? 626  ARG A CD  1 
ATOM   4782  N  NE  . ARG A 1 626  ? 26.979  28.996  -16.238 1.00 84.12  ? 626  ARG A NE  1 
ATOM   4783  C  CZ  . ARG A 1 626  ? 27.436  29.413  -17.408 1.00 87.77  ? 626  ARG A CZ  1 
ATOM   4784  N  NH1 . ARG A 1 626  ? 28.571  30.092  -17.484 1.00 89.25  ? 626  ARG A NH1 1 
ATOM   4785  N  NH2 . ARG A 1 626  ? 26.738  29.145  -18.500 1.00 89.12  ? 626  ARG A NH2 1 
ATOM   4786  N  N   . LYS A 1 627  ? 25.711  27.901  -10.639 1.00 73.95  ? 627  LYS A N   1 
ATOM   4787  C  CA  . LYS A 1 627  ? 26.756  27.274  -9.854  1.00 74.69  ? 627  LYS A CA  1 
ATOM   4788  C  C   . LYS A 1 627  ? 27.153  25.995  -10.581 1.00 72.61  ? 627  LYS A C   1 
ATOM   4789  O  O   . LYS A 1 627  ? 26.308  25.370  -11.218 1.00 70.83  ? 627  LYS A O   1 
ATOM   4790  C  CB  . LYS A 1 627  ? 26.256  26.966  -8.441  1.00 76.23  ? 627  LYS A CB  1 
ATOM   4791  C  CG  . LYS A 1 627  ? 26.044  28.180  -7.549  1.00 80.28  ? 627  LYS A CG  1 
ATOM   4792  C  CD  . LYS A 1 627  ? 25.931  27.829  -6.075  1.00 84.04  ? 627  LYS A CD  1 
ATOM   4793  C  CE  . LYS A 1 627  ? 26.318  28.955  -5.131  1.00 88.66  ? 627  LYS A CE  1 
ATOM   4794  N  NZ  . LYS A 1 627  ? 25.428  30.136  -5.255  1.00 90.83  ? 627  LYS A NZ  1 
ATOM   4795  N  N   . LYS A 1 628  ? 28.440  25.633  -10.496 1.00 73.36  ? 628  LYS A N   1 
ATOM   4796  C  CA  . LYS A 1 628  ? 28.963  24.431  -11.125 1.00 71.99  ? 628  LYS A CA  1 
ATOM   4797  C  C   . LYS A 1 628  ? 29.672  23.573  -10.082 1.00 73.67  ? 628  LYS A C   1 
ATOM   4798  O  O   . LYS A 1 628  ? 30.313  24.095  -9.173  1.00 74.84  ? 628  LYS A O   1 
ATOM   4799  C  CB  . LYS A 1 628  ? 29.909  24.797  -12.269 1.00 72.49  ? 628  LYS A CB  1 
ATOM   4800  C  CG  . LYS A 1 628  ? 30.517  23.620  -13.018 1.00 72.95  ? 628  LYS A CG  1 
ATOM   4801  C  CD  . LYS A 1 628  ? 31.451  24.066  -14.113 1.00 74.13  ? 628  LYS A CD  1 
ATOM   4802  C  CE  . LYS A 1 628  ? 31.975  22.926  -14.953 1.00 74.93  ? 628  LYS A CE  1 
ATOM   4803  N  NZ  . LYS A 1 628  ? 32.683  23.438  -16.147 1.00 76.90  ? 628  LYS A NZ  1 
ATOM   4804  N  N   . VAL A 1 629  ? 29.506  22.252  -10.211 1.00 73.62  ? 629  VAL A N   1 
ATOM   4805  C  CA  . VAL A 1 629  ? 30.235  21.275  -9.419  1.00 75.93  ? 629  VAL A CA  1 
ATOM   4806  C  C   . VAL A 1 629  ? 30.741  20.202  -10.372 1.00 76.03  ? 629  VAL A C   1 
ATOM   4807  O  O   . VAL A 1 629  ? 30.297  20.118  -11.509 1.00 73.99  ? 629  VAL A O   1 
ATOM   4808  C  CB  . VAL A 1 629  ? 29.381  20.672  -8.286  1.00 75.81  ? 629  VAL A CB  1 
ATOM   4809  C  CG1 . VAL A 1 629  ? 28.742  21.741  -7.415  1.00 76.10  ? 629  VAL A CG1 1 
ATOM   4810  C  CG2 . VAL A 1 629  ? 28.321  19.717  -8.805  1.00 74.03  ? 629  VAL A CG2 1 
ATOM   4811  N  N   . THR A 1 630  ? 31.707  19.415  -9.916  1.00 80.00  ? 630  THR A N   1 
ATOM   4812  C  CA  . THR A 1 630  ? 32.200  18.312  -10.716 1.00 82.34  ? 630  THR A CA  1 
ATOM   4813  C  C   . THR A 1 630  ? 31.908  17.042  -9.935  1.00 84.08  ? 630  THR A C   1 
ATOM   4814  O  O   . THR A 1 630  ? 32.197  16.966  -8.747  1.00 87.13  ? 630  THR A O   1 
ATOM   4815  C  CB  . THR A 1 630  ? 33.678  18.499  -11.077 1.00 85.26  ? 630  THR A CB  1 
ATOM   4816  O  OG1 . THR A 1 630  ? 34.355  18.750  -9.847  1.00 88.13  ? 630  THR A OG1 1 
ATOM   4817  C  CG2 . THR A 1 630  ? 33.902  19.668  -12.011 1.00 84.75  ? 630  THR A CG2 1 
ATOM   4818  N  N   . LEU A 1 631  ? 31.276  16.075  -10.592 1.00 83.87  ? 631  LEU A N   1 
ATOM   4819  C  CA  . LEU A 1 631  ? 30.896  14.875  -9.876  1.00 86.06  ? 631  LEU A CA  1 
ATOM   4820  C  C   . LEU A 1 631  ? 31.822  13.748  -10.313 1.00 90.47  ? 631  LEU A C   1 
ATOM   4821  O  O   . LEU A 1 631  ? 32.575  13.207  -9.501  1.00 94.92  ? 631  LEU A O   1 
ATOM   4822  C  CB  . LEU A 1 631  ? 29.419  14.566  -10.144 1.00 83.25  ? 631  LEU A CB  1 
ATOM   4823  C  CG  . LEU A 1 631  ? 28.429  15.679  -9.788  1.00 80.15  ? 631  LEU A CG  1 
ATOM   4824  C  CD1 . LEU A 1 631  ? 27.053  15.377  -10.360 1.00 77.03  ? 631  LEU A CD1 1 
ATOM   4825  C  CD2 . LEU A 1 631  ? 28.347  15.900  -8.282  1.00 80.97  ? 631  LEU A CD2 1 
ATOM   4826  N  N   . GLY A 1 632  ? 31.798  13.447  -11.615 1.00 90.29  ? 632  GLY A N   1 
ATOM   4827  C  CA  . GLY A 1 632  ? 32.595  12.350  -12.133 1.00 94.10  ? 632  GLY A CA  1 
ATOM   4828  C  C   . GLY A 1 632  ? 33.169  12.648  -13.512 1.00 94.67  ? 632  GLY A C   1 
ATOM   4829  O  O   . GLY A 1 632  ? 33.011  13.744  -14.042 1.00 92.57  ? 632  GLY A O   1 
ATOM   4830  N  N   . THR A 1 633  ? 33.855  11.650  -14.067 1.00 98.21  ? 633  THR A N   1 
ATOM   4831  C  CA  . THR A 1 633  ? 34.394  11.745  -15.410 1.00 99.92  ? 633  THR A CA  1 
ATOM   4832  C  C   . THR A 1 633  ? 33.310  11.357  -16.413 1.00 98.51  ? 633  THR A C   1 
ATOM   4833  O  O   . THR A 1 633  ? 33.292  11.871  -17.530 1.00 98.14  ? 633  THR A O   1 
ATOM   4834  C  CB  . THR A 1 633  ? 35.669  10.903  -15.535 1.00 104.79 ? 633  THR A CB  1 
ATOM   4835  O  OG1 . THR A 1 633  ? 35.402  9.620   -14.965 1.00 106.17 ? 633  THR A OG1 1 
ATOM   4836  C  CG2 . THR A 1 633  ? 36.860  11.533  -14.845 1.00 107.27 ? 633  THR A CG2 1 
ATOM   4837  N  N   . GLN A 1 634  ? 32.412  10.454  -15.994 1.00 98.46  ? 634  GLN A N   1 
ATOM   4838  C  CA  . GLN A 1 634  ? 31.374  9.902   -16.852 1.00 98.45  ? 634  GLN A CA  1 
ATOM   4839  C  C   . GLN A 1 634  ? 30.144  10.809  -16.822 1.00 93.84  ? 634  GLN A C   1 
ATOM   4840  O  O   . GLN A 1 634  ? 29.921  11.522  -15.844 1.00 92.54  ? 634  GLN A O   1 
ATOM   4841  C  CB  . GLN A 1 634  ? 30.983  8.491   -16.394 1.00 102.04 ? 634  GLN A CB  1 
ATOM   4842  C  CG  . GLN A 1 634  ? 32.140  7.498   -16.338 1.00 108.23 ? 634  GLN A CG  1 
ATOM   4843  C  CD  . GLN A 1 634  ? 32.339  6.713   -17.612 1.00 111.91 ? 634  GLN A CD  1 
ATOM   4844  O  OE1 . GLN A 1 634  ? 32.731  7.258   -18.643 1.00 112.91 ? 634  GLN A OE1 1 
ATOM   4845  N  NE2 . GLN A 1 634  ? 32.090  5.413   -17.539 1.00 114.55 ? 634  GLN A NE2 1 
ATOM   4846  N  N   . PRO A 1 635  ? 29.300  10.795  -17.881 1.00 92.12  ? 635  PRO A N   1 
ATOM   4847  C  CA  . PRO A 1 635  ? 28.035  11.536  -17.881 1.00 88.91  ? 635  PRO A CA  1 
ATOM   4848  C  C   . PRO A 1 635  ? 27.113  11.140  -16.728 1.00 87.51  ? 635  PRO A C   1 
ATOM   4849  O  O   . PRO A 1 635  ? 27.019  9.969   -16.372 1.00 90.35  ? 635  PRO A O   1 
ATOM   4850  C  CB  . PRO A 1 635  ? 27.375  11.143  -19.215 1.00 89.07  ? 635  PRO A CB  1 
ATOM   4851  C  CG  . PRO A 1 635  ? 28.098  9.881   -19.643 1.00 92.70  ? 635  PRO A CG  1 
ATOM   4852  C  CD  . PRO A 1 635  ? 29.514  10.057  -19.136 1.00 94.22  ? 635  PRO A CD  1 
ATOM   4853  N  N   . THR A 1 636  ? 26.436  12.137  -16.155 1.00 84.49  ? 636  THR A N   1 
ATOM   4854  C  CA  . THR A 1 636  ? 25.546  11.919  -15.028 1.00 83.80  ? 636  THR A CA  1 
ATOM   4855  C  C   . THR A 1 636  ? 24.108  11.793  -15.518 1.00 82.66  ? 636  THR A C   1 
ATOM   4856  O  O   . THR A 1 636  ? 23.706  12.485  -16.454 1.00 82.76  ? 636  THR A O   1 
ATOM   4857  C  CB  . THR A 1 636  ? 25.669  13.072  -14.030 1.00 83.57  ? 636  THR A CB  1 
ATOM   4858  O  OG1 . THR A 1 636  ? 27.061  13.195  -13.729 1.00 89.36  ? 636  THR A OG1 1 
ATOM   4859  C  CG2 . THR A 1 636  ? 24.865  12.851  -12.768 1.00 82.60  ? 636  THR A CG2 1 
ATOM   4860  N  N   . VAL A 1 637  ? 23.351  10.896  -14.870 1.00 82.14  ? 637  VAL A N   1 
ATOM   4861  C  CA  . VAL A 1 637  ? 21.912  10.778  -15.051 1.00 79.31  ? 637  VAL A CA  1 
ATOM   4862  C  C   . VAL A 1 637  ? 21.241  11.110  -13.719 1.00 77.49  ? 637  VAL A C   1 
ATOM   4863  O  O   . VAL A 1 637  ? 21.550  10.504  -12.696 1.00 79.61  ? 637  VAL A O   1 
ATOM   4864  C  CB  . VAL A 1 637  ? 21.528  9.371   -15.551 1.00 81.68  ? 637  VAL A CB  1 
ATOM   4865  C  CG1 . VAL A 1 637  ? 20.022  9.205   -15.724 1.00 80.52  ? 637  VAL A CG1 1 
ATOM   4866  C  CG2 . VAL A 1 637  ? 22.270  9.000   -16.831 1.00 83.55  ? 637  VAL A CG2 1 
ATOM   4867  N  N   . LEU A 1 638  ? 20.324  12.079  -13.735 1.00 74.43  ? 638  LEU A N   1 
ATOM   4868  C  CA  . LEU A 1 638  ? 19.703  12.546  -12.505 1.00 74.52  ? 638  LEU A CA  1 
ATOM   4869  C  C   . LEU A 1 638  ? 18.332  11.888  -12.323 1.00 75.47  ? 638  LEU A C   1 
ATOM   4870  O  O   . LEU A 1 638  ? 17.581  11.724  -13.283 1.00 75.25  ? 638  LEU A O   1 
ATOM   4871  C  CB  . LEU A 1 638  ? 19.608  14.077  -12.546 1.00 72.66  ? 638  LEU A CB  1 
ATOM   4872  C  CG  . LEU A 1 638  ? 20.924  14.820  -12.797 1.00 72.38  ? 638  LEU A CG  1 
ATOM   4873  C  CD1 . LEU A 1 638  ? 20.679  16.264  -13.209 1.00 70.54  ? 638  LEU A CD1 1 
ATOM   4874  C  CD2 . LEU A 1 638  ? 21.817  14.771  -11.571 1.00 74.07  ? 638  LEU A CD2 1 
ATOM   4875  N  N   . ARG A 1 639  ? 18.027  11.493  -11.079 1.00 77.33  ? 639  ARG A N   1 
ATOM   4876  C  CA  . ARG A 1 639  ? 16.752  10.890  -10.718 1.00 77.90  ? 639  ARG A CA  1 
ATOM   4877  C  C   . ARG A 1 639  ? 16.372  11.314  -9.304  1.00 77.69  ? 639  ARG A C   1 
ATOM   4878  O  O   . ARG A 1 639  ? 17.177  11.194  -8.385  1.00 79.36  ? 639  ARG A O   1 
ATOM   4879  C  CB  . ARG A 1 639  ? 16.844  9.361   -10.735 1.00 82.31  ? 639  ARG A CB  1 
ATOM   4880  C  CG  . ARG A 1 639  ? 16.761  8.726   -12.117 1.00 85.71  ? 639  ARG A CG  1 
ATOM   4881  C  CD  . ARG A 1 639  ? 15.395  8.780   -12.787 1.00 87.32  ? 639  ARG A CD  1 
ATOM   4882  N  NE  . ARG A 1 639  ? 14.301  8.300   -11.939 1.00 89.65  ? 639  ARG A NE  1 
ATOM   4883  C  CZ  . ARG A 1 639  ? 13.464  7.298   -12.224 1.00 91.94  ? 639  ARG A CZ  1 
ATOM   4884  N  NH1 . ARG A 1 639  ? 13.554  6.636   -13.368 1.00 92.63  ? 639  ARG A NH1 1 
ATOM   4885  N  NH2 . ARG A 1 639  ? 12.517  6.974   -11.361 1.00 92.96  ? 639  ARG A NH2 1 
ATOM   4886  N  N   . THR A 1 640  ? 15.130  11.784  -9.141  1.00 77.16  ? 640  THR A N   1 
ATOM   4887  C  CA  . THR A 1 640  ? 14.606  12.122  -7.826  1.00 78.29  ? 640  THR A CA  1 
ATOM   4888  C  C   . THR A 1 640  ? 14.302  10.834  -7.067  1.00 80.40  ? 640  THR A C   1 
ATOM   4889  O  O   . THR A 1 640  ? 13.928  9.828   -7.666  1.00 81.72  ? 640  THR A O   1 
ATOM   4890  C  CB  . THR A 1 640  ? 13.333  12.975  -7.913  1.00 78.01  ? 640  THR A CB  1 
ATOM   4891  O  OG1 . THR A 1 640  ? 13.604  14.157  -8.662  1.00 79.24  ? 640  THR A OG1 1 
ATOM   4892  C  CG2 . THR A 1 640  ? 12.809  13.390  -6.557  1.00 79.20  ? 640  THR A CG2 1 
ATOM   4893  N  N   . PHE A 1 641  ? 14.484  10.882  -5.745  1.00 81.28  ? 641  PHE A N   1 
ATOM   4894  C  CA  . PHE A 1 641  ? 14.075  9.813   -4.853  1.00 83.27  ? 641  PHE A CA  1 
ATOM   4895  C  C   . PHE A 1 641  ? 13.567  10.433  -3.554  1.00 84.92  ? 641  PHE A C   1 
ATOM   4896  O  O   . PHE A 1 641  ? 13.895  11.573  -3.225  1.00 83.49  ? 641  PHE A O   1 
ATOM   4897  C  CB  . PHE A 1 641  ? 15.224  8.821   -4.628  1.00 85.67  ? 641  PHE A CB  1 
ATOM   4898  C  CG  . PHE A 1 641  ? 16.303  9.293   -3.684  1.00 87.40  ? 641  PHE A CG  1 
ATOM   4899  C  CD1 . PHE A 1 641  ? 16.078  9.318   -2.315  1.00 89.59  ? 641  PHE A CD1 1 
ATOM   4900  C  CD2 . PHE A 1 641  ? 17.540  9.712   -4.157  1.00 86.44  ? 641  PHE A CD2 1 
ATOM   4901  C  CE1 . PHE A 1 641  ? 17.056  9.768   -1.442  1.00 90.88  ? 641  PHE A CE1 1 
ATOM   4902  C  CE2 . PHE A 1 641  ? 18.520  10.155  -3.281  1.00 87.77  ? 641  PHE A CE2 1 
ATOM   4903  C  CZ  . PHE A 1 641  ? 18.277  10.177  -1.926  1.00 90.02  ? 641  PHE A CZ  1 
ATOM   4904  N  N   . ARG A 1 642  ? 12.748  9.668   -2.828  1.00 88.30  ? 642  ARG A N   1 
ATOM   4905  C  CA  . ARG A 1 642  ? 12.269  10.088  -1.524  1.00 91.27  ? 642  ARG A CA  1 
ATOM   4906  C  C   . ARG A 1 642  ? 12.936  9.189   -0.491  1.00 93.92  ? 642  ARG A C   1 
ATOM   4907  O  O   . ARG A 1 642  ? 13.006  7.980   -0.699  1.00 96.22  ? 642  ARG A O   1 
ATOM   4908  C  CB  . ARG A 1 642  ? 10.740  9.970   -1.472  1.00 93.59  ? 642  ARG A CB  1 
ATOM   4909  C  CG  . ARG A 1 642  ? 10.043  11.086  -0.705  1.00 95.94  ? 642  ARG A CG  1 
ATOM   4910  C  CD  . ARG A 1 642  ? 9.489   12.209  -1.573  1.00 94.85  ? 642  ARG A CD  1 
ATOM   4911  N  NE  . ARG A 1 642  ? 9.572   13.536  -0.962  1.00 95.92  ? 642  ARG A NE  1 
ATOM   4912  C  CZ  . ARG A 1 642  ? 8.843   13.968  0.070   1.00 98.71  ? 642  ARG A CZ  1 
ATOM   4913  N  NH1 . ARG A 1 642  ? 7.952   13.174  0.644   1.00 100.15 ? 642  ARG A NH1 1 
ATOM   4914  N  NH2 . ARG A 1 642  ? 9.021   15.194  0.534   1.00 98.91  ? 642  ARG A NH2 1 
ATOM   4915  N  N   . SER A 1 643  ? 13.446  9.790   0.591   1.00 94.78  ? 643  SER A N   1 
ATOM   4916  C  CA  . SER A 1 643  ? 14.071  9.052   1.679   1.00 97.39  ? 643  SER A CA  1 
ATOM   4917  C  C   . SER A 1 643  ? 13.778  9.759   2.998   1.00 98.99  ? 643  SER A C   1 
ATOM   4918  O  O   . SER A 1 643  ? 14.133  10.923  3.162   1.00 98.72  ? 643  SER A O   1 
ATOM   4919  C  CB  . SER A 1 643  ? 15.557  8.925   1.445   1.00 98.38  ? 643  SER A CB  1 
ATOM   4920  O  OG  . SER A 1 643  ? 16.193  8.210   2.496   1.00 104.11 ? 643  SER A OG  1 
ATOM   4921  N  N   . LEU A 1 644  ? 13.121  9.048   3.922   1.00 101.74 ? 644  LEU A N   1 
ATOM   4922  C  CA  . LEU A 1 644  ? 12.788  9.558   5.245   1.00 104.98 ? 644  LEU A CA  1 
ATOM   4923  C  C   . LEU A 1 644  ? 12.087  10.913  5.147   1.00 103.65 ? 644  LEU A C   1 
ATOM   4924  O  O   . LEU A 1 644  ? 12.450  11.845  5.864   1.00 105.50 ? 644  LEU A O   1 
ATOM   4925  C  CB  . LEU A 1 644  ? 14.059  9.662   6.097   1.00 107.28 ? 644  LEU A CB  1 
ATOM   4926  C  CG  . LEU A 1 644  ? 14.714  8.340   6.494   1.00 110.51 ? 644  LEU A CG  1 
ATOM   4927  C  CD1 . LEU A 1 644  ? 16.023  8.586   7.228   1.00 112.71 ? 644  LEU A CD1 1 
ATOM   4928  C  CD2 . LEU A 1 644  ? 13.775  7.503   7.349   1.00 114.15 ? 644  LEU A CD2 1 
ATOM   4929  N  N   . SER A 1 645  ? 11.090  11.001  4.252   1.00 100.94 ? 645  SER A N   1 
ATOM   4930  C  CA  . SER A 1 645  ? 10.193  12.140  4.105   1.00 100.05 ? 645  SER A CA  1 
ATOM   4931  C  C   . SER A 1 645  ? 10.863  13.343  3.440   1.00 97.75  ? 645  SER A C   1 
ATOM   4932  O  O   . SER A 1 645  ? 10.336  14.451  3.525   1.00 98.53  ? 645  SER A O   1 
ATOM   4933  C  CB  . SER A 1 645  ? 9.555   12.538  5.417   1.00 103.58 ? 645  SER A CB  1 
ATOM   4934  O  OG  . SER A 1 645  ? 8.836   11.455  5.981   1.00 107.20 ? 645  SER A OG  1 
ATOM   4935  N  N   . THR A 1 646  ? 12.008  13.147  2.774   1.00 96.38  ? 646  THR A N   1 
ATOM   4936  C  CA  . THR A 1 646  ? 12.627  14.257  2.057   1.00 94.85  ? 646  THR A CA  1 
ATOM   4937  C  C   . THR A 1 646  ? 13.039  13.848  0.644   1.00 92.00  ? 646  THR A C   1 
ATOM   4938  O  O   . THR A 1 646  ? 13.495  12.727  0.417   1.00 92.70  ? 646  THR A O   1 
ATOM   4939  C  CB  . THR A 1 646  ? 13.755  14.943  2.844   1.00 96.41  ? 646  THR A CB  1 
ATOM   4940  O  OG1 . THR A 1 646  ? 14.625  13.956  3.395   1.00 99.21  ? 646  THR A OG1 1 
ATOM   4941  C  CG2 . THR A 1 646  ? 13.247  15.859  3.938   1.00 99.11  ? 646  THR A CG2 1 
ATOM   4942  N  N   . THR A 1 647  ? 12.871  14.795  -0.289  1.00 89.13  ? 647  THR A N   1 
ATOM   4943  C  CA  . THR A 1 647  ? 13.100  14.590  -1.710  1.00 85.76  ? 647  THR A CA  1 
ATOM   4944  C  C   . THR A 1 647  ? 14.538  14.972  -2.036  1.00 84.55  ? 647  THR A C   1 
ATOM   4945  O  O   . THR A 1 647  ? 14.973  16.065  -1.699  1.00 86.90  ? 647  THR A O   1 
ATOM   4946  C  CB  . THR A 1 647  ? 12.091  15.402  -2.533  1.00 84.47  ? 647  THR A CB  1 
ATOM   4947  O  OG1 . THR A 1 647  ? 10.856  14.681  -2.547  1.00 85.24  ? 647  THR A OG1 1 
ATOM   4948  C  CG2 . THR A 1 647  ? 12.534  15.669  -3.957  1.00 82.00  ? 647  THR A CG2 1 
ATOM   4949  N  N   . ASN A 1 648  ? 15.266  14.063  -2.692  1.00 83.08  ? 648  ASN A N   1 
ATOM   4950  C  CA  . ASN A 1 648  ? 16.678  14.261  -2.978  1.00 81.74  ? 648  ASN A CA  1 
ATOM   4951  C  C   . ASN A 1 648  ? 16.977  13.722  -4.371  1.00 79.27  ? 648  ASN A C   1 
ATOM   4952  O  O   . ASN A 1 648  ? 16.208  12.927  -4.903  1.00 80.35  ? 648  ASN A O   1 
ATOM   4953  C  CB  . ASN A 1 648  ? 17.558  13.548  -1.950  1.00 84.97  ? 648  ASN A CB  1 
ATOM   4954  C  CG  . ASN A 1 648  ? 17.089  13.743  -0.523  1.00 87.80  ? 648  ASN A CG  1 
ATOM   4955  O  OD1 . ASN A 1 648  ? 16.619  12.801  0.115   1.00 90.03  ? 648  ASN A OD1 1 
ATOM   4956  N  ND2 . ASN A 1 648  ? 17.186  14.964  -0.020  1.00 87.63  ? 648  ASN A ND2 1 
ATOM   4957  N  N   . VAL A 1 649  ? 18.098  14.148  -4.956  1.00 76.90  ? 649  VAL A N   1 
ATOM   4958  C  CA  . VAL A 1 649  ? 18.408  13.715  -6.307  1.00 75.20  ? 649  VAL A CA  1 
ATOM   4959  C  C   . VAL A 1 649  ? 19.624  12.798  -6.276  1.00 77.74  ? 649  VAL A C   1 
ATOM   4960  O  O   . VAL A 1 649  ? 20.638  13.129  -5.668  1.00 80.88  ? 649  VAL A O   1 
ATOM   4961  C  CB  . VAL A 1 649  ? 18.620  14.903  -7.261  1.00 71.94  ? 649  VAL A CB  1 
ATOM   4962  C  CG1 . VAL A 1 649  ? 18.920  14.435  -8.675  1.00 70.42  ? 649  VAL A CG1 1 
ATOM   4963  C  CG2 . VAL A 1 649  ? 17.429  15.844  -7.251  1.00 70.86  ? 649  VAL A CG2 1 
ATOM   4964  N  N   . PHE A 1 650  ? 19.497  11.644  -6.939  1.00 78.13  ? 650  PHE A N   1 
ATOM   4965  C  CA  . PHE A 1 650  ? 20.613  10.737  -7.141  1.00 79.99  ? 650  PHE A CA  1 
ATOM   4966  C  C   . PHE A 1 650  ? 21.298  11.090  -8.457  1.00 79.54  ? 650  PHE A C   1 
ATOM   4967  O  O   . PHE A 1 650  ? 20.648  11.184  -9.499  1.00 78.54  ? 650  PHE A O   1 
ATOM   4968  C  CB  . PHE A 1 650  ? 20.126  9.286   -7.150  1.00 80.94  ? 650  PHE A CB  1 
ATOM   4969  C  CG  . PHE A 1 650  ? 21.167  8.254   -6.798  1.00 83.22  ? 650  PHE A CG  1 
ATOM   4970  C  CD1 . PHE A 1 650  ? 21.996  7.708   -7.769  1.00 83.49  ? 650  PHE A CD1 1 
ATOM   4971  C  CD2 . PHE A 1 650  ? 21.306  7.811   -5.490  1.00 85.95  ? 650  PHE A CD2 1 
ATOM   4972  C  CE1 . PHE A 1 650  ? 22.939  6.744   -7.438  1.00 86.58  ? 650  PHE A CE1 1 
ATOM   4973  C  CE2 . PHE A 1 650  ? 22.254  6.854   -5.157  1.00 88.69  ? 650  PHE A CE2 1 
ATOM   4974  C  CZ  . PHE A 1 650  ? 23.068  6.320   -6.133  1.00 89.25  ? 650  PHE A CZ  1 
ATOM   4975  N  N   . ALA A 1 651  ? 22.616  11.299  -8.385  1.00 80.44  ? 651  ALA A N   1 
ATOM   4976  C  CA  . ALA A 1 651  ? 23.412  11.543  -9.572  1.00 80.23  ? 651  ALA A CA  1 
ATOM   4977  C  C   . ALA A 1 651  ? 24.198  10.279  -9.899  1.00 83.15  ? 651  ALA A C   1 
ATOM   4978  O  O   . ALA A 1 651  ? 25.153  9.939   -9.207  1.00 87.10  ? 651  ALA A O   1 
ATOM   4979  C  CB  . ALA A 1 651  ? 24.305  12.738  -9.353  1.00 80.41  ? 651  ALA A CB  1 
ATOM   4980  N  N   . CYS A 1 652  ? 23.761  9.579   -10.950 1.00 84.04  ? 652  CYS A N   1 
ATOM   4981  C  CA  . CYS A 1 652  ? 24.350  8.314   -11.360 1.00 88.30  ? 652  CYS A CA  1 
ATOM   4982  C  C   . CYS A 1 652  ? 25.598  8.571   -12.203 1.00 89.59  ? 652  CYS A C   1 
ATOM   4983  O  O   . CYS A 1 652  ? 25.533  9.267   -13.214 1.00 88.20  ? 652  CYS A O   1 
ATOM   4984  C  CB  . CYS A 1 652  ? 23.357  7.489   -12.174 1.00 88.53  ? 652  CYS A CB  1 
ATOM   4985  S  SG  . CYS A 1 652  ? 21.834  7.087   -11.279 1.00 90.16  ? 652  CYS A SG  1 
ATOM   4986  N  N   . SER A 1 653  ? 26.730  7.996   -11.778 1.00 92.96  ? 653  SER A N   1 
ATOM   4987  C  CA  . SER A 1 653  ? 27.960  8.038   -12.554 1.00 95.85  ? 653  SER A CA  1 
ATOM   4988  C  C   . SER A 1 653  ? 29.005  7.106   -11.945 1.00 100.73 ? 653  SER A C   1 
ATOM   4989  O  O   . SER A 1 653  ? 28.698  6.306   -11.063 1.00 103.57 ? 653  SER A O   1 
ATOM   4990  C  CB  . SER A 1 653  ? 28.490  9.452   -12.672 1.00 95.06  ? 653  SER A CB  1 
ATOM   4991  O  OG  . SER A 1 653  ? 29.093  9.883   -11.458 1.00 96.29  ? 653  SER A OG  1 
ATOM   4992  N  N   . ASP A 1 654  ? 30.245  7.232   -12.437 1.00 101.93 ? 654  ASP A N   1 
ATOM   4993  C  CA  . ASP A 1 654  ? 31.403  6.533   -11.906 1.00 104.98 ? 654  ASP A CA  1 
ATOM   4994  C  C   . ASP A 1 654  ? 31.670  7.008   -10.480 1.00 105.56 ? 654  ASP A C   1 
ATOM   4995  O  O   . ASP A 1 654  ? 32.356  6.334   -9.713  1.00 109.48 ? 654  ASP A O   1 
ATOM   4996  C  CB  . ASP A 1 654  ? 32.624  6.759   -12.800 1.00 106.78 ? 654  ASP A CB  1 
ATOM   4997  C  CG  . ASP A 1 654  ? 32.973  8.227   -12.980 1.00 105.03 ? 654  ASP A CG  1 
ATOM   4998  O  OD1 . ASP A 1 654  ? 32.092  8.992   -13.425 1.00 102.09 ? 654  ASP A OD1 1 
ATOM   4999  O  OD2 . ASP A 1 654  ? 34.118  8.599   -12.662 1.00 107.45 ? 654  ASP A OD2 1 
ATOM   5000  N  N   . ARG A 1 655  ? 31.141  8.192   -10.153 1.00 102.41 ? 655  ARG A N   1 
ATOM   5001  C  CA  . ARG A 1 655  ? 31.175  8.710   -8.796  1.00 103.13 ? 655  ARG A CA  1 
ATOM   5002  C  C   . ARG A 1 655  ? 29.745  9.070   -8.407  1.00 98.55  ? 655  ARG A C   1 
ATOM   5003  O  O   . ARG A 1 655  ? 29.328  10.217  -8.550  1.00 97.34  ? 655  ARG A O   1 
ATOM   5004  C  CB  . ARG A 1 655  ? 32.193  9.849   -8.656  1.00 105.85 ? 655  ARG A CB  1 
ATOM   5005  C  CG  . ARG A 1 655  ? 33.641  9.396   -8.794  1.00 112.38 ? 655  ARG A CG  1 
ATOM   5006  C  CD  . ARG A 1 655  ? 34.657  10.519  -8.889  1.00 115.69 ? 655  ARG A CD  1 
ATOM   5007  N  NE  . ARG A 1 655  ? 34.845  11.191  -7.611  1.00 118.80 ? 655  ARG A NE  1 
ATOM   5008  C  CZ  . ARG A 1 655  ? 35.532  10.698  -6.584  1.00 123.79 ? 655  ARG A CZ  1 
ATOM   5009  N  NH1 . ARG A 1 655  ? 36.105  9.509   -6.670  1.00 128.30 ? 655  ARG A NH1 1 
ATOM   5010  N  NH2 . ARG A 1 655  ? 35.636  11.397  -5.467  1.00 125.64 ? 655  ARG A NH2 1 
ATOM   5011  N  N   . PRO A 1 656  ? 28.939  8.075   -7.962  1.00 97.73  ? 656  PRO A N   1 
ATOM   5012  C  CA  . PRO A 1 656  ? 27.544  8.309   -7.585  1.00 93.07  ? 656  PRO A CA  1 
ATOM   5013  C  C   . PRO A 1 656  ? 27.426  9.230   -6.376  1.00 90.81  ? 656  PRO A C   1 
ATOM   5014  O  O   . PRO A 1 656  ? 28.207  9.132   -5.434  1.00 94.43  ? 656  PRO A O   1 
ATOM   5015  C  CB  . PRO A 1 656  ? 27.008  6.908   -7.245  1.00 95.72  ? 656  PRO A CB  1 
ATOM   5016  C  CG  . PRO A 1 656  ? 28.242  6.090   -6.922  1.00 100.53 ? 656  PRO A CG  1 
ATOM   5017  C  CD  . PRO A 1 656  ? 29.330  6.664   -7.807  1.00 101.39 ? 656  PRO A CD  1 
ATOM   5018  N  N   . THR A 1 657  ? 26.423  10.107  -6.416  1.00 85.54  ? 657  THR A N   1 
ATOM   5019  C  CA  . THR A 1 657  ? 26.312  11.218  -5.488  1.00 84.12  ? 657  THR A CA  1 
ATOM   5020  C  C   . THR A 1 657  ? 24.837  11.433  -5.169  1.00 81.17  ? 657  THR A C   1 
ATOM   5021  O  O   . THR A 1 657  ? 23.986  11.198  -6.020  1.00 79.30  ? 657  THR A O   1 
ATOM   5022  C  CB  . THR A 1 657  ? 26.893  12.491  -6.123  1.00 82.42  ? 657  THR A CB  1 
ATOM   5023  O  OG1 . THR A 1 657  ? 28.182  12.208  -6.669  1.00 84.34  ? 657  THR A OG1 1 
ATOM   5024  C  CG2 . THR A 1 657  ? 26.966  13.669  -5.175  1.00 81.96  ? 657  THR A CG2 1 
ATOM   5025  N  N   . VAL A 1 658  ? 24.544  11.876  -3.944  1.00 81.46  ? 658  VAL A N   1 
ATOM   5026  C  CA  . VAL A 1 658  ? 23.221  12.393  -3.637  1.00 79.82  ? 658  VAL A CA  1 
ATOM   5027  C  C   . VAL A 1 658  ? 23.319  13.909  -3.514  1.00 79.04  ? 658  VAL A C   1 
ATOM   5028  O  O   . VAL A 1 658  ? 24.224  14.424  -2.862  1.00 81.96  ? 658  VAL A O   1 
ATOM   5029  C  CB  . VAL A 1 658  ? 22.614  11.759  -2.371  1.00 81.85  ? 658  VAL A CB  1 
ATOM   5030  C  CG1 . VAL A 1 658  ? 21.416  12.540  -1.850  1.00 80.34  ? 658  VAL A CG1 1 
ATOM   5031  C  CG2 . VAL A 1 658  ? 22.232  10.307  -2.606  1.00 82.88  ? 658  VAL A CG2 1 
ATOM   5032  N  N   . ILE A 1 659  ? 22.374  14.600  -4.156  1.00 76.02  ? 659  ILE A N   1 
ATOM   5033  C  CA  . ILE A 1 659  ? 22.206  16.034  -4.014  1.00 75.14  ? 659  ILE A CA  1 
ATOM   5034  C  C   . ILE A 1 659  ? 21.033  16.274  -3.066  1.00 76.14  ? 659  ILE A C   1 
ATOM   5035  O  O   . ILE A 1 659  ? 19.987  15.650  -3.222  1.00 76.42  ? 659  ILE A O   1 
ATOM   5036  C  CB  . ILE A 1 659  ? 21.958  16.662  -5.396  1.00 71.91  ? 659  ILE A CB  1 
ATOM   5037  C  CG1 . ILE A 1 659  ? 23.035  16.256  -6.408  1.00 71.48  ? 659  ILE A CG1 1 
ATOM   5038  C  CG2 . ILE A 1 659  ? 21.811  18.170  -5.273  1.00 71.53  ? 659  ILE A CG2 1 
ATOM   5039  C  CD1 . ILE A 1 659  ? 22.676  16.553  -7.850  1.00 68.91  ? 659  ILE A CD1 1 
ATOM   5040  N  N   . TYR A 1 660  ? 21.217  17.159  -2.077  1.00 77.78  ? 660  TYR A N   1 
ATOM   5041  C  CA  . TYR A 1 660  ? 20.166  17.467  -1.116  1.00 79.33  ? 660  TYR A CA  1 
ATOM   5042  C  C   . TYR A 1 660  ? 20.321  18.894  -0.596  1.00 80.28  ? 660  TYR A C   1 
ATOM   5043  O  O   . TYR A 1 660  ? 21.226  19.604  -1.016  1.00 79.90  ? 660  TYR A O   1 
ATOM   5044  C  CB  . TYR A 1 660  ? 20.122  16.408  -0.013  1.00 82.86  ? 660  TYR A CB  1 
ATOM   5045  C  CG  . TYR A 1 660  ? 21.335  16.331  0.880   1.00 86.99  ? 660  TYR A CG  1 
ATOM   5046  C  CD1 . TYR A 1 660  ? 22.424  15.539  0.546   1.00 87.79  ? 660  TYR A CD1 1 
ATOM   5047  C  CD2 . TYR A 1 660  ? 21.383  17.024  2.083   1.00 89.76  ? 660  TYR A CD2 1 
ATOM   5048  C  CE1 . TYR A 1 660  ? 23.531  15.449  1.378   1.00 90.86  ? 660  TYR A CE1 1 
ATOM   5049  C  CE2 . TYR A 1 660  ? 22.482  16.947  2.923   1.00 92.70  ? 660  TYR A CE2 1 
ATOM   5050  C  CZ  . TYR A 1 660  ? 23.559  16.156  2.569   1.00 93.39  ? 660  TYR A CZ  1 
ATOM   5051  O  OH  . TYR A 1 660  ? 24.636  16.089  3.406   1.00 97.52  ? 660  TYR A OH  1 
ATOM   5052  N  N   . SER A 1 661  ? 19.426  19.316  0.305   1.00 82.49  ? 661  SER A N   1 
ATOM   5053  C  CA  . SER A 1 661  ? 19.453  20.684  0.802   1.00 85.55  ? 661  SER A CA  1 
ATOM   5054  C  C   . SER A 1 661  ? 19.732  20.726  2.303   1.00 90.89  ? 661  SER A C   1 
ATOM   5055  O  O   . SER A 1 661  ? 19.124  19.996  3.077   1.00 93.15  ? 661  SER A O   1 
ATOM   5056  C  CB  . SER A 1 661  ? 18.180  21.414  0.467   1.00 84.75  ? 661  SER A CB  1 
ATOM   5057  O  OG  . SER A 1 661  ? 18.119  22.658  1.157   1.00 87.72  ? 661  SER A OG  1 
ATOM   5058  N  N   . SER A 1 662  ? 20.655  21.603  2.709   1.00 94.52  ? 662  SER A N   1 
ATOM   5059  C  CA  . SER A 1 662  ? 20.864  21.898  4.118   1.00 100.72 ? 662  SER A CA  1 
ATOM   5060  C  C   . SER A 1 662  ? 20.909  23.408  4.314   1.00 103.39 ? 662  SER A C   1 
ATOM   5061  O  O   . SER A 1 662  ? 21.694  24.095  3.663   1.00 103.74 ? 662  SER A O   1 
ATOM   5062  C  CB  . SER A 1 662  ? 22.107  21.243  4.659   1.00 102.92 ? 662  SER A CB  1 
ATOM   5063  O  OG  . SER A 1 662  ? 21.936  19.837  4.745   1.00 103.97 ? 662  SER A OG  1 
ATOM   5064  N  N   . ASN A 1 663  ? 20.047  23.910  5.205   1.00 107.28 ? 663  ASN A N   1 
ATOM   5065  C  CA  . ASN A 1 663  ? 19.940  25.335  5.484   1.00 110.73 ? 663  ASN A CA  1 
ATOM   5066  C  C   . ASN A 1 663  ? 19.737  26.143  4.201   1.00 108.48 ? 663  ASN A C   1 
ATOM   5067  O  O   . ASN A 1 663  ? 20.366  27.190  4.038   1.00 110.19 ? 663  ASN A O   1 
ATOM   5068  C  CB  . ASN A 1 663  ? 21.186  25.874  6.191   1.00 114.43 ? 663  ASN A CB  1 
ATOM   5069  C  CG  . ASN A 1 663  ? 21.314  25.406  7.622   1.00 120.00 ? 663  ASN A CG  1 
ATOM   5070  O  OD1 . ASN A 1 663  ? 20.472  25.720  8.458   1.00 124.01 ? 663  ASN A OD1 1 
ATOM   5071  N  ND2 . ASN A 1 663  ? 22.371  24.668  7.917   1.00 121.60 ? 663  ASN A ND2 1 
ATOM   5072  N  N   . HIS A 1 664  ? 18.879  25.648  3.292   1.00 105.14 ? 664  HIS A N   1 
ATOM   5073  C  CA  . HIS A 1 664  ? 18.474  26.362  2.086   1.00 102.40 ? 664  HIS A CA  1 
ATOM   5074  C  C   . HIS A 1 664  ? 19.615  26.466  1.072   1.00 99.87  ? 664  HIS A C   1 
ATOM   5075  O  O   . HIS A 1 664  ? 19.638  27.397  0.268   1.00 98.84  ? 664  HIS A O   1 
ATOM   5076  C  CB  . HIS A 1 664  ? 17.911  27.755  2.426   1.00 105.85 ? 664  HIS A CB  1 
ATOM   5077  C  CG  . HIS A 1 664  ? 16.524  27.753  2.980   1.00 109.53 ? 664  HIS A CG  1 
ATOM   5078  N  ND1 . HIS A 1 664  ? 15.403  27.881  2.173   1.00 108.34 ? 664  HIS A ND1 1 
ATOM   5079  C  CD2 . HIS A 1 664  ? 16.067  27.654  4.250   1.00 113.25 ? 664  HIS A CD2 1 
ATOM   5080  C  CE1 . HIS A 1 664  ? 14.316  27.853  2.923   1.00 110.18 ? 664  HIS A CE1 1 
ATOM   5081  N  NE2 . HIS A 1 664  ? 14.697  27.713  4.202   1.00 113.70 ? 664  HIS A NE2 1 
ATOM   5082  N  N   . LYS A 1 665  ? 20.559  25.517  1.119   1.00 98.97  ? 665  LYS A N   1 
ATOM   5083  C  CA  . LYS A 1 665  ? 21.675  25.474  0.184   1.00 96.36  ? 665  LYS A CA  1 
ATOM   5084  C  C   . LYS A 1 665  ? 21.894  24.023  -0.237  1.00 93.91  ? 665  LYS A C   1 
ATOM   5085  O  O   . LYS A 1 665  ? 21.658  23.112  0.552   1.00 95.23  ? 665  LYS A O   1 
ATOM   5086  C  CB  . LYS A 1 665  ? 22.933  26.080  0.818   1.00 99.58  ? 665  LYS A CB  1 
ATOM   5087  C  CG  . LYS A 1 665  ? 22.871  27.573  1.121   1.00 102.33 ? 665  LYS A CG  1 
ATOM   5088  C  CD  . LYS A 1 665  ? 24.007  28.076  2.000   1.00 107.55 ? 665  LYS A CD  1 
ATOM   5089  C  CE  . LYS A 1 665  ? 23.723  28.025  3.488   1.00 112.09 ? 665  LYS A CE  1 
ATOM   5090  N  NZ  . LYS A 1 665  ? 23.743  26.642  4.024   1.00 112.73 ? 665  LYS A NZ  1 
ATOM   5091  N  N   . LEU A 1 666  ? 22.329  23.820  -1.487  1.00 90.81  ? 666  LEU A N   1 
ATOM   5092  C  CA  . LEU A 1 666  ? 22.480  22.480  -2.035  1.00 88.60  ? 666  LEU A CA  1 
ATOM   5093  C  C   . LEU A 1 666  ? 23.779  21.855  -1.542  1.00 89.68  ? 666  LEU A C   1 
ATOM   5094  O  O   . LEU A 1 666  ? 24.839  22.469  -1.641  1.00 91.27  ? 666  LEU A O   1 
ATOM   5095  C  CB  . LEU A 1 666  ? 22.457  22.534  -3.566  1.00 86.56  ? 666  LEU A CB  1 
ATOM   5096  C  CG  . LEU A 1 666  ? 21.154  22.068  -4.211  1.00 85.05  ? 666  LEU A CG  1 
ATOM   5097  C  CD1 . LEU A 1 666  ? 19.996  22.959  -3.796  1.00 85.19  ? 666  LEU A CD1 1 
ATOM   5098  C  CD2 . LEU A 1 666  ? 21.286  22.029  -5.724  1.00 83.49  ? 666  LEU A CD2 1 
ATOM   5099  N  N   . VAL A 1 667  ? 23.669  20.620  -1.038  1.00 88.94  ? 667  VAL A N   1 
ATOM   5100  C  CA  . VAL A 1 667  ? 24.802  19.859  -0.538  1.00 90.50  ? 667  VAL A CA  1 
ATOM   5101  C  C   . VAL A 1 667  ? 24.976  18.621  -1.415  1.00 87.85  ? 667  VAL A C   1 
ATOM   5102  O  O   . VAL A 1 667  ? 24.029  18.158  -2.045  1.00 85.90  ? 667  VAL A O   1 
ATOM   5103  C  CB  . VAL A 1 667  ? 24.628  19.485  0.950   1.00 94.05  ? 667  VAL A CB  1 
ATOM   5104  C  CG1 . VAL A 1 667  ? 25.908  18.916  1.546   1.00 97.58  ? 667  VAL A CG1 1 
ATOM   5105  C  CG2 . VAL A 1 667  ? 24.150  20.666  1.780   1.00 95.54  ? 667  VAL A CG2 1 
ATOM   5106  N  N   . PHE A 1 668  ? 26.203  18.097  -1.446  1.00 88.14  ? 668  PHE A N   1 
ATOM   5107  C  CA  . PHE A 1 668  ? 26.523  16.916  -2.223  1.00 86.56  ? 668  PHE A CA  1 
ATOM   5108  C  C   . PHE A 1 668  ? 27.213  15.927  -1.297  1.00 90.11  ? 668  PHE A C   1 
ATOM   5109  O  O   . PHE A 1 668  ? 28.053  16.328  -0.499  1.00 94.23  ? 668  PHE A O   1 
ATOM   5110  C  CB  . PHE A 1 668  ? 27.416  17.305  -3.403  1.00 85.42  ? 668  PHE A CB  1 
ATOM   5111  C  CG  . PHE A 1 668  ? 26.805  18.329  -4.325  1.00 82.26  ? 668  PHE A CG  1 
ATOM   5112  C  CD1 . PHE A 1 668  ? 26.828  19.680  -4.015  1.00 82.86  ? 668  PHE A CD1 1 
ATOM   5113  C  CD2 . PHE A 1 668  ? 26.196  17.933  -5.502  1.00 79.69  ? 668  PHE A CD2 1 
ATOM   5114  C  CE1 . PHE A 1 668  ? 26.252  20.610  -4.866  1.00 80.80  ? 668  PHE A CE1 1 
ATOM   5115  C  CE2 . PHE A 1 668  ? 25.615  18.861  -6.351  1.00 77.43  ? 668  PHE A CE2 1 
ATOM   5116  C  CZ  . PHE A 1 668  ? 25.648  20.197  -6.032  1.00 78.50  ? 668  PHE A CZ  1 
ATOM   5117  N  N   . SER A 1 669  ? 26.827  14.651  -1.382  1.00 90.04  ? 669  SER A N   1 
ATOM   5118  C  CA  . SER A 1 669  ? 27.466  13.616  -0.588  1.00 94.41  ? 669  SER A CA  1 
ATOM   5119  C  C   . SER A 1 669  ? 27.705  12.385  -1.453  1.00 94.29  ? 669  SER A C   1 
ATOM   5120  O  O   . SER A 1 669  ? 26.810  11.965  -2.178  1.00 93.01  ? 669  SER A O   1 
ATOM   5121  C  CB  . SER A 1 669  ? 26.660  13.285  0.638   1.00 96.72  ? 669  SER A CB  1 
ATOM   5122  O  OG  . SER A 1 669  ? 26.942  14.202  1.684   1.00 101.06 ? 669  SER A OG  1 
ATOM   5123  N  N   . ASN A 1 670  ? 28.924  11.839  -1.383  1.00 97.52  ? 670  ASN A N   1 
ATOM   5124  C  CA  . ASN A 1 670  ? 29.317  10.681  -2.168  1.00 98.62  ? 670  ASN A CA  1 
ATOM   5125  C  C   . ASN A 1 670  ? 28.585  9.450   -1.655  1.00 100.36 ? 670  ASN A C   1 
ATOM   5126  O  O   . ASN A 1 670  ? 28.514  9.231   -0.451  1.00 103.25 ? 670  ASN A O   1 
ATOM   5127  C  CB  . ASN A 1 670  ? 30.812  10.375  -2.054  1.00 102.91 ? 670  ASN A CB  1 
ATOM   5128  C  CG  . ASN A 1 670  ? 31.690  11.286  -2.881  1.00 102.28 ? 670  ASN A CG  1 
ATOM   5129  O  OD1 . ASN A 1 670  ? 31.324  11.673  -3.987  1.00 99.46  ? 670  ASN A OD1 1 
ATOM   5130  N  ND2 . ASN A 1 670  ? 32.862  11.613  -2.364  1.00 105.28 ? 670  ASN A ND2 1 
ATOM   5131  N  N   . VAL A 1 671  ? 28.055  8.659   -2.592  1.00 99.73  ? 671  VAL A N   1 
ATOM   5132  C  CA  . VAL A 1 671  ? 27.480  7.357   -2.295  1.00 101.79 ? 671  VAL A CA  1 
ATOM   5133  C  C   . VAL A 1 671  ? 28.574  6.314   -2.493  1.00 105.60 ? 671  VAL A C   1 
ATOM   5134  O  O   . VAL A 1 671  ? 29.290  6.361   -3.491  1.00 104.91 ? 671  VAL A O   1 
ATOM   5135  C  CB  . VAL A 1 671  ? 26.256  7.068   -3.182  1.00 98.71  ? 671  VAL A CB  1 
ATOM   5136  C  CG1 . VAL A 1 671  ? 25.918  5.586   -3.242  1.00 100.46 ? 671  VAL A CG1 1 
ATOM   5137  C  CG2 . VAL A 1 671  ? 25.053  7.871   -2.719  1.00 97.13  ? 671  VAL A CG2 1 
ATOM   5138  N  N   . ASN A 1 672  ? 28.663  5.369   -1.548  1.00 109.73 ? 672  ASN A N   1 
ATOM   5139  C  CA  . ASN A 1 672  ? 29.799  4.464   -1.444  1.00 115.04 ? 672  ASN A CA  1 
ATOM   5140  C  C   . ASN A 1 672  ? 29.591  3.235   -2.333  1.00 115.96 ? 672  ASN A C   1 
ATOM   5141  O  O   . ASN A 1 672  ? 29.546  2.107   -1.846  1.00 119.48 ? 672  ASN A O   1 
ATOM   5142  C  CB  . ASN A 1 672  ? 30.156  4.170   0.021   1.00 119.98 ? 672  ASN A CB  1 
ATOM   5143  C  CG  . ASN A 1 672  ? 30.739  5.356   0.768   1.00 120.92 ? 672  ASN A CG  1 
ATOM   5144  O  OD1 . ASN A 1 672  ? 31.121  6.359   0.168   1.00 118.36 ? 672  ASN A OD1 1 
ATOM   5145  N  ND2 . ASN A 1 672  ? 30.830  5.248   2.084   1.00 124.69 ? 672  ASN A ND2 1 
ATOM   5146  N  N   . LEU A 1 673  ? 29.475  3.473   -3.647  1.00 113.60 ? 673  LEU A N   1 
ATOM   5147  C  CA  . LEU A 1 673  ? 29.363  2.430   -4.658  1.00 115.45 ? 673  LEU A CA  1 
ATOM   5148  C  C   . LEU A 1 673  ? 30.375  2.707   -5.764  1.00 116.06 ? 673  LEU A C   1 
ATOM   5149  O  O   . LEU A 1 673  ? 30.828  3.839   -5.913  1.00 114.77 ? 673  LEU A O   1 
ATOM   5150  C  CB  . LEU A 1 673  ? 27.944  2.429   -5.242  1.00 112.07 ? 673  LEU A CB  1 
ATOM   5151  C  CG  . LEU A 1 673  ? 26.847  1.838   -4.355  1.00 113.06 ? 673  LEU A CG  1 
ATOM   5152  C  CD1 . LEU A 1 673  ? 25.472  2.309   -4.805  1.00 108.74 ? 673  LEU A CD1 1 
ATOM   5153  C  CD2 . LEU A 1 673  ? 26.910  0.315   -4.338  1.00 117.23 ? 673  LEU A CD2 1 
ATOM   5154  N  N   . LYS A 1 674  ? 30.698  1.669   -6.546  1.00 119.43 ? 674  LYS A N   1 
ATOM   5155  C  CA  . LYS A 1 674  ? 31.654  1.779   -7.638  1.00 121.06 ? 674  LYS A CA  1 
ATOM   5156  C  C   . LYS A 1 674  ? 31.052  2.624   -8.754  1.00 117.19 ? 674  LYS A C   1 
ATOM   5157  O  O   . LYS A 1 674  ? 31.556  3.703   -9.055  1.00 117.39 ? 674  LYS A O   1 
ATOM   5158  C  CB  . LYS A 1 674  ? 32.042  0.398   -8.174  1.00 124.98 ? 674  LYS A CB  1 
ATOM   5159  C  CG  . LYS A 1 674  ? 32.994  -0.405  -7.299  1.00 131.09 ? 674  LYS A CG  1 
ATOM   5160  C  CD  . LYS A 1 674  ? 33.067  -1.860  -7.706  1.00 135.24 ? 674  LYS A CD  1 
ATOM   5161  C  CE  . LYS A 1 674  ? 34.337  -2.547  -7.253  1.00 141.03 ? 674  LYS A CE  1 
ATOM   5162  N  NZ  . LYS A 1 674  ? 34.461  -3.894  -7.858  1.00 145.82 ? 674  LYS A NZ  1 
ATOM   5163  N  N   . GLU A 1 675  ? 29.969  2.120   -9.354  1.00 115.31 ? 675  GLU A N   1 
ATOM   5164  C  CA  . GLU A 1 675  ? 29.319  2.836   -10.437 1.00 112.16 ? 675  GLU A CA  1 
ATOM   5165  C  C   . GLU A 1 675  ? 27.838  2.479   -10.490 1.00 109.59 ? 675  GLU A C   1 
ATOM   5166  O  O   . GLU A 1 675  ? 27.463  1.328   -10.284 1.00 112.94 ? 675  GLU A O   1 
ATOM   5167  C  CB  . GLU A 1 675  ? 29.982  2.533   -11.781 1.00 115.91 ? 675  GLU A CB  1 
ATOM   5168  C  CG  . GLU A 1 675  ? 29.550  3.505   -12.866 1.00 115.45 ? 675  GLU A CG  1 
ATOM   5169  C  CD  . GLU A 1 675  ? 30.261  3.388   -14.204 1.00 119.35 ? 675  GLU A CD  1 
ATOM   5170  O  OE1 . GLU A 1 675  ? 29.972  2.422   -14.938 1.00 123.41 ? 675  GLU A OE1 1 
ATOM   5171  O  OE2 . GLU A 1 675  ? 31.102  4.266   -14.507 1.00 119.56 ? 675  GLU A OE2 1 
ATOM   5172  N  N   . VAL A 1 676  ? 27.021  3.494   -10.786 1.00 103.45 ? 676  VAL A N   1 
ATOM   5173  C  CA  . VAL A 1 676  ? 25.590  3.354   -10.966 1.00 100.44 ? 676  VAL A CA  1 
ATOM   5174  C  C   . VAL A 1 676  ? 25.244  4.067   -12.268 1.00 97.66  ? 676  VAL A C   1 
ATOM   5175  O  O   . VAL A 1 676  ? 25.537  5.249   -12.420 1.00 96.49  ? 676  VAL A O   1 
ATOM   5176  C  CB  . VAL A 1 676  ? 24.820  3.966   -9.778  1.00 98.58  ? 676  VAL A CB  1 
ATOM   5177  C  CG1 . VAL A 1 676  ? 23.314  3.827   -9.933  1.00 97.09  ? 676  VAL A CG1 1 
ATOM   5178  C  CG2 . VAL A 1 676  ? 25.271  3.400   -8.440  1.00 101.35 ? 676  VAL A CG2 1 
ATOM   5179  N  N   . ASN A 1 677  ? 24.636  3.336   -13.206 1.00 97.63  ? 677  ASN A N   1 
ATOM   5180  C  CA  . ASN A 1 677  ? 24.229  3.933   -14.466 1.00 94.69  ? 677  ASN A CA  1 
ATOM   5181  C  C   . ASN A 1 677  ? 22.851  4.568   -14.306 1.00 91.42  ? 677  ASN A C   1 
ATOM   5182  O  O   . ASN A 1 677  ? 22.677  5.735   -14.650 1.00 88.96  ? 677  ASN A O   1 
ATOM   5183  C  CB  . ASN A 1 677  ? 24.296  2.945   -15.631 1.00 96.90  ? 677  ASN A CB  1 
ATOM   5184  C  CG  . ASN A 1 677  ? 25.687  2.397   -15.858 1.00 99.98  ? 677  ASN A CG  1 
ATOM   5185  O  OD1 . ASN A 1 677  ? 26.665  3.140   -15.857 1.00 99.32  ? 677  ASN A OD1 1 
ATOM   5186  N  ND2 . ASN A 1 677  ? 25.784  1.094   -16.049 1.00 104.36 ? 677  ASN A ND2 1 
ATOM   5187  N  N   . TYR A 1 678  ? 21.897  3.787   -13.772 1.00 91.49  ? 678  TYR A N   1 
ATOM   5188  C  CA  . TYR A 1 678  ? 20.510  4.203   -13.618 1.00 88.26  ? 678  TYR A CA  1 
ATOM   5189  C  C   . TYR A 1 678  ? 19.988  3.780   -12.251 1.00 87.38  ? 678  TYR A C   1 
ATOM   5190  O  O   . TYR A 1 678  ? 20.439  2.782   -11.698 1.00 90.16  ? 678  TYR A O   1 
ATOM   5191  C  CB  . TYR A 1 678  ? 19.642  3.563   -14.702 1.00 90.58  ? 678  TYR A CB  1 
ATOM   5192  C  CG  . TYR A 1 678  ? 20.181  3.767   -16.093 1.00 92.15  ? 678  TYR A CG  1 
ATOM   5193  C  CD1 . TYR A 1 678  ? 19.897  4.928   -16.797 1.00 90.04  ? 678  TYR A CD1 1 
ATOM   5194  C  CD2 . TYR A 1 678  ? 21.006  2.825   -16.692 1.00 95.54  ? 678  TYR A CD2 1 
ATOM   5195  C  CE1 . TYR A 1 678  ? 20.404  5.143   -18.069 1.00 90.87  ? 678  TYR A CE1 1 
ATOM   5196  C  CE2 . TYR A 1 678  ? 21.522  3.025   -17.963 1.00 96.46  ? 678  TYR A CE2 1 
ATOM   5197  C  CZ  . TYR A 1 678  ? 21.219  4.188   -18.653 1.00 94.09  ? 678  TYR A CZ  1 
ATOM   5198  O  OH  . TYR A 1 678  ? 21.711  4.402   -19.908 1.00 95.27  ? 678  TYR A OH  1 
ATOM   5199  N  N   . MET A 1 679  ? 19.026  4.542   -11.726 1.00 83.65  ? 679  MET A N   1 
ATOM   5200  C  CA  . MET A 1 679  ? 18.359  4.153   -10.498 1.00 84.57  ? 679  MET A CA  1 
ATOM   5201  C  C   . MET A 1 679  ? 16.941  4.715   -10.470 1.00 83.07  ? 679  MET A C   1 
ATOM   5202  O  O   . MET A 1 679  ? 16.639  5.656   -11.203 1.00 80.30  ? 679  MET A O   1 
ATOM   5203  C  CB  . MET A 1 679  ? 19.135  4.625   -9.266  1.00 84.15  ? 679  MET A CB  1 
ATOM   5204  C  CG  . MET A 1 679  ? 19.166  6.125   -9.093  1.00 81.74  ? 679  MET A CG  1 
ATOM   5205  S  SD  . MET A 1 679  ? 17.701  6.830   -8.289  1.00 80.46  ? 679  MET A SD  1 
ATOM   5206  C  CE  . MET A 1 679  ? 17.782  6.079   -6.665  1.00 82.72  ? 679  MET A CE  1 
ATOM   5207  N  N   . CYS A 1 680  ? 16.093  4.120   -9.613  1.00 84.79  ? 680  CYS A N   1 
ATOM   5208  C  CA  . CYS A 1 680  ? 14.776  4.648   -9.292  1.00 83.16  ? 680  CYS A CA  1 
ATOM   5209  C  C   . CYS A 1 680  ? 14.374  4.244   -7.876  1.00 84.18  ? 680  CYS A C   1 
ATOM   5210  O  O   . CYS A 1 680  ? 14.816  3.208   -7.381  1.00 86.25  ? 680  CYS A O   1 
ATOM   5211  C  CB  . CYS A 1 680  ? 13.734  4.122   -10.268 1.00 84.94  ? 680  CYS A CB  1 
ATOM   5212  S  SG  . CYS A 1 680  ? 13.302  2.390   -9.968  1.00 92.52  ? 680  CYS A SG  1 
ATOM   5213  N  N   . PRO A 1 681  ? 13.503  5.035   -7.205  1.00 82.88  ? 681  PRO A N   1 
ATOM   5214  C  CA  . PRO A 1 681  ? 13.000  4.689   -5.875  1.00 86.03  ? 681  PRO A CA  1 
ATOM   5215  C  C   . PRO A 1 681  ? 12.039  3.507   -5.975  1.00 89.77  ? 681  PRO A C   1 
ATOM   5216  O  O   . PRO A 1 681  ? 11.435  3.279   -7.020  1.00 90.20  ? 681  PRO A O   1 
ATOM   5217  C  CB  . PRO A 1 681  ? 12.264  5.958   -5.416  1.00 83.54  ? 681  PRO A CB  1 
ATOM   5218  C  CG  . PRO A 1 681  ? 11.861  6.648   -6.702  1.00 80.37  ? 681  PRO A CG  1 
ATOM   5219  C  CD  . PRO A 1 681  ? 12.943  6.300   -7.704  1.00 79.67  ? 681  PRO A CD  1 
ATOM   5220  N  N   . LEU A 1 682  ? 11.916  2.750   -4.882  1.00 93.78  ? 682  LEU A N   1 
ATOM   5221  C  CA  . LEU A 1 682  ? 11.098  1.551   -4.876  1.00 97.51  ? 682  LEU A CA  1 
ATOM   5222  C  C   . LEU A 1 682  ? 10.475  1.402   -3.491  1.00 101.26 ? 682  LEU A C   1 
ATOM   5223  O  O   . LEU A 1 682  ? 11.119  0.917   -2.563  1.00 104.60 ? 682  LEU A O   1 
ATOM   5224  C  CB  . LEU A 1 682  ? 11.982  0.356   -5.257  1.00 99.64  ? 682  LEU A CB  1 
ATOM   5225  C  CG  . LEU A 1 682  ? 11.269  -0.971  -5.515  1.00 103.29 ? 682  LEU A CG  1 
ATOM   5226  C  CD1 . LEU A 1 682  ? 10.105  -0.793  -6.481  1.00 102.05 ? 682  LEU A CD1 1 
ATOM   5227  C  CD2 . LEU A 1 682  ? 12.246  -2.010  -6.047  1.00 105.33 ? 682  LEU A CD2 1 
ATOM   5228  N  N   . ASN A 1 683  ? 9.221   1.861   -3.368  1.00 101.89 ? 683  ASN A N   1 
ATOM   5229  C  CA  . ASN A 1 683  ? 8.458   1.771   -2.133  1.00 104.60 ? 683  ASN A CA  1 
ATOM   5230  C  C   . ASN A 1 683  ? 7.595   0.515   -2.203  1.00 108.47 ? 683  ASN A C   1 
ATOM   5231  O  O   . ASN A 1 683  ? 6.448   0.571   -2.636  1.00 109.29 ? 683  ASN A O   1 
ATOM   5232  C  CB  . ASN A 1 683  ? 7.649   3.051   -1.878  1.00 102.01 ? 683  ASN A CB  1 
ATOM   5233  C  CG  . ASN A 1 683  ? 7.243   3.263   -0.432  1.00 104.22 ? 683  ASN A CG  1 
ATOM   5234  O  OD1 . ASN A 1 683  ? 7.930   2.836   0.492   1.00 106.49 ? 683  ASN A OD1 1 
ATOM   5235  N  ND2 . ASN A 1 683  ? 6.132   3.950   -0.224  1.00 104.02 ? 683  ASN A ND2 1 
ATOM   5236  N  N   . SER A 1 684  ? 8.183   -0.620  -1.815  1.00 112.35 ? 684  SER A N   1 
ATOM   5237  C  CA  . SER A 1 684  ? 7.484   -1.893  -1.828  1.00 118.23 ? 684  SER A CA  1 
ATOM   5238  C  C   . SER A 1 684  ? 6.984   -2.224  -0.422  1.00 122.22 ? 684  SER A C   1 
ATOM   5239  O  O   . SER A 1 684  ? 7.239   -1.479  0.526   1.00 120.96 ? 684  SER A O   1 
ATOM   5240  C  CB  . SER A 1 684  ? 8.366   -2.988  -2.390  1.00 121.12 ? 684  SER A CB  1 
ATOM   5241  O  OG  . SER A 1 684  ? 7.689   -4.243  -2.394  1.00 126.95 ? 684  SER A OG  1 
ATOM   5242  N  N   . ASP A 1 685  ? 6.247   -3.338  -0.310  1.00 126.25 ? 685  ASP A N   1 
ATOM   5243  C  CA  . ASP A 1 685  ? 5.866   -3.890  0.978   1.00 131.13 ? 685  ASP A CA  1 
ATOM   5244  C  C   . ASP A 1 685  ? 7.078   -4.578  1.603   1.00 132.70 ? 685  ASP A C   1 
ATOM   5245  O  O   . ASP A 1 685  ? 7.319   -4.446  2.801   1.00 134.55 ? 685  ASP A O   1 
ATOM   5246  C  CB  . ASP A 1 685  ? 4.656   -4.819  0.844   1.00 136.69 ? 685  ASP A CB  1 
ATOM   5247  C  CG  . ASP A 1 685  ? 3.336   -4.070  0.798   1.00 137.41 ? 685  ASP A CG  1 
ATOM   5248  O  OD1 . ASP A 1 685  ? 2.850   -3.688  1.882   1.00 140.21 ? 685  ASP A OD1 1 
ATOM   5249  O  OD2 . ASP A 1 685  ? 2.813   -3.861  -0.320  1.00 136.37 ? 685  ASP A OD2 1 
ATOM   5250  N  N   . GLY A 1 686  ? 7.843   -5.288  0.765   1.00 132.14 ? 686  GLY A N   1 
ATOM   5251  C  CA  . GLY A 1 686  ? 9.038   -6.002  1.191   1.00 134.50 ? 686  GLY A CA  1 
ATOM   5252  C  C   . GLY A 1 686  ? 10.250  -5.089  1.394   1.00 131.09 ? 686  GLY A C   1 
ATOM   5253  O  O   . GLY A 1 686  ? 11.097  -5.355  2.243   1.00 133.31 ? 686  GLY A O   1 
ATOM   5254  N  N   . TYR A 1 687  ? 10.344  -4.019  0.597   1.00 126.20 ? 687  TYR A N   1 
ATOM   5255  C  CA  . TYR A 1 687  ? 11.450  -3.082  0.723   1.00 123.32 ? 687  TYR A CA  1 
ATOM   5256  C  C   . TYR A 1 687  ? 10.924  -1.650  0.852   1.00 118.64 ? 687  TYR A C   1 
ATOM   5257  O  O   . TYR A 1 687  ? 11.004  -0.881  -0.106  1.00 113.51 ? 687  TYR A O   1 
ATOM   5258  C  CB  . TYR A 1 687  ? 12.360  -3.120  -0.510  1.00 122.62 ? 687  TYR A CB  1 
ATOM   5259  C  CG  . TYR A 1 687  ? 12.589  -4.441  -1.203  1.00 126.39 ? 687  TYR A CG  1 
ATOM   5260  C  CD1 . TYR A 1 687  ? 13.277  -5.474  -0.579  1.00 130.79 ? 687  TYR A CD1 1 
ATOM   5261  C  CD2 . TYR A 1 687  ? 12.187  -4.626  -2.520  1.00 125.03 ? 687  TYR A CD2 1 
ATOM   5262  C  CE1 . TYR A 1 687  ? 13.513  -6.674  -1.233  1.00 134.52 ? 687  TYR A CE1 1 
ATOM   5263  C  CE2 . TYR A 1 687  ? 12.420  -5.818  -3.188  1.00 128.59 ? 687  TYR A CE2 1 
ATOM   5264  C  CZ  . TYR A 1 687  ? 13.084  -6.846  -2.540  1.00 133.59 ? 687  TYR A CZ  1 
ATOM   5265  O  OH  . TYR A 1 687  ? 13.309  -8.023  -3.195  1.00 137.53 ? 687  TYR A OH  1 
ATOM   5266  N  N   . PRO A 1 688  ? 10.383  -1.224  2.022   1.00 119.52 ? 688  PRO A N   1 
ATOM   5267  C  CA  . PRO A 1 688  ? 9.832   0.128   2.160   1.00 116.10 ? 688  PRO A CA  1 
ATOM   5268  C  C   . PRO A 1 688  ? 10.888  1.203   1.916   1.00 112.24 ? 688  PRO A C   1 
ATOM   5269  O  O   . PRO A 1 688  ? 11.975  1.147   2.485   1.00 113.46 ? 688  PRO A O   1 
ATOM   5270  C  CB  . PRO A 1 688  ? 9.330   0.187   3.613   1.00 119.43 ? 688  PRO A CB  1 
ATOM   5271  C  CG  . PRO A 1 688  ? 9.169   -1.266  4.017   1.00 124.63 ? 688  PRO A CG  1 
ATOM   5272  C  CD  . PRO A 1 688  ? 10.251  -2.011  3.260   1.00 124.36 ? 688  PRO A CD  1 
ATOM   5273  N  N   . ASP A 1 689  ? 10.552  2.165   1.048   1.00 109.26 ? 689  ASP A N   1 
ATOM   5274  C  CA  . ASP A 1 689  ? 11.410  3.285   0.675   1.00 107.14 ? 689  ASP A CA  1 
ATOM   5275  C  C   . ASP A 1 689  ? 12.806  2.803   0.266   1.00 106.88 ? 689  ASP A C   1 
ATOM   5276  O  O   . ASP A 1 689  ? 13.811  3.389   0.668   1.00 108.26 ? 689  ASP A O   1 
ATOM   5277  C  CB  . ASP A 1 689  ? 11.402  4.396   1.736   1.00 108.48 ? 689  ASP A CB  1 
ATOM   5278  C  CG  . ASP A 1 689  ? 10.487  5.577   1.425   1.00 106.89 ? 689  ASP A CG  1 
ATOM   5279  O  OD1 . ASP A 1 689  ? 10.323  5.912   0.227   1.00 103.35 ? 689  ASP A OD1 1 
ATOM   5280  O  OD2 . ASP A 1 689  ? 9.949   6.167   2.388   1.00 109.29 ? 689  ASP A OD2 1 
ATOM   5281  N  N   . SER A 1 690  ? 12.858  1.749   -0.560  1.00 106.43 ? 690  SER A N   1 
ATOM   5282  C  CA  . SER A 1 690  ? 14.115  1.189   -1.035  1.00 105.31 ? 690  SER A CA  1 
ATOM   5283  C  C   . SER A 1 690  ? 14.565  1.900   -2.311  1.00 100.52 ? 690  SER A C   1 
ATOM   5284  O  O   . SER A 1 690  ? 13.957  2.888   -2.723  1.00 95.97  ? 690  SER A O   1 
ATOM   5285  C  CB  . SER A 1 690  ? 14.022  -0.303  -1.224  1.00 108.73 ? 690  SER A CB  1 
ATOM   5286  O  OG  . SER A 1 690  ? 13.027  -0.635  -2.181  1.00 108.98 ? 690  SER A OG  1 
ATOM   5287  N  N   . LEU A 1 691  ? 15.659  1.396   -2.898  1.00 101.03 ? 691  LEU A N   1 
ATOM   5288  C  CA  . LEU A 1 691  ? 16.259  1.937   -4.109  1.00 97.84  ? 691  LEU A CA  1 
ATOM   5289  C  C   . LEU A 1 691  ? 16.685  0.778   -5.006  1.00 98.98  ? 691  LEU A C   1 
ATOM   5290  O  O   . LEU A 1 691  ? 17.154  -0.249  -4.521  1.00 101.49 ? 691  LEU A O   1 
ATOM   5291  C  CB  . LEU A 1 691  ? 17.479  2.791   -3.738  1.00 97.64  ? 691  LEU A CB  1 
ATOM   5292  C  CG  . LEU A 1 691  ? 17.229  4.278   -3.482  1.00 95.18  ? 691  LEU A CG  1 
ATOM   5293  C  CD1 . LEU A 1 691  ? 16.734  4.515   -2.064  1.00 97.65  ? 691  LEU A CD1 1 
ATOM   5294  C  CD2 . LEU A 1 691  ? 18.503  5.072   -3.708  1.00 94.28  ? 691  LEU A CD2 1 
ATOM   5295  N  N   . ALA A 1 692  ? 16.520  0.967   -6.319  1.00 97.25  ? 692  ALA A N   1 
ATOM   5296  C  CA  . ALA A 1 692  ? 16.968  0.005   -7.312  1.00 99.60  ? 692  ALA A CA  1 
ATOM   5297  C  C   . ALA A 1 692  ? 18.043  0.650   -8.183  1.00 97.89  ? 692  ALA A C   1 
ATOM   5298  O  O   . ALA A 1 692  ? 17.810  1.707   -8.763  1.00 94.41  ? 692  ALA A O   1 
ATOM   5299  C  CB  . ALA A 1 692  ? 15.797  -0.481  -8.135  1.00 100.38 ? 692  ALA A CB  1 
ATOM   5300  N  N   . LEU A 1 693  ? 19.216  0.002   -8.257  1.00 100.76 ? 693  LEU A N   1 
ATOM   5301  C  CA  . LEU A 1 693  ? 20.397  0.548   -8.914  1.00 99.55  ? 693  LEU A CA  1 
ATOM   5302  C  C   . LEU A 1 693  ? 20.871  -0.416  -9.998  1.00 101.95 ? 693  LEU A C   1 
ATOM   5303  O  O   . LEU A 1 693  ? 20.709  -1.625  -9.863  1.00 105.59 ? 693  LEU A O   1 
ATOM   5304  C  CB  . LEU A 1 693  ? 21.510  0.747   -7.879  1.00 100.34 ? 693  LEU A CB  1 
ATOM   5305  C  CG  . LEU A 1 693  ? 21.129  1.497   -6.604  1.00 99.18  ? 693  LEU A CG  1 
ATOM   5306  C  CD1 . LEU A 1 693  ? 22.089  1.146   -5.482  1.00 103.43 ? 693  LEU A CD1 1 
ATOM   5307  C  CD2 . LEU A 1 693  ? 21.109  3.000   -6.833  1.00 94.93  ? 693  LEU A CD2 1 
ATOM   5308  N  N   . ALA A 1 694  ? 21.486  0.127   -11.055 1.00 100.79 ? 694  ALA A N   1 
ATOM   5309  C  CA  . ALA A 1 694  ? 21.917  -0.699  -12.171 1.00 103.84 ? 694  ALA A CA  1 
ATOM   5310  C  C   . ALA A 1 694  ? 23.245  -0.209  -12.738 1.00 104.39 ? 694  ALA A C   1 
ATOM   5311  O  O   . ALA A 1 694  ? 23.346  0.920   -13.222 1.00 100.97 ? 694  ALA A O   1 
ATOM   5312  C  CB  . ALA A 1 694  ? 20.849  -0.752  -13.235 1.00 103.65 ? 694  ALA A CB  1 
ATOM   5313  N  N   . ASN A 1 695  ? 24.243  -1.100  -12.664 1.00 108.76 ? 695  ASN A N   1 
ATOM   5314  C  CA  . ASN A 1 695  ? 25.533  -0.943  -13.315 1.00 109.81 ? 695  ASN A CA  1 
ATOM   5315  C  C   . ASN A 1 695  ? 25.495  -1.724  -14.628 1.00 112.39 ? 695  ASN A C   1 
ATOM   5316  O  O   . ASN A 1 695  ? 24.414  -2.074  -15.101 1.00 112.72 ? 695  ASN A O   1 
ATOM   5317  C  CB  . ASN A 1 695  ? 26.696  -1.317  -12.384 1.00 112.73 ? 695  ASN A CB  1 
ATOM   5318  C  CG  . ASN A 1 695  ? 26.588  -2.703  -11.780 1.00 117.00 ? 695  ASN A CG  1 
ATOM   5319  O  OD1 . ASN A 1 695  ? 26.267  -3.667  -12.470 1.00 119.40 ? 695  ASN A OD1 1 
ATOM   5320  N  ND2 . ASN A 1 695  ? 26.875  -2.818  -10.495 1.00 118.35 ? 695  ASN A ND2 1 
ATOM   5321  N  N   . ASN A 1 696  ? 26.673  -2.000  -15.199 1.00 114.73 ? 696  ASN A N   1 
ATOM   5322  C  CA  . ASN A 1 696  ? 26.772  -2.666  -16.487 1.00 117.34 ? 696  ASN A CA  1 
ATOM   5323  C  C   . ASN A 1 696  ? 26.232  -4.095  -16.414 1.00 121.55 ? 696  ASN A C   1 
ATOM   5324  O  O   . ASN A 1 696  ? 25.891  -4.664  -17.448 1.00 123.84 ? 696  ASN A O   1 
ATOM   5325  C  CB  . ASN A 1 696  ? 28.204  -2.646  -17.031 1.00 120.66 ? 696  ASN A CB  1 
ATOM   5326  C  CG  . ASN A 1 696  ? 28.641  -1.288  -17.538 1.00 117.12 ? 696  ASN A CG  1 
ATOM   5327  O  OD1 . ASN A 1 696  ? 29.813  -1.082  -17.846 1.00 119.75 ? 696  ASN A OD1 1 
ATOM   5328  N  ND2 . ASN A 1 696  ? 27.712  -0.354  -17.631 1.00 111.70 ? 696  ASN A ND2 1 
ATOM   5329  N  N   . SER A 1 697  ? 26.150  -4.677  -15.208 1.00 122.86 ? 697  SER A N   1 
ATOM   5330  C  CA  . SER A 1 697  ? 25.881  -6.107  -15.122 1.00 127.87 ? 697  SER A CA  1 
ATOM   5331  C  C   . SER A 1 697  ? 24.919  -6.495  -13.995 1.00 127.06 ? 697  SER A C   1 
ATOM   5332  O  O   . SER A 1 697  ? 24.381  -7.600  -14.017 1.00 130.52 ? 697  SER A O   1 
ATOM   5333  C  CB  . SER A 1 697  ? 27.164  -6.921  -15.098 1.00 133.90 ? 697  SER A CB  1 
ATOM   5334  O  OG  . SER A 1 697  ? 27.926  -6.669  -13.927 1.00 134.60 ? 697  SER A OG  1 
ATOM   5335  N  N   . THR A 1 698  ? 24.690  -5.601  -13.023 1.00 122.86 ? 698  THR A N   1 
ATOM   5336  C  CA  . THR A 1 698  ? 23.925  -5.955  -11.834 1.00 122.75 ? 698  THR A CA  1 
ATOM   5337  C  C   . THR A 1 698  ? 22.721  -5.030  -11.665 1.00 117.42 ? 698  THR A C   1 
ATOM   5338  O  O   . THR A 1 698  ? 22.806  -3.833  -11.937 1.00 112.27 ? 698  THR A O   1 
ATOM   5339  C  CB  . THR A 1 698  ? 24.801  -5.917  -10.572 1.00 124.06 ? 698  THR A CB  1 
ATOM   5340  O  OG1 . THR A 1 698  ? 25.864  -6.859  -10.721 1.00 129.14 ? 698  THR A OG1 1 
ATOM   5341  C  CG2 . THR A 1 698  ? 24.043  -6.212  -9.295  1.00 124.47 ? 698  THR A CG2 1 
ATOM   5342  N  N   . LEU A 1 699  ? 21.608  -5.614  -11.203 1.00 118.00 ? 699  LEU A N   1 
ATOM   5343  C  CA  . LEU A 1 699  ? 20.513  -4.860  -10.617 1.00 114.32 ? 699  LEU A CA  1 
ATOM   5344  C  C   . LEU A 1 699  ? 20.547  -5.048  -9.102  1.00 115.49 ? 699  LEU A C   1 
ATOM   5345  O  O   . LEU A 1 699  ? 20.403  -6.159  -8.604  1.00 119.28 ? 699  LEU A O   1 
ATOM   5346  C  CB  . LEU A 1 699  ? 19.183  -5.337  -11.216 1.00 114.40 ? 699  LEU A CB  1 
ATOM   5347  C  CG  . LEU A 1 699  ? 17.927  -4.669  -10.652 1.00 111.37 ? 699  LEU A CG  1 
ATOM   5348  C  CD1 . LEU A 1 699  ? 17.805  -3.227  -11.130 1.00 106.32 ? 699  LEU A CD1 1 
ATOM   5349  C  CD2 . LEU A 1 699  ? 16.678  -5.456  -11.020 1.00 113.17 ? 699  LEU A CD2 1 
ATOM   5350  N  N   . THR A 1 700  ? 20.755  -3.950  -8.376  1.00 113.02 ? 700  THR A N   1 
ATOM   5351  C  CA  . THR A 1 700  ? 20.819  -3.998  -6.927  1.00 114.91 ? 700  THR A CA  1 
ATOM   5352  C  C   . THR A 1 700  ? 19.552  -3.377  -6.350  1.00 112.20 ? 700  THR A C   1 
ATOM   5353  O  O   . THR A 1 700  ? 19.055  -2.381  -6.868  1.00 109.05 ? 700  THR A O   1 
ATOM   5354  C  CB  . THR A 1 700  ? 22.042  -3.228  -6.417  1.00 115.19 ? 700  THR A CB  1 
ATOM   5355  O  OG1 . THR A 1 700  ? 23.172  -3.668  -7.171  1.00 118.18 ? 700  THR A OG1 1 
ATOM   5356  C  CG2 . THR A 1 700  ? 22.298  -3.442  -4.941  1.00 118.28 ? 700  THR A CG2 1 
ATOM   5357  N  N   . ILE A 1 701  ? 19.039  -3.980  -5.276  1.00 114.27 ? 701  ILE A N   1 
ATOM   5358  C  CA  . ILE A 1 701  ? 18.030  -3.333  -4.453  1.00 112.54 ? 701  ILE A CA  1 
ATOM   5359  C  C   . ILE A 1 701  ? 18.627  -3.169  -3.056  1.00 114.51 ? 701  ILE A C   1 
ATOM   5360  O  O   . ILE A 1 701  ? 19.281  -4.080  -2.551  1.00 118.88 ? 701  ILE A O   1 
ATOM   5361  C  CB  . ILE A 1 701  ? 16.697  -4.117  -4.444  1.00 114.07 ? 701  ILE A CB  1 
ATOM   5362  C  CG1 . ILE A 1 701  ? 16.150  -4.364  -5.856  1.00 112.66 ? 701  ILE A CG1 1 
ATOM   5363  C  CG2 . ILE A 1 701  ? 15.670  -3.424  -3.555  1.00 112.26 ? 701  ILE A CG2 1 
ATOM   5364  C  CD1 . ILE A 1 701  ? 15.177  -5.525  -5.953  1.00 116.27 ? 701  ILE A CD1 1 
ATOM   5365  N  N   . GLY A 1 702  ? 18.426  -1.994  -2.451  1.00 111.78 ? 702  GLY A N   1 
ATOM   5366  C  CA  . GLY A 1 702  ? 18.907  -1.768  -1.099  1.00 113.89 ? 702  GLY A CA  1 
ATOM   5367  C  C   . GLY A 1 702  ? 18.289  -0.531  -0.453  1.00 111.75 ? 702  GLY A C   1 
ATOM   5368  O  O   . GLY A 1 702  ? 17.603  0.250   -1.113  1.00 107.12 ? 702  GLY A O   1 
ATOM   5369  N  N   . THR A 1 703  ? 18.554  -0.367  0.849   1.00 115.16 ? 703  THR A N   1 
ATOM   5370  C  CA  . THR A 1 703  ? 18.163  0.835   1.569   1.00 114.51 ? 703  THR A CA  1 
ATOM   5371  C  C   . THR A 1 703  ? 19.357  1.779   1.707   1.00 114.05 ? 703  THR A C   1 
ATOM   5372  O  O   . THR A 1 703  ? 20.485  1.347   1.950   1.00 117.56 ? 703  THR A O   1 
ATOM   5373  C  CB  . THR A 1 703  ? 17.596  0.515   2.958   1.00 118.32 ? 703  THR A CB  1 
ATOM   5374  O  OG1 . THR A 1 703  ? 16.378  -0.217  2.813   1.00 119.04 ? 703  THR A OG1 1 
ATOM   5375  C  CG2 . THR A 1 703  ? 17.355  1.760   3.781   1.00 117.45 ? 703  THR A CG2 1 
ATOM   5376  N  N   . ILE A 1 704  ? 19.075  3.079   1.576   1.00 109.68 ? 704  ILE A N   1 
ATOM   5377  C  CA  . ILE A 1 704  ? 20.083  4.109   1.746   1.00 108.30 ? 704  ILE A CA  1 
ATOM   5378  C  C   . ILE A 1 704  ? 20.094  4.561   3.205   1.00 111.25 ? 704  ILE A C   1 
ATOM   5379  O  O   . ILE A 1 704  ? 19.048  4.613   3.853   1.00 111.27 ? 704  ILE A O   1 
ATOM   5380  C  CB  . ILE A 1 704  ? 19.831  5.274   0.766   1.00 103.21 ? 704  ILE A CB  1 
ATOM   5381  C  CG1 . ILE A 1 704  ? 21.104  6.090   0.513   1.00 102.57 ? 704  ILE A CG1 1 
ATOM   5382  C  CG2 . ILE A 1 704  ? 18.678  6.150   1.240   1.00 101.09 ? 704  ILE A CG2 1 
ATOM   5383  C  CD1 . ILE A 1 704  ? 21.072  6.944   -0.740  1.00 98.07  ? 704  ILE A CD1 1 
ATOM   5384  N  N   . ASP A 1 705  ? 21.299  4.867   3.709   1.00 113.18 ? 705  ASP A N   1 
ATOM   5385  C  CA  . ASP A 1 705  ? 21.478  5.431   5.036   1.00 115.92 ? 705  ASP A CA  1 
ATOM   5386  C  C   . ASP A 1 705  ? 20.996  6.874   5.020   1.00 112.45 ? 705  ASP A C   1 
ATOM   5387  O  O   . ASP A 1 705  ? 20.837  7.458   3.952   1.00 107.99 ? 705  ASP A O   1 
ATOM   5388  C  CB  . ASP A 1 705  ? 22.927  5.288   5.507   1.00 120.44 ? 705  ASP A CB  1 
ATOM   5389  C  CG  . ASP A 1 705  ? 23.241  3.860   5.920   1.00 125.88 ? 705  ASP A CG  1 
ATOM   5390  O  OD1 . ASP A 1 705  ? 22.340  3.007   5.754   1.00 125.44 ? 705  ASP A OD1 1 
ATOM   5391  O  OD2 . ASP A 1 705  ? 24.373  3.609   6.407   1.00 129.91 ? 705  ASP A OD2 1 
ATOM   5392  N  N   . GLU A 1 706  ? 20.765  7.428   6.214   1.00 115.10 ? 706  GLU A N   1 
ATOM   5393  C  CA  . GLU A 1 706  ? 20.314  8.801   6.364   1.00 114.03 ? 706  GLU A CA  1 
ATOM   5394  C  C   . GLU A 1 706  ? 21.135  9.721   5.462   1.00 111.61 ? 706  GLU A C   1 
ATOM   5395  O  O   . GLU A 1 706  ? 22.362  9.629   5.424   1.00 113.76 ? 706  GLU A O   1 
ATOM   5396  C  CB  . GLU A 1 706  ? 20.450  9.212   7.827   1.00 118.01 ? 706  GLU A CB  1 
ATOM   5397  C  CG  . GLU A 1 706  ? 19.855  10.569  8.123   1.00 117.34 ? 706  GLU A CG  1 
ATOM   5398  C  CD  . GLU A 1 706  ? 19.984  10.962  9.582   1.00 122.80 ? 706  GLU A CD  1 
ATOM   5399  O  OE1 . GLU A 1 706  ? 19.824  10.075  10.460  1.00 126.26 ? 706  GLU A OE1 1 
ATOM   5400  O  OE2 . GLU A 1 706  ? 20.256  12.152  9.834   1.00 123.59 ? 706  GLU A OE2 1 
ATOM   5401  N  N   . ILE A 1 707  ? 20.446  10.617  4.749   1.00 108.11 ? 707  ILE A N   1 
ATOM   5402  C  CA  . ILE A 1 707  ? 21.132  11.511  3.834   1.00 105.62 ? 707  ILE A CA  1 
ATOM   5403  C  C   . ILE A 1 707  ? 21.790  12.621  4.649   1.00 109.01 ? 707  ILE A C   1 
ATOM   5404  O  O   . ILE A 1 707  ? 21.108  13.530  5.122   1.00 109.46 ? 707  ILE A O   1 
ATOM   5405  C  CB  . ILE A 1 707  ? 20.178  12.036  2.742   1.00 100.73 ? 707  ILE A CB  1 
ATOM   5406  C  CG1 . ILE A 1 707  ? 19.458  10.891  2.022   1.00 99.28  ? 707  ILE A CG1 1 
ATOM   5407  C  CG2 . ILE A 1 707  ? 20.922  12.929  1.765   1.00 98.45  ? 707  ILE A CG2 1 
ATOM   5408  C  CD1 . ILE A 1 707  ? 20.375  9.841   1.418   1.00 99.08  ? 707  ILE A CD1 1 
ATOM   5409  N  N   . GLN A 1 708  ? 23.119  12.498  4.815   1.00 112.17 ? 708  GLN A N   1 
ATOM   5410  C  CA  . GLN A 1 708  ? 23.949  13.431  5.565   1.00 115.33 ? 708  GLN A CA  1 
ATOM   5411  C  C   . GLN A 1 708  ? 25.426  13.193  5.239   1.00 117.33 ? 708  GLN A C   1 
ATOM   5412  O  O   . GLN A 1 708  ? 25.756  12.385  4.373   1.00 116.62 ? 708  GLN A O   1 
ATOM   5413  C  CB  . GLN A 1 708  ? 23.693  13.270  7.064   1.00 119.98 ? 708  GLN A CB  1 
ATOM   5414  C  CG  . GLN A 1 708  ? 24.148  11.916  7.583   1.00 125.09 ? 708  GLN A CG  1 
ATOM   5415  C  CD  . GLN A 1 708  ? 23.649  11.573  8.963   1.00 130.82 ? 708  GLN A CD  1 
ATOM   5416  O  OE1 . GLN A 1 708  ? 23.268  12.442  9.745   1.00 133.59 ? 708  GLN A OE1 1 
ATOM   5417  N  NE2 . GLN A 1 708  ? 23.691  10.291  9.288   1.00 133.71 ? 708  GLN A NE2 1 
ATOM   5418  N  N   . LYS A 1 709  ? 26.306  13.906  5.956   1.00 121.26 ? 709  LYS A N   1 
ATOM   5419  C  CA  . LYS A 1 709  ? 27.747  13.854  5.757   1.00 123.73 ? 709  LYS A CA  1 
ATOM   5420  C  C   . LYS A 1 709  ? 28.331  12.565  6.341   1.00 127.16 ? 709  LYS A C   1 
ATOM   5421  O  O   . LYS A 1 709  ? 29.134  11.901  5.687   1.00 128.37 ? 709  LYS A O   1 
ATOM   5422  C  CB  . LYS A 1 709  ? 28.406  15.090  6.380   1.00 128.29 ? 709  LYS A CB  1 
ATOM   5423  C  CG  . LYS A 1 709  ? 28.032  16.418  5.731   1.00 127.60 ? 709  LYS A CG  1 
ATOM   5424  C  CD  . LYS A 1 709  ? 28.719  17.619  6.358   1.00 131.77 ? 709  LYS A CD  1 
ATOM   5425  C  CE  . LYS A 1 709  ? 28.357  18.930  5.687   1.00 128.95 ? 709  LYS A CE  1 
ATOM   5426  N  NZ  . LYS A 1 709  ? 28.948  20.080  6.411   1.00 133.30 ? 709  LYS A NZ  1 
ATOM   5427  N  N   . LEU A 1 710  ? 27.919  12.220  7.570   1.00 128.86 ? 710  LEU A N   1 
ATOM   5428  C  CA  . LEU A 1 710  ? 28.452  11.078  8.301   1.00 131.46 ? 710  LEU A CA  1 
ATOM   5429  C  C   . LEU A 1 710  ? 27.650  9.818   7.977   1.00 129.61 ? 710  LEU A C   1 
ATOM   5430  O  O   . LEU A 1 710  ? 26.425  9.831   8.030   1.00 127.70 ? 710  LEU A O   1 
ATOM   5431  C  CB  . LEU A 1 710  ? 28.384  11.373  9.803   1.00 135.34 ? 710  LEU A CB  1 
ATOM   5432  C  CG  . LEU A 1 710  ? 29.123  12.622  10.282  1.00 137.06 ? 710  LEU A CG  1 
ATOM   5433  C  CD1 . LEU A 1 710  ? 29.260  12.618  11.797  1.00 142.60 ? 710  LEU A CD1 1 
ATOM   5434  C  CD2 . LEU A 1 710  ? 30.496  12.720  9.635   1.00 137.71 ? 710  LEU A CD2 1 
ATOM   5435  N  N   . HIS A 1 711  ? 28.357  8.727   7.662   1.00 78.64  ? 711  HIS A N   1 
ATOM   5436  C  CA  . HIS A 1 711  ? 27.762  7.415   7.461   1.00 78.09  ? 711  HIS A CA  1 
ATOM   5437  C  C   . HIS A 1 711  ? 28.238  6.473   8.564   1.00 75.68  ? 711  HIS A C   1 
ATOM   5438  O  O   . HIS A 1 711  ? 29.442  6.259   8.716   1.00 74.95  ? 711  HIS A O   1 
ATOM   5439  C  CB  . HIS A 1 711  ? 28.140  6.878   6.081   1.00 81.40  ? 711  HIS A CB  1 
ATOM   5440  C  CG  . HIS A 1 711  ? 28.120  5.392   5.991   1.00 83.77  ? 711  HIS A CG  1 
ATOM   5441  N  ND1 . HIS A 1 711  ? 29.180  4.660   5.483   1.00 86.37  ? 711  HIS A ND1 1 
ATOM   5442  C  CD2 . HIS A 1 711  ? 27.173  4.496   6.340   1.00 85.74  ? 711  HIS A CD2 1 
ATOM   5443  C  CE1 . HIS A 1 711  ? 28.885  3.374   5.516   1.00 87.99  ? 711  HIS A CE1 1 
ATOM   5444  N  NE2 . HIS A 1 711  ? 27.653  3.249   6.037   1.00 88.51  ? 711  HIS A NE2 1 
ATOM   5445  N  N   . ILE A 1 712  ? 27.285  5.897   9.313   1.00 73.96  ? 712  ILE A N   1 
ATOM   5446  C  CA  . ILE A 1 712  ? 27.589  5.196   10.555  1.00 69.99  ? 712  ILE A CA  1 
ATOM   5447  C  C   . ILE A 1 712  ? 27.139  3.740   10.476  1.00 69.56  ? 712  ILE A C   1 
ATOM   5448  O  O   . ILE A 1 712  ? 26.023  3.458   10.059  1.00 73.27  ? 712  ILE A O   1 
ATOM   5449  C  CB  . ILE A 1 712  ? 26.959  5.919   11.760  1.00 68.11  ? 712  ILE A CB  1 
ATOM   5450  C  CG1 . ILE A 1 712  ? 27.144  7.438   11.659  1.00 68.30  ? 712  ILE A CG1 1 
ATOM   5451  C  CG2 . ILE A 1 712  ? 27.506  5.348   13.058  1.00 66.49  ? 712  ILE A CG2 1 
ATOM   5452  C  CD1 . ILE A 1 712  ? 26.760  8.213   12.899  1.00 67.31  ? 712  ILE A CD1 1 
ATOM   5453  N  N   . ARG A 1 713  ? 28.024  2.829   10.891  1.00 67.68  ? 713  ARG A N   1 
ATOM   5454  C  CA  . ARG A 1 713  ? 27.744  1.409   11.006  1.00 68.33  ? 713  ARG A CA  1 
ATOM   5455  C  C   . ARG A 1 713  ? 27.797  1.004   12.486  1.00 66.08  ? 713  ARG A C   1 
ATOM   5456  O  O   . ARG A 1 713  ? 28.631  1.501   13.239  1.00 64.20  ? 713  ARG A O   1 
ATOM   5457  C  CB  . ARG A 1 713  ? 28.726  0.617   10.134  1.00 70.18  ? 713  ARG A CB  1 
ATOM   5458  C  CG  . ARG A 1 713  ? 28.665  -0.889  10.350  1.00 72.71  ? 713  ARG A CG  1 
ATOM   5459  C  CD  . ARG A 1 713  ? 29.599  -1.761  9.536   1.00 75.50  ? 713  ARG A CD  1 
ATOM   5460  N  NE  . ARG A 1 713  ? 29.280  -3.157  9.814   1.00 77.65  ? 713  ARG A NE  1 
ATOM   5461  C  CZ  . ARG A 1 713  ? 29.873  -4.208  9.253   1.00 79.68  ? 713  ARG A CZ  1 
ATOM   5462  N  NH1 . ARG A 1 713  ? 30.842  -4.040  8.369   1.00 80.73  ? 713  ARG A NH1 1 
ATOM   5463  N  NH2 . ARG A 1 713  ? 29.493  -5.430  9.584   1.00 80.27  ? 713  ARG A NH2 1 
ATOM   5464  N  N   . THR A 1 714  ? 26.891  0.103   12.899  1.00 66.18  ? 714  THR A N   1 
ATOM   5465  C  CA  . THR A 1 714  ? 26.756  -0.348  14.277  1.00 63.03  ? 714  THR A CA  1 
ATOM   5466  C  C   . THR A 1 714  ? 27.109  -1.830  14.363  1.00 62.58  ? 714  THR A C   1 
ATOM   5467  O  O   . THR A 1 714  ? 26.628  -2.637  13.572  1.00 63.85  ? 714  THR A O   1 
ATOM   5468  C  CB  . THR A 1 714  ? 25.326  -0.135  14.796  1.00 64.05  ? 714  THR A CB  1 
ATOM   5469  O  OG1 . THR A 1 714  ? 24.990  1.248   14.696  1.00 64.38  ? 714  THR A OG1 1 
ATOM   5470  C  CG2 . THR A 1 714  ? 25.134  -0.555  16.235  1.00 63.34  ? 714  THR A CG2 1 
ATOM   5471  N  N   . VAL A 1 715  ? 27.958  -2.170  15.338  1.00 60.33  ? 715  VAL A N   1 
ATOM   5472  C  CA  . VAL A 1 715  ? 28.272  -3.549  15.669  1.00 59.84  ? 715  VAL A CA  1 
ATOM   5473  C  C   . VAL A 1 715  ? 27.893  -3.771  17.130  1.00 59.52  ? 715  VAL A C   1 
ATOM   5474  O  O   . VAL A 1 715  ? 28.660  -3.409  18.025  1.00 58.31  ? 715  VAL A O   1 
ATOM   5475  C  CB  . VAL A 1 715  ? 29.762  -3.868  15.439  1.00 58.17  ? 715  VAL A CB  1 
ATOM   5476  C  CG1 . VAL A 1 715  ? 30.069  -5.334  15.707  1.00 58.09  ? 715  VAL A CG1 1 
ATOM   5477  C  CG2 . VAL A 1 715  ? 30.233  -3.458  14.053  1.00 58.29  ? 715  VAL A CG2 1 
ATOM   5478  N  N   . PRO A 1 716  ? 26.702  -4.353  17.418  1.00 60.67  ? 716  PRO A N   1 
ATOM   5479  C  CA  . PRO A 1 716  ? 26.253  -4.555  18.796  1.00 60.13  ? 716  PRO A CA  1 
ATOM   5480  C  C   . PRO A 1 716  ? 27.108  -5.629  19.459  1.00 59.76  ? 716  PRO A C   1 
ATOM   5481  O  O   . PRO A 1 716  ? 27.459  -6.612  18.811  1.00 60.27  ? 716  PRO A O   1 
ATOM   5482  C  CB  . PRO A 1 716  ? 24.815  -5.064  18.649  1.00 61.20  ? 716  PRO A CB  1 
ATOM   5483  C  CG  . PRO A 1 716  ? 24.439  -4.706  17.234  1.00 62.63  ? 716  PRO A CG  1 
ATOM   5484  C  CD  . PRO A 1 716  ? 25.719  -4.835  16.440  1.00 62.51  ? 716  PRO A CD  1 
ATOM   5485  N  N   . LEU A 1 717  ? 27.436  -5.417  20.744  1.00 58.47  ? 717  LEU A N   1 
ATOM   5486  C  CA  . LEU A 1 717  ? 28.266  -6.334  21.509  1.00 57.49  ? 717  LEU A CA  1 
ATOM   5487  C  C   . LEU A 1 717  ? 27.444  -6.982  22.618  1.00 58.73  ? 717  LEU A C   1 
ATOM   5488  O  O   . LEU A 1 717  ? 27.742  -8.099  23.024  1.00 59.29  ? 717  LEU A O   1 
ATOM   5489  C  CB  . LEU A 1 717  ? 29.461  -5.578  22.105  1.00 55.18  ? 717  LEU A CB  1 
ATOM   5490  C  CG  . LEU A 1 717  ? 30.439  -4.933  21.122  1.00 53.79  ? 717  LEU A CG  1 
ATOM   5491  C  CD1 . LEU A 1 717  ? 31.377  -4.000  21.861  1.00 52.12  ? 717  LEU A CD1 1 
ATOM   5492  C  CD2 . LEU A 1 717  ? 31.250  -5.975  20.368  1.00 53.60  ? 717  LEU A CD2 1 
ATOM   5493  N  N   . TYR A 1 718  ? 26.434  -6.258  23.115  1.00 60.25  ? 718  TYR A N   1 
ATOM   5494  C  CA  . TYR A 1 718  ? 25.529  -6.723  24.161  1.00 62.58  ? 718  TYR A CA  1 
ATOM   5495  C  C   . TYR A 1 718  ? 26.238  -6.780  25.517  1.00 61.88  ? 718  TYR A C   1 
ATOM   5496  O  O   . TYR A 1 718  ? 25.775  -7.463  26.434  1.00 62.98  ? 718  TYR A O   1 
ATOM   5497  C  CB  . TYR A 1 718  ? 24.806  -8.011  23.750  1.00 64.56  ? 718  TYR A CB  1 
ATOM   5498  C  CG  . TYR A 1 718  ? 24.069  -7.921  22.437  1.00 66.77  ? 718  TYR A CG  1 
ATOM   5499  C  CD1 . TYR A 1 718  ? 23.200  -6.874  22.170  1.00 68.24  ? 718  TYR A CD1 1 
ATOM   5500  C  CD2 . TYR A 1 718  ? 24.226  -8.886  21.457  1.00 68.64  ? 718  TYR A CD2 1 
ATOM   5501  C  CE1 . TYR A 1 718  ? 22.508  -6.781  20.970  1.00 69.53  ? 718  TYR A CE1 1 
ATOM   5502  C  CE2 . TYR A 1 718  ? 23.541  -8.811  20.252  1.00 70.40  ? 718  TYR A CE2 1 
ATOM   5503  C  CZ  . TYR A 1 718  ? 22.685  -7.750  20.001  1.00 70.18  ? 718  TYR A CZ  1 
ATOM   5504  O  OH  . TYR A 1 718  ? 22.016  -7.650  18.814  1.00 70.73  ? 718  TYR A OH  1 
ATOM   5505  N  N   . GLU A 1 719  ? 27.347  -6.032  25.627  1.00 59.63  ? 719  GLU A N   1 
ATOM   5506  C  CA  . GLU A 1 719  ? 28.122  -5.844  26.845  1.00 59.02  ? 719  GLU A CA  1 
ATOM   5507  C  C   . GLU A 1 719  ? 28.921  -4.552  26.682  1.00 57.85  ? 719  GLU A C   1 
ATOM   5508  O  O   . GLU A 1 719  ? 28.947  -3.986  25.594  1.00 58.71  ? 719  GLU A O   1 
ATOM   5509  C  CB  . GLU A 1 719  ? 29.025  -7.053  27.085  1.00 59.77  ? 719  GLU A CB  1 
ATOM   5510  C  CG  . GLU A 1 719  ? 29.928  -7.372  25.904  1.00 61.66  ? 719  GLU A CG  1 
ATOM   5511  C  CD  . GLU A 1 719  ? 30.795  -8.611  26.069  1.00 63.87  ? 719  GLU A CD  1 
ATOM   5512  O  OE1 . GLU A 1 719  ? 30.239  -9.687  26.395  1.00 64.35  ? 719  GLU A OE1 1 
ATOM   5513  O  OE2 . GLU A 1 719  ? 32.030  -8.500  25.877  1.00 64.42  ? 719  GLU A OE2 1 
ATOM   5514  N  N   . SER A 1 720  ? 29.581  -4.083  27.746  1.00 56.78  ? 720  SER A N   1 
ATOM   5515  C  CA  . SER A 1 720  ? 30.215  -2.774  27.694  1.00 55.89  ? 720  SER A CA  1 
ATOM   5516  C  C   . SER A 1 720  ? 31.580  -2.865  27.023  1.00 55.93  ? 720  SER A C   1 
ATOM   5517  O  O   . SER A 1 720  ? 32.443  -3.576  27.521  1.00 58.97  ? 720  SER A O   1 
ATOM   5518  C  CB  . SER A 1 720  ? 30.356  -2.171  29.072  1.00 56.59  ? 720  SER A CB  1 
ATOM   5519  O  OG  . SER A 1 720  ? 29.174  -2.325  29.850  1.00 58.49  ? 720  SER A OG  1 
ATOM   5520  N  N   . PRO A 1 721  ? 31.840  -2.143  25.906  1.00 54.93  ? 721  PRO A N   1 
ATOM   5521  C  CA  . PRO A 1 721  ? 33.205  -1.977  25.399  1.00 53.24  ? 721  PRO A CA  1 
ATOM   5522  C  C   . PRO A 1 721  ? 33.886  -0.929  26.271  1.00 52.40  ? 721  PRO A C   1 
ATOM   5523  O  O   . PRO A 1 721  ? 33.210  -0.065  26.817  1.00 53.77  ? 721  PRO A O   1 
ATOM   5524  C  CB  . PRO A 1 721  ? 32.990  -1.433  23.983  1.00 52.64  ? 721  PRO A CB  1 
ATOM   5525  C  CG  . PRO A 1 721  ? 31.692  -0.675  24.079  1.00 53.75  ? 721  PRO A CG  1 
ATOM   5526  C  CD  . PRO A 1 721  ? 30.848  -1.449  25.075  1.00 54.94  ? 721  PRO A CD  1 
ATOM   5527  N  N   . ARG A 1 722  ? 35.216  -1.013  26.396  1.00 52.10  ? 722  ARG A N   1 
ATOM   5528  C  CA  . ARG A 1 722  ? 35.945  -0.156  27.317  1.00 50.13  ? 722  ARG A CA  1 
ATOM   5529  C  C   . ARG A 1 722  ? 37.128  0.522   26.642  1.00 49.02  ? 722  ARG A C   1 
ATOM   5530  O  O   . ARG A 1 722  ? 37.403  1.674   26.954  1.00 49.16  ? 722  ARG A O   1 
ATOM   5531  C  CB  . ARG A 1 722  ? 36.435  -0.971  28.510  1.00 50.92  ? 722  ARG A CB  1 
ATOM   5532  C  CG  . ARG A 1 722  ? 35.303  -1.540  29.347  1.00 52.73  ? 722  ARG A CG  1 
ATOM   5533  C  CD  . ARG A 1 722  ? 34.769  -0.510  30.316  1.00 53.48  ? 722  ARG A CD  1 
ATOM   5534  N  NE  . ARG A 1 722  ? 34.501  -1.185  31.571  1.00 54.30  ? 722  ARG A NE  1 
ATOM   5535  C  CZ  . ARG A 1 722  ? 33.318  -1.214  32.163  1.00 56.80  ? 722  ARG A CZ  1 
ATOM   5536  N  NH1 . ARG A 1 722  ? 32.288  -0.576  31.628  1.00 59.79  ? 722  ARG A NH1 1 
ATOM   5537  N  NH2 . ARG A 1 722  ? 33.165  -1.870  33.298  1.00 57.15  ? 722  ARG A NH2 1 
ATOM   5538  N  N   . LYS A 1 723  ? 37.838  -0.214  25.778  1.00 48.92  ? 723  LYS A N   1 
ATOM   5539  C  CA  . LYS A 1 723  ? 38.996  0.285   25.046  1.00 50.03  ? 723  LYS A CA  1 
ATOM   5540  C  C   . LYS A 1 723  ? 39.071  -0.423  23.697  1.00 52.45  ? 723  LYS A C   1 
ATOM   5541  O  O   . LYS A 1 723  ? 38.647  -1.574  23.564  1.00 54.11  ? 723  LYS A O   1 
ATOM   5542  C  CB  . LYS A 1 723  ? 40.317  -0.029  25.757  1.00 48.82  ? 723  LYS A CB  1 
ATOM   5543  C  CG  . LYS A 1 723  ? 40.509  0.602   27.126  1.00 48.03  ? 723  LYS A CG  1 
ATOM   5544  C  CD  . LYS A 1 723  ? 40.708  2.096   27.072  1.00 48.06  ? 723  LYS A CD  1 
ATOM   5545  C  CE  . LYS A 1 723  ? 40.255  2.766   28.352  1.00 48.14  ? 723  LYS A CE  1 
ATOM   5546  N  NZ  . LYS A 1 723  ? 40.888  4.089   28.553  1.00 47.79  ? 723  LYS A NZ  1 
ATOM   5547  N  N   . ILE A 1 724  ? 39.630  0.282   22.709  1.00 53.13  ? 724  ILE A N   1 
ATOM   5548  C  CA  . ILE A 1 724  ? 39.807  -0.251  21.370  1.00 54.77  ? 724  ILE A CA  1 
ATOM   5549  C  C   . ILE A 1 724  ? 41.179  0.182   20.876  1.00 56.14  ? 724  ILE A C   1 
ATOM   5550  O  O   . ILE A 1 724  ? 41.658  1.262   21.219  1.00 55.25  ? 724  ILE A O   1 
ATOM   5551  C  CB  . ILE A 1 724  ? 38.688  0.218   20.415  1.00 55.12  ? 724  ILE A CB  1 
ATOM   5552  C  CG1 . ILE A 1 724  ? 38.825  -0.406  19.022  1.00 56.77  ? 724  ILE A CG1 1 
ATOM   5553  C  CG2 . ILE A 1 724  ? 38.629  1.737   20.344  1.00 54.90  ? 724  ILE A CG2 1 
ATOM   5554  C  CD1 . ILE A 1 724  ? 37.646  -0.162  18.103  1.00 56.35  ? 724  ILE A CD1 1 
ATOM   5555  N  N   . CYS A 1 725  ? 41.800  -0.687  20.077  1.00 58.90  ? 725  CYS A N   1 
ATOM   5556  C  CA  . CYS A 1 725  ? 43.000  -0.339  19.339  1.00 60.33  ? 725  CYS A CA  1 
ATOM   5557  C  C   . CYS A 1 725  ? 43.081  -1.243  18.116  1.00 60.19  ? 725  CYS A C   1 
ATOM   5558  O  O   . CYS A 1 725  ? 42.547  -2.348  18.120  1.00 61.91  ? 725  CYS A O   1 
ATOM   5559  C  CB  . CYS A 1 725  ? 44.232  -0.562  20.199  1.00 61.97  ? 725  CYS A CB  1 
ATOM   5560  S  SG  . CYS A 1 725  ? 44.608  -2.324  20.339  1.00 69.94  ? 725  CYS A SG  1 
ATOM   5561  N  N   . TYR A 1 726  ? 43.755  -0.758  17.075  1.00 59.28  ? 726  TYR A N   1 
ATOM   5562  C  CA  . TYR A 1 726  ? 43.808  -1.461  15.806  1.00 59.26  ? 726  TYR A CA  1 
ATOM   5563  C  C   . TYR A 1 726  ? 45.142  -2.198  15.697  1.00 59.06  ? 726  TYR A C   1 
ATOM   5564  O  O   . TYR A 1 726  ? 46.147  -1.707  16.199  1.00 58.73  ? 726  TYR A O   1 
ATOM   5565  C  CB  . TYR A 1 726  ? 43.564  -0.451  14.684  1.00 59.41  ? 726  TYR A CB  1 
ATOM   5566  C  CG  . TYR A 1 726  ? 43.683  -1.008  13.292  1.00 61.46  ? 726  TYR A CG  1 
ATOM   5567  C  CD1 . TYR A 1 726  ? 42.841  -2.016  12.848  1.00 61.83  ? 726  TYR A CD1 1 
ATOM   5568  C  CD2 . TYR A 1 726  ? 44.638  -0.522  12.415  1.00 63.26  ? 726  TYR A CD2 1 
ATOM   5569  C  CE1 . TYR A 1 726  ? 42.949  -2.533  11.568  1.00 64.04  ? 726  TYR A CE1 1 
ATOM   5570  C  CE2 . TYR A 1 726  ? 44.752  -1.020  11.127  1.00 65.49  ? 726  TYR A CE2 1 
ATOM   5571  C  CZ  . TYR A 1 726  ? 43.906  -2.029  10.703  1.00 65.94  ? 726  TYR A CZ  1 
ATOM   5572  O  OH  . TYR A 1 726  ? 44.025  -2.526  9.439   1.00 68.51  ? 726  TYR A OH  1 
ATOM   5573  N  N   . GLN A 1 727  ? 45.133  -3.388  15.079  1.00 59.29  ? 727  GLN A N   1 
ATOM   5574  C  CA  . GLN A 1 727  ? 46.337  -4.173  14.837  1.00 60.28  ? 727  GLN A CA  1 
ATOM   5575  C  C   . GLN A 1 727  ? 46.415  -4.491  13.348  1.00 62.69  ? 727  GLN A C   1 
ATOM   5576  O  O   . GLN A 1 727  ? 45.931  -5.527  12.896  1.00 62.32  ? 727  GLN A O   1 
ATOM   5577  C  CB  . GLN A 1 727  ? 46.391  -5.435  15.710  1.00 59.42  ? 727  GLN A CB  1 
ATOM   5578  C  CG  . GLN A 1 727  ? 47.635  -6.299  15.506  1.00 60.55  ? 727  GLN A CG  1 
ATOM   5579  C  CD  . GLN A 1 727  ? 48.091  -7.033  16.750  1.00 60.25  ? 727  GLN A CD  1 
ATOM   5580  O  OE1 . GLN A 1 727  ? 48.247  -6.450  17.823  1.00 59.42  ? 727  GLN A OE1 1 
ATOM   5581  N  NE2 . GLN A 1 727  ? 48.336  -8.327  16.618  1.00 60.18  ? 727  GLN A NE2 1 
ATOM   5582  N  N   . GLU A 1 728  ? 47.050  -3.579  12.608  1.00 65.60  ? 728  GLU A N   1 
ATOM   5583  C  CA  . GLU A 1 728  ? 47.086  -3.622  11.159  1.00 69.22  ? 728  GLU A CA  1 
ATOM   5584  C  C   . GLU A 1 728  ? 47.575  -4.981  10.668  1.00 70.92  ? 728  GLU A C   1 
ATOM   5585  O  O   . GLU A 1 728  ? 47.007  -5.524  9.726   1.00 73.67  ? 728  GLU A O   1 
ATOM   5586  C  CB  . GLU A 1 728  ? 47.965  -2.502  10.609  1.00 72.24  ? 728  GLU A CB  1 
ATOM   5587  C  CG  . GLU A 1 728  ? 47.696  -2.210  9.146   1.00 76.73  ? 728  GLU A CG  1 
ATOM   5588  C  CD  . GLU A 1 728  ? 48.683  -1.262  8.489   1.00 80.99  ? 728  GLU A CD  1 
ATOM   5589  O  OE1 . GLU A 1 728  ? 49.017  -1.498  7.311   1.00 85.65  ? 728  GLU A OE1 1 
ATOM   5590  O  OE2 . GLU A 1 728  ? 49.118  -0.290  9.153   1.00 81.41  ? 728  GLU A OE2 1 
ATOM   5591  N  N   . VAL A 1 729  ? 48.619  -5.522  11.309  1.00 70.55  ? 729  VAL A N   1 
ATOM   5592  C  CA  . VAL A 1 729  ? 49.273  -6.735  10.833  1.00 72.41  ? 729  VAL A CA  1 
ATOM   5593  C  C   . VAL A 1 729  ? 48.332  -7.934  10.938  1.00 71.85  ? 729  VAL A C   1 
ATOM   5594  O  O   . VAL A 1 729  ? 48.446  -8.866  10.148  1.00 73.51  ? 729  VAL A O   1 
ATOM   5595  C  CB  . VAL A 1 729  ? 50.623  -7.004  11.529  1.00 72.22  ? 729  VAL A CB  1 
ATOM   5596  C  CG1 . VAL A 1 729  ? 51.687  -6.026  11.063  1.00 74.01  ? 729  VAL A CG1 1 
ATOM   5597  C  CG2 . VAL A 1 729  ? 50.516  -6.984  13.047  1.00 70.25  ? 729  VAL A CG2 1 
ATOM   5598  N  N   . SER A 1 730  ? 47.432  -7.909  11.927  1.00 70.36  ? 730  SER A N   1 
ATOM   5599  C  CA  . SER A 1 730  ? 46.461  -8.975  12.124  1.00 70.42  ? 730  SER A CA  1 
ATOM   5600  C  C   . SER A 1 730  ? 45.190  -8.669  11.342  1.00 71.05  ? 730  SER A C   1 
ATOM   5601  O  O   . SER A 1 730  ? 44.373  -9.557  11.138  1.00 71.23  ? 730  SER A O   1 
ATOM   5602  C  CB  . SER A 1 730  ? 46.145  -9.168  13.577  1.00 68.63  ? 730  SER A CB  1 
ATOM   5603  O  OG  . SER A 1 730  ? 47.331  -9.333  14.328  1.00 69.57  ? 730  SER A OG  1 
ATOM   5604  N  N   . GLN A 1 731  ? 45.045  -7.404  10.931  1.00 72.00  ? 731  GLN A N   1 
ATOM   5605  C  CA  . GLN A 1 731  ? 43.890  -6.904  10.206  1.00 72.68  ? 731  GLN A CA  1 
ATOM   5606  C  C   . GLN A 1 731  ? 42.634  -7.053  11.063  1.00 71.35  ? 731  GLN A C   1 
ATOM   5607  O  O   . GLN A 1 731  ? 41.606  -7.529  10.588  1.00 73.34  ? 731  GLN A O   1 
ATOM   5608  C  CB  . GLN A 1 731  ? 43.780  -7.579  8.840   1.00 75.09  ? 731  GLN A CB  1 
ATOM   5609  C  CG  . GLN A 1 731  ? 44.665  -6.948  7.782   1.00 78.15  ? 731  GLN A CG  1 
ATOM   5610  C  CD  . GLN A 1 731  ? 43.973  -6.937  6.443   1.00 83.66  ? 731  GLN A CD  1 
ATOM   5611  O  OE1 . GLN A 1 731  ? 43.314  -7.900  6.045   1.00 86.44  ? 731  GLN A OE1 1 
ATOM   5612  N  NE2 . GLN A 1 731  ? 44.115  -5.831  5.731   1.00 86.19  ? 731  GLN A NE2 1 
ATOM   5613  N  N   . CYS A 1 732  ? 42.732  -6.625  12.327  1.00 69.37  ? 732  CYS A N   1 
ATOM   5614  C  CA  . CYS A 1 732  ? 41.655  -6.785  13.286  1.00 67.85  ? 732  CYS A CA  1 
ATOM   5615  C  C   . CYS A 1 732  ? 41.787  -5.753  14.405  1.00 64.01  ? 732  CYS A C   1 
ATOM   5616  O  O   . CYS A 1 732  ? 42.784  -5.042  14.499  1.00 62.11  ? 732  CYS A O   1 
ATOM   5617  C  CB  . CYS A 1 732  ? 41.692  -8.187  13.881  1.00 70.77  ? 732  CYS A CB  1 
ATOM   5618  S  SG  . CYS A 1 732  ? 43.125  -8.458  14.954  1.00 78.35  ? 732  CYS A SG  1 
ATOM   5619  N  N   . PHE A 1 733  ? 40.756  -5.680  15.250  1.00 61.95  ? 733  PHE A N   1 
ATOM   5620  C  CA  . PHE A 1 733  ? 40.760  -4.780  16.389  1.00 59.26  ? 733  PHE A CA  1 
ATOM   5621  C  C   . PHE A 1 733  ? 40.863  -5.605  17.660  1.00 57.53  ? 733  PHE A C   1 
ATOM   5622  O  O   . PHE A 1 733  ? 40.340  -6.713  17.725  1.00 58.95  ? 733  PHE A O   1 
ATOM   5623  C  CB  . PHE A 1 733  ? 39.474  -3.952  16.439  1.00 58.32  ? 733  PHE A CB  1 
ATOM   5624  C  CG  . PHE A 1 733  ? 39.367  -2.936  15.338  1.00 59.11  ? 733  PHE A CG  1 
ATOM   5625  C  CD1 . PHE A 1 733  ? 39.873  -1.654  15.495  1.00 58.95  ? 733  PHE A CD1 1 
ATOM   5626  C  CD2 . PHE A 1 733  ? 38.790  -3.285  14.128  1.00 61.24  ? 733  PHE A CD2 1 
ATOM   5627  C  CE1 . PHE A 1 733  ? 39.793  -0.734  14.459  1.00 61.29  ? 733  PHE A CE1 1 
ATOM   5628  C  CE2 . PHE A 1 733  ? 38.702  -2.364  13.094  1.00 63.63  ? 733  PHE A CE2 1 
ATOM   5629  C  CZ  . PHE A 1 733  ? 39.203  -1.089  13.262  1.00 63.67  ? 733  PHE A CZ  1 
ATOM   5630  N  N   . GLY A 1 734  ? 41.551  -5.046  18.653  1.00 55.71  ? 734  GLY A N   1 
ATOM   5631  C  CA  . GLY A 1 734  ? 41.441  -5.507  20.023  1.00 55.15  ? 734  GLY A CA  1 
ATOM   5632  C  C   . GLY A 1 734  ? 40.501  -4.588  20.796  1.00 55.08  ? 734  GLY A C   1 
ATOM   5633  O  O   . GLY A 1 734  ? 40.590  -3.364  20.685  1.00 55.15  ? 734  GLY A O   1 
ATOM   5634  N  N   . VAL A 1 735  ? 39.579  -5.193  21.549  1.00 54.95  ? 735  VAL A N   1 
ATOM   5635  C  CA  . VAL A 1 735  ? 38.594  -4.437  22.302  1.00 54.18  ? 735  VAL A CA  1 
ATOM   5636  C  C   . VAL A 1 735  ? 38.453  -5.079  23.680  1.00 55.18  ? 735  VAL A C   1 
ATOM   5637  O  O   . VAL A 1 735  ? 38.151  -6.271  23.792  1.00 56.11  ? 735  VAL A O   1 
ATOM   5638  C  CB  . VAL A 1 735  ? 37.234  -4.375  21.577  1.00 54.00  ? 735  VAL A CB  1 
ATOM   5639  C  CG1 . VAL A 1 735  ? 36.170  -3.721  22.445  1.00 53.26  ? 735  VAL A CG1 1 
ATOM   5640  C  CG2 . VAL A 1 735  ? 37.314  -3.668  20.234  1.00 53.91  ? 735  VAL A CG2 1 
ATOM   5641  N  N   . LEU A 1 736  ? 38.682  -4.274  24.723  1.00 54.01  ? 736  LEU A N   1 
ATOM   5642  C  CA  . LEU A 1 736  ? 38.356  -4.699  26.071  1.00 54.62  ? 736  LEU A CA  1 
ATOM   5643  C  C   . LEU A 1 736  ? 36.861  -4.474  26.304  1.00 56.62  ? 736  LEU A C   1 
ATOM   5644  O  O   . LEU A 1 736  ? 36.284  -3.477  25.864  1.00 57.84  ? 736  LEU A O   1 
ATOM   5645  C  CB  . LEU A 1 736  ? 39.197  -3.907  27.077  1.00 53.73  ? 736  LEU A CB  1 
ATOM   5646  C  CG  . LEU A 1 736  ? 40.713  -3.956  26.896  1.00 52.95  ? 736  LEU A CG  1 
ATOM   5647  C  CD1 . LEU A 1 736  ? 41.382  -3.061  27.921  1.00 51.89  ? 736  LEU A CD1 1 
ATOM   5648  C  CD2 . LEU A 1 736  ? 41.223  -5.376  27.044  1.00 54.61  ? 736  LEU A CD2 1 
ATOM   5649  N  N   . SER A 1 737  ? 36.235  -5.430  26.992  1.00 56.26  ? 737  SER A N   1 
ATOM   5650  C  CA  . SER A 1 737  ? 34.825  -5.362  27.308  1.00 56.51  ? 737  SER A CA  1 
ATOM   5651  C  C   . SER A 1 737  ? 34.591  -6.046  28.648  1.00 58.26  ? 737  SER A C   1 
ATOM   5652  O  O   . SER A 1 737  ? 35.390  -6.879  29.065  1.00 60.36  ? 737  SER A O   1 
ATOM   5653  C  CB  . SER A 1 737  ? 34.012  -6.019  26.227  1.00 57.87  ? 737  SER A CB  1 
ATOM   5654  O  OG  . SER A 1 737  ? 34.270  -7.414  26.185  1.00 58.44  ? 737  SER A OG  1 
ATOM   5655  N  N   . SER A 1 738  ? 33.477  -5.699  29.298  1.00 58.53  ? 738  SER A N   1 
ATOM   5656  C  CA  . SER A 1 738  ? 33.059  -6.383  30.507  1.00 59.11  ? 738  SER A CA  1 
ATOM   5657  C  C   . SER A 1 738  ? 31.556  -6.634  30.478  1.00 59.74  ? 738  SER A C   1 
ATOM   5658  O  O   . SER A 1 738  ? 30.779  -5.801  30.020  1.00 60.32  ? 738  SER A O   1 
ATOM   5659  C  CB  . SER A 1 738  ? 33.446  -5.602  31.723  1.00 59.26  ? 738  SER A CB  1 
ATOM   5660  O  OG  . SER A 1 738  ? 32.713  -4.394  31.770  1.00 59.22  ? 738  SER A OG  1 
ATOM   5661  N  N   . ARG A 1 739  ? 31.161  -7.796  30.995  1.00 59.87  ? 739  ARG A N   1 
ATOM   5662  C  CA  . ARG A 1 739  ? 29.766  -8.180  31.078  1.00 60.17  ? 739  ARG A CA  1 
ATOM   5663  C  C   . ARG A 1 739  ? 29.432  -8.395  32.548  1.00 61.61  ? 739  ARG A C   1 
ATOM   5664  O  O   . ARG A 1 739  ? 30.298  -8.793  33.321  1.00 62.14  ? 739  ARG A O   1 
ATOM   5665  C  CB  . ARG A 1 739  ? 29.519  -9.449  30.256  1.00 60.02  ? 739  ARG A CB  1 
ATOM   5666  C  CG  . ARG A 1 739  ? 30.214  -10.693 30.788  1.00 60.30  ? 739  ARG A CG  1 
ATOM   5667  C  CD  . ARG A 1 739  ? 29.871  -11.927 29.984  1.00 62.19  ? 739  ARG A CD  1 
ATOM   5668  N  NE  . ARG A 1 739  ? 30.416  -13.123 30.609  1.00 63.44  ? 739  ARG A NE  1 
ATOM   5669  C  CZ  . ARG A 1 739  ? 31.569  -13.698 30.279  1.00 62.98  ? 739  ARG A CZ  1 
ATOM   5670  N  NH1 . ARG A 1 739  ? 32.318  -13.194 29.310  1.00 61.41  ? 739  ARG A NH1 1 
ATOM   5671  N  NH2 . ARG A 1 739  ? 31.967  -14.779 30.924  1.00 63.95  ? 739  ARG A NH2 1 
ATOM   5672  N  N   . ILE A 1 740  ? 28.180  -8.118  32.921  1.00 63.39  ? 740  ILE A N   1 
ATOM   5673  C  CA  . ILE A 1 740  ? 27.706  -8.434  34.258  1.00 65.64  ? 740  ILE A CA  1 
ATOM   5674  C  C   . ILE A 1 740  ? 27.267  -9.894  34.283  1.00 68.56  ? 740  ILE A C   1 
ATOM   5675  O  O   . ILE A 1 740  ? 26.507  -10.331 33.420  1.00 69.71  ? 740  ILE A O   1 
ATOM   5676  C  CB  . ILE A 1 740  ? 26.561  -7.503  34.707  1.00 66.01  ? 740  ILE A CB  1 
ATOM   5677  C  CG1 . ILE A 1 740  ? 26.907  -6.018  34.578  1.00 64.69  ? 740  ILE A CG1 1 
ATOM   5678  C  CG2 . ILE A 1 740  ? 26.135  -7.853  36.120  1.00 67.84  ? 740  ILE A CG2 1 
ATOM   5679  C  CD1 . ILE A 1 740  ? 28.130  -5.595  35.362  1.00 64.71  ? 740  ILE A CD1 1 
ATOM   5680  N  N   . GLU A 1 741  ? 27.769  -10.633 35.278  1.00 71.65  ? 741  GLU A N   1 
ATOM   5681  C  CA  . GLU A 1 741  ? 27.302  -11.974 35.587  1.00 76.19  ? 741  GLU A CA  1 
ATOM   5682  C  C   . GLU A 1 741  ? 26.774  -11.977 37.017  1.00 78.18  ? 741  GLU A C   1 
ATOM   5683  O  O   . GLU A 1 741  ? 27.212  -11.171 37.833  1.00 76.06  ? 741  GLU A O   1 
ATOM   5684  C  CB  . GLU A 1 741  ? 28.424  -12.993 35.412  1.00 77.81  ? 741  GLU A CB  1 
ATOM   5685  C  CG  . GLU A 1 741  ? 28.791  -13.224 33.963  1.00 79.95  ? 741  GLU A CG  1 
ATOM   5686  C  CD  . GLU A 1 741  ? 29.307  -14.623 33.693  1.00 84.60  ? 741  GLU A CD  1 
ATOM   5687  O  OE1 . GLU A 1 741  ? 29.563  -15.362 34.674  1.00 88.12  ? 741  GLU A OE1 1 
ATOM   5688  O  OE2 . GLU A 1 741  ? 29.436  -14.977 32.504  1.00 86.33  ? 741  GLU A OE2 1 
ATOM   5689  N  N   . VAL A 1 742  ? 25.819  -12.871 37.306  1.00 83.18  ? 742  VAL A N   1 
ATOM   5690  C  CA  . VAL A 1 742  ? 25.155  -12.872 38.603  1.00 87.33  ? 742  VAL A CA  1 
ATOM   5691  C  C   . VAL A 1 742  ? 25.535  -14.110 39.414  1.00 90.99  ? 742  VAL A C   1 
ATOM   5692  O  O   . VAL A 1 742  ? 25.860  -15.159 38.859  1.00 91.80  ? 742  VAL A O   1 
ATOM   5693  C  CB  . VAL A 1 742  ? 23.628  -12.680 38.507  1.00 89.77  ? 742  VAL A CB  1 
ATOM   5694  C  CG1 . VAL A 1 742  ? 23.260  -11.357 37.853  1.00 87.96  ? 742  VAL A CG1 1 
ATOM   5695  C  CG2 . VAL A 1 742  ? 22.927  -13.847 37.823  1.00 92.98  ? 742  VAL A CG2 1 
ATOM   5696  N  N   . GLN A 1 743  ? 25.482  -13.952 40.744  1.00 94.76  ? 743  GLN A N   1 
ATOM   5697  C  CA  . GLN A 1 743  ? 25.889  -14.956 41.718  1.00 98.19  ? 743  GLN A CA  1 
ATOM   5698  C  C   . GLN A 1 743  ? 24.696  -15.872 42.028  1.00 100.14 ? 743  GLN A C   1 
ATOM   5699  O  O   . GLN A 1 743  ? 24.912  -17.100 42.116  1.00 99.69  ? 743  GLN A O   1 
ATOM   5700  C  CB  . GLN A 1 743  ? 26.371  -14.267 43.002  1.00 101.47 ? 743  GLN A CB  1 
ATOM   5701  C  CG  . GLN A 1 743  ? 27.323  -15.101 43.859  1.00 104.73 ? 743  GLN A CG  1 
ATOM   5702  C  CD  . GLN A 1 743  ? 27.676  -14.470 45.189  1.00 106.50 ? 743  GLN A CD  1 
ATOM   5703  O  OE1 . GLN A 1 743  ? 26.849  -14.373 46.100  1.00 108.68 ? 743  GLN A OE1 1 
ATOM   5704  N  NE2 . GLN A 1 743  ? 28.927  -14.054 45.323  1.00 104.77 ? 743  GLN A NE2 1 
ATOM   5705  N  N   . THR A 1 749  ? 29.131  -18.040 39.205  1.00 105.59 ? 749  THR A N   1 
ATOM   5706  C  CA  . THR A 1 749  ? 28.411  -16.912 38.547  1.00 102.83 ? 749  THR A CA  1 
ATOM   5707  C  C   . THR A 1 749  ? 27.764  -17.403 37.252  1.00 102.11 ? 749  THR A C   1 
ATOM   5708  O  O   . THR A 1 749  ? 28.129  -18.457 36.728  1.00 104.85 ? 749  THR A O   1 
ATOM   5709  C  CB  . THR A 1 749  ? 29.321  -15.691 38.325  1.00 99.98  ? 749  THR A CB  1 
ATOM   5710  O  OG1 . THR A 1 749  ? 30.245  -15.919 37.258  1.00 97.27  ? 749  THR A OG1 1 
ATOM   5711  C  CG2 . THR A 1 749  ? 30.070  -15.264 39.570  1.00 100.29 ? 749  THR A CG2 1 
ATOM   5712  N  N   . THR A 1 750  ? 26.802  -16.622 36.745  1.00 98.81  ? 750  THR A N   1 
ATOM   5713  C  CA  . THR A 1 750  ? 26.052  -16.980 35.552  1.00 98.37  ? 750  THR A CA  1 
ATOM   5714  C  C   . THR A 1 750  ? 25.553  -15.713 34.862  1.00 95.97  ? 750  THR A C   1 
ATOM   5715  O  O   . THR A 1 750  ? 25.001  -14.822 35.506  1.00 96.79  ? 750  THR A O   1 
ATOM   5716  C  CB  . THR A 1 750  ? 24.919  -17.967 35.872  1.00 102.99 ? 750  THR A CB  1 
ATOM   5717  O  OG1 . THR A 1 750  ? 25.523  -19.185 36.313  1.00 105.91 ? 750  THR A OG1 1 
ATOM   5718  C  CG2 . THR A 1 750  ? 24.019  -18.254 34.689  1.00 103.72 ? 750  THR A CG2 1 
ATOM   5719  N  N   . ALA A 1 751  ? 25.728  -15.675 33.536  1.00 92.92  ? 751  ALA A N   1 
ATOM   5720  C  CA  . ALA A 1 751  ? 25.515  -14.477 32.740  1.00 88.34  ? 751  ALA A CA  1 
ATOM   5721  C  C   . ALA A 1 751  ? 24.030  -14.164 32.596  1.00 88.96  ? 751  ALA A C   1 
ATOM   5722  O  O   . ALA A 1 751  ? 23.175  -15.022 32.821  1.00 92.73  ? 751  ALA A O   1 
ATOM   5723  C  CB  . ALA A 1 751  ? 26.185  -14.615 31.395  1.00 86.81  ? 751  ALA A CB  1 
ATOM   5724  N  N   . LEU A 1 752  ? 23.761  -12.917 32.194  1.00 86.14  ? 752  LEU A N   1 
ATOM   5725  C  CA  . LEU A 1 752  ? 22.418  -12.367 32.105  1.00 86.73  ? 752  LEU A CA  1 
ATOM   5726  C  C   . LEU A 1 752  ? 21.815  -12.649 30.727  1.00 85.94  ? 752  LEU A C   1 
ATOM   5727  O  O   . LEU A 1 752  ? 20.611  -12.870 30.618  1.00 89.68  ? 752  LEU A O   1 
ATOM   5728  C  CB  . LEU A 1 752  ? 22.480  -10.858 32.383  1.00 85.90  ? 752  LEU A CB  1 
ATOM   5729  C  CG  . LEU A 1 752  ? 22.960  -10.435 33.773  1.00 84.96  ? 752  LEU A CG  1 
ATOM   5730  C  CD1 . LEU A 1 752  ? 23.362  -8.966  33.761  1.00 81.61  ? 752  LEU A CD1 1 
ATOM   5731  C  CD2 . LEU A 1 752  ? 21.884  -10.687 34.824  1.00 87.15  ? 752  LEU A CD2 1 
ATOM   5732  N  N   . ARG A 1 753  ? 22.659  -12.615 29.683  1.00 81.54  ? 753  ARG A N   1 
ATOM   5733  C  CA  . ARG A 1 753  ? 22.260  -12.803 28.295  1.00 79.08  ? 753  ARG A CA  1 
ATOM   5734  C  C   . ARG A 1 753  ? 23.514  -13.124 27.489  1.00 75.17  ? 753  ARG A C   1 
ATOM   5735  O  O   . ARG A 1 753  ? 24.606  -12.783 27.925  1.00 73.41  ? 753  ARG A O   1 
ATOM   5736  C  CB  . ARG A 1 753  ? 21.573  -11.541 27.759  1.00 78.53  ? 753  ARG A CB  1 
ATOM   5737  C  CG  . ARG A 1 753  ? 22.518  -10.393 27.432  1.00 77.35  ? 753  ARG A CG  1 
ATOM   5738  C  CD  . ARG A 1 753  ? 21.839  -9.102  26.996  1.00 77.87  ? 753  ARG A CD  1 
ATOM   5739  N  NE  . ARG A 1 753  ? 21.010  -8.490  28.030  1.00 80.04  ? 753  ARG A NE  1 
ATOM   5740  C  CZ  . ARG A 1 753  ? 21.466  -7.851  29.108  1.00 79.78  ? 753  ARG A CZ  1 
ATOM   5741  N  NH1 . ARG A 1 753  ? 20.610  -7.331  29.978  1.00 80.82  ? 753  ARG A NH1 1 
ATOM   5742  N  NH2 . ARG A 1 753  ? 22.769  -7.727  29.311  1.00 77.56  ? 753  ARG A NH2 1 
ATOM   5743  N  N   . PRO A 1 754  ? 23.423  -13.769 26.303  1.00 74.42  ? 754  PRO A N   1 
ATOM   5744  C  CA  . PRO A 1 754  ? 24.597  -13.943 25.444  1.00 72.50  ? 754  PRO A CA  1 
ATOM   5745  C  C   . PRO A 1 754  ? 25.083  -12.600 24.907  1.00 69.60  ? 754  PRO A C   1 
ATOM   5746  O  O   . PRO A 1 754  ? 24.277  -11.730 24.593  1.00 71.57  ? 754  PRO A O   1 
ATOM   5747  C  CB  . PRO A 1 754  ? 24.083  -14.828 24.301  1.00 74.19  ? 754  PRO A CB  1 
ATOM   5748  C  CG  . PRO A 1 754  ? 22.590  -14.571 24.271  1.00 75.80  ? 754  PRO A CG  1 
ATOM   5749  C  CD  . PRO A 1 754  ? 22.208  -14.357 25.721  1.00 76.33  ? 754  PRO A CD  1 
ATOM   5750  N  N   . SER A 1 755  ? 26.405  -12.447 24.816  1.00 67.22  ? 755  SER A N   1 
ATOM   5751  C  CA  . SER A 1 755  ? 27.043  -11.213 24.384  1.00 65.45  ? 755  SER A CA  1 
ATOM   5752  C  C   . SER A 1 755  ? 28.370  -11.542 23.706  1.00 63.67  ? 755  SER A C   1 
ATOM   5753  O  O   . SER A 1 755  ? 28.766  -12.706 23.652  1.00 63.56  ? 755  SER A O   1 
ATOM   5754  C  CB  . SER A 1 755  ? 27.251  -10.281 25.548  1.00 65.29  ? 755  SER A CB  1 
ATOM   5755  O  OG  . SER A 1 755  ? 27.828  -10.974 26.647  1.00 66.48  ? 755  SER A OG  1 
ATOM   5756  N  N   . ALA A 1 756  ? 29.064  -10.501 23.227  1.00 61.01  ? 756  ALA A N   1 
ATOM   5757  C  CA  . ALA A 1 756  ? 30.185  -10.667 22.315  1.00 59.86  ? 756  ALA A CA  1 
ATOM   5758  C  C   . ALA A 1 756  ? 31.191  -11.674 22.871  1.00 59.90  ? 756  ALA A C   1 
ATOM   5759  O  O   . ALA A 1 756  ? 31.711  -12.514 22.139  1.00 59.62  ? 756  ALA A O   1 
ATOM   5760  C  CB  . ALA A 1 756  ? 30.826  -9.334  22.029  1.00 57.91  ? 756  ALA A CB  1 
ATOM   5761  N  N   . SER A 1 757  ? 31.435  -11.592 24.182  1.00 59.76  ? 757  SER A N   1 
ATOM   5762  C  CA  . SER A 1 757  ? 32.477  -12.371 24.822  1.00 59.72  ? 757  SER A CA  1 
ATOM   5763  C  C   . SER A 1 757  ? 32.073  -13.838 24.952  1.00 62.80  ? 757  SER A C   1 
ATOM   5764  O  O   . SER A 1 757  ? 32.933  -14.709 25.019  1.00 63.34  ? 757  SER A O   1 
ATOM   5765  C  CB  . SER A 1 757  ? 32.858  -11.770 26.146  1.00 58.23  ? 757  SER A CB  1 
ATOM   5766  O  OG  . SER A 1 757  ? 31.791  -11.852 27.077  1.00 58.74  ? 757  SER A OG  1 
ATOM   5767  N  N   . THR A 1 758  ? 30.766  -14.125 24.963  1.00 66.44  ? 758  THR A N   1 
ATOM   5768  C  CA  . THR A 1 758  ? 30.311  -15.501 25.127  1.00 69.84  ? 758  THR A CA  1 
ATOM   5769  C  C   . THR A 1 758  ? 30.009  -16.167 23.781  1.00 72.05  ? 758  THR A C   1 
ATOM   5770  O  O   . THR A 1 758  ? 29.532  -17.295 23.760  1.00 73.72  ? 758  THR A O   1 
ATOM   5771  C  CB  . THR A 1 758  ? 29.101  -15.598 26.070  1.00 71.38  ? 758  THR A CB  1 
ATOM   5772  O  OG1 . THR A 1 758  ? 27.931  -15.135 25.398  1.00 72.97  ? 758  THR A OG1 1 
ATOM   5773  C  CG2 . THR A 1 758  ? 29.263  -14.825 27.360  1.00 70.33  ? 758  THR A CG2 1 
ATOM   5774  N  N   . GLN A 1 759  ? 30.302  -15.487 22.666  1.00 73.65  ? 759  GLN A N   1 
ATOM   5775  C  CA  . GLN A 1 759  ? 29.876  -15.943 21.351  1.00 75.58  ? 759  GLN A CA  1 
ATOM   5776  C  C   . GLN A 1 759  ? 31.013  -15.861 20.331  1.00 74.78  ? 759  GLN A C   1 
ATOM   5777  O  O   . GLN A 1 759  ? 30.750  -15.822 19.129  1.00 75.35  ? 759  GLN A O   1 
ATOM   5778  C  CB  . GLN A 1 759  ? 28.707  -15.082 20.875  1.00 78.09  ? 759  GLN A CB  1 
ATOM   5779  C  CG  . GLN A 1 759  ? 27.443  -15.231 21.707  1.00 82.26  ? 759  GLN A CG  1 
ATOM   5780  C  CD  . GLN A 1 759  ? 26.338  -14.337 21.193  1.00 85.71  ? 759  GLN A CD  1 
ATOM   5781  O  OE1 . GLN A 1 759  ? 26.489  -13.114 21.086  1.00 86.32  ? 759  GLN A OE1 1 
ATOM   5782  N  NE2 . GLN A 1 759  ? 25.210  -14.954 20.869  1.00 87.25  ? 759  GLN A NE2 1 
ATOM   5783  N  N   . ALA A 1 760  ? 32.265  -15.837 20.810  1.00 72.24  ? 760  ALA A N   1 
ATOM   5784  C  CA  . ALA A 1 760  ? 33.422  -15.792 19.932  1.00 71.08  ? 760  ALA A CA  1 
ATOM   5785  C  C   . ALA A 1 760  ? 33.559  -17.132 19.207  1.00 73.12  ? 760  ALA A C   1 
ATOM   5786  O  O   . ALA A 1 760  ? 32.944  -18.111 19.616  1.00 73.50  ? 760  ALA A O   1 
ATOM   5787  C  CB  . ALA A 1 760  ? 34.642  -15.466 20.752  1.00 69.90  ? 760  ALA A CB  1 
ATOM   5788  N  N   . LEU A 1 761  ? 34.337  -17.163 18.114  1.00 74.54  ? 761  LEU A N   1 
ATOM   5789  C  CA  . LEU A 1 761  ? 34.675  -18.403 17.425  1.00 78.10  ? 761  LEU A CA  1 
ATOM   5790  C  C   . LEU A 1 761  ? 35.500  -19.303 18.347  1.00 79.22  ? 761  LEU A C   1 
ATOM   5791  O  O   . LEU A 1 761  ? 35.128  -20.444 18.617  1.00 82.66  ? 761  LEU A O   1 
ATOM   5792  C  CB  . LEU A 1 761  ? 35.492  -18.078 16.171  1.00 79.31  ? 761  LEU A CB  1 
ATOM   5793  C  CG  . LEU A 1 761  ? 34.722  -17.673 14.919  1.00 81.61  ? 761  LEU A CG  1 
ATOM   5794  C  CD1 . LEU A 1 761  ? 35.678  -17.596 13.735  1.00 83.27  ? 761  LEU A CD1 1 
ATOM   5795  C  CD2 . LEU A 1 761  ? 33.602  -18.661 14.624  1.00 84.81  ? 761  LEU A CD2 1 
ATOM   5796  N  N   . SER A 1 762  ? 36.653  -18.788 18.779  1.00 75.87  ? 762  SER A N   1 
ATOM   5797  C  CA  . SER A 1 762  ? 37.499  -19.442 19.756  1.00 74.96  ? 762  SER A CA  1 
ATOM   5798  C  C   . SER A 1 762  ? 37.418  -18.617 21.034  1.00 72.99  ? 762  SER A C   1 
ATOM   5799  O  O   . SER A 1 762  ? 36.982  -17.469 20.982  1.00 71.35  ? 762  SER A O   1 
ATOM   5800  C  CB  . SER A 1 762  ? 38.904  -19.514 19.229  1.00 75.56  ? 762  SER A CB  1 
ATOM   5801  O  OG  . SER A 1 762  ? 39.209  -18.341 18.482  1.00 75.46  ? 762  SER A OG  1 
ATOM   5802  N  N   . SER A 1 763  ? 37.814  -19.205 22.172  1.00 72.31  ? 763  SER A N   1 
ATOM   5803  C  CA  . SER A 1 763  ? 37.919  -18.454 23.415  1.00 69.55  ? 763  SER A CA  1 
ATOM   5804  C  C   . SER A 1 763  ? 39.022  -19.030 24.297  1.00 69.11  ? 763  SER A C   1 
ATOM   5805  O  O   . SER A 1 763  ? 39.401  -20.186 24.162  1.00 70.75  ? 763  SER A O   1 
ATOM   5806  C  CB  . SER A 1 763  ? 36.594  -18.337 24.148  1.00 69.72  ? 763  SER A CB  1 
ATOM   5807  O  OG  . SER A 1 763  ? 36.120  -19.600 24.591  1.00 73.21  ? 763  SER A OG  1 
ATOM   5808  N  N   . SER A 1 764  ? 39.536  -18.197 25.199  1.00 67.56  ? 764  SER A N   1 
ATOM   5809  C  CA  . SER A 1 764  ? 40.570  -18.613 26.126  1.00 67.72  ? 764  SER A CA  1 
ATOM   5810  C  C   . SER A 1 764  ? 40.268  -18.046 27.510  1.00 67.40  ? 764  SER A C   1 
ATOM   5811  O  O   . SER A 1 764  ? 39.446  -17.144 27.653  1.00 67.53  ? 764  SER A O   1 
ATOM   5812  C  CB  . SER A 1 764  ? 41.948  -18.230 25.626  1.00 67.08  ? 764  SER A CB  1 
ATOM   5813  O  OG  . SER A 1 764  ? 42.058  -16.830 25.399  1.00 65.09  ? 764  SER A OG  1 
ATOM   5814  N  N   . VAL A 1 765  ? 40.923  -18.612 28.527  1.00 68.45  ? 765  VAL A N   1 
ATOM   5815  C  CA  . VAL A 1 765  ? 40.713  -18.217 29.908  1.00 69.29  ? 765  VAL A CA  1 
ATOM   5816  C  C   . VAL A 1 765  ? 42.073  -18.078 30.591  1.00 70.59  ? 765  VAL A C   1 
ATOM   5817  O  O   . VAL A 1 765  ? 42.977  -18.879 30.367  1.00 73.28  ? 765  VAL A O   1 
ATOM   5818  C  CB  . VAL A 1 765  ? 39.792  -19.220 30.629  1.00 70.58  ? 765  VAL A CB  1 
ATOM   5819  C  CG1 . VAL A 1 765  ? 39.892  -19.113 32.142  1.00 72.02  ? 765  VAL A CG1 1 
ATOM   5820  C  CG2 . VAL A 1 765  ? 38.346  -19.071 30.180  1.00 71.38  ? 765  VAL A CG2 1 
ATOM   5821  N  N   . SER A 1 766  ? 42.214  -17.045 31.424  1.00 70.33  ? 766  SER A N   1 
ATOM   5822  C  CA  . SER A 1 766  ? 43.466  -16.808 32.115  1.00 71.24  ? 766  SER A CA  1 
ATOM   5823  C  C   . SER A 1 766  ? 43.711  -17.922 33.131  1.00 72.22  ? 766  SER A C   1 
ATOM   5824  O  O   . SER A 1 766  ? 42.785  -18.350 33.818  1.00 72.36  ? 766  SER A O   1 
ATOM   5825  C  CB  . SER A 1 766  ? 43.465  -15.445 32.753  1.00 72.60  ? 766  SER A CB  1 
ATOM   5826  O  OG  . SER A 1 766  ? 44.791  -15.030 33.059  1.00 75.58  ? 766  SER A OG  1 
ATOM   5827  N  N   . SER A 1 767  ? 44.967  -18.382 33.193  1.00 73.19  ? 767  SER A N   1 
ATOM   5828  C  CA  . SER A 1 767  ? 45.394  -19.463 34.070  1.00 74.77  ? 767  SER A CA  1 
ATOM   5829  C  C   . SER A 1 767  ? 46.534  -18.991 34.975  1.00 74.38  ? 767  SER A C   1 
ATOM   5830  O  O   . SER A 1 767  ? 47.189  -19.804 35.626  1.00 76.00  ? 767  SER A O   1 
ATOM   5831  C  CB  . SER A 1 767  ? 45.798  -20.674 33.261  1.00 75.53  ? 767  SER A CB  1 
ATOM   5832  O  OG  . SER A 1 767  ? 46.847  -20.349 32.357  1.00 74.13  ? 767  SER A OG  1 
ATOM   5833  N  N   . SER A 1 768  ? 46.766  -17.673 34.995  1.00 71.77  ? 768  SER A N   1 
ATOM   5834  C  CA  . SER A 1 768  ? 47.796  -17.077 35.826  1.00 71.83  ? 768  SER A CA  1 
ATOM   5835  C  C   . SER A 1 768  ? 47.573  -17.458 37.290  1.00 74.45  ? 768  SER A C   1 
ATOM   5836  O  O   . SER A 1 768  ? 46.441  -17.433 37.774  1.00 75.62  ? 768  SER A O   1 
ATOM   5837  C  CB  . SER A 1 768  ? 47.826  -15.586 35.641  1.00 69.74  ? 768  SER A CB  1 
ATOM   5838  O  OG  . SER A 1 768  ? 48.712  -14.980 36.572  1.00 69.92  ? 768  SER A OG  1 
ATOM   5839  N  N   . LYS A 1 769  ? 48.669  -17.816 37.975  1.00 75.93  ? 769  LYS A N   1 
ATOM   5840  C  CA  . LYS A 1 769  ? 48.625  -18.245 39.366  1.00 77.54  ? 769  LYS A CA  1 
ATOM   5841  C  C   . LYS A 1 769  ? 49.272  -17.185 40.262  1.00 76.77  ? 769  LYS A C   1 
ATOM   5842  O  O   . LYS A 1 769  ? 49.562  -17.440 41.429  1.00 77.86  ? 769  LYS A O   1 
ATOM   5843  C  CB  . LYS A 1 769  ? 49.270  -19.628 39.515  1.00 79.86  ? 769  LYS A CB  1 
ATOM   5844  C  CG  . LYS A 1 769  ? 48.751  -20.698 38.561  1.00 81.70  ? 769  LYS A CG  1 
ATOM   5845  C  CD  . LYS A 1 769  ? 47.545  -21.470 39.066  1.00 84.77  ? 769  LYS A CD  1 
ATOM   5846  C  CE  . LYS A 1 769  ? 46.848  -22.258 37.972  1.00 85.96  ? 769  LYS A CE  1 
ATOM   5847  N  NZ  . LYS A 1 769  ? 45.933  -23.294 38.513  1.00 89.31  ? 769  LYS A NZ  1 
ATOM   5848  N  N   . LEU A 1 770  ? 49.453  -15.980 39.708  1.00 74.27  ? 770  LEU A N   1 
ATOM   5849  C  CA  . LEU A 1 770  ? 50.059  -14.860 40.408  1.00 73.53  ? 770  LEU A CA  1 
ATOM   5850  C  C   . LEU A 1 770  ? 49.257  -14.493 41.653  1.00 75.45  ? 770  LEU A C   1 
ATOM   5851  O  O   . LEU A 1 770  ? 49.837  -14.086 42.654  1.00 78.50  ? 770  LEU A O   1 
ATOM   5852  C  CB  . LEU A 1 770  ? 50.133  -13.659 39.463  1.00 70.82  ? 770  LEU A CB  1 
ATOM   5853  C  CG  . LEU A 1 770  ? 51.386  -13.553 38.596  1.00 70.31  ? 770  LEU A CG  1 
ATOM   5854  C  CD1 . LEU A 1 770  ? 51.374  -12.243 37.831  1.00 68.94  ? 770  LEU A CD1 1 
ATOM   5855  C  CD2 . LEU A 1 770  ? 52.651  -13.626 39.431  1.00 71.59  ? 770  LEU A CD2 1 
ATOM   5856  N  N   . PHE A 1 771  ? 47.927  -14.617 41.580  1.00 75.68  ? 771  PHE A N   1 
ATOM   5857  C  CA  . PHE A 1 771  ? 47.073  -14.272 42.706  1.00 76.17  ? 771  PHE A CA  1 
ATOM   5858  C  C   . PHE A 1 771  ? 46.208  -15.478 43.103  1.00 78.01  ? 771  PHE A C   1 
ATOM   5859  O  O   . PHE A 1 771  ? 46.763  -16.536 43.461  1.00 80.18  ? 771  PHE A O   1 
ATOM   5860  C  CB  . PHE A 1 771  ? 46.177  -13.080 42.351  1.00 75.06  ? 771  PHE A CB  1 
ATOM   5861  C  CG  . PHE A 1 771  ? 46.816  -11.983 41.534  1.00 71.94  ? 771  PHE A CG  1 
ATOM   5862  C  CD1 . PHE A 1 771  ? 47.661  -11.056 42.124  1.00 71.45  ? 771  PHE A CD1 1 
ATOM   5863  C  CD2 . PHE A 1 771  ? 46.551  -11.856 40.179  1.00 69.79  ? 771  PHE A CD2 1 
ATOM   5864  C  CE1 . PHE A 1 771  ? 48.234  -10.039 41.375  1.00 69.44  ? 771  PHE A CE1 1 
ATOM   5865  C  CE2 . PHE A 1 771  ? 47.132  -10.843 39.430  1.00 67.98  ? 771  PHE A CE2 1 
ATOM   5866  C  CZ  . PHE A 1 771  ? 47.973  -9.935  40.028  1.00 67.33  ? 771  PHE A CZ  1 
ATOM   5867  N  N   . GLU A 1 784  ? 24.520  -10.513 44.895  1.00 95.31  ? 784  GLU A N   1 
ATOM   5868  C  CA  . GLU A 1 784  ? 25.498  -9.509  44.389  1.00 92.11  ? 784  GLU A CA  1 
ATOM   5869  C  C   . GLU A 1 784  ? 25.867  -9.870  42.949  1.00 88.64  ? 784  GLU A C   1 
ATOM   5870  O  O   . GLU A 1 784  ? 25.760  -11.025 42.543  1.00 88.73  ? 784  GLU A O   1 
ATOM   5871  C  CB  . GLU A 1 784  ? 26.699  -9.402  45.340  1.00 93.67  ? 784  GLU A CB  1 
ATOM   5872  C  CG  . GLU A 1 784  ? 27.359  -8.022  45.359  1.00 93.74  ? 784  GLU A CG  1 
ATOM   5873  C  CD  . GLU A 1 784  ? 28.688  -7.868  46.098  1.00 94.83  ? 784  GLU A CD  1 
ATOM   5874  O  OE1 . GLU A 1 784  ? 28.899  -8.577  47.114  1.00 98.81  ? 784  GLU A OE1 1 
ATOM   5875  O  OE2 . GLU A 1 784  ? 29.517  -7.028  45.661  1.00 90.51  ? 784  GLU A OE2 1 
ATOM   5876  N  N   . GLU A 1 785  ? 26.281  -8.864  42.173  1.00 85.50  ? 785  GLU A N   1 
ATOM   5877  C  CA  . GLU A 1 785  ? 26.572  -9.046  40.760  1.00 84.04  ? 785  GLU A CA  1 
ATOM   5878  C  C   . GLU A 1 785  ? 28.044  -8.720  40.504  1.00 80.94  ? 785  GLU A C   1 
ATOM   5879  O  O   . GLU A 1 785  ? 28.615  -7.897  41.209  1.00 81.61  ? 785  GLU A O   1 
ATOM   5880  C  CB  . GLU A 1 785  ? 25.651  -8.139  39.950  1.00 84.26  ? 785  GLU A CB  1 
ATOM   5881  C  CG  . GLU A 1 785  ? 25.828  -6.675  40.289  1.00 86.08  ? 785  GLU A CG  1 
ATOM   5882  C  CD  . GLU A 1 785  ? 25.383  -5.743  39.178  1.00 87.46  ? 785  GLU A CD  1 
ATOM   5883  O  OE1 . GLU A 1 785  ? 24.161  -5.776  38.846  1.00 88.51  ? 785  GLU A OE1 1 
ATOM   5884  O  OE2 . GLU A 1 785  ? 26.261  -5.003  38.631  1.00 84.69  ? 785  GLU A OE2 1 
ATOM   5885  N  N   . VAL A 1 786  ? 28.661  -9.363  39.504  1.00 78.27  ? 786  VAL A N   1 
ATOM   5886  C  CA  . VAL A 1 786  ? 30.093  -9.197  39.283  1.00 75.59  ? 786  VAL A CA  1 
ATOM   5887  C  C   . VAL A 1 786  ? 30.365  -8.837  37.825  1.00 73.37  ? 786  VAL A C   1 
ATOM   5888  O  O   . VAL A 1 786  ? 29.552  -9.123  36.952  1.00 76.55  ? 786  VAL A O   1 
ATOM   5889  C  CB  . VAL A 1 786  ? 30.934  -10.411 39.735  1.00 76.38  ? 786  VAL A CB  1 
ATOM   5890  C  CG1 . VAL A 1 786  ? 30.849  -10.653 41.235  1.00 79.65  ? 786  VAL A CG1 1 
ATOM   5891  C  CG2 . VAL A 1 786  ? 30.632  -11.678 38.950  1.00 77.22  ? 786  VAL A CG2 1 
ATOM   5892  N  N   . GLU A 1 787  ? 31.510  -8.189  37.581  1.00 69.44  ? 787  GLU A N   1 
ATOM   5893  C  CA  . GLU A 1 787  ? 31.956  -7.891  36.231  1.00 65.83  ? 787  GLU A CA  1 
ATOM   5894  C  C   . GLU A 1 787  ? 32.963  -8.949  35.797  1.00 64.21  ? 787  GLU A C   1 
ATOM   5895  O  O   . GLU A 1 787  ? 33.808  -9.367  36.587  1.00 65.12  ? 787  GLU A O   1 
ATOM   5896  C  CB  . GLU A 1 787  ? 32.656  -6.539  36.163  1.00 65.42  ? 787  GLU A CB  1 
ATOM   5897  C  CG  . GLU A 1 787  ? 31.729  -5.347  36.171  1.00 68.46  ? 787  GLU A CG  1 
ATOM   5898  C  CD  . GLU A 1 787  ? 32.503  -4.084  35.844  1.00 69.04  ? 787  GLU A CD  1 
ATOM   5899  O  OE1 . GLU A 1 787  ? 33.176  -4.074  34.790  1.00 67.56  ? 787  GLU A OE1 1 
ATOM   5900  O  OE2 . GLU A 1 787  ? 32.473  -3.136  36.664  1.00 71.51  ? 787  GLU A OE2 1 
ATOM   5901  N  N   . VAL A 1 788  ? 32.859  -9.370  34.531  1.00 61.47  ? 788  VAL A N   1 
ATOM   5902  C  CA  . VAL A 1 788  ? 33.795  -10.303 33.922  1.00 59.15  ? 788  VAL A CA  1 
ATOM   5903  C  C   . VAL A 1 788  ? 34.397  -9.633  32.689  1.00 56.66  ? 788  VAL A C   1 
ATOM   5904  O  O   . VAL A 1 788  ? 33.680  -9.287  31.752  1.00 57.21  ? 788  VAL A O   1 
ATOM   5905  C  CB  . VAL A 1 788  ? 33.121  -11.644 33.567  1.00 60.62  ? 788  VAL A CB  1 
ATOM   5906  C  CG1 . VAL A 1 788  ? 34.008  -12.530 32.704  1.00 59.80  ? 788  VAL A CG1 1 
ATOM   5907  C  CG2 . VAL A 1 788  ? 32.663  -12.400 34.803  1.00 63.00  ? 788  VAL A CG2 1 
ATOM   5908  N  N   . HIS A 1 789  ? 35.723  -9.469  32.690  1.00 54.31  ? 789  HIS A N   1 
ATOM   5909  C  CA  . HIS A 1 789  ? 36.400  -8.707  31.651  1.00 52.45  ? 789  HIS A CA  1 
ATOM   5910  C  C   . HIS A 1 789  ? 36.961  -9.626  30.574  1.00 52.39  ? 789  HIS A C   1 
ATOM   5911  O  O   . HIS A 1 789  ? 37.229  -10.794 30.828  1.00 53.73  ? 789  HIS A O   1 
ATOM   5912  C  CB  . HIS A 1 789  ? 37.487  -7.822  32.262  1.00 51.47  ? 789  HIS A CB  1 
ATOM   5913  C  CG  . HIS A 1 789  ? 36.925  -6.683  33.039  1.00 51.03  ? 789  HIS A CG  1 
ATOM   5914  N  ND1 . HIS A 1 789  ? 37.188  -5.376  32.709  1.00 49.94  ? 789  HIS A ND1 1 
ATOM   5915  C  CD2 . HIS A 1 789  ? 36.105  -6.653  34.113  1.00 51.69  ? 789  HIS A CD2 1 
ATOM   5916  C  CE1 . HIS A 1 789  ? 36.555  -4.580  33.550  1.00 50.43  ? 789  HIS A CE1 1 
ATOM   5917  N  NE2 . HIS A 1 789  ? 35.888  -5.342  34.423  1.00 51.44  ? 789  HIS A NE2 1 
ATOM   5918  N  N   . ASN A 1 790  ? 37.122  -9.086  29.364  1.00 51.61  ? 790  ASN A N   1 
ATOM   5919  C  CA  . ASN A 1 790  ? 37.618  -9.882  28.257  1.00 53.83  ? 790  ASN A CA  1 
ATOM   5920  C  C   . ASN A 1 790  ? 38.411  -9.003  27.301  1.00 53.52  ? 790  ASN A C   1 
ATOM   5921  O  O   . ASN A 1 790  ? 38.171  -7.802  27.218  1.00 53.69  ? 790  ASN A O   1 
ATOM   5922  C  CB  . ASN A 1 790  ? 36.489  -10.516 27.447  1.00 56.78  ? 790  ASN A CB  1 
ATOM   5923  C  CG  . ASN A 1 790  ? 35.425  -11.182 28.291  1.00 59.96  ? 790  ASN A CG  1 
ATOM   5924  O  OD1 . ASN A 1 790  ? 35.511  -12.383 28.547  1.00 61.33  ? 790  ASN A OD1 1 
ATOM   5925  N  ND2 . ASN A 1 790  ? 34.421  -10.416 28.707  1.00 60.72  ? 790  ASN A ND2 1 
ATOM   5926  N  N   . LEU A 1 791  ? 39.363  -9.614  26.586  1.00 53.71  ? 791  LEU A N   1 
ATOM   5927  C  CA  . LEU A 1 791  ? 39.932  -8.989  25.406  1.00 53.40  ? 791  LEU A CA  1 
ATOM   5928  C  C   . LEU A 1 791  ? 39.303  -9.659  24.188  1.00 55.18  ? 791  LEU A C   1 
ATOM   5929  O  O   . LEU A 1 791  ? 39.407  -10.873 24.025  1.00 56.29  ? 791  LEU A O   1 
ATOM   5930  C  CB  . LEU A 1 791  ? 41.460  -9.132  25.432  1.00 53.16  ? 791  LEU A CB  1 
ATOM   5931  C  CG  . LEU A 1 791  ? 42.220  -8.727  24.166  1.00 52.38  ? 791  LEU A CG  1 
ATOM   5932  C  CD1 . LEU A 1 791  ? 41.975  -7.270  23.811  1.00 51.17  ? 791  LEU A CD1 1 
ATOM   5933  C  CD2 . LEU A 1 791  ? 43.707  -8.981  24.325  1.00 51.01  ? 791  LEU A CD2 1 
ATOM   5934  N  N   . LEU A 1 792  ? 38.607  -8.853  23.377  1.00 55.26  ? 792  LEU A N   1 
ATOM   5935  C  CA  . LEU A 1 792  ? 37.952  -9.318  22.166  1.00 56.46  ? 792  LEU A CA  1 
ATOM   5936  C  C   . LEU A 1 792  ? 38.859  -9.040  20.969  1.00 57.69  ? 792  LEU A C   1 
ATOM   5937  O  O   . LEU A 1 792  ? 39.388  -7.937  20.843  1.00 59.64  ? 792  LEU A O   1 
ATOM   5938  C  CB  . LEU A 1 792  ? 36.629  -8.562  22.014  1.00 56.05  ? 792  LEU A CB  1 
ATOM   5939  C  CG  . LEU A 1 792  ? 35.637  -8.687  23.174  1.00 56.02  ? 792  LEU A CG  1 
ATOM   5940  C  CD1 . LEU A 1 792  ? 34.403  -7.825  22.943  1.00 55.56  ? 792  LEU A CD1 1 
ATOM   5941  C  CD2 . LEU A 1 792  ? 35.214  -10.129 23.379  1.00 56.60  ? 792  LEU A CD2 1 
ATOM   5942  N  N   . ILE A 1 793  ? 39.039  -10.044 20.102  1.00 57.58  ? 793  ILE A N   1 
ATOM   5943  C  CA  . ILE A 1 793  ? 39.687  -9.839  18.816  1.00 57.06  ? 793  ILE A CA  1 
ATOM   5944  C  C   . ILE A 1 793  ? 38.596  -9.836  17.746  1.00 59.27  ? 793  ILE A C   1 
ATOM   5945  O  O   . ILE A 1 793  ? 37.827  -10.790 17.635  1.00 60.39  ? 793  ILE A O   1 
ATOM   5946  C  CB  . ILE A 1 793  ? 40.764  -10.914 18.562  1.00 56.56  ? 793  ILE A CB  1 
ATOM   5947  C  CG1 . ILE A 1 793  ? 41.683  -11.115 19.768  1.00 55.07  ? 793  ILE A CG1 1 
ATOM   5948  C  CG2 . ILE A 1 793  ? 41.553  -10.627 17.295  1.00 57.08  ? 793  ILE A CG2 1 
ATOM   5949  C  CD1 . ILE A 1 793  ? 42.308  -9.853  20.316  1.00 53.40  ? 793  ILE A CD1 1 
ATOM   5950  N  N   . ILE A 1 794  ? 38.541  -8.755  16.959  1.00 59.98  ? 794  ILE A N   1 
ATOM   5951  C  CA  . ILE A 1 794  ? 37.411  -8.482  16.083  1.00 61.54  ? 794  ILE A CA  1 
ATOM   5952  C  C   . ILE A 1 794  ? 37.919  -8.173  14.674  1.00 62.53  ? 794  ILE A C   1 
ATOM   5953  O  O   . ILE A 1 794  ? 38.739  -7.276  14.494  1.00 61.74  ? 794  ILE A O   1 
ATOM   5954  C  CB  . ILE A 1 794  ? 36.573  -7.335  16.685  1.00 60.84  ? 794  ILE A CB  1 
ATOM   5955  C  CG1 . ILE A 1 794  ? 35.791  -7.813  17.912  1.00 61.10  ? 794  ILE A CG1 1 
ATOM   5956  C  CG2 . ILE A 1 794  ? 35.659  -6.702  15.647  1.00 61.88  ? 794  ILE A CG2 1 
ATOM   5957  C  CD1 . ILE A 1 794  ? 35.354  -6.707  18.839  1.00 60.49  ? 794  ILE A CD1 1 
ATOM   5958  N  N   . ASP A 1 795  ? 37.411  -8.922  13.684  1.00 64.78  ? 795  ASP A N   1 
ATOM   5959  C  CA  . ASP A 1 795  ? 37.836  -8.831  12.292  1.00 67.76  ? 795  ASP A CA  1 
ATOM   5960  C  C   . ASP A 1 795  ? 37.513  -7.452  11.723  1.00 68.13  ? 795  ASP A C   1 
ATOM   5961  O  O   . ASP A 1 795  ? 36.415  -6.938  11.909  1.00 68.20  ? 795  ASP A O   1 
ATOM   5962  C  CB  . ASP A 1 795  ? 37.192  -9.926  11.438  1.00 71.23  ? 795  ASP A CB  1 
ATOM   5963  C  CG  . ASP A 1 795  ? 37.690  -9.953  10.002  1.00 74.56  ? 795  ASP A CG  1 
ATOM   5964  O  OD1 . ASP A 1 795  ? 37.188  -9.160  9.181   1.00 75.85  ? 795  ASP A OD1 1 
ATOM   5965  O  OD2 . ASP A 1 795  ? 38.583  -10.767 9.718   1.00 76.96  ? 795  ASP A OD2 1 
ATOM   5966  N  N   . GLN A 1 796  ? 38.463  -6.875  10.983  1.00 69.10  ? 796  GLN A N   1 
ATOM   5967  C  CA  . GLN A 1 796  ? 38.352  -5.475  10.613  1.00 70.16  ? 796  GLN A CA  1 
ATOM   5968  C  C   . GLN A 1 796  ? 37.393  -5.284  9.439   1.00 71.92  ? 796  GLN A C   1 
ATOM   5969  O  O   . GLN A 1 796  ? 36.991  -4.161  9.159   1.00 71.86  ? 796  GLN A O   1 
ATOM   5970  C  CB  . GLN A 1 796  ? 39.724  -4.892  10.287  1.00 71.98  ? 796  GLN A CB  1 
ATOM   5971  C  CG  . GLN A 1 796  ? 40.226  -5.266  8.901   1.00 75.75  ? 796  GLN A CG  1 
ATOM   5972  C  CD  . GLN A 1 796  ? 41.245  -4.260  8.436   1.00 76.96  ? 796  GLN A CD  1 
ATOM   5973  O  OE1 . GLN A 1 796  ? 40.977  -3.450  7.552   1.00 78.79  ? 796  GLN A OE1 1 
ATOM   5974  N  NE2 . GLN A 1 796  ? 42.408  -4.279  9.067   1.00 76.14  ? 796  GLN A NE2 1 
ATOM   5975  N  N   . HIS A 1 797  ? 37.051  -6.374  8.741   1.00 74.61  ? 797  HIS A N   1 
ATOM   5976  C  CA  . HIS A 1 797  ? 36.187  -6.296  7.571   1.00 76.76  ? 797  HIS A CA  1 
ATOM   5977  C  C   . HIS A 1 797  ? 34.755  -6.680  7.930   1.00 75.62  ? 797  HIS A C   1 
ATOM   5978  O  O   . HIS A 1 797  ? 33.828  -5.967  7.565   1.00 76.25  ? 797  HIS A O   1 
ATOM   5979  C  CB  . HIS A 1 797  ? 36.713  -7.151  6.407   1.00 80.94  ? 797  HIS A CB  1 
ATOM   5980  C  CG  . HIS A 1 797  ? 38.102  -6.814  5.968   1.00 83.37  ? 797  HIS A CG  1 
ATOM   5981  N  ND1 . HIS A 1 797  ? 38.422  -5.618  5.346   1.00 84.74  ? 797  HIS A ND1 1 
ATOM   5982  C  CD2 . HIS A 1 797  ? 39.257  -7.511  6.048   1.00 84.33  ? 797  HIS A CD2 1 
ATOM   5983  C  CE1 . HIS A 1 797  ? 39.711  -5.590  5.068   1.00 85.22  ? 797  HIS A CE1 1 
ATOM   5984  N  NE2 . HIS A 1 797  ? 40.247  -6.740  5.493   1.00 85.73  ? 797  HIS A NE2 1 
ATOM   5985  N  N   . THR A 1 798  ? 34.593  -7.805  8.640   1.00 74.22  ? 798  THR A N   1 
ATOM   5986  C  CA  . THR A 1 798  ? 33.287  -8.374  8.943   1.00 73.85  ? 798  THR A CA  1 
ATOM   5987  C  C   . THR A 1 798  ? 32.788  -7.946  10.324  1.00 72.09  ? 798  THR A C   1 
ATOM   5988  O  O   . THR A 1 798  ? 31.582  -7.955  10.561  1.00 72.12  ? 798  THR A O   1 
ATOM   5989  C  CB  . THR A 1 798  ? 33.302  -9.906  8.854   1.00 74.31  ? 798  THR A CB  1 
ATOM   5990  O  OG1 . THR A 1 798  ? 33.989  -10.461 9.979   1.00 71.83  ? 798  THR A OG1 1 
ATOM   5991  C  CG2 . THR A 1 798  ? 33.908  -10.415 7.565   1.00 76.33  ? 798  THR A CG2 1 
ATOM   5992  N  N   . PHE A 1 799  ? 33.724  -7.596  11.220  1.00 70.10  ? 799  PHE A N   1 
ATOM   5993  C  CA  . PHE A 1 799  ? 33.473  -7.270  12.620  1.00 67.50  ? 799  PHE A CA  1 
ATOM   5994  C  C   . PHE A 1 799  ? 32.902  -8.474  13.364  1.00 67.41  ? 799  PHE A C   1 
ATOM   5995  O  O   . PHE A 1 799  ? 32.113  -8.320  14.291  1.00 66.67  ? 799  PHE A O   1 
ATOM   5996  C  CB  . PHE A 1 799  ? 32.684  -5.967  12.785  1.00 66.79  ? 799  PHE A CB  1 
ATOM   5997  C  CG  . PHE A 1 799  ? 33.410  -4.734  12.311  1.00 67.10  ? 799  PHE A CG  1 
ATOM   5998  C  CD1 . PHE A 1 799  ? 34.302  -4.065  13.136  1.00 65.06  ? 799  PHE A CD1 1 
ATOM   5999  C  CD2 . PHE A 1 799  ? 33.198  -4.245  11.031  1.00 69.71  ? 799  PHE A CD2 1 
ATOM   6000  C  CE1 . PHE A 1 799  ? 34.969  -2.934  12.687  1.00 65.22  ? 799  PHE A CE1 1 
ATOM   6001  C  CE2 . PHE A 1 799  ? 33.861  -3.111  10.585  1.00 70.06  ? 799  PHE A CE2 1 
ATOM   6002  C  CZ  . PHE A 1 799  ? 34.749  -2.460  11.412  1.00 67.36  ? 799  PHE A CZ  1 
ATOM   6003  N  N   . GLU A 1 800  ? 33.331  -9.672  12.952  1.00 68.82  ? 800  GLU A N   1 
ATOM   6004  C  CA  . GLU A 1 800  ? 33.032  -10.891 13.682  1.00 70.16  ? 800  GLU A CA  1 
ATOM   6005  C  C   . GLU A 1 800  ? 33.967  -10.997 14.890  1.00 67.48  ? 800  GLU A C   1 
ATOM   6006  O  O   . GLU A 1 800  ? 35.157  -10.707 14.784  1.00 67.37  ? 800  GLU A O   1 
ATOM   6007  C  CB  . GLU A 1 800  ? 33.183  -12.096 12.750  1.00 74.62  ? 800  GLU A CB  1 
ATOM   6008  C  CG  . GLU A 1 800  ? 32.623  -13.386 13.333  1.00 79.00  ? 800  GLU A CG  1 
ATOM   6009  C  CD  . GLU A 1 800  ? 33.025  -14.695 12.661  1.00 83.29  ? 800  GLU A CD  1 
ATOM   6010  O  OE1 . GLU A 1 800  ? 32.249  -15.669 12.762  1.00 85.81  ? 800  GLU A OE1 1 
ATOM   6011  O  OE2 . GLU A 1 800  ? 34.123  -14.756 12.059  1.00 84.98  ? 800  GLU A OE2 1 
ATOM   6012  N  N   . VAL A 1 801  ? 33.431  -11.410 16.044  1.00 65.05  ? 801  VAL A N   1 
ATOM   6013  C  CA  . VAL A 1 801  ? 34.282  -11.711 17.183  1.00 62.05  ? 801  VAL A CA  1 
ATOM   6014  C  C   . VAL A 1 801  ? 34.984  -13.043 16.929  1.00 63.44  ? 801  VAL A C   1 
ATOM   6015  O  O   . VAL A 1 801  ? 34.383  -14.105 17.065  1.00 65.40  ? 801  VAL A O   1 
ATOM   6016  C  CB  . VAL A 1 801  ? 33.505  -11.730 18.510  1.00 60.48  ? 801  VAL A CB  1 
ATOM   6017  C  CG1 . VAL A 1 801  ? 34.412  -12.114 19.667  1.00 59.11  ? 801  VAL A CG1 1 
ATOM   6018  C  CG2 . VAL A 1 801  ? 32.848  -10.392 18.788  1.00 59.07  ? 801  VAL A CG2 1 
ATOM   6019  N  N   . LEU A 1 802  ? 36.271  -12.961 16.567  1.00 63.41  ? 802  LEU A N   1 
ATOM   6020  C  CA  . LEU A 1 802  ? 37.093  -14.104 16.192  1.00 63.72  ? 802  LEU A CA  1 
ATOM   6021  C  C   . LEU A 1 802  ? 37.608  -14.827 17.435  1.00 62.79  ? 802  LEU A C   1 
ATOM   6022  O  O   . LEU A 1 802  ? 37.815  -16.038 17.397  1.00 64.04  ? 802  LEU A O   1 
ATOM   6023  C  CB  . LEU A 1 802  ? 38.283  -13.617 15.354  1.00 63.43  ? 802  LEU A CB  1 
ATOM   6024  C  CG  . LEU A 1 802  ? 37.976  -12.997 13.991  1.00 63.96  ? 802  LEU A CG  1 
ATOM   6025  C  CD1 . LEU A 1 802  ? 39.256  -12.521 13.327  1.00 63.56  ? 802  LEU A CD1 1 
ATOM   6026  C  CD2 . LEU A 1 802  ? 37.267  -13.990 13.090  1.00 66.60  ? 802  LEU A CD2 1 
ATOM   6027  N  N   . HIS A 1 803  ? 37.855  -14.076 18.517  1.00 60.26  ? 803  HIS A N   1 
ATOM   6028  C  CA  . HIS A 1 803  ? 38.382  -14.667 19.736  1.00 59.82  ? 803  HIS A CA  1 
ATOM   6029  C  C   . HIS A 1 803  ? 38.077  -13.787 20.948  1.00 58.31  ? 803  HIS A C   1 
ATOM   6030  O  O   . HIS A 1 803  ? 38.098  -12.563 20.849  1.00 58.07  ? 803  HIS A O   1 
ATOM   6031  C  CB  . HIS A 1 803  ? 39.886  -14.922 19.578  1.00 59.84  ? 803  HIS A CB  1 
ATOM   6032  C  CG  . HIS A 1 803  ? 40.489  -15.663 20.719  1.00 60.00  ? 803  HIS A CG  1 
ATOM   6033  N  ND1 . HIS A 1 803  ? 40.609  -17.038 20.719  1.00 61.96  ? 803  HIS A ND1 1 
ATOM   6034  C  CD2 . HIS A 1 803  ? 41.004  -15.235 21.891  1.00 58.84  ? 803  HIS A CD2 1 
ATOM   6035  C  CE1 . HIS A 1 803  ? 41.168  -17.429 21.847  1.00 62.08  ? 803  HIS A CE1 1 
ATOM   6036  N  NE2 . HIS A 1 803  ? 41.425  -16.338 22.583  1.00 60.18  ? 803  HIS A NE2 1 
ATOM   6037  N  N   . ALA A 1 804  ? 37.837  -14.427 22.100  1.00 57.93  ? 804  ALA A N   1 
ATOM   6038  C  CA  . ALA A 1 804  ? 37.626  -13.740 23.365  1.00 56.80  ? 804  ALA A CA  1 
ATOM   6039  C  C   . ALA A 1 804  ? 38.473  -14.366 24.474  1.00 57.68  ? 804  ALA A C   1 
ATOM   6040  O  O   . ALA A 1 804  ? 38.310  -15.539 24.797  1.00 58.76  ? 804  ALA A O   1 
ATOM   6041  C  CB  . ALA A 1 804  ? 36.167  -13.800 23.728  1.00 56.49  ? 804  ALA A CB  1 
ATOM   6042  N  N   . HIS A 1 805  ? 39.356  -13.565 25.087  1.00 57.64  ? 805  HIS A N   1 
ATOM   6043  C  CA  . HIS A 1 805  ? 40.173  -14.028 26.201  1.00 58.16  ? 805  HIS A CA  1 
ATOM   6044  C  C   . HIS A 1 805  ? 39.630  -13.463 27.508  1.00 58.15  ? 805  HIS A C   1 
ATOM   6045  O  O   . HIS A 1 805  ? 39.614  -12.250 27.698  1.00 58.20  ? 805  HIS A O   1 
ATOM   6046  C  CB  . HIS A 1 805  ? 41.655  -13.664 26.013  1.00 56.47  ? 805  HIS A CB  1 
ATOM   6047  C  CG  . HIS A 1 805  ? 42.500  -14.019 27.190  1.00 55.86  ? 805  HIS A CG  1 
ATOM   6048  N  ND1 . HIS A 1 805  ? 43.061  -15.266 27.332  1.00 56.89  ? 805  HIS A ND1 1 
ATOM   6049  C  CD2 . HIS A 1 805  ? 42.864  -13.309 28.282  1.00 55.17  ? 805  HIS A CD2 1 
ATOM   6050  C  CE1 . HIS A 1 805  ? 43.741  -15.315 28.461  1.00 57.16  ? 805  HIS A CE1 1 
ATOM   6051  N  NE2 . HIS A 1 805  ? 43.637  -14.124 29.065  1.00 55.88  ? 805  HIS A NE2 1 
ATOM   6052  N  N   . GLN A 1 806  ? 39.211  -14.360 28.404  1.00 59.10  ? 806  GLN A N   1 
ATOM   6053  C  CA  . GLN A 1 806  ? 38.607  -13.953 29.659  1.00 60.01  ? 806  GLN A CA  1 
ATOM   6054  C  C   . GLN A 1 806  ? 39.691  -13.778 30.715  1.00 59.88  ? 806  GLN A C   1 
ATOM   6055  O  O   . GLN A 1 806  ? 40.546  -14.640 30.881  1.00 62.65  ? 806  GLN A O   1 
ATOM   6056  C  CB  . GLN A 1 806  ? 37.624  -15.017 30.135  1.00 62.65  ? 806  GLN A CB  1 
ATOM   6057  C  CG  . GLN A 1 806  ? 36.842  -14.597 31.368  1.00 63.51  ? 806  GLN A CG  1 
ATOM   6058  C  CD  . GLN A 1 806  ? 35.774  -15.608 31.688  1.00 65.92  ? 806  GLN A CD  1 
ATOM   6059  O  OE1 . GLN A 1 806  ? 35.882  -16.346 32.663  1.00 66.91  ? 806  GLN A OE1 1 
ATOM   6060  N  NE2 . GLN A 1 806  ? 34.757  -15.666 30.840  1.00 66.89  ? 806  GLN A NE2 1 
ATOM   6061  N  N   . PHE A 1 807  ? 39.619  -12.684 31.474  1.00 58.12  ? 807  PHE A N   1 
ATOM   6062  C  CA  . PHE A 1 807  ? 40.611  -12.437 32.507  1.00 57.16  ? 807  PHE A CA  1 
ATOM   6063  C  C   . PHE A 1 807  ? 40.285  -13.228 33.772  1.00 58.97  ? 807  PHE A C   1 
ATOM   6064  O  O   . PHE A 1 807  ? 39.328  -13.998 33.801  1.00 60.15  ? 807  PHE A O   1 
ATOM   6065  C  CB  . PHE A 1 807  ? 40.821  -10.934 32.692  1.00 54.38  ? 807  PHE A CB  1 
ATOM   6066  C  CG  . PHE A 1 807  ? 41.556  -10.316 31.533  1.00 52.64  ? 807  PHE A CG  1 
ATOM   6067  C  CD1 . PHE A 1 807  ? 42.916  -10.529 31.367  1.00 52.84  ? 807  PHE A CD1 1 
ATOM   6068  C  CD2 . PHE A 1 807  ? 40.889  -9.555  30.589  1.00 51.82  ? 807  PHE A CD2 1 
ATOM   6069  C  CE1 . PHE A 1 807  ? 43.598  -9.988  30.288  1.00 51.88  ? 807  PHE A CE1 1 
ATOM   6070  C  CE2 . PHE A 1 807  ? 41.569  -9.006  29.512  1.00 51.00  ? 807  PHE A CE2 1 
ATOM   6071  C  CZ  . PHE A 1 807  ? 42.921  -9.227  29.363  1.00 51.77  ? 807  PHE A CZ  1 
ATOM   6072  N  N   . LEU A 1 808  ? 41.117  -13.041 34.803  1.00 59.81  ? 808  LEU A N   1 
ATOM   6073  C  CA  . LEU A 1 808  ? 40.975  -13.733 36.072  1.00 63.24  ? 808  LEU A CA  1 
ATOM   6074  C  C   . LEU A 1 808  ? 39.720  -13.243 36.791  1.00 65.16  ? 808  LEU A C   1 
ATOM   6075  O  O   . LEU A 1 808  ? 39.232  -12.146 36.517  1.00 65.85  ? 808  LEU A O   1 
ATOM   6076  C  CB  . LEU A 1 808  ? 42.213  -13.429 36.919  1.00 62.92  ? 808  LEU A CB  1 
ATOM   6077  C  CG  . LEU A 1 808  ? 43.520  -14.052 36.436  1.00 63.10  ? 808  LEU A CG  1 
ATOM   6078  C  CD1 . LEU A 1 808  ? 44.713  -13.365 37.085  1.00 63.12  ? 808  LEU A CD1 1 
ATOM   6079  C  CD2 . LEU A 1 808  ? 43.548  -15.544 36.731  1.00 65.06  ? 808  LEU A CD2 1 
ATOM   6080  N  N   . GLN A 1 809  ? 39.220  -14.054 37.729  1.00 67.11  ? 809  GLN A N   1 
ATOM   6081  C  CA  . GLN A 1 809  ? 38.149  -13.605 38.600  1.00 68.88  ? 809  GLN A CA  1 
ATOM   6082  C  C   . GLN A 1 809  ? 38.590  -12.343 39.331  1.00 67.35  ? 809  GLN A C   1 
ATOM   6083  O  O   . GLN A 1 809  ? 39.636  -12.341 39.967  1.00 69.00  ? 809  GLN A O   1 
ATOM   6084  C  CB  . GLN A 1 809  ? 37.799  -14.687 39.616  1.00 72.61  ? 809  GLN A CB  1 
ATOM   6085  C  CG  . GLN A 1 809  ? 36.572  -15.486 39.218  1.00 76.50  ? 809  GLN A CG  1 
ATOM   6086  C  CD  . GLN A 1 809  ? 36.277  -16.575 40.217  1.00 81.17  ? 809  GLN A CD  1 
ATOM   6087  O  OE1 . GLN A 1 809  ? 35.449  -16.410 41.112  1.00 84.40  ? 809  GLN A OE1 1 
ATOM   6088  N  NE2 . GLN A 1 809  ? 36.961  -17.701 40.070  1.00 82.29  ? 809  GLN A NE2 1 
ATOM   6089  N  N   . ASN A 1 810  ? 37.794  -11.276 39.210  1.00 65.24  ? 810  ASN A N   1 
ATOM   6090  C  CA  . ASN A 1 810  ? 38.013  -10.042 39.941  1.00 64.23  ? 810  ASN A CA  1 
ATOM   6091  C  C   . ASN A 1 810  ? 39.079  -9.194  39.261  1.00 62.33  ? 810  ASN A C   1 
ATOM   6092  O  O   . ASN A 1 810  ? 39.521  -8.195  39.823  1.00 63.01  ? 810  ASN A O   1 
ATOM   6093  C  CB  . ASN A 1 810  ? 38.438  -10.306 41.380  1.00 66.43  ? 810  ASN A CB  1 
ATOM   6094  C  CG  . ASN A 1 810  ? 37.345  -10.974 42.178  1.00 69.35  ? 810  ASN A CG  1 
ATOM   6095  O  OD1 . ASN A 1 810  ? 36.172  -10.659 42.007  1.00 68.86  ? 810  ASN A OD1 1 
ATOM   6096  N  ND2 . ASN A 1 810  ? 37.719  -11.874 43.070  1.00 72.54  ? 810  ASN A ND2 1 
ATOM   6097  N  N   . GLU A 1 811  ? 39.494  -9.595  38.061  1.00 60.29  ? 811  GLU A N   1 
ATOM   6098  C  CA  . GLU A 1 811  ? 40.462  -8.791  37.347  1.00 58.62  ? 811  GLU A CA  1 
ATOM   6099  C  C   . GLU A 1 811  ? 39.725  -7.879  36.376  1.00 57.47  ? 811  GLU A C   1 
ATOM   6100  O  O   . GLU A 1 811  ? 38.885  -8.348  35.616  1.00 58.37  ? 811  GLU A O   1 
ATOM   6101  C  CB  . GLU A 1 811  ? 41.439  -9.686  36.600  1.00 58.78  ? 811  GLU A CB  1 
ATOM   6102  C  CG  . GLU A 1 811  ? 42.582  -8.895  36.011  1.00 58.94  ? 811  GLU A CG  1 
ATOM   6103  C  CD  . GLU A 1 811  ? 43.656  -9.793  35.445  1.00 60.40  ? 811  GLU A CD  1 
ATOM   6104  O  OE1 . GLU A 1 811  ? 43.292  -10.866 34.926  1.00 62.44  ? 811  GLU A OE1 1 
ATOM   6105  O  OE2 . GLU A 1 811  ? 44.843  -9.434  35.551  1.00 60.90  ? 811  GLU A OE2 1 
ATOM   6106  N  N   . TYR A 1 812  ? 40.051  -6.584  36.411  1.00 56.09  ? 812  TYR A N   1 
ATOM   6107  C  CA  . TYR A 1 812  ? 39.466  -5.613  35.505  1.00 55.55  ? 812  TYR A CA  1 
ATOM   6108  C  C   . TYR A 1 812  ? 40.527  -5.159  34.516  1.00 53.81  ? 812  TYR A C   1 
ATOM   6109  O  O   . TYR A 1 812  ? 41.569  -4.674  34.938  1.00 55.40  ? 812  TYR A O   1 
ATOM   6110  C  CB  . TYR A 1 812  ? 39.032  -4.364  36.274  1.00 57.45  ? 812  TYR A CB  1 
ATOM   6111  C  CG  . TYR A 1 812  ? 37.726  -4.443  37.025  1.00 60.83  ? 812  TYR A CG  1 
ATOM   6112  C  CD1 . TYR A 1 812  ? 37.201  -5.651  37.479  1.00 62.82  ? 812  TYR A CD1 1 
ATOM   6113  C  CD2 . TYR A 1 812  ? 37.029  -3.281  37.319  1.00 61.37  ? 812  TYR A CD2 1 
ATOM   6114  C  CE1 . TYR A 1 812  ? 36.009  -5.704  38.187  1.00 64.97  ? 812  TYR A CE1 1 
ATOM   6115  C  CE2 . TYR A 1 812  ? 35.838  -3.316  38.029  1.00 63.50  ? 812  TYR A CE2 1 
ATOM   6116  C  CZ  . TYR A 1 812  ? 35.327  -4.528  38.466  1.00 65.72  ? 812  TYR A CZ  1 
ATOM   6117  O  OH  . TYR A 1 812  ? 34.153  -4.537  39.166  1.00 67.81  ? 812  TYR A OH  1 
ATOM   6118  N  N   . ALA A 1 813  ? 40.258  -5.282  33.211  1.00 51.72  ? 813  ALA A N   1 
ATOM   6119  C  CA  . ALA A 1 813  ? 41.203  -4.750  32.240  1.00 50.01  ? 813  ALA A CA  1 
ATOM   6120  C  C   . ALA A 1 813  ? 40.944  -3.258  32.074  1.00 49.06  ? 813  ALA A C   1 
ATOM   6121  O  O   . ALA A 1 813  ? 39.799  -2.867  31.871  1.00 49.20  ? 813  ALA A O   1 
ATOM   6122  C  CB  . ALA A 1 813  ? 41.114  -5.478  30.921  1.00 49.40  ? 813  ALA A CB  1 
ATOM   6123  N  N   . LEU A 1 814  ? 42.010  -2.449  32.178  1.00 48.11  ? 814  LEU A N   1 
ATOM   6124  C  CA  . LEU A 1 814  ? 41.888  -0.999  32.176  1.00 46.63  ? 814  LEU A CA  1 
ATOM   6125  C  C   . LEU A 1 814  ? 42.511  -0.398  30.922  1.00 46.49  ? 814  LEU A C   1 
ATOM   6126  O  O   . LEU A 1 814  ? 41.974  0.564   30.381  1.00 46.87  ? 814  LEU A O   1 
ATOM   6127  C  CB  . LEU A 1 814  ? 42.545  -0.415  33.429  1.00 46.12  ? 814  LEU A CB  1 
ATOM   6128  C  CG  . LEU A 1 814  ? 42.064  -0.945  34.776  1.00 46.82  ? 814  LEU A CG  1 
ATOM   6129  C  CD1 . LEU A 1 814  ? 42.656  -0.111  35.898  1.00 47.57  ? 814  LEU A CD1 1 
ATOM   6130  C  CD2 . LEU A 1 814  ? 40.552  -0.921  34.879  1.00 47.13  ? 814  LEU A CD2 1 
ATOM   6131  N  N   . SER A 1 815  ? 43.649  -0.947  30.482  1.00 46.93  ? 815  SER A N   1 
ATOM   6132  C  CA  . SER A 1 815  ? 44.400  -0.317  29.405  1.00 47.53  ? 815  SER A CA  1 
ATOM   6133  C  C   . SER A 1 815  ? 44.696  -1.330  28.308  1.00 46.91  ? 815  SER A C   1 
ATOM   6134  O  O   . SER A 1 815  ? 44.728  -2.521  28.584  1.00 47.04  ? 815  SER A O   1 
ATOM   6135  C  CB  . SER A 1 815  ? 45.661  0.346   29.919  1.00 48.51  ? 815  SER A CB  1 
ATOM   6136  O  OG  . SER A 1 815  ? 46.353  -0.503  30.819  1.00 50.48  ? 815  SER A OG  1 
ATOM   6137  N  N   . LEU A 1 816  ? 44.907  -0.841  27.080  1.00 46.94  ? 816  LEU A N   1 
ATOM   6138  C  CA  . LEU A 1 816  ? 45.180  -1.695  25.938  1.00 48.12  ? 816  LEU A CA  1 
ATOM   6139  C  C   . LEU A 1 816  ? 46.072  -0.955  24.945  1.00 49.93  ? 816  LEU A C   1 
ATOM   6140  O  O   . LEU A 1 816  ? 45.849  0.214   24.665  1.00 51.19  ? 816  LEU A O   1 
ATOM   6141  C  CB  . LEU A 1 816  ? 43.841  -2.073  25.302  1.00 47.55  ? 816  LEU A CB  1 
ATOM   6142  C  CG  . LEU A 1 816  ? 43.906  -2.857  23.995  1.00 47.97  ? 816  LEU A CG  1 
ATOM   6143  C  CD1 . LEU A 1 816  ? 44.497  -4.236  24.218  1.00 48.83  ? 816  LEU A CD1 1 
ATOM   6144  C  CD2 . LEU A 1 816  ? 42.521  -2.977  23.388  1.00 48.10  ? 816  LEU A CD2 1 
ATOM   6145  N  N   . VAL A 1 817  ? 47.090  -1.650  24.431  1.00 52.32  ? 817  VAL A N   1 
ATOM   6146  C  CA  . VAL A 1 817  ? 47.909  -1.133  23.348  1.00 54.11  ? 817  VAL A CA  1 
ATOM   6147  C  C   . VAL A 1 817  ? 48.209  -2.266  22.367  1.00 54.74  ? 817  VAL A C   1 
ATOM   6148  O  O   . VAL A 1 817  ? 48.249  -3.435  22.747  1.00 55.12  ? 817  VAL A O   1 
ATOM   6149  C  CB  . VAL A 1 817  ? 49.188  -0.456  23.879  1.00 55.55  ? 817  VAL A CB  1 
ATOM   6150  C  CG1 . VAL A 1 817  ? 50.082  -1.428  24.636  1.00 57.62  ? 817  VAL A CG1 1 
ATOM   6151  C  CG2 . VAL A 1 817  ? 49.965  0.231   22.768  1.00 58.07  ? 817  VAL A CG2 1 
ATOM   6152  N  N   . SER A 1 818  ? 48.374  -1.906  21.093  1.00 54.84  ? 818  SER A N   1 
ATOM   6153  C  CA  . SER A 1 818  ? 48.934  -2.814  20.112  1.00 57.92  ? 818  SER A CA  1 
ATOM   6154  C  C   . SER A 1 818  ? 50.285  -2.259  19.662  1.00 60.83  ? 818  SER A C   1 
ATOM   6155  O  O   . SER A 1 818  ? 50.382  -1.083  19.314  1.00 61.59  ? 818  SER A O   1 
ATOM   6156  C  CB  . SER A 1 818  ? 47.989  -3.002  18.953  1.00 58.15  ? 818  SER A CB  1 
ATOM   6157  O  OG  . SER A 1 818  ? 48.668  -3.544  17.824  1.00 61.05  ? 818  SER A OG  1 
ATOM   6158  N  N   . CYS A 1 819  ? 51.340  -3.085  19.687  1.00 62.87  ? 819  CYS A N   1 
ATOM   6159  C  CA  . CYS A 1 819  ? 52.648  -2.548  19.340  1.00 65.84  ? 819  CYS A CA  1 
ATOM   6160  C  C   . CYS A 1 819  ? 53.744  -3.613  19.267  1.00 66.56  ? 819  CYS A C   1 
ATOM   6161  O  O   . CYS A 1 819  ? 53.576  -4.758  19.678  1.00 66.03  ? 819  CYS A O   1 
ATOM   6162  C  CB  . CYS A 1 819  ? 53.075  -1.459  20.320  1.00 67.29  ? 819  CYS A CB  1 
ATOM   6163  S  SG  . CYS A 1 819  ? 53.151  -2.022  22.041  1.00 71.45  ? 819  CYS A SG  1 
ATOM   6164  N  N   . LYS A 1 820  ? 54.879  -3.179  18.711  1.00 67.36  ? 820  LYS A N   1 
ATOM   6165  C  CA  . LYS A 1 820  ? 56.140  -3.898  18.715  1.00 68.03  ? 820  LYS A CA  1 
ATOM   6166  C  C   . LYS A 1 820  ? 57.015  -3.309  19.818  1.00 67.65  ? 820  LYS A C   1 
ATOM   6167  O  O   . LYS A 1 820  ? 56.944  -2.112  20.094  1.00 66.98  ? 820  LYS A O   1 
ATOM   6168  C  CB  . LYS A 1 820  ? 56.846  -3.680  17.373  1.00 69.70  ? 820  LYS A CB  1 
ATOM   6169  C  CG  . LYS A 1 820  ? 56.172  -4.282  16.147  1.00 70.72  ? 820  LYS A CG  1 
ATOM   6170  C  CD  . LYS A 1 820  ? 56.739  -3.789  14.829  1.00 73.17  ? 820  LYS A CD  1 
ATOM   6171  C  CE  . LYS A 1 820  ? 57.986  -4.531  14.388  1.00 78.28  ? 820  LYS A CE  1 
ATOM   6172  N  NZ  . LYS A 1 820  ? 57.713  -5.577  13.373  1.00 81.51  ? 820  LYS A NZ  1 
ATOM   6173  N  N   . LEU A 1 821  ? 57.852  -4.147  20.437  1.00 68.17  ? 821  LEU A N   1 
ATOM   6174  C  CA  . LEU A 1 821  ? 58.707  -3.682  21.519  1.00 67.86  ? 821  LEU A CA  1 
ATOM   6175  C  C   . LEU A 1 821  ? 60.139  -4.161  21.306  1.00 70.93  ? 821  LEU A C   1 
ATOM   6176  O  O   . LEU A 1 821  ? 60.369  -5.307  20.920  1.00 72.42  ? 821  LEU A O   1 
ATOM   6177  C  CB  . LEU A 1 821  ? 58.176  -4.214  22.851  1.00 65.44  ? 821  LEU A CB  1 
ATOM   6178  C  CG  . LEU A 1 821  ? 56.855  -3.625  23.334  1.00 63.12  ? 821  LEU A CG  1 
ATOM   6179  C  CD1 . LEU A 1 821  ? 56.494  -4.204  24.693  1.00 62.00  ? 821  LEU A CD1 1 
ATOM   6180  C  CD2 . LEU A 1 821  ? 56.930  -2.107  23.400  1.00 62.45  ? 821  LEU A CD2 1 
ATOM   6181  N  N   . GLY A 1 822  ? 61.095  -3.267  21.584  1.00 72.12  ? 822  GLY A N   1 
ATOM   6182  C  CA  . GLY A 1 822  ? 62.508  -3.607  21.560  1.00 74.60  ? 822  GLY A CA  1 
ATOM   6183  C  C   . GLY A 1 822  ? 62.956  -4.083  20.182  1.00 76.60  ? 822  GLY A C   1 
ATOM   6184  O  O   . GLY A 1 822  ? 62.577  -3.496  19.174  1.00 76.77  ? 822  GLY A O   1 
ATOM   6185  N  N   . LYS A 1 823  ? 63.759  -5.153  20.158  1.00 79.10  ? 823  LYS A N   1 
ATOM   6186  C  CA  . LYS A 1 823  ? 64.307  -5.686  18.919  1.00 82.53  ? 823  LYS A CA  1 
ATOM   6187  C  C   . LYS A 1 823  ? 63.384  -6.783  18.388  1.00 81.96  ? 823  LYS A C   1 
ATOM   6188  O  O   . LYS A 1 823  ? 63.599  -7.304  17.294  1.00 83.73  ? 823  LYS A O   1 
ATOM   6189  C  CB  . LYS A 1 823  ? 65.739  -6.199  19.130  1.00 86.03  ? 823  LYS A CB  1 
ATOM   6190  C  CG  . LYS A 1 823  ? 66.710  -5.212  19.774  1.00 87.83  ? 823  LYS A CG  1 
ATOM   6191  C  CD  . LYS A 1 823  ? 68.176  -5.515  19.506  1.00 91.24  ? 823  LYS A CD  1 
ATOM   6192  C  CE  . LYS A 1 823  ? 69.120  -4.616  20.280  1.00 92.75  ? 823  LYS A CE  1 
ATOM   6193  N  NZ  . LYS A 1 823  ? 70.547  -4.854  19.942  1.00 96.41  ? 823  LYS A NZ  1 
ATOM   6194  N  N   . ASP A 1 824  ? 62.356  -7.112  19.183  1.00 78.88  ? 824  ASP A N   1 
ATOM   6195  C  CA  . ASP A 1 824  ? 61.408  -8.174  18.895  1.00 77.12  ? 824  ASP A CA  1 
ATOM   6196  C  C   . ASP A 1 824  ? 60.563  -7.753  17.699  1.00 77.48  ? 824  ASP A C   1 
ATOM   6197  O  O   . ASP A 1 824  ? 59.953  -6.683  17.720  1.00 78.63  ? 824  ASP A O   1 
ATOM   6198  C  CB  . ASP A 1 824  ? 60.535  -8.463  20.122  1.00 74.59  ? 824  ASP A CB  1 
ATOM   6199  C  CG  . ASP A 1 824  ? 59.545  -9.607  19.958  1.00 73.92  ? 824  ASP A CG  1 
ATOM   6200  O  OD1 . ASP A 1 824  ? 59.408  -10.112 18.832  1.00 75.92  ? 824  ASP A OD1 1 
ATOM   6201  O  OD2 . ASP A 1 824  ? 58.922  -9.992  20.963  1.00 71.49  ? 824  ASP A OD2 1 
ATOM   6202  N  N   . PRO A 1 825  ? 60.508  -8.573  16.623  1.00 77.90  ? 825  PRO A N   1 
ATOM   6203  C  CA  . PRO A 1 825  ? 59.705  -8.245  15.442  1.00 77.68  ? 825  PRO A CA  1 
ATOM   6204  C  C   . PRO A 1 825  ? 58.209  -8.568  15.484  1.00 75.85  ? 825  PRO A C   1 
ATOM   6205  O  O   . PRO A 1 825  ? 57.489  -8.192  14.568  1.00 77.57  ? 825  PRO A O   1 
ATOM   6206  C  CB  . PRO A 1 825  ? 60.405  -9.044  14.337  1.00 79.72  ? 825  PRO A CB  1 
ATOM   6207  C  CG  . PRO A 1 825  ? 60.937  -10.271 15.052  1.00 80.22  ? 825  PRO A CG  1 
ATOM   6208  C  CD  . PRO A 1 825  ? 61.263  -9.825  16.463  1.00 78.89  ? 825  PRO A CD  1 
ATOM   6209  N  N   . ASN A 1 826  ? 57.738  -9.251  16.534  1.00 73.88  ? 826  ASN A N   1 
ATOM   6210  C  CA  . ASN A 1 826  ? 56.324  -9.564  16.689  1.00 72.26  ? 826  ASN A CA  1 
ATOM   6211  C  C   . ASN A 1 826  ? 55.539  -8.316  17.086  1.00 70.71  ? 826  ASN A C   1 
ATOM   6212  O  O   . ASN A 1 826  ? 56.110  -7.386  17.655  1.00 71.95  ? 826  ASN A O   1 
ATOM   6213  C  CB  . ASN A 1 826  ? 56.100  -10.636 17.756  1.00 71.70  ? 826  ASN A CB  1 
ATOM   6214  C  CG  . ASN A 1 826  ? 56.678  -11.974 17.359  1.00 74.41  ? 826  ASN A CG  1 
ATOM   6215  O  OD1 . ASN A 1 826  ? 56.704  -12.315 16.179  1.00 76.71  ? 826  ASN A OD1 1 
ATOM   6216  N  ND2 . ASN A 1 826  ? 57.145  -12.732 18.338  1.00 75.19  ? 826  ASN A ND2 1 
ATOM   6217  N  N   . THR A 1 827  ? 54.229  -8.320  16.794  1.00 69.15  ? 827  THR A N   1 
ATOM   6218  C  CA  . THR A 1 827  ? 53.305  -7.284  17.239  1.00 66.69  ? 827  THR A CA  1 
ATOM   6219  C  C   . THR A 1 827  ? 52.310  -7.878  18.235  1.00 64.26  ? 827  THR A C   1 
ATOM   6220  O  O   . THR A 1 827  ? 51.664  -8.882  17.944  1.00 65.21  ? 827  THR A O   1 
ATOM   6221  C  CB  . THR A 1 827  ? 52.537  -6.663  16.065  1.00 67.65  ? 827  THR A CB  1 
ATOM   6222  O  OG1 . THR A 1 827  ? 53.445  -6.407  14.993  1.00 71.10  ? 827  THR A OG1 1 
ATOM   6223  C  CG2 . THR A 1 827  ? 51.817  -5.384  16.431  1.00 66.13  ? 827  THR A CG2 1 
ATOM   6224  N  N   . TYR A 1 828  ? 52.164  -7.218  19.389  1.00 61.40  ? 828  TYR A N   1 
ATOM   6225  C  CA  . TYR A 1 828  ? 51.398  -7.757  20.497  1.00 59.33  ? 828  TYR A CA  1 
ATOM   6226  C  C   . TYR A 1 828  ? 50.226  -6.846  20.856  1.00 57.96  ? 828  TYR A C   1 
ATOM   6227  O  O   . TYR A 1 828  ? 50.278  -5.636  20.654  1.00 58.29  ? 828  TYR A O   1 
ATOM   6228  C  CB  . TYR A 1 828  ? 52.291  -7.882  21.731  1.00 59.30  ? 828  TYR A CB  1 
ATOM   6229  C  CG  . TYR A 1 828  ? 53.514  -8.738  21.549  1.00 61.21  ? 828  TYR A CG  1 
ATOM   6230  C  CD1 . TYR A 1 828  ? 53.400  -10.095 21.308  1.00 62.90  ? 828  TYR A CD1 1 
ATOM   6231  C  CD2 . TYR A 1 828  ? 54.788  -8.200  21.633  1.00 62.97  ? 828  TYR A CD2 1 
ATOM   6232  C  CE1 . TYR A 1 828  ? 54.516  -10.899 21.135  1.00 64.96  ? 828  TYR A CE1 1 
ATOM   6233  C  CE2 . TYR A 1 828  ? 55.917  -8.987  21.461  1.00 65.19  ? 828  TYR A CE2 1 
ATOM   6234  C  CZ  . TYR A 1 828  ? 55.781  -10.344 21.215  1.00 66.37  ? 828  TYR A CZ  1 
ATOM   6235  O  OH  . TYR A 1 828  ? 56.882  -11.142 21.051  1.00 68.80  ? 828  TYR A OH  1 
ATOM   6236  N  N   . PHE A 1 829  ? 49.172  -7.461  21.400  1.00 56.82  ? 829  PHE A N   1 
ATOM   6237  C  CA  . PHE A 1 829  ? 48.196  -6.770  22.218  1.00 54.45  ? 829  PHE A CA  1 
ATOM   6238  C  C   . PHE A 1 829  ? 48.666  -6.858  23.666  1.00 54.82  ? 829  PHE A C   1 
ATOM   6239  O  O   . PHE A 1 829  ? 48.859  -7.957  24.191  1.00 55.52  ? 829  PHE A O   1 
ATOM   6240  C  CB  . PHE A 1 829  ? 46.825  -7.440  22.106  1.00 52.69  ? 829  PHE A CB  1 
ATOM   6241  C  CG  . PHE A 1 829  ? 46.135  -7.308  20.776  1.00 52.17  ? 829  PHE A CG  1 
ATOM   6242  C  CD1 . PHE A 1 829  ? 45.603  -6.097  20.351  1.00 51.46  ? 829  PHE A CD1 1 
ATOM   6243  C  CD2 . PHE A 1 829  ? 45.988  -8.412  19.957  1.00 53.48  ? 829  PHE A CD2 1 
ATOM   6244  C  CE1 . PHE A 1 829  ? 44.966  -5.989  19.122  1.00 51.30  ? 829  PHE A CE1 1 
ATOM   6245  C  CE2 . PHE A 1 829  ? 45.342  -8.307  18.731  1.00 54.16  ? 829  PHE A CE2 1 
ATOM   6246  C  CZ  . PHE A 1 829  ? 44.832  -7.098  18.315  1.00 52.84  ? 829  PHE A CZ  1 
ATOM   6247  N  N   . ILE A 1 830  ? 48.840  -5.692  24.299  1.00 54.19  ? 830  ILE A N   1 
ATOM   6248  C  CA  . ILE A 1 830  ? 49.252  -5.618  25.691  1.00 53.95  ? 830  ILE A CA  1 
ATOM   6249  C  C   . ILE A 1 830  ? 48.109  -5.020  26.516  1.00 53.98  ? 830  ILE A C   1 
ATOM   6250  O  O   . ILE A 1 830  ? 47.532  -3.999  26.140  1.00 53.79  ? 830  ILE A O   1 
ATOM   6251  C  CB  . ILE A 1 830  ? 50.561  -4.812  25.819  1.00 53.64  ? 830  ILE A CB  1 
ATOM   6252  C  CG1 . ILE A 1 830  ? 51.560  -5.171  24.716  1.00 54.63  ? 830  ILE A CG1 1 
ATOM   6253  C  CG2 . ILE A 1 830  ? 51.160  -4.975  27.206  1.00 53.69  ? 830  ILE A CG2 1 
ATOM   6254  C  CD1 . ILE A 1 830  ? 52.878  -4.437  24.804  1.00 55.55  ? 830  ILE A CD1 1 
ATOM   6255  N  N   . VAL A 1 831  ? 47.795  -5.670  27.645  1.00 52.89  ? 831  VAL A N   1 
ATOM   6256  C  CA  . VAL A 1 831  ? 46.667  -5.292  28.477  1.00 51.52  ? 831  VAL A CA  1 
ATOM   6257  C  C   . VAL A 1 831  ? 47.166  -5.023  29.891  1.00 51.75  ? 831  VAL A C   1 
ATOM   6258  O  O   . VAL A 1 831  ? 47.826  -5.870  30.474  1.00 53.47  ? 831  VAL A O   1 
ATOM   6259  C  CB  . VAL A 1 831  ? 45.605  -6.406  28.494  1.00 51.64  ? 831  VAL A CB  1 
ATOM   6260  C  CG1 . VAL A 1 831  ? 44.550  -6.168  29.564  1.00 51.36  ? 831  VAL A CG1 1 
ATOM   6261  C  CG2 . VAL A 1 831  ? 44.970  -6.612  27.127  1.00 51.49  ? 831  VAL A CG2 1 
ATOM   6262  N  N   . GLY A 1 832  ? 46.817  -3.858  30.445  1.00 51.89  ? 832  GLY A N   1 
ATOM   6263  C  CA  . GLY A 1 832  ? 47.026  -3.572  31.856  1.00 51.81  ? 832  GLY A CA  1 
ATOM   6264  C  C   . GLY A 1 832  ? 45.739  -3.792  32.638  1.00 52.39  ? 832  GLY A C   1 
ATOM   6265  O  O   . GLY A 1 832  ? 44.666  -3.420  32.162  1.00 53.26  ? 832  GLY A O   1 
ATOM   6266  N  N   . THR A 1 833  ? 45.861  -4.434  33.807  1.00 52.32  ? 833  THR A N   1 
ATOM   6267  C  CA  . THR A 1 833  ? 44.704  -4.826  34.591  1.00 52.32  ? 833  THR A CA  1 
ATOM   6268  C  C   . THR A 1 833  ? 44.884  -4.374  36.037  1.00 53.32  ? 833  THR A C   1 
ATOM   6269  O  O   . THR A 1 833  ? 45.897  -3.775  36.391  1.00 54.24  ? 833  THR A O   1 
ATOM   6270  C  CB  . THR A 1 833  ? 44.448  -6.337  34.523  1.00 53.24  ? 833  THR A CB  1 
ATOM   6271  O  OG1 . THR A 1 833  ? 45.342  -6.950  35.446  1.00 55.63  ? 833  THR A OG1 1 
ATOM   6272  C  CG2 . THR A 1 833  ? 44.658  -6.945  33.154  1.00 52.96  ? 833  THR A CG2 1 
ATOM   6273  N  N   . ALA A 1 834  ? 43.874  -4.670  36.857  1.00 53.53  ? 834  ALA A N   1 
ATOM   6274  C  CA  . ALA A 1 834  ? 43.877  -4.372  38.274  1.00 55.29  ? 834  ALA A CA  1 
ATOM   6275  C  C   . ALA A 1 834  ? 43.000  -5.411  38.953  1.00 57.61  ? 834  ALA A C   1 
ATOM   6276  O  O   . ALA A 1 834  ? 41.964  -5.775  38.413  1.00 59.17  ? 834  ALA A O   1 
ATOM   6277  C  CB  . ALA A 1 834  ? 43.329  -2.989  38.492  1.00 54.68  ? 834  ALA A CB  1 
ATOM   6278  N  N   . MET A 1 835  ? 43.427  -5.907  40.114  1.00 60.54  ? 835  MET A N   1 
ATOM   6279  C  CA  . MET A 1 835  ? 42.600  -6.836  40.864  1.00 63.63  ? 835  MET A CA  1 
ATOM   6280  C  C   . MET A 1 835  ? 41.693  -6.031  41.786  1.00 65.95  ? 835  MET A C   1 
ATOM   6281  O  O   . MET A 1 835  ? 42.158  -5.195  42.560  1.00 68.05  ? 835  MET A O   1 
ATOM   6282  C  CB  . MET A 1 835  ? 43.439  -7.812  41.691  1.00 65.44  ? 835  MET A CB  1 
ATOM   6283  C  CG  . MET A 1 835  ? 44.351  -8.680  40.854  1.00 65.85  ? 835  MET A CG  1 
ATOM   6284  S  SD  . MET A 1 835  ? 43.448  -9.709  39.672  1.00 66.46  ? 835  MET A SD  1 
ATOM   6285  C  CE  . MET A 1 835  ? 42.500  -10.749 40.780  1.00 68.04  ? 835  MET A CE  1 
ATOM   6286  N  N   . VAL A 1 836  ? 40.391  -6.293  41.673  1.00 67.30  ? 836  VAL A N   1 
ATOM   6287  C  CA  . VAL A 1 836  ? 39.363  -5.539  42.366  1.00 69.02  ? 836  VAL A CA  1 
ATOM   6288  C  C   . VAL A 1 836  ? 38.643  -6.522  43.276  1.00 72.27  ? 836  VAL A C   1 
ATOM   6289  O  O   . VAL A 1 836  ? 38.073  -7.502  42.803  1.00 72.59  ? 836  VAL A O   1 
ATOM   6290  C  CB  . VAL A 1 836  ? 38.377  -4.926  41.353  1.00 67.17  ? 836  VAL A CB  1 
ATOM   6291  C  CG1 . VAL A 1 836  ? 37.054  -4.557  41.999  1.00 68.88  ? 836  VAL A CG1 1 
ATOM   6292  C  CG2 . VAL A 1 836  ? 38.975  -3.744  40.605  1.00 65.44  ? 836  VAL A CG2 1 
ATOM   6293  N  N   . TYR A 1 837  ? 38.681  -6.273  44.581  1.00 75.85  ? 837  TYR A N   1 
ATOM   6294  C  CA  . TYR A 1 837  ? 38.038  -7.224  45.468  1.00 79.56  ? 837  TYR A CA  1 
ATOM   6295  C  C   . TYR A 1 837  ? 36.843  -6.584  46.170  1.00 82.21  ? 837  TYR A C   1 
ATOM   6296  O  O   . TYR A 1 837  ? 36.821  -5.379  46.413  1.00 82.74  ? 837  TYR A O   1 
ATOM   6297  C  CB  . TYR A 1 837  ? 39.042  -7.883  46.420  1.00 81.27  ? 837  TYR A CB  1 
ATOM   6298  C  CG  . TYR A 1 837  ? 40.164  -8.669  45.783  1.00 80.23  ? 837  TYR A CG  1 
ATOM   6299  C  CD1 . TYR A 1 837  ? 39.947  -9.559  44.742  1.00 79.52  ? 837  TYR A CD1 1 
ATOM   6300  C  CD2 . TYR A 1 837  ? 41.457  -8.556  46.267  1.00 81.22  ? 837  TYR A CD2 1 
ATOM   6301  C  CE1 . TYR A 1 837  ? 40.989  -10.289 44.185  1.00 79.64  ? 837  TYR A CE1 1 
ATOM   6302  C  CE2 . TYR A 1 837  ? 42.510  -9.276  45.721  1.00 80.91  ? 837  TYR A CE2 1 
ATOM   6303  C  CZ  . TYR A 1 837  ? 42.280  -10.145 44.668  1.00 79.77  ? 837  TYR A CZ  1 
ATOM   6304  O  OH  . TYR A 1 837  ? 43.311  -10.862 44.121  1.00 78.26  ? 837  TYR A OH  1 
ATOM   6305  N  N   . PRO A 1 838  ? 35.812  -7.393  46.509  1.00 85.03  ? 838  PRO A N   1 
ATOM   6306  C  CA  . PRO A 1 838  ? 34.612  -6.891  47.177  1.00 87.83  ? 838  PRO A CA  1 
ATOM   6307  C  C   . PRO A 1 838  ? 34.921  -6.249  48.529  1.00 91.69  ? 838  PRO A C   1 
ATOM   6308  O  O   . PRO A 1 838  ? 34.362  -5.201  48.855  1.00 92.80  ? 838  PRO A O   1 
ATOM   6309  C  CB  . PRO A 1 838  ? 33.764  -8.159  47.379  1.00 89.99  ? 838  PRO A CB  1 
ATOM   6310  C  CG  . PRO A 1 838  ? 34.269  -9.125  46.331  1.00 87.55  ? 838  PRO A CG  1 
ATOM   6311  C  CD  . PRO A 1 838  ? 35.752  -8.842  46.258  1.00 85.99  ? 838  PRO A CD  1 
ATOM   6312  N  N   . GLU A 1 839  ? 35.830  -6.868  49.298  1.00 94.00  ? 839  GLU A N   1 
ATOM   6313  C  CA  . GLU A 1 839  ? 36.070  -6.451  50.674  1.00 96.95  ? 839  GLU A CA  1 
ATOM   6314  C  C   . GLU A 1 839  ? 37.262  -5.492  50.757  1.00 95.34  ? 839  GLU A C   1 
ATOM   6315  O  O   . GLU A 1 839  ? 37.930  -5.413  51.787  1.00 97.43  ? 839  GLU A O   1 
ATOM   6316  C  CB  . GLU A 1 839  ? 36.163  -7.669  51.604  1.00 100.83 ? 839  GLU A CB  1 
ATOM   6317  C  CG  . GLU A 1 839  ? 34.842  -8.420  51.787  1.00 104.47 ? 839  GLU A CG  1 
ATOM   6318  C  CD  . GLU A 1 839  ? 33.745  -7.770  52.627  1.00 106.37 ? 839  GLU A CD  1 
ATOM   6319  O  OE1 . GLU A 1 839  ? 33.594  -8.170  53.805  1.00 109.27 ? 839  GLU A OE1 1 
ATOM   6320  O  OE2 . GLU A 1 839  ? 33.019  -6.889  52.097  1.00 103.58 ? 839  GLU A OE2 1 
ATOM   6321  N  N   . GLU A 1 840  ? 37.480  -4.731  49.675  1.00 91.50  ? 840  GLU A N   1 
ATOM   6322  C  CA  . GLU A 1 840  ? 38.609  -3.829  49.500  1.00 89.71  ? 840  GLU A CA  1 
ATOM   6323  C  C   . GLU A 1 840  ? 38.110  -2.657  48.663  1.00 87.58  ? 840  GLU A C   1 
ATOM   6324  O  O   . GLU A 1 840  ? 37.073  -2.785  48.018  1.00 89.14  ? 840  GLU A O   1 
ATOM   6325  C  CB  . GLU A 1 840  ? 39.724  -4.567  48.759  1.00 90.06  ? 840  GLU A CB  1 
ATOM   6326  C  CG  . GLU A 1 840  ? 41.086  -3.897  48.838  1.00 92.23  ? 840  GLU A CG  1 
ATOM   6327  C  CD  . GLU A 1 840  ? 42.214  -4.625  48.117  1.00 92.85  ? 840  GLU A CD  1 
ATOM   6328  O  OE1 . GLU A 1 840  ? 43.020  -3.946  47.443  1.00 93.24  ? 840  GLU A OE1 1 
ATOM   6329  O  OE2 . GLU A 1 840  ? 42.298  -5.869  48.236  1.00 93.57  ? 840  GLU A OE2 1 
ATOM   6330  N  N   . ALA A 1 841  ? 38.839  -1.530  48.658  1.00 85.90  ? 841  ALA A N   1 
ATOM   6331  C  CA  . ALA A 1 841  ? 38.260  -0.291  48.147  1.00 82.91  ? 841  ALA A CA  1 
ATOM   6332  C  C   . ALA A 1 841  ? 39.156  0.448   47.151  1.00 79.57  ? 841  ALA A C   1 
ATOM   6333  O  O   . ALA A 1 841  ? 38.723  1.455   46.594  1.00 79.07  ? 841  ALA A O   1 
ATOM   6334  C  CB  . ALA A 1 841  ? 37.846  0.612   49.288  1.00 84.29  ? 841  ALA A CB  1 
ATOM   6335  N  N   . GLU A 1 842  ? 40.392  -0.027  46.941  1.00 78.11  ? 842  GLU A N   1 
ATOM   6336  C  CA  . GLU A 1 842  ? 41.280  0.537   45.930  1.00 76.42  ? 842  GLU A CA  1 
ATOM   6337  C  C   . GLU A 1 842  ? 42.309  -0.514  45.520  1.00 74.32  ? 842  GLU A C   1 
ATOM   6338  O  O   . GLU A 1 842  ? 42.614  -1.413  46.304  1.00 74.59  ? 842  GLU A O   1 
ATOM   6339  C  CB  . GLU A 1 842  ? 41.964  1.814   46.426  1.00 79.20  ? 842  GLU A CB  1 
ATOM   6340  C  CG  . GLU A 1 842  ? 42.809  1.611   47.668  1.00 85.68  ? 842  GLU A CG  1 
ATOM   6341  C  CD  . GLU A 1 842  ? 42.917  2.834   48.562  1.00 91.26  ? 842  GLU A CD  1 
ATOM   6342  O  OE1 . GLU A 1 842  ? 42.249  3.853   48.256  1.00 93.14  ? 842  GLU A OE1 1 
ATOM   6343  O  OE2 . GLU A 1 842  ? 43.665  2.763   49.572  1.00 94.85  ? 842  GLU A OE2 1 
ATOM   6344  N  N   . PRO A 1 843  ? 42.899  -0.428  44.303  1.00 71.41  ? 843  PRO A N   1 
ATOM   6345  C  CA  . PRO A 1 843  ? 43.717  -1.516  43.772  1.00 71.17  ? 843  PRO A CA  1 
ATOM   6346  C  C   . PRO A 1 843  ? 45.122  -1.504  44.357  1.00 71.80  ? 843  PRO A C   1 
ATOM   6347  O  O   . PRO A 1 843  ? 45.746  -0.454  44.475  1.00 72.69  ? 843  PRO A O   1 
ATOM   6348  C  CB  . PRO A 1 843  ? 43.832  -1.221  42.271  1.00 68.72  ? 843  PRO A CB  1 
ATOM   6349  C  CG  . PRO A 1 843  ? 43.014  0.036   42.044  1.00 69.43  ? 843  PRO A CG  1 
ATOM   6350  C  CD  . PRO A 1 843  ? 42.851  0.717   43.385  1.00 69.82  ? 843  PRO A CD  1 
ATOM   6351  N  N   . LYS A 1 844  ? 45.616  -2.694  44.696  1.00 72.51  ? 844  LYS A N   1 
ATOM   6352  C  CA  . LYS A 1 844  ? 46.944  -2.823  45.265  1.00 73.32  ? 844  LYS A CA  1 
ATOM   6353  C  C   . LYS A 1 844  ? 47.720  -3.888  44.499  1.00 70.61  ? 844  LYS A C   1 
ATOM   6354  O  O   . LYS A 1 844  ? 48.919  -4.034  44.688  1.00 72.39  ? 844  LYS A O   1 
ATOM   6355  C  CB  . LYS A 1 844  ? 46.829  -3.142  46.757  1.00 77.70  ? 844  LYS A CB  1 
ATOM   6356  C  CG  . LYS A 1 844  ? 46.118  -2.071  47.570  1.00 82.14  ? 844  LYS A CG  1 
ATOM   6357  C  CD  . LYS A 1 844  ? 45.695  -2.529  48.951  1.00 88.53  ? 844  LYS A CD  1 
ATOM   6358  C  CE  . LYS A 1 844  ? 44.894  -1.482  49.703  1.00 92.60  ? 844  LYS A CE  1 
ATOM   6359  N  NZ  . LYS A 1 844  ? 45.721  -0.324  50.130  1.00 95.31  ? 844  LYS A NZ  1 
ATOM   6360  N  N   . GLN A 1 845  ? 47.009  -4.638  43.657  1.00 67.57  ? 845  GLN A N   1 
ATOM   6361  C  CA  . GLN A 1 845  ? 47.577  -5.686  42.832  1.00 65.43  ? 845  GLN A CA  1 
ATOM   6362  C  C   . GLN A 1 845  ? 47.128  -5.434  41.402  1.00 62.48  ? 845  GLN A C   1 
ATOM   6363  O  O   . GLN A 1 845  ? 46.012  -4.986  41.155  1.00 62.22  ? 845  GLN A O   1 
ATOM   6364  C  CB  . GLN A 1 845  ? 47.073  -7.065  43.261  1.00 67.29  ? 845  GLN A CB  1 
ATOM   6365  C  CG  . GLN A 1 845  ? 47.942  -7.748  44.301  1.00 70.72  ? 845  GLN A CG  1 
ATOM   6366  C  CD  . GLN A 1 845  ? 47.141  -8.707  45.145  1.00 74.12  ? 845  GLN A CD  1 
ATOM   6367  O  OE1 . GLN A 1 845  ? 46.229  -8.310  45.865  1.00 76.33  ? 845  GLN A OE1 1 
ATOM   6368  N  NE2 . GLN A 1 845  ? 47.488  -9.984  45.076  1.00 76.54  ? 845  GLN A NE2 1 
ATOM   6369  N  N   . GLY A 1 846  ? 48.019  -5.726  40.464  1.00 61.02  ? 846  GLY A N   1 
ATOM   6370  C  CA  . GLY A 1 846  ? 47.701  -5.535  39.066  1.00 57.84  ? 846  GLY A CA  1 
ATOM   6371  C  C   . GLY A 1 846  ? 48.635  -6.365  38.205  1.00 57.23  ? 846  GLY A C   1 
ATOM   6372  O  O   . GLY A 1 846  ? 49.519  -7.051  38.713  1.00 58.31  ? 846  GLY A O   1 
ATOM   6373  N  N   . ARG A 1 847  ? 48.426  -6.286  36.897  1.00 54.98  ? 847  ARG A N   1 
ATOM   6374  C  CA  . ARG A 1 847  ? 49.169  -7.150  36.010  1.00 54.68  ? 847  ARG A CA  1 
ATOM   6375  C  C   . ARG A 1 847  ? 49.250  -6.493  34.637  1.00 52.96  ? 847  ARG A C   1 
ATOM   6376  O  O   . ARG A 1 847  ? 48.333  -5.782  34.227  1.00 51.57  ? 847  ARG A O   1 
ATOM   6377  C  CB  . ARG A 1 847  ? 48.448  -8.497  35.990  1.00 55.78  ? 847  ARG A CB  1 
ATOM   6378  C  CG  . ARG A 1 847  ? 49.180  -9.605  35.256  1.00 57.82  ? 847  ARG A CG  1 
ATOM   6379  C  CD  . ARG A 1 847  ? 48.650  -10.953 35.710  1.00 59.35  ? 847  ARG A CD  1 
ATOM   6380  N  NE  . ARG A 1 847  ? 47.217  -11.062 35.480  1.00 58.52  ? 847  ARG A NE  1 
ATOM   6381  C  CZ  . ARG A 1 847  ? 46.649  -11.810 34.538  1.00 58.44  ? 847  ARG A CZ  1 
ATOM   6382  N  NH1 . ARG A 1 847  ? 47.383  -12.541 33.723  1.00 58.14  ? 847  ARG A NH1 1 
ATOM   6383  N  NH2 . ARG A 1 847  ? 45.341  -11.833 34.401  1.00 59.35  ? 847  ARG A NH2 1 
ATOM   6384  N  N   . ILE A 1 848  ? 50.373  -6.714  33.945  1.00 52.32  ? 848  ILE A N   1 
ATOM   6385  C  CA  . ILE A 1 848  ? 50.474  -6.363  32.539  1.00 51.17  ? 848  ILE A CA  1 
ATOM   6386  C  C   . ILE A 1 848  ? 50.645  -7.656  31.754  1.00 51.69  ? 848  ILE A C   1 
ATOM   6387  O  O   . ILE A 1 848  ? 51.490  -8.470  32.118  1.00 54.42  ? 848  ILE A O   1 
ATOM   6388  C  CB  . ILE A 1 848  ? 51.634  -5.385  32.286  1.00 50.69  ? 848  ILE A CB  1 
ATOM   6389  C  CG1 . ILE A 1 848  ? 51.430  -4.081  33.063  1.00 50.47  ? 848  ILE A CG1 1 
ATOM   6390  C  CG2 . ILE A 1 848  ? 51.803  -5.149  30.792  1.00 49.41  ? 848  ILE A CG2 1 
ATOM   6391  C  CD1 . ILE A 1 848  ? 52.609  -3.129  33.033  1.00 51.36  ? 848  ILE A CD1 1 
ATOM   6392  N  N   . VAL A 1 849  ? 49.825  -7.852  30.712  1.00 49.55  ? 849  VAL A N   1 
ATOM   6393  C  CA  . VAL A 1 849  ? 49.843  -9.106  29.983  1.00 49.45  ? 849  VAL A CA  1 
ATOM   6394  C  C   . VAL A 1 849  ? 50.125  -8.819  28.515  1.00 49.98  ? 849  VAL A C   1 
ATOM   6395  O  O   . VAL A 1 849  ? 49.522  -7.917  27.936  1.00 49.68  ? 849  VAL A O   1 
ATOM   6396  C  CB  . VAL A 1 849  ? 48.542  -9.902  30.178  1.00 48.78  ? 849  VAL A CB  1 
ATOM   6397  C  CG1 . VAL A 1 849  ? 48.643  -11.283 29.561  1.00 50.08  ? 849  VAL A CG1 1 
ATOM   6398  C  CG2 . VAL A 1 849  ? 48.167  -10.023 31.646  1.00 48.73  ? 849  VAL A CG2 1 
ATOM   6399  N  N   . VAL A 1 850  ? 51.058  -9.594  27.944  1.00 51.13  ? 850  VAL A N   1 
ATOM   6400  C  CA  . VAL A 1 850  ? 51.413  -9.493  26.538  1.00 52.55  ? 850  VAL A CA  1 
ATOM   6401  C  C   . VAL A 1 850  ? 50.819  -10.690 25.796  1.00 54.81  ? 850  VAL A C   1 
ATOM   6402  O  O   . VAL A 1 850  ? 51.151  -11.837 26.100  1.00 57.04  ? 850  VAL A O   1 
ATOM   6403  C  CB  . VAL A 1 850  ? 52.940  -9.387  26.342  1.00 52.83  ? 850  VAL A CB  1 
ATOM   6404  C  CG1 . VAL A 1 850  ? 53.336  -9.398  24.875  1.00 52.98  ? 850  VAL A CG1 1 
ATOM   6405  C  CG2 . VAL A 1 850  ? 53.503  -8.152  27.021  1.00 52.01  ? 850  VAL A CG2 1 
ATOM   6406  N  N   . PHE A 1 851  ? 49.943  -10.402 24.823  1.00 54.30  ? 851  PHE A N   1 
ATOM   6407  C  CA  . PHE A 1 851  ? 49.310  -11.422 24.008  1.00 55.30  ? 851  PHE A CA  1 
ATOM   6408  C  C   . PHE A 1 851  ? 49.815  -11.312 22.578  1.00 57.15  ? 851  PHE A C   1 
ATOM   6409  O  O   . PHE A 1 851  ? 50.230  -10.239 22.156  1.00 57.64  ? 851  PHE A O   1 
ATOM   6410  C  CB  . PHE A 1 851  ? 47.802  -11.192 23.953  1.00 54.07  ? 851  PHE A CB  1 
ATOM   6411  C  CG  . PHE A 1 851  ? 47.103  -11.234 25.283  1.00 52.90  ? 851  PHE A CG  1 
ATOM   6412  C  CD1 . PHE A 1 851  ? 46.691  -12.433 25.839  1.00 53.50  ? 851  PHE A CD1 1 
ATOM   6413  C  CD2 . PHE A 1 851  ? 46.847  -10.065 25.973  1.00 51.68  ? 851  PHE A CD2 1 
ATOM   6414  C  CE1 . PHE A 1 851  ? 46.047  -12.460 27.064  1.00 52.98  ? 851  PHE A CE1 1 
ATOM   6415  C  CE2 . PHE A 1 851  ? 46.188  -10.093 27.191  1.00 51.16  ? 851  PHE A CE2 1 
ATOM   6416  C  CZ  . PHE A 1 851  ? 45.788  -11.289 27.735  1.00 51.72  ? 851  PHE A CZ  1 
ATOM   6417  N  N   . GLN A 1 852  ? 49.751  -12.430 21.848  1.00 59.42  ? 852  GLN A N   1 
ATOM   6418  C  CA  . GLN A 1 852  ? 50.022  -12.448 20.423  1.00 61.39  ? 852  GLN A CA  1 
ATOM   6419  C  C   . GLN A 1 852  ? 48.850  -13.121 19.714  1.00 61.69  ? 852  GLN A C   1 
ATOM   6420  O  O   . GLN A 1 852  ? 48.483  -14.245 20.052  1.00 61.38  ? 852  GLN A O   1 
ATOM   6421  C  CB  . GLN A 1 852  ? 51.328  -13.188 20.145  1.00 63.73  ? 852  GLN A CB  1 
ATOM   6422  C  CG  . GLN A 1 852  ? 51.988  -12.738 18.853  1.00 66.63  ? 852  GLN A CG  1 
ATOM   6423  C  CD  . GLN A 1 852  ? 52.879  -13.796 18.255  1.00 70.40  ? 852  GLN A CD  1 
ATOM   6424  O  OE1 . GLN A 1 852  ? 53.604  -14.508 18.956  1.00 70.49  ? 852  GLN A OE1 1 
ATOM   6425  N  NE2 . GLN A 1 852  ? 52.821  -13.905 16.936  1.00 73.44  ? 852  GLN A NE2 1 
ATOM   6426  N  N   . TYR A 1 853  ? 48.250  -12.413 18.752  1.00 61.49  ? 853  TYR A N   1 
ATOM   6427  C  CA  . TYR A 1 853  ? 47.157  -13.010 18.007  1.00 62.99  ? 853  TYR A CA  1 
ATOM   6428  C  C   . TYR A 1 853  ? 47.707  -13.677 16.753  1.00 66.00  ? 853  TYR A C   1 
ATOM   6429  O  O   . TYR A 1 853  ? 48.040  -13.009 15.779  1.00 66.02  ? 853  TYR A O   1 
ATOM   6430  C  CB  . TYR A 1 853  ? 46.011  -12.030 17.722  1.00 61.34  ? 853  TYR A CB  1 
ATOM   6431  C  CG  . TYR A 1 853  ? 44.867  -12.673 16.975  1.00 62.01  ? 853  TYR A CG  1 
ATOM   6432  C  CD1 . TYR A 1 853  ? 44.061  -13.624 17.585  1.00 62.00  ? 853  TYR A CD1 1 
ATOM   6433  C  CD2 . TYR A 1 853  ? 44.622  -12.377 15.643  1.00 63.02  ? 853  TYR A CD2 1 
ATOM   6434  C  CE1 . TYR A 1 853  ? 43.028  -14.244 16.898  1.00 63.75  ? 853  TYR A CE1 1 
ATOM   6435  C  CE2 . TYR A 1 853  ? 43.590  -12.986 14.945  1.00 64.83  ? 853  TYR A CE2 1 
ATOM   6436  C  CZ  . TYR A 1 853  ? 42.787  -13.925 15.571  1.00 64.93  ? 853  TYR A CZ  1 
ATOM   6437  O  OH  . TYR A 1 853  ? 41.777  -14.531 14.873  1.00 65.47  ? 853  TYR A OH  1 
ATOM   6438  N  N   . SER A 1 854  ? 47.759  -15.009 16.787  1.00 70.13  ? 854  SER A N   1 
ATOM   6439  C  CA  . SER A 1 854  ? 48.324  -15.772 15.691  1.00 74.95  ? 854  SER A CA  1 
ATOM   6440  C  C   . SER A 1 854  ? 47.515  -17.047 15.488  1.00 75.72  ? 854  SER A C   1 
ATOM   6441  O  O   . SER A 1 854  ? 47.123  -17.691 16.456  1.00 75.36  ? 854  SER A O   1 
ATOM   6442  C  CB  . SER A 1 854  ? 49.774  -16.067 15.969  1.00 78.72  ? 854  SER A CB  1 
ATOM   6443  O  OG  . SER A 1 854  ? 50.379  -16.709 14.859  1.00 87.76  ? 854  SER A OG  1 
ATOM   6444  N  N   . ASP A 1 855  ? 47.265  -17.381 14.219  1.00 78.07  ? 855  ASP A N   1 
ATOM   6445  C  CA  . ASP A 1 855  ? 46.566  -18.597 13.831  1.00 81.56  ? 855  ASP A CA  1 
ATOM   6446  C  C   . ASP A 1 855  ? 45.221  -18.730 14.552  1.00 81.44  ? 855  ASP A C   1 
ATOM   6447  O  O   . ASP A 1 855  ? 44.868  -19.818 14.997  1.00 83.72  ? 855  ASP A O   1 
ATOM   6448  C  CB  . ASP A 1 855  ? 47.464  -19.824 14.012  1.00 83.65  ? 855  ASP A CB  1 
ATOM   6449  C  CG  . ASP A 1 855  ? 48.747  -19.765 13.196  1.00 86.30  ? 855  ASP A CG  1 
ATOM   6450  O  OD1 . ASP A 1 855  ? 48.652  -19.861 11.953  1.00 88.33  ? 855  ASP A OD1 1 
ATOM   6451  O  OD2 . ASP A 1 855  ? 49.837  -19.633 13.811  1.00 86.20  ? 855  ASP A OD2 1 
ATOM   6452  N  N   . GLY A 1 856  ? 44.475  -17.624 14.675  1.00 79.78  ? 856  GLY A N   1 
ATOM   6453  C  CA  . GLY A 1 856  ? 43.103  -17.687 15.154  1.00 79.18  ? 856  GLY A CA  1 
ATOM   6454  C  C   . GLY A 1 856  ? 42.944  -17.611 16.675  1.00 79.40  ? 856  GLY A C   1 
ATOM   6455  O  O   . GLY A 1 856  ? 41.820  -17.447 17.148  1.00 80.66  ? 856  GLY A O   1 
ATOM   6456  N  N   . LYS A 1 857  ? 44.048  -17.701 17.438  1.00 79.69  ? 857  LYS A N   1 
ATOM   6457  C  CA  . LYS A 1 857  ? 43.987  -17.736 18.897  1.00 78.31  ? 857  LYS A CA  1 
ATOM   6458  C  C   . LYS A 1 857  ? 44.912  -16.700 19.529  1.00 75.37  ? 857  LYS A C   1 
ATOM   6459  O  O   . LYS A 1 857  ? 45.923  -16.331 18.937  1.00 76.86  ? 857  LYS A O   1 
ATOM   6460  C  CB  . LYS A 1 857  ? 44.421  -19.108 19.417  1.00 81.58  ? 857  LYS A CB  1 
ATOM   6461  C  CG  . LYS A 1 857  ? 43.304  -20.134 19.546  1.00 87.43  ? 857  LYS A CG  1 
ATOM   6462  C  CD  . LYS A 1 857  ? 43.833  -21.537 19.778  1.00 92.22  ? 857  LYS A CD  1 
ATOM   6463  C  CE  . LYS A 1 857  ? 42.754  -22.602 19.820  1.00 94.17  ? 857  LYS A CE  1 
ATOM   6464  N  NZ  . LYS A 1 857  ? 43.339  -23.962 19.739  1.00 95.46  ? 857  LYS A NZ  1 
ATOM   6465  N  N   . LEU A 1 858  ? 44.566  -16.287 20.758  1.00 71.81  ? 858  LEU A N   1 
ATOM   6466  C  CA  . LEU A 1 858  ? 45.344  -15.360 21.564  1.00 68.21  ? 858  LEU A CA  1 
ATOM   6467  C  C   . LEU A 1 858  ? 46.254  -16.162 22.482  1.00 68.44  ? 858  LEU A C   1 
ATOM   6468  O  O   . LEU A 1 858  ? 45.769  -16.950 23.294  1.00 69.72  ? 858  LEU A O   1 
ATOM   6469  C  CB  . LEU A 1 858  ? 44.385  -14.508 22.396  1.00 65.81  ? 858  LEU A CB  1 
ATOM   6470  C  CG  . LEU A 1 858  ? 44.854  -13.086 22.684  1.00 64.67  ? 858  LEU A CG  1 
ATOM   6471  C  CD1 . LEU A 1 858  ? 45.446  -12.461 21.434  1.00 64.73  ? 858  LEU A CD1 1 
ATOM   6472  C  CD2 . LEU A 1 858  ? 43.696  -12.232 23.178  1.00 64.79  ? 858  LEU A CD2 1 
ATOM   6473  N  N   . GLN A 1 859  ? 47.566  -15.955 22.324  1.00 67.16  ? 859  GLN A N   1 
ATOM   6474  C  CA  . GLN A 1 859  ? 48.570  -16.641 23.115  1.00 67.11  ? 859  GLN A CA  1 
ATOM   6475  C  C   . GLN A 1 859  ? 49.070  -15.664 24.178  1.00 65.05  ? 859  GLN A C   1 
ATOM   6476  O  O   . GLN A 1 859  ? 49.256  -14.488 23.881  1.00 64.52  ? 859  GLN A O   1 
ATOM   6477  C  CB  . GLN A 1 859  ? 49.671  -17.117 22.169  1.00 69.02  ? 859  GLN A CB  1 
ATOM   6478  C  CG  . GLN A 1 859  ? 50.904  -17.643 22.881  1.00 71.91  ? 859  GLN A CG  1 
ATOM   6479  C  CD  . GLN A 1 859  ? 52.044  -17.956 21.943  1.00 74.24  ? 859  GLN A CD  1 
ATOM   6480  O  OE1 . GLN A 1 859  ? 52.129  -17.443 20.828  1.00 74.76  ? 859  GLN A OE1 1 
ATOM   6481  N  NE2 . GLN A 1 859  ? 52.951  -18.794 22.417  1.00 75.28  ? 859  GLN A NE2 1 
ATOM   6482  N  N   . THR A 1 860  ? 49.229  -16.129 25.425  1.00 63.70  ? 860  THR A N   1 
ATOM   6483  C  CA  . THR A 1 860  ? 49.840  -15.294 26.446  1.00 62.24  ? 860  THR A CA  1 
ATOM   6484  C  C   . THR A 1 860  ? 51.349  -15.458 26.320  1.00 63.67  ? 860  THR A C   1 
ATOM   6485  O  O   . THR A 1 860  ? 51.849  -16.575 26.390  1.00 65.99  ? 860  THR A O   1 
ATOM   6486  C  CB  . THR A 1 860  ? 49.353  -15.654 27.856  1.00 61.81  ? 860  THR A CB  1 
ATOM   6487  O  OG1 . THR A 1 860  ? 47.936  -15.809 27.817  1.00 63.60  ? 860  THR A OG1 1 
ATOM   6488  C  CG2 . THR A 1 860  ? 49.681  -14.598 28.887  1.00 59.72  ? 860  THR A CG2 1 
ATOM   6489  N  N   . VAL A 1 861  ? 52.060  -14.349 26.095  1.00 62.62  ? 861  VAL A N   1 
ATOM   6490  C  CA  . VAL A 1 861  ? 53.492  -14.416 25.871  1.00 63.23  ? 861  VAL A CA  1 
ATOM   6491  C  C   . VAL A 1 861  ? 54.209  -14.172 27.191  1.00 63.15  ? 861  VAL A C   1 
ATOM   6492  O  O   . VAL A 1 861  ? 55.078  -14.945 27.574  1.00 65.74  ? 861  VAL A O   1 
ATOM   6493  C  CB  . VAL A 1 861  ? 53.941  -13.428 24.779  1.00 63.13  ? 861  VAL A CB  1 
ATOM   6494  C  CG1 . VAL A 1 861  ? 55.446  -13.478 24.554  1.00 64.88  ? 861  VAL A CG1 1 
ATOM   6495  C  CG2 . VAL A 1 861  ? 53.197  -13.676 23.476  1.00 63.37  ? 861  VAL A CG2 1 
ATOM   6496  N  N   . ALA A 1 862  ? 53.832  -13.089 27.871  1.00 61.36  ? 862  ALA A N   1 
ATOM   6497  C  CA  . ALA A 1 862  ? 54.490  -12.676 29.095  1.00 60.95  ? 862  ALA A CA  1 
ATOM   6498  C  C   . ALA A 1 862  ? 53.463  -12.034 30.018  1.00 59.57  ? 862  ALA A C   1 
ATOM   6499  O  O   . ALA A 1 862  ? 52.425  -11.555 29.571  1.00 58.61  ? 862  ALA A O   1 
ATOM   6500  C  CB  . ALA A 1 862  ? 55.613  -11.719 28.770  1.00 61.28  ? 862  ALA A CB  1 
ATOM   6501  N  N   . GLU A 1 863  ? 53.782  -12.033 31.308  1.00 60.72  ? 863  GLU A N   1 
ATOM   6502  C  CA  . GLU A 1 863  ? 52.919  -11.479 32.329  1.00 61.08  ? 863  GLU A CA  1 
ATOM   6503  C  C   . GLU A 1 863  ? 53.821  -10.827 33.370  1.00 61.21  ? 863  GLU A C   1 
ATOM   6504  O  O   . GLU A 1 863  ? 54.839  -11.400 33.750  1.00 62.97  ? 863  GLU A O   1 
ATOM   6505  C  CB  . GLU A 1 863  ? 51.994  -12.588 32.830  1.00 63.90  ? 863  GLU A CB  1 
ATOM   6506  C  CG  . GLU A 1 863  ? 51.863  -12.704 34.330  1.00 67.39  ? 863  GLU A CG  1 
ATOM   6507  C  CD  . GLU A 1 863  ? 51.259  -14.037 34.729  1.00 71.69  ? 863  GLU A CD  1 
ATOM   6508  O  OE1 . GLU A 1 863  ? 50.902  -14.186 35.907  1.00 74.88  ? 863  GLU A OE1 1 
ATOM   6509  O  OE2 . GLU A 1 863  ? 51.150  -14.931 33.853  1.00 73.72  ? 863  GLU A OE2 1 
ATOM   6510  N  N   . LYS A 1 864  ? 53.472  -9.598  33.763  1.00 59.57  ? 864  LYS A N   1 
ATOM   6511  C  CA  . LYS A 1 864  ? 54.258  -8.823  34.707  1.00 59.67  ? 864  LYS A CA  1 
ATOM   6512  C  C   . LYS A 1 864  ? 53.353  -8.332  35.839  1.00 59.78  ? 864  LYS A C   1 
ATOM   6513  O  O   . LYS A 1 864  ? 52.389  -7.606  35.594  1.00 59.09  ? 864  LYS A O   1 
ATOM   6514  C  CB  . LYS A 1 864  ? 54.928  -7.656  33.972  1.00 57.95  ? 864  LYS A CB  1 
ATOM   6515  C  CG  . LYS A 1 864  ? 55.868  -6.807  34.810  1.00 57.87  ? 864  LYS A CG  1 
ATOM   6516  C  CD  . LYS A 1 864  ? 57.109  -7.542  35.196  1.00 59.35  ? 864  LYS A CD  1 
ATOM   6517  C  CE  . LYS A 1 864  ? 57.878  -6.833  36.281  1.00 60.78  ? 864  LYS A CE  1 
ATOM   6518  N  NZ  . LYS A 1 864  ? 59.235  -7.410  36.420  1.00 63.92  ? 864  LYS A NZ  1 
ATOM   6519  N  N   . GLU A 1 865  ? 53.672  -8.724  37.078  1.00 61.19  ? 865  GLU A N   1 
ATOM   6520  C  CA  . GLU A 1 865  ? 52.898  -8.282  38.227  1.00 61.90  ? 865  GLU A CA  1 
ATOM   6521  C  C   . GLU A 1 865  ? 53.264  -6.836  38.558  1.00 61.92  ? 865  GLU A C   1 
ATOM   6522  O  O   . GLU A 1 865  ? 54.368  -6.388  38.266  1.00 63.01  ? 865  GLU A O   1 
ATOM   6523  C  CB  . GLU A 1 865  ? 53.081  -9.246  39.401  1.00 64.37  ? 865  GLU A CB  1 
ATOM   6524  C  CG  . GLU A 1 865  ? 52.474  -8.761  40.705  1.00 66.49  ? 865  GLU A CG  1 
ATOM   6525  C  CD  . GLU A 1 865  ? 52.676  -9.655  41.922  1.00 70.86  ? 865  GLU A CD  1 
ATOM   6526  O  OE1 . GLU A 1 865  ? 53.497  -10.612 41.856  1.00 72.47  ? 865  GLU A OE1 1 
ATOM   6527  O  OE2 . GLU A 1 865  ? 52.004  -9.396  42.945  1.00 73.08  ? 865  GLU A OE2 1 
ATOM   6528  N  N   . VAL A 1 866  ? 52.307  -6.097  39.132  1.00 62.40  ? 866  VAL A N   1 
ATOM   6529  C  CA  . VAL A 1 866  ? 52.521  -4.726  39.576  1.00 62.27  ? 866  VAL A CA  1 
ATOM   6530  C  C   . VAL A 1 866  ? 51.719  -4.513  40.860  1.00 62.35  ? 866  VAL A C   1 
ATOM   6531  O  O   . VAL A 1 866  ? 50.822  -5.299  41.145  1.00 62.24  ? 866  VAL A O   1 
ATOM   6532  C  CB  . VAL A 1 866  ? 52.145  -3.701  38.480  1.00 61.17  ? 866  VAL A CB  1 
ATOM   6533  C  CG1 . VAL A 1 866  ? 52.652  -4.076  37.090  1.00 60.14  ? 866  VAL A CG1 1 
ATOM   6534  C  CG2 . VAL A 1 866  ? 50.651  -3.430  38.435  1.00 58.44  ? 866  VAL A CG2 1 
ATOM   6535  N  N   . LYS A 1 867  ? 52.035  -3.455  41.621  1.00 63.18  ? 867  LYS A N   1 
ATOM   6536  C  CA  . LYS A 1 867  ? 51.389  -3.230  42.910  1.00 65.24  ? 867  LYS A CA  1 
ATOM   6537  C  C   . LYS A 1 867  ? 50.254  -2.193  42.840  1.00 64.05  ? 867  LYS A C   1 
ATOM   6538  O  O   . LYS A 1 867  ? 50.126  -1.357  43.737  1.00 64.90  ? 867  LYS A O   1 
ATOM   6539  C  CB  . LYS A 1 867  ? 52.425  -2.886  43.986  1.00 67.58  ? 867  LYS A CB  1 
ATOM   6540  C  CG  . LYS A 1 867  ? 53.634  -3.802  44.054  1.00 70.32  ? 867  LYS A CG  1 
ATOM   6541  C  CD  . LYS A 1 867  ? 53.516  -4.901  45.084  1.00 73.65  ? 867  LYS A CD  1 
ATOM   6542  C  CE  . LYS A 1 867  ? 54.875  -5.328  45.605  1.00 76.66  ? 867  LYS A CE  1 
ATOM   6543  N  NZ  . LYS A 1 867  ? 54.856  -6.678  46.218  1.00 78.94  ? 867  LYS A NZ  1 
ATOM   6544  N  N   . GLY A 1 868  ? 49.385  -2.286  41.821  1.00 61.26  ? 868  GLY A N   1 
ATOM   6545  C  CA  . GLY A 1 868  ? 48.283  -1.348  41.667  1.00 59.92  ? 868  GLY A CA  1 
ATOM   6546  C  C   . GLY A 1 868  ? 47.609  -1.452  40.299  1.00 58.69  ? 868  GLY A C   1 
ATOM   6547  O  O   . GLY A 1 868  ? 47.915  -2.348  39.525  1.00 59.59  ? 868  GLY A O   1 
ATOM   6548  N  N   . ALA A 1 869  ? 46.695  -0.517  40.003  1.00 57.59  ? 869  ALA A N   1 
ATOM   6549  C  CA  . ALA A 1 869  ? 45.908  -0.520  38.777  1.00 54.60  ? 869  ALA A CA  1 
ATOM   6550  C  C   . ALA A 1 869  ? 46.717  0.052   37.618  1.00 53.17  ? 869  ALA A C   1 
ATOM   6551  O  O   . ALA A 1 869  ? 47.223  1.164   37.704  1.00 53.36  ? 869  ALA A O   1 
ATOM   6552  C  CB  . ALA A 1 869  ? 44.659  0.295   38.990  1.00 53.95  ? 869  ALA A CB  1 
ATOM   6553  N  N   . VAL A 1 870  ? 46.791  -0.687  36.510  1.00 51.98  ? 870  VAL A N   1 
ATOM   6554  C  CA  . VAL A 1 870  ? 47.494  -0.190  35.337  1.00 51.88  ? 870  VAL A CA  1 
ATOM   6555  C  C   . VAL A 1 870  ? 46.574  0.702   34.499  1.00 51.26  ? 870  VAL A C   1 
ATOM   6556  O  O   . VAL A 1 870  ? 45.979  0.235   33.525  1.00 50.92  ? 870  VAL A O   1 
ATOM   6557  C  CB  . VAL A 1 870  ? 48.089  -1.341  34.505  1.00 51.34  ? 870  VAL A CB  1 
ATOM   6558  C  CG1 . VAL A 1 870  ? 48.899  -0.813  33.331  1.00 50.45  ? 870  VAL A CG1 1 
ATOM   6559  C  CG2 . VAL A 1 870  ? 48.932  -2.260  35.371  1.00 52.11  ? 870  VAL A CG2 1 
ATOM   6560  N  N   . TYR A 1 871  ? 46.513  1.998   34.851  1.00 50.82  ? 871  TYR A N   1 
ATOM   6561  C  CA  . TYR A 1 871  ? 45.496  2.904   34.330  1.00 50.77  ? 871  TYR A CA  1 
ATOM   6562  C  C   . TYR A 1 871  ? 45.707  3.205   32.851  1.00 51.24  ? 871  TYR A C   1 
ATOM   6563  O  O   . TYR A 1 871  ? 44.742  3.452   32.126  1.00 52.25  ? 871  TYR A O   1 
ATOM   6564  C  CB  . TYR A 1 871  ? 45.429  4.224   35.104  1.00 50.57  ? 871  TYR A CB  1 
ATOM   6565  C  CG  . TYR A 1 871  ? 44.778  4.116   36.457  1.00 51.84  ? 871  TYR A CG  1 
ATOM   6566  C  CD1 . TYR A 1 871  ? 43.472  3.672   36.584  1.00 51.88  ? 871  TYR A CD1 1 
ATOM   6567  C  CD2 . TYR A 1 871  ? 45.476  4.438   37.612  1.00 53.27  ? 871  TYR A CD2 1 
ATOM   6568  C  CE1 . TYR A 1 871  ? 42.877  3.547   37.827  1.00 53.56  ? 871  TYR A CE1 1 
ATOM   6569  C  CE2 . TYR A 1 871  ? 44.900  4.315   38.864  1.00 54.95  ? 871  TYR A CE2 1 
ATOM   6570  C  CZ  . TYR A 1 871  ? 43.594  3.868   38.968  1.00 55.90  ? 871  TYR A CZ  1 
ATOM   6571  O  OH  . TYR A 1 871  ? 43.033  3.743   40.204  1.00 59.21  ? 871  TYR A OH  1 
ATOM   6572  N  N   . SER A 1 872  ? 46.967  3.196   32.414  1.00 51.32  ? 872  SER A N   1 
ATOM   6573  C  CA  . SER A 1 872  ? 47.273  3.725   31.100  1.00 52.20  ? 872  SER A CA  1 
ATOM   6574  C  C   . SER A 1 872  ? 48.569  3.126   30.563  1.00 54.57  ? 872  SER A C   1 
ATOM   6575  O  O   . SER A 1 872  ? 49.511  2.889   31.317  1.00 58.42  ? 872  SER A O   1 
ATOM   6576  C  CB  . SER A 1 872  ? 47.354  5.214   31.168  1.00 51.99  ? 872  SER A CB  1 
ATOM   6577  O  OG  . SER A 1 872  ? 47.650  5.731   29.890  1.00 54.49  ? 872  SER A OG  1 
ATOM   6578  N  N   . MET A 1 873  ? 48.616  2.895   29.248  1.00 53.97  ? 873  MET A N   1 
ATOM   6579  C  CA  . MET A 1 873  ? 49.843  2.456   28.606  1.00 54.05  ? 873  MET A CA  1 
ATOM   6580  C  C   . MET A 1 873  ? 49.978  3.112   27.240  1.00 54.38  ? 873  MET A C   1 
ATOM   6581  O  O   . MET A 1 873  ? 48.996  3.331   26.542  1.00 56.14  ? 873  MET A O   1 
ATOM   6582  C  CB  . MET A 1 873  ? 49.840  0.948   28.375  1.00 54.77  ? 873  MET A CB  1 
ATOM   6583  C  CG  . MET A 1 873  ? 50.075  0.146   29.608  1.00 56.08  ? 873  MET A CG  1 
ATOM   6584  S  SD  . MET A 1 873  ? 49.614  -1.535  29.192  1.00 58.54  ? 873  MET A SD  1 
ATOM   6585  C  CE  . MET A 1 873  ? 50.160  -2.328  30.700  1.00 59.49  ? 873  MET A CE  1 
ATOM   6586  N  N   . VAL A 1 874  ? 51.221  3.373   26.847  1.00 55.85  ? 874  VAL A N   1 
ATOM   6587  C  CA  . VAL A 1 874  ? 51.552  3.913   25.541  1.00 56.96  ? 874  VAL A CA  1 
ATOM   6588  C  C   . VAL A 1 874  ? 52.833  3.216   25.106  1.00 58.78  ? 874  VAL A C   1 
ATOM   6589  O  O   . VAL A 1 874  ? 53.672  2.928   25.953  1.00 60.64  ? 874  VAL A O   1 
ATOM   6590  C  CB  . VAL A 1 874  ? 51.776  5.437   25.637  1.00 57.31  ? 874  VAL A CB  1 
ATOM   6591  C  CG1 . VAL A 1 874  ? 52.305  6.039   24.344  1.00 57.41  ? 874  VAL A CG1 1 
ATOM   6592  C  CG2 . VAL A 1 874  ? 50.543  6.187   26.123  1.00 55.88  ? 874  VAL A CG2 1 
ATOM   6593  N  N   . GLU A 1 875  ? 52.976  2.935   23.805  1.00 60.47  ? 875  GLU A N   1 
ATOM   6594  C  CA  . GLU A 1 875  ? 54.269  2.511   23.286  1.00 63.23  ? 875  GLU A CA  1 
ATOM   6595  C  C   . GLU A 1 875  ? 55.168  3.743   23.197  1.00 64.20  ? 875  GLU A C   1 
ATOM   6596  O  O   . GLU A 1 875  ? 54.715  4.795   22.761  1.00 65.43  ? 875  GLU A O   1 
ATOM   6597  C  CB  . GLU A 1 875  ? 54.110  1.796   21.943  1.00 65.52  ? 875  GLU A CB  1 
ATOM   6598  C  CG  . GLU A 1 875  ? 55.425  1.367   21.309  1.00 70.64  ? 875  GLU A CG  1 
ATOM   6599  C  CD  . GLU A 1 875  ? 56.014  2.407   20.368  1.00 74.45  ? 875  GLU A CD  1 
ATOM   6600  O  OE1 . GLU A 1 875  ? 55.230  3.262   19.913  1.00 75.10  ? 875  GLU A OE1 1 
ATOM   6601  O  OE2 . GLU A 1 875  ? 57.246  2.365   20.087  1.00 76.16  ? 875  GLU A OE2 1 
ATOM   6602  N  N   . PHE A 1 876  ? 56.433  3.614   23.621  1.00 64.05  ? 876  PHE A N   1 
ATOM   6603  C  CA  . PHE A 1 876  ? 57.304  4.773   23.740  1.00 64.25  ? 876  PHE A CA  1 
ATOM   6604  C  C   . PHE A 1 876  ? 58.706  4.447   23.232  1.00 66.19  ? 876  PHE A C   1 
ATOM   6605  O  O   . PHE A 1 876  ? 59.564  4.020   24.000  1.00 67.22  ? 876  PHE A O   1 
ATOM   6606  C  CB  . PHE A 1 876  ? 57.352  5.260   25.191  1.00 62.81  ? 876  PHE A CB  1 
ATOM   6607  C  CG  . PHE A 1 876  ? 58.100  6.554   25.395  1.00 63.22  ? 876  PHE A CG  1 
ATOM   6608  C  CD1 . PHE A 1 876  ? 57.618  7.734   24.858  1.00 62.87  ? 876  PHE A CD1 1 
ATOM   6609  C  CD2 . PHE A 1 876  ? 59.284  6.597   26.118  1.00 64.07  ? 876  PHE A CD2 1 
ATOM   6610  C  CE1 . PHE A 1 876  ? 58.298  8.925   25.050  1.00 64.06  ? 876  PHE A CE1 1 
ATOM   6611  C  CE2 . PHE A 1 876  ? 59.969  7.788   26.304  1.00 64.43  ? 876  PHE A CE2 1 
ATOM   6612  C  CZ  . PHE A 1 876  ? 59.473  8.950   25.767  1.00 64.89  ? 876  PHE A CZ  1 
ATOM   6613  N  N   . ASN A 1 877  ? 58.927  4.686   21.935  1.00 67.09  ? 877  ASN A N   1 
ATOM   6614  C  CA  . ASN A 1 877  ? 60.218  4.479   21.294  1.00 69.00  ? 877  ASN A CA  1 
ATOM   6615  C  C   . ASN A 1 877  ? 60.676  3.041   21.516  1.00 69.05  ? 877  ASN A C   1 
ATOM   6616  O  O   . ASN A 1 877  ? 61.808  2.808   21.940  1.00 71.12  ? 877  ASN A O   1 
ATOM   6617  C  CB  . ASN A 1 877  ? 61.284  5.460   21.785  1.00 70.32  ? 877  ASN A CB  1 
ATOM   6618  C  CG  . ASN A 1 877  ? 60.798  6.890   21.820  1.00 70.61  ? 877  ASN A CG  1 
ATOM   6619  O  OD1 . ASN A 1 877  ? 60.724  7.497   22.888  1.00 70.91  ? 877  ASN A OD1 1 
ATOM   6620  N  ND2 . ASN A 1 877  ? 60.453  7.427   20.661  1.00 70.81  ? 877  ASN A ND2 1 
ATOM   6621  N  N   . GLY A 1 878  ? 59.767  2.093   21.255  1.00 66.72  ? 878  GLY A N   1 
ATOM   6622  C  CA  . GLY A 1 878  ? 60.070  0.672   21.326  1.00 65.13  ? 878  GLY A CA  1 
ATOM   6623  C  C   . GLY A 1 878  ? 60.067  0.130   22.754  1.00 63.00  ? 878  GLY A C   1 
ATOM   6624  O  O   . GLY A 1 878  ? 60.493  -0.999  22.976  1.00 62.73  ? 878  GLY A O   1 
ATOM   6625  N  N   . LYS A 1 879  ? 59.586  0.942   23.704  1.00 61.76  ? 879  LYS A N   1 
ATOM   6626  C  CA  . LYS A 1 879  ? 59.473  0.573   25.107  1.00 61.09  ? 879  LYS A CA  1 
ATOM   6627  C  C   . LYS A 1 879  ? 58.018  0.755   25.533  1.00 59.62  ? 879  LYS A C   1 
ATOM   6628  O  O   . LYS A 1 879  ? 57.224  1.325   24.785  1.00 59.38  ? 879  LYS A O   1 
ATOM   6629  C  CB  . LYS A 1 879  ? 60.364  1.479   25.960  1.00 61.82  ? 879  LYS A CB  1 
ATOM   6630  C  CG  . LYS A 1 879  ? 61.841  1.460   25.605  1.00 64.44  ? 879  LYS A CG  1 
ATOM   6631  C  CD  . LYS A 1 879  ? 62.658  2.333   26.499  1.00 65.12  ? 879  LYS A CD  1 
ATOM   6632  C  CE  . LYS A 1 879  ? 64.079  2.436   26.008  1.00 68.22  ? 879  LYS A CE  1 
ATOM   6633  N  NZ  . LYS A 1 879  ? 64.656  3.729   26.428  1.00 69.75  ? 879  LYS A NZ  1 
ATOM   6634  N  N   . LEU A 1 880  ? 57.677  0.291   26.742  1.00 58.32  ? 880  LEU A N   1 
ATOM   6635  C  CA  . LEU A 1 880  ? 56.307  0.361   27.219  1.00 56.35  ? 880  LEU A CA  1 
ATOM   6636  C  C   . LEU A 1 880  ? 56.202  1.303   28.411  1.00 57.22  ? 880  LEU A C   1 
ATOM   6637  O  O   . LEU A 1 880  ? 56.655  0.973   29.503  1.00 60.34  ? 880  LEU A O   1 
ATOM   6638  C  CB  . LEU A 1 880  ? 55.857  -1.042  27.627  1.00 55.46  ? 880  LEU A CB  1 
ATOM   6639  C  CG  . LEU A 1 880  ? 54.408  -1.153  28.103  1.00 53.68  ? 880  LEU A CG  1 
ATOM   6640  C  CD1 . LEU A 1 880  ? 53.435  -0.922  26.957  1.00 52.18  ? 880  LEU A CD1 1 
ATOM   6641  C  CD2 . LEU A 1 880  ? 54.164  -2.512  28.736  1.00 53.38  ? 880  LEU A CD2 1 
ATOM   6642  N  N   . LEU A 1 881  ? 55.555  2.451   28.201  1.00 56.21  ? 881  LEU A N   1 
ATOM   6643  C  CA  . LEU A 1 881  ? 55.298  3.407   29.262  1.00 55.69  ? 881  LEU A CA  1 
ATOM   6644  C  C   . LEU A 1 881  ? 53.952  3.064   29.904  1.00 54.78  ? 881  LEU A C   1 
ATOM   6645  O  O   . LEU A 1 881  ? 52.968  2.885   29.197  1.00 54.73  ? 881  LEU A O   1 
ATOM   6646  C  CB  . LEU A 1 881  ? 55.288  4.795   28.612  1.00 55.50  ? 881  LEU A CB  1 
ATOM   6647  C  CG  . LEU A 1 881  ? 55.284  5.999   29.554  1.00 56.22  ? 881  LEU A CG  1 
ATOM   6648  C  CD1 . LEU A 1 881  ? 56.585  6.101   30.339  1.00 57.73  ? 881  LEU A CD1 1 
ATOM   6649  C  CD2 . LEU A 1 881  ? 55.040  7.278   28.775  1.00 55.78  ? 881  LEU A CD2 1 
ATOM   6650  N  N   . ALA A 1 882  ? 53.908  2.956   31.238  1.00 53.98  ? 882  ALA A N   1 
ATOM   6651  C  CA  . ALA A 1 882  ? 52.683  2.571   31.914  1.00 52.32  ? 882  ALA A CA  1 
ATOM   6652  C  C   . ALA A 1 882  ? 52.467  3.448   33.144  1.00 54.05  ? 882  ALA A C   1 
ATOM   6653  O  O   . ALA A 1 882  ? 53.428  3.934   33.740  1.00 54.80  ? 882  ALA A O   1 
ATOM   6654  C  CB  . ALA A 1 882  ? 52.751  1.113   32.281  1.00 51.58  ? 882  ALA A CB  1 
ATOM   6655  N  N   . SER A 1 883  ? 51.195  3.653   33.513  1.00 53.78  ? 883  SER A N   1 
ATOM   6656  C  CA  . SER A 1 883  ? 50.887  4.307   34.774  1.00 54.71  ? 883  SER A CA  1 
ATOM   6657  C  C   . SER A 1 883  ? 50.175  3.327   35.696  1.00 54.29  ? 883  SER A C   1 
ATOM   6658  O  O   . SER A 1 883  ? 49.206  2.689   35.299  1.00 54.72  ? 883  SER A O   1 
ATOM   6659  C  CB  . SER A 1 883  ? 50.102  5.575   34.592  1.00 55.29  ? 883  SER A CB  1 
ATOM   6660  O  OG  . SER A 1 883  ? 48.886  5.324   33.912  1.00 56.06  ? 883  SER A OG  1 
ATOM   6661  N  N   . ILE A 1 884  ? 50.700  3.216   36.917  1.00 54.32  ? 884  ILE A N   1 
ATOM   6662  C  CA  . ILE A 1 884  ? 50.211  2.313   37.942  1.00 53.90  ? 884  ILE A CA  1 
ATOM   6663  C  C   . ILE A 1 884  ? 49.970  3.163   39.179  1.00 55.05  ? 884  ILE A C   1 
ATOM   6664  O  O   . ILE A 1 884  ? 50.922  3.649   39.772  1.00 56.86  ? 884  ILE A O   1 
ATOM   6665  C  CB  . ILE A 1 884  ? 51.262  1.225   38.247  1.00 54.88  ? 884  ILE A CB  1 
ATOM   6666  C  CG1 . ILE A 1 884  ? 51.726  0.471   36.998  1.00 54.37  ? 884  ILE A CG1 1 
ATOM   6667  C  CG2 . ILE A 1 884  ? 50.786  0.279   39.337  1.00 55.37  ? 884  ILE A CG2 1 
ATOM   6668  C  CD1 . ILE A 1 884  ? 52.973  1.040   36.362  1.00 54.40  ? 884  ILE A CD1 1 
ATOM   6669  N  N   . ASN A 1 885  ? 48.705  3.329   39.569  1.00 55.66  ? 885  ASN A N   1 
ATOM   6670  C  CA  . ASN A 1 885  ? 48.331  4.201   40.674  1.00 57.29  ? 885  ASN A CA  1 
ATOM   6671  C  C   . ASN A 1 885  ? 48.898  5.607   40.454  1.00 57.85  ? 885  ASN A C   1 
ATOM   6672  O  O   . ASN A 1 885  ? 48.518  6.291   39.504  1.00 57.04  ? 885  ASN A O   1 
ATOM   6673  C  CB  . ASN A 1 885  ? 48.591  3.542   42.033  1.00 59.46  ? 885  ASN A CB  1 
ATOM   6674  C  CG  . ASN A 1 885  ? 47.690  2.348   42.274  1.00 60.32  ? 885  ASN A CG  1 
ATOM   6675  O  OD1 . ASN A 1 885  ? 46.940  1.935   41.386  1.00 60.17  ? 885  ASN A OD1 1 
ATOM   6676  N  ND2 . ASN A 1 885  ? 47.744  1.792   43.475  1.00 60.93  ? 885  ASN A ND2 1 
ATOM   6677  N  N   . SER A 1 886  ? 49.809  6.033   41.334  1.00 59.70  ? 886  SER A N   1 
ATOM   6678  C  CA  . SER A 1 886  ? 50.365  7.376   41.284  1.00 59.97  ? 886  SER A CA  1 
ATOM   6679  C  C   . SER A 1 886  ? 51.765  7.361   40.662  1.00 61.02  ? 886  SER A C   1 
ATOM   6680  O  O   . SER A 1 886  ? 52.500  8.349   40.757  1.00 63.04  ? 886  SER A O   1 
ATOM   6681  C  CB  . SER A 1 886  ? 50.359  7.996   42.665  1.00 61.51  ? 886  SER A CB  1 
ATOM   6682  O  OG  . SER A 1 886  ? 50.743  7.054   43.659  1.00 62.45  ? 886  SER A OG  1 
ATOM   6683  N  N   . THR A 1 887  ? 52.130  6.232   40.031  1.00 59.12  ? 887  THR A N   1 
ATOM   6684  C  CA  . THR A 1 887  ? 53.465  6.019   39.493  1.00 58.57  ? 887  THR A CA  1 
ATOM   6685  C  C   . THR A 1 887  ? 53.402  5.923   37.977  1.00 56.87  ? 887  THR A C   1 
ATOM   6686  O  O   . THR A 1 887  ? 52.558  5.218   37.434  1.00 55.47  ? 887  THR A O   1 
ATOM   6687  C  CB  . THR A 1 887  ? 54.072  4.700   39.982  1.00 59.38  ? 887  THR A CB  1 
ATOM   6688  O  OG1 . THR A 1 887  ? 54.122  4.753   41.408  1.00 61.79  ? 887  THR A OG1 1 
ATOM   6689  C  CG2 . THR A 1 887  ? 55.458  4.442   39.429  1.00 60.08  ? 887  THR A CG2 1 
ATOM   6690  N  N   . VAL A 1 888  ? 54.325  6.613   37.304  1.00 57.68  ? 888  VAL A N   1 
ATOM   6691  C  CA  . VAL A 1 888  ? 54.514  6.404   35.877  1.00 57.52  ? 888  VAL A CA  1 
ATOM   6692  C  C   . VAL A 1 888  ? 55.834  5.658   35.681  1.00 58.67  ? 888  VAL A C   1 
ATOM   6693  O  O   . VAL A 1 888  ? 56.845  6.069   36.233  1.00 59.83  ? 888  VAL A O   1 
ATOM   6694  C  CB  . VAL A 1 888  ? 54.472  7.726   35.087  1.00 57.55  ? 888  VAL A CB  1 
ATOM   6695  C  CG1 . VAL A 1 888  ? 54.514  7.484   33.587  1.00 57.01  ? 888  VAL A CG1 1 
ATOM   6696  C  CG2 . VAL A 1 888  ? 53.260  8.574   35.445  1.00 56.54  ? 888  VAL A CG2 1 
ATOM   6697  N  N   . ARG A 1 889  ? 55.799  4.563   34.903  1.00 58.39  ? 889  ARG A N   1 
ATOM   6698  C  CA  . ARG A 1 889  ? 56.886  3.600   34.786  1.00 58.63  ? 889  ARG A CA  1 
ATOM   6699  C  C   . ARG A 1 889  ? 57.199  3.315   33.315  1.00 59.29  ? 889  ARG A C   1 
ATOM   6700  O  O   . ARG A 1 889  ? 56.294  3.202   32.487  1.00 57.92  ? 889  ARG A O   1 
ATOM   6701  C  CB  . ARG A 1 889  ? 56.499  2.276   35.452  1.00 57.23  ? 889  ARG A CB  1 
ATOM   6702  C  CG  . ARG A 1 889  ? 57.675  1.571   36.102  1.00 58.44  ? 889  ARG A CG  1 
ATOM   6703  C  CD  . ARG A 1 889  ? 57.563  0.125   36.534  1.00 58.48  ? 889  ARG A CD  1 
ATOM   6704  N  NE  . ARG A 1 889  ? 56.563  -0.305  37.507  1.00 57.92  ? 889  ARG A NE  1 
ATOM   6705  C  CZ  . ARG A 1 889  ? 56.504  0.022   38.799  1.00 58.05  ? 889  ARG A CZ  1 
ATOM   6706  N  NH1 . ARG A 1 889  ? 57.371  0.866   39.333  1.00 59.05  ? 889  ARG A NH1 1 
ATOM   6707  N  NH2 . ARG A 1 889  ? 55.542  -0.484  39.552  1.00 57.68  ? 889  ARG A NH2 1 
ATOM   6708  N  N   . LEU A 1 890  ? 58.495  3.160   33.010  1.00 61.00  ? 890  LEU A N   1 
ATOM   6709  C  CA  . LEU A 1 890  ? 58.943  2.787   31.676  1.00 61.09  ? 890  LEU A CA  1 
ATOM   6710  C  C   . LEU A 1 890  ? 59.576  1.396   31.708  1.00 62.07  ? 890  LEU A C   1 
ATOM   6711  O  O   . LEU A 1 890  ? 60.510  1.157   32.473  1.00 64.16  ? 890  LEU A O   1 
ATOM   6712  C  CB  . LEU A 1 890  ? 59.948  3.837   31.195  1.00 62.05  ? 890  LEU A CB  1 
ATOM   6713  C  CG  . LEU A 1 890  ? 60.406  3.699   29.746  1.00 62.45  ? 890  LEU A CG  1 
ATOM   6714  C  CD1 . LEU A 1 890  ? 59.282  4.052   28.782  1.00 60.64  ? 890  LEU A CD1 1 
ATOM   6715  C  CD2 . LEU A 1 890  ? 61.622  4.572   29.490  1.00 64.22  ? 890  LEU A CD2 1 
ATOM   6716  N  N   . TYR A 1 891  ? 59.062  0.486   30.870  1.00 60.76  ? 891  TYR A N   1 
ATOM   6717  C  CA  . TYR A 1 891  ? 59.614  -0.857  30.784  1.00 62.48  ? 891  TYR A CA  1 
ATOM   6718  C  C   . TYR A 1 891  ? 60.324  -1.051  29.449  1.00 65.17  ? 891  TYR A C   1 
ATOM   6719  O  O   . TYR A 1 891  ? 59.848  -0.582  28.413  1.00 65.19  ? 891  TYR A O   1 
ATOM   6720  C  CB  . TYR A 1 891  ? 58.533  -1.936  30.856  1.00 59.99  ? 891  TYR A CB  1 
ATOM   6721  C  CG  . TYR A 1 891  ? 57.735  -1.986  32.129  1.00 59.07  ? 891  TYR A CG  1 
ATOM   6722  C  CD1 . TYR A 1 891  ? 58.243  -2.583  33.273  1.00 60.21  ? 891  TYR A CD1 1 
ATOM   6723  C  CD2 . TYR A 1 891  ? 56.455  -1.456  32.179  1.00 57.80  ? 891  TYR A CD2 1 
ATOM   6724  C  CE1 . TYR A 1 891  ? 57.505  -2.639  34.446  1.00 60.42  ? 891  TYR A CE1 1 
ATOM   6725  C  CE2 . TYR A 1 891  ? 55.702  -1.506  33.341  1.00 57.53  ? 891  TYR A CE2 1 
ATOM   6726  C  CZ  . TYR A 1 891  ? 56.227  -2.101  34.478  1.00 59.30  ? 891  TYR A CZ  1 
ATOM   6727  O  OH  . TYR A 1 891  ? 55.503  -2.171  35.636  1.00 58.97  ? 891  TYR A OH  1 
ATOM   6728  N  N   . GLU A 1 892  ? 61.459  -1.763  29.502  1.00 67.76  ? 892  GLU A N   1 
ATOM   6729  C  CA  . GLU A 1 892  ? 62.118  -2.303  28.325  1.00 68.52  ? 892  GLU A CA  1 
ATOM   6730  C  C   . GLU A 1 892  ? 61.683  -3.756  28.155  1.00 66.73  ? 892  GLU A C   1 
ATOM   6731  O  O   . GLU A 1 892  ? 61.337  -4.430  29.126  1.00 65.26  ? 892  GLU A O   1 
ATOM   6732  C  CB  . GLU A 1 892  ? 63.638  -2.194  28.462  1.00 72.31  ? 892  GLU A CB  1 
ATOM   6733  C  CG  . GLU A 1 892  ? 64.150  -0.777  28.305  1.00 75.00  ? 892  GLU A CG  1 
ATOM   6734  C  CD  . GLU A 1 892  ? 65.619  -0.611  28.647  1.00 80.60  ? 892  GLU A CD  1 
ATOM   6735  O  OE1 . GLU A 1 892  ? 66.015  -0.977  29.785  1.00 82.17  ? 892  GLU A OE1 1 
ATOM   6736  O  OE2 . GLU A 1 892  ? 66.363  -0.114  27.775  1.00 84.14  ? 892  GLU A OE2 1 
ATOM   6737  N  N   . TRP A 1 893  ? 61.721  -4.228  26.906  1.00 65.81  ? 893  TRP A N   1 
ATOM   6738  C  CA  . TRP A 1 893  ? 61.299  -5.577  26.567  1.00 64.59  ? 893  TRP A CA  1 
ATOM   6739  C  C   . TRP A 1 893  ? 62.513  -6.416  26.170  1.00 66.65  ? 893  TRP A C   1 
ATOM   6740  O  O   . TRP A 1 893  ? 63.092  -6.222  25.103  1.00 67.86  ? 893  TRP A O   1 
ATOM   6741  C  CB  . TRP A 1 893  ? 60.275  -5.475  25.441  1.00 62.52  ? 893  TRP A CB  1 
ATOM   6742  C  CG  . TRP A 1 893  ? 59.811  -6.767  24.856  1.00 62.29  ? 893  TRP A CG  1 
ATOM   6743  C  CD1 . TRP A 1 893  ? 60.093  -7.229  23.606  1.00 63.07  ? 893  TRP A CD1 1 
ATOM   6744  C  CD2 . TRP A 1 893  ? 58.925  -7.730  25.459  1.00 61.67  ? 893  TRP A CD2 1 
ATOM   6745  N  NE1 . TRP A 1 893  ? 59.466  -8.426  23.396  1.00 63.31  ? 893  TRP A NE1 1 
ATOM   6746  C  CE2 . TRP A 1 893  ? 58.730  -8.754  24.506  1.00 62.14  ? 893  TRP A CE2 1 
ATOM   6747  C  CE3 . TRP A 1 893  ? 58.284  -7.839  26.702  1.00 60.73  ? 893  TRP A CE3 1 
ATOM   6748  C  CZ2 . TRP A 1 893  ? 57.923  -9.864  24.760  1.00 61.35  ? 893  TRP A CZ2 1 
ATOM   6749  C  CZ3 . TRP A 1 893  ? 57.493  -8.940  26.955  1.00 60.10  ? 893  TRP A CZ3 1 
ATOM   6750  C  CH2 . TRP A 1 893  ? 57.315  -9.937  25.993  1.00 60.46  ? 893  TRP A CH2 1 
ATOM   6751  N  N   . THR A 1 894  ? 62.885  -7.363  27.035  1.00 66.70  ? 894  THR A N   1 
ATOM   6752  C  CA  . THR A 1 894  ? 64.191  -7.993  26.944  1.00 69.38  ? 894  THR A CA  1 
ATOM   6753  C  C   . THR A 1 894  ? 64.177  -9.080  25.870  1.00 70.56  ? 894  THR A C   1 
ATOM   6754  O  O   . THR A 1 894  ? 63.132  -9.370  25.297  1.00 69.81  ? 894  THR A O   1 
ATOM   6755  C  CB  . THR A 1 894  ? 64.683  -8.452  28.324  1.00 69.95  ? 894  THR A CB  1 
ATOM   6756  O  OG1 . THR A 1 894  ? 63.920  -9.593  28.711  1.00 70.37  ? 894  THR A OG1 1 
ATOM   6757  C  CG2 . THR A 1 894  ? 64.575  -7.378  29.384  1.00 68.65  ? 894  THR A CG2 1 
ATOM   6758  N  N   . THR A 1 895  ? 65.359  -9.646  25.587  1.00 73.51  ? 895  THR A N   1 
ATOM   6759  C  CA  . THR A 1 895  ? 65.531  -10.768 24.673  1.00 74.77  ? 895  THR A CA  1 
ATOM   6760  C  C   . THR A 1 895  ? 64.720  -11.961 25.177  1.00 73.96  ? 895  THR A C   1 
ATOM   6761  O  O   . THR A 1 895  ? 64.269  -12.804 24.404  1.00 73.46  ? 895  THR A O   1 
ATOM   6762  C  CB  . THR A 1 895  ? 67.015  -11.149 24.550  1.00 76.83  ? 895  THR A CB  1 
ATOM   6763  O  OG1 . THR A 1 895  ? 67.714  -9.977  24.137  1.00 78.93  ? 895  THR A OG1 1 
ATOM   6764  C  CG2 . THR A 1 895  ? 67.273  -12.269 23.568  1.00 76.95  ? 895  THR A CG2 1 
ATOM   6765  N  N   . GLU A 1 896  ? 64.528  -11.986 26.497  1.00 74.01  ? 896  GLU A N   1 
ATOM   6766  C  CA  . GLU A 1 896  ? 63.955  -13.107 27.216  1.00 75.20  ? 896  GLU A CA  1 
ATOM   6767  C  C   . GLU A 1 896  ? 62.440  -12.933 27.336  1.00 74.77  ? 896  GLU A C   1 
ATOM   6768  O  O   . GLU A 1 896  ? 61.804  -13.595 28.161  1.00 75.55  ? 896  GLU A O   1 
ATOM   6769  C  CB  . GLU A 1 896  ? 64.588  -13.163 28.607  1.00 75.58  ? 896  GLU A CB  1 
ATOM   6770  C  CG  . GLU A 1 896  ? 66.083  -13.445 28.595  1.00 79.32  ? 896  GLU A CG  1 
ATOM   6771  C  CD  . GLU A 1 896  ? 67.052  -12.278 28.440  1.00 80.05  ? 896  GLU A CD  1 
ATOM   6772  O  OE1 . GLU A 1 896  ? 66.628  -11.115 28.599  1.00 79.10  ? 896  GLU A OE1 1 
ATOM   6773  O  OE2 . GLU A 1 896  ? 68.244  -12.536 28.171  1.00 81.57  ? 896  GLU A OE2 1 
ATOM   6774  N  N   . LYS A 1 897  ? 61.870  -12.039 26.510  1.00 73.22  ? 897  LYS A N   1 
ATOM   6775  C  CA  . LYS A 1 897  ? 60.437  -11.802 26.439  1.00 69.78  ? 897  LYS A CA  1 
ATOM   6776  C  C   . LYS A 1 897  ? 59.893  -11.473 27.829  1.00 69.66  ? 897  LYS A C   1 
ATOM   6777  O  O   . LYS A 1 897  ? 58.943  -12.099 28.300  1.00 68.38  ? 897  LYS A O   1 
ATOM   6778  C  CB  . LYS A 1 897  ? 59.697  -13.021 25.880  1.00 68.58  ? 897  LYS A CB  1 
ATOM   6779  C  CG  . LYS A 1 897  ? 60.299  -13.669 24.646  1.00 69.96  ? 897  LYS A CG  1 
ATOM   6780  C  CD  . LYS A 1 897  ? 60.107  -12.880 23.382  1.00 69.51  ? 897  LYS A CD  1 
ATOM   6781  C  CE  . LYS A 1 897  ? 59.968  -13.792 22.183  1.00 71.41  ? 897  LYS A CE  1 
ATOM   6782  N  NZ  . LYS A 1 897  ? 60.407  -13.142 20.924  1.00 73.01  ? 897  LYS A NZ  1 
ATOM   6783  N  N   . GLU A 1 898  ? 60.512  -10.495 28.493  1.00 70.86  ? 898  GLU A N   1 
ATOM   6784  C  CA  . GLU A 1 898  ? 59.988  -10.025 29.763  1.00 71.37  ? 898  GLU A CA  1 
ATOM   6785  C  C   . GLU A 1 898  ? 60.062  -8.507  29.821  1.00 70.31  ? 898  GLU A C   1 
ATOM   6786  O  O   . GLU A 1 898  ? 60.884  -7.892  29.147  1.00 72.50  ? 898  GLU A O   1 
ATOM   6787  C  CB  . GLU A 1 898  ? 60.761  -10.622 30.934  1.00 74.36  ? 898  GLU A CB  1 
ATOM   6788  C  CG  . GLU A 1 898  ? 60.235  -11.979 31.347  1.00 79.26  ? 898  GLU A CG  1 
ATOM   6789  C  CD  . GLU A 1 898  ? 61.182  -12.807 32.205  1.00 84.60  ? 898  GLU A CD  1 
ATOM   6790  O  OE1 . GLU A 1 898  ? 62.199  -12.255 32.705  1.00 84.25  ? 898  GLU A OE1 1 
ATOM   6791  O  OE2 . GLU A 1 898  ? 60.904  -14.017 32.367  1.00 89.31  ? 898  GLU A OE2 1 
ATOM   6792  N  N   . LEU A 1 899  ? 59.190  -7.920  30.641  1.00 66.99  ? 899  LEU A N   1 
ATOM   6793  C  CA  . LEU A 1 899  ? 59.230  -6.487  30.851  1.00 65.48  ? 899  LEU A CA  1 
ATOM   6794  C  C   . LEU A 1 899  ? 60.117  -6.194  32.057  1.00 66.72  ? 899  LEU A C   1 
ATOM   6795  O  O   . LEU A 1 899  ? 59.910  -6.751  33.134  1.00 67.27  ? 899  LEU A O   1 
ATOM   6796  C  CB  . LEU A 1 899  ? 57.802  -5.968  31.046  1.00 61.71  ? 899  LEU A CB  1 
ATOM   6797  C  CG  . LEU A 1 899  ? 56.911  -6.008  29.808  1.00 58.83  ? 899  LEU A CG  1 
ATOM   6798  C  CD1 . LEU A 1 899  ? 55.466  -5.762  30.191  1.00 57.32  ? 899  LEU A CD1 1 
ATOM   6799  C  CD2 . LEU A 1 899  ? 57.346  -4.983  28.778  1.00 58.64  ? 899  LEU A CD2 1 
ATOM   6800  N  N   . ARG A 1 900  ? 61.105  -5.316  31.855  1.00 67.73  ? 900  ARG A N   1 
ATOM   6801  C  CA  . ARG A 1 900  ? 62.041  -4.952  32.904  1.00 69.44  ? 900  ARG A CA  1 
ATOM   6802  C  C   . ARG A 1 900  ? 61.955  -3.448  33.131  1.00 67.73  ? 900  ARG A C   1 
ATOM   6803  O  O   . ARG A 1 900  ? 62.064  -2.681  32.178  1.00 67.27  ? 900  ARG A O   1 
ATOM   6804  C  CB  . ARG A 1 900  ? 63.447  -5.380  32.481  1.00 73.93  ? 900  ARG A CB  1 
ATOM   6805  C  CG  . ARG A 1 900  ? 64.558  -4.754  33.308  1.00 79.62  ? 900  ARG A CG  1 
ATOM   6806  C  CD  . ARG A 1 900  ? 65.927  -5.037  32.717  1.00 86.23  ? 900  ARG A CD  1 
ATOM   6807  N  NE  . ARG A 1 900  ? 66.190  -4.380  31.437  1.00 88.96  ? 900  ARG A NE  1 
ATOM   6808  C  CZ  . ARG A 1 900  ? 67.252  -4.626  30.666  1.00 90.30  ? 900  ARG A CZ  1 
ATOM   6809  N  NH1 . ARG A 1 900  ? 68.151  -5.520  31.041  1.00 90.02  ? 900  ARG A NH1 1 
ATOM   6810  N  NH2 . ARG A 1 900  ? 67.409  -3.981  29.522  1.00 90.71  ? 900  ARG A NH2 1 
ATOM   6811  N  N   . THR A 1 901  ? 61.755  -3.041  34.392  1.00 66.87  ? 901  THR A N   1 
ATOM   6812  C  CA  . THR A 1 901  ? 61.600  -1.635  34.731  1.00 66.33  ? 901  THR A CA  1 
ATOM   6813  C  C   . THR A 1 901  ? 62.899  -0.895  34.441  1.00 67.94  ? 901  THR A C   1 
ATOM   6814  O  O   . THR A 1 901  ? 63.974  -1.351  34.824  1.00 69.93  ? 901  THR A O   1 
ATOM   6815  C  CB  . THR A 1 901  ? 61.257  -1.439  36.213  1.00 67.08  ? 901  THR A CB  1 
ATOM   6816  O  OG1 . THR A 1 901  ? 60.044  -2.127  36.516  1.00 67.19  ? 901  THR A OG1 1 
ATOM   6817  C  CG2 . THR A 1 901  ? 61.109  0.016   36.607  1.00 67.10  ? 901  THR A CG2 1 
ATOM   6818  N  N   . GLU A 1 902  ? 62.781  0.255   33.773  1.00 67.36  ? 902  GLU A N   1 
ATOM   6819  C  CA  . GLU A 1 902  ? 63.941  1.092   33.528  1.00 68.86  ? 902  GLU A CA  1 
ATOM   6820  C  C   . GLU A 1 902  ? 63.949  2.246   34.525  1.00 69.02  ? 902  GLU A C   1 
ATOM   6821  O  O   . GLU A 1 902  ? 64.928  2.407   35.244  1.00 71.72  ? 902  GLU A O   1 
ATOM   6822  C  CB  . GLU A 1 902  ? 63.995  1.531   32.067  1.00 69.35  ? 902  GLU A CB  1 
ATOM   6823  C  CG  . GLU A 1 902  ? 65.164  2.439   31.758  1.00 71.94  ? 902  GLU A CG  1 
ATOM   6824  C  CD  . GLU A 1 902  ? 65.260  2.912   30.317  1.00 73.50  ? 902  GLU A CD  1 
ATOM   6825  O  OE1 . GLU A 1 902  ? 64.477  2.444   29.464  1.00 72.69  ? 902  GLU A OE1 1 
ATOM   6826  O  OE2 . GLU A 1 902  ? 66.126  3.757   30.052  1.00 77.72  ? 902  GLU A OE2 1 
ATOM   6827  N  N   . CYS A 1 903  ? 62.846  3.007   34.595  1.00 66.78  ? 903  CYS A N   1 
ATOM   6828  C  CA  . CYS A 1 903  ? 62.773  4.165   35.474  1.00 67.53  ? 903  CYS A CA  1 
ATOM   6829  C  C   . CYS A 1 903  ? 61.334  4.471   35.875  1.00 66.29  ? 903  CYS A C   1 
ATOM   6830  O  O   . CYS A 1 903  ? 60.392  4.040   35.220  1.00 64.79  ? 903  CYS A O   1 
ATOM   6831  C  CB  . CYS A 1 903  ? 63.369  5.395   34.806  1.00 68.58  ? 903  CYS A CB  1 
ATOM   6832  S  SG  . CYS A 1 903  ? 62.794  5.635   33.107  1.00 67.19  ? 903  CYS A SG  1 
ATOM   6833  N  N   . ASN A 1 904  ? 61.195  5.265   36.941  1.00 68.14  ? 904  ASN A N   1 
ATOM   6834  C  CA  . ASN A 1 904  ? 59.913  5.595   37.540  1.00 67.25  ? 904  ASN A CA  1 
ATOM   6835  C  C   . ASN A 1 904  ? 59.806  7.098   37.779  1.00 68.07  ? 904  ASN A C   1 
ATOM   6836  O  O   . ASN A 1 904  ? 60.814  7.786   37.934  1.00 71.96  ? 904  ASN A O   1 
ATOM   6837  C  CB  . ASN A 1 904  ? 59.738  4.896   38.887  1.00 68.60  ? 904  ASN A CB  1 
ATOM   6838  C  CG  . ASN A 1 904  ? 59.743  3.391   38.766  1.00 69.63  ? 904  ASN A CG  1 
ATOM   6839  O  OD1 . ASN A 1 904  ? 60.517  2.707   39.425  1.00 73.64  ? 904  ASN A OD1 1 
ATOM   6840  N  ND2 . ASN A 1 904  ? 58.881  2.864   37.923  1.00 69.07  ? 904  ASN A ND2 1 
ATOM   6841  N  N   . HIS A 1 905  ? 58.563  7.581   37.828  1.00 65.88  ? 905  HIS A N   1 
ATOM   6842  C  CA  . HIS A 1 905  ? 58.222  8.907   38.310  1.00 65.93  ? 905  HIS A CA  1 
ATOM   6843  C  C   . HIS A 1 905  ? 57.092  8.740   39.318  1.00 65.63  ? 905  HIS A C   1 
ATOM   6844  O  O   . HIS A 1 905  ? 56.136  8.029   39.028  1.00 65.82  ? 905  HIS A O   1 
ATOM   6845  C  CB  . HIS A 1 905  ? 57.839  9.782   37.117  1.00 64.33  ? 905  HIS A CB  1 
ATOM   6846  C  CG  . HIS A 1 905  ? 57.270  11.099  37.498  1.00 64.89  ? 905  HIS A CG  1 
ATOM   6847  N  ND1 . HIS A 1 905  ? 55.909  11.314  37.589  1.00 64.59  ? 905  HIS A ND1 1 
ATOM   6848  C  CD2 . HIS A 1 905  ? 57.865  12.271  37.794  1.00 66.71  ? 905  HIS A CD2 1 
ATOM   6849  C  CE1 . HIS A 1 905  ? 55.688  12.565  37.938  1.00 65.26  ? 905  HIS A CE1 1 
ATOM   6850  N  NE2 . HIS A 1 905  ? 56.876  13.177  38.065  1.00 66.91  ? 905  HIS A NE2 1 
ATOM   6851  N  N   . TYR A 1 906  ? 57.216  9.352   40.502  1.00 67.21  ? 906  TYR A N   1 
ATOM   6852  C  CA  . TYR A 1 906  ? 56.271  9.064   41.572  1.00 68.10  ? 906  TYR A CA  1 
ATOM   6853  C  C   . TYR A 1 906  ? 55.458  10.290  41.996  1.00 68.37  ? 906  TYR A C   1 
ATOM   6854  O  O   . TYR A 1 906  ? 54.612  10.182  42.878  1.00 69.08  ? 906  TYR A O   1 
ATOM   6855  C  CB  . TYR A 1 906  ? 56.979  8.522   42.813  1.00 70.19  ? 906  TYR A CB  1 
ATOM   6856  C  CG  . TYR A 1 906  ? 57.801  7.277   42.629  1.00 71.91  ? 906  TYR A CG  1 
ATOM   6857  C  CD1 . TYR A 1 906  ? 57.213  6.029   42.476  1.00 71.60  ? 906  TYR A CD1 1 
ATOM   6858  C  CD2 . TYR A 1 906  ? 59.185  7.342   42.674  1.00 75.24  ? 906  TYR A CD2 1 
ATOM   6859  C  CE1 . TYR A 1 906  ? 57.987  4.884   42.341  1.00 73.17  ? 906  TYR A CE1 1 
ATOM   6860  C  CE2 . TYR A 1 906  ? 59.973  6.208   42.546  1.00 75.78  ? 906  TYR A CE2 1 
ATOM   6861  C  CZ  . TYR A 1 906  ? 59.369  4.974   42.378  1.00 74.74  ? 906  TYR A CZ  1 
ATOM   6862  O  OH  . TYR A 1 906  ? 60.119  3.846   42.237  1.00 75.72  ? 906  TYR A OH  1 
ATOM   6863  N  N   . ASN A 1 907  ? 55.707  11.453  41.392  1.00 68.82  ? 907  ASN A N   1 
ATOM   6864  C  CA  . ASN A 1 907  ? 55.057  12.671  41.850  1.00 70.18  ? 907  ASN A CA  1 
ATOM   6865  C  C   . ASN A 1 907  ? 53.712  12.847  41.155  1.00 68.36  ? 907  ASN A C   1 
ATOM   6866  O  O   . ASN A 1 907  ? 53.541  13.761  40.353  1.00 67.75  ? 907  ASN A O   1 
ATOM   6867  C  CB  . ASN A 1 907  ? 55.926  13.907  41.633  1.00 73.07  ? 907  ASN A CB  1 
ATOM   6868  C  CG  . ASN A 1 907  ? 56.883  14.157  42.774  1.00 76.77  ? 907  ASN A CG  1 
ATOM   6869  O  OD1 . ASN A 1 907  ? 56.933  13.390  43.736  1.00 77.73  ? 907  ASN A OD1 1 
ATOM   6870  N  ND2 . ASN A 1 907  ? 57.651  15.229  42.663  1.00 80.47  ? 907  ASN A ND2 1 
ATOM   6871  N  N   . ASN A 1 908  ? 52.767  11.957  41.483  1.00 67.50  ? 908  ASN A N   1 
ATOM   6872  C  CA  . ASN A 1 908  ? 51.399  12.010  41.000  1.00 64.58  ? 908  ASN A CA  1 
ATOM   6873  C  C   . ASN A 1 908  ? 50.466  11.594  42.127  1.00 65.34  ? 908  ASN A C   1 
ATOM   6874  O  O   . ASN A 1 908  ? 50.905  10.991  43.105  1.00 66.33  ? 908  ASN A O   1 
ATOM   6875  C  CB  . ASN A 1 908  ? 51.193  11.063  39.823  1.00 62.72  ? 908  ASN A CB  1 
ATOM   6876  C  CG  . ASN A 1 908  ? 52.058  11.432  38.641  1.00 63.20  ? 908  ASN A CG  1 
ATOM   6877  O  OD1 . ASN A 1 908  ? 52.991  10.709  38.292  1.00 62.80  ? 908  ASN A OD1 1 
ATOM   6878  N  ND2 . ASN A 1 908  ? 51.762  12.572  38.038  1.00 63.53  ? 908  ASN A ND2 1 
ATOM   6879  N  N   . ILE A 1 909  ? 49.181  11.933  41.968  1.00 65.59  ? 909  ILE A N   1 
ATOM   6880  C  CA  . ILE A 1 909  ? 48.124  11.453  42.844  1.00 65.99  ? 909  ILE A CA  1 
ATOM   6881  C  C   . ILE A 1 909  ? 47.493  10.223  42.203  1.00 64.65  ? 909  ILE A C   1 
ATOM   6882  O  O   . ILE A 1 909  ? 47.188  9.241   42.875  1.00 65.62  ? 909  ILE A O   1 
ATOM   6883  C  CB  . ILE A 1 909  ? 47.078  12.554  43.094  1.00 65.89  ? 909  ILE A CB  1 
ATOM   6884  C  CG1 . ILE A 1 909  ? 47.721  13.842  43.612  1.00 67.38  ? 909  ILE A CG1 1 
ATOM   6885  C  CG2 . ILE A 1 909  ? 45.993  12.062  44.036  1.00 67.18  ? 909  ILE A CG2 1 
ATOM   6886  C  CD1 . ILE A 1 909  ? 48.567  13.655  44.850  1.00 69.63  ? 909  ILE A CD1 1 
ATOM   6887  N  N   . MET A 1 910  ? 47.315  10.296  40.884  1.00 63.75  ? 910  MET A N   1 
ATOM   6888  C  CA  . MET A 1 910  ? 46.594  9.268   40.161  1.00 63.43  ? 910  MET A CA  1 
ATOM   6889  C  C   . MET A 1 910  ? 46.764  9.517   38.667  1.00 61.35  ? 910  MET A C   1 
ATOM   6890  O  O   . MET A 1 910  ? 46.037  10.318  38.082  1.00 59.76  ? 910  MET A O   1 
ATOM   6891  C  CB  . MET A 1 910  ? 45.110  9.381   40.508  1.00 65.21  ? 910  MET A CB  1 
ATOM   6892  C  CG  . MET A 1 910  ? 44.375  8.070   40.500  1.00 66.41  ? 910  MET A CG  1 
ATOM   6893  S  SD  . MET A 1 910  ? 42.912  8.212   41.549  1.00 68.95  ? 910  MET A SD  1 
ATOM   6894  C  CE  . MET A 1 910  ? 41.877  6.978   40.769  1.00 67.67  ? 910  MET A CE  1 
ATOM   6895  N  N   . ALA A 1 911  ? 47.727  8.815   38.065  1.00 60.67  ? 911  ALA A N   1 
ATOM   6896  C  CA  . ALA A 1 911  ? 48.114  9.077   36.692  1.00 59.83  ? 911  ALA A CA  1 
ATOM   6897  C  C   . ALA A 1 911  ? 47.225  8.264   35.760  1.00 57.88  ? 911  ALA A C   1 
ATOM   6898  O  O   . ALA A 1 911  ? 47.529  7.104   35.498  1.00 58.01  ? 911  ALA A O   1 
ATOM   6899  C  CB  . ALA A 1 911  ? 49.573  8.734   36.521  1.00 61.70  ? 911  ALA A CB  1 
ATOM   6900  N  N   . LEU A 1 912  ? 46.144  8.890   35.264  1.00 56.74  ? 912  LEU A N   1 
ATOM   6901  C  CA  . LEU A 1 912  ? 45.103  8.193   34.519  1.00 54.46  ? 912  LEU A CA  1 
ATOM   6902  C  C   . LEU A 1 912  ? 45.329  8.275   33.012  1.00 53.08  ? 912  LEU A C   1 
ATOM   6903  O  O   . LEU A 1 912  ? 44.770  7.471   32.274  1.00 53.40  ? 912  LEU A O   1 
ATOM   6904  C  CB  . LEU A 1 912  ? 43.726  8.779   34.843  1.00 55.05  ? 912  LEU A CB  1 
ATOM   6905  C  CG  . LEU A 1 912  ? 43.208  8.603   36.271  1.00 57.60  ? 912  LEU A CG  1 
ATOM   6906  C  CD1 . LEU A 1 912  ? 41.691  8.496   36.272  1.00 56.58  ? 912  LEU A CD1 1 
ATOM   6907  C  CD2 . LEU A 1 912  ? 43.813  7.379   36.943  1.00 58.14  ? 912  LEU A CD2 1 
ATOM   6908  N  N   . TYR A 1 913  ? 46.093  9.269   32.548  1.00 52.72  ? 913  TYR A N   1 
ATOM   6909  C  CA  . TYR A 1 913  ? 46.173  9.538   31.120  1.00 51.48  ? 913  TYR A CA  1 
ATOM   6910  C  C   . TYR A 1 913  ? 47.610  9.836   30.728  1.00 51.16  ? 913  TYR A C   1 
ATOM   6911  O  O   . TYR A 1 913  ? 48.277  10.617  31.396  1.00 53.54  ? 913  TYR A O   1 
ATOM   6912  C  CB  . TYR A 1 913  ? 45.298  10.730  30.720  1.00 51.30  ? 913  TYR A CB  1 
ATOM   6913  C  CG  . TYR A 1 913  ? 44.013  10.853  31.493  1.00 50.94  ? 913  TYR A CG  1 
ATOM   6914  C  CD1 . TYR A 1 913  ? 42.941  10.003  31.250  1.00 51.14  ? 913  TYR A CD1 1 
ATOM   6915  C  CD2 . TYR A 1 913  ? 43.871  11.806  32.488  1.00 51.43  ? 913  TYR A CD2 1 
ATOM   6916  C  CE1 . TYR A 1 913  ? 41.755  10.103  31.964  1.00 49.86  ? 913  TYR A CE1 1 
ATOM   6917  C  CE2 . TYR A 1 913  ? 42.695  11.921  33.211  1.00 51.77  ? 913  TYR A CE2 1 
ATOM   6918  C  CZ  . TYR A 1 913  ? 41.633  11.071  32.948  1.00 50.95  ? 913  TYR A CZ  1 
ATOM   6919  O  OH  . TYR A 1 913  ? 40.487  11.212  33.676  1.00 51.06  ? 913  TYR A OH  1 
ATOM   6920  N  N   . LEU A 1 914  ? 48.042  9.230   29.620  1.00 50.10  ? 914  LEU A N   1 
ATOM   6921  C  CA  . LEU A 1 914  ? 49.387  9.387   29.103  1.00 52.28  ? 914  LEU A CA  1 
ATOM   6922  C  C   . LEU A 1 914  ? 49.319  9.661   27.606  1.00 53.67  ? 914  LEU A C   1 
ATOM   6923  O  O   . LEU A 1 914  ? 48.573  8.996   26.891  1.00 54.14  ? 914  LEU A O   1 
ATOM   6924  C  CB  . LEU A 1 914  ? 50.168  8.093   29.360  1.00 52.15  ? 914  LEU A CB  1 
ATOM   6925  C  CG  . LEU A 1 914  ? 50.395  7.711   30.822  1.00 52.25  ? 914  LEU A CG  1 
ATOM   6926  C  CD1 . LEU A 1 914  ? 50.951  6.305   30.926  1.00 52.93  ? 914  LEU A CD1 1 
ATOM   6927  C  CD2 . LEU A 1 914  ? 51.319  8.692   31.525  1.00 53.10  ? 914  LEU A CD2 1 
ATOM   6928  N  N   . LYS A 1 915  ? 50.114  10.637  27.152  1.00 55.82  ? 915  LYS A N   1 
ATOM   6929  C  CA  . LYS A 1 915  ? 50.348  10.881  25.737  1.00 57.44  ? 915  LYS A CA  1 
ATOM   6930  C  C   . LYS A 1 915  ? 51.837  11.170  25.545  1.00 59.55  ? 915  LYS A C   1 
ATOM   6931  O  O   . LYS A 1 915  ? 52.492  11.689  26.447  1.00 60.54  ? 915  LYS A O   1 
ATOM   6932  C  CB  . LYS A 1 915  ? 49.438  12.007  25.227  1.00 58.27  ? 915  LYS A CB  1 
ATOM   6933  C  CG  . LYS A 1 915  ? 47.945  11.682  25.170  1.00 57.97  ? 915  LYS A CG  1 
ATOM   6934  C  CD  . LYS A 1 915  ? 47.590  10.573  24.181  1.00 57.41  ? 915  LYS A CD  1 
ATOM   6935  C  CE  . LYS A 1 915  ? 46.107  10.287  24.100  1.00 55.51  ? 915  LYS A CE  1 
ATOM   6936  N  NZ  . LYS A 1 915  ? 45.349  11.434  23.541  1.00 55.19  ? 915  LYS A NZ  1 
ATOM   6937  N  N   . THR A 1 916  ? 52.388  10.802  24.383  1.00 60.05  ? 916  THR A N   1 
ATOM   6938  C  CA  . THR A 1 916  ? 53.813  10.981  24.157  1.00 61.45  ? 916  THR A CA  1 
ATOM   6939  C  C   . THR A 1 916  ? 54.073  11.556  22.775  1.00 62.90  ? 916  THR A C   1 
ATOM   6940  O  O   . THR A 1 916  ? 53.350  11.282  21.822  1.00 63.41  ? 916  THR A O   1 
ATOM   6941  C  CB  . THR A 1 916  ? 54.620  9.683   24.270  1.00 62.32  ? 916  THR A CB  1 
ATOM   6942  O  OG1 . THR A 1 916  ? 54.167  8.779   23.266  1.00 64.65  ? 916  THR A OG1 1 
ATOM   6943  C  CG2 . THR A 1 916  ? 54.525  9.051   25.639  1.00 61.94  ? 916  THR A CG2 1 
ATOM   6944  N  N   . LYS A 1 917  ? 55.139  12.350  22.696  1.00 64.29  ? 917  LYS A N   1 
ATOM   6945  C  CA  . LYS A 1 917  ? 55.664  12.843  21.439  1.00 65.09  ? 917  LYS A CA  1 
ATOM   6946  C  C   . LYS A 1 917  ? 57.171  12.955  21.594  1.00 67.46  ? 917  LYS A C   1 
ATOM   6947  O  O   . LYS A 1 917  ? 57.655  13.629  22.500  1.00 68.06  ? 917  LYS A O   1 
ATOM   6948  C  CB  . LYS A 1 917  ? 55.087  14.220  21.105  1.00 65.08  ? 917  LYS A CB  1 
ATOM   6949  C  CG  . LYS A 1 917  ? 55.516  14.769  19.754  1.00 66.57  ? 917  LYS A CG  1 
ATOM   6950  C  CD  . LYS A 1 917  ? 55.165  16.221  19.565  1.00 67.74  ? 917  LYS A CD  1 
ATOM   6951  C  CE  . LYS A 1 917  ? 55.172  16.639  18.112  1.00 69.43  ? 917  LYS A CE  1 
ATOM   6952  N  NZ  . LYS A 1 917  ? 56.410  16.188  17.443  1.00 71.67  ? 917  LYS A NZ  1 
ATOM   6953  N  N   . GLY A 1 918  ? 57.895  12.294  20.688  1.00 69.27  ? 918  GLY A N   1 
ATOM   6954  C  CA  . GLY A 1 918  ? 59.338  12.214  20.790  1.00 71.27  ? 918  GLY A CA  1 
ATOM   6955  C  C   . GLY A 1 918  ? 59.721  11.634  22.146  1.00 71.55  ? 918  GLY A C   1 
ATOM   6956  O  O   . GLY A 1 918  ? 59.287  10.537  22.487  1.00 69.54  ? 918  GLY A O   1 
ATOM   6957  N  N   . ASP A 1 919  ? 60.498  12.399  22.924  1.00 74.29  ? 919  ASP A N   1 
ATOM   6958  C  CA  . ASP A 1 919  ? 60.918  11.962  24.247  1.00 74.81  ? 919  ASP A CA  1 
ATOM   6959  C  C   . ASP A 1 919  ? 60.035  12.586  25.330  1.00 74.17  ? 919  ASP A C   1 
ATOM   6960  O  O   . ASP A 1 919  ? 60.251  12.359  26.520  1.00 74.69  ? 919  ASP A O   1 
ATOM   6961  C  CB  . ASP A 1 919  ? 62.420  12.174  24.464  1.00 77.51  ? 919  ASP A CB  1 
ATOM   6962  C  CG  . ASP A 1 919  ? 63.295  11.147  23.761  1.00 80.11  ? 919  ASP A CG  1 
ATOM   6963  O  OD1 . ASP A 1 919  ? 62.876  9.979   23.650  1.00 79.56  ? 919  ASP A OD1 1 
ATOM   6964  O  OD2 . ASP A 1 919  ? 64.404  11.520  23.335  1.00 84.58  ? 919  ASP A OD2 1 
ATOM   6965  N  N   . PHE A 1 920  ? 59.013  13.341  24.910  1.00 73.89  ? 920  PHE A N   1 
ATOM   6966  C  CA  . PHE A 1 920  ? 58.156  14.074  25.829  1.00 72.76  ? 920  PHE A CA  1 
ATOM   6967  C  C   . PHE A 1 920  ? 56.941  13.223  26.191  1.00 69.97  ? 920  PHE A C   1 
ATOM   6968  O  O   . PHE A 1 920  ? 56.420  12.492  25.352  1.00 69.22  ? 920  PHE A O   1 
ATOM   6969  C  CB  . PHE A 1 920  ? 57.785  15.436  25.234  1.00 74.63  ? 920  PHE A CB  1 
ATOM   6970  C  CG  . PHE A 1 920  ? 58.913  16.439  25.256  1.00 79.78  ? 920  PHE A CG  1 
ATOM   6971  C  CD1 . PHE A 1 920  ? 59.811  16.531  24.201  1.00 82.52  ? 920  PHE A CD1 1 
ATOM   6972  C  CD2 . PHE A 1 920  ? 59.099  17.276  26.348  1.00 81.17  ? 920  PHE A CD2 1 
ATOM   6973  C  CE1 . PHE A 1 920  ? 60.857  17.440  24.234  1.00 85.10  ? 920  PHE A CE1 1 
ATOM   6974  C  CE2 . PHE A 1 920  ? 60.140  18.191  26.377  1.00 83.53  ? 920  PHE A CE2 1 
ATOM   6975  C  CZ  . PHE A 1 920  ? 61.016  18.272  25.320  1.00 86.45  ? 920  PHE A CZ  1 
ATOM   6976  N  N   . ILE A 1 921  ? 56.518  13.315  27.459  1.00 68.49  ? 921  ILE A N   1 
ATOM   6977  C  CA  . ILE A 1 921  ? 55.369  12.579  27.965  1.00 64.95  ? 921  ILE A CA  1 
ATOM   6978  C  C   . ILE A 1 921  ? 54.453  13.546  28.702  1.00 63.36  ? 921  ILE A C   1 
ATOM   6979  O  O   . ILE A 1 921  ? 54.880  14.175  29.669  1.00 63.90  ? 921  ILE A O   1 
ATOM   6980  C  CB  . ILE A 1 921  ? 55.809  11.443  28.909  1.00 64.43  ? 921  ILE A CB  1 
ATOM   6981  C  CG1 . ILE A 1 921  ? 56.701  10.423  28.200  1.00 65.52  ? 921  ILE A CG1 1 
ATOM   6982  C  CG2 . ILE A 1 921  ? 54.599  10.782  29.557  1.00 62.49  ? 921  ILE A CG2 1 
ATOM   6983  C  CD1 . ILE A 1 921  ? 57.646  9.681   29.126  1.00 67.24  ? 921  ILE A CD1 1 
ATOM   6984  N  N   . LEU A 1 922  ? 53.200  13.635  28.241  1.00 61.39  ? 922  LEU A N   1 
ATOM   6985  C  CA  . LEU A 1 922  ? 52.169  14.392  28.931  1.00 60.61  ? 922  LEU A CA  1 
ATOM   6986  C  C   . LEU A 1 922  ? 51.444  13.455  29.892  1.00 58.85  ? 922  LEU A C   1 
ATOM   6987  O  O   . LEU A 1 922  ? 51.008  12.373  29.495  1.00 56.58  ? 922  LEU A O   1 
ATOM   6988  C  CB  . LEU A 1 922  ? 51.214  15.007  27.901  1.00 60.06  ? 922  LEU A CB  1 
ATOM   6989  C  CG  . LEU A 1 922  ? 50.147  15.948  28.463  1.00 60.25  ? 922  LEU A CG  1 
ATOM   6990  C  CD1 . LEU A 1 922  ? 50.774  17.192  29.076  1.00 61.82  ? 922  LEU A CD1 1 
ATOM   6991  C  CD2 . LEU A 1 922  ? 49.146  16.336  27.387  1.00 59.62  ? 922  LEU A CD2 1 
ATOM   6992  N  N   . VAL A 1 923  ? 51.348  13.887  31.159  1.00 59.36  ? 923  VAL A N   1 
ATOM   6993  C  CA  . VAL A 1 923  ? 50.721  13.108  32.220  1.00 58.79  ? 923  VAL A CA  1 
ATOM   6994  C  C   . VAL A 1 923  ? 49.467  13.826  32.723  1.00 58.37  ? 923  VAL A C   1 
ATOM   6995  O  O   . VAL A 1 923  ? 49.557  14.917  33.292  1.00 59.08  ? 923  VAL A O   1 
ATOM   6996  C  CB  . VAL A 1 923  ? 51.699  12.826  33.380  1.00 59.27  ? 923  VAL A CB  1 
ATOM   6997  C  CG1 . VAL A 1 923  ? 51.051  12.005  34.489  1.00 58.22  ? 923  VAL A CG1 1 
ATOM   6998  C  CG2 . VAL A 1 923  ? 52.972  12.153  32.891  1.00 59.89  ? 923  VAL A CG2 1 
ATOM   6999  N  N   . GLY A 1 924  ? 48.309  13.177  32.536  1.00 56.25  ? 924  GLY A N   1 
ATOM   7000  C  CA  . GLY A 1 924  ? 47.053  13.660  33.085  1.00 55.83  ? 924  GLY A CA  1 
ATOM   7001  C  C   . GLY A 1 924  ? 46.767  13.020  34.440  1.00 55.77  ? 924  GLY A C   1 
ATOM   7002  O  O   . GLY A 1 924  ? 46.861  11.805  34.586  1.00 54.89  ? 924  GLY A O   1 
ATOM   7003  N  N   . ASP A 1 925  ? 46.441  13.856  35.426  1.00 57.59  ? 925  ASP A N   1 
ATOM   7004  C  CA  . ASP A 1 925  ? 46.119  13.380  36.754  1.00 60.92  ? 925  ASP A CA  1 
ATOM   7005  C  C   . ASP A 1 925  ? 44.630  13.598  36.965  1.00 64.71  ? 925  ASP A C   1 
ATOM   7006  O  O   . ASP A 1 925  ? 44.061  14.567  36.463  1.00 67.01  ? 925  ASP A O   1 
ATOM   7007  C  CB  . ASP A 1 925  ? 46.892  14.150  37.821  1.00 64.14  ? 925  ASP A CB  1 
ATOM   7008  C  CG  . ASP A 1 925  ? 46.951  13.424  39.156  1.00 66.92  ? 925  ASP A CG  1 
ATOM   7009  O  OD1 . ASP A 1 925  ? 45.876  13.176  39.739  1.00 68.00  ? 925  ASP A OD1 1 
ATOM   7010  O  OD2 . ASP A 1 925  ? 48.079  13.096  39.601  1.00 69.41  ? 925  ASP A OD2 1 
ATOM   7011  N  N   . LEU A 1 926  ? 43.994  12.695  37.713  1.00 67.14  ? 926  LEU A N   1 
ATOM   7012  C  CA  . LEU A 1 926  ? 42.581  12.892  37.965  1.00 67.80  ? 926  LEU A CA  1 
ATOM   7013  C  C   . LEU A 1 926  ? 42.374  14.216  38.695  1.00 69.70  ? 926  LEU A C   1 
ATOM   7014  O  O   . LEU A 1 926  ? 41.458  14.949  38.343  1.00 73.30  ? 926  LEU A O   1 
ATOM   7015  C  CB  . LEU A 1 926  ? 41.975  11.701  38.716  1.00 68.97  ? 926  LEU A CB  1 
ATOM   7016  C  CG  . LEU A 1 926  ? 40.443  11.648  38.744  1.00 68.71  ? 926  LEU A CG  1 
ATOM   7017  C  CD1 . LEU A 1 926  ? 39.850  11.690  37.338  1.00 66.74  ? 926  LEU A CD1 1 
ATOM   7018  C  CD2 . LEU A 1 926  ? 39.958  10.408  39.477  1.00 68.18  ? 926  LEU A CD2 1 
ATOM   7019  N  N   . MET A 1 927  ? 43.234  14.544  39.665  1.00 70.47  ? 927  MET A N   1 
ATOM   7020  C  CA  . MET A 1 927  ? 42.962  15.719  40.478  1.00 74.14  ? 927  MET A CA  1 
ATOM   7021  C  C   . MET A 1 927  ? 44.035  16.800  40.338  1.00 74.96  ? 927  MET A C   1 
ATOM   7022  O  O   . MET A 1 927  ? 43.811  17.944  40.742  1.00 77.86  ? 927  MET A O   1 
ATOM   7023  C  CB  . MET A 1 927  ? 42.738  15.355  41.949  1.00 78.44  ? 927  MET A CB  1 
ATOM   7024  C  CG  . MET A 1 927  ? 43.277  13.990  42.324  1.00 80.71  ? 927  MET A CG  1 
ATOM   7025  S  SD  . MET A 1 927  ? 42.088  13.039  43.318  1.00 85.53  ? 927  MET A SD  1 
ATOM   7026  C  CE  . MET A 1 927  ? 41.109  12.293  42.018  1.00 81.46  ? 927  MET A CE  1 
ATOM   7027  N  N   . ARG A 1 928  ? 45.179  16.468  39.731  1.00 72.59  ? 928  ARG A N   1 
ATOM   7028  C  CA  . ARG A 1 928  ? 46.305  17.381  39.825  1.00 71.38  ? 928  ARG A CA  1 
ATOM   7029  C  C   . ARG A 1 928  ? 46.785  17.836  38.449  1.00 69.13  ? 928  ARG A C   1 
ATOM   7030  O  O   . ARG A 1 928  ? 47.985  17.901  38.218  1.00 71.62  ? 928  ARG A O   1 
ATOM   7031  C  CB  . ARG A 1 928  ? 47.437  16.733  40.623  1.00 72.87  ? 928  ARG A CB  1 
ATOM   7032  C  CG  . ARG A 1 928  ? 48.086  17.670  41.629  1.00 76.28  ? 928  ARG A CG  1 
ATOM   7033  C  CD  . ARG A 1 928  ? 49.155  16.953  42.422  1.00 78.60  ? 928  ARG A CD  1 
ATOM   7034  N  NE  . ARG A 1 928  ? 50.408  16.888  41.688  1.00 80.18  ? 928  ARG A NE  1 
ATOM   7035  C  CZ  . ARG A 1 928  ? 51.447  17.679  41.927  1.00 84.34  ? 928  ARG A CZ  1 
ATOM   7036  N  NH1 . ARG A 1 928  ? 52.550  17.546  41.209  1.00 86.19  ? 928  ARG A NH1 1 
ATOM   7037  N  NH2 . ARG A 1 928  ? 51.385  18.589  42.889  1.00 85.97  ? 928  ARG A NH2 1 
ATOM   7038  N  N   . SER A 1 929  ? 45.847  18.155  37.549  1.00 65.92  ? 929  SER A N   1 
ATOM   7039  C  CA  . SER A 1 929  ? 46.141  18.813  36.283  1.00 64.49  ? 929  SER A CA  1 
ATOM   7040  C  C   . SER A 1 929  ? 47.127  18.003  35.443  1.00 62.65  ? 929  SER A C   1 
ATOM   7041  O  O   . SER A 1 929  ? 47.171  16.785  35.562  1.00 61.69  ? 929  SER A O   1 
ATOM   7042  C  CB  . SER A 1 929  ? 46.628  20.218  36.503  1.00 66.44  ? 929  SER A CB  1 
ATOM   7043  O  OG  . SER A 1 929  ? 46.640  20.930  35.277  1.00 67.98  ? 929  SER A OG  1 
ATOM   7044  N  N   . VAL A 1 930  ? 47.913  18.697  34.605  1.00 62.47  ? 930  VAL A N   1 
ATOM   7045  C  CA  . VAL A 1 930  ? 48.822  18.067  33.659  1.00 61.30  ? 930  VAL A CA  1 
ATOM   7046  C  C   . VAL A 1 930  ? 50.277  18.322  34.053  1.00 62.05  ? 930  VAL A C   1 
ATOM   7047  O  O   . VAL A 1 930  ? 50.603  19.317  34.693  1.00 62.94  ? 930  VAL A O   1 
ATOM   7048  C  CB  . VAL A 1 930  ? 48.529  18.508  32.213  1.00 61.23  ? 930  VAL A CB  1 
ATOM   7049  C  CG1 . VAL A 1 930  ? 47.215  17.930  31.709  1.00 58.93  ? 930  VAL A CG1 1 
ATOM   7050  C  CG2 . VAL A 1 930  ? 48.533  20.021  32.072  1.00 62.67  ? 930  VAL A CG2 1 
ATOM   7051  N  N   . LEU A 1 931  ? 51.144  17.397  33.637  1.00 62.17  ? 931  LEU A N   1 
ATOM   7052  C  CA  . LEU A 1 931  ? 52.562  17.382  33.964  1.00 63.20  ? 931  LEU A CA  1 
ATOM   7053  C  C   . LEU A 1 931  ? 53.309  16.929  32.713  1.00 62.81  ? 931  LEU A C   1 
ATOM   7054  O  O   . LEU A 1 931  ? 52.865  16.013  32.015  1.00 61.48  ? 931  LEU A O   1 
ATOM   7055  C  CB  . LEU A 1 931  ? 52.758  16.414  35.139  1.00 62.95  ? 931  LEU A CB  1 
ATOM   7056  C  CG  . LEU A 1 931  ? 54.179  15.993  35.494  1.00 64.40  ? 931  LEU A CG  1 
ATOM   7057  C  CD1 . LEU A 1 931  ? 54.831  16.994  36.438  1.00 67.69  ? 931  LEU A CD1 1 
ATOM   7058  C  CD2 . LEU A 1 931  ? 54.135  14.634  36.155  1.00 63.91  ? 931  LEU A CD2 1 
ATOM   7059  N  N   . LEU A 1 932  ? 54.406  17.625  32.406  1.00 63.47  ? 932  LEU A N   1 
ATOM   7060  C  CA  . LEU A 1 932  ? 55.201  17.285  31.241  1.00 64.09  ? 932  LEU A CA  1 
ATOM   7061  C  C   . LEU A 1 932  ? 56.502  16.651  31.710  1.00 65.83  ? 932  LEU A C   1 
ATOM   7062  O  O   . LEU A 1 932  ? 57.279  17.286  32.419  1.00 67.94  ? 932  LEU A O   1 
ATOM   7063  C  CB  . LEU A 1 932  ? 55.466  18.551  30.419  1.00 65.82  ? 932  LEU A CB  1 
ATOM   7064  C  CG  . LEU A 1 932  ? 56.365  18.367  29.196  1.00 66.64  ? 932  LEU A CG  1 
ATOM   7065  C  CD1 . LEU A 1 932  ? 55.669  17.558  28.112  1.00 64.74  ? 932  LEU A CD1 1 
ATOM   7066  C  CD2 . LEU A 1 932  ? 56.823  19.706  28.644  1.00 68.47  ? 932  LEU A CD2 1 
ATOM   7067  N  N   . LEU A 1 933  ? 56.717  15.391  31.311  1.00 65.46  ? 933  LEU A N   1 
ATOM   7068  C  CA  . LEU A 1 933  ? 57.957  14.683  31.600  1.00 66.43  ? 933  LEU A CA  1 
ATOM   7069  C  C   . LEU A 1 933  ? 58.829  14.638  30.350  1.00 67.11  ? 933  LEU A C   1 
ATOM   7070  O  O   . LEU A 1 933  ? 58.363  14.833  29.231  1.00 66.65  ? 933  LEU A O   1 
ATOM   7071  C  CB  . LEU A 1 933  ? 57.648  13.248  32.045  1.00 64.72  ? 933  LEU A CB  1 
ATOM   7072  C  CG  . LEU A 1 933  ? 57.019  13.057  33.422  1.00 63.49  ? 933  LEU A CG  1 
ATOM   7073  C  CD1 . LEU A 1 933  ? 56.909  11.576  33.740  1.00 62.42  ? 933  LEU A CD1 1 
ATOM   7074  C  CD2 . LEU A 1 933  ? 57.823  13.758  34.500  1.00 64.64  ? 933  LEU A CD2 1 
ATOM   7075  N  N   . ALA A 1 934  ? 60.103  14.327  30.560  1.00 69.38  ? 934  ALA A N   1 
ATOM   7076  C  CA  . ALA A 1 934  ? 60.991  14.000  29.460  1.00 71.35  ? 934  ALA A CA  1 
ATOM   7077  C  C   . ALA A 1 934  ? 61.802  12.769  29.838  1.00 71.68  ? 934  ALA A C   1 
ATOM   7078  O  O   . ALA A 1 934  ? 62.177  12.600  30.995  1.00 72.75  ? 934  ALA A O   1 
ATOM   7079  C  CB  . ALA A 1 934  ? 61.887  15.169  29.144  1.00 73.41  ? 934  ALA A CB  1 
ATOM   7080  N  N   . TYR A 1 935  ? 62.036  11.911  28.846  1.00 71.71  ? 935  TYR A N   1 
ATOM   7081  C  CA  . TYR A 1 935  ? 62.963  10.807  28.992  1.00 72.94  ? 935  TYR A CA  1 
ATOM   7082  C  C   . TYR A 1 935  ? 64.333  11.293  28.544  1.00 77.08  ? 935  TYR A C   1 
ATOM   7083  O  O   . TYR A 1 935  ? 64.465  11.821  27.443  1.00 79.67  ? 935  TYR A O   1 
ATOM   7084  C  CB  . TYR A 1 935  ? 62.528  9.638   28.111  1.00 71.33  ? 935  TYR A CB  1 
ATOM   7085  C  CG  . TYR A 1 935  ? 63.420  8.427   28.194  1.00 71.74  ? 935  TYR A CG  1 
ATOM   7086  C  CD1 . TYR A 1 935  ? 63.560  7.733   29.385  1.00 71.59  ? 935  TYR A CD1 1 
ATOM   7087  C  CD2 . TYR A 1 935  ? 64.106  7.969   27.081  1.00 72.39  ? 935  TYR A CD2 1 
ATOM   7088  C  CE1 . TYR A 1 935  ? 64.374  6.618   29.475  1.00 72.75  ? 935  TYR A CE1 1 
ATOM   7089  C  CE2 . TYR A 1 935  ? 64.916  6.852   27.150  1.00 73.72  ? 935  TYR A CE2 1 
ATOM   7090  C  CZ  . TYR A 1 935  ? 65.050  6.179   28.351  1.00 74.03  ? 935  TYR A CZ  1 
ATOM   7091  O  OH  . TYR A 1 935  ? 65.859  5.087   28.405  1.00 76.08  ? 935  TYR A OH  1 
ATOM   7092  N  N   . LYS A 1 936  ? 65.333  11.133  29.412  1.00 79.00  ? 936  LYS A N   1 
ATOM   7093  C  CA  . LYS A 1 936  ? 66.698  11.465  29.057  1.00 81.18  ? 936  LYS A CA  1 
ATOM   7094  C  C   . LYS A 1 936  ? 67.419  10.174  28.682  1.00 80.77  ? 936  LYS A C   1 
ATOM   7095  O  O   . LYS A 1 936  ? 67.660  9.327   29.536  1.00 79.53  ? 936  LYS A O   1 
ATOM   7096  C  CB  . LYS A 1 936  ? 67.347  12.219  30.217  1.00 84.81  ? 936  LYS A CB  1 
ATOM   7097  C  CG  . LYS A 1 936  ? 66.579  13.448  30.683  1.00 85.60  ? 936  LYS A CG  1 
ATOM   7098  C  CD  . LYS A 1 936  ? 66.417  14.506  29.606  1.00 87.39  ? 936  LYS A CD  1 
ATOM   7099  C  CE  . LYS A 1 936  ? 66.555  15.923  30.126  1.00 89.69  ? 936  LYS A CE  1 
ATOM   7100  N  NZ  . LYS A 1 936  ? 65.802  16.888  29.286  1.00 89.34  ? 936  LYS A NZ  1 
ATOM   7101  N  N   . PRO A 1 937  ? 67.726  9.962   27.383  1.00 81.54  ? 937  PRO A N   1 
ATOM   7102  C  CA  . PRO A 1 937  ? 68.362  8.725   26.927  1.00 83.09  ? 937  PRO A CA  1 
ATOM   7103  C  C   . PRO A 1 937  ? 69.734  8.442   27.540  1.00 87.31  ? 937  PRO A C   1 
ATOM   7104  O  O   . PRO A 1 937  ? 70.083  7.286   27.764  1.00 87.89  ? 937  PRO A O   1 
ATOM   7105  C  CB  . PRO A 1 937  ? 68.464  8.911   25.405  1.00 83.18  ? 937  PRO A CB  1 
ATOM   7106  C  CG  . PRO A 1 937  ? 67.409  9.941   25.079  1.00 81.12  ? 937  PRO A CG  1 
ATOM   7107  C  CD  . PRO A 1 937  ? 67.416  10.873  26.271  1.00 81.56  ? 937  PRO A CD  1 
ATOM   7108  N  N   . MET A 1 938  ? 70.515  9.490   27.816  1.00 91.33  ? 938  MET A N   1 
ATOM   7109  C  CA  . MET A 1 938  ? 71.837  9.279   28.379  1.00 96.66  ? 938  MET A CA  1 
ATOM   7110  C  C   . MET A 1 938  ? 71.748  8.934   29.859  1.00 95.75  ? 938  MET A C   1 
ATOM   7111  O  O   . MET A 1 938  ? 72.500  8.087   30.340  1.00 98.88  ? 938  MET A O   1 
ATOM   7112  C  CB  . MET A 1 938  ? 72.714  10.515  28.215  1.00 102.39 ? 938  MET A CB  1 
ATOM   7113  C  CG  . MET A 1 938  ? 73.448  10.489  26.921  1.00 107.08 ? 938  MET A CG  1 
ATOM   7114  S  SD  . MET A 1 938  ? 74.183  12.085  26.639  1.00 115.26 ? 938  MET A SD  1 
ATOM   7115  C  CE  . MET A 1 938  ? 75.153  11.685  25.188  1.00 117.88 ? 938  MET A CE  1 
ATOM   7116  N  N   . GLU A 1 939  ? 70.860  9.635   30.570  1.00 92.69  ? 939  GLU A N   1 
ATOM   7117  C  CA  . GLU A 1 939  ? 70.690  9.451   32.000  1.00 91.23  ? 939  GLU A CA  1 
ATOM   7118  C  C   . GLU A 1 939  ? 69.843  8.209   32.252  1.00 87.40  ? 939  GLU A C   1 
ATOM   7119  O  O   . GLU A 1 939  ? 69.920  7.620   33.320  1.00 87.85  ? 939  GLU A O   1 
ATOM   7120  C  CB  . GLU A 1 939  ? 70.027  10.672  32.640  1.00 91.85  ? 939  GLU A CB  1 
ATOM   7121  C  CG  . GLU A 1 939  ? 70.933  11.884  32.745  1.00 96.35  ? 939  GLU A CG  1 
ATOM   7122  C  CD  . GLU A 1 939  ? 71.163  12.626  31.439  1.00 98.65  ? 939  GLU A CD  1 
ATOM   7123  O  OE1 . GLU A 1 939  ? 70.181  13.184  30.895  1.00 97.03  ? 939  GLU A OE1 1 
ATOM   7124  O  OE2 . GLU A 1 939  ? 72.325  12.639  30.962  1.00 101.88 ? 939  GLU A OE2 1 
ATOM   7125  N  N   . GLY A 1 940  ? 69.012  7.837   31.277  1.00 84.73  ? 940  GLY A N   1 
ATOM   7126  C  CA  . GLY A 1 940  ? 68.139  6.678   31.394  1.00 82.90  ? 940  GLY A CA  1 
ATOM   7127  C  C   . GLY A 1 940  ? 67.087  6.813   32.498  1.00 81.17  ? 940  GLY A C   1 
ATOM   7128  O  O   . GLY A 1 940  ? 66.811  5.857   33.219  1.00 80.87  ? 940  GLY A O   1 
ATOM   7129  N  N   . ASN A 1 941  ? 66.482  8.000   32.611  1.00 80.22  ? 941  ASN A N   1 
ATOM   7130  C  CA  . ASN A 1 941  ? 65.494  8.272   33.643  1.00 77.67  ? 941  ASN A CA  1 
ATOM   7131  C  C   . ASN A 1 941  ? 64.629  9.452   33.208  1.00 75.70  ? 941  ASN A C   1 
ATOM   7132  O  O   . ASN A 1 941  ? 64.894  10.072  32.183  1.00 75.80  ? 941  ASN A O   1 
ATOM   7133  C  CB  . ASN A 1 941  ? 66.140  8.490   35.016  1.00 80.16  ? 941  ASN A CB  1 
ATOM   7134  C  CG  . ASN A 1 941  ? 67.057  9.693   35.078  1.00 82.91  ? 941  ASN A CG  1 
ATOM   7135  O  OD1 . ASN A 1 941  ? 66.880  10.665  34.344  1.00 82.73  ? 941  ASN A OD1 1 
ATOM   7136  N  ND2 . ASN A 1 941  ? 68.038  9.633   35.965  1.00 86.09  ? 941  ASN A ND2 1 
ATOM   7137  N  N   . PHE A 1 942  ? 63.588  9.755   33.989  1.00 73.86  ? 942  PHE A N   1 
ATOM   7138  C  CA  . PHE A 1 942  ? 62.702  10.847  33.618  1.00 72.92  ? 942  PHE A CA  1 
ATOM   7139  C  C   . PHE A 1 942  ? 63.157  12.137  34.286  1.00 74.30  ? 942  PHE A C   1 
ATOM   7140  O  O   . PHE A 1 942  ? 63.793  12.104  35.335  1.00 76.24  ? 942  PHE A O   1 
ATOM   7141  C  CB  . PHE A 1 942  ? 61.250  10.601  34.036  1.00 70.15  ? 942  PHE A CB  1 
ATOM   7142  C  CG  . PHE A 1 942  ? 60.569  9.386   33.463  1.00 68.21  ? 942  PHE A CG  1 
ATOM   7143  C  CD1 . PHE A 1 942  ? 60.408  9.224   32.094  1.00 68.03  ? 942  PHE A CD1 1 
ATOM   7144  C  CD2 . PHE A 1 942  ? 60.043  8.423   34.310  1.00 67.07  ? 942  PHE A CD2 1 
ATOM   7145  C  CE1 . PHE A 1 942  ? 59.755  8.111   31.585  1.00 66.77  ? 942  PHE A CE1 1 
ATOM   7146  C  CE2 . PHE A 1 942  ? 59.400  7.307   33.802  1.00 66.13  ? 942  PHE A CE2 1 
ATOM   7147  C  CZ  . PHE A 1 942  ? 59.253  7.155   32.440  1.00 65.97  ? 942  PHE A CZ  1 
ATOM   7148  N  N   . GLU A 1 943  ? 62.797  13.258  33.656  1.00 73.98  ? 943  GLU A N   1 
ATOM   7149  C  CA  . GLU A 1 943  ? 62.963  14.592  34.203  1.00 76.24  ? 943  GLU A CA  1 
ATOM   7150  C  C   . GLU A 1 943  ? 61.624  15.321  34.098  1.00 74.14  ? 943  GLU A C   1 
ATOM   7151  O  O   . GLU A 1 943  ? 60.981  15.273  33.055  1.00 73.16  ? 943  GLU A O   1 
ATOM   7152  C  CB  . GLU A 1 943  ? 64.052  15.312  33.405  1.00 79.12  ? 943  GLU A CB  1 
ATOM   7153  C  CG  . GLU A 1 943  ? 64.205  16.773  33.765  1.00 82.45  ? 943  GLU A CG  1 
ATOM   7154  C  CD  . GLU A 1 943  ? 65.386  17.480  33.122  1.00 87.46  ? 943  GLU A CD  1 
ATOM   7155  O  OE1 . GLU A 1 943  ? 65.214  18.660  32.742  1.00 89.08  ? 943  GLU A OE1 1 
ATOM   7156  O  OE2 . GLU A 1 943  ? 66.479  16.864  33.019  1.00 90.13  ? 943  GLU A OE2 1 
ATOM   7157  N  N   . GLU A 1 944  ? 61.194  15.985  35.177  1.00 74.48  ? 944  GLU A N   1 
ATOM   7158  C  CA  . GLU A 1 944  ? 59.993  16.803  35.113  1.00 73.84  ? 944  GLU A CA  1 
ATOM   7159  C  C   . GLU A 1 944  ? 60.364  18.136  34.485  1.00 74.63  ? 944  GLU A C   1 
ATOM   7160  O  O   . GLU A 1 944  ? 61.100  18.906  35.088  1.00 76.61  ? 944  GLU A O   1 
ATOM   7161  C  CB  . GLU A 1 944  ? 59.433  17.101  36.504  1.00 76.12  ? 944  GLU A CB  1 
ATOM   7162  C  CG  . GLU A 1 944  ? 59.043  15.866  37.294  1.00 78.53  ? 944  GLU A CG  1 
ATOM   7163  C  CD  . GLU A 1 944  ? 58.746  16.102  38.766  1.00 81.21  ? 944  GLU A CD  1 
ATOM   7164  O  OE1 . GLU A 1 944  ? 59.706  16.349  39.533  1.00 84.23  ? 944  GLU A OE1 1 
ATOM   7165  O  OE2 . GLU A 1 944  ? 57.555  16.034  39.143  1.00 81.37  ? 944  GLU A OE2 1 
ATOM   7166  N  N   . ILE A 1 945  ? 59.850  18.398  33.281  1.00 74.01  ? 945  ILE A N   1 
ATOM   7167  C  CA  . ILE A 1 945  ? 60.114  19.656  32.600  1.00 76.29  ? 945  ILE A CA  1 
ATOM   7168  C  C   . ILE A 1 945  ? 59.286  20.759  33.258  1.00 76.71  ? 945  ILE A C   1 
ATOM   7169  O  O   . ILE A 1 945  ? 59.831  21.740  33.762  1.00 80.38  ? 945  ILE A O   1 
ATOM   7170  C  CB  . ILE A 1 945  ? 59.854  19.542  31.082  1.00 75.24  ? 945  ILE A CB  1 
ATOM   7171  C  CG1 . ILE A 1 945  ? 60.747  18.492  30.411  1.00 75.20  ? 945  ILE A CG1 1 
ATOM   7172  C  CG2 . ILE A 1 945  ? 59.947  20.894  30.391  1.00 77.02  ? 945  ILE A CG2 1 
ATOM   7173  C  CD1 . ILE A 1 945  ? 62.229  18.688  30.622  1.00 78.19  ? 945  ILE A CD1 1 
ATOM   7174  N  N   . ALA A 1 946  ? 57.965  20.575  33.264  1.00 74.60  ? 946  ALA A N   1 
ATOM   7175  C  CA  . ALA A 1 946  ? 57.055  21.560  33.822  1.00 75.54  ? 946  ALA A CA  1 
ATOM   7176  C  C   . ALA A 1 946  ? 55.711  20.915  34.157  1.00 73.90  ? 946  ALA A C   1 
ATOM   7177  O  O   . ALA A 1 946  ? 55.421  19.786  33.760  1.00 72.64  ? 946  ALA A O   1 
ATOM   7178  C  CB  . ALA A 1 946  ? 56.894  22.698  32.846  1.00 76.22  ? 946  ALA A CB  1 
ATOM   7179  N  N   . ARG A 1 947  ? 54.881  21.664  34.885  1.00 74.69  ? 947  ARG A N   1 
ATOM   7180  C  CA  . ARG A 1 947  ? 53.569  21.178  35.265  1.00 74.05  ? 947  ARG A CA  1 
ATOM   7181  C  C   . ARG A 1 947  ? 52.609  22.353  35.402  1.00 75.42  ? 947  ARG A C   1 
ATOM   7182  O  O   . ARG A 1 947  ? 53.034  23.489  35.626  1.00 78.15  ? 947  ARG A O   1 
ATOM   7183  C  CB  . ARG A 1 947  ? 53.657  20.448  36.603  1.00 74.94  ? 947  ARG A CB  1 
ATOM   7184  C  CG  . ARG A 1 947  ? 54.386  21.227  37.688  1.00 79.91  ? 947  ARG A CG  1 
ATOM   7185  C  CD  . ARG A 1 947  ? 54.260  20.473  38.997  1.00 82.41  ? 947  ARG A CD  1 
ATOM   7186  N  NE  . ARG A 1 947  ? 52.860  20.089  39.099  1.00 82.97  ? 947  ARG A NE  1 
ATOM   7187  C  CZ  . ARG A 1 947  ? 51.976  20.616  39.941  1.00 85.31  ? 947  ARG A CZ  1 
ATOM   7188  N  NH1 . ARG A 1 947  ? 52.347  21.535  40.817  1.00 88.49  ? 947  ARG A NH1 1 
ATOM   7189  N  NH2 . ARG A 1 947  ? 50.723  20.193  39.923  1.00 83.32  ? 947  ARG A NH2 1 
ATOM   7190  N  N   . ASP A 1 948  ? 51.310  22.045  35.294  1.00 73.18  ? 948  ASP A N   1 
ATOM   7191  C  CA  . ASP A 1 948  ? 50.266  23.033  35.483  1.00 72.36  ? 948  ASP A CA  1 
ATOM   7192  C  C   . ASP A 1 948  ? 49.804  23.047  36.940  1.00 73.79  ? 948  ASP A C   1 
ATOM   7193  O  O   . ASP A 1 948  ? 49.285  22.054  37.450  1.00 73.04  ? 948  ASP A O   1 
ATOM   7194  C  CB  . ASP A 1 948  ? 49.129  22.818  34.498  1.00 69.62  ? 948  ASP A CB  1 
ATOM   7195  C  CG  . ASP A 1 948  ? 48.128  23.945  34.582  1.00 71.07  ? 948  ASP A CG  1 
ATOM   7196  O  OD1 . ASP A 1 948  ? 48.370  24.866  35.385  1.00 73.46  ? 948  ASP A OD1 1 
ATOM   7197  O  OD2 . ASP A 1 948  ? 47.118  23.882  33.858  1.00 69.95  ? 948  ASP A OD2 1 
ATOM   7198  N  N   . PHE A 1 949  ? 49.975  24.214  37.574  1.00 76.66  ? 949  PHE A N   1 
ATOM   7199  C  CA  . PHE A 1 949  ? 49.877  24.372  39.015  1.00 78.70  ? 949  PHE A CA  1 
ATOM   7200  C  C   . PHE A 1 949  ? 48.451  24.736  39.408  1.00 78.03  ? 949  PHE A C   1 
ATOM   7201  O  O   . PHE A 1 949  ? 48.163  24.950  40.584  1.00 80.53  ? 949  PHE A O   1 
ATOM   7202  C  CB  . PHE A 1 949  ? 50.843  25.454  39.502  1.00 82.20  ? 949  PHE A CB  1 
ATOM   7203  C  CG  . PHE A 1 949  ? 52.288  25.041  39.611  1.00 83.50  ? 949  PHE A CG  1 
ATOM   7204  C  CD1 . PHE A 1 949  ? 52.662  23.939  40.366  1.00 83.74  ? 949  PHE A CD1 1 
ATOM   7205  C  CD2 . PHE A 1 949  ? 53.281  25.786  38.997  1.00 85.00  ? 949  PHE A CD2 1 
ATOM   7206  C  CE1 . PHE A 1 949  ? 53.996  23.578  40.481  1.00 84.78  ? 949  PHE A CE1 1 
ATOM   7207  C  CE2 . PHE A 1 949  ? 54.615  25.428  39.118  1.00 85.80  ? 949  PHE A CE2 1 
ATOM   7208  C  CZ  . PHE A 1 949  ? 54.968  24.321  39.853  1.00 86.01  ? 949  PHE A CZ  1 
ATOM   7209  N  N   . ASN A 1 950  ? 47.576  24.826  38.406  1.00 76.02  ? 950  ASN A N   1 
ATOM   7210  C  CA  . ASN A 1 950  ? 46.154  24.929  38.667  1.00 76.22  ? 950  ASN A CA  1 
ATOM   7211  C  C   . ASN A 1 950  ? 45.619  23.521  38.892  1.00 75.50  ? 950  ASN A C   1 
ATOM   7212  O  O   . ASN A 1 950  ? 45.916  22.626  38.104  1.00 75.32  ? 950  ASN A O   1 
ATOM   7213  C  CB  . ASN A 1 950  ? 45.417  25.567  37.491  1.00 75.92  ? 950  ASN A CB  1 
ATOM   7214  C  CG  . ASN A 1 950  ? 45.885  26.970  37.168  1.00 78.09  ? 950  ASN A CG  1 
ATOM   7215  O  OD1 . ASN A 1 950  ? 45.389  27.946  37.730  1.00 79.75  ? 950  ASN A OD1 1 
ATOM   7216  N  ND2 . ASN A 1 950  ? 46.822  27.085  36.242  1.00 78.16  ? 950  ASN A ND2 1 
ATOM   7217  N  N   . PRO A 1 951  ? 44.835  23.281  39.970  1.00 76.61  ? 951  PRO A N   1 
ATOM   7218  C  CA  . PRO A 1 951  ? 44.119  22.014  40.126  1.00 74.41  ? 951  PRO A CA  1 
ATOM   7219  C  C   . PRO A 1 951  ? 43.098  21.911  38.997  1.00 70.07  ? 951  PRO A C   1 
ATOM   7220  O  O   . PRO A 1 951  ? 42.457  22.897  38.645  1.00 67.54  ? 951  PRO A O   1 
ATOM   7221  C  CB  . PRO A 1 951  ? 43.436  22.138  41.499  1.00 77.56  ? 951  PRO A CB  1 
ATOM   7222  C  CG  . PRO A 1 951  ? 43.362  23.635  41.757  1.00 78.96  ? 951  PRO A CG  1 
ATOM   7223  C  CD  . PRO A 1 951  ? 44.587  24.216  41.081  1.00 78.61  ? 951  PRO A CD  1 
ATOM   7224  N  N   . ASN A 1 952  ? 43.022  20.728  38.395  1.00 67.55  ? 952  ASN A N   1 
ATOM   7225  C  CA  . ASN A 1 952  ? 42.081  20.465  37.328  1.00 66.89  ? 952  ASN A CA  1 
ATOM   7226  C  C   . ASN A 1 952  ? 41.760  18.985  37.380  1.00 66.69  ? 952  ASN A C   1 
ATOM   7227  O  O   . ASN A 1 952  ? 42.670  18.157  37.437  1.00 68.53  ? 952  ASN A O   1 
ATOM   7228  C  CB  . ASN A 1 952  ? 42.651  20.799  35.950  1.00 66.63  ? 952  ASN A CB  1 
ATOM   7229  C  CG  . ASN A 1 952  ? 42.443  22.237  35.534  1.00 68.12  ? 952  ASN A CG  1 
ATOM   7230  O  OD1 . ASN A 1 952  ? 41.315  22.725  35.474  1.00 69.49  ? 952  ASN A OD1 1 
ATOM   7231  N  ND2 . ASN A 1 952  ? 43.531  22.911  35.207  1.00 68.77  ? 952  ASN A ND2 1 
ATOM   7232  N  N   . TRP A 1 953  ? 40.461  18.688  37.373  1.00 65.59  ? 953  TRP A N   1 
ATOM   7233  C  CA  . TRP A 1 953  ? 40.000  17.319  37.387  1.00 62.70  ? 953  TRP A CA  1 
ATOM   7234  C  C   . TRP A 1 953  ? 39.889  16.846  35.949  1.00 60.31  ? 953  TRP A C   1 
ATOM   7235  O  O   . TRP A 1 953  ? 38.903  17.123  35.282  1.00 61.41  ? 953  TRP A O   1 
ATOM   7236  C  CB  . TRP A 1 953  ? 38.687  17.245  38.151  1.00 64.97  ? 953  TRP A CB  1 
ATOM   7237  C  CG  . TRP A 1 953  ? 38.941  17.323  39.619  1.00 67.91  ? 953  TRP A CG  1 
ATOM   7238  C  CD1 . TRP A 1 953  ? 39.394  18.395  40.330  1.00 70.66  ? 953  TRP A CD1 1 
ATOM   7239  C  CD2 . TRP A 1 953  ? 38.794  16.250  40.558  1.00 69.68  ? 953  TRP A CD2 1 
ATOM   7240  N  NE1 . TRP A 1 953  ? 39.531  18.066  41.652  1.00 73.30  ? 953  TRP A NE1 1 
ATOM   7241  C  CE2 . TRP A 1 953  ? 39.170  16.755  41.820  1.00 72.47  ? 953  TRP A CE2 1 
ATOM   7242  C  CE3 . TRP A 1 953  ? 38.369  14.921  40.454  1.00 69.43  ? 953  TRP A CE3 1 
ATOM   7243  C  CZ2 . TRP A 1 953  ? 39.129  15.968  42.970  1.00 74.23  ? 953  TRP A CZ2 1 
ATOM   7244  C  CZ3 . TRP A 1 953  ? 38.323  14.147  41.591  1.00 70.87  ? 953  TRP A CZ3 1 
ATOM   7245  C  CH2 . TRP A 1 953  ? 38.698  14.666  42.831  1.00 72.89  ? 953  TRP A CH2 1 
ATOM   7246  N  N   . MET A 1 954  ? 40.936  16.158  35.487  1.00 58.65  ? 954  MET A N   1 
ATOM   7247  C  CA  . MET A 1 954  ? 41.114  15.838  34.080  1.00 56.10  ? 954  MET A CA  1 
ATOM   7248  C  C   . MET A 1 954  ? 40.226  14.665  33.653  1.00 54.90  ? 954  MET A C   1 
ATOM   7249  O  O   . MET A 1 954  ? 39.950  13.743  34.431  1.00 53.91  ? 954  MET A O   1 
ATOM   7250  C  CB  . MET A 1 954  ? 42.581  15.508  33.810  1.00 54.49  ? 954  MET A CB  1 
ATOM   7251  C  CG  . MET A 1 954  ? 43.507  16.581  34.309  1.00 55.40  ? 954  MET A CG  1 
ATOM   7252  S  SD  . MET A 1 954  ? 43.099  18.193  33.609  1.00 56.24  ? 954  MET A SD  1 
ATOM   7253  C  CE  . MET A 1 954  ? 43.236  17.851  31.855  1.00 54.61  ? 954  MET A CE  1 
ATOM   7254  N  N   . SER A 1 955  ? 39.783  14.723  32.390  1.00 53.20  ? 955  SER A N   1 
ATOM   7255  C  CA  . SER A 1 955  ? 39.078  13.618  31.764  1.00 51.22  ? 955  SER A CA  1 
ATOM   7256  C  C   . SER A 1 955  ? 39.886  13.074  30.587  1.00 50.89  ? 955  SER A C   1 
ATOM   7257  O  O   . SER A 1 955  ? 39.850  11.878  30.300  1.00 51.32  ? 955  SER A O   1 
ATOM   7258  C  CB  . SER A 1 955  ? 37.716  14.033  31.336  1.00 50.17  ? 955  SER A CB  1 
ATOM   7259  O  OG  . SER A 1 955  ? 37.810  14.967  30.275  1.00 51.24  ? 955  SER A OG  1 
ATOM   7260  N  N   . ALA A 1 956  ? 40.627  13.954  29.906  1.00 50.60  ? 956  ALA A N   1 
ATOM   7261  C  CA  . ALA A 1 956  ? 41.406  13.544  28.750  1.00 50.35  ? 956  ALA A CA  1 
ATOM   7262  C  C   . ALA A 1 956  ? 42.528  14.551  28.524  1.00 51.46  ? 956  ALA A C   1 
ATOM   7263  O  O   . ALA A 1 956  ? 42.406  15.682  28.989  1.00 52.22  ? 956  ALA A O   1 
ATOM   7264  C  CB  . ALA A 1 956  ? 40.495  13.443  27.553  1.00 49.61  ? 956  ALA A CB  1 
ATOM   7265  N  N   . VAL A 1 957  ? 43.607  14.123  27.839  1.00 51.40  ? 957  VAL A N   1 
ATOM   7266  C  CA  . VAL A 1 957  ? 44.730  14.988  27.483  1.00 52.23  ? 957  VAL A CA  1 
ATOM   7267  C  C   . VAL A 1 957  ? 45.198  14.683  26.063  1.00 52.52  ? 957  VAL A C   1 
ATOM   7268  O  O   . VAL A 1 957  ? 45.079  13.555  25.595  1.00 51.35  ? 957  VAL A O   1 
ATOM   7269  C  CB  . VAL A 1 957  ? 45.916  14.878  28.465  1.00 52.54  ? 957  VAL A CB  1 
ATOM   7270  C  CG1 . VAL A 1 957  ? 45.525  15.178  29.899  1.00 53.21  ? 957  VAL A CG1 1 
ATOM   7271  C  CG2 . VAL A 1 957  ? 46.646  13.546  28.374  1.00 51.54  ? 957  VAL A CG2 1 
ATOM   7272  N  N   . GLU A 1 958  ? 45.776  15.691  25.399  1.00 54.73  ? 958  GLU A N   1 
ATOM   7273  C  CA  . GLU A 1 958  ? 46.418  15.477  24.111  1.00 57.19  ? 958  GLU A CA  1 
ATOM   7274  C  C   . GLU A 1 958  ? 47.636  16.389  23.968  1.00 59.80  ? 958  GLU A C   1 
ATOM   7275  O  O   . GLU A 1 958  ? 47.680  17.458  24.571  1.00 61.70  ? 958  GLU A O   1 
ATOM   7276  C  CB  . GLU A 1 958  ? 45.418  15.699  22.976  1.00 57.83  ? 958  GLU A CB  1 
ATOM   7277  C  CG  . GLU A 1 958  ? 45.878  15.180  21.626  1.00 60.50  ? 958  GLU A CG  1 
ATOM   7278  C  CD  . GLU A 1 958  ? 46.485  13.785  21.614  1.00 62.17  ? 958  GLU A CD  1 
ATOM   7279  O  OE1 . GLU A 1 958  ? 45.755  12.824  21.260  1.00 61.36  ? 958  GLU A OE1 1 
ATOM   7280  O  OE2 . GLU A 1 958  ? 47.700  13.664  21.928  1.00 63.50  ? 958  GLU A OE2 1 
ATOM   7281  N  N   . ILE A 1 959  ? 48.624  15.951  23.178  1.00 60.84  ? 959  ILE A N   1 
ATOM   7282  C  CA  . ILE A 1 959  ? 49.746  16.798  22.803  1.00 64.47  ? 959  ILE A CA  1 
ATOM   7283  C  C   . ILE A 1 959  ? 49.422  17.376  21.431  1.00 67.34  ? 959  ILE A C   1 
ATOM   7284  O  O   . ILE A 1 959  ? 49.270  16.625  20.473  1.00 68.55  ? 959  ILE A O   1 
ATOM   7285  C  CB  . ILE A 1 959  ? 51.075  16.005  22.802  1.00 64.45  ? 959  ILE A CB  1 
ATOM   7286  C  CG1 . ILE A 1 959  ? 51.518  15.622  24.215  1.00 62.72  ? 959  ILE A CG1 1 
ATOM   7287  C  CG2 . ILE A 1 959  ? 52.176  16.745  22.056  1.00 66.21  ? 959  ILE A CG2 1 
ATOM   7288  C  CD1 . ILE A 1 959  ? 52.264  14.320  24.270  1.00 62.26  ? 959  ILE A CD1 1 
ATOM   7289  N  N   . LEU A 1 960  ? 49.282  18.706  21.359  1.00 70.40  ? 960  LEU A N   1 
ATOM   7290  C  CA  . LEU A 1 960  ? 48.987  19.388  20.106  1.00 72.87  ? 960  LEU A CA  1 
ATOM   7291  C  C   . LEU A 1 960  ? 50.286  19.563  19.326  1.00 75.47  ? 960  LEU A C   1 
ATOM   7292  O  O   . LEU A 1 960  ? 50.314  19.365  18.115  1.00 76.93  ? 960  LEU A O   1 
ATOM   7293  C  CB  . LEU A 1 960  ? 48.349  20.751  20.399  1.00 72.78  ? 960  LEU A CB  1 
ATOM   7294  C  CG  . LEU A 1 960  ? 46.945  20.726  21.004  1.00 70.51  ? 960  LEU A CG  1 
ATOM   7295  C  CD1 . LEU A 1 960  ? 46.527  22.115  21.465  1.00 70.71  ? 960  LEU A CD1 1 
ATOM   7296  C  CD2 . LEU A 1 960  ? 45.934  20.173  20.013  1.00 69.91  ? 960  LEU A CD2 1 
ATOM   7297  N  N   . ASP A 1 961  ? 51.341  19.964  20.046  1.00 77.45  ? 961  ASP A N   1 
ATOM   7298  C  CA  . ASP A 1 961  ? 52.705  19.898  19.545  1.00 80.98  ? 961  ASP A CA  1 
ATOM   7299  C  C   . ASP A 1 961  ? 53.692  19.906  20.710  1.00 79.85  ? 961  ASP A C   1 
ATOM   7300  O  O   . ASP A 1 961  ? 53.320  19.701  21.861  1.00 77.64  ? 961  ASP A O   1 
ATOM   7301  C  CB  . ASP A 1 961  ? 52.999  20.981  18.500  1.00 85.84  ? 961  ASP A CB  1 
ATOM   7302  C  CG  . ASP A 1 961  ? 53.025  22.400  19.048  1.00 88.51  ? 961  ASP A CG  1 
ATOM   7303  O  OD1 . ASP A 1 961  ? 53.658  22.619  20.103  1.00 88.33  ? 961  ASP A OD1 1 
ATOM   7304  O  OD2 . ASP A 1 961  ? 52.423  23.285  18.404  1.00 91.27  ? 961  ASP A OD2 1 
ATOM   7305  N  N   . ASP A 1 962  ? 54.957  20.175  20.385  1.00 82.82  ? 962  ASP A N   1 
ATOM   7306  C  CA  . ASP A 1 962  ? 56.055  20.126  21.336  1.00 84.19  ? 962  ASP A CA  1 
ATOM   7307  C  C   . ASP A 1 962  ? 55.816  21.042  22.537  1.00 83.34  ? 962  ASP A C   1 
ATOM   7308  O  O   . ASP A 1 962  ? 56.253  20.718  23.641  1.00 81.18  ? 962  ASP A O   1 
ATOM   7309  C  CB  . ASP A 1 962  ? 57.388  20.407  20.640  1.00 88.34  ? 962  ASP A CB  1 
ATOM   7310  C  CG  . ASP A 1 962  ? 57.899  19.218  19.845  1.00 89.59  ? 962  ASP A CG  1 
ATOM   7311  O  OD1 . ASP A 1 962  ? 57.541  18.071  20.200  1.00 87.85  ? 962  ASP A OD1 1 
ATOM   7312  O  OD2 . ASP A 1 962  ? 58.651  19.444  18.883  1.00 93.66  ? 962  ASP A OD2 1 
ATOM   7313  N  N   . ASP A 1 963  ? 55.107  22.163  22.322  1.00 83.73  ? 963  ASP A N   1 
ATOM   7314  C  CA  . ASP A 1 963  ? 55.006  23.224  23.316  1.00 82.75  ? 963  ASP A CA  1 
ATOM   7315  C  C   . ASP A 1 963  ? 53.564  23.480  23.759  1.00 80.72  ? 963  ASP A C   1 
ATOM   7316  O  O   . ASP A 1 963  ? 53.330  24.399  24.546  1.00 81.52  ? 963  ASP A O   1 
ATOM   7317  C  CB  . ASP A 1 963  ? 55.652  24.514  22.808  1.00 85.84  ? 963  ASP A CB  1 
ATOM   7318  C  CG  . ASP A 1 963  ? 57.128  24.355  22.487  1.00 88.77  ? 963  ASP A CG  1 
ATOM   7319  O  OD1 . ASP A 1 963  ? 57.868  23.827  23.346  1.00 88.44  ? 963  ASP A OD1 1 
ATOM   7320  O  OD2 . ASP A 1 963  ? 57.523  24.750  21.376  1.00 91.04  ? 963  ASP A OD2 1 
ATOM   7321  N  N   . ASN A 1 964  ? 52.618  22.647  23.293  1.00 76.85  ? 964  ASN A N   1 
ATOM   7322  C  CA  . ASN A 1 964  ? 51.200  22.945  23.426  1.00 74.15  ? 964  ASN A CA  1 
ATOM   7323  C  C   . ASN A 1 964  ? 50.408  21.698  23.820  1.00 71.12  ? 964  ASN A C   1 
ATOM   7324  O  O   . ASN A 1 964  ? 50.362  20.715  23.082  1.00 70.76  ? 964  ASN A O   1 
ATOM   7325  C  CB  . ASN A 1 964  ? 50.665  23.616  22.161  1.00 75.11  ? 964  ASN A CB  1 
ATOM   7326  C  CG  . ASN A 1 964  ? 51.118  25.055  22.051  1.00 76.83  ? 964  ASN A CG  1 
ATOM   7327  O  OD1 . ASN A 1 964  ? 50.555  25.935  22.699  1.00 76.30  ? 964  ASN A OD1 1 
ATOM   7328  N  ND2 . ASN A 1 964  ? 52.142  25.294  21.247  1.00 78.78  ? 964  ASN A ND2 1 
ATOM   7329  N  N   . PHE A 1 965  ? 49.756  21.766  24.987  1.00 68.72  ? 965  PHE A N   1 
ATOM   7330  C  CA  . PHE A 1 965  ? 49.132  20.601  25.594  1.00 65.85  ? 965  PHE A CA  1 
ATOM   7331  C  C   . PHE A 1 965  ? 47.662  20.887  25.887  1.00 64.02  ? 965  PHE A C   1 
ATOM   7332  O  O   . PHE A 1 965  ? 47.331  21.877  26.537  1.00 65.06  ? 965  PHE A O   1 
ATOM   7333  C  CB  . PHE A 1 965  ? 49.936  20.147  26.818  1.00 65.80  ? 965  PHE A CB  1 
ATOM   7334  C  CG  . PHE A 1 965  ? 51.418  20.151  26.561  1.00 67.89  ? 965  PHE A CG  1 
ATOM   7335  C  CD1 . PHE A 1 965  ? 51.971  19.274  25.639  1.00 68.26  ? 965  PHE A CD1 1 
ATOM   7336  C  CD2 . PHE A 1 965  ? 52.249  21.066  27.189  1.00 69.63  ? 965  PHE A CD2 1 
ATOM   7337  C  CE1 . PHE A 1 965  ? 53.330  19.302  25.362  1.00 69.84  ? 965  PHE A CE1 1 
ATOM   7338  C  CE2 . PHE A 1 965  ? 53.608  21.087  26.915  1.00 71.43  ? 965  PHE A CE2 1 
ATOM   7339  C  CZ  . PHE A 1 965  ? 54.146  20.208  26.001  1.00 71.29  ? 965  PHE A CZ  1 
ATOM   7340  N  N   . LEU A 1 966  ? 46.794  19.994  25.401  1.00 61.11  ? 966  LEU A N   1 
ATOM   7341  C  CA  . LEU A 1 966  ? 45.357  20.189  25.445  1.00 59.94  ? 966  LEU A CA  1 
ATOM   7342  C  C   . LEU A 1 966  ? 44.762  19.307  26.530  1.00 58.08  ? 966  LEU A C   1 
ATOM   7343  O  O   . LEU A 1 966  ? 45.018  18.106  26.578  1.00 56.61  ? 966  LEU A O   1 
ATOM   7344  C  CB  . LEU A 1 966  ? 44.762  19.822  24.084  1.00 59.86  ? 966  LEU A CB  1 
ATOM   7345  C  CG  . LEU A 1 966  ? 43.245  19.941  23.966  1.00 59.14  ? 966  LEU A CG  1 
ATOM   7346  C  CD1 . LEU A 1 966  ? 42.798  21.381  24.171  1.00 60.18  ? 966  LEU A CD1 1 
ATOM   7347  C  CD2 . LEU A 1 966  ? 42.790  19.434  22.609  1.00 59.22  ? 966  LEU A CD2 1 
ATOM   7348  N  N   . GLY A 1 967  ? 43.946  19.928  27.379  1.00 58.29  ? 967  GLY A N   1 
ATOM   7349  C  CA  . GLY A 1 967  ? 43.301  19.207  28.461  1.00 57.85  ? 967  GLY A CA  1 
ATOM   7350  C  C   . GLY A 1 967  ? 41.798  19.452  28.464  1.00 57.77  ? 967  GLY A C   1 
ATOM   7351  O  O   . GLY A 1 967  ? 41.352  20.554  28.151  1.00 60.65  ? 967  GLY A O   1 
ATOM   7352  N  N   . ALA A 1 968  ? 41.033  18.408  28.797  1.00 55.39  ? 968  ALA A N   1 
ATOM   7353  C  CA  . ALA A 1 968  ? 39.604  18.538  29.021  1.00 53.87  ? 968  ALA A CA  1 
ATOM   7354  C  C   . ALA A 1 968  ? 39.300  18.121  30.454  1.00 53.52  ? 968  ALA A C   1 
ATOM   7355  O  O   . ALA A 1 968  ? 39.785  17.097  30.928  1.00 52.66  ? 968  ALA A O   1 
ATOM   7356  C  CB  . ALA A 1 968  ? 38.859  17.691  28.029  1.00 52.66  ? 968  ALA A CB  1 
ATOM   7357  N  N   . GLU A 1 969  ? 38.501  18.923  31.151  1.00 55.33  ? 969  GLU A N   1 
ATOM   7358  C  CA  . GLU A 1 969  ? 38.276  18.617  32.552  1.00 57.13  ? 969  GLU A CA  1 
ATOM   7359  C  C   . GLU A 1 969  ? 36.803  18.329  32.840  1.00 56.04  ? 969  GLU A C   1 
ATOM   7360  O  O   . GLU A 1 969  ? 36.017  18.105  31.921  1.00 55.50  ? 969  GLU A O   1 
ATOM   7361  C  CB  . GLU A 1 969  ? 38.936  19.668  33.439  1.00 61.18  ? 969  GLU A CB  1 
ATOM   7362  C  CG  . GLU A 1 969  ? 38.755  21.071  32.913  1.00 65.09  ? 969  GLU A CG  1 
ATOM   7363  C  CD  . GLU A 1 969  ? 37.417  21.658  33.312  1.00 68.82  ? 969  GLU A CD  1 
ATOM   7364  O  OE1 . GLU A 1 969  ? 36.381  21.194  32.786  1.00 69.60  ? 969  GLU A OE1 1 
ATOM   7365  O  OE2 . GLU A 1 969  ? 37.414  22.573  34.159  1.00 73.12  ? 969  GLU A OE2 1 
ATOM   7366  N  N   . ASN A 1 970  ? 36.468  18.319  34.136  1.00 55.49  ? 970  ASN A N   1 
ATOM   7367  C  CA  . ASN A 1 970  ? 35.290  17.652  34.667  1.00 56.03  ? 970  ASN A CA  1 
ATOM   7368  C  C   . ASN A 1 970  ? 34.114  18.627  34.715  1.00 56.92  ? 970  ASN A C   1 
ATOM   7369  O  O   . ASN A 1 970  ? 33.005  18.274  35.114  1.00 56.63  ? 970  ASN A O   1 
ATOM   7370  C  CB  . ASN A 1 970  ? 35.562  17.120  36.077  1.00 56.67  ? 970  ASN A CB  1 
ATOM   7371  C  CG  . ASN A 1 970  ? 35.364  18.154  37.172  1.00 58.53  ? 970  ASN A CG  1 
ATOM   7372  O  OD1 . ASN A 1 970  ? 35.486  19.354  36.956  1.00 59.23  ? 970  ASN A OD1 1 
ATOM   7373  N  ND2 . ASN A 1 970  ? 35.065  17.703  38.376  1.00 60.23  ? 970  ASN A ND2 1 
ATOM   7374  N  N   . ALA A 1 971  ? 34.402  19.874  34.346  1.00 57.39  ? 971  ALA A N   1 
ATOM   7375  C  CA  . ALA A 1 971  ? 33.434  20.947  34.404  1.00 58.74  ? 971  ALA A CA  1 
ATOM   7376  C  C   . ALA A 1 971  ? 33.066  21.341  32.978  1.00 59.24  ? 971  ALA A C   1 
ATOM   7377  O  O   . ALA A 1 971  ? 32.425  22.369  32.753  1.00 61.13  ? 971  ALA A O   1 
ATOM   7378  C  CB  . ALA A 1 971  ? 34.017  22.099  35.180  1.00 59.62  ? 971  ALA A CB  1 
ATOM   7379  N  N   . PHE A 1 972  ? 33.482  20.490  32.031  1.00 57.94  ? 972  PHE A N   1 
ATOM   7380  C  CA  . PHE A 1 972  ? 33.120  20.584  30.624  1.00 58.58  ? 972  PHE A CA  1 
ATOM   7381  C  C   . PHE A 1 972  ? 33.904  21.685  29.910  1.00 59.64  ? 972  PHE A C   1 
ATOM   7382  O  O   . PHE A 1 972  ? 33.444  22.209  28.896  1.00 60.89  ? 972  PHE A O   1 
ATOM   7383  C  CB  . PHE A 1 972  ? 31.609  20.757  30.464  1.00 59.31  ? 972  PHE A CB  1 
ATOM   7384  C  CG  . PHE A 1 972  ? 30.813  19.862  31.374  1.00 59.15  ? 972  PHE A CG  1 
ATOM   7385  C  CD1 . PHE A 1 972  ? 30.916  18.484  31.267  1.00 58.06  ? 972  PHE A CD1 1 
ATOM   7386  C  CD2 . PHE A 1 972  ? 29.984  20.396  32.349  1.00 59.73  ? 972  PHE A CD2 1 
ATOM   7387  C  CE1 . PHE A 1 972  ? 30.181  17.659  32.106  1.00 58.17  ? 972  PHE A CE1 1 
ATOM   7388  C  CE2 . PHE A 1 972  ? 29.257  19.570  33.189  1.00 59.57  ? 972  PHE A CE2 1 
ATOM   7389  C  CZ  . PHE A 1 972  ? 29.358  18.204  33.065  1.00 58.54  ? 972  PHE A CZ  1 
ATOM   7390  N  N   . ASN A 1 973  ? 35.102  21.999  30.418  1.00 59.00  ? 973  ASN A N   1 
ATOM   7391  C  CA  . ASN A 1 973  ? 35.947  23.007  29.799  1.00 58.93  ? 973  ASN A CA  1 
ATOM   7392  C  C   . ASN A 1 973  ? 37.117  22.339  29.085  1.00 58.17  ? 973  ASN A C   1 
ATOM   7393  O  O   . ASN A 1 973  ? 37.518  21.231  29.430  1.00 57.91  ? 973  ASN A O   1 
ATOM   7394  C  CB  . ASN A 1 973  ? 36.496  23.991  30.827  1.00 60.01  ? 973  ASN A CB  1 
ATOM   7395  C  CG  . ASN A 1 973  ? 35.438  24.644  31.689  1.00 61.64  ? 973  ASN A CG  1 
ATOM   7396  O  OD1 . ASN A 1 973  ? 34.717  25.531  31.238  1.00 62.64  ? 973  ASN A OD1 1 
ATOM   7397  N  ND2 . ASN A 1 973  ? 35.374  24.248  32.951  1.00 61.73  ? 973  ASN A ND2 1 
ATOM   7398  N  N   . LEU A 1 974  ? 37.640  23.027  28.068  1.00 58.64  ? 974  LEU A N   1 
ATOM   7399  C  CA  . LEU A 1 974  ? 38.928  22.722  27.467  1.00 58.52  ? 974  LEU A CA  1 
ATOM   7400  C  C   . LEU A 1 974  ? 39.925  23.781  27.925  1.00 61.24  ? 974  LEU A C   1 
ATOM   7401  O  O   . LEU A 1 974  ? 39.548  24.926  28.170  1.00 62.46  ? 974  LEU A O   1 
ATOM   7402  C  CB  . LEU A 1 974  ? 38.801  22.761  25.939  1.00 57.72  ? 974  LEU A CB  1 
ATOM   7403  C  CG  . LEU A 1 974  ? 37.919  21.689  25.299  1.00 55.87  ? 974  LEU A CG  1 
ATOM   7404  C  CD1 . LEU A 1 974  ? 38.017  21.735  23.782  1.00 54.97  ? 974  LEU A CD1 1 
ATOM   7405  C  CD2 . LEU A 1 974  ? 38.297  20.313  25.812  1.00 55.13  ? 974  LEU A CD2 1 
ATOM   7406  N  N   . PHE A 1 975  ? 41.199  23.396  28.042  1.00 63.13  ? 975  PHE A N   1 
ATOM   7407  C  CA  . PHE A 1 975  ? 42.260  24.369  28.253  1.00 66.24  ? 975  PHE A CA  1 
ATOM   7408  C  C   . PHE A 1 975  ? 43.529  23.903  27.556  1.00 65.98  ? 975  PHE A C   1 
ATOM   7409  O  O   . PHE A 1 975  ? 43.726  22.703  27.375  1.00 64.84  ? 975  PHE A O   1 
ATOM   7410  C  CB  . PHE A 1 975  ? 42.523  24.631  29.738  1.00 69.22  ? 975  PHE A CB  1 
ATOM   7411  C  CG  . PHE A 1 975  ? 43.060  23.461  30.523  1.00 71.25  ? 975  PHE A CG  1 
ATOM   7412  C  CD1 . PHE A 1 975  ? 42.196  22.562  31.134  1.00 71.75  ? 975  PHE A CD1 1 
ATOM   7413  C  CD2 . PHE A 1 975  ? 44.428  23.267  30.680  1.00 72.69  ? 975  PHE A CD2 1 
ATOM   7414  C  CE1 . PHE A 1 975  ? 42.690  21.489  31.868  1.00 72.76  ? 975  PHE A CE1 1 
ATOM   7415  C  CE2 . PHE A 1 975  ? 44.921  22.194  31.414  1.00 72.66  ? 975  PHE A CE2 1 
ATOM   7416  C  CZ  . PHE A 1 975  ? 44.052  21.305  32.007  1.00 72.19  ? 975  PHE A CZ  1 
ATOM   7417  N  N   . VAL A 1 976  ? 44.372  24.874  27.181  1.00 67.75  ? 976  VAL A N   1 
ATOM   7418  C  CA  . VAL A 1 976  ? 45.653  24.593  26.548  1.00 69.33  ? 976  VAL A CA  1 
ATOM   7419  C  C   . VAL A 1 976  ? 46.788  25.166  27.396  1.00 72.40  ? 976  VAL A C   1 
ATOM   7420  O  O   . VAL A 1 976  ? 46.766  26.341  27.764  1.00 74.46  ? 976  VAL A O   1 
ATOM   7421  C  CB  . VAL A 1 976  ? 45.712  25.101  25.093  1.00 69.35  ? 976  VAL A CB  1 
ATOM   7422  C  CG1 . VAL A 1 976  ? 47.111  24.982  24.506  1.00 70.72  ? 976  VAL A CG1 1 
ATOM   7423  C  CG2 . VAL A 1 976  ? 44.727  24.364  24.206  1.00 67.97  ? 976  VAL A CG2 1 
ATOM   7424  N  N   . CYS A 1 977  ? 47.797  24.323  27.659  1.00 73.66  ? 977  CYS A N   1 
ATOM   7425  C  CA  . CYS A 1 977  ? 48.989  24.691  28.410  1.00 76.45  ? 977  CYS A CA  1 
ATOM   7426  C  C   . CYS A 1 977  ? 50.182  24.922  27.488  1.00 78.33  ? 977  CYS A C   1 
ATOM   7427  O  O   . CYS A 1 977  ? 50.315  24.254  26.463  1.00 80.13  ? 977  CYS A O   1 
ATOM   7428  C  CB  . CYS A 1 977  ? 49.387  23.552  29.330  1.00 76.42  ? 977  CYS A CB  1 
ATOM   7429  S  SG  . CYS A 1 977  ? 48.557  23.676  30.927  1.00 82.92  ? 977  CYS A SG  1 
ATOM   7430  N  N   . GLN A 1 978  ? 51.081  25.826  27.900  1.00 78.79  ? 978  GLN A N   1 
ATOM   7431  C  CA  . GLN A 1 978  ? 52.321  26.045  27.173  1.00 78.84  ? 978  GLN A CA  1 
ATOM   7432  C  C   . GLN A 1 978  ? 53.513  26.064  28.122  1.00 80.55  ? 978  GLN A C   1 
ATOM   7433  O  O   . GLN A 1 978  ? 53.421  26.592  29.231  1.00 82.00  ? 978  GLN A O   1 
ATOM   7434  C  CB  . GLN A 1 978  ? 52.287  27.398  26.471  1.00 79.82  ? 978  GLN A CB  1 
ATOM   7435  C  CG  . GLN A 1 978  ? 51.996  27.312  24.984  1.00 79.14  ? 978  GLN A CG  1 
ATOM   7436  C  CD  . GLN A 1 978  ? 52.085  28.684  24.356  1.00 81.23  ? 978  GLN A CD  1 
ATOM   7437  O  OE1 . GLN A 1 978  ? 52.346  29.680  25.036  1.00 80.53  ? 978  GLN A OE1 1 
ATOM   7438  N  NE2 . GLN A 1 978  ? 51.856  28.759  23.052  1.00 82.18  ? 978  GLN A NE2 1 
ATOM   7439  N  N   . LYS A 1 979  ? 54.629  25.498  27.642  1.00 81.01  ? 979  LYS A N   1 
ATOM   7440  C  CA  . LYS A 1 979  ? 55.959  25.853  28.117  1.00 81.98  ? 979  LYS A CA  1 
ATOM   7441  C  C   . LYS A 1 979  ? 56.137  27.357  27.939  1.00 83.72  ? 979  LYS A C   1 
ATOM   7442  O  O   . LYS A 1 979  ? 55.716  27.917  26.930  1.00 83.41  ? 979  LYS A O   1 
ATOM   7443  C  CB  . LYS A 1 979  ? 57.037  25.213  27.238  1.00 82.61  ? 979  LYS A CB  1 
ATOM   7444  C  CG  . LYS A 1 979  ? 57.506  23.818  27.617  1.00 81.74  ? 979  LYS A CG  1 
ATOM   7445  C  CD  . LYS A 1 979  ? 58.537  23.300  26.636  1.00 83.57  ? 979  LYS A CD  1 
ATOM   7446  C  CE  . LYS A 1 979  ? 58.375  21.826  26.324  1.00 82.84  ? 979  LYS A CE  1 
ATOM   7447  N  NZ  . LYS A 1 979  ? 58.942  21.454  25.005  1.00 84.61  ? 979  LYS A NZ  1 
ATOM   7448  N  N   . ASP A 1 980  ? 56.789  27.996  28.910  1.00 85.80  ? 980  ASP A N   1 
ATOM   7449  C  CA  . ASP A 1 980  ? 57.009  29.432  28.873  1.00 89.47  ? 980  ASP A CA  1 
ATOM   7450  C  C   . ASP A 1 980  ? 58.206  29.745  27.971  1.00 92.51  ? 980  ASP A C   1 
ATOM   7451  O  O   . ASP A 1 980  ? 59.353  29.496  28.335  1.00 93.93  ? 980  ASP A O   1 
ATOM   7452  C  CB  . ASP A 1 980  ? 57.156  29.964  30.302  1.00 91.04  ? 980  ASP A CB  1 
ATOM   7453  C  CG  . ASP A 1 980  ? 57.047  31.471  30.457  1.00 93.71  ? 980  ASP A CG  1 
ATOM   7454  O  OD1 . ASP A 1 980  ? 56.649  32.154  29.484  1.00 94.13  ? 980  ASP A OD1 1 
ATOM   7455  O  OD2 . ASP A 1 980  ? 57.359  31.949  31.565  1.00 95.69  ? 980  ASP A OD2 1 
ATOM   7456  N  N   . SER A 1 981  ? 57.923  30.304  26.790  1.00 94.17  ? 981  SER A N   1 
ATOM   7457  C  CA  . SER A 1 981  ? 58.955  30.644  25.824  1.00 97.72  ? 981  SER A CA  1 
ATOM   7458  C  C   . SER A 1 981  ? 59.499  32.046  26.095  1.00 102.62 ? 981  SER A C   1 
ATOM   7459  O  O   . SER A 1 981  ? 60.007  32.704  25.187  1.00 107.21 ? 981  SER A O   1 
ATOM   7460  C  CB  . SER A 1 981  ? 58.445  30.504  24.408  1.00 97.60  ? 981  SER A CB  1 
ATOM   7461  O  OG  . SER A 1 981  ? 57.409  31.441  24.140  1.00 98.64  ? 981  SER A OG  1 
ATOM   7462  N  N   . ALA A 1 982  ? 59.385  32.495  27.352  1.00 102.91 ? 982  ALA A N   1 
ATOM   7463  C  CA  . ALA A 1 982  ? 59.958  33.757  27.797  1.00 105.91 ? 982  ALA A CA  1 
ATOM   7464  C  C   . ALA A 1 982  ? 60.666  33.555  29.136  1.00 106.46 ? 982  ALA A C   1 
ATOM   7465  O  O   . ALA A 1 982  ? 61.232  34.492  29.700  1.00 109.16 ? 982  ALA A O   1 
ATOM   7466  C  CB  . ALA A 1 982  ? 58.884  34.816  27.882  1.00 105.94 ? 982  ALA A CB  1 
ATOM   7467  N  N   . ALA A 1 983  ? 60.627  32.308  29.621  1.00 103.91 ? 983  ALA A N   1 
ATOM   7468  C  CA  . ALA A 1 983  ? 61.229  31.926  30.884  1.00 104.55 ? 983  ALA A CA  1 
ATOM   7469  C  C   . ALA A 1 983  ? 62.717  32.269  30.868  1.00 108.88 ? 983  ALA A C   1 
ATOM   7470  O  O   . ALA A 1 983  ? 63.475  31.755  30.046  1.00 109.72 ? 983  ALA A O   1 
ATOM   7471  C  CB  . ALA A 1 983  ? 60.991  30.457  31.128  1.00 100.75 ? 983  ALA A CB  1 
ATOM   7472  N  N   . THR A 1 984  ? 63.109  33.168  31.778  1.00 112.22 ? 984  THR A N   1 
ATOM   7473  C  CA  . THR A 1 984  ? 64.491  33.598  31.917  1.00 116.46 ? 984  THR A CA  1 
ATOM   7474  C  C   . THR A 1 984  ? 65.219  32.646  32.862  1.00 116.39 ? 984  THR A C   1 
ATOM   7475  O  O   . THR A 1 984  ? 66.319  32.192  32.559  1.00 118.71 ? 984  THR A O   1 
ATOM   7476  C  CB  . THR A 1 984  ? 64.575  35.048  32.412  1.00 120.25 ? 984  THR A CB  1 
ATOM   7477  O  OG1 . THR A 1 984  ? 64.061  35.094  33.743  1.00 119.94 ? 984  THR A OG1 1 
ATOM   7478  C  CG2 . THR A 1 984  ? 63.818  36.027  31.539  1.00 121.22 ? 984  THR A CG2 1 
ATOM   7479  N  N   . THR A 1 985  ? 64.585  32.359  34.007  1.00 115.06 ? 985  THR A N   1 
ATOM   7480  C  CA  . THR A 1 985  ? 65.141  31.481  35.026  1.00 115.03 ? 985  THR A CA  1 
ATOM   7481  C  C   . THR A 1 985  ? 64.564  30.077  34.860  1.00 111.11 ? 985  THR A C   1 
ATOM   7482  O  O   . THR A 1 985  ? 63.678  29.867  34.034  1.00 108.70 ? 985  THR A O   1 
ATOM   7483  C  CB  . THR A 1 985  ? 64.901  32.028  36.442  1.00 115.92 ? 985  THR A CB  1 
ATOM   7484  O  OG1 . THR A 1 985  ? 63.554  31.746  36.836  1.00 111.77 ? 985  THR A OG1 1 
ATOM   7485  C  CG2 . THR A 1 985  ? 65.230  33.501  36.576  1.00 119.16 ? 985  THR A CG2 1 
ATOM   7486  N  N   . ASP A 1 986  ? 65.071  29.138  35.673  1.00 111.42 ? 986  ASP A N   1 
ATOM   7487  C  CA  . ASP A 1 986  ? 64.719  27.726  35.599  1.00 108.98 ? 986  ASP A CA  1 
ATOM   7488  C  C   . ASP A 1 986  ? 63.421  27.449  36.357  1.00 106.65 ? 986  ASP A C   1 
ATOM   7489  O  O   . ASP A 1 986  ? 62.743  26.455  36.096  1.00 103.18 ? 986  ASP A O   1 
ATOM   7490  C  CB  . ASP A 1 986  ? 65.842  26.834  36.137  1.00 110.83 ? 986  ASP A CB  1 
ATOM   7491  C  CG  . ASP A 1 986  ? 66.967  26.600  35.148  1.00 113.43 ? 986  ASP A CG  1 
ATOM   7492  O  OD1 . ASP A 1 986  ? 66.657  26.343  33.960  1.00 111.93 ? 986  ASP A OD1 1 
ATOM   7493  O  OD2 . ASP A 1 986  ? 68.137  26.664  35.576  1.00 118.34 ? 986  ASP A OD2 1 
ATOM   7494  N  N   . GLU A 1 987  ? 63.090  28.328  37.308  1.00 108.41 ? 987  GLU A N   1 
ATOM   7495  C  CA  . GLU A 1 987  ? 61.864  28.184  38.074  1.00 105.58 ? 987  GLU A CA  1 
ATOM   7496  C  C   . GLU A 1 987  ? 60.677  28.492  37.163  1.00 102.26 ? 987  GLU A C   1 
ATOM   7497  O  O   . GLU A 1 987  ? 59.638  27.846  37.261  1.00 99.90  ? 987  GLU A O   1 
ATOM   7498  C  CB  . GLU A 1 987  ? 61.922  29.052  39.336  1.00 109.31 ? 987  GLU A CB  1 
ATOM   7499  C  CG  . GLU A 1 987  ? 60.742  28.853  40.274  1.00 108.75 ? 987  GLU A CG  1 
ATOM   7500  C  CD  . GLU A 1 987  ? 59.493  29.634  39.894  1.00 108.66 ? 987  GLU A CD  1 
ATOM   7501  O  OE1 . GLU A 1 987  ? 58.396  29.029  39.857  1.00 105.39 ? 987  GLU A OE1 1 
ATOM   7502  O  OE2 . GLU A 1 987  ? 59.620  30.852  39.639  1.00 111.47 ? 987  GLU A OE2 1 
ATOM   7503  N  N   . GLU A 1 988  ? 60.861  29.468  36.265  1.00 103.12 ? 988  GLU A N   1 
ATOM   7504  C  CA  . GLU A 1 988  ? 59.819  29.930  35.361  1.00 101.19 ? 988  GLU A CA  1 
ATOM   7505  C  C   . GLU A 1 988  ? 59.659  28.932  34.219  1.00 98.24  ? 988  GLU A C   1 
ATOM   7506  O  O   . GLU A 1 988  ? 58.607  28.865  33.584  1.00 95.50  ? 988  GLU A O   1 
ATOM   7507  C  CB  . GLU A 1 988  ? 60.189  31.298  34.784  1.00 105.01 ? 988  GLU A CB  1 
ATOM   7508  C  CG  . GLU A 1 988  ? 60.345  32.391  35.827  1.00 108.94 ? 988  GLU A CG  1 
ATOM   7509  C  CD  . GLU A 1 988  ? 61.058  33.637  35.325  1.00 114.22 ? 988  GLU A CD  1 
ATOM   7510  O  OE1 . GLU A 1 988  ? 61.186  33.783  34.089  1.00 115.31 ? 988  GLU A OE1 1 
ATOM   7511  O  OE2 . GLU A 1 988  ? 61.496  34.458  36.168  1.00 117.70 ? 988  GLU A OE2 1 
ATOM   7512  N  N   . ARG A 1 989  ? 60.730  28.167  33.979  1.00 98.65  ? 989  ARG A N   1 
ATOM   7513  C  CA  . ARG A 1 989  ? 60.841  27.216  32.886  1.00 97.61  ? 989  ARG A CA  1 
ATOM   7514  C  C   . ARG A 1 989  ? 59.908  26.037  33.159  1.00 92.88  ? 989  ARG A C   1 
ATOM   7515  O  O   . ARG A 1 989  ? 59.628  25.231  32.274  1.00 90.43  ? 989  ARG A O   1 
ATOM   7516  C  CB  . ARG A 1 989  ? 62.324  26.834  32.791  1.00 101.71 ? 989  ARG A CB  1 
ATOM   7517  C  CG  . ARG A 1 989  ? 62.720  25.906  31.652  1.00 104.23 ? 989  ARG A CG  1 
ATOM   7518  C  CD  . ARG A 1 989  ? 64.050  25.208  31.933  1.00 108.94 ? 989  ARG A CD  1 
ATOM   7519  N  NE  . ARG A 1 989  ? 64.072  24.307  33.091  1.00 109.72 ? 989  ARG A NE  1 
ATOM   7520  C  CZ  . ARG A 1 989  ? 63.393  23.154  33.206  1.00 107.56 ? 989  ARG A CZ  1 
ATOM   7521  N  NH1 . ARG A 1 989  ? 62.605  22.723  32.231  1.00 101.82 ? 989  ARG A NH1 1 
ATOM   7522  N  NH2 . ARG A 1 989  ? 63.500  22.436  34.312  1.00 107.80 ? 989  ARG A NH2 1 
ATOM   7523  N  N   . GLN A 1 990  ? 59.377  26.012  34.386  1.00 92.12  ? 990  GLN A N   1 
ATOM   7524  C  CA  . GLN A 1 990  ? 58.814  24.834  35.023  1.00 89.40  ? 990  GLN A CA  1 
ATOM   7525  C  C   . GLN A 1 990  ? 57.312  24.997  35.242  1.00 86.88  ? 990  GLN A C   1 
ATOM   7526  O  O   . GLN A 1 990  ? 56.666  24.084  35.755  1.00 85.02  ? 990  GLN A O   1 
ATOM   7527  C  CB  . GLN A 1 990  ? 59.480  24.625  36.384  1.00 91.63  ? 990  GLN A CB  1 
ATOM   7528  C  CG  . GLN A 1 990  ? 60.697  23.712  36.367  1.00 92.98  ? 990  GLN A CG  1 
ATOM   7529  C  CD  . GLN A 1 990  ? 61.067  23.312  37.775  1.00 94.78  ? 990  GLN A CD  1 
ATOM   7530  O  OE1 . GLN A 1 990  ? 60.895  22.161  38.175  1.00 94.49  ? 990  GLN A OE1 1 
ATOM   7531  N  NE2 . GLN A 1 990  ? 61.549  24.272  38.551  1.00 96.68  ? 990  GLN A NE2 1 
ATOM   7532  N  N   . HIS A 1 991  ? 56.765  26.163  34.875  1.00 87.64  ? 991  HIS A N   1 
ATOM   7533  C  CA  . HIS A 1 991  ? 55.328  26.379  34.903  1.00 85.66  ? 991  HIS A CA  1 
ATOM   7534  C  C   . HIS A 1 991  ? 54.759  26.159  33.515  1.00 83.34  ? 991  HIS A C   1 
ATOM   7535  O  O   . HIS A 1 991  ? 55.271  26.715  32.545  1.00 84.85  ? 991  HIS A O   1 
ATOM   7536  C  CB  . HIS A 1 991  ? 54.982  27.828  35.229  1.00 89.25  ? 991  HIS A CB  1 
ATOM   7537  C  CG  . HIS A 1 991  ? 55.127  28.167  36.666  1.00 94.58  ? 991  HIS A CG  1 
ATOM   7538  N  ND1 . HIS A 1 991  ? 56.273  27.861  37.385  1.00 97.53  ? 991  HIS A ND1 1 
ATOM   7539  C  CD2 . HIS A 1 991  ? 54.296  28.815  37.509  1.00 96.88  ? 991  HIS A CD2 1 
ATOM   7540  C  CE1 . HIS A 1 991  ? 56.138  28.301  38.619  1.00 100.46 ? 991  HIS A CE1 1 
ATOM   7541  N  NE2 . HIS A 1 991  ? 54.934  28.891  38.719  1.00 100.88 ? 991  HIS A NE2 1 
ATOM   7542  N  N   . LEU A 1 992  ? 53.688  25.368  33.441  1.00 79.51  ? 992  LEU A N   1 
ATOM   7543  C  CA  . LEU A 1 992  ? 52.884  25.371  32.237  1.00 77.36  ? 992  LEU A CA  1 
ATOM   7544  C  C   . LEU A 1 992  ? 51.854  26.482  32.405  1.00 78.63  ? 992  LEU A C   1 
ATOM   7545  O  O   . LEU A 1 992  ? 51.201  26.561  33.441  1.00 78.89  ? 992  LEU A O   1 
ATOM   7546  C  CB  . LEU A 1 992  ? 52.266  23.984  32.040  1.00 73.42  ? 992  LEU A CB  1 
ATOM   7547  C  CG  . LEU A 1 992  ? 53.268  22.892  31.662  1.00 72.01  ? 992  LEU A CG  1 
ATOM   7548  C  CD1 . LEU A 1 992  ? 52.622  21.518  31.683  1.00 69.36  ? 992  LEU A CD1 1 
ATOM   7549  C  CD2 . LEU A 1 992  ? 53.900  23.170  30.304  1.00 72.02  ? 992  LEU A CD2 1 
ATOM   7550  N  N   . GLN A 1 993  ? 51.787  27.386  31.422  1.00 81.07  ? 993  GLN A N   1 
ATOM   7551  C  CA  . GLN A 1 993  ? 50.898  28.534  31.508  1.00 83.07  ? 993  GLN A CA  1 
ATOM   7552  C  C   . GLN A 1 993  ? 49.638  28.264  30.700  1.00 79.83  ? 993  GLN A C   1 
ATOM   7553  O  O   . GLN A 1 993  ? 49.715  27.872  29.536  1.00 78.64  ? 993  GLN A O   1 
ATOM   7554  C  CB  . GLN A 1 993  ? 51.555  29.794  30.954  1.00 89.17  ? 993  GLN A CB  1 
ATOM   7555  C  CG  . GLN A 1 993  ? 52.714  30.307  31.790  1.00 95.37  ? 993  GLN A CG  1 
ATOM   7556  C  CD  . GLN A 1 993  ? 53.287  31.530  31.119  1.00 101.34 ? 993  GLN A CD  1 
ATOM   7557  O  OE1 . GLN A 1 993  ? 53.027  31.791  29.943  1.00 103.28 ? 993  GLN A OE1 1 
ATOM   7558  N  NE2 . GLN A 1 993  ? 54.050  32.307  31.871  1.00 105.65 ? 993  GLN A NE2 1 
ATOM   7559  N  N   . GLU A 1 994  ? 48.487  28.494  31.340  1.00 78.15  ? 994  GLU A N   1 
ATOM   7560  C  CA  . GLU A 1 994  ? 47.202  28.201  30.729  1.00 75.94  ? 994  GLU A CA  1 
ATOM   7561  C  C   . GLU A 1 994  ? 46.839  29.338  29.783  1.00 75.31  ? 994  GLU A C   1 
ATOM   7562  O  O   . GLU A 1 994  ? 46.342  30.374  30.217  1.00 75.34  ? 994  GLU A O   1 
ATOM   7563  C  CB  . GLU A 1 994  ? 46.130  27.960  31.794  1.00 77.27  ? 994  GLU A CB  1 
ATOM   7564  C  CG  . GLU A 1 994  ? 46.065  26.514  32.257  1.00 77.07  ? 994  GLU A CG  1 
ATOM   7565  C  CD  . GLU A 1 994  ? 45.020  26.187  33.308  1.00 77.08  ? 994  GLU A CD  1 
ATOM   7566  O  OE1 . GLU A 1 994  ? 44.148  27.040  33.572  1.00 78.73  ? 994  GLU A OE1 1 
ATOM   7567  O  OE2 . GLU A 1 994  ? 45.084  25.074  33.860  1.00 77.59  ? 994  GLU A OE2 1 
ATOM   7568  N  N   . VAL A 1 995  ? 47.093  29.122  28.487  1.00 74.25  ? 995  VAL A N   1 
ATOM   7569  C  CA  . VAL A 1 995  ? 47.016  30.182  27.488  1.00 74.83  ? 995  VAL A CA  1 
ATOM   7570  C  C   . VAL A 1 995  ? 45.727  30.084  26.671  1.00 73.04  ? 995  VAL A C   1 
ATOM   7571  O  O   . VAL A 1 995  ? 45.416  31.003  25.916  1.00 73.24  ? 995  VAL A O   1 
ATOM   7572  C  CB  . VAL A 1 995  ? 48.244  30.211  26.558  1.00 75.44  ? 995  VAL A CB  1 
ATOM   7573  C  CG1 . VAL A 1 995  ? 49.503  30.634  27.293  1.00 77.38  ? 995  VAL A CG1 1 
ATOM   7574  C  CG2 . VAL A 1 995  ? 48.437  28.901  25.804  1.00 73.40  ? 995  VAL A CG2 1 
ATOM   7575  N  N   . GLY A 1 996  ? 45.006  28.964  26.802  1.00 70.45  ? 996  GLY A N   1 
ATOM   7576  C  CA  . GLY A 1 996  ? 43.706  28.791  26.174  1.00 69.73  ? 996  GLY A CA  1 
ATOM   7577  C  C   . GLY A 1 996  ? 42.687  28.248  27.170  1.00 68.38  ? 996  GLY A C   1 
ATOM   7578  O  O   . GLY A 1 996  ? 43.004  27.341  27.935  1.00 67.90  ? 996  GLY A O   1 
ATOM   7579  N  N   . LEU A 1 997  ? 41.483  28.834  27.172  1.00 68.63  ? 997  LEU A N   1 
ATOM   7580  C  CA  . LEU A 1 997  ? 40.369  28.399  28.008  1.00 67.75  ? 997  LEU A CA  1 
ATOM   7581  C  C   . LEU A 1 997  ? 39.076  28.509  27.200  1.00 68.18  ? 997  LEU A C   1 
ATOM   7582  O  O   . LEU A 1 997  ? 38.894  29.482  26.473  1.00 70.08  ? 997  LEU A O   1 
ATOM   7583  C  CB  . LEU A 1 997  ? 40.263  29.306  29.241  1.00 68.32  ? 997  LEU A CB  1 
ATOM   7584  C  CG  . LEU A 1 997  ? 41.478  29.414  30.158  1.00 68.54  ? 997  LEU A CG  1 
ATOM   7585  C  CD1 . LEU A 1 997  ? 41.266  30.525  31.173  1.00 70.26  ? 997  LEU A CD1 1 
ATOM   7586  C  CD2 . LEU A 1 997  ? 41.744  28.102  30.873  1.00 67.09  ? 997  LEU A CD2 1 
ATOM   7587  N  N   . PHE A 1 998  ? 38.167  27.535  27.358  1.00 66.69  ? 998  PHE A N   1 
ATOM   7588  C  CA  . PHE A 1 998  ? 36.960  27.453  26.551  1.00 65.79  ? 998  PHE A CA  1 
ATOM   7589  C  C   . PHE A 1 998  ? 35.968  26.502  27.205  1.00 64.84  ? 998  PHE A C   1 
ATOM   7590  O  O   . PHE A 1 998  ? 36.321  25.364  27.506  1.00 63.79  ? 998  PHE A O   1 
ATOM   7591  C  CB  . PHE A 1 998  ? 37.296  26.845  25.192  1.00 65.32  ? 998  PHE A CB  1 
ATOM   7592  C  CG  . PHE A 1 998  ? 36.179  26.850  24.181  1.00 66.76  ? 998  PHE A CG  1 
ATOM   7593  C  CD1 . PHE A 1 998  ? 35.784  28.032  23.575  1.00 68.38  ? 998  PHE A CD1 1 
ATOM   7594  C  CD2 . PHE A 1 998  ? 35.543  25.672  23.809  1.00 65.82  ? 998  PHE A CD2 1 
ATOM   7595  C  CE1 . PHE A 1 998  ? 34.772  28.042  22.627  1.00 68.69  ? 998  PHE A CE1 1 
ATOM   7596  C  CE2 . PHE A 1 998  ? 34.531  25.681  22.858  1.00 66.14  ? 998  PHE A CE2 1 
ATOM   7597  C  CZ  . PHE A 1 998  ? 34.150  26.867  22.270  1.00 67.84  ? 998  PHE A CZ  1 
ATOM   7598  N  N   . HIS A 1 999  ? 34.729  26.966  27.408  1.00 65.83  ? 999  HIS A N   1 
ATOM   7599  C  CA  . HIS A 1 999  ? 33.688  26.076  27.895  1.00 64.83  ? 999  HIS A CA  1 
ATOM   7600  C  C   . HIS A 1 999  ? 33.091  25.326  26.711  1.00 64.01  ? 999  HIS A C   1 
ATOM   7601  O  O   . HIS A 1 999  ? 32.527  25.940  25.811  1.00 65.29  ? 999  HIS A O   1 
ATOM   7602  C  CB  . HIS A 1 999  ? 32.633  26.834  28.703  1.00 67.32  ? 999  HIS A CB  1 
ATOM   7603  C  CG  . HIS A 1 999  ? 31.656  25.914  29.349  1.00 67.97  ? 999  HIS A CG  1 
ATOM   7604  N  ND1 . HIS A 1 999  ? 31.957  25.219  30.503  1.00 68.12  ? 999  HIS A ND1 1 
ATOM   7605  C  CD2 . HIS A 1 999  ? 30.412  25.534  28.989  1.00 68.88  ? 999  HIS A CD2 1 
ATOM   7606  C  CE1 . HIS A 1 999  ? 30.937  24.456  30.837  1.00 68.31  ? 999  HIS A CE1 1 
ATOM   7607  N  NE2 . HIS A 1 999  ? 29.973  24.633  29.923  1.00 69.40  ? 999  HIS A NE2 1 
ATOM   7608  N  N   . LEU A 1 1000 ? 33.248  23.998  26.703  1.00 62.85  ? 1000 LEU A N   1 
ATOM   7609  C  CA  . LEU A 1 1000 ? 32.818  23.195  25.567  1.00 63.03  ? 1000 LEU A CA  1 
ATOM   7610  C  C   . LEU A 1 1000 ? 31.386  22.706  25.766  1.00 63.99  ? 1000 LEU A C   1 
ATOM   7611  O  O   . LEU A 1 1000 ? 30.623  22.617  24.811  1.00 66.81  ? 1000 LEU A O   1 
ATOM   7612  C  CB  . LEU A 1 1000 ? 33.771  22.013  25.361  1.00 61.30  ? 1000 LEU A CB  1 
ATOM   7613  C  CG  . LEU A 1 1000 ? 33.302  20.962  24.352  1.00 60.25  ? 1000 LEU A CG  1 
ATOM   7614  C  CD1 . LEU A 1 1000 ? 33.271  21.516  22.934  1.00 60.79  ? 1000 LEU A CD1 1 
ATOM   7615  C  CD2 . LEU A 1 1000 ? 34.173  19.721  24.417  1.00 58.86  ? 1000 LEU A CD2 1 
ATOM   7616  N  N   . GLY A 1 1001 ? 31.032  22.352  27.002  1.00 63.58  ? 1001 GLY A N   1 
ATOM   7617  C  CA  . GLY A 1 1001 ? 29.675  21.931  27.293  1.00 63.11  ? 1001 GLY A CA  1 
ATOM   7618  C  C   . GLY A 1 1001 ? 29.516  20.422  27.153  1.00 61.97  ? 1001 GLY A C   1 
ATOM   7619  O  O   . GLY A 1 1001 ? 28.429  19.891  27.370  1.00 61.90  ? 1001 GLY A O   1 
ATOM   7620  N  N   . GLU A 1 1002 ? 30.617  19.748  26.797  1.00 61.60  ? 1002 GLU A N   1 
ATOM   7621  C  CA  . GLU A 1 1002 ? 30.654  18.295  26.705  1.00 61.08  ? 1002 GLU A CA  1 
ATOM   7622  C  C   . GLU A 1 1002 ? 31.670  17.742  27.708  1.00 58.41  ? 1002 GLU A C   1 
ATOM   7623  O  O   . GLU A 1 1002 ? 32.448  18.496  28.281  1.00 58.85  ? 1002 GLU A O   1 
ATOM   7624  C  CB  . GLU A 1 1002 ? 30.954  17.866  25.268  1.00 62.67  ? 1002 GLU A CB  1 
ATOM   7625  C  CG  . GLU A 1 1002 ? 29.897  18.316  24.275  1.00 67.95  ? 1002 GLU A CG  1 
ATOM   7626  C  CD  . GLU A 1 1002 ? 28.618  17.493  24.218  1.00 72.16  ? 1002 GLU A CD  1 
ATOM   7627  O  OE1 . GLU A 1 1002 ? 28.571  16.425  24.869  1.00 73.85  ? 1002 GLU A OE1 1 
ATOM   7628  O  OE2 . GLU A 1 1002 ? 27.676  17.911  23.503  1.00 76.62  ? 1002 GLU A OE2 1 
ATOM   7629  N  N   . PHE A 1 1003 ? 31.616  16.426  27.945  1.00 55.91  ? 1003 PHE A N   1 
ATOM   7630  C  CA  . PHE A 1 1003 ? 32.609  15.707  28.732  1.00 54.22  ? 1003 PHE A CA  1 
ATOM   7631  C  C   . PHE A 1 1003 ? 33.441  14.815  27.804  1.00 53.48  ? 1003 PHE A C   1 
ATOM   7632  O  O   . PHE A 1 1003 ? 32.935  13.845  27.237  1.00 52.72  ? 1003 PHE A O   1 
ATOM   7633  C  CB  . PHE A 1 1003 ? 31.927  14.890  29.833  1.00 52.43  ? 1003 PHE A CB  1 
ATOM   7634  C  CG  . PHE A 1 1003 ? 32.836  14.275  30.869  1.00 51.47  ? 1003 PHE A CG  1 
ATOM   7635  C  CD1 . PHE A 1 1003 ? 33.502  13.080  30.635  1.00 49.70  ? 1003 PHE A CD1 1 
ATOM   7636  C  CD2 . PHE A 1 1003 ? 33.002  14.879  32.108  1.00 52.33  ? 1003 PHE A CD2 1 
ATOM   7637  C  CE1 . PHE A 1 1003 ? 34.306  12.513  31.614  1.00 48.58  ? 1003 PHE A CE1 1 
ATOM   7638  C  CE2 . PHE A 1 1003 ? 33.821  14.321  33.080  1.00 50.58  ? 1003 PHE A CE2 1 
ATOM   7639  C  CZ  . PHE A 1 1003 ? 34.464  13.132  32.834  1.00 49.09  ? 1003 PHE A CZ  1 
ATOM   7640  N  N   . VAL A 1 1004 ? 34.730  15.147  27.657  1.00 52.98  ? 1004 VAL A N   1 
ATOM   7641  C  CA  . VAL A 1 1004 ? 35.584  14.469  26.690  1.00 51.66  ? 1004 VAL A CA  1 
ATOM   7642  C  C   . VAL A 1 1004 ? 36.167  13.202  27.322  1.00 51.08  ? 1004 VAL A C   1 
ATOM   7643  O  O   . VAL A 1 1004 ? 36.687  13.235  28.430  1.00 52.05  ? 1004 VAL A O   1 
ATOM   7644  C  CB  . VAL A 1 1004 ? 36.662  15.422  26.132  1.00 50.72  ? 1004 VAL A CB  1 
ATOM   7645  C  CG1 . VAL A 1 1004 ? 37.613  14.726  25.175  1.00 50.04  ? 1004 VAL A CG1 1 
ATOM   7646  C  CG2 . VAL A 1 1004 ? 36.050  16.642  25.459  1.00 50.81  ? 1004 VAL A CG2 1 
ATOM   7647  N  N   . ASN A 1 1005 ? 36.056  12.069  26.625  1.00 50.74  ? 1005 ASN A N   1 
ATOM   7648  C  CA  . ASN A 1 1005 ? 36.606  10.817  27.121  1.00 51.07  ? 1005 ASN A CA  1 
ATOM   7649  C  C   . ASN A 1 1005 ? 37.881  10.448  26.363  1.00 52.00  ? 1005 ASN A C   1 
ATOM   7650  O  O   . ASN A 1 1005 ? 38.750  9.755   26.887  1.00 51.66  ? 1005 ASN A O   1 
ATOM   7651  C  CB  . ASN A 1 1005 ? 35.616  9.666   26.967  1.00 50.67  ? 1005 ASN A CB  1 
ATOM   7652  C  CG  . ASN A 1 1005 ? 34.715  9.507   28.167  1.00 51.29  ? 1005 ASN A CG  1 
ATOM   7653  O  OD1 . ASN A 1 1005 ? 34.964  10.090  29.217  1.00 51.77  ? 1005 ASN A OD1 1 
ATOM   7654  N  ND2 . ASN A 1 1005 ? 33.672  8.708   28.019  1.00 52.62  ? 1005 ASN A ND2 1 
ATOM   7655  N  N   . VAL A 1 1006 ? 37.980  10.897  25.111  1.00 52.89  ? 1006 VAL A N   1 
ATOM   7656  C  CA  . VAL A 1 1006 ? 39.087  10.487  24.268  1.00 52.75  ? 1006 VAL A CA  1 
ATOM   7657  C  C   . VAL A 1 1006 ? 39.505  11.650  23.368  1.00 54.85  ? 1006 VAL A C   1 
ATOM   7658  O  O   . VAL A 1 1006 ? 38.667  12.423  22.908  1.00 56.02  ? 1006 VAL A O   1 
ATOM   7659  C  CB  . VAL A 1 1006 ? 38.730  9.219   23.470  1.00 51.43  ? 1006 VAL A CB  1 
ATOM   7660  C  CG1 . VAL A 1 1006 ? 37.450  9.394   22.670  1.00 51.04  ? 1006 VAL A CG1 1 
ATOM   7661  C  CG2 . VAL A 1 1006 ? 39.874  8.758   22.578  1.00 50.71  ? 1006 VAL A CG2 1 
ATOM   7662  N  N   . PHE A 1 1007 ? 40.822  11.772  23.160  1.00 54.82  ? 1007 PHE A N   1 
ATOM   7663  C  CA  . PHE A 1 1007 ? 41.407  12.693  22.202  1.00 56.68  ? 1007 PHE A CA  1 
ATOM   7664  C  C   . PHE A 1 1007 ? 42.214  11.876  21.197  1.00 59.78  ? 1007 PHE A C   1 
ATOM   7665  O  O   . PHE A 1 1007 ? 42.881  10.912  21.564  1.00 62.47  ? 1007 PHE A O   1 
ATOM   7666  C  CB  . PHE A 1 1007 ? 42.305  13.715  22.905  1.00 55.53  ? 1007 PHE A CB  1 
ATOM   7667  C  CG  . PHE A 1 1007 ? 41.610  14.944  23.439  1.00 55.33  ? 1007 PHE A CG  1 
ATOM   7668  C  CD1 . PHE A 1 1007 ? 40.859  15.756  22.600  1.00 56.20  ? 1007 PHE A CD1 1 
ATOM   7669  C  CD2 . PHE A 1 1007 ? 41.723  15.313  24.775  1.00 54.38  ? 1007 PHE A CD2 1 
ATOM   7670  C  CE1 . PHE A 1 1007 ? 40.218  16.890  23.082  1.00 56.06  ? 1007 PHE A CE1 1 
ATOM   7671  C  CE2 . PHE A 1 1007 ? 41.079  16.446  25.257  1.00 55.29  ? 1007 PHE A CE2 1 
ATOM   7672  C  CZ  . PHE A 1 1007 ? 40.330  17.237  24.410  1.00 55.52  ? 1007 PHE A CZ  1 
ATOM   7673  N  N   . CYS A 1 1008 ? 42.158  12.268  19.925  1.00 62.78  ? 1008 CYS A N   1 
ATOM   7674  C  CA  . CYS A 1 1008 ? 42.701  11.436  18.868  1.00 64.13  ? 1008 CYS A CA  1 
ATOM   7675  C  C   . CYS A 1 1008 ? 43.228  12.304  17.730  1.00 66.34  ? 1008 CYS A C   1 
ATOM   7676  O  O   . CYS A 1 1008 ? 42.519  13.178  17.240  1.00 70.10  ? 1008 CYS A O   1 
ATOM   7677  C  CB  . CYS A 1 1008 ? 41.591  10.555  18.321  1.00 65.67  ? 1008 CYS A CB  1 
ATOM   7678  S  SG  . CYS A 1 1008 ? 42.205  8.954   17.755  1.00 73.83  ? 1008 CYS A SG  1 
ATOM   7679  N  N   . HIS A 1 1009 ? 44.467  12.053  17.297  1.00 65.22  ? 1009 HIS A N   1 
ATOM   7680  C  CA  . HIS A 1 1009 ? 44.978  12.719  16.111  1.00 66.85  ? 1009 HIS A CA  1 
ATOM   7681  C  C   . HIS A 1 1009 ? 44.410  12.013  14.884  1.00 68.34  ? 1009 HIS A C   1 
ATOM   7682  O  O   . HIS A 1 1009 ? 44.521  10.797  14.767  1.00 68.05  ? 1009 HIS A O   1 
ATOM   7683  C  CB  . HIS A 1 1009 ? 46.517  12.748  16.102  1.00 66.82  ? 1009 HIS A CB  1 
ATOM   7684  C  CG  . HIS A 1 1009 ? 47.103  13.677  17.113  1.00 66.32  ? 1009 HIS A CG  1 
ATOM   7685  N  ND1 . HIS A 1 1009 ? 47.376  15.001  16.825  1.00 67.52  ? 1009 HIS A ND1 1 
ATOM   7686  C  CD2 . HIS A 1 1009 ? 47.453  13.488  18.404  1.00 64.59  ? 1009 HIS A CD2 1 
ATOM   7687  C  CE1 . HIS A 1 1009 ? 47.867  15.589  17.897  1.00 67.12  ? 1009 HIS A CE1 1 
ATOM   7688  N  NE2 . HIS A 1 1009 ? 47.923  14.681  18.881  1.00 64.92  ? 1009 HIS A NE2 1 
ATOM   7689  N  N   . GLY A 1 1010 ? 43.781  12.779  13.986  1.00 70.54  ? 1010 GLY A N   1 
ATOM   7690  C  CA  . GLY A 1 1010 ? 43.292  12.225  12.733  1.00 72.37  ? 1010 GLY A CA  1 
ATOM   7691  C  C   . GLY A 1 1010 ? 42.211  13.090  12.090  1.00 74.49  ? 1010 GLY A C   1 
ATOM   7692  O  O   . GLY A 1 1010 ? 41.853  14.148  12.606  1.00 74.91  ? 1010 GLY A O   1 
ATOM   7693  N  N   . SER A 1 1011 ? 41.684  12.608  10.960  1.00 76.26  ? 1011 SER A N   1 
ATOM   7694  C  CA  . SER A 1 1011 ? 40.700  13.357  10.199  1.00 78.28  ? 1011 SER A CA  1 
ATOM   7695  C  C   . SER A 1 1011 ? 39.799  12.414  9.402   1.00 79.80  ? 1011 SER A C   1 
ATOM   7696  O  O   . SER A 1 1011 ? 40.249  11.381  8.902   1.00 80.07  ? 1011 SER A O   1 
ATOM   7697  C  CB  . SER A 1 1011 ? 41.388  14.349  9.301   1.00 81.27  ? 1011 SER A CB  1 
ATOM   7698  O  OG  . SER A 1 1011 ? 40.440  15.147  8.605   1.00 84.33  ? 1011 SER A OG  1 
ATOM   7699  N  N   . LEU A 1 1012 ? 38.525  12.805  9.272   1.00 80.24  ? 1012 LEU A N   1 
ATOM   7700  C  CA  . LEU A 1 1012 ? 37.564  12.066  8.470   1.00 81.12  ? 1012 LEU A CA  1 
ATOM   7701  C  C   . LEU A 1 1012 ? 37.626  12.543  7.017   1.00 84.74  ? 1012 LEU A C   1 
ATOM   7702  O  O   . LEU A 1 1012 ? 36.932  12.011  6.150   1.00 86.48  ? 1012 LEU A O   1 
ATOM   7703  C  CB  . LEU A 1 1012 ? 36.172  12.267  9.075   1.00 79.37  ? 1012 LEU A CB  1 
ATOM   7704  C  CG  . LEU A 1 1012 ? 35.866  11.441  10.323  1.00 76.07  ? 1012 LEU A CG  1 
ATOM   7705  C  CD1 . LEU A 1 1012 ? 34.599  11.950  10.997  1.00 74.46  ? 1012 LEU A CD1 1 
ATOM   7706  C  CD2 . LEU A 1 1012 ? 35.722  9.970   9.960   1.00 77.20  ? 1012 LEU A CD2 1 
ATOM   7707  N  N   . VAL A 1 1013 ? 38.477  13.545  6.761   1.00 86.29  ? 1013 VAL A N   1 
ATOM   7708  C  CA  . VAL A 1 1013 ? 38.595  14.147  5.442   1.00 91.02  ? 1013 VAL A CA  1 
ATOM   7709  C  C   . VAL A 1 1013 ? 39.758  13.486  4.708   1.00 95.45  ? 1013 VAL A C   1 
ATOM   7710  O  O   . VAL A 1 1013 ? 40.662  12.936  5.340   1.00 95.29  ? 1013 VAL A O   1 
ATOM   7711  C  CB  . VAL A 1 1013 ? 38.760  15.681  5.523   1.00 91.09  ? 1013 VAL A CB  1 
ATOM   7712  C  CG1 . VAL A 1 1013 ? 38.927  16.323  4.152   1.00 94.82  ? 1013 VAL A CG1 1 
ATOM   7713  C  CG2 . VAL A 1 1013 ? 37.609  16.343  6.263   1.00 89.09  ? 1013 VAL A CG2 1 
ATOM   7714  N  N   . MET A 1 1014 ? 39.708  13.555  3.368   1.00 102.67 ? 1014 MET A N   1 
ATOM   7715  C  CA  . MET A 1 1014 ? 40.709  12.984  2.477   1.00 109.72 ? 1014 MET A CA  1 
ATOM   7716  C  C   . MET A 1 1014 ? 42.097  13.513  2.830   1.00 112.11 ? 1014 MET A C   1 
ATOM   7717  O  O   . MET A 1 1014 ? 43.029  12.728  3.023   1.00 113.97 ? 1014 MET A O   1 
ATOM   7718  C  CB  . MET A 1 1014 ? 40.411  13.329  1.013   1.00 115.76 ? 1014 MET A CB  1 
ATOM   7719  C  CG  . MET A 1 1014 ? 39.214  12.595  0.446   1.00 121.36 ? 1014 MET A CG  1 
ATOM   7720  S  SD  . MET A 1 1014 ? 38.694  13.120  -1.218  1.00 138.34 ? 1014 MET A SD  1 
ATOM   7721  C  CE  . MET A 1 1014 ? 39.934  12.317  -2.234  1.00 136.44 ? 1014 MET A CE  1 
ATOM   7722  N  N   . GLN A 1 1015 ? 42.207  14.850  2.901   1.00 113.48 ? 1015 GLN A N   1 
ATOM   7723  C  CA  . GLN A 1 1015 ? 43.438  15.566  3.209   1.00 114.98 ? 1015 GLN A CA  1 
ATOM   7724  C  C   . GLN A 1 1015 ? 44.482  15.311  2.111   1.00 118.27 ? 1015 GLN A C   1 
ATOM   7725  O  O   . GLN A 1 1015 ? 45.468  14.602  2.409   1.00 118.73 ? 1015 GLN A O   1 
ATOM   7726  C  CB  . GLN A 1 1015 ? 43.956  15.236  4.614   1.00 111.21 ? 1015 GLN A CB  1 
ATOM   7727  C  CG  . GLN A 1 1015 ? 43.286  16.043  5.715   1.00 110.27 ? 1015 GLN A CG  1 
ATOM   7728  C  CD  . GLN A 1 1015 ? 43.965  15.840  7.047   1.00 110.90 ? 1015 GLN A CD  1 
ATOM   7729  O  OE1 . GLN A 1 1015 ? 44.216  14.713  7.475   1.00 111.56 ? 1015 GLN A OE1 1 
ATOM   7730  N  NE2 . GLN A 1 1015 ? 44.263  16.941  7.720   1.00 111.37 ? 1015 GLN A NE2 1 
ATOM   7731  N  N   . THR A 1 1022 ? 47.242  25.918  3.919   1.00 113.78 ? 1022 THR A N   1 
ATOM   7732  C  CA  . THR A 1 1022 ? 46.037  25.498  4.694   1.00 111.03 ? 1022 THR A CA  1 
ATOM   7733  C  C   . THR A 1 1022 ? 45.798  26.454  5.865   1.00 110.27 ? 1022 THR A C   1 
ATOM   7734  O  O   . THR A 1 1022 ? 46.712  26.737  6.641   1.00 110.22 ? 1022 THR A O   1 
ATOM   7735  C  CB  . THR A 1 1022 ? 46.086  24.017  5.111   1.00 107.12 ? 1022 THR A CB  1 
ATOM   7736  O  OG1 . THR A 1 1022 ? 44.918  23.744  5.889   1.00 103.80 ? 1022 THR A OG1 1 
ATOM   7737  C  CG2 . THR A 1 1022 ? 47.325  23.641  5.899   1.00 105.82 ? 1022 THR A CG2 1 
ATOM   7738  N  N   . PRO A 1 1023 ? 44.552  26.967  6.030   1.00 110.25 ? 1023 PRO A N   1 
ATOM   7739  C  CA  . PRO A 1 1023 ? 44.217  27.890  7.122   1.00 108.77 ? 1023 PRO A CA  1 
ATOM   7740  C  C   . PRO A 1 1023 ? 44.357  27.326  8.536   1.00 104.85 ? 1023 PRO A C   1 
ATOM   7741  O  O   . PRO A 1 1023 ? 44.307  28.077  9.510   1.00 103.82 ? 1023 PRO A O   1 
ATOM   7742  C  CB  . PRO A 1 1023 ? 42.728  28.204  6.890   1.00 109.02 ? 1023 PRO A CB  1 
ATOM   7743  C  CG  . PRO A 1 1023 ? 42.480  27.870  5.432   1.00 110.77 ? 1023 PRO A CG  1 
ATOM   7744  C  CD  . PRO A 1 1023 ? 43.404  26.706  5.143   1.00 110.38 ? 1023 PRO A CD  1 
ATOM   7745  N  N   . THR A 1 1024 ? 44.509  25.999  8.634   1.00 103.05 ? 1024 THR A N   1 
ATOM   7746  C  CA  . THR A 1 1024 ? 44.590  25.314  9.915   1.00 101.08 ? 1024 THR A CA  1 
ATOM   7747  C  C   . THR A 1 1024 ? 45.740  24.310  9.897   1.00 101.25 ? 1024 THR A C   1 
ATOM   7748  O  O   . THR A 1 1024 ? 46.086  23.779  8.841   1.00 104.18 ? 1024 THR A O   1 
ATOM   7749  C  CB  . THR A 1 1024 ? 43.268  24.611  10.255  1.00 99.71  ? 1024 THR A CB  1 
ATOM   7750  O  OG1 . THR A 1 1024 ? 42.966  23.670  9.222   1.00 102.14 ? 1024 THR A OG1 1 
ATOM   7751  C  CG2 . THR A 1 1024 ? 42.109  25.567  10.440  1.00 99.13  ? 1024 THR A CG2 1 
ATOM   7752  N  N   . GLN A 1 1025 ? 46.321  24.066  11.082  1.00 99.29  ? 1025 GLN A N   1 
ATOM   7753  C  CA  . GLN A 1 1025 ? 47.397  23.103  11.269  1.00 97.50  ? 1025 GLN A CA  1 
ATOM   7754  C  C   . GLN A 1 1025 ? 46.950  22.069  12.300  1.00 92.34  ? 1025 GLN A C   1 
ATOM   7755  O  O   . GLN A 1 1025 ? 46.443  22.434  13.359  1.00 91.42  ? 1025 GLN A O   1 
ATOM   7756  C  CB  . GLN A 1 1025 ? 48.675  23.778  11.782  1.00 100.09 ? 1025 GLN A CB  1 
ATOM   7757  C  CG  . GLN A 1 1025 ? 49.114  25.026  11.021  1.00 104.89 ? 1025 GLN A CG  1 
ATOM   7758  C  CD  . GLN A 1 1025 ? 50.255  25.744  11.707  1.00 107.77 ? 1025 GLN A CD  1 
ATOM   7759  O  OE1 . GLN A 1 1025 ? 51.037  26.458  11.076  1.00 110.98 ? 1025 GLN A OE1 1 
ATOM   7760  N  NE2 . GLN A 1 1025 ? 50.369  25.557  13.015  1.00 106.30 ? 1025 GLN A NE2 1 
ATOM   7761  N  N   . GLY A 1 1026 ? 47.144  20.784  11.978  1.00 89.72  ? 1026 GLY A N   1 
ATOM   7762  C  CA  . GLY A 1 1026 ? 46.839  19.700  12.900  1.00 85.90  ? 1026 GLY A CA  1 
ATOM   7763  C  C   . GLY A 1 1026 ? 45.344  19.399  12.958  1.00 83.04  ? 1026 GLY A C   1 
ATOM   7764  O  O   . GLY A 1 1026 ? 44.527  20.172  12.461  1.00 85.19  ? 1026 GLY A O   1 
ATOM   7765  N  N   . SER A 1 1027 ? 45.002  18.266  13.579  1.00 79.53  ? 1027 SER A N   1 
ATOM   7766  C  CA  . SER A 1 1027 ? 43.630  17.787  13.609  1.00 76.60  ? 1027 SER A CA  1 
ATOM   7767  C  C   . SER A 1 1027 ? 43.474  16.786  14.751  1.00 73.63  ? 1027 SER A C   1 
ATOM   7768  O  O   . SER A 1 1027 ? 44.030  15.688  14.705  1.00 75.03  ? 1027 SER A O   1 
ATOM   7769  C  CB  . SER A 1 1027 ? 43.256  17.187  12.276  1.00 77.03  ? 1027 SER A CB  1 
ATOM   7770  O  OG  . SER A 1 1027 ? 41.899  16.788  12.259  1.00 75.99  ? 1027 SER A OG  1 
ATOM   7771  N  N   . VAL A 1 1028 ? 42.757  17.201  15.798  1.00 70.26  ? 1028 VAL A N   1 
ATOM   7772  C  CA  . VAL A 1 1028 ? 42.486  16.337  16.934  1.00 67.74  ? 1028 VAL A CA  1 
ATOM   7773  C  C   . VAL A 1 1028 ? 40.975  16.155  17.023  1.00 66.28  ? 1028 VAL A C   1 
ATOM   7774  O  O   . VAL A 1 1028 ? 40.249  17.135  17.176  1.00 66.68  ? 1028 VAL A O   1 
ATOM   7775  C  CB  . VAL A 1 1028 ? 43.068  16.910  18.245  1.00 67.64  ? 1028 VAL A CB  1 
ATOM   7776  C  CG1 . VAL A 1 1028 ? 42.775  16.032  19.454  1.00 64.50  ? 1028 VAL A CG1 1 
ATOM   7777  C  CG2 . VAL A 1 1028 ? 44.559  17.178  18.133  1.00 69.61  ? 1028 VAL A CG2 1 
ATOM   7778  N  N   . LEU A 1 1029 ? 40.521  14.902  16.894  1.00 64.47  ? 1029 LEU A N   1 
ATOM   7779  C  CA  . LEU A 1 1029 ? 39.123  14.544  17.074  1.00 63.09  ? 1029 LEU A CA  1 
ATOM   7780  C  C   . LEU A 1 1029 ? 38.914  14.193  18.540  1.00 61.00  ? 1029 LEU A C   1 
ATOM   7781  O  O   . LEU A 1 1029 ? 39.843  13.718  19.186  1.00 61.40  ? 1029 LEU A O   1 
ATOM   7782  C  CB  . LEU A 1 1029 ? 38.819  13.327  16.198  1.00 62.86  ? 1029 LEU A CB  1 
ATOM   7783  C  CG  . LEU A 1 1029 ? 38.943  13.556  14.697  1.00 64.80  ? 1029 LEU A CG  1 
ATOM   7784  C  CD1 . LEU A 1 1029 ? 39.047  12.228  13.970  1.00 64.70  ? 1029 LEU A CD1 1 
ATOM   7785  C  CD2 . LEU A 1 1029 ? 37.758  14.356  14.185  1.00 66.22  ? 1029 LEU A CD2 1 
ATOM   7786  N  N   . PHE A 1 1030 ? 37.705  14.432  19.059  1.00 59.27  ? 1030 PHE A N   1 
ATOM   7787  C  CA  . PHE A 1 1030 ? 37.416  14.010  20.420  1.00 57.78  ? 1030 PHE A CA  1 
ATOM   7788  C  C   . PHE A 1 1030 ? 36.062  13.321  20.489  1.00 56.48  ? 1030 PHE A C   1 
ATOM   7789  O  O   . PHE A 1 1030 ? 35.199  13.565  19.658  1.00 58.36  ? 1030 PHE A O   1 
ATOM   7790  C  CB  . PHE A 1 1030 ? 37.608  15.135  21.441  1.00 58.55  ? 1030 PHE A CB  1 
ATOM   7791  C  CG  . PHE A 1 1030 ? 36.836  16.409  21.208  1.00 60.37  ? 1030 PHE A CG  1 
ATOM   7792  C  CD1 . PHE A 1 1030 ? 37.282  17.357  20.303  1.00 61.74  ? 1030 PHE A CD1 1 
ATOM   7793  C  CD2 . PHE A 1 1030 ? 35.693  16.692  21.940  1.00 61.22  ? 1030 PHE A CD2 1 
ATOM   7794  C  CE1 . PHE A 1 1030 ? 36.585  18.540  20.114  1.00 63.15  ? 1030 PHE A CE1 1 
ATOM   7795  C  CE2 . PHE A 1 1030 ? 34.987  17.870  21.741  1.00 62.07  ? 1030 PHE A CE2 1 
ATOM   7796  C  CZ  . PHE A 1 1030 ? 35.439  18.796  20.832  1.00 63.00  ? 1030 PHE A CZ  1 
ATOM   7797  N  N   . GLY A 1 1031 ? 35.918  12.427  21.469  1.00 55.37  ? 1031 GLY A N   1 
ATOM   7798  C  CA  . GLY A 1 1031 ? 34.678  11.710  21.711  1.00 54.56  ? 1031 GLY A CA  1 
ATOM   7799  C  C   . GLY A 1 1031 ? 34.175  11.975  23.124  1.00 54.34  ? 1031 GLY A C   1 
ATOM   7800  O  O   . GLY A 1 1031 ? 34.961  12.008  24.073  1.00 54.20  ? 1031 GLY A O   1 
ATOM   7801  N  N   . THR A 1 1032 ? 32.852  12.121  23.238  1.00 54.59  ? 1032 THR A N   1 
ATOM   7802  C  CA  . THR A 1 1032 ? 32.198  12.665  24.415  1.00 55.13  ? 1032 THR A CA  1 
ATOM   7803  C  C   . THR A 1 1032 ? 31.169  11.686  24.982  1.00 54.23  ? 1032 THR A C   1 
ATOM   7804  O  O   . THR A 1 1032 ? 30.737  10.759  24.300  1.00 53.75  ? 1032 THR A O   1 
ATOM   7805  C  CB  . THR A 1 1032 ? 31.553  14.008  24.055  1.00 57.52  ? 1032 THR A CB  1 
ATOM   7806  O  OG1 . THR A 1 1032 ? 30.593  13.802  23.017  1.00 59.34  ? 1032 THR A OG1 1 
ATOM   7807  C  CG2 . THR A 1 1032 ? 32.574  15.027  23.599  1.00 57.55  ? 1032 THR A CG2 1 
ATOM   7808  N  N   . VAL A 1 1033 ? 30.776  11.918  26.242  1.00 53.96  ? 1033 VAL A N   1 
ATOM   7809  C  CA  . VAL A 1 1033 ? 29.739  11.141  26.905  1.00 54.03  ? 1033 VAL A CA  1 
ATOM   7810  C  C   . VAL A 1 1033 ? 28.439  11.254  26.111  1.00 56.35  ? 1033 VAL A C   1 
ATOM   7811  O  O   . VAL A 1 1033 ? 27.750  10.259  25.941  1.00 59.20  ? 1033 VAL A O   1 
ATOM   7812  C  CB  . VAL A 1 1033 ? 29.570  11.541  28.386  1.00 52.92  ? 1033 VAL A CB  1 
ATOM   7813  C  CG1 . VAL A 1 1033 ? 28.223  11.143  28.961  1.00 52.55  ? 1033 VAL A CG1 1 
ATOM   7814  C  CG2 . VAL A 1 1033 ? 30.694  10.995  29.250  1.00 51.13  ? 1033 VAL A CG2 1 
ATOM   7815  N  N   . ASN A 1 1034 ? 28.137  12.444  25.581  1.00 57.41  ? 1034 ASN A N   1 
ATOM   7816  C  CA  . ASN A 1 1034 ? 26.866  12.675  24.914  1.00 58.35  ? 1034 ASN A CA  1 
ATOM   7817  C  C   . ASN A 1 1034 ? 26.875  12.138  23.483  1.00 58.71  ? 1034 ASN A C   1 
ATOM   7818  O  O   . ASN A 1 1034 ? 25.851  12.182  22.804  1.00 58.89  ? 1034 ASN A O   1 
ATOM   7819  C  CB  . ASN A 1 1034 ? 26.442  14.136  25.032  1.00 60.58  ? 1034 ASN A CB  1 
ATOM   7820  C  CG  . ASN A 1 1034 ? 25.768  14.425  26.356  1.00 62.69  ? 1034 ASN A CG  1 
ATOM   7821  O  OD1 . ASN A 1 1034 ? 24.783  13.780  26.712  1.00 64.54  ? 1034 ASN A OD1 1 
ATOM   7822  N  ND2 . ASN A 1 1034 ? 26.272  15.405  27.084  1.00 63.75  ? 1034 ASN A ND2 1 
ATOM   7823  N  N   . GLY A 1 1035 ? 28.031  11.619  23.042  1.00 58.36  ? 1035 GLY A N   1 
ATOM   7824  C  CA  . GLY A 1 1035 ? 28.181  11.032  21.716  1.00 58.54  ? 1035 GLY A CA  1 
ATOM   7825  C  C   . GLY A 1 1035 ? 28.498  12.075  20.646  1.00 59.04  ? 1035 GLY A C   1 
ATOM   7826  O  O   . GLY A 1 1035 ? 28.356  11.810  19.453  1.00 59.31  ? 1035 GLY A O   1 
ATOM   7827  N  N   . MET A 1 1036 ? 28.912  13.264  21.102  1.00 59.01  ? 1036 MET A N   1 
ATOM   7828  C  CA  . MET A 1 1036 ? 29.350  14.328  20.220  1.00 59.73  ? 1036 MET A CA  1 
ATOM   7829  C  C   . MET A 1 1036 ? 30.757  14.004  19.729  1.00 58.55  ? 1036 MET A C   1 
ATOM   7830  O  O   . MET A 1 1036 ? 31.579  13.469  20.464  1.00 58.06  ? 1036 MET A O   1 
ATOM   7831  C  CB  . MET A 1 1036 ? 29.374  15.672  20.953  1.00 60.91  ? 1036 MET A CB  1 
ATOM   7832  C  CG  . MET A 1 1036 ? 29.843  16.799  20.061  1.00 64.40  ? 1036 MET A CG  1 
ATOM   7833  S  SD  . MET A 1 1036 ? 30.912  17.980  20.904  1.00 67.14  ? 1036 MET A SD  1 
ATOM   7834  C  CE  . MET A 1 1036 ? 31.944  18.531  19.550  1.00 66.54  ? 1036 MET A CE  1 
ATOM   7835  N  N   . ILE A 1 1037 ? 31.032  14.319  18.469  1.00 59.18  ? 1037 ILE A N   1 
ATOM   7836  C  CA  . ILE A 1 1037 ? 32.394  14.215  17.986  1.00 59.60  ? 1037 ILE A CA  1 
ATOM   7837  C  C   . ILE A 1 1037 ? 32.833  15.602  17.542  1.00 61.95  ? 1037 ILE A C   1 
ATOM   7838  O  O   . ILE A 1 1037 ? 32.175  16.223  16.710  1.00 64.32  ? 1037 ILE A O   1 
ATOM   7839  C  CB  . ILE A 1 1037 ? 32.514  13.191  16.843  1.00 59.73  ? 1037 ILE A CB  1 
ATOM   7840  C  CG1 . ILE A 1 1037 ? 32.118  11.784  17.295  1.00 59.18  ? 1037 ILE A CG1 1 
ATOM   7841  C  CG2 . ILE A 1 1037 ? 33.914  13.213  16.250  1.00 58.74  ? 1037 ILE A CG2 1 
ATOM   7842  C  CD1 . ILE A 1 1037 ? 31.998  10.799  16.152  1.00 60.01  ? 1037 ILE A CD1 1 
ATOM   7843  N  N   . GLY A 1 1038 ? 33.948  16.074  18.109  1.00 61.60  ? 1038 GLY A N   1 
ATOM   7844  C  CA  . GLY A 1 1038 ? 34.475  17.380  17.759  1.00 62.69  ? 1038 GLY A CA  1 
ATOM   7845  C  C   . GLY A 1 1038 ? 35.841  17.297  17.091  1.00 63.03  ? 1038 GLY A C   1 
ATOM   7846  O  O   . GLY A 1 1038 ? 36.438  16.227  16.979  1.00 62.74  ? 1038 GLY A O   1 
ATOM   7847  N  N   . LEU A 1 1039 ? 36.323  18.459  16.656  1.00 64.01  ? 1039 LEU A N   1 
ATOM   7848  C  CA  . LEU A 1 1039 ? 37.639  18.555  16.060  1.00 65.63  ? 1039 LEU A CA  1 
ATOM   7849  C  C   . LEU A 1 1039 ? 38.305  19.826  16.577  1.00 66.88  ? 1039 LEU A C   1 
ATOM   7850  O  O   . LEU A 1 1039 ? 37.712  20.899  16.513  1.00 68.99  ? 1039 LEU A O   1 
ATOM   7851  C  CB  . LEU A 1 1039 ? 37.452  18.592  14.542  1.00 66.75  ? 1039 LEU A CB  1 
ATOM   7852  C  CG  . LEU A 1 1039 ? 38.730  18.655  13.714  1.00 68.47  ? 1039 LEU A CG  1 
ATOM   7853  C  CD1 . LEU A 1 1039 ? 39.600  17.440  13.985  1.00 68.41  ? 1039 LEU A CD1 1 
ATOM   7854  C  CD2 . LEU A 1 1039 ? 38.390  18.739  12.236  1.00 70.09  ? 1039 LEU A CD2 1 
ATOM   7855  N  N   . VAL A 1 1040 ? 39.516  19.684  17.125  1.00 66.35  ? 1040 VAL A N   1 
ATOM   7856  C  CA  . VAL A 1 1040 ? 40.320  20.835  17.501  1.00 67.98  ? 1040 VAL A CA  1 
ATOM   7857  C  C   . VAL A 1 1040 ? 41.426  20.975  16.459  1.00 70.44  ? 1040 VAL A C   1 
ATOM   7858  O  O   . VAL A 1 1040 ? 41.998  19.978  16.022  1.00 71.57  ? 1040 VAL A O   1 
ATOM   7859  C  CB  . VAL A 1 1040 ? 40.875  20.708  18.935  1.00 66.35  ? 1040 VAL A CB  1 
ATOM   7860  C  CG1 . VAL A 1 1040 ? 41.836  21.835  19.278  1.00 67.36  ? 1040 VAL A CG1 1 
ATOM   7861  C  CG2 . VAL A 1 1040 ? 39.760  20.636  19.968  1.00 64.50  ? 1040 VAL A CG2 1 
ATOM   7862  N  N   . THR A 1 1041 ? 41.681  22.216  16.034  1.00 72.52  ? 1041 THR A N   1 
ATOM   7863  C  CA  . THR A 1 1041 ? 42.800  22.511  15.155  1.00 74.94  ? 1041 THR A CA  1 
ATOM   7864  C  C   . THR A 1 1041 ? 43.444  23.832  15.585  1.00 76.48  ? 1041 THR A C   1 
ATOM   7865  O  O   . THR A 1 1041 ? 42.866  24.573  16.379  1.00 76.37  ? 1041 THR A O   1 
ATOM   7866  C  CB  . THR A 1 1041 ? 42.360  22.452  13.687  1.00 76.37  ? 1041 THR A CB  1 
ATOM   7867  O  OG1 . THR A 1 1041 ? 43.519  22.486  12.853  1.00 79.38  ? 1041 THR A OG1 1 
ATOM   7868  C  CG2 . THR A 1 1041 ? 41.427  23.583  13.311  1.00 78.36  ? 1041 THR A CG2 1 
ATOM   7869  N  N   . SER A 1 1042 ? 44.636  24.121  15.047  1.00 77.88  ? 1042 SER A N   1 
ATOM   7870  C  CA  . SER A 1 1042 ? 45.394  25.297  15.446  1.00 79.03  ? 1042 SER A CA  1 
ATOM   7871  C  C   . SER A 1 1042 ? 45.388  26.346  14.343  1.00 80.77  ? 1042 SER A C   1 
ATOM   7872  O  O   . SER A 1 1042 ? 45.252  26.010  13.171  1.00 81.88  ? 1042 SER A O   1 
ATOM   7873  C  CB  . SER A 1 1042 ? 46.790  24.917  15.846  1.00 80.60  ? 1042 SER A CB  1 
ATOM   7874  O  OG  . SER A 1 1042 ? 46.753  24.050  16.973  1.00 79.26  ? 1042 SER A OG  1 
ATOM   7875  N  N   . LEU A 1 1043 ? 45.537  27.612  14.749  1.00 81.79  ? 1043 LEU A N   1 
ATOM   7876  C  CA  . LEU A 1 1043 ? 45.538  28.745  13.836  1.00 85.19  ? 1043 LEU A CA  1 
ATOM   7877  C  C   . LEU A 1 1043 ? 46.816  29.562  14.019  1.00 86.86  ? 1043 LEU A C   1 
ATOM   7878  O  O   . LEU A 1 1043 ? 47.483  29.462  15.046  1.00 84.92  ? 1043 LEU A O   1 
ATOM   7879  C  CB  . LEU A 1 1043 ? 44.315  29.620  14.138  1.00 85.33  ? 1043 LEU A CB  1 
ATOM   7880  C  CG  . LEU A 1 1043 ? 42.951  28.928  14.124  1.00 83.76  ? 1043 LEU A CG  1 
ATOM   7881  C  CD1 . LEU A 1 1043 ? 41.929  29.733  14.918  1.00 82.99  ? 1043 LEU A CD1 1 
ATOM   7882  C  CD2 . LEU A 1 1043 ? 42.458  28.699  12.699  1.00 85.65  ? 1043 LEU A CD2 1 
ATOM   7883  N  N   . SER A 1 1044 ? 47.124  30.391  13.016  1.00 90.36  ? 1044 SER A N   1 
ATOM   7884  C  CA  . SER A 1 1044 ? 48.070  31.480  13.190  1.00 94.37  ? 1044 SER A CA  1 
ATOM   7885  C  C   . SER A 1 1044 ? 47.396  32.610  13.968  1.00 95.68  ? 1044 SER A C   1 
ATOM   7886  O  O   . SER A 1 1044 ? 46.176  32.762  13.899  1.00 95.36  ? 1044 SER A O   1 
ATOM   7887  C  CB  . SER A 1 1044 ? 48.609  31.953  11.859  1.00 97.81  ? 1044 SER A CB  1 
ATOM   7888  O  OG  . SER A 1 1044 ? 47.599  32.600  11.100  1.00 98.97  ? 1044 SER A OG  1 
ATOM   7889  N  N   . GLU A 1 1045 ? 48.206  33.391  14.700  1.00 98.37  ? 1045 GLU A N   1 
ATOM   7890  C  CA  . GLU A 1 1045 ? 47.767  34.567  15.440  1.00 99.77  ? 1045 GLU A CA  1 
ATOM   7891  C  C   . GLU A 1 1045 ? 46.864  35.429  14.559  1.00 101.70 ? 1045 GLU A C   1 
ATOM   7892  O  O   . GLU A 1 1045 ? 45.847  35.947  15.016  1.00 100.91 ? 1045 GLU A O   1 
ATOM   7893  C  CB  . GLU A 1 1045 ? 48.981  35.386  15.885  1.00 102.90 ? 1045 GLU A CB  1 
ATOM   7894  C  CG  . GLU A 1 1045 ? 48.635  36.499  16.856  1.00 104.39 ? 1045 GLU A CG  1 
ATOM   7895  C  CD  . GLU A 1 1045 ? 49.759  37.475  17.149  1.00 108.23 ? 1045 GLU A CD  1 
ATOM   7896  O  OE1 . GLU A 1 1045 ? 50.405  37.950  16.185  1.00 111.68 ? 1045 GLU A OE1 1 
ATOM   7897  O  OE2 . GLU A 1 1045 ? 49.983  37.758  18.341  1.00 108.50 ? 1045 GLU A OE2 1 
ATOM   7898  N  N   . SER A 1 1046 ? 47.271  35.564  13.292  1.00 104.11 ? 1046 SER A N   1 
ATOM   7899  C  CA  . SER A 1 1046 ? 46.548  36.309  12.280  1.00 106.57 ? 1046 SER A CA  1 
ATOM   7900  C  C   . SER A 1 1046 ? 45.122  35.774  12.121  1.00 104.85 ? 1046 SER A C   1 
ATOM   7901  O  O   . SER A 1 1046 ? 44.167  36.530  12.299  1.00 106.13 ? 1046 SER A O   1 
ATOM   7902  C  CB  . SER A 1 1046 ? 47.320  36.284  10.990  1.00 109.46 ? 1046 SER A CB  1 
ATOM   7903  O  OG  . SER A 1 1046 ? 46.960  37.378  10.167  1.00 113.86 ? 1046 SER A OG  1 
ATOM   7904  N  N   . TRP A 1 1047 ? 44.979  34.471  11.816  1.00 101.99 ? 1047 TRP A N   1 
ATOM   7905  C  CA  . TRP A 1 1047 ? 43.670  33.872  11.589  1.00 98.86  ? 1047 TRP A CA  1 
ATOM   7906  C  C   . TRP A 1 1047 ? 42.812  33.993  12.842  1.00 95.26  ? 1047 TRP A C   1 
ATOM   7907  O  O   . TRP A 1 1047 ? 41.624  34.290  12.753  1.00 96.48  ? 1047 TRP A O   1 
ATOM   7908  C  CB  . TRP A 1 1047 ? 43.762  32.430  11.065  1.00 97.88  ? 1047 TRP A CB  1 
ATOM   7909  C  CG  . TRP A 1 1047 ? 43.996  32.393  9.586   1.00 101.27 ? 1047 TRP A CG  1 
ATOM   7910  C  CD1 . TRP A 1 1047 ? 45.149  32.740  8.949   1.00 105.22 ? 1047 TRP A CD1 1 
ATOM   7911  C  CD2 . TRP A 1 1047 ? 43.059  32.048  8.548   1.00 102.55 ? 1047 TRP A CD2 1 
ATOM   7912  N  NE1 . TRP A 1 1047 ? 45.005  32.623  7.594   1.00 108.11 ? 1047 TRP A NE1 1 
ATOM   7913  C  CE2 . TRP A 1 1047 ? 43.735  32.199  7.317   1.00 106.16 ? 1047 TRP A CE2 1 
ATOM   7914  C  CE3 . TRP A 1 1047 ? 41.725  31.623  8.529   1.00 101.83 ? 1047 TRP A CE3 1 
ATOM   7915  C  CZ2 . TRP A 1 1047 ? 43.127  31.942  6.088   1.00 108.40 ? 1047 TRP A CZ2 1 
ATOM   7916  C  CZ3 . TRP A 1 1047 ? 41.123  31.368  7.313   1.00 103.49 ? 1047 TRP A CZ3 1 
ATOM   7917  C  CH2 . TRP A 1 1047 ? 41.816  31.524  6.110   1.00 106.87 ? 1047 TRP A CH2 1 
ATOM   7918  N  N   . TYR A 1 1048 ? 43.441  33.813  14.004  1.00 91.63  ? 1048 TYR A N   1 
ATOM   7919  C  CA  . TYR A 1 1048 ? 42.733  33.903  15.267  1.00 88.61  ? 1048 TYR A CA  1 
ATOM   7920  C  C   . TYR A 1 1048 ? 42.148  35.299  15.467  1.00 90.79  ? 1048 TYR A C   1 
ATOM   7921  O  O   . TYR A 1 1048 ? 41.015  35.427  15.921  1.00 90.33  ? 1048 TYR A O   1 
ATOM   7922  C  CB  . TYR A 1 1048 ? 43.659  33.553  16.428  1.00 86.64  ? 1048 TYR A CB  1 
ATOM   7923  C  CG  . TYR A 1 1048 ? 43.020  33.724  17.781  1.00 84.72  ? 1048 TYR A CG  1 
ATOM   7924  C  CD1 . TYR A 1 1048 ? 42.256  32.712  18.339  1.00 82.01  ? 1048 TYR A CD1 1 
ATOM   7925  C  CD2 . TYR A 1 1048 ? 43.171  34.899  18.501  1.00 86.45  ? 1048 TYR A CD2 1 
ATOM   7926  C  CE1 . TYR A 1 1048 ? 41.666  32.859  19.584  1.00 81.06  ? 1048 TYR A CE1 1 
ATOM   7927  C  CE2 . TYR A 1 1048 ? 42.588  35.063  19.747  1.00 84.97  ? 1048 TYR A CE2 1 
ATOM   7928  C  CZ  . TYR A 1 1048 ? 41.836  34.038  20.291  1.00 82.57  ? 1048 TYR A CZ  1 
ATOM   7929  O  OH  . TYR A 1 1048 ? 41.261  34.206  21.517  1.00 82.14  ? 1048 TYR A OH  1 
ATOM   7930  N  N   . ASN A 1 1049 ? 42.935  36.335  15.151  1.00 93.93  ? 1049 ASN A N   1 
ATOM   7931  C  CA  . ASN A 1 1049 ? 42.544  37.713  15.408  1.00 96.15  ? 1049 ASN A CA  1 
ATOM   7932  C  C   . ASN A 1 1049 ? 41.383  38.101  14.498  1.00 97.40  ? 1049 ASN A C   1 
ATOM   7933  O  O   . ASN A 1 1049 ? 40.507  38.864  14.904  1.00 97.98  ? 1049 ASN A O   1 
ATOM   7934  C  CB  . ASN A 1 1049 ? 43.691  38.703  15.186  1.00 100.03 ? 1049 ASN A CB  1 
ATOM   7935  C  CG  . ASN A 1 1049 ? 44.811  38.605  16.199  1.00 99.22  ? 1049 ASN A CG  1 
ATOM   7936  O  OD1 . ASN A 1 1049 ? 44.610  38.173  17.333  1.00 96.97  ? 1049 ASN A OD1 1 
ATOM   7937  N  ND2 . ASN A 1 1049 ? 46.001  39.009  15.790  1.00 101.74 ? 1049 ASN A ND2 1 
ATOM   7938  N  N   . LEU A 1 1050 ? 41.420  37.597  13.257  1.00 97.61  ? 1050 LEU A N   1 
ATOM   7939  C  CA  . LEU A 1 1050 ? 40.361  37.838  12.292  1.00 98.56  ? 1050 LEU A CA  1 
ATOM   7940  C  C   . LEU A 1 1050 ? 39.074  37.184  12.788  1.00 95.50  ? 1050 LEU A C   1 
ATOM   7941  O  O   . LEU A 1 1050 ? 38.025  37.827  12.831  1.00 96.84  ? 1050 LEU A O   1 
ATOM   7942  C  CB  . LEU A 1 1050 ? 40.782  37.284  10.924  1.00 99.47  ? 1050 LEU A CB  1 
ATOM   7943  C  CG  . LEU A 1 1050 ? 39.667  37.144  9.885   1.00 99.91  ? 1050 LEU A CG  1 
ATOM   7944  C  CD1 . LEU A 1 1050 ? 39.145  38.502  9.443   1.00 102.82 ? 1050 LEU A CD1 1 
ATOM   7945  C  CD2 . LEU A 1 1050 ? 40.139  36.341  8.685   1.00 100.50 ? 1050 LEU A CD2 1 
ATOM   7946  N  N   . LEU A 1 1051 ? 39.174  35.910  13.180  1.00 90.81  ? 1051 LEU A N   1 
ATOM   7947  C  CA  . LEU A 1 1051 ? 37.998  35.125  13.507  1.00 87.86  ? 1051 LEU A CA  1 
ATOM   7948  C  C   . LEU A 1 1051 ? 37.428  35.529  14.866  1.00 87.51  ? 1051 LEU A C   1 
ATOM   7949  O  O   . LEU A 1 1051 ? 36.224  35.407  15.078  1.00 87.69  ? 1051 LEU A O   1 
ATOM   7950  C  CB  . LEU A 1 1051 ? 38.330  33.631  13.433  1.00 83.80  ? 1051 LEU A CB  1 
ATOM   7951  C  CG  . LEU A 1 1051 ? 38.635  33.086  12.038  1.00 84.47  ? 1051 LEU A CG  1 
ATOM   7952  C  CD1 . LEU A 1 1051 ? 39.226  31.688  12.107  1.00 81.00  ? 1051 LEU A CD1 1 
ATOM   7953  C  CD2 . LEU A 1 1051 ? 37.401  33.101  11.152  1.00 85.64  ? 1051 LEU A CD2 1 
ATOM   7954  N  N   . LEU A 1 1052 ? 38.275  36.022  15.780  1.00 87.91  ? 1052 LEU A N   1 
ATOM   7955  C  CA  . LEU A 1 1052 ? 37.775  36.460  17.076  1.00 87.40  ? 1052 LEU A CA  1 
ATOM   7956  C  C   . LEU A 1 1052 ? 36.938  37.723  16.895  1.00 90.15  ? 1052 LEU A C   1 
ATOM   7957  O  O   . LEU A 1 1052 ? 35.891  37.879  17.515  1.00 89.91  ? 1052 LEU A O   1 
ATOM   7958  C  CB  . LEU A 1 1052 ? 38.936  36.686  18.051  1.00 86.91  ? 1052 LEU A CB  1 
ATOM   7959  C  CG  . LEU A 1 1052 ? 38.541  37.213  19.433  1.00 86.39  ? 1052 LEU A CG  1 
ATOM   7960  C  CD1 . LEU A 1 1052 ? 37.444  36.364  20.060  1.00 84.70  ? 1052 LEU A CD1 1 
ATOM   7961  C  CD2 . LEU A 1 1052 ? 39.745  37.279  20.355  1.00 86.35  ? 1052 LEU A CD2 1 
ATOM   7962  N  N   . ASP A 1 1053 ? 37.425  38.625  16.045  1.00 93.79  ? 1053 ASP A N   1 
ATOM   7963  C  CA  . ASP A 1 1053 ? 36.683  39.815  15.673  1.00 97.96  ? 1053 ASP A CA  1 
ATOM   7964  C  C   . ASP A 1 1053 ? 35.351  39.387  15.047  1.00 99.20  ? 1053 ASP A C   1 
ATOM   7965  O  O   . ASP A 1 1053 ? 34.297  39.916  15.400  1.00 101.26 ? 1053 ASP A O   1 
ATOM   7966  C  CB  . ASP A 1 1053 ? 37.564  40.725  14.806  1.00 100.74 ? 1053 ASP A CB  1 
ATOM   7967  C  CG  . ASP A 1 1053 ? 36.949  42.063  14.425  1.00 103.39 ? 1053 ASP A CG  1 
ATOM   7968  O  OD1 . ASP A 1 1053 ? 35.996  42.494  15.104  1.00 102.64 ? 1053 ASP A OD1 1 
ATOM   7969  O  OD2 . ASP A 1 1053 ? 37.432  42.666  13.446  1.00 106.32 ? 1053 ASP A OD2 1 
ATOM   7970  N  N   . MET A 1 1054 ? 35.407  38.394  14.143  1.00 98.82  ? 1054 MET A N   1 
ATOM   7971  C  CA  . MET A 1 1054 ? 34.241  37.859  13.455  1.00 98.05  ? 1054 MET A CA  1 
ATOM   7972  C  C   . MET A 1 1054 ? 33.212  37.386  14.470  1.00 94.81  ? 1054 MET A C   1 
ATOM   7973  O  O   . MET A 1 1054 ? 32.038  37.727  14.360  1.00 95.74  ? 1054 MET A O   1 
ATOM   7974  C  CB  . MET A 1 1054 ? 34.605  36.657  12.579  1.00 98.17  ? 1054 MET A CB  1 
ATOM   7975  C  CG  . MET A 1 1054 ? 35.168  37.030  11.235  1.00 103.32 ? 1054 MET A CG  1 
ATOM   7976  S  SD  . MET A 1 1054 ? 34.098  38.212  10.397  1.00 110.62 ? 1054 MET A SD  1 
ATOM   7977  C  CE  . MET A 1 1054 ? 32.665  37.184  10.077  1.00 107.61 ? 1054 MET A CE  1 
ATOM   7978  N  N   . GLN A 1 1055 ? 33.676  36.579  15.431  1.00 91.88  ? 1055 GLN A N   1 
ATOM   7979  C  CA  . GLN A 1 1055 ? 32.838  36.072  16.504  1.00 90.73  ? 1055 GLN A CA  1 
ATOM   7980  C  C   . GLN A 1 1055 ? 32.039  37.219  17.118  1.00 93.36  ? 1055 GLN A C   1 
ATOM   7981  O  O   . GLN A 1 1055 ? 30.811  37.151  17.192  1.00 94.79  ? 1055 GLN A O   1 
ATOM   7982  C  CB  . GLN A 1 1055 ? 33.673  35.373  17.579  1.00 88.02  ? 1055 GLN A CB  1 
ATOM   7983  C  CG  . GLN A 1 1055 ? 33.849  33.880  17.349  1.00 86.36  ? 1055 GLN A CG  1 
ATOM   7984  C  CD  . GLN A 1 1055 ? 34.204  33.157  18.626  1.00 84.03  ? 1055 GLN A CD  1 
ATOM   7985  O  OE1 . GLN A 1 1055 ? 34.034  33.680  19.723  1.00 84.67  ? 1055 GLN A OE1 1 
ATOM   7986  N  NE2 . GLN A 1 1055 ? 34.709  31.943  18.498  1.00 81.43  ? 1055 GLN A NE2 1 
ATOM   7987  N  N   . ASN A 1 1056 ? 32.754  38.282  17.516  1.00 94.82  ? 1056 ASN A N   1 
ATOM   7988  C  CA  . ASN A 1 1056 ? 32.195  39.397  18.264  1.00 96.34  ? 1056 ASN A CA  1 
ATOM   7989  C  C   . ASN A 1 1056 ? 31.141  40.133  17.443  1.00 98.57  ? 1056 ASN A C   1 
ATOM   7990  O  O   . ASN A 1 1056 ? 30.212  40.701  18.010  1.00 100.18 ? 1056 ASN A O   1 
ATOM   7991  C  CB  . ASN A 1 1056 ? 33.282  40.372  18.718  1.00 99.09  ? 1056 ASN A CB  1 
ATOM   7992  C  CG  . ASN A 1 1056 ? 34.169  39.803  19.805  1.00 97.77  ? 1056 ASN A CG  1 
ATOM   7993  O  OD1 . ASN A 1 1056 ? 34.273  38.587  19.962  1.00 96.39  ? 1056 ASN A OD1 1 
ATOM   7994  N  ND2 . ASN A 1 1056 ? 34.798  40.675  20.575  1.00 99.15  ? 1056 ASN A ND2 1 
ATOM   7995  N  N   . ARG A 1 1057 ? 31.314  40.133  16.116  1.00 99.00  ? 1057 ARG A N   1 
ATOM   7996  C  CA  . ARG A 1 1057 ? 30.377  40.773  15.208  1.00 100.70 ? 1057 ARG A CA  1 
ATOM   7997  C  C   . ARG A 1 1057 ? 29.164  39.869  14.988  1.00 98.79  ? 1057 ARG A C   1 
ATOM   7998  O  O   . ARG A 1 1057 ? 28.030  40.345  14.943  1.00 99.41  ? 1057 ARG A O   1 
ATOM   7999  C  CB  . ARG A 1 1057 ? 31.093  41.127  13.904  1.00 103.03 ? 1057 ARG A CB  1 
ATOM   8000  C  CG  . ARG A 1 1057 ? 32.051  42.299  14.051  1.00 105.06 ? 1057 ARG A CG  1 
ATOM   8001  C  CD  . ARG A 1 1057 ? 33.189  42.232  13.053  1.00 106.15 ? 1057 ARG A CD  1 
ATOM   8002  N  NE  . ARG A 1 1057 ? 34.031  43.407  13.194  1.00 108.75 ? 1057 ARG A NE  1 
ATOM   8003  C  CZ  . ARG A 1 1057 ? 33.752  44.606  12.698  1.00 111.86 ? 1057 ARG A CZ  1 
ATOM   8004  N  NH1 . ARG A 1 1057 ? 32.643  44.802  12.005  1.00 113.25 ? 1057 ARG A NH1 1 
ATOM   8005  N  NH2 . ARG A 1 1057 ? 34.589  45.608  12.894  1.00 114.43 ? 1057 ARG A NH2 1 
ATOM   8006  N  N   . LEU A 1 1058 ? 29.424  38.562  14.862  1.00 95.55  ? 1058 LEU A N   1 
ATOM   8007  C  CA  . LEU A 1 1058 ? 28.380  37.563  14.708  1.00 93.56  ? 1058 LEU A CA  1 
ATOM   8008  C  C   . LEU A 1 1058 ? 27.484  37.554  15.942  1.00 92.95  ? 1058 LEU A C   1 
ATOM   8009  O  O   . LEU A 1 1058 ? 26.290  37.308  15.827  1.00 94.33  ? 1058 LEU A O   1 
ATOM   8010  C  CB  . LEU A 1 1058 ? 29.022  36.191  14.483  1.00 89.36  ? 1058 LEU A CB  1 
ATOM   8011  C  CG  . LEU A 1 1058 ? 29.491  35.916  13.055  1.00 89.94  ? 1058 LEU A CG  1 
ATOM   8012  C  CD1 . LEU A 1 1058 ? 30.395  34.699  13.004  1.00 87.26  ? 1058 LEU A CD1 1 
ATOM   8013  C  CD2 . LEU A 1 1058 ? 28.312  35.734  12.113  1.00 91.35  ? 1058 LEU A CD2 1 
ATOM   8014  N  N   . ASN A 1 1059 ? 28.070  37.840  17.110  1.00 92.33  ? 1059 ASN A N   1 
ATOM   8015  C  CA  . ASN A 1 1059 ? 27.337  37.849  18.366  1.00 92.10  ? 1059 ASN A CA  1 
ATOM   8016  C  C   . ASN A 1 1059 ? 26.418  39.065  18.465  1.00 95.69  ? 1059 ASN A C   1 
ATOM   8017  O  O   . ASN A 1 1059 ? 25.436  39.030  19.204  1.00 97.66  ? 1059 ASN A O   1 
ATOM   8018  C  CB  . ASN A 1 1059 ? 28.265  37.763  19.575  1.00 91.17  ? 1059 ASN A CB  1 
ATOM   8019  C  CG  . ASN A 1 1059 ? 28.834  36.376  19.774  1.00 89.02  ? 1059 ASN A CG  1 
ATOM   8020  O  OD1 . ASN A 1 1059 ? 28.218  35.388  19.386  1.00 89.19  ? 1059 ASN A OD1 1 
ATOM   8021  N  ND2 . ASN A 1 1059 ? 30.002  36.287  20.385  1.00 88.87  ? 1059 ASN A ND2 1 
ATOM   8022  N  N   . LYS A 1 1060 ? 26.732  40.140  17.731  1.00 97.52  ? 1060 LYS A N   1 
ATOM   8023  C  CA  . LYS A 1 1060 ? 25.912  41.341  17.775  1.00 99.43  ? 1060 LYS A CA  1 
ATOM   8024  C  C   . LYS A 1 1060 ? 24.756  41.240  16.778  1.00 100.34 ? 1060 LYS A C   1 
ATOM   8025  O  O   . LYS A 1 1060 ? 23.784  41.983  16.884  1.00 102.66 ? 1060 LYS A O   1 
ATOM   8026  C  CB  . LYS A 1 1060 ? 26.762  42.595  17.538  1.00 101.88 ? 1060 LYS A CB  1 
ATOM   8027  C  CG  . LYS A 1 1060 ? 27.562  43.087  18.736  1.00 101.66 ? 1060 LYS A CG  1 
ATOM   8028  C  CD  . LYS A 1 1060 ? 28.362  44.338  18.443  1.00 104.64 ? 1060 LYS A CD  1 
ATOM   8029  C  CE  . LYS A 1 1060 ? 29.382  44.666  19.513  1.00 104.63 ? 1060 LYS A CE  1 
ATOM   8030  N  NZ  . LYS A 1 1060 ? 30.323  45.717  19.058  1.00 107.37 ? 1060 LYS A NZ  1 
ATOM   8031  N  N   . VAL A 1 1061 ? 24.873  40.328  15.803  1.00 98.97  ? 1061 VAL A N   1 
ATOM   8032  C  CA  . VAL A 1 1061 ? 23.887  40.182  14.740  1.00 100.10 ? 1061 VAL A CA  1 
ATOM   8033  C  C   . VAL A 1 1061 ? 22.969  39.007  15.068  1.00 97.19  ? 1061 VAL A C   1 
ATOM   8034  O  O   . VAL A 1 1061 ? 21.753  39.093  14.917  1.00 98.48  ? 1061 VAL A O   1 
ATOM   8035  C  CB  . VAL A 1 1061 ? 24.552  40.012  13.358  1.00 101.58 ? 1061 VAL A CB  1 
ATOM   8036  C  CG1 . VAL A 1 1061 ? 23.591  39.488  12.300  1.00 102.53 ? 1061 VAL A CG1 1 
ATOM   8037  C  CG2 . VAL A 1 1061 ? 25.190  41.306  12.885  1.00 105.45 ? 1061 VAL A CG2 1 
ATOM   8038  N  N   . ILE A 1 1062 ? 23.573  37.901  15.511  1.00 93.33  ? 1062 ILE A N   1 
ATOM   8039  C  CA  . ILE A 1 1062 ? 22.847  36.675  15.802  1.00 90.29  ? 1062 ILE A CA  1 
ATOM   8040  C  C   . ILE A 1 1062 ? 22.281  36.754  17.216  1.00 89.97  ? 1062 ILE A C   1 
ATOM   8041  O  O   . ILE A 1 1062 ? 23.017  37.003  18.168  1.00 88.42  ? 1062 ILE A O   1 
ATOM   8042  C  CB  . ILE A 1 1062 ? 23.755  35.440  15.639  1.00 86.05  ? 1062 ILE A CB  1 
ATOM   8043  C  CG1 . ILE A 1 1062 ? 24.147  35.203  14.180  1.00 86.17  ? 1062 ILE A CG1 1 
ATOM   8044  C  CG2 . ILE A 1 1062 ? 23.098  34.212  16.239  1.00 83.90  ? 1062 ILE A CG2 1 
ATOM   8045  C  CD1 . ILE A 1 1062 ? 25.133  34.081  13.986  1.00 83.26  ? 1062 ILE A CD1 1 
ATOM   8046  N  N   . LYS A 1 1063 ? 20.974  36.500  17.334  1.00 91.53  ? 1063 LYS A N   1 
ATOM   8047  C  CA  . LYS A 1 1063 ? 20.275  36.532  18.607  1.00 91.20  ? 1063 LYS A CA  1 
ATOM   8048  C  C   . LYS A 1 1063 ? 20.252  35.133  19.213  1.00 87.73  ? 1063 LYS A C   1 
ATOM   8049  O  O   . LYS A 1 1063 ? 20.070  34.148  18.506  1.00 86.52  ? 1063 LYS A O   1 
ATOM   8050  C  CB  . LYS A 1 1063 ? 18.865  37.080  18.393  1.00 94.37  ? 1063 LYS A CB  1 
ATOM   8051  C  CG  . LYS A 1 1063 ? 18.829  38.461  17.764  1.00 97.74  ? 1063 LYS A CG  1 
ATOM   8052  C  CD  . LYS A 1 1063 ? 19.509  39.471  18.642  1.00 99.41  ? 1063 LYS A CD  1 
ATOM   8053  C  CE  . LYS A 1 1063 ? 19.315  40.886  18.148  1.00 104.25 ? 1063 LYS A CE  1 
ATOM   8054  N  NZ  . LYS A 1 1063 ? 20.016  41.859  19.017  1.00 105.91 ? 1063 LYS A NZ  1 
ATOM   8055  N  N   . SER A 1 1064 ? 20.455  35.056  20.528  1.00 86.45  ? 1064 SER A N   1 
ATOM   8056  C  CA  . SER A 1 1064 ? 20.470  33.764  21.187  1.00 84.20  ? 1064 SER A CA  1 
ATOM   8057  C  C   . SER A 1 1064 ? 19.114  33.518  21.838  1.00 84.22  ? 1064 SER A C   1 
ATOM   8058  O  O   . SER A 1 1064 ? 18.595  34.369  22.561  1.00 85.12  ? 1064 SER A O   1 
ATOM   8059  C  CB  . SER A 1 1064 ? 21.608  33.636  22.169  1.00 83.12  ? 1064 SER A CB  1 
ATOM   8060  O  OG  . SER A 1 1064 ? 21.161  33.764  23.510  1.00 83.82  ? 1064 SER A OG  1 
ATOM   8061  N  N   . VAL A 1 1065 ? 18.536  32.352  21.541  1.00 82.18  ? 1065 VAL A N   1 
ATOM   8062  C  CA  . VAL A 1 1065 ? 17.287  31.947  22.157  1.00 81.78  ? 1065 VAL A CA  1 
ATOM   8063  C  C   . VAL A 1 1065 ? 17.504  31.870  23.663  1.00 81.15  ? 1065 VAL A C   1 
ATOM   8064  O  O   . VAL A 1 1065 ? 18.423  31.203  24.127  1.00 80.46  ? 1065 VAL A O   1 
ATOM   8065  C  CB  . VAL A 1 1065 ? 16.800  30.605  21.583  1.00 80.07  ? 1065 VAL A CB  1 
ATOM   8066  C  CG1 . VAL A 1 1065 ? 15.695  29.993  22.427  1.00 80.10  ? 1065 VAL A CG1 1 
ATOM   8067  C  CG2 . VAL A 1 1065 ? 16.352  30.751  20.140  1.00 81.52  ? 1065 VAL A CG2 1 
ATOM   8068  N  N   . GLY A 1 1066 ? 16.652  32.569  24.415  1.00 83.09  ? 1066 GLY A N   1 
ATOM   8069  C  CA  . GLY A 1 1066 ? 16.759  32.608  25.863  1.00 83.96  ? 1066 GLY A CA  1 
ATOM   8070  C  C   . GLY A 1 1066 ? 17.505  33.853  26.333  1.00 85.50  ? 1066 GLY A C   1 
ATOM   8071  O  O   . GLY A 1 1066 ? 17.531  34.148  27.529  1.00 85.19  ? 1066 GLY A O   1 
ATOM   8072  N  N   . LYS A 1 1067 ? 18.093  34.567  25.360  1.00 87.22  ? 1067 LYS A N   1 
ATOM   8073  C  CA  . LYS A 1 1067 ? 18.837  35.809  25.542  1.00 89.46  ? 1067 LYS A CA  1 
ATOM   8074  C  C   . LYS A 1 1067 ? 20.087  35.567  26.394  1.00 88.15  ? 1067 LYS A C   1 
ATOM   8075  O  O   . LYS A 1 1067 ? 20.449  36.393  27.232  1.00 89.49  ? 1067 LYS A O   1 
ATOM   8076  C  CB  . LYS A 1 1067 ? 17.944  36.958  26.037  1.00 92.92  ? 1067 LYS A CB  1 
ATOM   8077  C  CG  . LYS A 1 1067 ? 16.849  37.413  25.076  1.00 96.59  ? 1067 LYS A CG  1 
ATOM   8078  C  CD  . LYS A 1 1067 ? 16.302  38.803  25.378  1.00 101.16 ? 1067 LYS A CD  1 
ATOM   8079  C  CE  . LYS A 1 1067 ? 15.120  39.238  24.526  1.00 104.40 ? 1067 LYS A CE  1 
ATOM   8080  N  NZ  . LYS A 1 1067 ? 13.923  38.384  24.718  1.00 105.45 ? 1067 LYS A NZ  1 
ATOM   8081  N  N   . ILE A 1 1068 ? 20.745  34.423  26.156  1.00 85.09  ? 1068 ILE A N   1 
ATOM   8082  C  CA  . ILE A 1 1068 ? 22.017  34.082  26.775  1.00 83.13  ? 1068 ILE A CA  1 
ATOM   8083  C  C   . ILE A 1 1068 ? 23.145  34.626  25.904  1.00 83.41  ? 1068 ILE A C   1 
ATOM   8084  O  O   . ILE A 1 1068 ? 23.183  34.366  24.707  1.00 83.32  ? 1068 ILE A O   1 
ATOM   8085  C  CB  . ILE A 1 1068 ? 22.154  32.553  26.940  1.00 80.21  ? 1068 ILE A CB  1 
ATOM   8086  C  CG1 . ILE A 1 1068 ? 21.052  31.966  27.825  1.00 80.73  ? 1068 ILE A CG1 1 
ATOM   8087  C  CG2 . ILE A 1 1068 ? 23.536  32.175  27.450  1.00 77.37  ? 1068 ILE A CG2 1 
ATOM   8088  C  CD1 . ILE A 1 1068 ? 20.982  30.455  27.795  1.00 78.84  ? 1068 ILE A CD1 1 
ATOM   8089  N  N   . GLU A 1 1069 ? 24.093  35.332  26.526  1.00 84.64  ? 1069 GLU A N   1 
ATOM   8090  C  CA  . GLU A 1 1069 ? 25.276  35.810  25.826  1.00 86.06  ? 1069 GLU A CA  1 
ATOM   8091  C  C   . GLU A 1 1069 ? 26.220  34.658  25.479  1.00 83.67  ? 1069 GLU A C   1 
ATOM   8092  O  O   . GLU A 1 1069 ? 26.527  33.808  26.321  1.00 82.15  ? 1069 GLU A O   1 
ATOM   8093  C  CB  . GLU A 1 1069 ? 26.029  36.812  26.694  1.00 88.76  ? 1069 GLU A CB  1 
ATOM   8094  C  CG  . GLU A 1 1069 ? 25.287  38.114  26.886  1.00 93.41  ? 1069 GLU A CG  1 
ATOM   8095  C  CD  . GLU A 1 1069 ? 25.983  39.089  27.817  1.00 97.47  ? 1069 GLU A CD  1 
ATOM   8096  O  OE1 . GLU A 1 1069 ? 26.973  38.689  28.472  1.00 97.68  ? 1069 GLU A OE1 1 
ATOM   8097  O  OE2 . GLU A 1 1069 ? 25.534  40.255  27.881  1.00 102.22 ? 1069 GLU A OE2 1 
ATOM   8098  N  N   . HIS A 1 1070 ? 26.717  34.680  24.235  1.00 82.26  ? 1070 HIS A N   1 
ATOM   8099  C  CA  . HIS A 1 1070 ? 27.668  33.696  23.744  1.00 78.96  ? 1070 HIS A CA  1 
ATOM   8100  C  C   . HIS A 1 1070 ? 28.936  33.690  24.597  1.00 77.51  ? 1070 HIS A C   1 
ATOM   8101  O  O   . HIS A 1 1070 ? 29.471  32.629  24.909  1.00 74.35  ? 1070 HIS A O   1 
ATOM   8102  C  CB  . HIS A 1 1070 ? 28.006  33.978  22.279  1.00 78.98  ? 1070 HIS A CB  1 
ATOM   8103  C  CG  . HIS A 1 1070 ? 28.694  32.839  21.610  1.00 76.29  ? 1070 HIS A CG  1 
ATOM   8104  N  ND1 . HIS A 1 1070 ? 30.044  32.595  21.755  1.00 74.32  ? 1070 HIS A ND1 1 
ATOM   8105  C  CD2 . HIS A 1 1070 ? 28.217  31.874  20.802  1.00 75.30  ? 1070 HIS A CD2 1 
ATOM   8106  C  CE1 . HIS A 1 1070 ? 30.371  31.531  21.054  1.00 72.75  ? 1070 HIS A CE1 1 
ATOM   8107  N  NE2 . HIS A 1 1070 ? 29.270  31.070  20.468  1.00 73.58  ? 1070 HIS A NE2 1 
ATOM   8108  N  N   . SER A 1 1071 ? 29.411  34.890  24.950  1.00 79.27  ? 1071 SER A N   1 
ATOM   8109  C  CA  . SER A 1 1071 ? 30.646  35.056  25.701  1.00 78.40  ? 1071 SER A CA  1 
ATOM   8110  C  C   . SER A 1 1071 ? 30.515  34.425  27.089  1.00 76.32  ? 1071 SER A C   1 
ATOM   8111  O  O   . SER A 1 1071 ? 31.493  33.917  27.636  1.00 74.96  ? 1071 SER A O   1 
ATOM   8112  C  CB  . SER A 1 1071 ? 31.030  36.509  25.788  1.00 80.62  ? 1071 SER A CB  1 
ATOM   8113  O  OG  . SER A 1 1071 ? 30.184  37.193  26.699  1.00 82.21  ? 1071 SER A OG  1 
ATOM   8114  N  N   . PHE A 1 1072 ? 29.299  34.474  27.648  1.00 75.16  ? 1072 PHE A N   1 
ATOM   8115  C  CA  . PHE A 1 1072 ? 29.015  33.895  28.948  1.00 73.12  ? 1072 PHE A CA  1 
ATOM   8116  C  C   . PHE A 1 1072 ? 29.068  32.374  28.843  1.00 71.42  ? 1072 PHE A C   1 
ATOM   8117  O  O   . PHE A 1 1072 ? 29.681  31.705  29.682  1.00 70.39  ? 1072 PHE A O   1 
ATOM   8118  C  CB  . PHE A 1 1072 ? 27.634  34.332  29.433  1.00 73.03  ? 1072 PHE A CB  1 
ATOM   8119  C  CG  . PHE A 1 1072 ? 27.212  33.709  30.737  1.00 71.45  ? 1072 PHE A CG  1 
ATOM   8120  C  CD1 . PHE A 1 1072 ? 27.618  34.248  31.946  1.00 72.40  ? 1072 PHE A CD1 1 
ATOM   8121  C  CD2 . PHE A 1 1072 ? 26.415  32.577  30.763  1.00 69.87  ? 1072 PHE A CD2 1 
ATOM   8122  C  CE1 . PHE A 1 1072 ? 27.236  33.676  33.150  1.00 71.89  ? 1072 PHE A CE1 1 
ATOM   8123  C  CE2 . PHE A 1 1072 ? 26.035  32.002  31.967  1.00 69.65  ? 1072 PHE A CE2 1 
ATOM   8124  C  CZ  . PHE A 1 1072 ? 26.444  32.553  33.161  1.00 70.65  ? 1072 PHE A CZ  1 
ATOM   8125  N  N   . TRP A 1 1073 ? 28.394  31.853  27.808  1.00 70.59  ? 1073 TRP A N   1 
ATOM   8126  C  CA  . TRP A 1 1073 ? 28.307  30.429  27.522  1.00 67.87  ? 1073 TRP A CA  1 
ATOM   8127  C  C   . TRP A 1 1073 ? 29.711  29.838  27.415  1.00 67.13  ? 1073 TRP A C   1 
ATOM   8128  O  O   . TRP A 1 1073 ? 30.009  28.825  28.044  1.00 66.20  ? 1073 TRP A O   1 
ATOM   8129  C  CB  . TRP A 1 1073 ? 27.465  30.234  26.253  1.00 67.11  ? 1073 TRP A CB  1 
ATOM   8130  C  CG  . TRP A 1 1073 ? 27.512  28.923  25.522  1.00 64.69  ? 1073 TRP A CG  1 
ATOM   8131  C  CD1 . TRP A 1 1073 ? 27.634  28.779  24.171  1.00 64.63  ? 1073 TRP A CD1 1 
ATOM   8132  C  CD2 . TRP A 1 1073 ? 27.354  27.589  26.044  1.00 62.38  ? 1073 TRP A CD2 1 
ATOM   8133  N  NE1 . TRP A 1 1073 ? 27.583  27.459  23.817  1.00 62.67  ? 1073 TRP A NE1 1 
ATOM   8134  C  CE2 . TRP A 1 1073 ? 27.420  26.705  24.945  1.00 61.30  ? 1073 TRP A CE2 1 
ATOM   8135  C  CE3 . TRP A 1 1073 ? 27.185  27.048  27.320  1.00 62.06  ? 1073 TRP A CE3 1 
ATOM   8136  C  CZ2 . TRP A 1 1073 ? 27.332  25.323  25.083  1.00 59.98  ? 1073 TRP A CZ2 1 
ATOM   8137  C  CZ3 . TRP A 1 1073 ? 27.092  25.679  27.457  1.00 61.02  ? 1073 TRP A CZ3 1 
ATOM   8138  C  CH2 . TRP A 1 1073 ? 27.161  24.829  26.354  1.00 59.86  ? 1073 TRP A CH2 1 
ATOM   8139  N  N   . ARG A 1 1074 ? 30.583  30.526  26.669  1.00 67.37  ? 1074 ARG A N   1 
ATOM   8140  C  CA  . ARG A 1 1074 ? 31.887  29.991  26.331  1.00 65.33  ? 1074 ARG A CA  1 
ATOM   8141  C  C   . ARG A 1 1074 ? 32.924  30.340  27.397  1.00 66.66  ? 1074 ARG A C   1 
ATOM   8142  O  O   . ARG A 1 1074 ? 34.064  29.888  27.307  1.00 66.82  ? 1074 ARG A O   1 
ATOM   8143  C  CB  . ARG A 1 1074 ? 32.304  30.447  24.932  1.00 64.88  ? 1074 ARG A CB  1 
ATOM   8144  C  CG  . ARG A 1 1074 ? 31.518  29.793  23.808  1.00 63.64  ? 1074 ARG A CG  1 
ATOM   8145  C  CD  . ARG A 1 1074 ? 31.397  28.289  23.932  1.00 61.22  ? 1074 ARG A CD  1 
ATOM   8146  N  NE  . ARG A 1 1074 ? 30.993  27.692  22.665  1.00 60.81  ? 1074 ARG A NE  1 
ATOM   8147  C  CZ  . ARG A 1 1074 ? 30.644  26.422  22.485  1.00 59.01  ? 1074 ARG A CZ  1 
ATOM   8148  N  NH1 . ARG A 1 1074 ? 30.635  25.570  23.498  1.00 56.85  ? 1074 ARG A NH1 1 
ATOM   8149  N  NH2 . ARG A 1 1074 ? 30.296  26.011  21.280  1.00 59.49  ? 1074 ARG A NH2 1 
ATOM   8150  N  N   . SER A 1 1075 ? 32.538  31.118  28.415  1.00 68.39  ? 1075 SER A N   1 
ATOM   8151  C  CA  . SER A 1 1075 ? 33.470  31.412  29.494  1.00 69.45  ? 1075 SER A CA  1 
ATOM   8152  C  C   . SER A 1 1075 ? 33.889  30.118  30.187  1.00 68.75  ? 1075 SER A C   1 
ATOM   8153  O  O   . SER A 1 1075 ? 33.062  29.236  30.395  1.00 68.65  ? 1075 SER A O   1 
ATOM   8154  C  CB  . SER A 1 1075 ? 32.891  32.381  30.477  1.00 70.39  ? 1075 SER A CB  1 
ATOM   8155  O  OG  . SER A 1 1075 ? 32.810  33.669  29.898  1.00 72.57  ? 1075 SER A OG  1 
ATOM   8156  N  N   . PHE A 1 1076 ? 35.183  30.015  30.519  1.00 69.42  ? 1076 PHE A N   1 
ATOM   8157  C  CA  . PHE A 1 1076 ? 35.685  28.945  31.367  1.00 69.27  ? 1076 PHE A CA  1 
ATOM   8158  C  C   . PHE A 1 1076 ? 34.993  29.043  32.725  1.00 71.82  ? 1076 PHE A C   1 
ATOM   8159  O  O   . PHE A 1 1076 ? 35.030  30.088  33.377  1.00 72.57  ? 1076 PHE A O   1 
ATOM   8160  C  CB  . PHE A 1 1076 ? 37.212  29.010  31.473  1.00 68.01  ? 1076 PHE A CB  1 
ATOM   8161  C  CG  . PHE A 1 1076 ? 37.874  27.861  32.193  1.00 66.16  ? 1076 PHE A CG  1 
ATOM   8162  C  CD1 . PHE A 1 1076 ? 37.953  27.832  33.579  1.00 67.03  ? 1076 PHE A CD1 1 
ATOM   8163  C  CD2 . PHE A 1 1076 ? 38.455  26.821  31.483  1.00 64.65  ? 1076 PHE A CD2 1 
ATOM   8164  C  CE1 . PHE A 1 1076 ? 38.569  26.777  34.239  1.00 66.29  ? 1076 PHE A CE1 1 
ATOM   8165  C  CE2 . PHE A 1 1076 ? 39.084  25.772  32.143  1.00 64.05  ? 1076 PHE A CE2 1 
ATOM   8166  C  CZ  . PHE A 1 1076 ? 39.134  25.746  33.521  1.00 64.59  ? 1076 PHE A CZ  1 
ATOM   8167  N  N   . HIS A 1 1077 ? 34.344  27.946  33.136  1.00 73.63  ? 1077 HIS A N   1 
ATOM   8168  C  CA  . HIS A 1 1077 ? 33.558  27.968  34.358  1.00 77.13  ? 1077 HIS A CA  1 
ATOM   8169  C  C   . HIS A 1 1077 ? 33.764  26.697  35.176  1.00 77.51  ? 1077 HIS A C   1 
ATOM   8170  O  O   . HIS A 1 1077 ? 33.571  25.578  34.700  1.00 75.77  ? 1077 HIS A O   1 
ATOM   8171  C  CB  . HIS A 1 1077 ? 32.097  28.300  34.053  1.00 79.16  ? 1077 HIS A CB  1 
ATOM   8172  C  CG  . HIS A 1 1077 ? 31.188  28.180  35.228  1.00 82.17  ? 1077 HIS A CG  1 
ATOM   8173  N  ND1 . HIS A 1 1077 ? 31.173  29.113  36.252  1.00 85.24  ? 1077 HIS A ND1 1 
ATOM   8174  C  CD2 . HIS A 1 1077 ? 30.245  27.259  35.532  1.00 82.36  ? 1077 HIS A CD2 1 
ATOM   8175  C  CE1 . HIS A 1 1077 ? 30.262  28.767  37.141  1.00 86.43  ? 1077 HIS A CE1 1 
ATOM   8176  N  NE2 . HIS A 1 1077 ? 29.681  27.628  36.725  1.00 84.86  ? 1077 HIS A NE2 1 
ATOM   8177  N  N   . THR A 1 1078 ? 34.195  26.938  36.415  1.00 80.38  ? 1078 THR A N   1 
ATOM   8178  C  CA  . THR A 1 1078 ? 34.382  25.964  37.471  1.00 80.98  ? 1078 THR A CA  1 
ATOM   8179  C  C   . THR A 1 1078 ? 33.776  26.606  38.720  1.00 85.50  ? 1078 THR A C   1 
ATOM   8180  O  O   . THR A 1 1078 ? 33.257  27.721  38.639  1.00 87.21  ? 1078 THR A O   1 
ATOM   8181  C  CB  . THR A 1 1078 ? 35.856  25.533  37.520  1.00 78.31  ? 1078 THR A CB  1 
ATOM   8182  O  OG1 . THR A 1 1078 ? 35.968  24.388  38.360  1.00 80.05  ? 1078 THR A OG1 1 
ATOM   8183  C  CG2 . THR A 1 1078 ? 36.785  26.615  38.019  1.00 79.08  ? 1078 THR A CG2 1 
ATOM   8184  N  N   . GLU A 1 1079 ? 33.811  25.908  39.860  1.00 88.58  ? 1079 GLU A N   1 
ATOM   8185  C  CA  . GLU A 1 1079 ? 33.224  26.463  41.069  1.00 92.01  ? 1079 GLU A CA  1 
ATOM   8186  C  C   . GLU A 1 1079 ? 34.221  27.415  41.718  1.00 94.54  ? 1079 GLU A C   1 
ATOM   8187  O  O   . GLU A 1 1079 ? 33.816  28.330  42.435  1.00 99.01  ? 1079 GLU A O   1 
ATOM   8188  C  CB  . GLU A 1 1079 ? 32.752  25.367  42.027  1.00 93.87  ? 1079 GLU A CB  1 
ATOM   8189  C  CG  . GLU A 1 1079 ? 31.542  24.603  41.512  1.00 94.48  ? 1079 GLU A CG  1 
ATOM   8190  C  CD  . GLU A 1 1079 ? 30.887  23.665  42.513  1.00 96.31  ? 1079 GLU A CD  1 
ATOM   8191  O  OE1 . GLU A 1 1079 ? 30.329  22.637  42.076  1.00 96.08  ? 1079 GLU A OE1 1 
ATOM   8192  O  OE2 . GLU A 1 1079 ? 30.930  23.964  43.730  1.00 98.34  ? 1079 GLU A OE2 1 
ATOM   8193  N  N   . ARG A 1 1080 ? 35.512  27.199  41.437  1.00 93.19  ? 1080 ARG A N   1 
ATOM   8194  C  CA  . ARG A 1 1080 ? 36.557  28.043  41.995  1.00 96.92  ? 1080 ARG A CA  1 
ATOM   8195  C  C   . ARG A 1 1080 ? 36.638  29.368  41.232  1.00 96.41  ? 1080 ARG A C   1 
ATOM   8196  O  O   . ARG A 1 1080 ? 36.698  30.432  41.849  1.00 98.34  ? 1080 ARG A O   1 
ATOM   8197  C  CB  . ARG A 1 1080 ? 37.881  27.280  42.143  1.00 100.06 ? 1080 ARG A CB  1 
ATOM   8198  C  CG  . ARG A 1 1080 ? 37.835  26.205  43.223  1.00 104.50 ? 1080 ARG A CG  1 
ATOM   8199  C  CD  . ARG A 1 1080 ? 39.155  25.896  43.909  1.00 109.64 ? 1080 ARG A CD  1 
ATOM   8200  N  NE  . ARG A 1 1080 ? 39.013  25.510  45.310  1.00 114.90 ? 1080 ARG A NE  1 
ATOM   8201  C  CZ  . ARG A 1 1080 ? 39.927  24.837  46.006  1.00 116.98 ? 1080 ARG A CZ  1 
ATOM   8202  N  NH1 . ARG A 1 1080 ? 39.702  24.554  47.278  1.00 117.78 ? 1080 ARG A NH1 1 
ATOM   8203  N  NH2 . ARG A 1 1080 ? 41.057  24.451  45.432  1.00 115.83 ? 1080 ARG A NH2 1 
ATOM   8204  N  N   . LYS A 1 1081 ? 36.621  29.313  39.894  1.00 93.56  ? 1081 LYS A N   1 
ATOM   8205  C  CA  . LYS A 1 1081 ? 36.810  30.531  39.115  1.00 92.01  ? 1081 LYS A CA  1 
ATOM   8206  C  C   . LYS A 1 1081 ? 35.943  30.529  37.856  1.00 88.78  ? 1081 LYS A C   1 
ATOM   8207  O  O   . LYS A 1 1081 ? 35.586  29.475  37.328  1.00 84.48  ? 1081 LYS A O   1 
ATOM   8208  C  CB  . LYS A 1 1081 ? 38.295  30.783  38.804  1.00 91.90  ? 1081 LYS A CB  1 
ATOM   8209  C  CG  . LYS A 1 1081 ? 39.009  29.692  38.011  1.00 88.63  ? 1081 LYS A CG  1 
ATOM   8210  C  CD  . LYS A 1 1081 ? 40.269  30.147  37.298  1.00 88.96  ? 1081 LYS A CD  1 
ATOM   8211  C  CE  . LYS A 1 1081 ? 40.889  29.041  36.464  1.00 86.55  ? 1081 LYS A CE  1 
ATOM   8212  N  NZ  . LYS A 1 1081 ? 42.043  29.503  35.652  1.00 86.48  ? 1081 LYS A NZ  1 
ATOM   8213  N  N   . THR A 1 1082 ? 35.619  31.747  37.400  1.00 89.17  ? 1082 THR A N   1 
ATOM   8214  C  CA  . THR A 1 1082 ? 34.933  31.995  36.140  1.00 88.35  ? 1082 THR A CA  1 
ATOM   8215  C  C   . THR A 1 1082 ? 35.765  33.013  35.360  1.00 87.17  ? 1082 THR A C   1 
ATOM   8216  O  O   . THR A 1 1082 ? 36.191  34.016  35.925  1.00 89.33  ? 1082 THR A O   1 
ATOM   8217  C  CB  . THR A 1 1082 ? 33.465  32.396  36.380  1.00 90.69  ? 1082 THR A CB  1 
ATOM   8218  O  OG1 . THR A 1 1082 ? 32.824  31.397  37.181  1.00 90.94  ? 1082 THR A OG1 1 
ATOM   8219  C  CG2 . THR A 1 1082 ? 32.671  32.615  35.107  1.00 89.20  ? 1082 THR A CG2 1 
ATOM   8220  N  N   . GLU A 1 1083 ? 36.012  32.734  34.074  1.00 84.07  ? 1083 GLU A N   1 
ATOM   8221  C  CA  . GLU A 1 1083 ? 37.010  33.454  33.297  1.00 83.01  ? 1083 GLU A CA  1 
ATOM   8222  C  C   . GLU A 1 1083 ? 36.596  33.445  31.828  1.00 79.41  ? 1083 GLU A C   1 
ATOM   8223  O  O   . GLU A 1 1083 ? 36.225  32.398  31.305  1.00 77.52  ? 1083 GLU A O   1 
ATOM   8224  C  CB  . GLU A 1 1083 ? 38.369  32.764  33.466  1.00 84.69  ? 1083 GLU A CB  1 
ATOM   8225  C  CG  . GLU A 1 1083 ? 39.544  33.559  32.928  1.00 89.30  ? 1083 GLU A CG  1 
ATOM   8226  C  CD  . GLU A 1 1083 ? 39.951  34.722  33.816  1.00 95.23  ? 1083 GLU A CD  1 
ATOM   8227  O  OE1 . GLU A 1 1083 ? 40.763  35.564  33.364  1.00 98.11  ? 1083 GLU A OE1 1 
ATOM   8228  O  OE2 . GLU A 1 1083 ? 39.451  34.787  34.960  1.00 98.16  ? 1083 GLU A OE2 1 
ATOM   8229  N  N   . PRO A 1 1084 ? 36.649  34.594  31.110  1.00 78.92  ? 1084 PRO A N   1 
ATOM   8230  C  CA  . PRO A 1 1084 ? 36.279  34.637  29.693  1.00 77.07  ? 1084 PRO A CA  1 
ATOM   8231  C  C   . PRO A 1 1084 ? 37.176  33.727  28.862  1.00 74.90  ? 1084 PRO A C   1 
ATOM   8232  O  O   . PRO A 1 1084 ? 38.375  33.645  29.110  1.00 75.18  ? 1084 PRO A O   1 
ATOM   8233  C  CB  . PRO A 1 1084 ? 36.545  36.092  29.283  1.00 78.87  ? 1084 PRO A CB  1 
ATOM   8234  C  CG  . PRO A 1 1084 ? 36.499  36.866  30.580  1.00 80.96  ? 1084 PRO A CG  1 
ATOM   8235  C  CD  . PRO A 1 1084 ? 37.052  35.913  31.620  1.00 80.91  ? 1084 PRO A CD  1 
ATOM   8236  N  N   . ALA A 1 1085 ? 36.582  33.053  27.875  1.00 73.07  ? 1085 ALA A N   1 
ATOM   8237  C  CA  . ALA A 1 1085 ? 37.311  32.164  26.985  1.00 70.97  ? 1085 ALA A CA  1 
ATOM   8238  C  C   . ALA A 1 1085 ? 38.416  32.933  26.268  1.00 72.37  ? 1085 ALA A C   1 
ATOM   8239  O  O   . ALA A 1 1085 ? 38.213  34.061  25.840  1.00 74.71  ? 1085 ALA A O   1 
ATOM   8240  C  CB  . ALA A 1 1085 ? 36.352  31.566  25.991  1.00 69.86  ? 1085 ALA A CB  1 
ATOM   8241  N  N   . THR A 1 1086 ? 39.589  32.312  26.144  1.00 72.07  ? 1086 THR A N   1 
ATOM   8242  C  CA  . THR A 1 1086 ? 40.695  32.918  25.419  1.00 74.93  ? 1086 THR A CA  1 
ATOM   8243  C  C   . THR A 1 1086 ? 41.375  31.857  24.561  1.00 73.51  ? 1086 THR A C   1 
ATOM   8244  O  O   . THR A 1 1086 ? 41.400  30.683  24.922  1.00 70.83  ? 1086 THR A O   1 
ATOM   8245  C  CB  . THR A 1 1086 ? 41.768  33.483  26.360  1.00 76.86  ? 1086 THR A CB  1 
ATOM   8246  O  OG1 . THR A 1 1086 ? 42.204  32.379  27.152  1.00 76.10  ? 1086 THR A OG1 1 
ATOM   8247  C  CG2 . THR A 1 1086 ? 41.290  34.606  27.254  1.00 79.24  ? 1086 THR A CG2 1 
ATOM   8248  N  N   . GLY A 1 1087 ? 41.922  32.293  23.423  1.00 75.14  ? 1087 GLY A N   1 
ATOM   8249  C  CA  . GLY A 1 1087 ? 42.750  31.444  22.583  1.00 75.56  ? 1087 GLY A CA  1 
ATOM   8250  C  C   . GLY A 1 1087 ? 41.972  30.300  21.942  1.00 74.43  ? 1087 GLY A C   1 
ATOM   8251  O  O   . GLY A 1 1087 ? 42.566  29.311  21.513  1.00 73.10  ? 1087 GLY A O   1 
ATOM   8252  N  N   . PHE A 1 1088 ? 40.644  30.465  21.876  1.00 75.87  ? 1088 PHE A N   1 
ATOM   8253  C  CA  . PHE A 1 1088 ? 39.739  29.461  21.336  1.00 74.76  ? 1088 PHE A CA  1 
ATOM   8254  C  C   . PHE A 1 1088 ? 38.630  30.123  20.527  1.00 75.84  ? 1088 PHE A C   1 
ATOM   8255  O  O   . PHE A 1 1088 ? 37.944  31.018  21.018  1.00 76.06  ? 1088 PHE A O   1 
ATOM   8256  C  CB  . PHE A 1 1088 ? 39.085  28.646  22.454  1.00 73.42  ? 1088 PHE A CB  1 
ATOM   8257  C  CG  . PHE A 1 1088 ? 39.792  27.367  22.815  1.00 73.33  ? 1088 PHE A CG  1 
ATOM   8258  C  CD1 . PHE A 1 1088 ? 39.944  26.350  21.883  1.00 73.03  ? 1088 PHE A CD1 1 
ATOM   8259  C  CD2 . PHE A 1 1088 ? 40.306  27.177  24.089  1.00 73.42  ? 1088 PHE A CD2 1 
ATOM   8260  C  CE1 . PHE A 1 1088 ? 40.601  25.174  22.215  1.00 71.10  ? 1088 PHE A CE1 1 
ATOM   8261  C  CE2 . PHE A 1 1088 ? 40.955  25.998  24.424  1.00 72.01  ? 1088 PHE A CE2 1 
ATOM   8262  C  CZ  . PHE A 1 1088 ? 41.101  25.000  23.486  1.00 71.01  ? 1088 PHE A CZ  1 
ATOM   8263  N  N   . ILE A 1 1089 ? 38.439  29.626  19.301  1.00 76.02  ? 1089 ILE A N   1 
ATOM   8264  C  CA  . ILE A 1 1089 ? 37.385  30.096  18.421  1.00 76.79  ? 1089 ILE A CA  1 
ATOM   8265  C  C   . ILE A 1 1089 ? 36.289  29.035  18.338  1.00 75.97  ? 1089 ILE A C   1 
ATOM   8266  O  O   . ILE A 1 1089 ? 36.563  27.852  18.134  1.00 75.44  ? 1089 ILE A O   1 
ATOM   8267  C  CB  . ILE A 1 1089 ? 37.958  30.503  17.050  1.00 77.97  ? 1089 ILE A CB  1 
ATOM   8268  C  CG1 . ILE A 1 1089 ? 38.667  31.854  17.171  1.00 80.47  ? 1089 ILE A CG1 1 
ATOM   8269  C  CG2 . ILE A 1 1089 ? 36.876  30.520  15.983  1.00 78.43  ? 1089 ILE A CG2 1 
ATOM   8270  C  CD1 . ILE A 1 1089 ? 39.243  32.383  15.889  1.00 84.19  ? 1089 ILE A CD1 1 
ATOM   8271  N  N   . ASP A 1 1090 ? 35.042  29.486  18.520  1.00 76.16  ? 1090 ASP A N   1 
ATOM   8272  C  CA  . ASP A 1 1090 ? 33.863  28.648  18.382  1.00 73.82  ? 1090 ASP A CA  1 
ATOM   8273  C  C   . ASP A 1 1090 ? 33.537  28.459  16.904  1.00 74.08  ? 1090 ASP A C   1 
ATOM   8274  O  O   . ASP A 1 1090 ? 32.797  29.246  16.323  1.00 75.12  ? 1090 ASP A O   1 
ATOM   8275  C  CB  . ASP A 1 1090 ? 32.663  29.248  19.117  1.00 74.74  ? 1090 ASP A CB  1 
ATOM   8276  C  CG  . ASP A 1 1090 ? 31.460  28.322  19.132  1.00 74.21  ? 1090 ASP A CG  1 
ATOM   8277  O  OD1 . ASP A 1 1090 ? 31.518  27.269  18.462  1.00 73.56  ? 1090 ASP A OD1 1 
ATOM   8278  O  OD2 . ASP A 1 1090 ? 30.480  28.653  19.822  1.00 74.57  ? 1090 ASP A OD2 1 
ATOM   8279  N  N   . GLY A 1 1091 ? 34.070  27.379  16.326  1.00 73.23  ? 1091 GLY A N   1 
ATOM   8280  C  CA  . GLY A 1 1091 ? 33.907  27.050  14.919  1.00 74.54  ? 1091 GLY A CA  1 
ATOM   8281  C  C   . GLY A 1 1091 ? 32.446  26.969  14.482  1.00 75.22  ? 1091 GLY A C   1 
ATOM   8282  O  O   . GLY A 1 1091 ? 32.136  27.302  13.340  1.00 77.24  ? 1091 GLY A O   1 
ATOM   8283  N  N   . ASP A 1 1092 ? 31.562  26.525  15.390  1.00 73.85  ? 1092 ASP A N   1 
ATOM   8284  C  CA  . ASP A 1 1092 ? 30.140  26.393  15.095  1.00 74.93  ? 1092 ASP A CA  1 
ATOM   8285  C  C   . ASP A 1 1092 ? 29.520  27.764  14.841  1.00 77.21  ? 1092 ASP A C   1 
ATOM   8286  O  O   . ASP A 1 1092 ? 28.761  27.936  13.889  1.00 79.25  ? 1092 ASP A O   1 
ATOM   8287  C  CB  . ASP A 1 1092 ? 29.368  25.667  16.200  1.00 73.45  ? 1092 ASP A CB  1 
ATOM   8288  C  CG  . ASP A 1 1092 ? 29.544  24.155  16.204  1.00 71.82  ? 1092 ASP A CG  1 
ATOM   8289  O  OD1 . ASP A 1 1092 ? 29.845  23.585  15.127  1.00 71.67  ? 1092 ASP A OD1 1 
ATOM   8290  O  OD2 . ASP A 1 1092 ? 29.378  23.555  17.290  1.00 70.21  ? 1092 ASP A OD2 1 
ATOM   8291  N  N   . LEU A 1 1093 ? 29.851  28.727  15.708  1.00 77.91  ? 1093 LEU A N   1 
ATOM   8292  C  CA  . LEU A 1 1093 ? 29.463  30.116  15.518  1.00 79.91  ? 1093 LEU A CA  1 
ATOM   8293  C  C   . LEU A 1 1093 ? 29.940  30.613  14.154  1.00 81.61  ? 1093 LEU A C   1 
ATOM   8294  O  O   . LEU A 1 1093 ? 29.139  31.125  13.383  1.00 83.43  ? 1093 LEU A O   1 
ATOM   8295  C  CB  . LEU A 1 1093 ? 30.053  30.966  16.647  1.00 79.44  ? 1093 LEU A CB  1 
ATOM   8296  C  CG  . LEU A 1 1093 ? 29.553  32.405  16.691  1.00 81.77  ? 1093 LEU A CG  1 
ATOM   8297  C  CD1 . LEU A 1 1093 ? 28.045  32.430  16.886  1.00 81.71  ? 1093 LEU A CD1 1 
ATOM   8298  C  CD2 . LEU A 1 1093 ? 30.242  33.172  17.806  1.00 82.99  ? 1093 LEU A CD2 1 
ATOM   8299  N  N   . ILE A 1 1094 ? 31.235  30.430  13.856  1.00 81.05  ? 1094 ILE A N   1 
ATOM   8300  C  CA  . ILE A 1 1094 ? 31.857  30.939  12.641  1.00 82.73  ? 1094 ILE A CA  1 
ATOM   8301  C  C   . ILE A 1 1094 ? 31.127  30.400  11.409  1.00 84.24  ? 1094 ILE A C   1 
ATOM   8302  O  O   . ILE A 1 1094 ? 30.867  31.150  10.471  1.00 86.48  ? 1094 ILE A O   1 
ATOM   8303  C  CB  . ILE A 1 1094 ? 33.375  30.636  12.612  1.00 81.19  ? 1094 ILE A CB  1 
ATOM   8304  C  CG1 . ILE A 1 1094 ? 34.152  31.441  13.659  1.00 80.56  ? 1094 ILE A CG1 1 
ATOM   8305  C  CG2 . ILE A 1 1094 ? 33.965  30.825  11.221  1.00 83.16  ? 1094 ILE A CG2 1 
ATOM   8306  C  CD1 . ILE A 1 1094 ? 34.329  32.906  13.336  1.00 82.72  ? 1094 ILE A CD1 1 
ATOM   8307  N  N   . GLU A 1 1095 ? 30.791  29.105  11.427  1.00 83.26  ? 1095 GLU A N   1 
ATOM   8308  C  CA  . GLU A 1 1095 ? 30.229  28.436  10.264  1.00 84.59  ? 1095 GLU A CA  1 
ATOM   8309  C  C   . GLU A 1 1095 ? 28.812  28.937  10.009  1.00 85.15  ? 1095 GLU A C   1 
ATOM   8310  O  O   . GLU A 1 1095 ? 28.353  28.940  8.868   1.00 86.66  ? 1095 GLU A O   1 
ATOM   8311  C  CB  . GLU A 1 1095 ? 30.278  26.915  10.428  1.00 83.80  ? 1095 GLU A CB  1 
ATOM   8312  C  CG  . GLU A 1 1095 ? 31.655  26.333  10.155  1.00 84.78  ? 1095 GLU A CG  1 
ATOM   8313  C  CD  . GLU A 1 1095 ? 31.770  24.819  10.098  1.00 84.60  ? 1095 GLU A CD  1 
ATOM   8314  O  OE1 . GLU A 1 1095 ? 30.742  24.142  9.873   1.00 85.36  ? 1095 GLU A OE1 1 
ATOM   8315  O  OE2 . GLU A 1 1095 ? 32.901  24.321  10.274  1.00 84.94  ? 1095 GLU A OE2 1 
ATOM   8316  N  N   . SER A 1 1096 ? 28.147  29.379  11.082  1.00 83.64  ? 1096 SER A N   1 
ATOM   8317  C  CA  . SER A 1 1096 ? 26.763  29.816  10.994  1.00 85.09  ? 1096 SER A CA  1 
ATOM   8318  C  C   . SER A 1 1096 ? 26.657  31.167  10.284  1.00 87.85  ? 1096 SER A C   1 
ATOM   8319  O  O   . SER A 1 1096 ? 25.559  31.682  10.106  1.00 90.31  ? 1096 SER A O   1 
ATOM   8320  C  CB  . SER A 1 1096 ? 26.098  29.817  12.349  1.00 83.68  ? 1096 SER A CB  1 
ATOM   8321  O  OG  . SER A 1 1096 ? 26.179  31.092  12.960  1.00 86.01  ? 1096 SER A OG  1 
ATOM   8322  N  N   . PHE A 1 1097 ? 27.804  31.725  9.874   1.00 88.16  ? 1097 PHE A N   1 
ATOM   8323  C  CA  . PHE A 1 1097 ? 27.864  32.949  9.090   1.00 90.63  ? 1097 PHE A CA  1 
ATOM   8324  C  C   . PHE A 1 1097 ? 27.325  32.692  7.684   1.00 93.05  ? 1097 PHE A C   1 
ATOM   8325  O  O   . PHE A 1 1097 ? 26.854  33.612  7.025   1.00 96.80  ? 1097 PHE A O   1 
ATOM   8326  C  CB  . PHE A 1 1097 ? 29.295  33.493  9.068   1.00 90.25  ? 1097 PHE A CB  1 
ATOM   8327  C  CG  . PHE A 1 1097 ? 29.553  34.573  8.050   1.00 93.38  ? 1097 PHE A CG  1 
ATOM   8328  C  CD1 . PHE A 1 1097 ? 29.328  35.907  8.358   1.00 94.99  ? 1097 PHE A CD1 1 
ATOM   8329  C  CD2 . PHE A 1 1097 ? 30.023  34.255  6.783   1.00 94.93  ? 1097 PHE A CD2 1 
ATOM   8330  C  CE1 . PHE A 1 1097 ? 29.568  36.899  7.420   1.00 98.29  ? 1097 PHE A CE1 1 
ATOM   8331  C  CE2 . PHE A 1 1097 ? 30.259  35.246  5.843   1.00 98.30  ? 1097 PHE A CE2 1 
ATOM   8332  C  CZ  . PHE A 1 1097 ? 30.035  36.565  6.167   1.00 100.20 ? 1097 PHE A CZ  1 
ATOM   8333  N  N   . LEU A 1 1098 ? 27.387  31.432  7.239   1.00 91.51  ? 1098 LEU A N   1 
ATOM   8334  C  CA  . LEU A 1 1098 ? 26.967  31.053  5.899   1.00 93.86  ? 1098 LEU A CA  1 
ATOM   8335  C  C   . LEU A 1 1098 ? 25.451  30.873  5.830   1.00 95.03  ? 1098 LEU A C   1 
ATOM   8336  O  O   . LEU A 1 1098 ? 24.903  30.693  4.743   1.00 97.07  ? 1098 LEU A O   1 
ATOM   8337  C  CB  . LEU A 1 1098 ? 27.661  29.742  5.517   1.00 91.83  ? 1098 LEU A CB  1 
ATOM   8338  C  CG  . LEU A 1 1098 ? 29.166  29.807  5.269   1.00 91.75  ? 1098 LEU A CG  1 
ATOM   8339  C  CD1 . LEU A 1 1098 ? 29.688  28.442  4.851   1.00 90.19  ? 1098 LEU A CD1 1 
ATOM   8340  C  CD2 . LEU A 1 1098 ? 29.509  30.849  4.214   1.00 95.66  ? 1098 LEU A CD2 1 
ATOM   8341  N  N   . ASP A 1 1099 ? 24.788  30.909  6.993   1.00 93.75  ? 1099 ASP A N   1 
ATOM   8342  C  CA  . ASP A 1 1099 ? 23.384  30.547  7.091   1.00 94.56  ? 1099 ASP A CA  1 
ATOM   8343  C  C   . ASP A 1 1099 ? 22.518  31.769  7.375   1.00 97.18  ? 1099 ASP A C   1 
ATOM   8344  O  O   . ASP A 1 1099 ? 21.293  31.662  7.363   1.00 99.02  ? 1099 ASP A O   1 
ATOM   8345  C  CB  . ASP A 1 1099 ? 23.168  29.459  8.141   1.00 90.91  ? 1099 ASP A CB  1 
ATOM   8346  C  CG  . ASP A 1 1099 ? 23.794  28.138  7.744   1.00 89.71  ? 1099 ASP A CG  1 
ATOM   8347  O  OD1 . ASP A 1 1099 ? 23.710  27.787  6.549   1.00 91.40  ? 1099 ASP A OD1 1 
ATOM   8348  O  OD2 . ASP A 1 1099 ? 24.374  27.482  8.632   1.00 87.19  ? 1099 ASP A OD2 1 
ATOM   8349  N  N   . ILE A 1 1100 ? 23.156  32.916  7.632   1.00 97.73  ? 1100 ILE A N   1 
ATOM   8350  C  CA  . ILE A 1 1100 ? 22.423  34.138  7.916   1.00 99.91  ? 1100 ILE A CA  1 
ATOM   8351  C  C   . ILE A 1 1100 ? 22.065  34.822  6.594   1.00 104.38 ? 1100 ILE A C   1 
ATOM   8352  O  O   . ILE A 1 1100 ? 22.607  34.467  5.549   1.00 105.46 ? 1100 ILE A O   1 
ATOM   8353  C  CB  . ILE A 1 1100 ? 23.205  35.043  8.889   1.00 98.47  ? 1100 ILE A CB  1 
ATOM   8354  C  CG1 . ILE A 1 1100 ? 24.564  35.455  8.323   1.00 99.30  ? 1100 ILE A CG1 1 
ATOM   8355  C  CG2 . ILE A 1 1100 ? 23.344  34.378  10.248  1.00 94.37  ? 1100 ILE A CG2 1 
ATOM   8356  C  CD1 . ILE A 1 1100 ? 25.112  36.723  8.927   1.00 100.76 ? 1100 ILE A CD1 1 
ATOM   8357  N  N   . SER A 1 1101 ? 21.120  35.773  6.643   1.00 106.98 ? 1101 SER A N   1 
ATOM   8358  C  CA  . SER A 1 1101 ? 20.674  36.488  5.454   1.00 111.44 ? 1101 SER A CA  1 
ATOM   8359  C  C   . SER A 1 1101 ? 21.787  37.386  4.914   1.00 113.31 ? 1101 SER A C   1 
ATOM   8360  O  O   . SER A 1 1101 ? 22.645  37.839  5.667   1.00 112.41 ? 1101 SER A O   1 
ATOM   8361  C  CB  . SER A 1 1101 ? 19.394  37.264  5.703   1.00 113.58 ? 1101 SER A CB  1 
ATOM   8362  O  OG  . SER A 1 1101 ? 19.651  38.538  6.279   1.00 114.24 ? 1101 SER A OG  1 
ATOM   8363  N  N   . ARG A 1 1102 ? 21.745  37.651  3.603   1.00 116.15 ? 1102 ARG A N   1 
ATOM   8364  C  CA  . ARG A 1 1102 ? 22.757  38.460  2.947   1.00 118.33 ? 1102 ARG A CA  1 
ATOM   8365  C  C   . ARG A 1 1102 ? 22.885  39.822  3.631   1.00 119.08 ? 1102 ARG A C   1 
ATOM   8366  O  O   . ARG A 1 1102 ? 23.995  40.216  3.975   1.00 118.08 ? 1102 ARG A O   1 
ATOM   8367  C  CB  . ARG A 1 1102 ? 22.460  38.599  1.452   1.00 123.40 ? 1102 ARG A CB  1 
ATOM   8368  C  CG  . ARG A 1 1102 ? 23.250  39.705  0.765   1.00 128.14 ? 1102 ARG A CG  1 
ATOM   8369  C  CD  . ARG A 1 1102 ? 24.724  39.373  0.643   1.00 127.77 ? 1102 ARG A CD  1 
ATOM   8370  N  NE  . ARG A 1 1102 ? 24.898  38.183  -0.173  1.00 128.03 ? 1102 ARG A NE  1 
ATOM   8371  C  CZ  . ARG A 1 1102 ? 25.927  37.966  -0.981  1.00 129.94 ? 1102 ARG A CZ  1 
ATOM   8372  N  NH1 . ARG A 1 1102 ? 26.888  38.868  -1.097  1.00 132.37 ? 1102 ARG A NH1 1 
ATOM   8373  N  NH2 . ARG A 1 1102 ? 25.985  36.850  -1.683  1.00 129.75 ? 1102 ARG A NH2 1 
ATOM   8374  N  N   . PRO A 1 1103 ? 21.787  40.593  3.847   1.00 120.75 ? 1103 PRO A N   1 
ATOM   8375  C  CA  . PRO A 1 1103 ? 21.891  41.898  4.505   1.00 121.40 ? 1103 PRO A CA  1 
ATOM   8376  C  C   . PRO A 1 1103 ? 22.581  41.793  5.865   1.00 117.81 ? 1103 PRO A C   1 
ATOM   8377  O  O   . PRO A 1 1103 ? 23.383  42.650  6.232   1.00 118.81 ? 1103 PRO A O   1 
ATOM   8378  C  CB  . PRO A 1 1103 ? 20.437  42.384  4.649   1.00 122.58 ? 1103 PRO A CB  1 
ATOM   8379  C  CG  . PRO A 1 1103 ? 19.587  41.151  4.424   1.00 121.47 ? 1103 PRO A CG  1 
ATOM   8380  C  CD  . PRO A 1 1103 ? 20.394  40.268  3.494   1.00 121.66 ? 1103 PRO A CD  1 
ATOM   8381  N  N   . LYS A 1 1104 ? 22.282  40.715  6.595   1.00 113.54 ? 1104 LYS A N   1 
ATOM   8382  C  CA  . LYS A 1 1104 ? 22.803  40.520  7.935   1.00 110.15 ? 1104 LYS A CA  1 
ATOM   8383  C  C   . LYS A 1 1104 ? 24.250  40.045  7.862   1.00 109.13 ? 1104 LYS A C   1 
ATOM   8384  O  O   . LYS A 1 1104 ? 25.025  40.228  8.800   1.00 107.69 ? 1104 LYS A O   1 
ATOM   8385  C  CB  . LYS A 1 1104 ? 21.912  39.526  8.677   1.00 106.76 ? 1104 LYS A CB  1 
ATOM   8386  C  CG  . LYS A 1 1104 ? 20.595  40.120  9.144   1.00 107.33 ? 1104 LYS A CG  1 
ATOM   8387  C  CD  . LYS A 1 1104 ? 20.789  41.308  10.061  1.00 108.09 ? 1104 LYS A CD  1 
ATOM   8388  C  CE  . LYS A 1 1104 ? 19.623  41.515  11.002  1.00 108.11 ? 1104 LYS A CE  1 
ATOM   8389  N  NZ  . LYS A 1 1104 ? 19.841  42.662  11.911  1.00 109.35 ? 1104 LYS A NZ  1 
ATOM   8390  N  N   . MET A 1 1105 ? 24.581  39.409  6.736   1.00 109.63 ? 1105 MET A N   1 
ATOM   8391  C  CA  . MET A 1 1105 ? 25.936  39.016  6.400   1.00 108.28 ? 1105 MET A CA  1 
ATOM   8392  C  C   . MET A 1 1105 ? 26.777  40.280  6.262   1.00 111.31 ? 1105 MET A C   1 
ATOM   8393  O  O   . MET A 1 1105 ? 27.871  40.370  6.807   1.00 110.72 ? 1105 MET A O   1 
ATOM   8394  C  CB  . MET A 1 1105 ? 25.919  38.275  5.062   1.00 108.51 ? 1105 MET A CB  1 
ATOM   8395  C  CG  . MET A 1 1105 ? 27.090  37.361  4.847   1.00 106.11 ? 1105 MET A CG  1 
ATOM   8396  S  SD  . MET A 1 1105 ? 26.671  36.039  3.696   1.00 104.95 ? 1105 MET A SD  1 
ATOM   8397  C  CE  . MET A 1 1105 ? 25.474  35.129  4.667   1.00 102.08 ? 1105 MET A CE  1 
ATOM   8398  N  N   . GLN A 1 1106 ? 26.225  41.267  5.555   1.00 115.98 ? 1106 GLN A N   1 
ATOM   8399  C  CA  . GLN A 1 1106 ? 26.927  42.505  5.257   1.00 119.69 ? 1106 GLN A CA  1 
ATOM   8400  C  C   . GLN A 1 1106 ? 27.068  43.352  6.519   1.00 119.46 ? 1106 GLN A C   1 
ATOM   8401  O  O   . GLN A 1 1106 ? 28.063  44.055  6.675   1.00 120.47 ? 1106 GLN A O   1 
ATOM   8402  C  CB  . GLN A 1 1106 ? 26.265  43.219  4.077   1.00 123.41 ? 1106 GLN A CB  1 
ATOM   8403  C  CG  . GLN A 1 1106 ? 26.336  42.376  2.813   1.00 124.30 ? 1106 GLN A CG  1 
ATOM   8404  C  CD  . GLN A 1 1106 ? 25.774  42.997  1.562   1.00 129.26 ? 1106 GLN A CD  1 
ATOM   8405  O  OE1 . GLN A 1 1106 ? 24.791  43.740  1.585   1.00 131.55 ? 1106 GLN A OE1 1 
ATOM   8406  N  NE2 . GLN A 1 1106 ? 26.395  42.656  0.444   1.00 131.03 ? 1106 GLN A NE2 1 
ATOM   8407  N  N   . GLU A 1 1107 ? 26.085  43.247  7.421   1.00 118.79 ? 1107 GLU A N   1 
ATOM   8408  C  CA  . GLU A 1 1107 ? 26.105  43.959  8.691   1.00 118.95 ? 1107 GLU A CA  1 
ATOM   8409  C  C   . GLU A 1 1107 ? 27.236  43.432  9.576   1.00 115.87 ? 1107 GLU A C   1 
ATOM   8410  O  O   . GLU A 1 1107 ? 27.794  44.183  10.374  1.00 116.59 ? 1107 GLU A O   1 
ATOM   8411  C  CB  . GLU A 1 1107 ? 24.737  43.895  9.378   1.00 118.72 ? 1107 GLU A CB  1 
ATOM   8412  C  CG  . GLU A 1 1107 ? 24.603  44.842  10.563  1.00 119.61 ? 1107 GLU A CG  1 
ATOM   8413  C  CD  . GLU A 1 1107 ? 23.206  45.048  11.129  1.00 119.93 ? 1107 GLU A CD  1 
ATOM   8414  O  OE1 . GLU A 1 1107 ? 22.309  44.229  10.835  1.00 118.66 ? 1107 GLU A OE1 1 
ATOM   8415  O  OE2 . GLU A 1 1107 ? 23.014  46.040  11.861  1.00 121.67 ? 1107 GLU A OE2 1 
ATOM   8416  N  N   . VAL A 1 1108 ? 27.568  42.143  9.432   1.00 112.78 ? 1108 VAL A N   1 
ATOM   8417  C  CA  . VAL A 1 1108 ? 28.667  41.550  10.179  1.00 110.04 ? 1108 VAL A CA  1 
ATOM   8418  C  C   . VAL A 1 1108 ? 29.984  42.134  9.671   1.00 112.45 ? 1108 VAL A C   1 
ATOM   8419  O  O   . VAL A 1 1108 ? 30.869  42.445  10.462  1.00 112.05 ? 1108 VAL A O   1 
ATOM   8420  C  CB  . VAL A 1 1108 ? 28.653  40.009  10.116  1.00 106.69 ? 1108 VAL A CB  1 
ATOM   8421  C  CG1 . VAL A 1 1108 ? 29.912  39.408  10.722  1.00 104.68 ? 1108 VAL A CG1 1 
ATOM   8422  C  CG2 . VAL A 1 1108 ? 27.425  39.420  10.791  1.00 104.32 ? 1108 VAL A CG2 1 
ATOM   8423  N  N   . VAL A 1 1109 ? 30.083  42.322  8.353   1.00 115.75 ? 1109 VAL A N   1 
ATOM   8424  C  CA  . VAL A 1 1109 ? 31.331  42.710  7.718   1.00 118.28 ? 1109 VAL A CA  1 
ATOM   8425  C  C   . VAL A 1 1109 ? 31.437  44.237  7.673   1.00 121.87 ? 1109 VAL A C   1 
ATOM   8426  O  O   . VAL A 1 1109 ? 32.341  44.782  7.040   1.00 124.19 ? 1109 VAL A O   1 
ATOM   8427  C  CB  . VAL A 1 1109 ? 31.447  42.049  6.329   1.00 120.25 ? 1109 VAL A CB  1 
ATOM   8428  C  CG1 . VAL A 1 1109 ? 32.854  42.154  5.765   1.00 123.12 ? 1109 VAL A CG1 1 
ATOM   8429  C  CG2 . VAL A 1 1109 ? 31.026  40.589  6.386   1.00 116.31 ? 1109 VAL A CG2 1 
ATOM   8430  N  N   . ALA A 1 1110 ? 30.547  44.912  8.416   1.00 122.14 ? 1110 ALA A N   1 
ATOM   8431  C  CA  . ALA A 1 1110 ? 30.315  46.348  8.326   1.00 126.41 ? 1110 ALA A CA  1 
ATOM   8432  C  C   . ALA A 1 1110 ? 31.622  47.135  8.232   1.00 129.71 ? 1110 ALA A C   1 
ATOM   8433  O  O   . ALA A 1 1110 ? 31.793  47.946  7.322   1.00 134.88 ? 1110 ALA A O   1 
ATOM   8434  C  CB  . ALA A 1 1110 ? 29.458  46.813  9.480   1.00 124.56 ? 1110 ALA A CB  1 
ATOM   8435  N  N   . ASN A 1 1111 ? 32.540  46.909  9.177   1.00 127.83 ? 1111 ASN A N   1 
ATOM   8436  C  CA  . ASN A 1 1111 ? 33.821  47.598  9.155   1.00 130.04 ? 1111 ASN A CA  1 
ATOM   8437  C  C   . ASN A 1 1111 ? 34.935  46.559  9.221   1.00 128.09 ? 1111 ASN A C   1 
ATOM   8438  O  O   . ASN A 1 1111 ? 34.972  45.752  10.149  1.00 125.62 ? 1111 ASN A O   1 
ATOM   8439  C  CB  . ASN A 1 1111 ? 33.914  48.652  10.263  1.00 130.83 ? 1111 ASN A CB  1 
ATOM   8440  C  CG  . ASN A 1 1111 ? 32.788  49.666  10.212  1.00 133.55 ? 1111 ASN A CG  1 
ATOM   8441  O  OD1 . ASN A 1 1111 ? 32.046  49.829  11.177  1.00 133.19 ? 1111 ASN A OD1 1 
ATOM   8442  N  ND2 . ASN A 1 1111 ? 32.645  50.346  9.086   1.00 136.56 ? 1111 ASN A ND2 1 
ATOM   8443  N  N   . LEU A 1 1112 ? 35.824  46.555  8.220   1.00 129.88 ? 1112 LEU A N   1 
ATOM   8444  C  CA  . LEU A 1 1112 ? 36.850  45.525  8.181   1.00 128.24 ? 1112 LEU A CA  1 
ATOM   8445  C  C   . LEU A 1 1112 ? 38.043  45.968  7.342   1.00 132.78 ? 1112 LEU A C   1 
ATOM   8446  O  O   . LEU A 1 1112 ? 37.977  46.964  6.625   1.00 136.94 ? 1112 LEU A O   1 
ATOM   8447  C  CB  . LEU A 1 1112 ? 36.245  44.225  7.638   1.00 124.88 ? 1112 LEU A CB  1 
ATOM   8448  C  CG  . LEU A 1 1112 ? 36.841  42.942  8.216   1.00 120.55 ? 1112 LEU A CG  1 
ATOM   8449  C  CD1 . LEU A 1 1112 ? 36.312  42.669  9.619   1.00 115.82 ? 1112 LEU A CD1 1 
ATOM   8450  C  CD2 . LEU A 1 1112 ? 36.564  41.759  7.304   1.00 119.69 ? 1112 LEU A CD2 1 
ATOM   8451  N  N   . GLN A 1 1113 ? 39.136  45.203  7.452   1.00 132.75 ? 1113 GLN A N   1 
ATOM   8452  C  CA  . GLN A 1 1113 ? 40.336  45.463  6.675   1.00 137.81 ? 1113 GLN A CA  1 
ATOM   8453  C  C   . GLN A 1 1113 ? 40.870  44.156  6.088   1.00 137.13 ? 1113 GLN A C   1 
ATOM   8454  O  O   . GLN A 1 1113 ? 40.671  43.082  6.660   1.00 130.78 ? 1113 GLN A O   1 
ATOM   8455  C  CB  . GLN A 1 1113 ? 41.389  46.169  7.532   1.00 139.11 ? 1113 GLN A CB  1 
ATOM   8456  C  CG  . GLN A 1 1113 ? 41.034  47.606  7.899   1.00 141.47 ? 1113 GLN A CG  1 
ATOM   8457  C  CD  . GLN A 1 1113 ? 42.114  48.263  8.724   1.00 142.51 ? 1113 GLN A CD  1 
ATOM   8458  O  OE1 . GLN A 1 1113 ? 42.886  47.609  9.424   1.00 140.66 ? 1113 GLN A OE1 1 
ATOM   8459  N  NE2 . GLN A 1 1113 ? 42.194  49.580  8.624   1.00 145.79 ? 1113 GLN A NE2 1 
ATOM   8460  N  N   . TYR A 1 1114 ? 41.543  44.284  4.934   1.00 143.27 ? 1114 TYR A N   1 
ATOM   8461  C  CA  . TYR A 1 1114 ? 42.182  43.176  4.240   1.00 145.13 ? 1114 TYR A CA  1 
ATOM   8462  C  C   . TYR A 1 1114 ? 43.670  43.496  4.020   1.00 148.32 ? 1114 TYR A C   1 
ATOM   8463  O  O   . TYR A 1 1114 ? 44.494  42.561  4.145   1.00 147.16 ? 1114 TYR A O   1 
ATOM   8464  C  CB  . TYR A 1 1114 ? 41.465  42.876  2.918   1.00 148.31 ? 1114 TYR A CB  1 
ATOM   8465  C  CG  . TYR A 1 1114 ? 42.070  41.741  2.126   1.00 149.25 ? 1114 TYR A CG  1 
ATOM   8466  C  CD1 . TYR A 1 1114 ? 41.865  40.414  2.495   1.00 144.69 ? 1114 TYR A CD1 1 
ATOM   8467  C  CD2 . TYR A 1 1114 ? 42.870  41.995  1.019   1.00 153.36 ? 1114 TYR A CD2 1 
ATOM   8468  C  CE1 . TYR A 1 1114 ? 42.434  39.371  1.779   1.00 144.67 ? 1114 TYR A CE1 1 
ATOM   8469  C  CE2 . TYR A 1 1114 ? 43.446  40.964  0.293   1.00 153.43 ? 1114 TYR A CE2 1 
ATOM   8470  C  CZ  . TYR A 1 1114 ? 43.227  39.650  0.676   1.00 149.52 ? 1114 TYR A CZ  1 
ATOM   8471  O  OH  . TYR A 1 1114 ? 43.792  38.632  -0.037  1.00 150.33 ? 1114 TYR A OH  1 
ATOM   8472  N  N   . ARG A 1 1122 ? 41.368  46.526  3.083   1.00 151.58 ? 1122 ARG A N   1 
ATOM   8473  C  CA  . ARG A 1 1122 ? 40.421  47.455  3.761   1.00 151.52 ? 1122 ARG A CA  1 
ATOM   8474  C  C   . ARG A 1 1122 ? 38.996  47.197  3.266   1.00 151.64 ? 1122 ARG A C   1 
ATOM   8475  O  O   . ARG A 1 1122 ? 38.798  46.582  2.218   1.00 154.80 ? 1122 ARG A O   1 
ATOM   8476  C  CB  . ARG A 1 1122 ? 40.861  48.915  3.587   1.00 155.24 ? 1122 ARG A CB  1 
ATOM   8477  C  CG  . ARG A 1 1122 ? 42.146  49.269  4.326   1.00 154.77 ? 1122 ARG A CG  1 
ATOM   8478  C  CD  . ARG A 1 1122 ? 42.464  50.753  4.290   1.00 159.01 ? 1122 ARG A CD  1 
ATOM   8479  N  NE  . ARG A 1 1122 ? 43.765  51.077  4.871   1.00 160.10 ? 1122 ARG A NE  1 
ATOM   8480  C  CZ  . ARG A 1 1122 ? 44.351  52.275  4.825   1.00 164.00 ? 1122 ARG A CZ  1 
ATOM   8481  N  NH1 . ARG A 1 1122 ? 43.760  53.291  4.221   1.00 167.18 ? 1122 ARG A NH1 1 
ATOM   8482  N  NH2 . ARG A 1 1122 ? 45.534  52.456  5.386   1.00 164.91 ? 1122 ARG A NH2 1 
ATOM   8483  N  N   . GLU A 1 1123 ? 38.016  47.655  4.062   1.00 149.37 ? 1123 GLU A N   1 
ATOM   8484  C  CA  . GLU A 1 1123 ? 36.585  47.601  3.777   1.00 147.69 ? 1123 GLU A CA  1 
ATOM   8485  C  C   . GLU A 1 1123 ? 36.045  46.172  3.896   1.00 143.28 ? 1123 GLU A C   1 
ATOM   8486  O  O   . GLU A 1 1123 ? 36.726  45.286  4.414   1.00 140.23 ? 1123 GLU A O   1 
ATOM   8487  C  CB  . GLU A 1 1123 ? 36.235  48.318  2.468   1.00 151.75 ? 1123 GLU A CB  1 
ATOM   8488  C  CG  . GLU A 1 1123 ? 36.339  49.832  2.566   1.00 156.26 ? 1123 GLU A CG  1 
ATOM   8489  C  CD  . GLU A 1 1123 ? 35.880  50.620  1.346   1.00 162.11 ? 1123 GLU A CD  1 
ATOM   8490  O  OE1 . GLU A 1 1123 ? 35.576  49.993  0.310   1.00 163.68 ? 1123 GLU A OE1 1 
ATOM   8491  O  OE2 . GLU A 1 1123 ? 35.815  51.865  1.433   1.00 165.56 ? 1123 GLU A OE2 1 
ATOM   8492  N  N   . ALA A 1 1124 ? 34.807  45.968  3.414   1.00 143.57 ? 1124 ALA A N   1 
ATOM   8493  C  CA  . ALA A 1 1124 ? 34.025  44.763  3.670   1.00 138.94 ? 1124 ALA A CA  1 
ATOM   8494  C  C   . ALA A 1 1124 ? 33.968  43.856  2.441   1.00 138.91 ? 1124 ALA A C   1 
ATOM   8495  O  O   . ALA A 1 1124 ? 33.545  44.272  1.361   1.00 143.56 ? 1124 ALA A O   1 
ATOM   8496  C  CB  . ALA A 1 1124 ? 32.632  45.149  4.113   1.00 139.06 ? 1124 ALA A CB  1 
ATOM   8497  N  N   . THR A 1 1125 ? 34.359  42.594  2.635   1.00 133.52 ? 1125 THR A N   1 
ATOM   8498  C  CA  . THR A 1 1125 ? 34.268  41.589  1.589   1.00 132.87 ? 1125 THR A CA  1 
ATOM   8499  C  C   . THR A 1 1125 ? 33.399  40.437  2.100   1.00 129.13 ? 1125 THR A C   1 
ATOM   8500  O  O   . THR A 1 1125 ? 33.914  39.392  2.513   1.00 126.01 ? 1125 THR A O   1 
ATOM   8501  C  CB  . THR A 1 1125 ? 35.671  41.193  1.107   1.00 132.72 ? 1125 THR A CB  1 
ATOM   8502  O  OG1 . THR A 1 1125 ? 36.434  40.917  2.279   1.00 129.67 ? 1125 THR A OG1 1 
ATOM   8503  C  CG2 . THR A 1 1125 ? 36.384  42.291  0.352   1.00 137.33 ? 1125 THR A CG2 1 
ATOM   8504  N  N   . ALA A 1 1126 ? 32.074  40.666  2.094   1.00 128.52 ? 1126 ALA A N   1 
ATOM   8505  C  CA  . ALA A 1 1126 ? 31.090  39.703  2.571   1.00 124.56 ? 1126 ALA A CA  1 
ATOM   8506  C  C   . ALA A 1 1126 ? 31.223  38.398  1.791   1.00 123.61 ? 1126 ALA A C   1 
ATOM   8507  O  O   . ALA A 1 1126 ? 30.987  37.316  2.329   1.00 121.08 ? 1126 ALA A O   1 
ATOM   8508  C  CB  . ALA A 1 1126 ? 29.699  40.277  2.455   1.00 125.06 ? 1126 ALA A CB  1 
ATOM   8509  N  N   . ASP A 1 1127 ? 31.627  38.531  0.523   1.00 126.11 ? 1127 ASP A N   1 
ATOM   8510  C  CA  . ASP A 1 1127 ? 31.907  37.401  -0.343  1.00 125.69 ? 1127 ASP A CA  1 
ATOM   8511  C  C   . ASP A 1 1127 ? 33.278  36.803  -0.039  1.00 123.87 ? 1127 ASP A C   1 
ATOM   8512  O  O   . ASP A 1 1127 ? 33.481  35.608  -0.240  1.00 122.66 ? 1127 ASP A O   1 
ATOM   8513  C  CB  . ASP A 1 1127 ? 31.783  37.790  -1.814  1.00 130.55 ? 1127 ASP A CB  1 
ATOM   8514  C  CG  . ASP A 1 1127 ? 30.381  37.579  -2.351  1.00 132.05 ? 1127 ASP A CG  1 
ATOM   8515  O  OD1 . ASP A 1 1127 ? 29.778  36.537  -2.003  1.00 129.00 ? 1127 ASP A OD1 1 
ATOM   8516  O  OD2 . ASP A 1 1127 ? 29.897  38.462  -3.100  1.00 135.84 ? 1127 ASP A OD2 1 
ATOM   8517  N  N   . ASP A 1 1128 ? 34.219  37.634  0.427   1.00 124.65 ? 1128 ASP A N   1 
ATOM   8518  C  CA  . ASP A 1 1128 ? 35.558  37.158  0.745   1.00 123.12 ? 1128 ASP A CA  1 
ATOM   8519  C  C   . ASP A 1 1128 ? 35.540  36.406  2.072   1.00 117.22 ? 1128 ASP A C   1 
ATOM   8520  O  O   . ASP A 1 1128 ? 36.259  35.421  2.223   1.00 114.78 ? 1128 ASP A O   1 
ATOM   8521  C  CB  . ASP A 1 1128 ? 36.604  38.277  0.758   1.00 127.06 ? 1128 ASP A CB  1 
ATOM   8522  C  CG  . ASP A 1 1128 ? 37.316  38.531  -0.565  1.00 132.07 ? 1128 ASP A CG  1 
ATOM   8523  O  OD1 . ASP A 1 1128 ? 36.801  38.093  -1.618  1.00 134.17 ? 1128 ASP A OD1 1 
ATOM   8524  O  OD2 . ASP A 1 1128 ? 38.380  39.182  -0.532  1.00 134.52 ? 1128 ASP A OD2 1 
ATOM   8525  N  N   . LEU A 1 1129 ? 34.725  36.883  3.022   1.00 114.94 ? 1129 LEU A N   1 
ATOM   8526  C  CA  . LEU A 1 1129 ? 34.527  36.173  4.275   1.00 110.59 ? 1129 LEU A CA  1 
ATOM   8527  C  C   . LEU A 1 1129 ? 33.804  34.852  4.020   1.00 108.37 ? 1129 LEU A C   1 
ATOM   8528  O  O   . LEU A 1 1129 ? 34.071  33.859  4.697   1.00 105.25 ? 1129 LEU A O   1 
ATOM   8529  C  CB  . LEU A 1 1129 ? 33.757  37.055  5.262   1.00 109.93 ? 1129 LEU A CB  1 
ATOM   8530  C  CG  . LEU A 1 1129 ? 34.628  37.826  6.253   1.00 109.57 ? 1129 LEU A CG  1 
ATOM   8531  C  CD1 . LEU A 1 1129 ? 33.840  38.926  6.938   1.00 110.80 ? 1129 LEU A CD1 1 
ATOM   8532  C  CD2 . LEU A 1 1129 ? 35.251  36.893  7.282   1.00 105.05 ? 1129 LEU A CD2 1 
ATOM   8533  N  N   . ILE A 1 1130 ? 32.888  34.850  3.044   1.00 109.75 ? 1130 ILE A N   1 
ATOM   8534  C  CA  . ILE A 1 1130 ? 32.225  33.623  2.635   1.00 108.10 ? 1130 ILE A CA  1 
ATOM   8535  C  C   . ILE A 1 1130 ? 33.276  32.617  2.170   1.00 107.59 ? 1130 ILE A C   1 
ATOM   8536  O  O   . ILE A 1 1130 ? 33.268  31.473  2.620   1.00 105.70 ? 1130 ILE A O   1 
ATOM   8537  C  CB  . ILE A 1 1130 ? 31.149  33.878  1.559   1.00 110.67 ? 1130 ILE A CB  1 
ATOM   8538  C  CG1 . ILE A 1 1130 ? 29.896  34.520  2.158   1.00 110.01 ? 1130 ILE A CG1 1 
ATOM   8539  C  CG2 . ILE A 1 1130 ? 30.814  32.591  0.815   1.00 110.04 ? 1130 ILE A CG2 1 
ATOM   8540  C  CD1 . ILE A 1 1130 ? 28.862  34.909  1.129   1.00 113.39 ? 1130 ILE A CD1 1 
ATOM   8541  N  N   . LYS A 1 1131 ? 34.183  33.061  1.289   1.00 110.30 ? 1131 LYS A N   1 
ATOM   8542  C  CA  . LYS A 1 1131 ? 35.202  32.196  0.712   1.00 110.46 ? 1131 LYS A CA  1 
ATOM   8543  C  C   . LYS A 1 1131 ? 36.130  31.640  1.794   1.00 106.77 ? 1131 LYS A C   1 
ATOM   8544  O  O   . LYS A 1 1131 ? 36.637  30.526  1.666   1.00 104.66 ? 1131 LYS A O   1 
ATOM   8545  C  CB  . LYS A 1 1131 ? 35.988  32.931  -0.377  1.00 114.98 ? 1131 LYS A CB  1 
ATOM   8546  C  CG  . LYS A 1 1131 ? 35.475  32.718  -1.795  1.00 118.75 ? 1131 LYS A CG  1 
ATOM   8547  C  CD  . LYS A 1 1131 ? 36.232  33.505  -2.858  1.00 123.94 ? 1131 LYS A CD  1 
ATOM   8548  C  CE  . LYS A 1 1131 ? 37.526  32.859  -3.310  1.00 124.24 ? 1131 LYS A CE  1 
ATOM   8549  N  NZ  . LYS A 1 1131 ? 38.073  33.534  -4.511  1.00 128.41 ? 1131 LYS A NZ  1 
ATOM   8550  N  N   . VAL A 1 1132 ? 36.344  32.433  2.851   1.00 105.70 ? 1132 VAL A N   1 
ATOM   8551  C  CA  . VAL A 1 1132 ? 37.209  32.066  3.961   1.00 102.41 ? 1132 VAL A CA  1 
ATOM   8552  C  C   . VAL A 1 1132 ? 36.554  30.936  4.749   1.00 98.47  ? 1132 VAL A C   1 
ATOM   8553  O  O   . VAL A 1 1132 ? 37.195  29.923  5.013   1.00 96.56  ? 1132 VAL A O   1 
ATOM   8554  C  CB  . VAL A 1 1132 ? 37.540  33.285  4.849   1.00 102.84 ? 1132 VAL A CB  1 
ATOM   8555  C  CG1 . VAL A 1 1132 ? 37.854  32.898  6.289   1.00 98.80  ? 1132 VAL A CG1 1 
ATOM   8556  C  CG2 . VAL A 1 1132 ? 38.657  34.137  4.257   1.00 106.07 ? 1132 VAL A CG2 1 
ATOM   8557  N  N   . VAL A 1 1133 ? 35.271  31.117  5.096   1.00 98.05  ? 1133 VAL A N   1 
ATOM   8558  C  CA  . VAL A 1 1133 ? 34.543  30.191  5.955   1.00 94.72  ? 1133 VAL A CA  1 
ATOM   8559  C  C   . VAL A 1 1133 ? 34.330  28.862  5.230   1.00 94.84  ? 1133 VAL A C   1 
ATOM   8560  O  O   . VAL A 1 1133 ? 34.389  27.804  5.856   1.00 92.28  ? 1133 VAL A O   1 
ATOM   8561  C  CB  . VAL A 1 1133 ? 33.224  30.796  6.484   1.00 93.71  ? 1133 VAL A CB  1 
ATOM   8562  C  CG1 . VAL A 1 1133 ? 32.386  29.782  7.249   1.00 90.15  ? 1133 VAL A CG1 1 
ATOM   8563  C  CG2 . VAL A 1 1133 ? 33.472  32.020  7.353   1.00 93.41  ? 1133 VAL A CG2 1 
ATOM   8564  N  N   . GLU A 1 1134 ? 34.102  28.925  3.911   1.00 98.29  ? 1134 GLU A N   1 
ATOM   8565  C  CA  . GLU A 1 1134 ? 33.983  27.734  3.086   1.00 100.02 ? 1134 GLU A CA  1 
ATOM   8566  C  C   . GLU A 1 1134 ? 35.216  26.848  3.244   1.00 100.15 ? 1134 GLU A C   1 
ATOM   8567  O  O   . GLU A 1 1134 ? 35.088  25.625  3.291   1.00 99.53  ? 1134 GLU A O   1 
ATOM   8568  C  CB  . GLU A 1 1134 ? 33.781  28.102  1.618   1.00 104.36 ? 1134 GLU A CB  1 
ATOM   8569  C  CG  . GLU A 1 1134 ? 32.328  28.330  1.262   1.00 106.99 ? 1134 GLU A CG  1 
ATOM   8570  C  CD  . GLU A 1 1134 ? 31.978  28.065  -0.194  1.00 111.94 ? 1134 GLU A CD  1 
ATOM   8571  O  OE1 . GLU A 1 1134 ? 32.306  28.917  -1.048  1.00 115.72 ? 1134 GLU A OE1 1 
ATOM   8572  O  OE2 . GLU A 1 1134 ? 31.373  27.008  -0.473  1.00 112.61 ? 1134 GLU A OE2 1 
ATOM   8573  N  N   . GLU A 1 1135 ? 36.399  27.478  3.324   1.00 102.44 ? 1135 GLU A N   1 
ATOM   8574  C  CA  . GLU A 1 1135 ? 37.658  26.780  3.548   1.00 102.18 ? 1135 GLU A CA  1 
ATOM   8575  C  C   . GLU A 1 1135 ? 37.628  26.053  4.892   1.00 98.00  ? 1135 GLU A C   1 
ATOM   8576  O  O   . GLU A 1 1135 ? 38.049  24.898  4.977   1.00 96.75  ? 1135 GLU A O   1 
ATOM   8577  C  CB  . GLU A 1 1135 ? 38.849  27.739  3.472   1.00 105.65 ? 1135 GLU A CB  1 
ATOM   8578  C  CG  . GLU A 1 1135 ? 39.383  27.946  2.063   1.00 110.49 ? 1135 GLU A CG  1 
ATOM   8579  C  CD  . GLU A 1 1135 ? 40.897  28.038  1.973   1.00 112.20 ? 1135 GLU A CD  1 
ATOM   8580  O  OE1 . GLU A 1 1135 ? 41.390  29.012  1.363   1.00 116.07 ? 1135 GLU A OE1 1 
ATOM   8581  O  OE2 . GLU A 1 1135 ? 41.579  27.132  2.508   1.00 110.15 ? 1135 GLU A OE2 1 
ATOM   8582  N  N   . LEU A 1 1136 ? 37.101  26.731  5.922   1.00 95.50  ? 1136 LEU A N   1 
ATOM   8583  C  CA  . LEU A 1 1136 ? 37.096  26.207  7.279   1.00 91.87  ? 1136 LEU A CA  1 
ATOM   8584  C  C   . LEU A 1 1136 ? 36.146  25.017  7.402   1.00 90.59  ? 1136 LEU A C   1 
ATOM   8585  O  O   . LEU A 1 1136 ? 36.353  24.164  8.262   1.00 89.46  ? 1136 LEU A O   1 
ATOM   8586  C  CB  . LEU A 1 1136 ? 36.732  27.322  8.266   1.00 90.60  ? 1136 LEU A CB  1 
ATOM   8587  C  CG  . LEU A 1 1136 ? 37.829  28.353  8.536   1.00 91.80  ? 1136 LEU A CG  1 
ATOM   8588  C  CD1 . LEU A 1 1136 ? 37.263  29.588  9.220   1.00 92.05  ? 1136 LEU A CD1 1 
ATOM   8589  C  CD2 . LEU A 1 1136 ? 38.955  27.756  9.365   1.00 89.36  ? 1136 LEU A CD2 1 
ATOM   8590  N  N   . THR A 1 1137 ? 35.112  24.957  6.550   1.00 91.28  ? 1137 THR A N   1 
ATOM   8591  C  CA  . THR A 1 1137 ? 34.140  23.876  6.634   1.00 89.30  ? 1137 THR A CA  1 
ATOM   8592  C  C   . THR A 1 1137 ? 34.697  22.603  6.000   1.00 90.16  ? 1137 THR A C   1 
ATOM   8593  O  O   . THR A 1 1137 ? 34.092  21.537  6.133   1.00 89.83  ? 1137 THR A O   1 
ATOM   8594  C  CB  . THR A 1 1137 ? 32.814  24.216  5.943   1.00 89.93  ? 1137 THR A CB  1 
ATOM   8595  O  OG1 . THR A 1 1137 ? 33.109  24.343  4.553   1.00 91.81  ? 1137 THR A OG1 1 
ATOM   8596  C  CG2 . THR A 1 1137 ? 32.147  25.462  6.482   1.00 90.00  ? 1137 THR A CG2 1 
ATOM   8597  N  N   . ARG A 1 1138 ? 35.846  22.723  5.317   1.00 91.53  ? 1138 ARG A N   1 
ATOM   8598  C  CA  . ARG A 1 1138 ? 36.422  21.605  4.582   1.00 92.05  ? 1138 ARG A CA  1 
ATOM   8599  C  C   . ARG A 1 1138 ? 37.312  20.746  5.482   1.00 90.17  ? 1138 ARG A C   1 
ATOM   8600  O  O   . ARG A 1 1138 ? 37.757  19.671  5.076   1.00 91.02  ? 1138 ARG A O   1 
ATOM   8601  C  CB  . ARG A 1 1138 ? 37.137  22.083  3.315   1.00 94.51  ? 1138 ARG A CB  1 
ATOM   8602  C  CG  . ARG A 1 1138 ? 36.182  22.609  2.256   1.00 97.98  ? 1138 ARG A CG  1 
ATOM   8603  C  CD  . ARG A 1 1138 ? 36.786  22.767  0.874   1.00 102.20 ? 1138 ARG A CD  1 
ATOM   8604  N  NE  . ARG A 1 1138 ? 36.268  23.961  0.210   1.00 105.53 ? 1138 ARG A NE  1 
ATOM   8605  C  CZ  . ARG A 1 1138 ? 36.952  25.091  0.025   1.00 107.72 ? 1138 ARG A CZ  1 
ATOM   8606  N  NH1 . ARG A 1 1138 ? 38.204  25.193  0.439   1.00 107.78 ? 1138 ARG A NH1 1 
ATOM   8607  N  NH2 . ARG A 1 1138 ? 36.385  26.116  -0.586  1.00 110.45 ? 1138 ARG A NH2 1 
ATOM   8608  N  N   . ILE A 1 1139 ? 37.541  21.204  6.716   1.00 88.29  ? 1139 ILE A N   1 
ATOM   8609  C  CA  . ILE A 1 1139 ? 38.393  20.486  7.652   1.00 86.74  ? 1139 ILE A CA  1 
ATOM   8610  C  C   . ILE A 1 1139 ? 37.650  19.289  8.245   1.00 85.18  ? 1139 ILE A C   1 
ATOM   8611  O  O   . ILE A 1 1139 ? 38.217  18.555  9.050   1.00 84.89  ? 1139 ILE A O   1 
ATOM   8612  C  CB  . ILE A 1 1139 ? 38.916  21.427  8.756   1.00 85.86  ? 1139 ILE A CB  1 
ATOM   8613  C  CG1 . ILE A 1 1139 ? 37.766  22.071  9.537   1.00 85.47  ? 1139 ILE A CG1 1 
ATOM   8614  C  CG2 . ILE A 1 1139 ? 39.881  22.458  8.189   1.00 88.04  ? 1139 ILE A CG2 1 
ATOM   8615  C  CD1 . ILE A 1 1139 ? 38.211  23.015  10.628  1.00 85.92  ? 1139 ILE A CD1 1 
ATOM   8616  N  N   . HIS A 1 1140 ? 36.383  19.097  7.863   1.00 86.64  ? 1140 HIS A N   1 
ATOM   8617  C  CA  . HIS A 1 1140 ? 35.595  17.994  8.394   1.00 86.61  ? 1140 HIS A CA  1 
ATOM   8618  C  C   . HIS A 1 1140 ? 34.386  17.713  7.496   1.00 91.35  ? 1140 HIS A C   1 
ATOM   8619  O  O   . HIS A 1 1140 ? 34.074  18.418  6.514   1.00 95.59  ? 1140 HIS A O   1 
ATOM   8620  C  CB  . HIS A 1 1140 ? 35.140  18.281  9.831   1.00 83.40  ? 1140 HIS A CB  1 
ATOM   8621  C  CG  . HIS A 1 1140 ? 34.161  19.403  9.922   1.00 84.00  ? 1140 HIS A CG  1 
ATOM   8622  N  ND1 . HIS A 1 1140 ? 32.803  19.193  10.076  1.00 83.59  ? 1140 HIS A ND1 1 
ATOM   8623  C  CD2 . HIS A 1 1140 ? 34.332  20.741  9.853   1.00 85.64  ? 1140 HIS A CD2 1 
ATOM   8624  C  CE1 . HIS A 1 1140 ? 32.181  20.355  10.107  1.00 84.44  ? 1140 HIS A CE1 1 
ATOM   8625  N  NE2 . HIS A 1 1140 ? 33.098  21.322  9.974   1.00 85.42  ? 1140 HIS A NE2 1 
ATOM   8626  O  OXT . HIS A 1 1140 ? 33.692  16.733  7.790   1.00 92.63  ? 1140 HIS A OXT 1 
ATOM   8627  N  N   . ARG B 2 39   ? 31.045  0.562   50.358  1.00 119.77 ? 33   ARG C N   1 
ATOM   8628  C  CA  . ARG B 2 39   ? 30.423  -0.382  49.373  1.00 120.53 ? 33   ARG C CA  1 
ATOM   8629  C  C   . ARG B 2 39   ? 30.817  0.008   47.945  1.00 114.79 ? 33   ARG C C   1 
ATOM   8630  O  O   . ARG B 2 39   ? 30.530  -0.730  47.000  1.00 115.55 ? 33   ARG C O   1 
ATOM   8631  C  CB  . ARG B 2 39   ? 28.905  -0.457  49.582  1.00 125.53 ? 33   ARG C CB  1 
ATOM   8632  C  CG  . ARG B 2 39   ? 28.193  -1.421  48.644  1.00 126.83 ? 33   ARG C CG  1 
ATOM   8633  C  CD  . ARG B 2 39   ? 26.793  -1.818  49.076  1.00 134.79 ? 33   ARG C CD  1 
ATOM   8634  N  NE  . ARG B 2 39   ? 26.082  -2.475  47.981  1.00 135.79 ? 33   ARG C NE  1 
ATOM   8635  C  CZ  . ARG B 2 39   ? 24.866  -3.027  48.056  1.00 142.20 ? 33   ARG C CZ  1 
ATOM   8636  N  NH1 . ARG B 2 39   ? 24.328  -3.593  46.987  1.00 141.78 ? 33   ARG C NH1 1 
ATOM   8637  N  NH2 . ARG B 2 39   ? 24.187  -3.012  49.190  1.00 148.71 ? 33   ARG C NH2 1 
ATOM   8638  N  N   . GLU B 2 40   ? 31.469  1.171   47.797  1.00 109.64 ? 34   GLU C N   1 
ATOM   8639  C  CA  . GLU B 2 40   ? 31.987  1.626   46.516  1.00 103.44 ? 34   GLU C CA  1 
ATOM   8640  C  C   . GLU B 2 40   ? 33.488  1.360   46.474  1.00 98.26  ? 34   GLU C C   1 
ATOM   8641  O  O   . GLU B 2 40   ? 34.147  1.335   47.509  1.00 101.24 ? 34   GLU C O   1 
ATOM   8642  C  CB  . GLU B 2 40   ? 31.711  3.119   46.300  1.00 104.90 ? 34   GLU C CB  1 
ATOM   8643  C  CG  . GLU B 2 40   ? 30.366  3.423   45.644  1.00 109.53 ? 34   GLU C CG  1 
ATOM   8644  C  CD  . GLU B 2 40   ? 30.102  4.880   45.279  1.00 109.25 ? 34   GLU C CD  1 
ATOM   8645  O  OE1 . GLU B 2 40   ? 29.330  5.543   46.017  1.00 113.68 ? 34   GLU C OE1 1 
ATOM   8646  O  OE2 . GLU B 2 40   ? 30.645  5.348   44.245  1.00 104.22 ? 34   GLU C OE2 1 
ATOM   8647  N  N   . HIS B 2 41   ? 34.012  1.159   45.264  1.00 91.54  ? 35   HIS C N   1 
ATOM   8648  C  CA  . HIS B 2 41   ? 35.427  0.918   45.051  1.00 86.83  ? 35   HIS C CA  1 
ATOM   8649  C  C   . HIS B 2 41   ? 35.937  1.926   44.025  1.00 80.40  ? 35   HIS C C   1 
ATOM   8650  O  O   . HIS B 2 41   ? 35.232  2.238   43.072  1.00 80.12  ? 35   HIS C O   1 
ATOM   8651  C  CB  . HIS B 2 41   ? 35.644  -0.538  44.607  1.00 89.12  ? 35   HIS C CB  1 
ATOM   8652  C  CG  . HIS B 2 41   ? 37.076  -0.899  44.380  1.00 88.67  ? 35   HIS C CG  1 
ATOM   8653  N  ND1 . HIS B 2 41   ? 37.868  -0.246  43.448  1.00 84.55  ? 35   HIS C ND1 1 
ATOM   8654  C  CD2 . HIS B 2 41   ? 37.862  -1.844  44.942  1.00 91.36  ? 35   HIS C CD2 1 
ATOM   8655  C  CE1 . HIS B 2 41   ? 39.079  -0.765  43.456  1.00 84.29  ? 35   HIS C CE1 1 
ATOM   8656  N  NE2 . HIS B 2 41   ? 39.101  -1.749  44.363  1.00 88.66  ? 35   HIS C NE2 1 
ATOM   8657  N  N   . VAL B 2 42   ? 37.165  2.416   44.213  1.00 75.76  ? 36   VAL C N   1 
ATOM   8658  C  CA  . VAL B 2 42   ? 37.735  3.440   43.354  1.00 71.41  ? 36   VAL C CA  1 
ATOM   8659  C  C   . VAL B 2 42   ? 37.467  3.131   41.884  1.00 68.76  ? 36   VAL C C   1 
ATOM   8660  O  O   . VAL B 2 42   ? 37.214  4.039   41.099  1.00 67.05  ? 36   VAL C O   1 
ATOM   8661  C  CB  . VAL B 2 42   ? 39.248  3.603   43.581  1.00 70.97  ? 36   VAL C CB  1 
ATOM   8662  C  CG1 . VAL B 2 42   ? 39.826  4.728   42.734  1.00 67.75  ? 36   VAL C CG1 1 
ATOM   8663  C  CG2 . VAL B 2 42   ? 39.577  3.821   45.047  1.00 73.89  ? 36   VAL C CG2 1 
ATOM   8664  N  N   . LEU B 2 43   ? 37.577  1.860   41.494  1.00 68.82  ? 37   LEU C N   1 
ATOM   8665  C  CA  . LEU B 2 43   ? 37.585  1.555   40.074  1.00 67.07  ? 37   LEU C CA  1 
ATOM   8666  C  C   . LEU B 2 43   ? 36.165  1.535   39.518  1.00 67.97  ? 37   LEU C C   1 
ATOM   8667  O  O   . LEU B 2 43   ? 35.970  1.838   38.344  1.00 66.25  ? 37   LEU C O   1 
ATOM   8668  C  CB  . LEU B 2 43   ? 38.346  0.253   39.806  1.00 68.08  ? 37   LEU C CB  1 
ATOM   8669  C  CG  . LEU B 2 43   ? 39.872  0.370   39.811  1.00 66.65  ? 37   LEU C CG  1 
ATOM   8670  C  CD1 . LEU B 2 43   ? 40.509  -0.924  39.358  1.00 69.18  ? 37   LEU C CD1 1 
ATOM   8671  C  CD2 . LEU B 2 43   ? 40.353  1.505   38.926  1.00 63.56  ? 37   LEU C CD2 1 
ATOM   8672  N  N   . LYS B 2 44   ? 35.191  1.198   40.377  1.00 71.29  ? 38   LYS C N   1 
ATOM   8673  C  CA  . LYS B 2 44   ? 33.779  1.231   40.029  1.00 72.33  ? 38   LYS C CA  1 
ATOM   8674  C  C   . LYS B 2 44   ? 33.344  2.680   39.833  1.00 70.43  ? 38   LYS C C   1 
ATOM   8675  O  O   . LYS B 2 44   ? 32.564  2.985   38.936  1.00 70.17  ? 38   LYS C O   1 
ATOM   8676  C  CB  . LYS B 2 44   ? 32.935  0.571   41.121  1.00 77.27  ? 38   LYS C CB  1 
ATOM   8677  C  CG  . LYS B 2 44   ? 33.070  -0.941  41.257  1.00 81.51  ? 38   LYS C CG  1 
ATOM   8678  C  CD  . LYS B 2 44   ? 32.530  -1.730  40.073  1.00 82.99  ? 38   LYS C CD  1 
ATOM   8679  C  CE  . LYS B 2 44   ? 31.585  -2.852  40.461  1.00 88.95  ? 38   LYS C CE  1 
ATOM   8680  N  NZ  . LYS B 2 44   ? 32.037  -3.586  41.667  1.00 93.09  ? 38   LYS C NZ  1 
ATOM   8681  N  N   . GLN B 2 45   ? 33.880  3.568   40.672  1.00 69.64  ? 39   GLN C N   1 
ATOM   8682  C  CA  . GLN B 2 45   ? 33.593  4.988   40.603  1.00 69.50  ? 39   GLN C CA  1 
ATOM   8683  C  C   . GLN B 2 45   ? 34.115  5.588   39.300  1.00 66.51  ? 39   GLN C C   1 
ATOM   8684  O  O   . GLN B 2 45   ? 33.507  6.508   38.760  1.00 66.72  ? 39   GLN C O   1 
ATOM   8685  C  CB  . GLN B 2 45   ? 34.226  5.696   41.792  1.00 70.77  ? 39   GLN C CB  1 
ATOM   8686  C  CG  . GLN B 2 45   ? 33.787  5.113   43.120  1.00 76.35  ? 39   GLN C CG  1 
ATOM   8687  C  CD  . GLN B 2 45   ? 33.584  6.220   44.119  1.00 80.20  ? 39   GLN C CD  1 
ATOM   8688  O  OE1 . GLN B 2 45   ? 33.361  7.370   43.747  1.00 82.34  ? 39   GLN C OE1 1 
ATOM   8689  N  NE2 . GLN B 2 45   ? 33.652  5.876   45.396  1.00 83.58  ? 39   GLN C NE2 1 
ATOM   8690  N  N   . LEU B 2 46   ? 35.245  5.074   38.810  1.00 64.76  ? 40   LEU C N   1 
ATOM   8691  C  CA  . LEU B 2 46   ? 35.872  5.621   37.621  1.00 63.28  ? 40   LEU C CA  1 
ATOM   8692  C  C   . LEU B 2 46   ? 35.154  5.135   36.367  1.00 64.30  ? 40   LEU C C   1 
ATOM   8693  O  O   . LEU B 2 46   ? 35.074  5.867   35.384  1.00 63.66  ? 40   LEU C O   1 
ATOM   8694  C  CB  . LEU B 2 46   ? 37.344  5.210   37.599  1.00 62.16  ? 40   LEU C CB  1 
ATOM   8695  C  CG  . LEU B 2 46   ? 38.265  6.020   38.504  1.00 61.02  ? 40   LEU C CG  1 
ATOM   8696  C  CD1 . LEU B 2 46   ? 39.699  5.577   38.307  1.00 60.21  ? 40   LEU C CD1 1 
ATOM   8697  C  CD2 . LEU B 2 46   ? 38.129  7.500   38.209  1.00 60.52  ? 40   LEU C CD2 1 
ATOM   8698  N  N   . GLU B 2 47   ? 34.652  3.894   36.402  1.00 68.03  ? 41   GLU C N   1 
ATOM   8699  C  CA  . GLU B 2 47   ? 33.814  3.388   35.324  1.00 69.79  ? 41   GLU C CA  1 
ATOM   8700  C  C   . GLU B 2 47   ? 32.549  4.239   35.219  1.00 68.25  ? 41   GLU C C   1 
ATOM   8701  O  O   . GLU B 2 47   ? 32.213  4.687   34.128  1.00 66.45  ? 41   GLU C O   1 
ATOM   8702  C  CB  . GLU B 2 47   ? 33.582  1.884   35.447  1.00 76.21  ? 41   GLU C CB  1 
ATOM   8703  C  CG  . GLU B 2 47   ? 34.782  1.078   34.970  1.00 84.26  ? 41   GLU C CG  1 
ATOM   8704  C  CD  . GLU B 2 47   ? 34.789  -0.415  35.291  1.00 94.89  ? 41   GLU C CD  1 
ATOM   8705  O  OE1 . GLU B 2 47   ? 33.770  -0.912  35.842  1.00 100.03 ? 41   GLU C OE1 1 
ATOM   8706  O  OE2 . GLU B 2 47   ? 35.817  -1.091  34.993  1.00 99.59  ? 41   GLU C OE2 1 
ATOM   8707  N  N   . ARG B 2 48   ? 31.894  4.503   36.361  1.00 68.25  ? 42   ARG C N   1 
ATOM   8708  C  CA  . ARG B 2 48   ? 30.761  5.415   36.405  1.00 68.49  ? 42   ARG C CA  1 
ATOM   8709  C  C   . ARG B 2 48   ? 31.103  6.716   35.689  1.00 66.02  ? 42   ARG C C   1 
ATOM   8710  O  O   . ARG B 2 48   ? 30.321  7.174   34.867  1.00 66.79  ? 42   ARG C O   1 
ATOM   8711  C  CB  . ARG B 2 48   ? 30.274  5.679   37.833  1.00 71.66  ? 42   ARG C CB  1 
ATOM   8712  C  CG  . ARG B 2 48   ? 28.998  4.929   38.184  1.00 76.59  ? 42   ARG C CG  1 
ATOM   8713  C  CD  . ARG B 2 48   ? 28.467  5.151   39.587  1.00 81.22  ? 42   ARG C CD  1 
ATOM   8714  N  NE  . ARG B 2 48   ? 28.307  3.847   40.217  1.00 84.88  ? 42   ARG C NE  1 
ATOM   8715  C  CZ  . ARG B 2 48   ? 28.941  3.448   41.318  1.00 86.79  ? 42   ARG C CZ  1 
ATOM   8716  N  NH1 . ARG B 2 48   ? 29.759  4.270   41.954  1.00 85.49  ? 42   ARG C NH1 1 
ATOM   8717  N  NH2 . ARG B 2 48   ? 28.736  2.232   41.799  1.00 90.15  ? 42   ARG C NH2 1 
ATOM   8718  N  N   . VAL B 2 49   ? 32.276  7.290   35.983  1.00 63.81  ? 43   VAL C N   1 
ATOM   8719  C  CA  . VAL B 2 49   ? 32.630  8.602   35.460  1.00 62.14  ? 43   VAL C CA  1 
ATOM   8720  C  C   . VAL B 2 49   ? 32.577  8.578   33.931  1.00 60.34  ? 43   VAL C C   1 
ATOM   8721  O  O   . VAL B 2 49   ? 31.964  9.452   33.327  1.00 60.64  ? 43   VAL C O   1 
ATOM   8722  C  CB  . VAL B 2 49   ? 33.962  9.149   36.025  1.00 60.80  ? 43   VAL C CB  1 
ATOM   8723  C  CG1 . VAL B 2 49   ? 34.365  10.465  35.375  1.00 60.14  ? 43   VAL C CG1 1 
ATOM   8724  C  CG2 . VAL B 2 49   ? 33.898  9.333   37.534  1.00 61.87  ? 43   VAL C CG2 1 
ATOM   8725  N  N   . LYS B 2 50   ? 33.171  7.553   33.310  1.00 59.00  ? 44   LYS C N   1 
ATOM   8726  C  CA  . LYS B 2 50   ? 33.334  7.542   31.862  1.00 58.16  ? 44   LYS C CA  1 
ATOM   8727  C  C   . LYS B 2 50   ? 31.983  7.435   31.143  1.00 57.75  ? 44   LYS C C   1 
ATOM   8728  O  O   . LYS B 2 50   ? 31.825  7.958   30.044  1.00 56.98  ? 44   LYS C O   1 
ATOM   8729  C  CB  . LYS B 2 50   ? 34.389  6.515   31.426  1.00 57.91  ? 44   LYS C CB  1 
ATOM   8730  C  CG  . LYS B 2 50   ? 35.794  6.806   31.931  1.00 59.60  ? 44   LYS C CG  1 
ATOM   8731  C  CD  . LYS B 2 50   ? 36.920  6.006   31.307  1.00 61.05  ? 44   LYS C CD  1 
ATOM   8732  C  CE  . LYS B 2 50   ? 38.280  6.445   31.824  1.00 60.93  ? 44   LYS C CE  1 
ATOM   8733  N  NZ  . LYS B 2 50   ? 39.393  5.582   31.356  1.00 63.14  ? 44   LYS C NZ  1 
ATOM   8734  N  N   . ILE B 2 51   ? 30.997  6.781   31.767  1.00 58.20  ? 45   ILE C N   1 
ATOM   8735  C  CA  . ILE B 2 51   ? 29.736  6.515   31.089  1.00 58.58  ? 45   ILE C CA  1 
ATOM   8736  C  C   . ILE B 2 51   ? 28.692  7.570   31.429  1.00 60.85  ? 45   ILE C C   1 
ATOM   8737  O  O   . ILE B 2 51   ? 27.782  7.777   30.638  1.00 62.15  ? 45   ILE C O   1 
ATOM   8738  C  CB  . ILE B 2 51   ? 29.199  5.098   31.361  1.00 58.67  ? 45   ILE C CB  1 
ATOM   8739  C  CG1 . ILE B 2 51   ? 28.917  4.865   32.846  1.00 59.58  ? 45   ILE C CG1 1 
ATOM   8740  C  CG2 . ILE B 2 51   ? 30.126  4.052   30.764  1.00 57.19  ? 45   ILE C CG2 1 
ATOM   8741  C  CD1 . ILE B 2 51   ? 28.076  3.657   33.128  1.00 61.64  ? 45   ILE C CD1 1 
ATOM   8742  N  N   . SER B 2 52   ? 28.820  8.207   32.600  1.00 62.48  ? 46   SER C N   1 
ATOM   8743  C  CA  . SER B 2 52   ? 27.871  9.203   33.076  1.00 65.94  ? 46   SER C CA  1 
ATOM   8744  C  C   . SER B 2 52   ? 28.366  10.621  32.785  1.00 66.72  ? 46   SER C C   1 
ATOM   8745  O  O   . SER B 2 52   ? 27.589  11.503  32.436  1.00 68.66  ? 46   SER C O   1 
ATOM   8746  C  CB  . SER B 2 52   ? 27.580  9.021   34.544  1.00 67.82  ? 46   SER C CB  1 
ATOM   8747  O  OG  . SER B 2 52   ? 28.601  9.615   35.331  1.00 66.85  ? 46   SER C OG  1 
ATOM   8748  N  N   . GLY B 2 53   ? 29.667  10.853  32.964  1.00 66.22  ? 47   GLY C N   1 
ATOM   8749  C  CA  . GLY B 2 53   ? 30.231  12.179  32.776  1.00 67.82  ? 47   GLY C CA  1 
ATOM   8750  C  C   . GLY B 2 53   ? 30.014  13.074  33.995  1.00 71.82  ? 47   GLY C C   1 
ATOM   8751  O  O   . GLY B 2 53   ? 30.137  14.295  33.901  1.00 72.85  ? 47   GLY C O   1 
ATOM   8752  N  N   . GLN B 2 54   ? 29.710  12.457  35.142  1.00 74.58  ? 48   GLN C N   1 
ATOM   8753  C  CA  . GLN B 2 54   ? 29.646  13.186  36.399  1.00 80.14  ? 48   GLN C CA  1 
ATOM   8754  C  C   . GLN B 2 54   ? 30.874  12.891  37.258  1.00 79.81  ? 48   GLN C C   1 
ATOM   8755  O  O   . GLN B 2 54   ? 30.939  11.867  37.938  1.00 79.87  ? 48   GLN C O   1 
ATOM   8756  C  CB  . GLN B 2 54   ? 28.393  12.815  37.177  1.00 85.27  ? 48   GLN C CB  1 
ATOM   8757  C  CG  . GLN B 2 54   ? 27.148  13.494  36.644  1.00 92.21  ? 48   GLN C CG  1 
ATOM   8758  C  CD  . GLN B 2 54   ? 25.931  12.796  37.190  1.00 98.16  ? 48   GLN C CD  1 
ATOM   8759  O  OE1 . GLN B 2 54   ? 24.963  12.535  36.474  1.00 100.90 ? 48   GLN C OE1 1 
ATOM   8760  N  NE2 . GLN B 2 54   ? 25.979  12.480  38.475  1.00 101.27 ? 48   GLN C NE2 1 
ATOM   8761  N  N   . LEU B 2 55   ? 31.831  13.826  37.227  1.00 80.19  ? 49   LEU C N   1 
ATOM   8762  C  CA  . LEU B 2 55   ? 33.053  13.754  38.008  1.00 77.53  ? 49   LEU C CA  1 
ATOM   8763  C  C   . LEU B 2 55   ? 33.023  14.903  39.006  1.00 81.32  ? 49   LEU C C   1 
ATOM   8764  O  O   . LEU B 2 55   ? 32.960  16.061  38.608  1.00 83.02  ? 49   LEU C O   1 
ATOM   8765  C  CB  . LEU B 2 55   ? 34.243  13.887  37.052  1.00 75.16  ? 49   LEU C CB  1 
ATOM   8766  C  CG  . LEU B 2 55   ? 35.638  13.951  37.678  1.00 73.70  ? 49   LEU C CG  1 
ATOM   8767  C  CD1 . LEU B 2 55   ? 35.879  12.789  38.631  1.00 71.63  ? 49   LEU C CD1 1 
ATOM   8768  C  CD2 . LEU B 2 55   ? 36.706  13.954  36.595  1.00 71.82  ? 49   LEU C CD2 1 
ATOM   8769  N  N   . SER B 2 56   ? 33.040  14.559  40.296  1.00 83.45  ? 50   SER C N   1 
ATOM   8770  C  CA  . SER B 2 56   ? 32.937  15.527  41.378  1.00 87.99  ? 50   SER C CA  1 
ATOM   8771  C  C   . SER B 2 56   ? 33.774  15.041  42.559  1.00 88.08  ? 50   SER C C   1 
ATOM   8772  O  O   . SER B 2 56   ? 33.796  13.847  42.853  1.00 86.00  ? 50   SER C O   1 
ATOM   8773  C  CB  . SER B 2 56   ? 31.484  15.740  41.768  1.00 91.57  ? 50   SER C CB  1 
ATOM   8774  O  OG  . SER B 2 56   ? 31.348  16.664  42.842  1.00 95.38  ? 50   SER C OG  1 
ATOM   8775  N  N   . PRO B 2 57   ? 34.495  15.939  43.272  1.00 91.43  ? 51   PRO C N   1 
ATOM   8776  C  CA  . PRO B 2 57   ? 35.218  15.549  44.485  1.00 92.71  ? 51   PRO C CA  1 
ATOM   8777  C  C   . PRO B 2 57   ? 34.323  14.913  45.552  1.00 97.17  ? 51   PRO C C   1 
ATOM   8778  O  O   . PRO B 2 57   ? 34.782  14.084  46.330  1.00 97.31  ? 51   PRO C O   1 
ATOM   8779  C  CB  . PRO B 2 57   ? 35.810  16.872  45.001  1.00 95.25  ? 51   PRO C CB  1 
ATOM   8780  C  CG  . PRO B 2 57   ? 35.865  17.766  43.777  1.00 95.17  ? 51   PRO C CG  1 
ATOM   8781  C  CD  . PRO B 2 57   ? 34.666  17.365  42.943  1.00 94.21  ? 51   PRO C CD  1 
ATOM   8782  N  N   . ARG B 2 58   ? 33.032  15.269  45.552  1.00 102.60 ? 52   ARG C N   1 
ATOM   8783  C  CA  . ARG B 2 58   ? 32.101  14.873  46.599  1.00 107.30 ? 52   ARG C CA  1 
ATOM   8784  C  C   . ARG B 2 58   ? 31.525  13.479  46.358  1.00 105.94 ? 52   ARG C C   1 
ATOM   8785  O  O   . ARG B 2 58   ? 30.575  13.089  47.034  1.00 112.58 ? 52   ARG C O   1 
ATOM   8786  C  CB  . ARG B 2 58   ? 30.932  15.859  46.671  1.00 113.60 ? 52   ARG C CB  1 
ATOM   8787  C  CG  . ARG B 2 58   ? 31.325  17.219  47.223  1.00 117.88 ? 52   ARG C CG  1 
ATOM   8788  C  CD  . ARG B 2 58   ? 30.183  18.205  47.296  1.00 124.17 ? 52   ARG C CD  1 
ATOM   8789  N  NE  . ARG B 2 58   ? 30.751  19.463  47.744  1.00 128.39 ? 52   ARG C NE  1 
ATOM   8790  C  CZ  . ARG B 2 58   ? 30.137  20.630  47.655  1.00 135.92 ? 52   ARG C CZ  1 
ATOM   8791  N  NH1 . ARG B 2 58   ? 28.930  20.693  47.115  1.00 139.37 ? 52   ARG C NH1 1 
ATOM   8792  N  NH2 . ARG B 2 58   ? 30.740  21.723  48.094  1.00 140.89 ? 52   ARG C NH2 1 
ATOM   8793  N  N   . LEU B 2 59   ? 32.066  12.743  45.384  1.00 100.12 ? 53   LEU C N   1 
ATOM   8794  C  CA  . LEU B 2 59   ? 31.580  11.391  45.158  1.00 99.36  ? 53   LEU C CA  1 
ATOM   8795  C  C   . LEU B 2 59   ? 32.636  10.381  45.600  1.00 96.73  ? 53   LEU C C   1 
ATOM   8796  O  O   . LEU B 2 59   ? 32.300  9.306   46.101  1.00 98.05  ? 53   LEU C O   1 
ATOM   8797  C  CB  . LEU B 2 59   ? 31.152  11.229  43.694  1.00 97.12  ? 53   LEU C CB  1 
ATOM   8798  C  CG  . LEU B 2 59   ? 29.935  12.066  43.275  1.00 100.03 ? 53   LEU C CG  1 
ATOM   8799  C  CD1 . LEU B 2 59   ? 29.726  12.026  41.766  1.00 96.73  ? 53   LEU C CD1 1 
ATOM   8800  C  CD2 . LEU B 2 59   ? 28.665  11.651  44.016  1.00 103.17 ? 53   LEU C CD2 1 
ATOM   8801  N  N   . PHE B 2 60   ? 33.907  10.780  45.461  1.00 93.70  ? 54   PHE C N   1 
ATOM   8802  C  CA  . PHE B 2 60   ? 35.047  10.029  45.960  1.00 92.99  ? 54   PHE C CA  1 
ATOM   8803  C  C   . PHE B 2 60   ? 35.305  10.312  47.441  1.00 96.55  ? 54   PHE C C   1 
ATOM   8804  O  O   . PHE B 2 60   ? 36.218  9.725   48.025  1.00 96.68  ? 54   PHE C O   1 
ATOM   8805  C  CB  . PHE B 2 60   ? 36.310  10.445  45.209  1.00 90.47  ? 54   PHE C CB  1 
ATOM   8806  C  CG  . PHE B 2 60   ? 36.368  10.037  43.761  1.00 88.09  ? 54   PHE C CG  1 
ATOM   8807  C  CD1 . PHE B 2 60   ? 35.643  10.725  42.799  1.00 87.50  ? 54   PHE C CD1 1 
ATOM   8808  C  CD2 . PHE B 2 60   ? 37.183  8.990   43.362  1.00 86.15  ? 54   PHE C CD2 1 
ATOM   8809  C  CE1 . PHE B 2 60   ? 35.720  10.363  41.463  1.00 84.87  ? 54   PHE C CE1 1 
ATOM   8810  C  CE2 . PHE B 2 60   ? 37.251  8.624   42.026  1.00 84.27  ? 54   PHE C CE2 1 
ATOM   8811  C  CZ  . PHE B 2 60   ? 36.522  9.313   41.081  1.00 83.08  ? 54   PHE C CZ  1 
ATOM   8812  N  N   . ARG B 2 61   ? 34.516  11.220  48.035  1.00 100.47 ? 55   ARG C N   1 
ATOM   8813  C  CA  . ARG B 2 61   ? 34.701  11.672  49.408  1.00 104.27 ? 55   ARG C CA  1 
ATOM   8814  C  C   . ARG B 2 61   ? 34.422  10.516  50.369  1.00 106.70 ? 55   ARG C C   1 
ATOM   8815  O  O   . ARG B 2 61   ? 34.679  10.616  51.568  1.00 110.06 ? 55   ARG C O   1 
ATOM   8816  C  CB  . ARG B 2 61   ? 33.807  12.890  49.676  1.00 110.14 ? 55   ARG C CB  1 
ATOM   8817  C  CG  . ARG B 2 61   ? 34.103  13.652  50.964  1.00 114.84 ? 55   ARG C CG  1 
ATOM   8818  C  CD  . ARG B 2 61   ? 33.221  14.885  51.124  1.00 119.53 ? 55   ARG C CD  1 
ATOM   8819  N  NE  . ARG B 2 61   ? 31.796  14.568  51.087  1.00 122.82 ? 55   ARG C NE  1 
ATOM   8820  C  CZ  . ARG B 2 61   ? 31.008  14.426  52.153  1.00 129.06 ? 55   ARG C CZ  1 
ATOM   8821  N  NH1 . ARG B 2 61   ? 31.494  14.595  53.374  1.00 131.68 ? 55   ARG C NH1 1 
ATOM   8822  N  NH2 . ARG B 2 61   ? 29.731  14.123  51.990  1.00 131.99 ? 55   ARG C NH2 1 
ATOM   8823  N  N   . LYS B 2 62   ? 33.910  9.416   49.805  1.00 106.01 ? 56   LYS C N   1 
ATOM   8824  C  CA  . LYS B 2 62   ? 33.623  8.172   50.500  1.00 107.26 ? 56   LYS C CA  1 
ATOM   8825  C  C   . LYS B 2 62   ? 34.935  7.449   50.809  1.00 102.77 ? 56   LYS C C   1 
ATOM   8826  O  O   . LYS B 2 62   ? 35.046  6.769   51.826  1.00 104.89 ? 56   LYS C O   1 
ATOM   8827  C  CB  . LYS B 2 62   ? 32.751  7.304   49.583  1.00 107.86 ? 56   LYS C CB  1 
ATOM   8828  C  CG  . LYS B 2 62   ? 31.565  6.596   50.231  1.00 113.87 ? 56   LYS C CG  1 
ATOM   8829  C  CD  . LYS B 2 62   ? 30.559  6.092   49.205  1.00 113.72 ? 56   LYS C CD  1 
ATOM   8830  C  CE  . LYS B 2 62   ? 29.683  4.958   49.697  1.00 118.23 ? 56   LYS C CE  1 
ATOM   8831  N  NZ  . LYS B 2 62   ? 28.793  5.384   50.802  1.00 124.73 ? 56   LYS C NZ  1 
ATOM   8832  N  N   . LEU B 2 63   ? 35.925  7.639   49.924  1.00 97.63  ? 57   LEU C N   1 
ATOM   8833  C  CA  . LEU B 2 63   ? 37.104  6.792   49.807  1.00 94.90  ? 57   LEU C CA  1 
ATOM   8834  C  C   . LEU B 2 63   ? 38.275  7.362   50.605  1.00 93.55  ? 57   LEU C C   1 
ATOM   8835  O  O   . LEU B 2 63   ? 38.250  8.527   51.001  1.00 94.60  ? 57   LEU C O   1 
ATOM   8836  C  CB  . LEU B 2 63   ? 37.489  6.688   48.326  1.00 91.43  ? 57   LEU C CB  1 
ATOM   8837  C  CG  . LEU B 2 63   ? 36.462  6.023   47.409  1.00 93.39  ? 57   LEU C CG  1 
ATOM   8838  C  CD1 . LEU B 2 63   ? 36.917  6.103   45.959  1.00 89.98  ? 57   LEU C CD1 1 
ATOM   8839  C  CD2 . LEU B 2 63   ? 36.193  4.575   47.812  1.00 95.74  ? 57   LEU C CD2 1 
ATOM   8840  N  N   . PRO B 2 64   ? 39.357  6.570   50.813  1.00 91.44  ? 58   PRO C N   1 
ATOM   8841  C  CA  . PRO B 2 64   ? 40.510  7.010   51.600  1.00 90.40  ? 58   PRO C CA  1 
ATOM   8842  C  C   . PRO B 2 64   ? 41.394  7.975   50.807  1.00 85.92  ? 58   PRO C C   1 
ATOM   8843  O  O   . PRO B 2 64   ? 41.301  8.038   49.580  1.00 84.46  ? 58   PRO C O   1 
ATOM   8844  C  CB  . PRO B 2 64   ? 41.281  5.713   51.917  1.00 90.89  ? 58   PRO C CB  1 
ATOM   8845  C  CG  . PRO B 2 64   ? 40.462  4.582   51.314  1.00 92.26  ? 58   PRO C CG  1 
ATOM   8846  C  CD  . PRO B 2 64   ? 39.550  5.212   50.281  1.00 90.46  ? 58   PRO C CD  1 
ATOM   8847  N  N   . PRO B 2 65   ? 42.270  8.766   51.479  1.00 84.19  ? 59   PRO C N   1 
ATOM   8848  C  CA  . PRO B 2 65   ? 43.183  9.674   50.788  1.00 80.15  ? 59   PRO C CA  1 
ATOM   8849  C  C   . PRO B 2 65   ? 43.939  8.945   49.686  1.00 76.36  ? 59   PRO C C   1 
ATOM   8850  O  O   . PRO B 2 65   ? 44.307  7.784   49.845  1.00 76.39  ? 59   PRO C O   1 
ATOM   8851  C  CB  . PRO B 2 65   ? 44.168  10.112  51.883  1.00 81.49  ? 59   PRO C CB  1 
ATOM   8852  C  CG  . PRO B 2 65   ? 43.902  9.178   53.046  1.00 84.39  ? 59   PRO C CG  1 
ATOM   8853  C  CD  . PRO B 2 65   ? 42.434  8.830   52.939  1.00 86.67  ? 59   PRO C CD  1 
ATOM   8854  N  N   . ARG B 2 66   ? 44.159  9.646   48.571  1.00 74.21  ? 60   ARG C N   1 
ATOM   8855  C  CA  . ARG B 2 66   ? 44.870  9.072   47.442  1.00 72.30  ? 60   ARG C CA  1 
ATOM   8856  C  C   . ARG B 2 66   ? 46.354  8.927   47.779  1.00 71.80  ? 60   ARG C C   1 
ATOM   8857  O  O   . ARG B 2 66   ? 46.927  7.848   47.654  1.00 70.93  ? 60   ARG C O   1 
ATOM   8858  C  CB  . ARG B 2 66   ? 44.613  9.886   46.169  1.00 71.44  ? 60   ARG C CB  1 
ATOM   8859  C  CG  . ARG B 2 66   ? 43.145  10.015  45.779  1.00 72.40  ? 60   ARG C CG  1 
ATOM   8860  C  CD  . ARG B 2 66   ? 42.258  8.820   46.104  1.00 73.10  ? 60   ARG C CD  1 
ATOM   8861  N  NE  . ARG B 2 66   ? 42.780  7.537   45.642  1.00 71.55  ? 60   ARG C NE  1 
ATOM   8862  C  CZ  . ARG B 2 66   ? 42.564  6.378   46.251  1.00 72.41  ? 60   ARG C CZ  1 
ATOM   8863  N  NH1 . ARG B 2 66   ? 41.838  6.333   47.356  1.00 74.53  ? 60   ARG C NH1 1 
ATOM   8864  N  NH2 . ARG B 2 66   ? 43.078  5.266   45.754  1.00 72.13  ? 60   ARG C NH2 1 
ATOM   8865  N  N   . VAL B 2 67   ? 46.960  10.023  48.234  1.00 72.50  ? 61   VAL C N   1 
ATOM   8866  C  CA  . VAL B 2 67   ? 48.362  10.023  48.604  1.00 72.89  ? 61   VAL C CA  1 
ATOM   8867  C  C   . VAL B 2 67   ? 48.495  10.599  50.008  1.00 73.98  ? 61   VAL C C   1 
ATOM   8868  O  O   . VAL B 2 67   ? 48.014  11.695  50.267  1.00 75.36  ? 61   VAL C O   1 
ATOM   8869  C  CB  . VAL B 2 67   ? 49.183  10.827  47.578  1.00 73.35  ? 61   VAL C CB  1 
ATOM   8870  C  CG1 . VAL B 2 67   ? 50.565  11.188  48.101  1.00 75.23  ? 61   VAL C CG1 1 
ATOM   8871  C  CG2 . VAL B 2 67   ? 49.280  10.092  46.247  1.00 72.63  ? 61   VAL C CG2 1 
ATOM   8872  N  N   . CYS B 2 68   ? 49.125  9.839   50.911  1.00 74.19  ? 62   CYS C N   1 
ATOM   8873  C  CA  . CYS B 2 68   ? 49.634  10.395  52.155  1.00 75.74  ? 62   CYS C CA  1 
ATOM   8874  C  C   . CYS B 2 68   ? 51.146  10.540  52.034  1.00 75.62  ? 62   CYS C C   1 
ATOM   8875  O  O   . CYS B 2 68   ? 51.802  9.696   51.427  1.00 75.23  ? 62   CYS C O   1 
ATOM   8876  C  CB  . CYS B 2 68   ? 49.379  9.482   53.347  1.00 77.38  ? 62   CYS C CB  1 
ATOM   8877  S  SG  . CYS B 2 68   ? 47.630  9.195   53.709  1.00 78.91  ? 62   CYS C SG  1 
ATOM   8878  N  N   . VAL B 2 69   ? 51.676  11.615  52.626  1.00 76.30  ? 63   VAL C N   1 
ATOM   8879  C  CA  . VAL B 2 69   ? 53.105  11.860  52.703  1.00 76.50  ? 63   VAL C CA  1 
ATOM   8880  C  C   . VAL B 2 69   ? 53.461  12.114  54.165  1.00 79.07  ? 63   VAL C C   1 
ATOM   8881  O  O   . VAL B 2 69   ? 52.635  12.612  54.927  1.00 81.47  ? 63   VAL C O   1 
ATOM   8882  C  CB  . VAL B 2 69   ? 53.495  13.057  51.820  1.00 76.56  ? 63   VAL C CB  1 
ATOM   8883  C  CG1 . VAL B 2 69   ? 54.869  13.593  52.164  1.00 78.99  ? 63   VAL C CG1 1 
ATOM   8884  C  CG2 . VAL B 2 69   ? 53.416  12.717  50.345  1.00 75.00  ? 63   VAL C CG2 1 
ATOM   8885  N  N   . SER B 2 70   ? 54.694  11.771  54.553  1.00 79.47  ? 64   SER C N   1 
ATOM   8886  C  CA  . SER B 2 70   ? 55.183  12.107  55.879  1.00 81.18  ? 64   SER C CA  1 
ATOM   8887  C  C   . SER B 2 70   ? 56.007  13.392  55.817  1.00 83.17  ? 64   SER C C   1 
ATOM   8888  O  O   . SER B 2 70   ? 56.854  13.539  54.942  1.00 82.96  ? 64   SER C O   1 
ATOM   8889  C  CB  . SER B 2 70   ? 55.983  10.976  56.441  1.00 81.33  ? 64   SER C CB  1 
ATOM   8890  O  OG  . SER B 2 70   ? 56.244  11.197  57.816  1.00 83.65  ? 64   SER C OG  1 
ATOM   8891  N  N   . LEU B 2 71   ? 55.752  14.316  56.754  1.00 85.56  ? 65   LEU C N   1 
ATOM   8892  C  CA  . LEU B 2 71   ? 56.484  15.572  56.835  1.00 88.52  ? 65   LEU C CA  1 
ATOM   8893  C  C   . LEU B 2 71   ? 57.986  15.309  56.921  1.00 90.77  ? 65   LEU C C   1 
ATOM   8894  O  O   . LEU B 2 71   ? 58.754  16.000  56.257  1.00 92.71  ? 65   LEU C O   1 
ATOM   8895  C  CB  . LEU B 2 71   ? 55.997  16.388  58.037  1.00 90.06  ? 65   LEU C CB  1 
ATOM   8896  C  CG  . LEU B 2 71   ? 56.605  17.784  58.169  1.00 92.59  ? 65   LEU C CG  1 
ATOM   8897  C  CD1 . LEU B 2 71   ? 55.974  18.753  57.183  1.00 92.53  ? 65   LEU C CD1 1 
ATOM   8898  C  CD2 . LEU B 2 71   ? 56.458  18.298  59.589  1.00 95.70  ? 65   LEU C CD2 1 
ATOM   8899  N  N   . LYS B 2 72   ? 58.382  14.310  57.729  1.00 91.89  ? 66   LYS C N   1 
ATOM   8900  C  CA  . LYS B 2 72   ? 59.769  13.905  57.931  1.00 94.01  ? 66   LYS C CA  1 
ATOM   8901  C  C   . LYS B 2 72   ? 60.495  13.733  56.599  1.00 93.55  ? 66   LYS C C   1 
ATOM   8902  O  O   . LYS B 2 72   ? 61.712  13.909  56.536  1.00 96.14  ? 66   LYS C O   1 
ATOM   8903  C  CB  . LYS B 2 72   ? 59.851  12.567  58.669  1.00 94.66  ? 66   LYS C CB  1 
ATOM   8904  C  CG  . LYS B 2 72   ? 59.646  12.639  60.173  1.00 98.58  ? 66   LYS C CG  1 
ATOM   8905  C  CD  . LYS B 2 72   ? 59.747  11.295  60.863  1.00 100.64 ? 66   LYS C CD  1 
ATOM   8906  C  CE  . LYS B 2 72   ? 59.639  11.411  62.371  1.00 104.71 ? 66   LYS C CE  1 
ATOM   8907  N  NZ  . LYS B 2 72   ? 60.010  10.150  63.058  1.00 107.35 ? 66   LYS C NZ  1 
ATOM   8908  N  N   . ASN B 2 73   ? 59.732  13.408  55.545  1.00 90.27  ? 67   ASN C N   1 
ATOM   8909  C  CA  . ASN B 2 73   ? 60.267  12.926  54.283  1.00 88.99  ? 67   ASN C CA  1 
ATOM   8910  C  C   . ASN B 2 73   ? 60.232  13.995  53.190  1.00 89.53  ? 67   ASN C C   1 
ATOM   8911  O  O   . ASN B 2 73   ? 60.684  13.734  52.078  1.00 89.71  ? 67   ASN C O   1 
ATOM   8912  C  CB  . ASN B 2 73   ? 59.514  11.686  53.797  1.00 86.15  ? 67   ASN C CB  1 
ATOM   8913  C  CG  . ASN B 2 73   ? 59.684  10.478  54.692  1.00 86.45  ? 67   ASN C CG  1 
ATOM   8914  O  OD1 . ASN B 2 73   ? 60.392  10.531  55.691  1.00 88.74  ? 67   ASN C OD1 1 
ATOM   8915  N  ND2 . ASN B 2 73   ? 59.039  9.380   54.341  1.00 85.33  ? 67   ASN C ND2 1 
ATOM   8916  N  N   . ILE B 2 74   ? 59.687  15.183  53.484  1.00 90.60  ? 68   ILE C N   1 
ATOM   8917  C  CA  . ILE B 2 74   ? 59.552  16.211  52.459  1.00 91.89  ? 68   ILE C CA  1 
ATOM   8918  C  C   . ILE B 2 74   ? 60.121  17.543  52.942  1.00 96.73  ? 68   ILE C C   1 
ATOM   8919  O  O   . ILE B 2 74   ? 60.198  18.495  52.169  1.00 99.03  ? 68   ILE C O   1 
ATOM   8920  C  CB  . ILE B 2 74   ? 58.102  16.357  51.952  1.00 89.01  ? 68   ILE C CB  1 
ATOM   8921  C  CG1 . ILE B 2 74   ? 57.094  16.560  53.088  1.00 87.99  ? 68   ILE C CG1 1 
ATOM   8922  C  CG2 . ILE B 2 74   ? 57.729  15.193  51.049  1.00 85.63  ? 68   ILE C CG2 1 
ATOM   8923  C  CD1 . ILE B 2 74   ? 55.877  17.356  52.686  1.00 87.61  ? 68   ILE C CD1 1 
ATOM   8924  N  N   . VAL B 2 75   ? 60.502  17.608  54.222  1.00 98.89  ? 69   VAL C N   1 
ATOM   8925  C  CA  . VAL B 2 75   ? 61.171  18.791  54.734  1.00 103.98 ? 69   VAL C CA  1 
ATOM   8926  C  C   . VAL B 2 75   ? 62.675  18.609  54.572  1.00 108.14 ? 69   VAL C C   1 
ATOM   8927  O  O   . VAL B 2 75   ? 63.193  17.498  54.704  1.00 106.45 ? 69   VAL C O   1 
ATOM   8928  C  CB  . VAL B 2 75   ? 60.808  19.107  56.197  1.00 104.29 ? 69   VAL C CB  1 
ATOM   8929  C  CG1 . VAL B 2 75   ? 59.422  19.714  56.332  1.00 103.51 ? 69   VAL C CG1 1 
ATOM   8930  C  CG2 . VAL B 2 75   ? 60.990  17.909  57.116  1.00 102.15 ? 69   VAL C CG2 1 
ATOM   8931  N  N   . ASP B 2 76   ? 63.348  19.736  54.302  1.00 114.76 ? 70   ASP C N   1 
ATOM   8932  C  CA  . ASP B 2 76   ? 64.796  19.839  54.209  1.00 119.71 ? 70   ASP C CA  1 
ATOM   8933  C  C   . ASP B 2 76   ? 65.434  19.549  55.565  1.00 121.65 ? 70   ASP C C   1 
ATOM   8934  O  O   . ASP B 2 76   ? 64.750  19.486  56.588  1.00 119.95 ? 70   ASP C O   1 
ATOM   8935  C  CB  . ASP B 2 76   ? 65.225  21.236  53.750  1.00 125.36 ? 70   ASP C CB  1 
ATOM   8936  C  CG  . ASP B 2 76   ? 64.796  21.600  52.338  1.00 126.23 ? 70   ASP C CG  1 
ATOM   8937  O  OD1 . ASP B 2 76   ? 64.288  20.706  51.622  1.00 122.26 ? 70   ASP C OD1 1 
ATOM   8938  O  OD2 . ASP B 2 76   ? 64.976  22.780  51.964  1.00 131.15 ? 70   ASP C OD2 1 
ATOM   8939  N  N   . GLU B 2 77   ? 66.766  19.416  55.549  1.00 126.57 ? 71   GLU C N   1 
ATOM   8940  C  CA  . GLU B 2 77   ? 67.560  19.063  56.716  1.00 129.05 ? 71   GLU C CA  1 
ATOM   8941  C  C   . GLU B 2 77   ? 67.855  20.297  57.570  1.00 133.27 ? 71   GLU C C   1 
ATOM   8942  O  O   . GLU B 2 77   ? 67.980  20.184  58.790  1.00 133.48 ? 71   GLU C O   1 
ATOM   8943  C  CB  . GLU B 2 77   ? 68.880  18.410  56.292  1.00 132.98 ? 71   GLU C CB  1 
ATOM   8944  C  CG  . GLU B 2 77   ? 68.714  17.166  55.428  1.00 130.90 ? 71   GLU C CG  1 
ATOM   8945  C  CD  . GLU B 2 77   ? 69.927  16.791  54.587  1.00 135.23 ? 71   GLU C CD  1 
ATOM   8946  O  OE1 . GLU B 2 77   ? 71.056  17.215  54.935  1.00 140.50 ? 71   GLU C OE1 1 
ATOM   8947  O  OE2 . GLU B 2 77   ? 69.738  16.078  53.576  1.00 133.73 ? 71   GLU C OE2 1 
ATOM   8948  N  N   . ASP B 2 78   ? 67.975  21.465  56.922  1.00 137.21 ? 72   ASP C N   1 
ATOM   8949  C  CA  . ASP B 2 78   ? 68.413  22.694  57.571  1.00 142.81 ? 72   ASP C CA  1 
ATOM   8950  C  C   . ASP B 2 78   ? 67.329  23.248  58.495  1.00 141.80 ? 72   ASP C C   1 
ATOM   8951  O  O   . ASP B 2 78   ? 67.632  23.800  59.552  1.00 144.35 ? 72   ASP C O   1 
ATOM   8952  C  CB  . ASP B 2 78   ? 68.864  23.732  56.540  1.00 148.52 ? 72   ASP C CB  1 
ATOM   8953  C  CG  . ASP B 2 78   ? 70.223  23.414  55.940  1.00 152.38 ? 72   ASP C CG  1 
ATOM   8954  O  OD1 . ASP B 2 78   ? 71.245  23.671  56.625  1.00 156.11 ? 72   ASP C OD1 1 
ATOM   8955  O  OD2 . ASP B 2 78   ? 70.247  22.891  54.802  1.00 151.31 ? 72   ASP C OD2 1 
ATOM   8956  N  N   . PHE B 2 79   ? 66.068  23.093  58.075  1.00 138.85 ? 73   PHE C N   1 
ATOM   8957  C  CA  . PHE B 2 79   ? 64.917  23.653  58.765  1.00 138.90 ? 73   PHE C CA  1 
ATOM   8958  C  C   . PHE B 2 79   ? 64.351  22.632  59.753  1.00 136.03 ? 73   PHE C C   1 
ATOM   8959  O  O   . PHE B 2 79   ? 63.411  22.943  60.487  1.00 136.59 ? 73   PHE C O   1 
ATOM   8960  C  CB  . PHE B 2 79   ? 63.859  24.105  57.750  1.00 136.27 ? 73   PHE C CB  1 
ATOM   8961  C  CG  . PHE B 2 79   ? 64.400  24.872  56.566  1.00 139.26 ? 73   PHE C CG  1 
ATOM   8962  C  CD1 . PHE B 2 79   ? 64.596  26.246  56.628  1.00 145.51 ? 73   PHE C CD1 1 
ATOM   8963  C  CD2 . PHE B 2 79   ? 64.718  24.216  55.386  1.00 136.52 ? 73   PHE C CD2 1 
ATOM   8964  C  CE1 . PHE B 2 79   ? 65.098  26.945  55.539  1.00 149.52 ? 73   PHE C CE1 1 
ATOM   8965  C  CE2 . PHE B 2 79   ? 65.223  24.915  54.299  1.00 140.66 ? 73   PHE C CE2 1 
ATOM   8966  C  CZ  . PHE B 2 79   ? 65.412  26.278  54.375  1.00 147.23 ? 73   PHE C CZ  1 
ATOM   8967  N  N   . LEU B 2 80   ? 64.956  21.433  59.773  1.00 134.51 ? 74   LEU C N   1 
ATOM   8968  C  CA  . LEU B 2 80   ? 64.459  20.267  60.493  1.00 130.73 ? 74   LEU C CA  1 
ATOM   8969  C  C   . LEU B 2 80   ? 64.465  20.520  62.002  1.00 132.96 ? 74   LEU C C   1 
ATOM   8970  O  O   . LEU B 2 80   ? 63.607  19.995  62.712  1.00 131.08 ? 74   LEU C O   1 
ATOM   8971  C  CB  . LEU B 2 80   ? 65.309  19.045  60.122  1.00 129.20 ? 74   LEU C CB  1 
ATOM   8972  C  CG  . LEU B 2 80   ? 64.766  17.677  60.543  1.00 125.53 ? 74   LEU C CG  1 
ATOM   8973  C  CD1 . LEU B 2 80   ? 63.375  17.431  59.971  1.00 122.25 ? 74   LEU C CD1 1 
ATOM   8974  C  CD2 . LEU B 2 80   ? 65.719  16.564  60.125  1.00 124.46 ? 74   LEU C CD2 1 
ATOM   8975  N  N   . TYR B 2 81   ? 65.434  21.317  62.477  1.00 137.21 ? 75   TYR C N   1 
ATOM   8976  C  CA  . TYR B 2 81   ? 65.481  21.735  63.873  1.00 140.91 ? 75   TYR C CA  1 
ATOM   8977  C  C   . TYR B 2 81   ? 65.666  23.250  63.960  1.00 145.89 ? 75   TYR C C   1 
ATOM   8978  O  O   . TYR B 2 81   ? 66.614  23.736  64.578  1.00 149.31 ? 75   TYR C O   1 
ATOM   8979  C  CB  . TYR B 2 81   ? 66.551  20.966  64.663  1.00 143.83 ? 75   TYR C CB  1 
ATOM   8980  C  CG  . TYR B 2 81   ? 66.342  19.474  64.771  1.00 142.06 ? 75   TYR C CG  1 
ATOM   8981  C  CD1 . TYR B 2 81   ? 65.090  18.941  65.050  1.00 140.44 ? 75   TYR C CD1 1 
ATOM   8982  C  CD2 . TYR B 2 81   ? 67.400  18.587  64.614  1.00 142.70 ? 75   TYR C CD2 1 
ATOM   8983  C  CE1 . TYR B 2 81   ? 64.884  17.571  65.139  1.00 138.35 ? 75   TYR C CE1 1 
ATOM   8984  C  CE2 . TYR B 2 81   ? 67.213  17.215  64.710  1.00 140.67 ? 75   TYR C CE2 1 
ATOM   8985  C  CZ  . TYR B 2 81   ? 65.952  16.703  64.971  1.00 138.16 ? 75   TYR C CZ  1 
ATOM   8986  O  OH  . TYR B 2 81   ? 65.772  15.351  65.068  1.00 135.65 ? 75   TYR C OH  1 
ATOM   8987  N  N   . ALA B 2 82   ? 64.744  23.990  63.332  1.00 105.56 ? 76   ALA C N   1 
ATOM   8988  C  CA  . ALA B 2 82   ? 64.746  25.445  63.374  1.00 105.14 ? 76   ALA C CA  1 
ATOM   8989  C  C   . ALA B 2 82   ? 63.375  25.976  63.805  1.00 100.94 ? 76   ALA C C   1 
ATOM   8990  O  O   . ALA B 2 82   ? 63.119  27.176  63.716  1.00 100.64 ? 76   ALA C O   1 
ATOM   8991  C  CB  . ALA B 2 82   ? 65.191  26.009  62.044  1.00 105.90 ? 76   ALA C CB  1 
ATOM   8992  N  N   . GLY B 2 83   ? 62.496  25.070  64.255  1.00 97.75  ? 77   GLY C N   1 
ATOM   8993  C  CA  . GLY B 2 83   ? 61.339  25.427  65.063  1.00 94.81  ? 77   GLY C CA  1 
ATOM   8994  C  C   . GLY B 2 83   ? 60.056  25.640  64.260  1.00 90.36  ? 77   GLY C C   1 
ATOM   8995  O  O   . GLY B 2 83   ? 59.081  26.173  64.790  1.00 88.67  ? 77   GLY C O   1 
ATOM   8996  N  N   . HIS B 2 84   ? 60.058  25.208  62.992  1.00 88.43  ? 78   HIS C N   1 
ATOM   8997  C  CA  . HIS B 2 84   ? 58.907  25.358  62.111  1.00 83.68  ? 78   HIS C CA  1 
ATOM   8998  C  C   . HIS B 2 84   ? 57.704  24.605  62.665  1.00 81.04  ? 78   HIS C C   1 
ATOM   8999  O  O   . HIS B 2 84   ? 57.827  23.461  63.090  1.00 81.53  ? 78   HIS C O   1 
ATOM   9000  C  CB  . HIS B 2 84   ? 59.228  24.862  60.695  1.00 83.26  ? 78   HIS C CB  1 
ATOM   9001  C  CG  . HIS B 2 84   ? 59.882  25.891  59.835  1.00 85.43  ? 78   HIS C CG  1 
ATOM   9002  N  ND1 . HIS B 2 84   ? 61.255  25.985  59.711  1.00 89.11  ? 78   HIS C ND1 1 
ATOM   9003  C  CD2 . HIS B 2 84   ? 59.361  26.875  59.068  1.00 84.64  ? 78   HIS C CD2 1 
ATOM   9004  C  CE1 . HIS B 2 84   ? 61.552  26.981  58.899  1.00 90.43  ? 78   HIS C CE1 1 
ATOM   9005  N  NE2 . HIS B 2 84   ? 60.405  27.544  58.490  1.00 87.57  ? 78   HIS C NE2 1 
ATOM   9006  N  N   . ILE B 2 85   ? 56.546  25.274  62.645  1.00 79.36  ? 79   ILE C N   1 
ATOM   9007  C  CA  . ILE B 2 85   ? 55.258  24.666  62.937  1.00 76.80  ? 79   ILE C CA  1 
ATOM   9008  C  C   . ILE B 2 85   ? 54.390  24.863  61.699  1.00 74.47  ? 79   ILE C C   1 
ATOM   9009  O  O   . ILE B 2 85   ? 53.973  25.985  61.427  1.00 75.05  ? 79   ILE C O   1 
ATOM   9010  C  CB  . ILE B 2 85   ? 54.612  25.322  64.176  1.00 77.98  ? 79   ILE C CB  1 
ATOM   9011  C  CG1 . ILE B 2 85   ? 55.600  25.506  65.331  1.00 81.22  ? 79   ILE C CG1 1 
ATOM   9012  C  CG2 . ILE B 2 85   ? 53.379  24.551  64.621  1.00 78.44  ? 79   ILE C CG2 1 
ATOM   9013  C  CD1 . ILE B 2 85   ? 55.064  26.343  66.474  1.00 82.91  ? 79   ILE C CD1 1 
ATOM   9014  N  N   . PHE B 2 86   ? 54.132  23.773  60.959  1.00 73.41  ? 80   PHE C N   1 
ATOM   9015  C  CA  . PHE B 2 86   ? 53.405  23.811  59.693  1.00 70.99  ? 80   PHE C CA  1 
ATOM   9016  C  C   . PHE B 2 86   ? 51.902  23.972  59.917  1.00 69.45  ? 80   PHE C C   1 
ATOM   9017  O  O   . PHE B 2 86   ? 51.329  23.361  60.817  1.00 69.89  ? 80   PHE C O   1 
ATOM   9018  C  CB  . PHE B 2 86   ? 53.733  22.580  58.847  1.00 70.86  ? 80   PHE C CB  1 
ATOM   9019  C  CG  . PHE B 2 86   ? 55.103  22.615  58.217  1.00 72.02  ? 80   PHE C CG  1 
ATOM   9020  C  CD1 . PHE B 2 86   ? 56.235  22.294  58.951  1.00 73.75  ? 80   PHE C CD1 1 
ATOM   9021  C  CD2 . PHE B 2 86   ? 55.258  22.977  56.887  1.00 71.54  ? 80   PHE C CD2 1 
ATOM   9022  C  CE1 . PHE B 2 86   ? 57.490  22.331  58.360  1.00 76.65  ? 80   PHE C CE1 1 
ATOM   9023  C  CE2 . PHE B 2 86   ? 56.512  23.014  56.297  1.00 73.28  ? 80   PHE C CE2 1 
ATOM   9024  C  CZ  . PHE B 2 86   ? 57.626  22.692  57.036  1.00 76.05  ? 80   PHE C CZ  1 
ATOM   9025  N  N   . LEU B 2 87   ? 51.271  24.801  59.076  1.00 68.01  ? 81   LEU C N   1 
ATOM   9026  C  CA  . LEU B 2 87   ? 49.909  25.254  59.326  1.00 67.73  ? 81   LEU C CA  1 
ATOM   9027  C  C   . LEU B 2 87   ? 48.907  24.504  58.447  1.00 67.12  ? 81   LEU C C   1 
ATOM   9028  O  O   . LEU B 2 87   ? 47.913  24.004  58.962  1.00 66.51  ? 81   LEU C O   1 
ATOM   9029  C  CB  . LEU B 2 87   ? 49.831  26.772  59.127  1.00 68.02  ? 81   LEU C CB  1 
ATOM   9030  C  CG  . LEU B 2 87   ? 50.613  27.596  60.149  1.00 69.56  ? 81   LEU C CG  1 
ATOM   9031  C  CD1 . LEU B 2 87   ? 50.894  28.998  59.635  1.00 70.12  ? 81   LEU C CD1 1 
ATOM   9032  C  CD2 . LEU B 2 87   ? 49.880  27.650  61.484  1.00 71.36  ? 81   LEU C CD2 1 
ATOM   9033  N  N   . GLY B 2 88   ? 49.173  24.430  57.131  1.00 66.80  ? 82   GLY C N   1 
ATOM   9034  C  CA  . GLY B 2 88   ? 48.290  23.742  56.199  1.00 65.88  ? 82   GLY C CA  1 
ATOM   9035  C  C   . GLY B 2 88   ? 48.593  24.039  54.729  1.00 65.16  ? 82   GLY C C   1 
ATOM   9036  O  O   . GLY B 2 88   ? 49.660  24.553  54.400  1.00 64.30  ? 82   GLY C O   1 
ATOM   9037  N  N   . PHE B 2 89   ? 47.634  23.690  53.857  1.00 64.99  ? 83   PHE C N   1 
ATOM   9038  C  CA  . PHE B 2 89   ? 47.749  23.870  52.418  1.00 65.80  ? 83   PHE C CA  1 
ATOM   9039  C  C   . PHE B 2 89   ? 47.003  25.127  51.989  1.00 67.81  ? 83   PHE C C   1 
ATOM   9040  O  O   . PHE B 2 89   ? 45.967  25.449  52.555  1.00 69.34  ? 83   PHE C O   1 
ATOM   9041  C  CB  . PHE B 2 89   ? 47.083  22.709  51.676  1.00 64.98  ? 83   PHE C CB  1 
ATOM   9042  C  CG  . PHE B 2 89   ? 47.920  21.470  51.504  1.00 64.16  ? 83   PHE C CG  1 
ATOM   9043  C  CD1 . PHE B 2 89   ? 48.743  21.312  50.399  1.00 64.45  ? 83   PHE C CD1 1 
ATOM   9044  C  CD2 . PHE B 2 89   ? 47.875  20.450  52.442  1.00 64.01  ? 83   PHE C CD2 1 
ATOM   9045  C  CE1 . PHE B 2 89   ? 49.509  20.165  50.244  1.00 64.24  ? 83   PHE C CE1 1 
ATOM   9046  C  CE2 . PHE B 2 89   ? 48.643  19.305  52.286  1.00 63.60  ? 83   PHE C CE2 1 
ATOM   9047  C  CZ  . PHE B 2 89   ? 49.458  19.163  51.186  1.00 63.49  ? 83   PHE C CZ  1 
ATOM   9048  N  N   . SER B 2 90   ? 47.511  25.816  50.966  1.00 69.93  ? 84   SER C N   1 
ATOM   9049  C  CA  . SER B 2 90   ? 46.719  26.850  50.325  1.00 73.41  ? 84   SER C CA  1 
ATOM   9050  C  C   . SER B 2 90   ? 45.541  26.188  49.614  1.00 75.36  ? 84   SER C C   1 
ATOM   9051  O  O   . SER B 2 90   ? 45.621  25.009  49.261  1.00 74.20  ? 84   SER C O   1 
ATOM   9052  C  CB  . SER B 2 90   ? 47.559  27.663  49.382  1.00 74.91  ? 84   SER C CB  1 
ATOM   9053  O  OG  . SER B 2 90   ? 48.163  26.824  48.411  1.00 74.91  ? 84   SER C OG  1 
ATOM   9054  N  N   . LYS B 2 91   ? 44.453  26.952  49.423  1.00 78.13  ? 85   LYS C N   1 
ATOM   9055  C  CA  . LYS B 2 91   ? 43.232  26.448  48.809  1.00 79.98  ? 85   LYS C CA  1 
ATOM   9056  C  C   . LYS B 2 91   ? 43.528  25.872  47.427  1.00 80.89  ? 85   LYS C C   1 
ATOM   9057  O  O   . LYS B 2 91   ? 42.922  24.878  47.038  1.00 83.47  ? 85   LYS C O   1 
ATOM   9058  C  CB  . LYS B 2 91   ? 42.166  27.541  48.711  1.00 83.23  ? 85   LYS C CB  1 
ATOM   9059  C  CG  . LYS B 2 91   ? 41.520  27.940  50.031  1.00 83.46  ? 85   LYS C CG  1 
ATOM   9060  C  CD  . LYS B 2 91   ? 40.597  29.128  49.909  1.00 86.07  ? 85   LYS C CD  1 
ATOM   9061  C  CE  . LYS B 2 91   ? 39.361  28.820  49.097  1.00 88.27  ? 85   LYS C CE  1 
ATOM   9062  N  NZ  . LYS B 2 91   ? 38.416  29.959  49.094  1.00 93.15  ? 85   LYS C NZ  1 
ATOM   9063  N  N   . CYS B 2 92   ? 44.471  26.496  46.712  1.00 80.98  ? 86   CYS C N   1 
ATOM   9064  C  CA  . CYS B 2 92   ? 44.865  26.088  45.374  1.00 81.86  ? 86   CYS C CA  1 
ATOM   9065  C  C   . CYS B 2 92   ? 45.702  24.808  45.434  1.00 79.40  ? 86   CYS C C   1 
ATOM   9066  O  O   . CYS B 2 92   ? 45.874  24.128  44.420  1.00 79.83  ? 86   CYS C O   1 
ATOM   9067  C  CB  . CYS B 2 92   ? 45.674  27.197  44.719  1.00 84.39  ? 86   CYS C CB  1 
ATOM   9068  S  SG  . CYS B 2 92   ? 47.222  27.511  45.603  1.00 83.55  ? 86   CYS C SG  1 
ATOM   9069  N  N   . GLY B 2 93   ? 46.229  24.501  46.628  1.00 76.47  ? 87   GLY C N   1 
ATOM   9070  C  CA  . GLY B 2 93   ? 46.881  23.231  46.908  1.00 74.84  ? 87   GLY C CA  1 
ATOM   9071  C  C   . GLY B 2 93   ? 48.356  23.202  46.508  1.00 74.83  ? 87   GLY C C   1 
ATOM   9072  O  O   . GLY B 2 93   ? 48.974  22.138  46.505  1.00 73.97  ? 87   GLY C O   1 
ATOM   9073  N  N   . ARG B 2 94   ? 48.911  24.377  46.190  1.00 76.19  ? 88   ARG C N   1 
ATOM   9074  C  CA  . ARG B 2 94   ? 50.270  24.484  45.688  1.00 77.35  ? 88   ARG C CA  1 
ATOM   9075  C  C   . ARG B 2 94   ? 51.263  24.718  46.828  1.00 75.32  ? 88   ARG C C   1 
ATOM   9076  O  O   . ARG B 2 94   ? 52.456  24.460  46.673  1.00 75.52  ? 88   ARG C O   1 
ATOM   9077  C  CB  . ARG B 2 94   ? 50.348  25.607  44.653  1.00 81.60  ? 88   ARG C CB  1 
ATOM   9078  C  CG  . ARG B 2 94   ? 51.757  26.106  44.380  1.00 84.38  ? 88   ARG C CG  1 
ATOM   9079  C  CD  . ARG B 2 94   ? 51.666  27.341  43.515  1.00 89.93  ? 88   ARG C CD  1 
ATOM   9080  N  NE  . ARG B 2 94   ? 52.913  27.590  42.807  1.00 94.25  ? 88   ARG C NE  1 
ATOM   9081  C  CZ  . ARG B 2 94   ? 53.041  28.420  41.778  1.00 97.86  ? 88   ARG C CZ  1 
ATOM   9082  N  NH1 . ARG B 2 94   ? 51.995  29.090  41.321  1.00 99.31  ? 88   ARG C NH1 1 
ATOM   9083  N  NH2 . ARG B 2 94   ? 54.221  28.575  41.212  1.00 100.79 ? 88   ARG C NH2 1 
ATOM   9084  N  N   . TYR B 2 95   ? 50.770  25.213  47.966  1.00 73.14  ? 89   TYR C N   1 
ATOM   9085  C  CA  . TYR B 2 95   ? 51.654  25.593  49.052  1.00 72.14  ? 89   TYR C CA  1 
ATOM   9086  C  C   . TYR B 2 95   ? 51.207  24.961  50.361  1.00 70.02  ? 89   TYR C C   1 
ATOM   9087  O  O   . TYR B 2 95   ? 50.023  24.918  50.675  1.00 69.51  ? 89   TYR C O   1 
ATOM   9088  C  CB  . TYR B 2 95   ? 51.653  27.108  49.272  1.00 73.07  ? 89   TYR C CB  1 
ATOM   9089  C  CG  . TYR B 2 95   ? 52.076  27.929  48.084  1.00 76.00  ? 89   TYR C CG  1 
ATOM   9090  C  CD1 . TYR B 2 95   ? 53.324  27.758  47.503  1.00 78.17  ? 89   TYR C CD1 1 
ATOM   9091  C  CD2 . TYR B 2 95   ? 51.234  28.887  47.547  1.00 77.36  ? 89   TYR C CD2 1 
ATOM   9092  C  CE1 . TYR B 2 95   ? 53.726  28.514  46.412  1.00 81.47  ? 89   TYR C CE1 1 
ATOM   9093  C  CE2 . TYR B 2 95   ? 51.621  29.651  46.457  1.00 81.41  ? 89   TYR C CE2 1 
ATOM   9094  C  CZ  . TYR B 2 95   ? 52.872  29.469  45.889  1.00 83.04  ? 89   TYR C CZ  1 
ATOM   9095  O  OH  . TYR B 2 95   ? 53.265  30.218  44.816  1.00 86.56  ? 89   TYR C OH  1 
ATOM   9096  N  N   . VAL B 2 96   ? 52.194  24.482  51.111  1.00 69.79  ? 90   VAL C N   1 
ATOM   9097  C  CA  . VAL B 2 96   ? 52.084  24.387  52.552  1.00 68.63  ? 90   VAL C CA  1 
ATOM   9098  C  C   . VAL B 2 96   ? 52.751  25.641  53.102  1.00 69.44  ? 90   VAL C C   1 
ATOM   9099  O  O   . VAL B 2 96   ? 53.692  26.149  52.500  1.00 71.97  ? 90   VAL C O   1 
ATOM   9100  C  CB  . VAL B 2 96   ? 52.771  23.106  53.058  1.00 68.60  ? 90   VAL C CB  1 
ATOM   9101  C  CG1 . VAL B 2 96   ? 52.724  22.986  54.572  1.00 67.97  ? 90   VAL C CG1 1 
ATOM   9102  C  CG2 . VAL B 2 96   ? 52.162  21.876  52.406  1.00 68.63  ? 90   VAL C CG2 1 
ATOM   9103  N  N   . LEU B 2 97   ? 52.246  26.163  54.220  1.00 68.59  ? 91   LEU C N   1 
ATOM   9104  C  CA  . LEU B 2 97   ? 52.970  27.242  54.864  1.00 69.65  ? 91   LEU C CA  1 
ATOM   9105  C  C   . LEU B 2 97   ? 53.013  27.041  56.375  1.00 69.67  ? 91   LEU C C   1 
ATOM   9106  O  O   . LEU B 2 97   ? 52.213  26.289  56.927  1.00 69.01  ? 91   LEU C O   1 
ATOM   9107  C  CB  . LEU B 2 97   ? 52.420  28.605  54.427  1.00 71.49  ? 91   LEU C CB  1 
ATOM   9108  C  CG  . LEU B 2 97   ? 50.947  28.906  54.693  1.00 71.74  ? 91   LEU C CG  1 
ATOM   9109  C  CD1 . LEU B 2 97   ? 50.732  29.299  56.145  1.00 73.50  ? 91   LEU C CD1 1 
ATOM   9110  C  CD2 . LEU B 2 97   ? 50.482  30.034  53.782  1.00 73.04  ? 91   LEU C CD2 1 
ATOM   9111  N  N   . SER B 2 98   ? 53.990  27.703  57.010  1.00 71.37  ? 92   SER C N   1 
ATOM   9112  C  CA  . SER B 2 98   ? 54.284  27.558  58.426  1.00 71.51  ? 92   SER C CA  1 
ATOM   9113  C  C   . SER B 2 98   ? 54.761  28.894  58.985  1.00 73.61  ? 92   SER C C   1 
ATOM   9114  O  O   . SER B 2 98   ? 54.961  29.851  58.237  1.00 74.63  ? 92   SER C O   1 
ATOM   9115  C  CB  . SER B 2 98   ? 55.324  26.497  58.650  1.00 72.05  ? 92   SER C CB  1 
ATOM   9116  O  OG  . SER B 2 98   ? 56.585  26.924  58.152  1.00 74.77  ? 92   SER C OG  1 
ATOM   9117  N  N   . TYR B 2 99   ? 54.950  28.923  60.308  1.00 74.70  ? 93   TYR C N   1 
ATOM   9118  C  CA  . TYR B 2 99   ? 55.437  30.090  61.023  1.00 77.54  ? 93   TYR C CA  1 
ATOM   9119  C  C   . TYR B 2 99   ? 56.475  29.648  62.057  1.00 79.53  ? 93   TYR C C   1 
ATOM   9120  O  O   . TYR B 2 99   ? 56.512  28.476  62.436  1.00 78.57  ? 93   TYR C O   1 
ATOM   9121  C  CB  . TYR B 2 99   ? 54.262  30.850  61.646  1.00 77.62  ? 93   TYR C CB  1 
ATOM   9122  C  CG  . TYR B 2 99   ? 53.769  30.306  62.965  1.00 78.43  ? 93   TYR C CG  1 
ATOM   9123  C  CD1 . TYR B 2 99   ? 52.982  29.165  63.023  1.00 77.42  ? 93   TYR C CD1 1 
ATOM   9124  C  CD2 . TYR B 2 99   ? 54.082  30.936  64.161  1.00 80.71  ? 93   TYR C CD2 1 
ATOM   9125  C  CE1 . TYR B 2 99   ? 52.525  28.660  64.230  1.00 78.20  ? 93   TYR C CE1 1 
ATOM   9126  C  CE2 . TYR B 2 99   ? 53.633  30.448  65.377  1.00 81.46  ? 93   TYR C CE2 1 
ATOM   9127  C  CZ  . TYR B 2 99   ? 52.850  29.307  65.409  1.00 80.52  ? 93   TYR C CZ  1 
ATOM   9128  O  OH  . TYR B 2 99   ? 52.399  28.815  66.597  1.00 82.67  ? 93   TYR C OH  1 
ATOM   9129  N  N   . THR B 2 100  ? 57.316  30.595  62.500  1.00 81.70  ? 94   THR C N   1 
ATOM   9130  C  CA  . THR B 2 100  ? 58.286  30.328  63.552  1.00 83.94  ? 94   THR C CA  1 
ATOM   9131  C  C   . THR B 2 100  ? 58.126  31.350  64.669  1.00 86.81  ? 94   THR C C   1 
ATOM   9132  O  O   . THR B 2 100  ? 57.705  32.480  64.426  1.00 87.53  ? 94   THR C O   1 
ATOM   9133  C  CB  . THR B 2 100  ? 59.729  30.352  63.035  1.00 85.60  ? 94   THR C CB  1 
ATOM   9134  O  OG1 . THR B 2 100  ? 59.879  31.496  62.195  1.00 86.37  ? 94   THR C OG1 1 
ATOM   9135  C  CG2 . THR B 2 100  ? 60.117  29.096  62.287  1.00 83.88  ? 94   THR C CG2 1 
ATOM   9136  N  N   . SER B 2 101  ? 58.495  30.924  65.884  1.00 89.10  ? 95   SER C N   1 
ATOM   9137  C  CA  . SER B 2 101  ? 58.391  31.731  67.087  1.00 91.91  ? 95   SER C CA  1 
ATOM   9138  C  C   . SER B 2 101  ? 59.677  31.607  67.900  1.00 95.98  ? 95   SER C C   1 
ATOM   9139  O  O   . SER B 2 101  ? 59.797  30.709  68.730  1.00 97.24  ? 95   SER C O   1 
ATOM   9140  C  CB  . SER B 2 101  ? 57.198  31.289  67.888  1.00 91.05  ? 95   SER C CB  1 
ATOM   9141  O  OG  . SER B 2 101  ? 57.203  31.884  69.174  1.00 95.01  ? 95   SER C OG  1 
ATOM   9142  N  N   . SER B 2 102  ? 60.632  32.512  67.651  1.00 98.94  ? 96   SER C N   1 
ATOM   9143  C  CA  . SER B 2 102  ? 61.906  32.507  68.354  1.00 103.83 ? 96   SER C CA  1 
ATOM   9144  C  C   . SER B 2 102  ? 62.121  33.840  69.069  1.00 107.96 ? 96   SER C C   1 
ATOM   9145  O  O   . SER B 2 102  ? 61.380  34.794  68.843  1.00 107.61 ? 96   SER C O   1 
ATOM   9146  C  CB  . SER B 2 102  ? 63.039  32.187  67.416  1.00 104.64 ? 96   SER C CB  1 
ATOM   9147  O  OG  . SER B 2 102  ? 63.024  33.072  66.310  1.00 104.18 ? 96   SER C OG  1 
ATOM   9148  N  N   . SER B 2 103  ? 63.131  33.884  69.948  1.00 112.78 ? 97   SER C N   1 
ATOM   9149  C  CA  . SER B 2 103  ? 63.453  35.080  70.711  1.00 117.50 ? 97   SER C CA  1 
ATOM   9150  C  C   . SER B 2 103  ? 64.789  35.639  70.231  1.00 121.97 ? 97   SER C C   1 
ATOM   9151  O  O   . SER B 2 103  ? 64.848  36.286  69.186  1.00 121.48 ? 97   SER C O   1 
ATOM   9152  C  CB  . SER B 2 103  ? 63.459  34.798  72.200  1.00 119.89 ? 97   SER C CB  1 
ATOM   9153  O  OG  . SER B 2 103  ? 62.194  34.321  72.637  1.00 116.47 ? 97   SER C OG  1 
ATOM   9154  N  N   . GLY B 2 104  ? 65.845  35.376  71.013  1.00 127.60 ? 98   GLY C N   1 
ATOM   9155  C  CA  . GLY B 2 104  ? 67.219  35.652  70.622  1.00 132.53 ? 98   GLY C CA  1 
ATOM   9156  C  C   . GLY B 2 104  ? 67.787  36.905  71.286  1.00 138.44 ? 98   GLY C C   1 
ATOM   9157  O  O   . GLY B 2 104  ? 67.116  37.567  72.078  1.00 138.45 ? 98   GLY C O   1 
ATOM   9158  N  N   . ASP B 2 105  ? 69.046  37.202  70.939  1.00 144.60 ? 99   ASP C N   1 
ATOM   9159  C  CA  . ASP B 2 105  ? 69.784  38.373  71.396  1.00 151.66 ? 99   ASP C CA  1 
ATOM   9160  C  C   . ASP B 2 105  ? 69.861  38.388  72.922  1.00 153.72 ? 99   ASP C C   1 
ATOM   9161  O  O   . ASP B 2 105  ? 70.085  37.353  73.548  1.00 153.78 ? 99   ASP C O   1 
ATOM   9162  C  CB  . ASP B 2 105  ? 69.203  39.671  70.820  1.00 153.70 ? 99   ASP C CB  1 
ATOM   9163  C  CG  . ASP B 2 105  ? 69.449  39.867  69.332  1.00 154.95 ? 99   ASP C CG  1 
ATOM   9164  O  OD1 . ASP B 2 105  ? 70.397  39.249  68.799  1.00 158.34 ? 99   ASP C OD1 1 
ATOM   9165  O  OD2 . ASP B 2 105  ? 68.689  40.644  68.719  1.00 154.24 ? 99   ASP C OD2 1 
ATOM   9166  N  N   . ASP B 2 106  ? 69.694  39.584  73.499  1.00 155.58 ? 100  ASP C N   1 
ATOM   9167  C  CA  . ASP B 2 106  ? 69.524  39.756  74.933  1.00 157.69 ? 100  ASP C CA  1 
ATOM   9168  C  C   . ASP B 2 106  ? 68.035  39.783  75.273  1.00 153.19 ? 100  ASP C C   1 
ATOM   9169  O  O   . ASP B 2 106  ? 67.675  39.911  76.443  1.00 155.13 ? 100  ASP C O   1 
ATOM   9170  C  CB  . ASP B 2 106  ? 70.226  41.020  75.438  1.00 163.66 ? 100  ASP C CB  1 
ATOM   9171  C  CG  . ASP B 2 106  ? 71.705  40.825  75.729  1.00 170.63 ? 100  ASP C CG  1 
ATOM   9172  O  OD1 . ASP B 2 106  ? 72.265  39.806  75.273  1.00 170.45 ? 100  ASP C OD1 1 
ATOM   9173  O  OD2 . ASP B 2 106  ? 72.290  41.691  76.417  1.00 176.12 ? 100  ASP C OD2 1 
ATOM   9174  N  N   . ASP B 2 107  ? 67.190  39.648  74.237  1.00 147.47 ? 101  ASP C N   1 
ATOM   9175  C  CA  . ASP B 2 107  ? 65.747  39.793  74.352  1.00 143.48 ? 101  ASP C CA  1 
ATOM   9176  C  C   . ASP B 2 107  ? 65.104  38.417  74.516  1.00 139.15 ? 101  ASP C C   1 
ATOM   9177  O  O   . ASP B 2 107  ? 64.528  37.876  73.571  1.00 134.31 ? 101  ASP C O   1 
ATOM   9178  C  CB  . ASP B 2 107  ? 65.174  40.595  73.177  1.00 140.87 ? 101  ASP C CB  1 
ATOM   9179  C  CG  . ASP B 2 107  ? 65.543  42.073  73.202  1.00 145.32 ? 101  ASP C CG  1 
ATOM   9180  O  OD1 . ASP B 2 107  ? 65.729  42.615  74.307  1.00 148.79 ? 101  ASP C OD1 1 
ATOM   9181  O  OD2 . ASP B 2 107  ? 65.646  42.672  72.114  1.00 145.70 ? 101  ASP C OD2 1 
ATOM   9182  N  N   . PHE B 2 108  ? 65.231  37.857  75.726  1.00 141.52 ? 102  PHE C N   1 
ATOM   9183  C  CA  . PHE B 2 108  ? 64.584  36.604  76.081  1.00 138.01 ? 102  PHE C CA  1 
ATOM   9184  C  C   . PHE B 2 108  ? 63.154  36.908  76.524  1.00 135.66 ? 102  PHE C C   1 
ATOM   9185  O  O   . PHE B 2 108  ? 62.873  38.014  76.991  1.00 137.43 ? 102  PHE C O   1 
ATOM   9186  C  CB  . PHE B 2 108  ? 65.429  35.831  77.101  1.00 141.99 ? 102  PHE C CB  1 
ATOM   9187  C  CG  . PHE B 2 108  ? 66.859  35.602  76.676  1.00 144.66 ? 102  PHE C CG  1 
ATOM   9188  C  CD1 . PHE B 2 108  ? 67.833  36.557  76.933  1.00 150.24 ? 102  PHE C CD1 1 
ATOM   9189  C  CD2 . PHE B 2 108  ? 67.233  34.444  76.007  1.00 142.33 ? 102  PHE C CD2 1 
ATOM   9190  C  CE1 . PHE B 2 108  ? 69.148  36.357  76.536  1.00 153.75 ? 102  PHE C CE1 1 
ATOM   9191  C  CE2 . PHE B 2 108  ? 68.549  34.243  75.612  1.00 145.57 ? 102  PHE C CE2 1 
ATOM   9192  C  CZ  . PHE B 2 108  ? 69.504  35.199  75.878  1.00 151.25 ? 102  PHE C CZ  1 
ATOM   9193  N  N   . SER B 2 109  ? 62.261  35.920  76.353  1.00 131.65 ? 103  SER C N   1 
ATOM   9194  C  CA  . SER B 2 109  ? 60.823  36.113  76.485  1.00 129.07 ? 103  SER C CA  1 
ATOM   9195  C  C   . SER B 2 109  ? 60.410  37.344  75.676  1.00 128.11 ? 103  SER C C   1 
ATOM   9196  O  O   . SER B 2 109  ? 59.859  38.303  76.219  1.00 130.93 ? 103  SER C O   1 
ATOM   9197  C  CB  . SER B 2 109  ? 60.403  36.215  77.939  1.00 132.64 ? 103  SER C CB  1 
ATOM   9198  O  OG  . SER B 2 109  ? 60.760  35.047  78.664  1.00 134.16 ? 103  SER C OG  1 
ATOM   9199  N  N   . PHE B 2 110  ? 60.726  37.307  74.374  1.00 124.59 ? 104  PHE C N   1 
ATOM   9200  C  CA  . PHE B 2 110  ? 60.564  38.424  73.455  1.00 122.79 ? 104  PHE C CA  1 
ATOM   9201  C  C   . PHE B 2 110  ? 60.565  37.866  72.036  1.00 117.13 ? 104  PHE C C   1 
ATOM   9202  O  O   . PHE B 2 110  ? 61.571  37.320  71.588  1.00 117.03 ? 104  PHE C O   1 
ATOM   9203  C  CB  . PHE B 2 110  ? 61.699  39.435  73.633  1.00 128.73 ? 104  PHE C CB  1 
ATOM   9204  C  CG  . PHE B 2 110  ? 61.545  40.717  72.854  1.00 130.34 ? 104  PHE C CG  1 
ATOM   9205  C  CD1 . PHE B 2 110  ? 61.515  40.720  71.464  1.00 127.18 ? 104  PHE C CD1 1 
ATOM   9206  C  CD2 . PHE B 2 110  ? 61.456  41.930  73.521  1.00 135.28 ? 104  PHE C CD2 1 
ATOM   9207  C  CE1 . PHE B 2 110  ? 61.383  41.907  70.759  1.00 128.94 ? 104  PHE C CE1 1 
ATOM   9208  C  CE2 . PHE B 2 110  ? 61.325  43.117  72.816  1.00 137.09 ? 104  PHE C CE2 1 
ATOM   9209  C  CZ  . PHE B 2 110  ? 61.293  43.101  71.438  1.00 134.23 ? 104  PHE C CZ  1 
ATOM   9210  N  N   . TYR B 2 111  ? 59.442  38.050  71.334  1.00 112.17 ? 105  TYR C N   1 
ATOM   9211  C  CA  . TYR B 2 111  ? 59.034  37.107  70.306  1.00 105.75 ? 105  TYR C CA  1 
ATOM   9212  C  C   . TYR B 2 111  ? 59.088  37.711  68.907  1.00 103.75 ? 105  TYR C C   1 
ATOM   9213  O  O   . TYR B 2 111  ? 58.653  38.839  68.685  1.00 104.61 ? 105  TYR C O   1 
ATOM   9214  C  CB  . TYR B 2 111  ? 57.651  36.557  70.645  1.00 102.75 ? 105  TYR C CB  1 
ATOM   9215  C  CG  . TYR B 2 111  ? 57.664  35.531  71.746  1.00 103.15 ? 105  TYR C CG  1 
ATOM   9216  C  CD1 . TYR B 2 111  ? 57.594  35.900  73.082  1.00 106.54 ? 105  TYR C CD1 1 
ATOM   9217  C  CD2 . TYR B 2 111  ? 57.762  34.183  71.445  1.00 100.61 ? 105  TYR C CD2 1 
ATOM   9218  C  CE1 . TYR B 2 111  ? 57.608  34.951  74.092  1.00 107.85 ? 105  TYR C CE1 1 
ATOM   9219  C  CE2 . TYR B 2 111  ? 57.778  33.222  72.442  1.00 101.78 ? 105  TYR C CE2 1 
ATOM   9220  C  CZ  . TYR B 2 111  ? 57.697  33.606  73.768  1.00 105.46 ? 105  TYR C CZ  1 
ATOM   9221  O  OH  . TYR B 2 111  ? 57.713  32.652  74.743  1.00 107.38 ? 105  TYR C OH  1 
ATOM   9222  N  N   . ILE B 2 112  ? 59.626  36.910  67.980  1.00 101.17 ? 106  ILE C N   1 
ATOM   9223  C  CA  . ILE B 2 112  ? 59.675  37.215  66.559  1.00 99.87  ? 106  ILE C CA  1 
ATOM   9224  C  C   . ILE B 2 112  ? 58.847  36.164  65.819  1.00 94.68  ? 106  ILE C C   1 
ATOM   9225  O  O   . ILE B 2 112  ? 58.905  34.974  66.133  1.00 92.40  ? 106  ILE C O   1 
ATOM   9226  C  CB  . ILE B 2 112  ? 61.138  37.308  66.053  1.00 102.77 ? 106  ILE C CB  1 
ATOM   9227  C  CG1 . ILE B 2 112  ? 61.265  38.056  64.723  1.00 103.01 ? 106  ILE C CG1 1 
ATOM   9228  C  CG2 . ILE B 2 112  ? 61.827  35.952  66.005  1.00 102.18 ? 106  ILE C CG2 1 
ATOM   9229  C  CD1 . ILE B 2 112  ? 61.589  39.522  64.895  1.00 106.28 ? 106  ILE C CD1 1 
ATOM   9230  N  N   . TYR B 2 113  ? 58.059  36.628  64.844  1.00 92.69  ? 107  TYR C N   1 
ATOM   9231  C  CA  . TYR B 2 113  ? 57.186  35.748  64.087  1.00 88.69  ? 107  TYR C CA  1 
ATOM   9232  C  C   . TYR B 2 113  ? 57.467  35.894  62.593  1.00 88.40  ? 107  TYR C C   1 
ATOM   9233  O  O   . TYR B 2 113  ? 57.356  36.982  62.029  1.00 89.73  ? 107  TYR C O   1 
ATOM   9234  C  CB  . TYR B 2 113  ? 55.717  35.984  64.457  1.00 86.71  ? 107  TYR C CB  1 
ATOM   9235  C  CG  . TYR B 2 113  ? 55.369  35.666  65.890  1.00 86.59  ? 107  TYR C CG  1 
ATOM   9236  C  CD1 . TYR B 2 113  ? 54.982  34.390  66.267  1.00 84.00  ? 107  TYR C CD1 1 
ATOM   9237  C  CD2 . TYR B 2 113  ? 55.430  36.640  66.874  1.00 89.60  ? 107  TYR C CD2 1 
ATOM   9238  C  CE1 . TYR B 2 113  ? 54.664  34.087  67.581  1.00 85.00  ? 107  TYR C CE1 1 
ATOM   9239  C  CE2 . TYR B 2 113  ? 55.115  36.355  68.193  1.00 90.61  ? 107  TYR C CE2 1 
ATOM   9240  C  CZ  . TYR B 2 113  ? 54.730  35.074  68.549  1.00 88.47  ? 107  TYR C CZ  1 
ATOM   9241  O  OH  . TYR B 2 113  ? 54.421  34.786  69.847  1.00 90.08  ? 107  TYR C OH  1 
ATOM   9242  N  N   . HIS B 2 114  ? 57.845  34.774  61.972  1.00 86.86  ? 108  HIS C N   1 
ATOM   9243  C  CA  . HIS B 2 114  ? 58.056  34.714  60.537  1.00 87.03  ? 108  HIS C CA  1 
ATOM   9244  C  C   . HIS B 2 114  ? 57.067  33.726  59.927  1.00 83.81  ? 108  HIS C C   1 
ATOM   9245  O  O   . HIS B 2 114  ? 56.788  32.681  60.511  1.00 81.27  ? 108  HIS C O   1 
ATOM   9246  C  CB  . HIS B 2 114  ? 59.506  34.321  60.214  1.00 89.31  ? 108  HIS C CB  1 
ATOM   9247  C  CG  . HIS B 2 114  ? 60.542  35.305  60.651  1.00 93.47  ? 108  HIS C CG  1 
ATOM   9248  N  ND1 . HIS B 2 114  ? 60.960  35.408  61.966  1.00 94.68  ? 108  HIS C ND1 1 
ATOM   9249  C  CD2 . HIS B 2 114  ? 61.269  36.203  59.949  1.00 96.51  ? 108  HIS C CD2 1 
ATOM   9250  C  CE1 . HIS B 2 114  ? 61.888  36.337  62.055  1.00 98.94  ? 108  HIS C CE1 1 
ATOM   9251  N  NE2 . HIS B 2 114  ? 62.095  36.840  60.832  1.00 100.21 ? 108  HIS C NE2 1 
ATOM   9252  N  N   . LEU B 2 115  ? 56.547  34.087  58.750  1.00 83.74  ? 109  LEU C N   1 
ATOM   9253  C  CA  . LEU B 2 115  ? 55.699  33.229  57.940  1.00 81.50  ? 109  LEU C CA  1 
ATOM   9254  C  C   . LEU B 2 115  ? 56.505  32.762  56.729  1.00 82.56  ? 109  LEU C C   1 
ATOM   9255  O  O   . LEU B 2 115  ? 57.332  33.513  56.217  1.00 85.84  ? 109  LEU C O   1 
ATOM   9256  C  CB  . LEU B 2 115  ? 54.484  34.058  57.513  1.00 80.94  ? 109  LEU C CB  1 
ATOM   9257  C  CG  . LEU B 2 115  ? 53.378  33.302  56.783  1.00 77.35  ? 109  LEU C CG  1 
ATOM   9258  C  CD1 . LEU B 2 115  ? 52.753  32.264  57.697  1.00 74.73  ? 109  LEU C CD1 1 
ATOM   9259  C  CD2 . LEU B 2 115  ? 52.323  34.275  56.294  1.00 78.60  ? 109  LEU C CD2 1 
ATOM   9260  N  N   . TYR B 2 116  ? 56.267  31.519  56.279  1.00 80.75  ? 110  TYR C N   1 
ATOM   9261  C  CA  . TYR B 2 116  ? 57.006  30.954  55.158  1.00 81.03  ? 110  TYR C CA  1 
ATOM   9262  C  C   . TYR B 2 116  ? 56.064  30.179  54.243  1.00 78.42  ? 110  TYR C C   1 
ATOM   9263  O  O   . TYR B 2 116  ? 55.278  29.373  54.724  1.00 76.47  ? 110  TYR C O   1 
ATOM   9264  C  CB  . TYR B 2 116  ? 58.078  29.961  55.621  1.00 80.78  ? 110  TYR C CB  1 
ATOM   9265  C  CG  . TYR B 2 116  ? 58.871  30.344  56.844  1.00 82.89  ? 110  TYR C CG  1 
ATOM   9266  C  CD1 . TYR B 2 116  ? 58.336  30.187  58.113  1.00 81.93  ? 110  TYR C CD1 1 
ATOM   9267  C  CD2 . TYR B 2 116  ? 60.166  30.827  56.739  1.00 86.18  ? 110  TYR C CD2 1 
ATOM   9268  C  CE1 . TYR B 2 116  ? 59.057  30.522  59.246  1.00 83.90  ? 110  TYR C CE1 1 
ATOM   9269  C  CE2 . TYR B 2 116  ? 60.904  31.162  57.863  1.00 88.22  ? 110  TYR C CE2 1 
ATOM   9270  C  CZ  . TYR B 2 116  ? 60.346  31.006  59.120  1.00 86.99  ? 110  TYR C CZ  1 
ATOM   9271  O  OH  . TYR B 2 116  ? 61.055  31.331  60.236  1.00 89.29  ? 110  TYR C OH  1 
ATOM   9272  N  N   . TRP B 2 117  ? 56.187  30.409  52.930  1.00 79.58  ? 111  TRP C N   1 
ATOM   9273  C  CA  . TRP B 2 117  ? 55.497  29.642  51.905  1.00 78.64  ? 111  TRP C CA  1 
ATOM   9274  C  C   . TRP B 2 117  ? 56.418  28.538  51.389  1.00 79.63  ? 111  TRP C C   1 
ATOM   9275  O  O   . TRP B 2 117  ? 57.551  28.813  50.994  1.00 83.47  ? 111  TRP C O   1 
ATOM   9276  C  CB  . TRP B 2 117  ? 55.115  30.566  50.745  1.00 81.69  ? 111  TRP C CB  1 
ATOM   9277  C  CG  . TRP B 2 117  ? 53.829  31.325  50.882  1.00 82.36  ? 111  TRP C CG  1 
ATOM   9278  C  CD1 . TRP B 2 117  ? 52.652  31.050  50.249  1.00 81.64  ? 111  TRP C CD1 1 
ATOM   9279  C  CD2 . TRP B 2 117  ? 53.600  32.530  51.638  1.00 83.83  ? 111  TRP C CD2 1 
ATOM   9280  N  NE1 . TRP B 2 117  ? 51.705  31.982  50.575  1.00 82.67  ? 111  TRP C NE1 1 
ATOM   9281  C  CE2 . TRP B 2 117  ? 52.256  32.901  51.424  1.00 83.43  ? 111  TRP C CE2 1 
ATOM   9282  C  CE3 . TRP B 2 117  ? 54.390  33.322  52.480  1.00 86.03  ? 111  TRP C CE3 1 
ATOM   9283  C  CZ2 . TRP B 2 117  ? 51.686  34.023  52.021  1.00 85.56  ? 111  TRP C CZ2 1 
ATOM   9284  C  CZ3 . TRP B 2 117  ? 53.826  34.431  53.073  1.00 87.67  ? 111  TRP C CZ3 1 
ATOM   9285  C  CH2 . TRP B 2 117  ? 52.493  34.775  52.842  1.00 87.72  ? 111  TRP C CH2 1 
ATOM   9286  N  N   . TRP B 2 118  ? 55.904  27.302  51.358  1.00 76.77  ? 112  TRP C N   1 
ATOM   9287  C  CA  . TRP B 2 118  ? 56.617  26.156  50.817  1.00 77.42  ? 112  TRP C CA  1 
ATOM   9288  C  C   . TRP B 2 118  ? 55.874  25.622  49.598  1.00 77.94  ? 112  TRP C C   1 
ATOM   9289  O  O   . TRP B 2 118  ? 54.666  25.435  49.664  1.00 77.25  ? 112  TRP C O   1 
ATOM   9290  C  CB  . TRP B 2 118  ? 56.683  25.059  51.878  1.00 75.62  ? 112  TRP C CB  1 
ATOM   9291  C  CG  . TRP B 2 118  ? 57.405  25.450  53.127  1.00 77.02  ? 112  TRP C CG  1 
ATOM   9292  C  CD1 . TRP B 2 118  ? 56.880  26.058  54.229  1.00 76.36  ? 112  TRP C CD1 1 
ATOM   9293  C  CD2 . TRP B 2 118  ? 58.797  25.230  53.412  1.00 79.97  ? 112  TRP C CD2 1 
ATOM   9294  N  NE1 . TRP B 2 118  ? 57.851  26.238  55.180  1.00 78.45  ? 112  TRP C NE1 1 
ATOM   9295  C  CE2 . TRP B 2 118  ? 59.039  25.745  54.706  1.00 80.16  ? 112  TRP C CE2 1 
ATOM   9296  C  CE3 . TRP B 2 118  ? 59.858  24.655  52.702  1.00 81.97  ? 112  TRP C CE3 1 
ATOM   9297  C  CZ2 . TRP B 2 118  ? 60.298  25.696  55.304  1.00 81.79  ? 112  TRP C CZ2 1 
ATOM   9298  C  CZ3 . TRP B 2 118  ? 61.101  24.608  53.295  1.00 84.00  ? 112  TRP C CZ3 1 
ATOM   9299  C  CH2 . TRP B 2 118  ? 61.313  25.118  54.577  1.00 83.96  ? 112  TRP C CH2 1 
ATOM   9300  N  N   . GLU B 2 119  ? 56.586  25.329  48.506  1.00 81.90  ? 113  GLU C N   1 
ATOM   9301  C  CA  . GLU B 2 119  ? 55.930  24.675  47.385  1.00 83.56  ? 113  GLU C CA  1 
ATOM   9302  C  C   . GLU B 2 119  ? 55.878  23.164  47.611  1.00 81.61  ? 113  GLU C C   1 
ATOM   9303  O  O   . GLU B 2 119  ? 56.916  22.504  47.662  1.00 84.48  ? 113  GLU C O   1 
ATOM   9304  C  CB  . GLU B 2 119  ? 56.615  25.003  46.060  1.00 90.00  ? 113  GLU C CB  1 
ATOM   9305  C  CG  . GLU B 2 119  ? 55.859  24.442  44.872  1.00 94.73  ? 113  GLU C CG  1 
ATOM   9306  C  CD  . GLU B 2 119  ? 56.618  24.453  43.557  1.00 103.26 ? 113  GLU C CD  1 
ATOM   9307  O  OE1 . GLU B 2 119  ? 57.657  25.142  43.480  1.00 108.53 ? 113  GLU C OE1 1 
ATOM   9308  O  OE2 . GLU B 2 119  ? 56.188  23.746  42.623  1.00 107.57 ? 113  GLU C OE2 1 
ATOM   9309  N  N   . PHE B 2 120  ? 54.654  22.627  47.716  1.00 78.32  ? 114  PHE C N   1 
ATOM   9310  C  CA  . PHE B 2 120  ? 54.399  21.199  47.835  1.00 74.67  ? 114  PHE C CA  1 
ATOM   9311  C  C   . PHE B 2 120  ? 54.573  20.551  46.466  1.00 76.70  ? 114  PHE C C   1 
ATOM   9312  O  O   . PHE B 2 120  ? 54.055  21.053  45.473  1.00 79.46  ? 114  PHE C O   1 
ATOM   9313  C  CB  . PHE B 2 120  ? 52.975  20.991  48.358  1.00 70.38  ? 114  PHE C CB  1 
ATOM   9314  C  CG  . PHE B 2 120  ? 52.525  19.557  48.484  1.00 68.29  ? 114  PHE C CG  1 
ATOM   9315  C  CD1 . PHE B 2 120  ? 52.742  18.848  49.659  1.00 66.53  ? 114  PHE C CD1 1 
ATOM   9316  C  CD2 . PHE B 2 120  ? 51.859  18.927  47.441  1.00 67.89  ? 114  PHE C CD2 1 
ATOM   9317  C  CE1 . PHE B 2 120  ? 52.324  17.534  49.782  1.00 64.97  ? 114  PHE C CE1 1 
ATOM   9318  C  CE2 . PHE B 2 120  ? 51.440  17.612  47.565  1.00 66.98  ? 114  PHE C CE2 1 
ATOM   9319  C  CZ  . PHE B 2 120  ? 51.674  16.923  48.735  1.00 65.95  ? 114  PHE C CZ  1 
ATOM   9320  N  N   . ASN B 2 121  ? 55.326  19.453  46.401  1.00 77.65  ? 115  ASN C N   1 
ATOM   9321  C  CA  . ASN B 2 121  ? 55.434  18.757  45.130  1.00 79.44  ? 115  ASN C CA  1 
ATOM   9322  C  C   . ASN B 2 121  ? 55.387  17.254  45.380  1.00 77.84  ? 115  ASN C C   1 
ATOM   9323  O  O   . ASN B 2 121  ? 56.290  16.525  44.982  1.00 79.64  ? 115  ASN C O   1 
ATOM   9324  C  CB  . ASN B 2 121  ? 56.623  19.229  44.286  1.00 85.47  ? 115  ASN C CB  1 
ATOM   9325  C  CG  . ASN B 2 121  ? 56.371  19.082  42.799  1.00 89.53  ? 115  ASN C CG  1 
ATOM   9326  O  OD1 . ASN B 2 121  ? 55.805  18.081  42.359  1.00 89.85  ? 115  ASN C OD1 1 
ATOM   9327  N  ND2 . ASN B 2 121  ? 56.776  20.077  42.022  1.00 92.62  ? 115  ASN C ND2 1 
ATOM   9328  N  N   . VAL B 2 122  ? 54.305  16.822  46.041  1.00 74.37  ? 116  VAL C N   1 
ATOM   9329  C  CA  . VAL B 2 122  ? 54.019  15.434  46.381  1.00 72.91  ? 116  VAL C CA  1 
ATOM   9330  C  C   . VAL B 2 122  ? 55.189  14.828  47.168  1.00 73.43  ? 116  VAL C C   1 
ATOM   9331  O  O   . VAL B 2 122  ? 55.437  15.255  48.290  1.00 72.21  ? 116  VAL C O   1 
ATOM   9332  C  CB  . VAL B 2 122  ? 53.513  14.606  45.175  1.00 73.80  ? 116  VAL C CB  1 
ATOM   9333  C  CG1 . VAL B 2 122  ? 52.996  13.233  45.596  1.00 72.77  ? 116  VAL C CG1 1 
ATOM   9334  C  CG2 . VAL B 2 122  ? 52.413  15.348  44.429  1.00 72.84  ? 116  VAL C CG2 1 
ATOM   9335  N  N   . HIS B 2 123  ? 55.897  13.845  46.593  1.00 75.28  ? 117  HIS C N   1 
ATOM   9336  C  CA  . HIS B 2 123  ? 56.897  13.061  47.305  1.00 76.21  ? 117  HIS C CA  1 
ATOM   9337  C  C   . HIS B 2 123  ? 58.206  13.832  47.463  1.00 78.36  ? 117  HIS C C   1 
ATOM   9338  O  O   . HIS B 2 123  ? 58.933  13.623  48.431  1.00 78.91  ? 117  HIS C O   1 
ATOM   9339  C  CB  . HIS B 2 123  ? 57.106  11.708  46.617  1.00 77.92  ? 117  HIS C CB  1 
ATOM   9340  C  CG  . HIS B 2 123  ? 55.972  10.766  46.831  1.00 76.38  ? 117  HIS C CG  1 
ATOM   9341  N  ND1 . HIS B 2 123  ? 55.105  10.408  45.818  1.00 76.38  ? 117  HIS C ND1 1 
ATOM   9342  C  CD2 . HIS B 2 123  ? 55.544  10.131  47.942  1.00 75.14  ? 117  HIS C CD2 1 
ATOM   9343  C  CE1 . HIS B 2 123  ? 54.193  9.587   46.295  1.00 75.33  ? 117  HIS C CE1 1 
ATOM   9344  N  NE2 . HIS B 2 123  ? 54.447  9.397   47.593  1.00 74.69  ? 117  HIS C NE2 1 
ATOM   9345  N  N   . SER B 2 124  ? 58.508  14.712  46.503  1.00 80.13  ? 118  SER C N   1 
ATOM   9346  C  CA  . SER B 2 124  ? 59.748  15.472  46.512  1.00 83.58  ? 118  SER C CA  1 
ATOM   9347  C  C   . SER B 2 124  ? 59.718  16.503  47.640  1.00 82.44  ? 118  SER C C   1 
ATOM   9348  O  O   . SER B 2 124  ? 58.648  16.807  48.163  1.00 79.97  ? 118  SER C O   1 
ATOM   9349  C  CB  . SER B 2 124  ? 60.015  16.101  45.163  1.00 85.74  ? 118  SER C CB  1 
ATOM   9350  O  OG  . SER B 2 124  ? 58.991  17.024  44.822  1.00 83.31  ? 118  SER C OG  1 
ATOM   9351  N  N   . LYS B 2 125  ? 60.900  17.021  48.009  1.00 85.15  ? 119  LYS C N   1 
ATOM   9352  C  CA  . LYS B 2 125  ? 61.050  17.867  49.183  1.00 84.69  ? 119  LYS C CA  1 
ATOM   9353  C  C   . LYS B 2 125  ? 60.414  19.236  48.933  1.00 83.58  ? 119  LYS C C   1 
ATOM   9354  O  O   . LYS B 2 125  ? 60.325  19.685  47.790  1.00 85.48  ? 119  LYS C O   1 
ATOM   9355  C  CB  . LYS B 2 125  ? 62.514  17.891  49.637  1.00 88.43  ? 119  LYS C CB  1 
ATOM   9356  C  CG  . LYS B 2 125  ? 63.053  16.536  50.081  1.00 90.94  ? 119  LYS C CG  1 
ATOM   9357  C  CD  . LYS B 2 125  ? 64.158  16.573  51.126  1.00 94.53  ? 119  LYS C CD  1 
ATOM   9358  C  CE  . LYS B 2 125  ? 64.119  15.384  52.069  1.00 94.91  ? 119  LYS C CE  1 
ATOM   9359  N  NZ  . LYS B 2 125  ? 63.803  14.113  51.372  1.00 94.95  ? 119  LYS C NZ  1 
ATOM   9360  N  N   . LEU B 2 126  ? 59.930  19.864  50.015  1.00 80.62  ? 120  LEU C N   1 
ATOM   9361  C  CA  . LEU B 2 126  ? 59.288  21.167  49.960  1.00 79.20  ? 120  LEU C CA  1 
ATOM   9362  C  C   . LEU B 2 126  ? 60.339  22.229  49.663  1.00 83.17  ? 120  LEU C C   1 
ATOM   9363  O  O   . LEU B 2 126  ? 61.311  22.341  50.403  1.00 86.22  ? 120  LEU C O   1 
ATOM   9364  C  CB  . LEU B 2 126  ? 58.655  21.463  51.322  1.00 75.91  ? 120  LEU C CB  1 
ATOM   9365  C  CG  . LEU B 2 126  ? 57.546  20.521  51.777  1.00 73.00  ? 120  LEU C CG  1 
ATOM   9366  C  CD1 . LEU B 2 126  ? 57.159  20.830  53.213  1.00 71.52  ? 120  LEU C CD1 1 
ATOM   9367  C  CD2 . LEU B 2 126  ? 56.335  20.621  50.859  1.00 71.53  ? 120  LEU C CD2 1 
ATOM   9368  N  N   . LYS B 2 127  ? 60.134  23.003  48.592  1.00 84.97  ? 121  LYS C N   1 
ATOM   9369  C  CA  . LYS B 2 127  ? 60.999  24.138  48.305  1.00 89.07  ? 121  LYS C CA  1 
ATOM   9370  C  C   . LYS B 2 127  ? 60.466  25.352  49.062  1.00 87.19  ? 121  LYS C C   1 
ATOM   9371  O  O   . LYS B 2 127  ? 59.255  25.513  49.188  1.00 84.55  ? 121  LYS C O   1 
ATOM   9372  C  CB  . LYS B 2 127  ? 61.058  24.415  46.797  1.00 93.74  ? 121  LYS C CB  1 
ATOM   9373  C  CG  . LYS B 2 127  ? 61.515  23.251  45.922  1.00 98.75  ? 121  LYS C CG  1 
ATOM   9374  C  CD  . LYS B 2 127  ? 61.056  23.339  44.465  1.00 102.22 ? 121  LYS C CD  1 
ATOM   9375  C  CE  . LYS B 2 127  ? 60.789  21.985  43.829  1.00 103.07 ? 121  LYS C CE  1 
ATOM   9376  N  NZ  . LYS B 2 127  ? 60.567  22.065  42.363  1.00 105.95 ? 121  LYS C NZ  1 
ATOM   9377  N  N   . LEU B 2 128  ? 61.381  26.186  49.575  1.00 88.27  ? 122  LEU C N   1 
ATOM   9378  C  CA  . LEU B 2 128  ? 61.023  27.430  50.241  1.00 86.53  ? 122  LEU C CA  1 
ATOM   9379  C  C   . LEU B 2 128  ? 60.900  28.541  49.196  1.00 88.66  ? 122  LEU C C   1 
ATOM   9380  O  O   . LEU B 2 128  ? 61.820  28.761  48.411  1.00 92.12  ? 122  LEU C O   1 
ATOM   9381  C  CB  . LEU B 2 128  ? 62.102  27.754  51.279  1.00 87.84  ? 122  LEU C CB  1 
ATOM   9382  C  CG  . LEU B 2 128  ? 61.801  28.922  52.213  1.00 87.06  ? 122  LEU C CG  1 
ATOM   9383  C  CD1 . LEU B 2 128  ? 60.806  28.506  53.281  1.00 83.70  ? 122  LEU C CD1 1 
ATOM   9384  C  CD2 . LEU B 2 128  ? 63.075  29.443  52.853  1.00 90.76  ? 122  LEU C CD2 1 
ATOM   9385  N  N   . VAL B 2 129  ? 59.755  29.237  49.192  1.00 86.89  ? 123  VAL C N   1 
ATOM   9386  C  CA  . VAL B 2 129  ? 59.467  30.228  48.165  1.00 89.56  ? 123  VAL C CA  1 
ATOM   9387  C  C   . VAL B 2 129  ? 59.504  31.628  48.779  1.00 91.36  ? 123  VAL C C   1 
ATOM   9388  O  O   . VAL B 2 129  ? 60.031  32.552  48.162  1.00 95.54  ? 123  VAL C O   1 
ATOM   9389  C  CB  . VAL B 2 129  ? 58.137  29.951  47.427  1.00 87.55  ? 123  VAL C CB  1 
ATOM   9390  C  CG1 . VAL B 2 129  ? 58.005  30.760  46.144  1.00 90.81  ? 123  VAL C CG1 1 
ATOM   9391  C  CG2 . VAL B 2 129  ? 57.950  28.474  47.117  1.00 85.61  ? 123  VAL C CG2 1 
ATOM   9392  N  N   . ARG B 2 130  ? 58.941  31.780  49.985  1.00 88.32  ? 124  ARG C N   1 
ATOM   9393  C  CA  . ARG B 2 130  ? 58.904  33.078  50.641  1.00 90.03  ? 124  ARG C CA  1 
ATOM   9394  C  C   . ARG B 2 130  ? 59.097  32.927  52.149  1.00 88.74  ? 124  ARG C C   1 
ATOM   9395  O  O   . ARG B 2 130  ? 58.630  31.964  52.751  1.00 85.48  ? 124  ARG C O   1 
ATOM   9396  C  CB  . ARG B 2 130  ? 57.600  33.814  50.312  1.00 89.80  ? 124  ARG C CB  1 
ATOM   9397  C  CG  . ARG B 2 130  ? 57.501  35.207  50.919  1.00 91.99  ? 124  ARG C CG  1 
ATOM   9398  C  CD  . ARG B 2 130  ? 56.499  36.111  50.228  1.00 93.39  ? 124  ARG C CD  1 
ATOM   9399  N  NE  . ARG B 2 130  ? 56.913  36.407  48.865  1.00 96.79  ? 124  ARG C NE  1 
ATOM   9400  C  CZ  . ARG B 2 130  ? 56.193  37.083  47.981  1.00 99.03  ? 124  ARG C CZ  1 
ATOM   9401  N  NH1 . ARG B 2 130  ? 55.001  37.551  48.313  1.00 97.96  ? 124  ARG C NH1 1 
ATOM   9402  N  NH2 . ARG B 2 130  ? 56.670  37.288  46.765  1.00 103.05 ? 124  ARG C NH2 1 
ATOM   9403  N  N   . GLN B 2 131  ? 59.789  33.914  52.732  1.00 92.13  ? 125  GLN C N   1 
ATOM   9404  C  CA  . GLN B 2 131  ? 60.037  34.056  54.158  1.00 91.80  ? 125  GLN C CA  1 
ATOM   9405  C  C   . GLN B 2 131  ? 59.741  35.514  54.499  1.00 93.70  ? 125  GLN C C   1 
ATOM   9406  O  O   . GLN B 2 131  ? 60.186  36.406  53.779  1.00 97.19  ? 125  GLN C O   1 
ATOM   9407  C  CB  . GLN B 2 131  ? 61.507  33.716  54.434  1.00 95.59  ? 125  GLN C CB  1 
ATOM   9408  C  CG  . GLN B 2 131  ? 61.907  33.649  55.907  1.00 95.94  ? 125  GLN C CG  1 
ATOM   9409  C  CD  . GLN B 2 131  ? 63.360  33.281  56.129  1.00 98.89  ? 125  GLN C CD  1 
ATOM   9410  O  OE1 . GLN B 2 131  ? 64.071  32.854  55.217  1.00 99.96  ? 125  GLN C OE1 1 
ATOM   9411  N  NE2 . GLN B 2 131  ? 63.812  33.431  57.365  1.00 99.65  ? 125  GLN C NE2 1 
ATOM   9412  N  N   . VAL B 2 132  ? 58.977  35.750  55.575  1.00 91.90  ? 126  VAL C N   1 
ATOM   9413  C  CA  . VAL B 2 132  ? 58.454  37.077  55.877  1.00 94.24  ? 126  VAL C CA  1 
ATOM   9414  C  C   . VAL B 2 132  ? 58.258  37.221  57.387  1.00 94.41  ? 126  VAL C C   1 
ATOM   9415  O  O   . VAL B 2 132  ? 57.637  36.361  58.011  1.00 91.21  ? 126  VAL C O   1 
ATOM   9416  C  CB  . VAL B 2 132  ? 57.137  37.345  55.116  1.00 92.64  ? 126  VAL C CB  1 
ATOM   9417  C  CG1 . VAL B 2 132  ? 56.400  38.548  55.667  1.00 94.42  ? 126  VAL C CG1 1 
ATOM   9418  C  CG2 . VAL B 2 132  ? 57.341  37.510  53.619  1.00 94.32  ? 126  VAL C CG2 1 
ATOM   9419  N  N   . ARG B 2 133  ? 58.766  38.325  57.959  1.00 98.63  ? 127  ARG C N   1 
ATOM   9420  C  CA  . ARG B 2 133  ? 58.546  38.629  59.367  1.00 99.51  ? 127  ARG C CA  1 
ATOM   9421  C  C   . ARG B 2 133  ? 57.186  39.299  59.552  1.00 99.22  ? 127  ARG C C   1 
ATOM   9422  O  O   . ARG B 2 133  ? 56.800  40.161  58.764  1.00 101.52 ? 127  ARG C O   1 
ATOM   9423  C  CB  . ARG B 2 133  ? 59.664  39.505  59.938  1.00 104.43 ? 127  ARG C CB  1 
ATOM   9424  C  CG  . ARG B 2 133  ? 59.470  39.884  61.401  1.00 106.48 ? 127  ARG C CG  1 
ATOM   9425  C  CD  . ARG B 2 133  ? 60.568  40.816  61.878  1.00 113.24 ? 127  ARG C CD  1 
ATOM   9426  N  NE  . ARG B 2 133  ? 61.869  40.210  61.617  1.00 116.19 ? 127  ARG C NE  1 
ATOM   9427  C  CZ  . ARG B 2 133  ? 63.043  40.831  61.694  1.00 121.28 ? 127  ARG C CZ  1 
ATOM   9428  N  NH1 . ARG B 2 133  ? 63.103  42.108  62.032  1.00 124.96 ? 127  ARG C NH1 1 
ATOM   9429  N  NH2 . ARG B 2 133  ? 64.157  40.170  61.426  1.00 122.80 ? 127  ARG C NH2 1 
ATOM   9430  N  N   . LEU B 2 134  ? 56.483  38.905  60.621  1.00 96.46  ? 128  LEU C N   1 
ATOM   9431  C  CA  . LEU B 2 134  ? 55.153  39.408  60.921  1.00 96.04  ? 128  LEU C CA  1 
ATOM   9432  C  C   . LEU B 2 134  ? 55.234  40.472  62.013  1.00 100.09 ? 128  LEU C C   1 
ATOM   9433  O  O   . LEU B 2 134  ? 56.144  40.448  62.838  1.00 101.92 ? 128  LEU C O   1 
ATOM   9434  C  CB  . LEU B 2 134  ? 54.277  38.237  61.380  1.00 91.75  ? 128  LEU C CB  1 
ATOM   9435  C  CG  . LEU B 2 134  ? 54.202  37.041  60.432  1.00 88.35  ? 128  LEU C CG  1 
ATOM   9436  C  CD1 . LEU B 2 134  ? 53.684  35.811  61.161  1.00 84.84  ? 128  LEU C CD1 1 
ATOM   9437  C  CD2 . LEU B 2 134  ? 53.339  37.348  59.216  1.00 87.96  ? 128  LEU C CD2 1 
ATOM   9438  N  N   . PHE B 2 135  ? 54.265  41.398  61.988  1.00 102.36 ? 129  PHE C N   1 
ATOM   9439  C  CA  . PHE B 2 135  ? 54.038  42.423  62.999  1.00 106.37 ? 129  PHE C CA  1 
ATOM   9440  C  C   . PHE B 2 135  ? 55.300  43.253  63.236  1.00 111.42 ? 129  PHE C C   1 
ATOM   9441  O  O   . PHE B 2 135  ? 55.839  43.259  64.340  1.00 113.53 ? 129  PHE C O   1 
ATOM   9442  C  CB  . PHE B 2 135  ? 53.493  41.820  64.300  1.00 103.93 ? 129  PHE C CB  1 
ATOM   9443  C  CG  . PHE B 2 135  ? 52.673  40.562  64.150  1.00 99.21  ? 129  PHE C CG  1 
ATOM   9444  C  CD1 . PHE B 2 135  ? 51.611  40.498  63.258  1.00 97.95  ? 129  PHE C CD1 1 
ATOM   9445  C  CD2 . PHE B 2 135  ? 52.953  39.441  64.917  1.00 96.79  ? 129  PHE C CD2 1 
ATOM   9446  C  CE1 . PHE B 2 135  ? 50.865  39.336  63.122  1.00 94.45  ? 129  PHE C CE1 1 
ATOM   9447  C  CE2 . PHE B 2 135  ? 52.205  38.279  64.783  1.00 93.19  ? 129  PHE C CE2 1 
ATOM   9448  C  CZ  . PHE B 2 135  ? 51.163  38.228  63.885  1.00 92.08  ? 129  PHE C CZ  1 
ATOM   9449  N  N   . GLN B 2 136  ? 55.747  43.974  62.201  1.00 115.17 ? 130  GLN C N   1 
ATOM   9450  C  CA  . GLN B 2 136  ? 56.997  44.719  62.267  1.00 120.24 ? 130  GLN C CA  1 
ATOM   9451  C  C   . GLN B 2 136  ? 56.887  45.845  63.291  1.00 124.28 ? 130  GLN C C   1 
ATOM   9452  O  O   . GLN B 2 136  ? 55.784  46.270  63.636  1.00 124.34 ? 130  GLN C O   1 
ATOM   9453  C  CB  . GLN B 2 136  ? 57.381  45.288  60.899  1.00 123.69 ? 130  GLN C CB  1 
ATOM   9454  C  CG  . GLN B 2 136  ? 58.131  44.302  60.014  1.00 122.29 ? 130  GLN C CG  1 
ATOM   9455  C  CD  . GLN B 2 136  ? 58.360  44.848  58.625  1.00 125.48 ? 130  GLN C CD  1 
ATOM   9456  O  OE1 . GLN B 2 136  ? 57.753  44.399  57.654  1.00 123.81 ? 130  GLN C OE1 1 
ATOM   9457  N  NE2 . GLN B 2 136  ? 59.234  45.837  58.526  1.00 130.43 ? 130  GLN C NE2 1 
ATOM   9458  N  N   . ASP B 2 137  ? 58.059  46.301  63.757  1.00 127.82 ? 131  ASP C N   1 
ATOM   9459  C  CA  . ASP B 2 137  ? 58.203  47.411  64.690  1.00 132.81 ? 131  ASP C CA  1 
ATOM   9460  C  C   . ASP B 2 137  ? 57.611  47.045  66.053  1.00 130.81 ? 131  ASP C C   1 
ATOM   9461  O  O   . ASP B 2 137  ? 57.359  47.935  66.869  1.00 134.73 ? 131  ASP C O   1 
ATOM   9462  C  CB  . ASP B 2 137  ? 57.564  48.703  64.157  1.00 137.48 ? 131  ASP C CB  1 
ATOM   9463  C  CG  . ASP B 2 137  ? 58.419  49.506  63.188  1.00 142.12 ? 131  ASP C CG  1 
ATOM   9464  O  OD1 . ASP B 2 137  ? 59.547  49.885  63.568  1.00 145.51 ? 131  ASP C OD1 1 
ATOM   9465  O  OD2 . ASP B 2 137  ? 57.937  49.770  62.070  1.00 143.05 ? 131  ASP C OD2 1 
ATOM   9466  N  N   . GLU B 2 138  ? 57.410  45.741  66.302  1.00 124.19 ? 132  GLU C N   1 
ATOM   9467  C  CA  . GLU B 2 138  ? 56.568  45.320  67.413  1.00 121.45 ? 132  GLU C CA  1 
ATOM   9468  C  C   . GLU B 2 138  ? 57.312  44.408  68.386  1.00 119.77 ? 132  GLU C C   1 
ATOM   9469  O  O   . GLU B 2 138  ? 57.735  43.316  68.019  1.00 116.30 ? 132  GLU C O   1 
ATOM   9470  C  CB  . GLU B 2 138  ? 55.272  44.685  66.905  1.00 116.66 ? 132  GLU C CB  1 
ATOM   9471  C  CG  . GLU B 2 138  ? 54.183  45.694  66.581  1.00 118.67 ? 132  GLU C CG  1 
ATOM   9472  C  CD  . GLU B 2 138  ? 53.539  46.385  67.774  1.00 121.98 ? 132  GLU C CD  1 
ATOM   9473  O  OE1 . GLU B 2 138  ? 53.886  46.040  68.924  1.00 122.16 ? 132  GLU C OE1 1 
ATOM   9474  O  OE2 . GLU B 2 138  ? 52.683  47.267  67.549  1.00 124.50 ? 132  GLU C OE2 1 
ATOM   9475  N  N   . GLU B 2 139  ? 57.420  44.872  69.639  1.00 122.78 ? 133  GLU C N   1 
ATOM   9476  C  CA  . GLU B 2 139  ? 57.931  44.094  70.758  1.00 122.75 ? 133  GLU C CA  1 
ATOM   9477  C  C   . GLU B 2 139  ? 56.797  43.244  71.325  1.00 119.52 ? 133  GLU C C   1 
ATOM   9478  O  O   . GLU B 2 139  ? 55.862  43.780  71.913  1.00 121.13 ? 133  GLU C O   1 
ATOM   9479  C  CB  . GLU B 2 139  ? 58.400  45.016  71.888  1.00 128.72 ? 133  GLU C CB  1 
ATOM   9480  C  CG  . GLU B 2 139  ? 59.486  46.006  71.498  1.00 133.22 ? 133  GLU C CG  1 
ATOM   9481  C  CD  . GLU B 2 139  ? 59.892  46.966  72.606  1.00 139.13 ? 133  GLU C CD  1 
ATOM   9482  O  OE1 . GLU B 2 139  ? 59.288  46.905  73.699  1.00 140.00 ? 133  GLU C OE1 1 
ATOM   9483  O  OE2 . GLU B 2 139  ? 60.809  47.777  72.372  1.00 143.46 ? 133  GLU C OE2 1 
ATOM   9484  N  N   . ILE B 2 140  ? 56.903  41.919  71.166  1.00 115.59 ? 134  ILE C N   1 
ATOM   9485  C  CA  . ILE B 2 140  ? 55.868  40.998  71.614  1.00 112.72 ? 134  ILE C CA  1 
ATOM   9486  C  C   . ILE B 2 140  ? 56.350  40.279  72.870  1.00 113.93 ? 134  ILE C C   1 
ATOM   9487  O  O   . ILE B 2 140  ? 57.179  39.376  72.791  1.00 113.00 ? 134  ILE C O   1 
ATOM   9488  C  CB  . ILE B 2 140  ? 55.495  39.987  70.506  1.00 107.92 ? 134  ILE C CB  1 
ATOM   9489  C  CG1 . ILE B 2 140  ? 55.291  40.637  69.132  1.00 107.05 ? 134  ILE C CG1 1 
ATOM   9490  C  CG2 . ILE B 2 140  ? 54.297  39.148  70.925  1.00 105.67 ? 134  ILE C CG2 1 
ATOM   9491  C  CD1 . ILE B 2 140  ? 54.142  41.621  69.057  1.00 108.48 ? 134  ILE C CD1 1 
ATOM   9492  N  N   . TYR B 2 141  ? 55.787  40.656  74.020  1.00 117.13 ? 135  TYR C N   1 
ATOM   9493  C  CA  . TYR B 2 141  ? 56.247  40.136  75.298  1.00 120.21 ? 135  TYR C CA  1 
ATOM   9494  C  C   . TYR B 2 141  ? 55.470  38.883  75.702  1.00 117.57 ? 135  TYR C C   1 
ATOM   9495  O  O   . TYR B 2 141  ? 55.422  38.549  76.885  1.00 120.83 ? 135  TYR C O   1 
ATOM   9496  C  CB  . TYR B 2 141  ? 56.103  41.189  76.402  1.00 126.07 ? 135  TYR C CB  1 
ATOM   9497  C  CG  . TYR B 2 141  ? 57.099  42.322  76.402  1.00 130.46 ? 135  TYR C CG  1 
ATOM   9498  C  CD1 . TYR B 2 141  ? 58.332  42.217  75.772  1.00 130.30 ? 135  TYR C CD1 1 
ATOM   9499  C  CD2 . TYR B 2 141  ? 56.815  43.498  77.082  1.00 135.97 ? 135  TYR C CD2 1 
ATOM   9500  C  CE1 . TYR B 2 141  ? 59.240  43.266  75.794  1.00 135.29 ? 135  TYR C CE1 1 
ATOM   9501  C  CE2 . TYR B 2 141  ? 57.713  44.554  77.119  1.00 140.31 ? 135  TYR C CE2 1 
ATOM   9502  C  CZ  . TYR B 2 141  ? 58.931  44.436  76.472  1.00 140.19 ? 135  TYR C CZ  1 
ATOM   9503  O  OH  . TYR B 2 141  ? 59.815  45.477  76.511  1.00 145.06 ? 135  TYR C OH  1 
ATOM   9504  N  N   . SER B 2 142  ? 54.861  38.190  74.734  1.00 112.65 ? 136  SER C N   1 
ATOM   9505  C  CA  . SER B 2 142  ? 54.079  37.001  75.044  1.00 110.55 ? 136  SER C CA  1 
ATOM   9506  C  C   . SER B 2 142  ? 53.897  36.143  73.798  1.00 105.14 ? 136  SER C C   1 
ATOM   9507  O  O   . SER B 2 142  ? 53.823  36.665  72.690  1.00 103.08 ? 136  SER C O   1 
ATOM   9508  C  CB  . SER B 2 142  ? 52.748  37.354  75.668  1.00 112.66 ? 136  SER C CB  1 
ATOM   9509  O  OG  . SER B 2 142  ? 52.012  38.244  74.840  1.00 111.97 ? 136  SER C OG  1 
ATOM   9510  N  N   . ASP B 2 143  ? 53.814  34.825  74.006  1.00 103.43 ? 137  ASP C N   1 
ATOM   9511  C  CA  . ASP B 2 143  ? 53.673  33.877  72.912  1.00 99.25  ? 137  ASP C CA  1 
ATOM   9512  C  C   . ASP B 2 143  ? 52.224  33.859  72.424  1.00 97.26  ? 137  ASP C C   1 
ATOM   9513  O  O   . ASP B 2 143  ? 51.301  33.585  73.188  1.00 98.49  ? 137  ASP C O   1 
ATOM   9514  C  CB  . ASP B 2 143  ? 54.219  32.500  73.295  1.00 98.94  ? 137  ASP C CB  1 
ATOM   9515  C  CG  . ASP B 2 143  ? 54.508  31.597  72.105  1.00 95.35  ? 137  ASP C CG  1 
ATOM   9516  O  OD1 . ASP B 2 143  ? 54.593  32.115  70.965  1.00 92.74  ? 137  ASP C OD1 1 
ATOM   9517  O  OD2 . ASP B 2 143  ? 54.655  30.379  72.328  1.00 95.41  ? 137  ASP C OD2 1 
ATOM   9518  N  N   . LEU B 2 144  ? 52.051  34.143  71.129  1.00 94.32  ? 138  LEU C N   1 
ATOM   9519  C  CA  . LEU B 2 144  ? 50.745  34.396  70.546  1.00 93.98  ? 138  LEU C CA  1 
ATOM   9520  C  C   . LEU B 2 144  ? 50.099  33.083  70.104  1.00 93.15  ? 138  LEU C C   1 
ATOM   9521  O  O   . LEU B 2 144  ? 50.796  32.126  69.774  1.00 92.13  ? 138  LEU C O   1 
ATOM   9522  C  CB  . LEU B 2 144  ? 50.924  35.350  69.358  1.00 90.94  ? 138  LEU C CB  1 
ATOM   9523  C  CG  . LEU B 2 144  ? 51.621  36.676  69.657  1.00 92.46  ? 138  LEU C CG  1 
ATOM   9524  C  CD1 . LEU B 2 144  ? 51.747  37.518  68.399  1.00 90.93  ? 138  LEU C CD1 1 
ATOM   9525  C  CD2 . LEU B 2 144  ? 50.879  37.449  70.735  1.00 96.36  ? 138  LEU C CD2 1 
ATOM   9526  N  N   . TYR B 2 145  ? 48.759  33.044  70.154  1.00 86.90  ? 139  TYR C N   1 
ATOM   9527  C  CA  . TYR B 2 145  ? 47.949  32.154  69.336  1.00 86.02  ? 139  TYR C CA  1 
ATOM   9528  C  C   . TYR B 2 145  ? 47.891  32.766  67.942  1.00 84.44  ? 139  TYR C C   1 
ATOM   9529  O  O   . TYR B 2 145  ? 47.472  33.912  67.788  1.00 84.59  ? 139  TYR C O   1 
ATOM   9530  C  CB  . TYR B 2 145  ? 46.502  32.093  69.838  1.00 87.61  ? 139  TYR C CB  1 
ATOM   9531  C  CG  . TYR B 2 145  ? 46.231  31.263  71.072  1.00 92.51  ? 139  TYR C CG  1 
ATOM   9532  C  CD1 . TYR B 2 145  ? 46.542  31.735  72.343  1.00 95.02  ? 139  TYR C CD1 1 
ATOM   9533  C  CD2 . TYR B 2 145  ? 45.614  30.021  70.977  1.00 94.50  ? 139  TYR C CD2 1 
ATOM   9534  C  CE1 . TYR B 2 145  ? 46.282  30.984  73.480  1.00 97.74  ? 139  TYR C CE1 1 
ATOM   9535  C  CE2 . TYR B 2 145  ? 45.349  29.257  72.106  1.00 96.83  ? 139  TYR C CE2 1 
ATOM   9536  C  CZ  . TYR B 2 145  ? 45.683  29.740  73.362  1.00 98.20  ? 139  TYR C CZ  1 
ATOM   9537  O  OH  . TYR B 2 145  ? 45.426  29.003  74.484  1.00 99.87  ? 139  TYR C OH  1 
ATOM   9538  N  N   . LEU B 2 146  ? 48.318  32.003  66.932  1.00 83.91  ? 140  LEU C N   1 
ATOM   9539  C  CA  . LEU B 2 146  ? 48.475  32.537  65.589  1.00 82.26  ? 140  LEU C CA  1 
ATOM   9540  C  C   . LEU B 2 146  ? 47.580  31.762  64.627  1.00 79.43  ? 140  LEU C C   1 
ATOM   9541  O  O   . LEU B 2 146  ? 47.414  30.553  64.769  1.00 79.30  ? 140  LEU C O   1 
ATOM   9542  C  CB  . LEU B 2 146  ? 49.957  32.433  65.205  1.00 85.50  ? 140  LEU C CB  1 
ATOM   9543  C  CG  . LEU B 2 146  ? 50.388  33.153  63.927  1.00 85.70  ? 140  LEU C CG  1 
ATOM   9544  C  CD1 . LEU B 2 146  ? 51.712  33.873  64.136  1.00 87.04  ? 140  LEU C CD1 1 
ATOM   9545  C  CD2 . LEU B 2 146  ? 50.484  32.179  62.758  1.00 85.75  ? 140  LEU C CD2 1 
ATOM   9546  N  N   . THR B 2 147  ? 46.996  32.479  63.662  1.00 78.04  ? 141  THR C N   1 
ATOM   9547  C  CA  . THR B 2 147  ? 46.119  31.888  62.662  1.00 77.21  ? 141  THR C CA  1 
ATOM   9548  C  C   . THR B 2 147  ? 46.316  32.621  61.340  1.00 77.22  ? 141  THR C C   1 
ATOM   9549  O  O   . THR B 2 147  ? 46.439  33.842  61.317  1.00 78.12  ? 141  THR C O   1 
ATOM   9550  C  CB  . THR B 2 147  ? 44.648  31.916  63.104  1.00 75.79  ? 141  THR C CB  1 
ATOM   9551  O  OG1 . THR B 2 147  ? 44.526  31.108  64.273  1.00 77.84  ? 141  THR C OG1 1 
ATOM   9552  C  CG2 . THR B 2 147  ? 43.683  31.389  62.065  1.00 74.29  ? 141  THR C CG2 1 
ATOM   9553  N  N   . VAL B 2 148  ? 46.349  31.854  60.248  1.00 76.71  ? 142  VAL C N   1 
ATOM   9554  C  CA  . VAL B 2 148  ? 46.482  32.416  58.917  1.00 76.50  ? 142  VAL C CA  1 
ATOM   9555  C  C   . VAL B 2 148  ? 45.177  32.159  58.178  1.00 75.99  ? 142  VAL C C   1 
ATOM   9556  O  O   . VAL B 2 148  ? 44.612  31.074  58.294  1.00 76.34  ? 142  VAL C O   1 
ATOM   9557  C  CB  . VAL B 2 148  ? 47.666  31.769  58.178  1.00 77.48  ? 142  VAL C CB  1 
ATOM   9558  C  CG1 . VAL B 2 148  ? 47.688  32.141  56.708  1.00 77.67  ? 142  VAL C CG1 1 
ATOM   9559  C  CG2 . VAL B 2 148  ? 48.991  32.106  58.842  1.00 79.34  ? 142  VAL C CG2 1 
ATOM   9560  N  N   . CYS B 2 149  ? 44.714  33.152  57.414  1.00 75.94  ? 143  CYS C N   1 
ATOM   9561  C  CA  . CYS B 2 149  ? 43.494  32.970  56.647  1.00 75.54  ? 143  CYS C CA  1 
ATOM   9562  C  C   . CYS B 2 149  ? 43.711  33.377  55.196  1.00 76.85  ? 143  CYS C C   1 
ATOM   9563  O  O   . CYS B 2 149  ? 44.481  34.297  54.926  1.00 78.40  ? 143  CYS C O   1 
ATOM   9564  C  CB  . CYS B 2 149  ? 42.360  33.793  57.235  1.00 74.71  ? 143  CYS C CB  1 
ATOM   9565  S  SG  . CYS B 2 149  ? 41.863  33.212  58.873  1.00 75.13  ? 143  CYS C SG  1 
ATOM   9566  N  N   . GLU B 2 150  ? 43.034  32.656  54.290  1.00 76.45  ? 144  GLU C N   1 
ATOM   9567  C  CA  . GLU B 2 150  ? 42.858  33.053  52.902  1.00 77.16  ? 144  GLU C CA  1 
ATOM   9568  C  C   . GLU B 2 150  ? 41.415  33.520  52.727  1.00 75.65  ? 144  GLU C C   1 
ATOM   9569  O  O   . GLU B 2 150  ? 40.500  32.952  53.321  1.00 73.17  ? 144  GLU C O   1 
ATOM   9570  C  CB  . GLU B 2 150  ? 43.086  31.872  51.953  1.00 79.36  ? 144  GLU C CB  1 
ATOM   9571  C  CG  . GLU B 2 150  ? 44.407  31.139  52.134  1.00 81.78  ? 144  GLU C CG  1 
ATOM   9572  C  CD  . GLU B 2 150  ? 44.611  29.972  51.172  1.00 84.47  ? 144  GLU C CD  1 
ATOM   9573  O  OE1 . GLU B 2 150  ? 44.481  28.801  51.609  1.00 83.79  ? 144  GLU C OE1 1 
ATOM   9574  O  OE2 . GLU B 2 150  ? 44.904  30.230  49.982  1.00 86.60  ? 144  GLU C OE2 1 
ATOM   9575  N  N   . TRP B 2 151  ? 41.229  34.551  51.895  1.00 76.39  ? 145  TRP C N   1 
ATOM   9576  C  CA  . TRP B 2 151  ? 39.910  35.045  51.524  1.00 75.80  ? 145  TRP C CA  1 
ATOM   9577  C  C   . TRP B 2 151  ? 39.216  34.048  50.592  1.00 75.71  ? 145  TRP C C   1 
ATOM   9578  O  O   . TRP B 2 151  ? 39.852  33.148  50.041  1.00 75.45  ? 145  TRP C O   1 
ATOM   9579  C  CB  . TRP B 2 151  ? 40.005  36.448  50.899  1.00 77.30  ? 145  TRP C CB  1 
ATOM   9580  C  CG  . TRP B 2 151  ? 40.158  37.572  51.882  1.00 76.98  ? 145  TRP C CG  1 
ATOM   9581  C  CD1 . TRP B 2 151  ? 39.163  38.188  52.585  1.00 76.09  ? 145  TRP C CD1 1 
ATOM   9582  C  CD2 . TRP B 2 151  ? 41.380  38.236  52.263  1.00 77.75  ? 145  TRP C CD2 1 
ATOM   9583  N  NE1 . TRP B 2 151  ? 39.679  39.179  53.377  1.00 76.19  ? 145  TRP C NE1 1 
ATOM   9584  C  CE2 . TRP B 2 151  ? 41.036  39.231  53.206  1.00 77.25  ? 145  TRP C CE2 1 
ATOM   9585  C  CE3 . TRP B 2 151  ? 42.729  38.086  51.913  1.00 79.38  ? 145  TRP C CE3 1 
ATOM   9586  C  CZ2 . TRP B 2 151  ? 41.990  40.062  53.799  1.00 77.65  ? 145  TRP C CZ2 1 
ATOM   9587  C  CZ3 . TRP B 2 151  ? 43.672  38.905  52.501  1.00 79.58  ? 145  TRP C CZ3 1 
ATOM   9588  C  CH2 . TRP B 2 151  ? 43.304  39.882  53.428  1.00 78.76  ? 145  TRP C CH2 1 
ATOM   9589  N  N   . PRO B 2 152  ? 37.882  34.175  50.398  1.00 75.26  ? 146  PRO C N   1 
ATOM   9590  C  CA  . PRO B 2 152  ? 37.109  33.226  49.592  1.00 75.89  ? 146  PRO C CA  1 
ATOM   9591  C  C   . PRO B 2 152  ? 37.494  33.118  48.120  1.00 77.77  ? 146  PRO C C   1 
ATOM   9592  O  O   . PRO B 2 152  ? 37.523  32.021  47.575  1.00 78.07  ? 146  PRO C O   1 
ATOM   9593  C  CB  . PRO B 2 152  ? 35.679  33.778  49.671  1.00 75.55  ? 146  PRO C CB  1 
ATOM   9594  C  CG  . PRO B 2 152  ? 35.666  34.576  50.952  1.00 74.09  ? 146  PRO C CG  1 
ATOM   9595  C  CD  . PRO B 2 152  ? 37.035  35.216  51.001  1.00 73.96  ? 146  PRO C CD  1 
ATOM   9596  N  N   . SER B 2 153  ? 37.755  34.262  47.480  1.00 79.98  ? 147  SER C N   1 
ATOM   9597  C  CA  . SER B 2 153  ? 37.970  34.288  46.044  1.00 83.65  ? 147  SER C CA  1 
ATOM   9598  C  C   . SER B 2 153  ? 39.155  35.184  45.680  1.00 85.65  ? 147  SER C C   1 
ATOM   9599  O  O   . SER B 2 153  ? 39.233  35.694  44.562  1.00 89.14  ? 147  SER C O   1 
ATOM   9600  C  CB  . SER B 2 153  ? 36.710  34.711  45.339  1.00 85.52  ? 147  SER C CB  1 
ATOM   9601  O  OG  . SER B 2 153  ? 36.806  34.448  43.948  1.00 89.65  ? 147  SER C OG  1 
ATOM   9602  N  N   . ASP B 2 154  ? 40.090  35.353  46.624  1.00 83.90  ? 148  ASP C N   1 
ATOM   9603  C  CA  . ASP B 2 154  ? 41.231  36.228  46.421  1.00 84.06  ? 148  ASP C CA  1 
ATOM   9604  C  C   . ASP B 2 154  ? 42.493  35.553  46.947  1.00 83.52  ? 148  ASP C C   1 
ATOM   9605  O  O   . ASP B 2 154  ? 42.730  35.514  48.154  1.00 82.50  ? 148  ASP C O   1 
ATOM   9606  C  CB  . ASP B 2 154  ? 41.000  37.598  47.062  1.00 83.85  ? 148  ASP C CB  1 
ATOM   9607  C  CG  . ASP B 2 154  ? 42.198  38.532  46.992  1.00 85.54  ? 148  ASP C CG  1 
ATOM   9608  O  OD1 . ASP B 2 154  ? 43.192  38.186  46.318  1.00 86.89  ? 148  ASP C OD1 1 
ATOM   9609  O  OD2 . ASP B 2 154  ? 42.126  39.604  47.614  1.00 86.01  ? 148  ASP C OD2 1 
ATOM   9610  N  N   . ALA B 2 155  ? 43.317  35.066  46.017  1.00 84.12  ? 149  ALA C N   1 
ATOM   9611  C  CA  . ALA B 2 155  ? 44.517  34.333  46.381  1.00 84.19  ? 149  ALA C CA  1 
ATOM   9612  C  C   . ALA B 2 155  ? 45.765  35.207  46.230  1.00 86.07  ? 149  ALA C C   1 
ATOM   9613  O  O   . ALA B 2 155  ? 46.873  34.680  46.138  1.00 87.07  ? 149  ALA C O   1 
ATOM   9614  C  CB  . ALA B 2 155  ? 44.599  33.074  45.552  1.00 84.36  ? 149  ALA C CB  1 
ATOM   9615  N  N   . SER B 2 156  ? 45.591  36.538  46.219  1.00 86.42  ? 150  SER C N   1 
ATOM   9616  C  CA  . SER B 2 156  ? 46.708  37.451  46.007  1.00 87.57  ? 150  SER C CA  1 
ATOM   9617  C  C   . SER B 2 156  ? 47.313  37.906  47.336  1.00 87.05  ? 150  SER C C   1 
ATOM   9618  O  O   . SER B 2 156  ? 48.499  38.217  47.400  1.00 88.37  ? 150  SER C O   1 
ATOM   9619  C  CB  . SER B 2 156  ? 46.325  38.623  45.138  1.00 88.55  ? 150  SER C CB  1 
ATOM   9620  O  OG  . SER B 2 156  ? 45.662  39.624  45.896  1.00 87.03  ? 150  SER C OG  1 
ATOM   9621  N  N   . LYS B 2 157  ? 46.487  37.964  48.387  1.00 86.01  ? 151  LYS C N   1 
ATOM   9622  C  CA  . LYS B 2 157  ? 46.955  38.298  49.724  1.00 85.16  ? 151  LYS C CA  1 
ATOM   9623  C  C   . LYS B 2 157  ? 46.454  37.263  50.726  1.00 82.69  ? 151  LYS C C   1 
ATOM   9624  O  O   . LYS B 2 157  ? 45.401  36.655  50.545  1.00 82.55  ? 151  LYS C O   1 
ATOM   9625  C  CB  . LYS B 2 157  ? 46.423  39.653  50.198  1.00 85.80  ? 151  LYS C CB  1 
ATOM   9626  C  CG  . LYS B 2 157  ? 46.451  40.775  49.175  1.00 89.36  ? 151  LYS C CG  1 
ATOM   9627  C  CD  . LYS B 2 157  ? 45.086  41.092  48.631  1.00 89.00  ? 151  LYS C CD  1 
ATOM   9628  C  CE  . LYS B 2 157  ? 44.231  41.836  49.633  1.00 88.01  ? 151  LYS C CE  1 
ATOM   9629  N  NZ  . LYS B 2 157  ? 43.094  42.503  48.962  1.00 89.27  ? 151  LYS C NZ  1 
ATOM   9630  N  N   . VAL B 2 158  ? 47.214  37.113  51.808  1.00 81.11  ? 152  VAL C N   1 
ATOM   9631  C  CA  . VAL B 2 158  ? 46.825  36.272  52.922  1.00 78.43  ? 152  VAL C CA  1 
ATOM   9632  C  C   . VAL B 2 158  ? 46.798  37.146  54.171  1.00 77.54  ? 152  VAL C C   1 
ATOM   9633  O  O   . VAL B 2 158  ? 47.317  38.260  54.157  1.00 79.20  ? 152  VAL C O   1 
ATOM   9634  C  CB  . VAL B 2 158  ? 47.773  35.064  53.025  1.00 79.07  ? 152  VAL C CB  1 
ATOM   9635  C  CG1 . VAL B 2 158  ? 47.754  34.414  54.394  1.00 78.22  ? 152  VAL C CG1 1 
ATOM   9636  C  CG2 . VAL B 2 158  ? 47.450  34.045  51.941  1.00 79.63  ? 152  VAL C CG2 1 
ATOM   9637  N  N   . ILE B 2 159  ? 46.155  36.657  55.235  1.00 75.34  ? 153  ILE C N   1 
ATOM   9638  C  CA  . ILE B 2 159  ? 45.959  37.475  56.421  1.00 74.53  ? 153  ILE C CA  1 
ATOM   9639  C  C   . ILE B 2 159  ? 46.119  36.618  57.675  1.00 73.38  ? 153  ILE C C   1 
ATOM   9640  O  O   . ILE B 2 159  ? 45.585  35.508  57.744  1.00 72.03  ? 153  ILE C O   1 
ATOM   9641  C  CB  . ILE B 2 159  ? 44.615  38.235  56.356  1.00 73.85  ? 153  ILE C CB  1 
ATOM   9642  C  CG1 . ILE B 2 159  ? 44.447  39.226  57.512  1.00 73.43  ? 153  ILE C CG1 1 
ATOM   9643  C  CG2 . ILE B 2 159  ? 43.439  37.276  56.250  1.00 73.11  ? 153  ILE C CG2 1 
ATOM   9644  C  CD1 . ILE B 2 159  ? 43.491  40.358  57.216  1.00 72.74  ? 153  ILE C CD1 1 
ATOM   9645  N  N   . VAL B 2 160  ? 46.860  37.172  58.649  1.00 73.50  ? 154  VAL C N   1 
ATOM   9646  C  CA  . VAL B 2 160  ? 47.328  36.477  59.843  1.00 73.71  ? 154  VAL C CA  1 
ATOM   9647  C  C   . VAL B 2 160  ? 46.800  37.218  61.067  1.00 73.15  ? 154  VAL C C   1 
ATOM   9648  O  O   . VAL B 2 160  ? 46.741  38.441  61.050  1.00 74.49  ? 154  VAL C O   1 
ATOM   9649  C  CB  . VAL B 2 160  ? 48.870  36.396  59.886  1.00 75.48  ? 154  VAL C CB  1 
ATOM   9650  C  CG1 . VAL B 2 160  ? 49.363  35.508  61.017  1.00 75.69  ? 154  VAL C CG1 1 
ATOM   9651  C  CG2 . VAL B 2 160  ? 49.479  35.942  58.567  1.00 76.09  ? 154  VAL C CG2 1 
ATOM   9652  N  N   . PHE B 2 161  ? 46.437  36.472  62.121  1.00 72.56  ? 155  PHE C N   1 
ATOM   9653  C  CA  . PHE B 2 161  ? 45.899  37.034  63.353  1.00 72.76  ? 155  PHE C CA  1 
ATOM   9654  C  C   . PHE B 2 161  ? 46.684  36.503  64.548  1.00 74.08  ? 155  PHE C C   1 
ATOM   9655  O  O   . PHE B 2 161  ? 46.884  35.297  64.661  1.00 74.26  ? 155  PHE C O   1 
ATOM   9656  C  CB  . PHE B 2 161  ? 44.439  36.617  63.562  1.00 71.33  ? 155  PHE C CB  1 
ATOM   9657  C  CG  . PHE B 2 161  ? 43.438  37.188  62.588  1.00 70.99  ? 155  PHE C CG  1 
ATOM   9658  C  CD1 . PHE B 2 161  ? 42.890  38.450  62.773  1.00 70.91  ? 155  PHE C CD1 1 
ATOM   9659  C  CD2 . PHE B 2 161  ? 43.015  36.446  61.495  1.00 70.75  ? 155  PHE C CD2 1 
ATOM   9660  C  CE1 . PHE B 2 161  ? 41.965  38.966  61.875  1.00 69.82  ? 155  PHE C CE1 1 
ATOM   9661  C  CE2 . PHE B 2 161  ? 42.089  36.963  60.600  1.00 70.31  ? 155  PHE C CE2 1 
ATOM   9662  C  CZ  . PHE B 2 161  ? 41.569  38.224  60.787  1.00 69.33  ? 155  PHE C CZ  1 
ATOM   9663  N  N   . GLY B 2 162  ? 47.105  37.405  65.443  1.00 75.12  ? 156  GLY C N   1 
ATOM   9664  C  CA  . GLY B 2 162  ? 47.759  37.012  66.680  1.00 76.66  ? 156  GLY C CA  1 
ATOM   9665  C  C   . GLY B 2 162  ? 47.018  37.565  67.893  1.00 77.14  ? 156  GLY C C   1 
ATOM   9666  O  O   . GLY B 2 162  ? 46.650  38.733  67.902  1.00 77.35  ? 156  GLY C O   1 
ATOM   9667  N  N   . PHE B 2 163  ? 46.813  36.720  68.909  1.00 78.48  ? 157  PHE C N   1 
ATOM   9668  C  CA  . PHE B 2 163  ? 46.017  37.101  70.066  1.00 80.61  ? 157  PHE C CA  1 
ATOM   9669  C  C   . PHE B 2 163  ? 46.789  36.824  71.353  1.00 82.64  ? 157  PHE C C   1 
ATOM   9670  O  O   . PHE B 2 163  ? 47.723  36.029  71.361  1.00 82.45  ? 157  PHE C O   1 
ATOM   9671  C  CB  . PHE B 2 163  ? 44.655  36.388  70.086  1.00 80.82  ? 157  PHE C CB  1 
ATOM   9672  C  CG  . PHE B 2 163  ? 43.830  36.477  68.823  1.00 80.84  ? 157  PHE C CG  1 
ATOM   9673  C  CD1 . PHE B 2 163  ? 43.269  37.682  68.407  1.00 81.18  ? 157  PHE C CD1 1 
ATOM   9674  C  CD2 . PHE B 2 163  ? 43.592  35.344  68.051  1.00 80.90  ? 157  PHE C CD2 1 
ATOM   9675  C  CE1 . PHE B 2 163  ? 42.511  37.751  67.240  1.00 80.35  ? 157  PHE C CE1 1 
ATOM   9676  C  CE2 . PHE B 2 163  ? 42.840  35.415  66.883  1.00 79.02  ? 157  PHE C CE2 1 
ATOM   9677  C  CZ  . PHE B 2 163  ? 42.299  36.619  66.478  1.00 78.63  ? 157  PHE C CZ  1 
ATOM   9678  N  N   . ASN B 2 164  ? 46.348  37.486  72.433  1.00 85.35  ? 158  ASN C N   1 
ATOM   9679  C  CA  . ASN B 2 164  ? 46.853  37.340  73.789  1.00 89.37  ? 158  ASN C CA  1 
ATOM   9680  C  C   . ASN B 2 164  ? 48.308  37.812  73.850  1.00 91.39  ? 158  ASN C C   1 
ATOM   9681  O  O   . ASN B 2 164  ? 48.485  39.002  74.161  1.00 92.40  ? 158  ASN C O   1 
ATOM   9682  C  CB  . ASN B 2 164  ? 46.612  35.941  74.368  1.00 92.16  ? 158  ASN C CB  1 
ATOM   9683  C  CG  . ASN B 2 164  ? 46.827  35.863  75.866  1.00 96.98  ? 158  ASN C CG  1 
ATOM   9684  O  OD1 . ASN B 2 164  ? 46.531  36.809  76.596  1.00 99.59  ? 158  ASN C OD1 1 
ATOM   9685  N  ND2 . ASN B 2 164  ? 47.326  34.734  76.340  1.00 99.89  ? 158  ASN C ND2 1 
ATOM   9686  N  N   . GLU B 2 181  ? 46.022  43.695  81.624  1.00 105.69 ? 175  GLU C N   1 
ATOM   9687  C  CA  . GLU B 2 181  ? 45.673  42.439  82.345  1.00 106.20 ? 175  GLU C CA  1 
ATOM   9688  C  C   . GLU B 2 181  ? 44.156  42.273  82.415  1.00 104.09 ? 175  GLU C C   1 
ATOM   9689  O  O   . GLU B 2 181  ? 43.656  41.215  82.797  1.00 103.53 ? 175  GLU C O   1 
ATOM   9690  C  CB  . GLU B 2 181  ? 46.352  42.388  83.715  1.00 110.41 ? 175  GLU C CB  1 
ATOM   9691  C  CG  . GLU B 2 181  ? 47.791  41.905  83.631  1.00 113.30 ? 175  GLU C CG  1 
ATOM   9692  C  CD  . GLU B 2 181  ? 48.512  41.674  84.950  1.00 118.22 ? 175  GLU C CD  1 
ATOM   9693  O  OE1 . GLU B 2 181  ? 49.699  41.288  84.903  1.00 120.85 ? 175  GLU C OE1 1 
ATOM   9694  O  OE2 . GLU B 2 181  ? 47.891  41.877  86.017  1.00 120.25 ? 175  GLU C OE2 1 
ATOM   9695  N  N   . ASN B 2 182  ? 43.431  43.336  82.052  1.00 103.48 ? 176  ASN C N   1 
ATOM   9696  C  CA  . ASN B 2 182  ? 42.034  43.200  81.682  1.00 99.30  ? 176  ASN C CA  1 
ATOM   9697  C  C   . ASN B 2 182  ? 41.836  43.788  80.286  1.00 95.20  ? 176  ASN C C   1 
ATOM   9698  O  O   . ASN B 2 182  ? 40.737  44.197  79.913  1.00 93.70  ? 176  ASN C O   1 
ATOM   9699  C  CB  . ASN B 2 182  ? 41.072  43.698  82.764  1.00 102.23 ? 176  ASN C CB  1 
ATOM   9700  C  CG  . ASN B 2 182  ? 39.798  42.876  82.762  1.00 103.27 ? 176  ASN C CG  1 
ATOM   9701  O  OD1 . ASN B 2 182  ? 39.855  41.645  82.786  1.00 103.62 ? 176  ASN C OD1 1 
ATOM   9702  N  ND2 . ASN B 2 182  ? 38.650  43.534  82.695  1.00 102.85 ? 176  ASN C ND2 1 
ATOM   9703  N  N   . HIS B 2 183  ? 42.934  43.820  79.528  1.00 93.69  ? 177  HIS C N   1 
ATOM   9704  C  CA  . HIS B 2 183  ? 42.904  44.113  78.107  1.00 91.07  ? 177  HIS C CA  1 
ATOM   9705  C  C   . HIS B 2 183  ? 43.305  42.847  77.350  1.00 88.30  ? 177  HIS C C   1 
ATOM   9706  O  O   . HIS B 2 183  ? 43.655  41.839  77.960  1.00 89.39  ? 177  HIS C O   1 
ATOM   9707  C  CB  . HIS B 2 183  ? 43.789  45.334  77.799  1.00 95.02  ? 177  HIS C CB  1 
ATOM   9708  C  CG  . HIS B 2 183  ? 43.240  46.634  78.301  1.00 97.77  ? 177  HIS C CG  1 
ATOM   9709  N  ND1 . HIS B 2 183  ? 43.360  47.035  79.625  1.00 100.41 ? 177  HIS C ND1 1 
ATOM   9710  C  CD2 . HIS B 2 183  ? 42.577  47.630  77.666  1.00 97.36  ? 177  HIS C CD2 1 
ATOM   9711  C  CE1 . HIS B 2 183  ? 42.783  48.214  79.782  1.00 101.11 ? 177  HIS C CE1 1 
ATOM   9712  N  NE2 . HIS B 2 183  ? 42.296  48.602  78.594  1.00 99.12  ? 177  HIS C NE2 1 
ATOM   9713  N  N   . ARG B 2 184  ? 43.206  42.889  76.021  1.00 84.08  ? 178  ARG C N   1 
ATOM   9714  C  CA  . ARG B 2 184  ? 43.764  41.848  75.178  1.00 81.92  ? 178  ARG C CA  1 
ATOM   9715  C  C   . ARG B 2 184  ? 44.311  42.526  73.930  1.00 82.65  ? 178  ARG C C   1 
ATOM   9716  O  O   . ARG B 2 184  ? 43.692  43.457  73.417  1.00 81.96  ? 178  ARG C O   1 
ATOM   9717  C  CB  . ARG B 2 184  ? 42.715  40.785  74.833  1.00 78.20  ? 178  ARG C CB  1 
ATOM   9718  C  CG  . ARG B 2 184  ? 43.087  39.911  73.641  1.00 75.88  ? 178  ARG C CG  1 
ATOM   9719  C  CD  . ARG B 2 184  ? 42.064  38.861  73.260  1.00 72.77  ? 178  ARG C CD  1 
ATOM   9720  N  NE  . ARG B 2 184  ? 41.820  37.915  74.340  1.00 72.58  ? 178  ARG C NE  1 
ATOM   9721  C  CZ  . ARG B 2 184  ? 40.792  37.080  74.397  1.00 70.72  ? 178  ARG C CZ  1 
ATOM   9722  N  NH1 . ARG B 2 184  ? 39.892  37.061  73.431  1.00 69.36  ? 178  ARG C NH1 1 
ATOM   9723  N  NH2 . ARG B 2 184  ? 40.664  36.267  75.425  1.00 71.08  ? 178  ARG C NH2 1 
ATOM   9724  N  N   . ASP B 2 185  ? 45.476  42.057  73.467  1.00 84.40  ? 179  ASP C N   1 
ATOM   9725  C  CA  . ASP B 2 185  ? 46.159  42.665  72.336  1.00 85.16  ? 179  ASP C CA  1 
ATOM   9726  C  C   . ASP B 2 185  ? 45.963  41.788  71.103  1.00 82.60  ? 179  ASP C C   1 
ATOM   9727  O  O   . ASP B 2 185  ? 46.096  40.571  71.189  1.00 82.98  ? 179  ASP C O   1 
ATOM   9728  C  CB  . ASP B 2 185  ? 47.635  42.918  72.659  1.00 88.80  ? 179  ASP C CB  1 
ATOM   9729  C  CG  . ASP B 2 185  ? 47.829  43.572  74.017  1.00 91.70  ? 179  ASP C CG  1 
ATOM   9730  O  OD1 . ASP B 2 185  ? 47.166  44.609  74.270  1.00 91.69  ? 179  ASP C OD1 1 
ATOM   9731  O  OD2 . ASP B 2 185  ? 48.623  43.030  74.818  1.00 93.67  ? 179  ASP C OD2 1 
ATOM   9732  N  N   . ILE B 2 186  ? 45.654  42.426  69.966  1.00 81.11  ? 180  ILE C N   1 
ATOM   9733  C  CA  . ILE B 2 186  ? 45.357  41.734  68.719  1.00 79.20  ? 180  ILE C CA  1 
ATOM   9734  C  C   . ILE B 2 186  ? 46.256  42.265  67.603  1.00 80.12  ? 180  ILE C C   1 
ATOM   9735  O  O   . ILE B 2 186  ? 46.220  43.450  67.279  1.00 81.62  ? 180  ILE C O   1 
ATOM   9736  C  CB  . ILE B 2 186  ? 43.862  41.868  68.363  1.00 76.98  ? 180  ILE C CB  1 
ATOM   9737  C  CG1 . ILE B 2 186  ? 42.989  41.121  69.373  1.00 76.38  ? 180  ILE C CG1 1 
ATOM   9738  C  CG2 . ILE B 2 186  ? 43.592  41.411  66.935  1.00 74.69  ? 180  ILE C CG2 1 
ATOM   9739  C  CD1 . ILE B 2 186  ? 41.642  41.754  69.598  1.00 76.38  ? 180  ILE C CD1 1 
ATOM   9740  N  N   . TYR B 2 187  ? 47.044  41.367  67.006  1.00 79.85  ? 181  TYR C N   1 
ATOM   9741  C  CA  . TYR B 2 187  ? 47.934  41.718  65.912  1.00 81.21  ? 181  TYR C CA  1 
ATOM   9742  C  C   . TYR B 2 187  ? 47.380  41.123  64.621  1.00 79.91  ? 181  TYR C C   1 
ATOM   9743  O  O   . TYR B 2 187  ? 46.846  40.014  64.633  1.00 78.99  ? 181  TYR C O   1 
ATOM   9744  C  CB  . TYR B 2 187  ? 49.358  41.241  66.211  1.00 83.27  ? 181  TYR C CB  1 
ATOM   9745  C  CG  . TYR B 2 187  ? 49.877  41.674  67.559  1.00 85.77  ? 181  TYR C CG  1 
ATOM   9746  C  CD1 . TYR B 2 187  ? 49.589  40.942  68.702  1.00 85.31  ? 181  TYR C CD1 1 
ATOM   9747  C  CD2 . TYR B 2 187  ? 50.634  42.830  67.699  1.00 88.65  ? 181  TYR C CD2 1 
ATOM   9748  C  CE1 . TYR B 2 187  ? 50.045  41.343  69.948  1.00 88.42  ? 181  TYR C CE1 1 
ATOM   9749  C  CE2 . TYR B 2 187  ? 51.103  43.242  68.938  1.00 91.35  ? 181  TYR C CE2 1 
ATOM   9750  C  CZ  . TYR B 2 187  ? 50.809  42.494  70.068  1.00 91.43  ? 181  TYR C CZ  1 
ATOM   9751  O  OH  . TYR B 2 187  ? 51.264  42.891  71.294  1.00 93.66  ? 181  TYR C OH  1 
ATOM   9752  N  N   . VAL B 2 188  ? 47.497  41.880  63.522  1.00 80.05  ? 182  VAL C N   1 
ATOM   9753  C  CA  . VAL B 2 188  ? 46.917  41.504  62.241  1.00 79.02  ? 182  VAL C CA  1 
ATOM   9754  C  C   . VAL B 2 188  ? 47.881  41.926  61.136  1.00 80.93  ? 182  VAL C C   1 
ATOM   9755  O  O   . VAL B 2 188  ? 48.284  43.085  61.095  1.00 83.83  ? 182  VAL C O   1 
ATOM   9756  C  CB  . VAL B 2 188  ? 45.531  42.154  62.031  1.00 77.96  ? 182  VAL C CB  1 
ATOM   9757  C  CG1 . VAL B 2 188  ? 44.899  41.746  60.708  1.00 76.58  ? 182  VAL C CG1 1 
ATOM   9758  C  CG2 . VAL B 2 188  ? 44.571  41.892  63.183  1.00 76.54  ? 182  VAL C CG2 1 
ATOM   9759  N  N   . SER B 2 189  ? 48.231  40.991  60.241  1.00 80.26  ? 183  SER C N   1 
ATOM   9760  C  CA  . SER B 2 189  ? 49.162  41.265  59.156  1.00 81.89  ? 183  SER C CA  1 
ATOM   9761  C  C   . SER B 2 189  ? 48.611  40.746  57.832  1.00 80.83  ? 183  SER C C   1 
ATOM   9762  O  O   . SER B 2 189  ? 48.145  39.612  57.754  1.00 79.81  ? 183  SER C O   1 
ATOM   9763  C  CB  . SER B 2 189  ? 50.525  40.675  59.431  1.00 83.85  ? 183  SER C CB  1 
ATOM   9764  O  OG  . SER B 2 189  ? 51.315  41.545  60.231  1.00 85.75  ? 183  SER C OG  1 
ATOM   9765  N  N   . THR B 2 190  ? 48.705  41.577  56.789  1.00 81.83  ? 184  THR C N   1 
ATOM   9766  C  CA  . THR B 2 190  ? 48.323  41.174  55.444  1.00 81.51  ? 184  THR C CA  1 
ATOM   9767  C  C   . THR B 2 190  ? 49.575  41.075  54.572  1.00 83.87  ? 184  THR C C   1 
ATOM   9768  O  O   . THR B 2 190  ? 50.229  42.083  54.308  1.00 86.28  ? 184  THR C O   1 
ATOM   9769  C  CB  . THR B 2 190  ? 47.244  42.107  54.874  1.00 80.85  ? 184  THR C CB  1 
ATOM   9770  O  OG1 . THR B 2 190  ? 46.221  42.295  55.853  1.00 78.66  ? 184  THR C OG1 1 
ATOM   9771  C  CG2 . THR B 2 190  ? 46.634  41.602  53.585  1.00 80.14  ? 184  THR C CG2 1 
ATOM   9772  N  N   . VAL B 2 191  ? 49.892  39.848  54.136  1.00 83.30  ? 185  VAL C N   1 
ATOM   9773  C  CA  . VAL B 2 191  ? 51.114  39.545  53.402  1.00 85.13  ? 185  VAL C CA  1 
ATOM   9774  C  C   . VAL B 2 191  ? 50.751  39.150  51.972  1.00 85.40  ? 185  VAL C C   1 
ATOM   9775  O  O   . VAL B 2 191  ? 49.832  38.365  51.750  1.00 83.80  ? 185  VAL C O   1 
ATOM   9776  C  CB  . VAL B 2 191  ? 51.939  38.435  54.089  1.00 84.67  ? 185  VAL C CB  1 
ATOM   9777  C  CG1 . VAL B 2 191  ? 53.260  38.175  53.381  1.00 86.74  ? 185  VAL C CG1 1 
ATOM   9778  C  CG2 . VAL B 2 191  ? 52.168  38.710  55.568  1.00 84.13  ? 185  VAL C CG2 1 
ATOM   9779  N  N   . ALA B 2 192  ? 51.499  39.696  51.008  1.00 87.96  ? 186  ALA C N   1 
ATOM   9780  C  CA  . ALA B 2 192  ? 51.308  39.368  49.606  1.00 88.78  ? 186  ALA C CA  1 
ATOM   9781  C  C   . ALA B 2 192  ? 51.630  37.894  49.377  1.00 88.31  ? 186  ALA C C   1 
ATOM   9782  O  O   . ALA B 2 192  ? 52.459  37.307  50.074  1.00 88.26  ? 186  ALA C O   1 
ATOM   9783  C  CB  . ALA B 2 192  ? 52.163  40.261  48.744  1.00 91.73  ? 186  ALA C CB  1 
ATOM   9784  N  N   . VAL B 2 193  ? 50.935  37.308  48.401  1.00 88.07  ? 187  VAL C N   1 
ATOM   9785  C  CA  . VAL B 2 193  ? 51.174  35.937  47.994  1.00 87.66  ? 187  VAL C CA  1 
ATOM   9786  C  C   . VAL B 2 193  ? 52.218  35.963  46.885  1.00 90.15  ? 187  VAL C C   1 
ATOM   9787  O  O   . VAL B 2 193  ? 52.145  36.798  45.986  1.00 91.41  ? 187  VAL C O   1 
ATOM   9788  C  CB  . VAL B 2 193  ? 49.873  35.241  47.543  1.00 86.15  ? 187  VAL C CB  1 
ATOM   9789  C  CG1 . VAL B 2 193  ? 50.126  34.044  46.636  1.00 86.60  ? 187  VAL C CG1 1 
ATOM   9790  C  CG2 . VAL B 2 193  ? 48.999  34.852  48.726  1.00 83.31  ? 187  VAL C CG2 1 
ATOM   9791  N  N   . PRO B 2 194  ? 53.208  35.045  46.928  1.00 91.00  ? 188  PRO C N   1 
ATOM   9792  C  CA  . PRO B 2 194  ? 54.196  34.911  45.860  1.00 93.83  ? 188  PRO C CA  1 
ATOM   9793  C  C   . PRO B 2 194  ? 53.552  34.932  44.478  1.00 95.32  ? 188  PRO C C   1 
ATOM   9794  O  O   . PRO B 2 194  ? 52.417  34.486  44.311  1.00 93.86  ? 188  PRO C O   1 
ATOM   9795  C  CB  . PRO B 2 194  ? 54.768  33.513  46.126  1.00 93.82  ? 188  PRO C CB  1 
ATOM   9796  C  CG  . PRO B 2 194  ? 54.701  33.374  47.628  1.00 91.99  ? 188  PRO C CG  1 
ATOM   9797  C  CD  . PRO B 2 194  ? 53.417  34.075  48.016  1.00 90.08  ? 188  PRO C CD  1 
ATOM   9798  N  N   . PRO B 2 195  ? 54.254  35.454  43.445  1.00 99.12  ? 189  PRO C N   1 
ATOM   9799  C  CA  . PRO B 2 195  ? 53.708  35.489  42.089  1.00 100.55 ? 189  PRO C CA  1 
ATOM   9800  C  C   . PRO B 2 195  ? 53.455  34.071  41.587  1.00 100.19 ? 189  PRO C C   1 
ATOM   9801  O  O   . PRO B 2 195  ? 54.309  33.197  41.739  1.00 100.25 ? 189  PRO C O   1 
ATOM   9802  C  CB  . PRO B 2 195  ? 54.811  36.169  41.262  1.00 103.92 ? 189  PRO C CB  1 
ATOM   9803  C  CG  . PRO B 2 195  ? 56.075  35.969  42.075  1.00 104.20 ? 189  PRO C CG  1 
ATOM   9804  C  CD  . PRO B 2 195  ? 55.615  36.014  43.518  1.00 101.48 ? 189  PRO C CD  1 
ATOM   9805  N  N   . PRO B 2 196  ? 52.264  33.801  41.005  1.00 99.53  ? 190  PRO C N   1 
ATOM   9806  C  CA  . PRO B 2 196  ? 51.961  32.490  40.432  1.00 99.69  ? 190  PRO C CA  1 
ATOM   9807  C  C   . PRO B 2 196  ? 53.069  31.979  39.516  1.00 102.50 ? 190  PRO C C   1 
ATOM   9808  O  O   . PRO B 2 196  ? 53.532  30.858  39.692  1.00 102.92 ? 190  PRO C O   1 
ATOM   9809  C  CB  . PRO B 2 196  ? 50.681  32.752  39.625  1.00 99.86  ? 190  PRO C CB  1 
ATOM   9810  C  CG  . PRO B 2 196  ? 50.005  33.885  40.369  1.00 98.14  ? 190  PRO C CG  1 
ATOM   9811  C  CD  . PRO B 2 196  ? 51.137  34.743  40.893  1.00 98.46  ? 190  PRO C CD  1 
ATOM   9812  N  N   . GLY B 2 197  ? 53.500  32.815  38.562  1.00 105.21 ? 191  GLY C N   1 
ATOM   9813  C  CA  . GLY B 2 197  ? 54.431  32.375  37.533  1.00 108.87 ? 191  GLY C CA  1 
ATOM   9814  C  C   . GLY B 2 197  ? 55.616  33.320  37.352  1.00 111.25 ? 191  GLY C C   1 
ATOM   9815  O  O   . GLY B 2 197  ? 56.673  33.120  37.945  1.00 112.59 ? 191  GLY C O   1 
ATOM   9816  N  N   . ARG B 2 198  ? 55.427  34.325  36.493  1.00 112.22 ? 192  ARG C N   1 
ATOM   9817  C  CA  . ARG B 2 198  ? 56.438  35.320  36.185  1.00 113.81 ? 192  ARG C CA  1 
ATOM   9818  C  C   . ARG B 2 198  ? 55.735  36.661  36.009  1.00 114.30 ? 192  ARG C C   1 
ATOM   9819  O  O   . ARG B 2 198  ? 55.027  36.864  35.025  1.00 116.32 ? 192  ARG C O   1 
ATOM   9820  C  CB  . ARG B 2 198  ? 57.175  34.916  34.906  1.00 116.61 ? 192  ARG C CB  1 
ATOM   9821  C  CG  . ARG B 2 198  ? 58.097  35.986  34.345  1.00 120.05 ? 192  ARG C CG  1 
ATOM   9822  C  CD  . ARG B 2 198  ? 58.783  35.462  33.102  1.00 123.68 ? 192  ARG C CD  1 
ATOM   9823  N  NE  . ARG B 2 198  ? 57.825  34.999  32.109  1.00 124.26 ? 192  ARG C NE  1 
ATOM   9824  C  CZ  . ARG B 2 198  ? 57.363  35.732  31.104  1.00 126.61 ? 192  ARG C CZ  1 
ATOM   9825  N  NH1 . ARG B 2 198  ? 57.779  36.976  30.941  1.00 128.76 ? 192  ARG C NH1 1 
ATOM   9826  N  NH2 . ARG B 2 198  ? 56.491  35.214  30.258  1.00 127.15 ? 192  ARG C NH2 1 
ATOM   9827  N  N   . CYS B 2 199  ? 55.932  37.570  36.969  1.00 113.03 ? 193  CYS C N   1 
ATOM   9828  C  CA  . CYS B 2 199  ? 55.262  38.860  36.942  1.00 112.72 ? 193  CYS C CA  1 
ATOM   9829  C  C   . CYS B 2 199  ? 56.119  39.857  36.170  1.00 116.92 ? 193  CYS C C   1 
ATOM   9830  O  O   . CYS B 2 199  ? 57.270  40.097  36.530  1.00 118.62 ? 193  CYS C O   1 
ATOM   9831  C  CB  . CYS B 2 199  ? 55.006  39.364  38.355  1.00 109.23 ? 193  CYS C CB  1 
ATOM   9832  S  SG  . CYS B 2 199  ? 54.147  40.956  38.407  1.00 109.12 ? 193  CYS C SG  1 
ATOM   9833  N  N   . ALA B 2 200  ? 55.546  40.419  35.099  1.00 119.11 ? 194  ALA C N   1 
ATOM   9834  C  CA  . ALA B 2 200  ? 56.247  41.382  34.265  1.00 122.98 ? 194  ALA C CA  1 
ATOM   9835  C  C   . ALA B 2 200  ? 56.703  42.575  35.106  1.00 123.30 ? 194  ALA C C   1 
ATOM   9836  O  O   . ALA B 2 200  ? 57.838  43.033  34.975  1.00 125.61 ? 194  ALA C O   1 
ATOM   9837  C  CB  . ALA B 2 200  ? 55.363  41.804  33.117  1.00 124.82 ? 194  ALA C CB  1 
ATOM   9838  N  N   . ALA B 2 201  ? 55.800  43.066  35.964  1.00 120.78 ? 195  ALA C N   1 
ATOM   9839  C  CA  . ALA B 2 201  ? 56.086  44.157  36.879  1.00 121.11 ? 195  ALA C CA  1 
ATOM   9840  C  C   . ALA B 2 201  ? 57.199  43.766  37.854  1.00 120.30 ? 195  ALA C C   1 
ATOM   9841  O  O   . ALA B 2 201  ? 58.075  44.580  38.137  1.00 122.55 ? 195  ALA C O   1 
ATOM   9842  C  CB  . ALA B 2 201  ? 54.822  44.573  37.590  1.00 118.35 ? 195  ALA C CB  1 
ATOM   9843  N  N   . CYS B 2 202  ? 57.157  42.519  38.355  1.00 117.61 ? 196  CYS C N   1 
ATOM   9844  C  CA  . CYS B 2 202  ? 58.158  41.995  39.278  1.00 116.79 ? 196  CYS C CA  1 
ATOM   9845  C  C   . CYS B 2 202  ? 59.523  41.948  38.599  1.00 120.44 ? 196  CYS C C   1 
ATOM   9846  O  O   . CYS B 2 202  ? 60.541  42.192  39.244  1.00 121.62 ? 196  CYS C O   1 
ATOM   9847  C  CB  . CYS B 2 202  ? 57.837  40.577  39.745  1.00 113.42 ? 196  CYS C CB  1 
ATOM   9848  S  SG  . CYS B 2 202  ? 56.736  40.472  41.181  1.00 110.24 ? 196  CYS C SG  1 
ATOM   9849  N  N   . GLN B 2 203  ? 59.533  41.604  37.304  1.00 122.43 ? 197  GLN C N   1 
ATOM   9850  C  CA  . GLN B 2 203  ? 60.754  41.576  36.515  1.00 126.04 ? 197  GLN C CA  1 
ATOM   9851  C  C   . GLN B 2 203  ? 61.314  42.989  36.396  1.00 130.26 ? 197  GLN C C   1 
ATOM   9852  O  O   . GLN B 2 203  ? 62.529  43.179  36.424  1.00 132.94 ? 197  GLN C O   1 
ATOM   9853  C  CB  . GLN B 2 203  ? 60.471  41.101  35.092  1.00 126.97 ? 197  GLN C CB  1 
ATOM   9854  C  CG  . GLN B 2 203  ? 60.276  39.604  34.941  1.00 124.02 ? 197  GLN C CG  1 
ATOM   9855  C  CD  . GLN B 2 203  ? 59.974  39.288  33.498  1.00 125.92 ? 197  GLN C CD  1 
ATOM   9856  O  OE1 . GLN B 2 203  ? 60.391  38.264  32.966  1.00 126.31 ? 197  GLN C OE1 1 
ATOM   9857  N  NE2 . GLN B 2 203  ? 59.259  40.189  32.844  1.00 127.34 ? 197  GLN C NE2 1 
ATOM   9858  N  N   . ASP B 2 204  ? 60.408  43.962  36.230  1.00 131.36 ? 198  ASP C N   1 
ATOM   9859  C  CA  . ASP B 2 204  ? 60.767  45.369  36.156  1.00 134.95 ? 198  ASP C CA  1 
ATOM   9860  C  C   . ASP B 2 204  ? 61.401  45.801  37.476  1.00 134.46 ? 198  ASP C C   1 
ATOM   9861  O  O   . ASP B 2 204  ? 62.285  46.652  37.487  1.00 138.08 ? 198  ASP C O   1 
ATOM   9862  C  CB  . ASP B 2 204  ? 59.566  46.241  35.776  1.00 134.97 ? 198  ASP C CB  1 
ATOM   9863  C  CG  . ASP B 2 204  ? 59.185  46.146  34.307  1.00 137.25 ? 198  ASP C CG  1 
ATOM   9864  O  OD1 . ASP B 2 204  ? 60.106  46.051  33.463  1.00 140.28 ? 198  ASP C OD1 1 
ATOM   9865  O  OD2 . ASP B 2 204  ? 57.972  46.166  34.017  1.00 135.65 ? 198  ASP C OD2 1 
ATOM   9866  N  N   . ALA B 2 205  ? 60.950  45.191  38.579  1.00 130.50 ? 199  ALA C N   1 
ATOM   9867  C  CA  . ALA B 2 205  ? 61.465  45.486  39.907  1.00 130.10 ? 199  ALA C CA  1 
ATOM   9868  C  C   . ALA B 2 205  ? 62.879  44.931  40.079  1.00 132.26 ? 199  ALA C C   1 
ATOM   9869  O  O   . ALA B 2 205  ? 63.612  45.382  40.957  1.00 133.64 ? 199  ALA C O   1 
ATOM   9870  C  CB  . ALA B 2 205  ? 60.525  44.962  40.966  1.00 125.57 ? 199  ALA C CB  1 
ATOM   9871  N  N   . SER B 2 206  ? 63.245  43.947  39.247  1.00 133.17 ? 200  SER C N   1 
ATOM   9872  C  CA  . SER B 2 206  ? 64.591  43.393  39.239  1.00 135.54 ? 200  SER C CA  1 
ATOM   9873  C  C   . SER B 2 206  ? 65.360  43.877  38.012  1.00 140.52 ? 200  SER C C   1 
ATOM   9874  O  O   . SER B 2 206  ? 66.502  43.472  37.799  1.00 143.09 ? 200  SER C O   1 
ATOM   9875  C  CB  . SER B 2 206  ? 64.577  41.889  39.327  1.00 133.12 ? 200  SER C CB  1 
ATOM   9876  O  OG  . SER B 2 206  ? 64.435  41.470  40.676  1.00 131.04 ? 200  SER C OG  1 
ATOM   9877  N  N   . ARG B 2 207  ? 64.724  44.750  37.219  1.00 142.69 ? 201  ARG C N   1 
ATOM   9878  C  CA  . ARG B 2 207  ? 65.362  45.339  36.051  1.00 147.96 ? 201  ARG C CA  1 
ATOM   9879  C  C   . ARG B 2 207  ? 65.520  46.846  36.244  1.00 151.22 ? 201  ARG C C   1 
ATOM   9880  O  O   . ARG B 2 207  ? 66.640  47.322  36.422  1.00 154.80 ? 201  ARG C O   1 
ATOM   9881  C  CB  . ARG B 2 207  ? 64.612  44.996  34.757  1.00 148.59 ? 201  ARG C CB  1 
ATOM   9882  C  CG  . ARG B 2 207  ? 65.344  45.420  33.490  1.00 154.07 ? 201  ARG C CG  1 
ATOM   9883  C  CD  . ARG B 2 207  ? 64.649  45.066  32.186  1.00 155.50 ? 201  ARG C CD  1 
ATOM   9884  N  NE  . ARG B 2 207  ? 63.277  45.557  32.096  1.00 155.00 ? 201  ARG C NE  1 
ATOM   9885  C  CZ  . ARG B 2 207  ? 62.903  46.727  31.577  1.00 158.62 ? 201  ARG C CZ  1 
ATOM   9886  N  NH1 . ARG B 2 207  ? 63.802  47.563  31.080  1.00 163.51 ? 201  ARG C NH1 1 
ATOM   9887  N  NH2 . ARG B 2 207  ? 61.621  47.046  31.555  1.00 157.14 ? 201  ARG C NH2 1 
ATOM   9888  N  N   . ALA B 2 208  ? 64.395  47.579  36.195  1.00 150.73 ? 202  ALA C N   1 
ATOM   9889  C  CA  . ALA B 2 208  ? 64.369  49.031  36.333  1.00 153.94 ? 202  ALA C CA  1 
ATOM   9890  C  C   . ALA B 2 208  ? 65.007  49.445  37.660  1.00 154.33 ? 202  ALA C C   1 
ATOM   9891  O  O   . ALA B 2 208  ? 65.681  50.474  37.736  1.00 158.27 ? 202  ALA C O   1 
ATOM   9892  C  CB  . ALA B 2 208  ? 62.952  49.540  36.199  1.00 151.78 ? 202  ALA C CB  1 
ATOM   9893  N  N   . HIS B 2 209  ? 64.763  48.623  38.693  1.00 150.12 ? 203  HIS C N   1 
ATOM   9894  C  CA  . HIS B 2 209  ? 65.484  48.616  39.958  1.00 149.67 ? 203  HIS C CA  1 
ATOM   9895  C  C   . HIS B 2 209  ? 66.427  47.409  39.962  1.00 149.24 ? 203  HIS C C   1 
ATOM   9896  O  O   . HIS B 2 209  ? 65.986  46.301  39.657  1.00 146.39 ? 203  HIS C O   1 
ATOM   9897  C  CB  . HIS B 2 209  ? 64.467  48.522  41.109  1.00 144.94 ? 203  HIS C CB  1 
ATOM   9898  C  CG  . HIS B 2 209  ? 65.006  48.880  42.455  1.00 145.64 ? 203  HIS C CG  1 
ATOM   9899  N  ND1 . HIS B 2 209  ? 66.160  48.317  42.967  1.00 147.06 ? 203  HIS C ND1 1 
ATOM   9900  C  CD2 . HIS B 2 209  ? 64.541  49.717  43.407  1.00 145.41 ? 203  HIS C CD2 1 
ATOM   9901  C  CE1 . HIS B 2 209  ? 66.396  48.807  44.166  1.00 147.32 ? 203  HIS C CE1 1 
ATOM   9902  N  NE2 . HIS B 2 209  ? 65.414  49.667  44.461  1.00 146.59 ? 203  HIS C NE2 1 
ATOM   9903  N  N   . PRO B 2 210  ? 67.743  47.559  40.274  1.00 152.11 ? 204  PRO C N   1 
ATOM   9904  C  CA  . PRO B 2 210  ? 68.666  46.417  40.318  1.00 151.92 ? 204  PRO C CA  1 
ATOM   9905  C  C   . PRO B 2 210  ? 68.282  45.302  41.290  1.00 147.90 ? 204  PRO C C   1 
ATOM   9906  O  O   . PRO B 2 210  ? 68.532  44.130  41.008  1.00 147.47 ? 204  PRO C O   1 
ATOM   9907  C  CB  . PRO B 2 210  ? 70.002  47.037  40.756  1.00 155.88 ? 204  PRO C CB  1 
ATOM   9908  C  CG  . PRO B 2 210  ? 69.892  48.486  40.333  1.00 159.37 ? 204  PRO C CG  1 
ATOM   9909  C  CD  . PRO B 2 210  ? 68.432  48.834  40.541  1.00 156.06 ? 204  PRO C CD  1 
ATOM   9910  N  N   . GLY B 2 211  ? 67.704  45.693  42.437  1.00 145.93 ? 205  GLY C N   1 
ATOM   9911  C  CA  . GLY B 2 211  ? 67.189  44.782  43.449  1.00 140.79 ? 205  GLY C CA  1 
ATOM   9912  C  C   . GLY B 2 211  ? 68.122  43.599  43.685  1.00 140.96 ? 205  GLY C C   1 
ATOM   9913  O  O   . GLY B 2 211  ? 69.317  43.779  43.925  1.00 144.55 ? 205  GLY C O   1 
ATOM   9914  N  N   . ASP B 2 212  ? 67.550  42.392  43.582  1.00 137.32 ? 206  ASP C N   1 
ATOM   9915  C  CA  . ASP B 2 212  ? 68.232  41.150  43.909  1.00 137.11 ? 206  ASP C CA  1 
ATOM   9916  C  C   . ASP B 2 212  ? 67.187  40.056  44.146  1.00 133.44 ? 206  ASP C C   1 
ATOM   9917  O  O   . ASP B 2 212  ? 66.002  40.256  43.871  1.00 131.07 ? 206  ASP C O   1 
ATOM   9918  C  CB  . ASP B 2 212  ? 69.152  41.337  45.124  1.00 138.17 ? 206  ASP C CB  1 
ATOM   9919  C  CG  . ASP B 2 212  ? 68.410  41.584  46.431  1.00 134.94 ? 206  ASP C CG  1 
ATOM   9920  O  OD1 . ASP B 2 212  ? 67.324  42.210  46.398  1.00 132.42 ? 206  ASP C OD1 1 
ATOM   9921  O  OD2 . ASP B 2 212  ? 68.924  41.143  47.478  1.00 134.73 ? 206  ASP C OD2 1 
ATOM   9922  N  N   . PRO B 2 213  ? 67.589  38.860  44.649  1.00 133.05 ? 207  PRO C N   1 
ATOM   9923  C  CA  . PRO B 2 213  ? 66.629  37.858  45.127  1.00 128.91 ? 207  PRO C CA  1 
ATOM   9924  C  C   . PRO B 2 213  ? 65.729  38.416  46.230  1.00 126.68 ? 207  PRO C C   1 
ATOM   9925  O  O   . PRO B 2 213  ? 66.219  38.977  47.207  1.00 127.13 ? 207  PRO C O   1 
ATOM   9926  C  CB  . PRO B 2 213  ? 67.510  36.729  45.693  1.00 129.27 ? 207  PRO C CB  1 
ATOM   9927  C  CG  . PRO B 2 213  ? 68.864  36.912  45.027  1.00 133.48 ? 207  PRO C CG  1 
ATOM   9928  C  CD  . PRO B 2 213  ? 68.985  38.394  44.737  1.00 135.98 ? 207  PRO C CD  1 
ATOM   9929  N  N   . ASN B 2 214  ? 64.410  38.261  46.038  1.00 125.73 ? 208  ASN C N   1 
ATOM   9930  C  CA  . ASN B 2 214  ? 63.346  38.665  46.958  1.00 124.44 ? 208  ASN C CA  1 
ATOM   9931  C  C   . ASN B 2 214  ? 62.837  40.080  46.656  1.00 123.99 ? 208  ASN C C   1 
ATOM   9932  O  O   . ASN B 2 214  ? 62.003  40.599  47.402  1.00 121.41 ? 208  ASN C O   1 
ATOM   9933  C  CB  . ASN B 2 214  ? 63.680  38.435  48.442  1.00 126.44 ? 208  ASN C CB  1 
ATOM   9934  C  CG  . ASN B 2 214  ? 63.992  36.995  48.793  1.00 127.37 ? 208  ASN C CG  1 
ATOM   9935  O  OD1 . ASN B 2 214  ? 63.682  36.076  48.033  1.00 127.72 ? 208  ASN C OD1 1 
ATOM   9936  N  ND2 . ASN B 2 214  ? 64.591  36.787  49.957  1.00 128.55 ? 208  ASN C ND2 1 
ATOM   9937  N  N   . ALA B 2 215  ? 63.324  40.691  45.562  1.00 125.23 ? 209  ALA C N   1 
ATOM   9938  C  CA  . ALA B 2 215  ? 62.820  41.980  45.103  1.00 124.81 ? 209  ALA C CA  1 
ATOM   9939  C  C   . ALA B 2 215  ? 61.626  41.768  44.171  1.00 122.62 ? 209  ALA C C   1 
ATOM   9940  O  O   . ALA B 2 215  ? 61.795  41.273  43.058  1.00 124.38 ? 209  ALA C O   1 
ATOM   9941  C  CB  . ALA B 2 215  ? 63.920  42.759  44.424  1.00 128.21 ? 209  ALA C CB  1 
ATOM   9942  N  N   . GLN B 2 216  ? 60.425  42.150  44.630  1.00 118.87 ? 210  GLN C N   1 
ATOM   9943  C  CA  . GLN B 2 216  ? 59.199  41.903  43.883  1.00 115.97 ? 210  GLN C CA  1 
ATOM   9944  C  C   . GLN B 2 216  ? 58.392  43.191  43.741  1.00 115.59 ? 210  GLN C C   1 
ATOM   9945  O  O   . GLN B 2 216  ? 58.601  44.139  44.495  1.00 116.42 ? 210  GLN C O   1 
ATOM   9946  C  CB  . GLN B 2 216  ? 58.357  40.809  44.546  1.00 112.22 ? 210  GLN C CB  1 
ATOM   9947  C  CG  . GLN B 2 216  ? 58.614  39.411  43.996  1.00 112.62 ? 210  GLN C CG  1 
ATOM   9948  C  CD  . GLN B 2 216  ? 59.605  38.624  44.818  1.00 113.19 ? 210  GLN C CD  1 
ATOM   9949  O  OE1 . GLN B 2 216  ? 59.799  38.878  46.006  1.00 113.06 ? 210  GLN C OE1 1 
ATOM   9950  N  NE2 . GLN B 2 216  ? 60.229  37.637  44.196  1.00 113.87 ? 210  GLN C NE2 1 
ATOM   9951  N  N   . CYS B 2 217  ? 57.474  43.199  42.763  1.00 114.33 ? 211  CYS C N   1 
ATOM   9952  C  CA  . CYS B 2 217  ? 56.584  44.321  42.501  1.00 114.12 ? 211  CYS C CA  1 
ATOM   9953  C  C   . CYS B 2 217  ? 55.651  44.520  43.694  1.00 110.58 ? 211  CYS C C   1 
ATOM   9954  O  O   . CYS B 2 217  ? 55.805  43.861  44.719  1.00 108.02 ? 211  CYS C O   1 
ATOM   9955  C  CB  . CYS B 2 217  ? 55.814  44.132  41.196  1.00 114.54 ? 211  CYS C CB  1 
ATOM   9956  S  SG  . CYS B 2 217  ? 54.144  43.446  41.376  1.00 110.38 ? 211  CYS C SG  1 
ATOM   9957  N  N   . LEU B 2 218  ? 54.693  45.442  43.557  1.00 110.73 ? 212  LEU C N   1 
ATOM   9958  C  CA  . LEU B 2 218  ? 53.883  45.853  44.692  1.00 108.79 ? 212  LEU C CA  1 
ATOM   9959  C  C   . LEU B 2 218  ? 52.844  44.785  45.037  1.00 105.24 ? 212  LEU C C   1 
ATOM   9960  O  O   . LEU B 2 218  ? 52.757  44.377  46.195  1.00 103.33 ? 212  LEU C O   1 
ATOM   9961  C  CB  . LEU B 2 218  ? 53.250  47.219  44.407  1.00 110.96 ? 212  LEU C CB  1 
ATOM   9962  C  CG  . LEU B 2 218  ? 52.751  47.987  45.632  1.00 109.96 ? 212  LEU C CG  1 
ATOM   9963  C  CD1 . LEU B 2 218  ? 53.719  47.854  46.798  1.00 109.85 ? 212  LEU C CD1 1 
ATOM   9964  C  CD2 . LEU B 2 218  ? 52.519  49.453  45.301  1.00 113.01 ? 212  LEU C CD2 1 
ATOM   9965  N  N   . ARG B 2 219  ? 52.077  44.328  44.035  1.00 104.61 ? 213  ARG C N   1 
ATOM   9966  C  CA  . ARG B 2 219  ? 51.002  43.371  44.263  1.00 101.37 ? 213  ARG C CA  1 
ATOM   9967  C  C   . ARG B 2 219  ? 51.556  42.090  44.878  1.00 98.88  ? 213  ARG C C   1 
ATOM   9968  O  O   . ARG B 2 219  ? 50.971  41.540  45.809  1.00 96.03  ? 213  ARG C O   1 
ATOM   9969  C  CB  . ARG B 2 219  ? 50.245  43.033  42.973  1.00 102.54 ? 213  ARG C CB  1 
ATOM   9970  C  CG  . ARG B 2 219  ? 49.071  42.080  43.174  1.00 99.92  ? 213  ARG C CG  1 
ATOM   9971  C  CD  . ARG B 2 219  ? 48.342  41.660  41.910  1.00 101.06 ? 213  ARG C CD  1 
ATOM   9972  N  NE  . ARG B 2 219  ? 47.806  42.800  41.175  1.00 104.02 ? 213  ARG C NE  1 
ATOM   9973  C  CZ  . ARG B 2 219  ? 48.428  43.425  40.176  1.00 107.41 ? 213  ARG C CZ  1 
ATOM   9974  N  NH1 . ARG B 2 219  ? 49.619  43.017  39.771  1.00 109.49 ? 213  ARG C NH1 1 
ATOM   9975  N  NH2 . ARG B 2 219  ? 47.852  44.454  39.580  1.00 109.00 ? 213  ARG C NH2 1 
ATOM   9976  N  N   . HIS B 2 220  ? 52.685  41.626  44.338  1.00 100.10 ? 214  HIS C N   1 
ATOM   9977  C  CA  . HIS B 2 220  ? 53.247  40.350  44.738  1.00 98.93  ? 214  HIS C CA  1 
ATOM   9978  C  C   . HIS B 2 220  ? 54.271  40.536  45.858  1.00 98.69  ? 214  HIS C C   1 
ATOM   9979  O  O   . HIS B 2 220  ? 55.018  39.610  46.162  1.00 98.76  ? 214  HIS C O   1 
ATOM   9980  C  CB  . HIS B 2 220  ? 53.805  39.611  43.510  1.00 101.17 ? 214  HIS C CB  1 
ATOM   9981  C  CG  . HIS B 2 220  ? 52.772  39.196  42.512  1.00 101.25 ? 214  HIS C CG  1 
ATOM   9982  N  ND1 . HIS B 2 220  ? 52.656  39.799  41.272  1.00 103.96 ? 214  HIS C ND1 1 
ATOM   9983  C  CD2 . HIS B 2 220  ? 51.819  38.240  42.554  1.00 99.53  ? 214  HIS C CD2 1 
ATOM   9984  C  CE1 . HIS B 2 220  ? 51.678  39.235  40.594  1.00 103.22 ? 214  HIS C CE1 1 
ATOM   9985  N  NE2 . HIS B 2 220  ? 51.151  38.274  41.359  1.00 101.12 ? 214  HIS C NE2 1 
ATOM   9986  N  N   . GLY B 2 221  ? 54.289  41.720  46.488  1.00 98.90  ? 215  GLY C N   1 
ATOM   9987  C  CA  . GLY B 2 221  ? 55.287  41.996  47.510  1.00 99.64  ? 215  GLY C CA  1 
ATOM   9988  C  C   . GLY B 2 221  ? 55.018  43.268  48.309  1.00 100.21 ? 215  GLY C C   1 
ATOM   9989  O  O   . GLY B 2 221  ? 55.713  44.270  48.147  1.00 103.10 ? 215  GLY C O   1 
ATOM   9990  N  N   . PHE B 2 222  ? 54.008  43.199  49.180  1.00 98.13  ? 216  PHE C N   1 
ATOM   9991  C  CA  . PHE B 2 222  ? 53.704  44.236  50.152  1.00 98.62  ? 216  PHE C CA  1 
ATOM   9992  C  C   . PHE B 2 222  ? 53.137  43.564  51.400  1.00 95.74  ? 216  PHE C C   1 
ATOM   9993  O  O   . PHE B 2 222  ? 52.531  42.500  51.313  1.00 93.93  ? 216  PHE C O   1 
ATOM   9994  C  CB  . PHE B 2 222  ? 52.685  45.229  49.583  1.00 99.53  ? 216  PHE C CB  1 
ATOM   9995  C  CG  . PHE B 2 222  ? 51.257  44.742  49.611  1.00 97.13  ? 216  PHE C CG  1 
ATOM   9996  C  CD1 . PHE B 2 222  ? 50.748  43.966  48.579  1.00 96.69  ? 216  PHE C CD1 1 
ATOM   9997  C  CD2 . PHE B 2 222  ? 50.426  45.033  50.685  1.00 95.55  ? 216  PHE C CD2 1 
ATOM   9998  C  CE1 . PHE B 2 222  ? 49.440  43.500  48.616  1.00 94.81  ? 216  PHE C CE1 1 
ATOM   9999  C  CE2 . PHE B 2 222  ? 49.120  44.566  50.723  1.00 93.31  ? 216  PHE C CE2 1 
ATOM   10000 C  CZ  . PHE B 2 222  ? 48.628  43.800  49.688  1.00 92.90  ? 216  PHE C CZ  1 
ATOM   10001 N  N   . MET B 2 223  ? 53.326  44.195  52.559  1.00 96.31  ? 217  MET C N   1 
ATOM   10002 C  CA  . MET B 2 223  ? 52.693  43.729  53.781  1.00 94.17  ? 217  MET C CA  1 
ATOM   10003 C  C   . MET B 2 223  ? 51.982  44.901  54.443  1.00 94.54  ? 217  MET C C   1 
ATOM   10004 O  O   . MET B 2 223  ? 52.222  46.053  54.091  1.00 97.90  ? 217  MET C O   1 
ATOM   10005 C  CB  . MET B 2 223  ? 53.718  43.165  54.765  1.00 95.08  ? 217  MET C CB  1 
ATOM   10006 C  CG  . MET B 2 223  ? 54.367  41.886  54.304  1.00 95.20  ? 217  MET C CG  1 
ATOM   10007 S  SD  . MET B 2 223  ? 55.703  41.485  55.443  1.00 97.76  ? 217  MET C SD  1 
ATOM   10008 C  CE  . MET B 2 223  ? 54.765  41.167  56.936  1.00 94.72  ? 217  MET C CE  1 
ATOM   10009 N  N   . LEU B 2 224  ? 51.116  44.589  55.410  1.00 92.02  ? 218  LEU C N   1 
ATOM   10010 C  CA  . LEU B 2 224  ? 50.375  45.604  56.135  1.00 92.15  ? 218  LEU C CA  1 
ATOM   10011 C  C   . LEU B 2 224  ? 50.115  45.103  57.554  1.00 91.43  ? 218  LEU C C   1 
ATOM   10012 O  O   . LEU B 2 224  ? 49.434  44.095  57.737  1.00 89.91  ? 218  LEU C O   1 
ATOM   10013 C  CB  . LEU B 2 224  ? 49.069  45.868  55.379  1.00 90.44  ? 218  LEU C CB  1 
ATOM   10014 C  CG  . LEU B 2 224  ? 48.244  47.060  55.861  1.00 91.29  ? 218  LEU C CG  1 
ATOM   10015 C  CD1 . LEU B 2 224  ? 47.298  47.533  54.770  1.00 91.42  ? 218  LEU C CD1 1 
ATOM   10016 C  CD2 . LEU B 2 224  ? 47.462  46.730  57.125  1.00 89.16  ? 218  LEU C CD2 1 
ATOM   10017 N  N   . HIS B 2 225  ? 50.670  45.818  58.545  1.00 93.80  ? 219  HIS C N   1 
ATOM   10018 C  CA  . HIS B 2 225  ? 50.573  45.451  59.952  1.00 93.18  ? 219  HIS C CA  1 
ATOM   10019 C  C   . HIS B 2 225  ? 49.531  46.324  60.645  1.00 91.52  ? 219  HIS C C   1 
ATOM   10020 O  O   . HIS B 2 225  ? 49.169  47.379  60.133  1.00 92.28  ? 219  HIS C O   1 
ATOM   10021 C  CB  . HIS B 2 225  ? 51.938  45.578  60.651  1.00 97.98  ? 219  HIS C CB  1 
ATOM   10022 C  CG  . HIS B 2 225  ? 53.054  44.885  59.941  1.00 101.38 ? 219  HIS C CG  1 
ATOM   10023 N  ND1 . HIS B 2 225  ? 53.218  43.513  59.990  1.00 100.80 ? 219  HIS C ND1 1 
ATOM   10024 C  CD2 . HIS B 2 225  ? 54.051  45.358  59.158  1.00 104.98 ? 219  HIS C CD2 1 
ATOM   10025 C  CE1 . HIS B 2 225  ? 54.271  43.171  59.275  1.00 103.25 ? 219  HIS C CE1 1 
ATOM   10026 N  NE2 . HIS B 2 225  ? 54.800  44.287  58.749  1.00 105.93 ? 219  HIS C NE2 1 
ATOM   10027 N  N   . THR B 2 226  ? 49.045  45.854  61.801  1.00 89.01  ? 220  THR C N   1 
ATOM   10028 C  CA  . THR B 2 226  ? 48.198  46.635  62.692  1.00 88.33  ? 220  THR C CA  1 
ATOM   10029 C  C   . THR B 2 226  ? 48.008  45.905  64.018  1.00 87.11  ? 220  THR C C   1 
ATOM   10030 O  O   . THR B 2 226  ? 48.026  44.679  64.088  1.00 85.68  ? 220  THR C O   1 
ATOM   10031 C  CB  . THR B 2 226  ? 46.859  47.064  62.067  1.00 86.36  ? 220  THR C CB  1 
ATOM   10032 O  OG1 . THR B 2 226  ? 46.153  47.794  63.070  1.00 85.36  ? 220  THR C OG1 1 
ATOM   10033 C  CG2 . THR B 2 226  ? 46.001  45.912  61.590  1.00 83.73  ? 220  THR C CG2 1 
ATOM   10034 N  N   . LYS B 2 227  ? 47.825  46.705  65.064  1.00 88.57  ? 221  LYS C N   1 
ATOM   10035 C  CA  . LYS B 2 227  ? 47.644  46.243  66.423  1.00 89.15  ? 221  LYS C CA  1 
ATOM   10036 C  C   . LYS B 2 227  ? 46.489  47.053  66.992  1.00 88.38  ? 221  LYS C C   1 
ATOM   10037 O  O   . LYS B 2 227  ? 46.354  48.231  66.669  1.00 89.65  ? 221  LYS C O   1 
ATOM   10038 C  CB  . LYS B 2 227  ? 48.909  46.559  67.229  1.00 94.98  ? 221  LYS C CB  1 
ATOM   10039 C  CG  . LYS B 2 227  ? 48.829  46.284  68.729  1.00 98.12  ? 221  LYS C CG  1 
ATOM   10040 C  CD  . LYS B 2 227  ? 49.963  46.873  69.556  1.00 101.86 ? 221  LYS C CD  1 
ATOM   10041 C  CE  . LYS B 2 227  ? 49.960  46.369  70.986  1.00 102.89 ? 221  LYS C CE  1 
ATOM   10042 N  NZ  . LYS B 2 227  ? 51.142  46.838  71.749  1.00 107.36 ? 221  LYS C NZ  1 
ATOM   10043 N  N   . TYR B 2 228  ? 45.661  46.416  67.825  1.00 86.33  ? 222  TYR C N   1 
ATOM   10044 C  CA  . TYR B 2 228  ? 44.691  47.158  68.610  1.00 85.89  ? 222  TYR C CA  1 
ATOM   10045 C  C   . TYR B 2 228  ? 44.482  46.480  69.959  1.00 85.80  ? 222  TYR C C   1 
ATOM   10046 O  O   . TYR B 2 228  ? 44.871  45.331  70.155  1.00 85.51  ? 222  TYR C O   1 
ATOM   10047 C  CB  . TYR B 2 228  ? 43.406  47.421  67.822  1.00 83.36  ? 222  TYR C CB  1 
ATOM   10048 C  CG  . TYR B 2 228  ? 42.641  46.204  67.372  1.00 81.19  ? 222  TYR C CG  1 
ATOM   10049 C  CD1 . TYR B 2 228  ? 41.717  45.592  68.204  1.00 80.04  ? 222  TYR C CD1 1 
ATOM   10050 C  CD2 . TYR B 2 228  ? 42.799  45.689  66.094  1.00 80.73  ? 222  TYR C CD2 1 
ATOM   10051 C  CE1 . TYR B 2 228  ? 40.986  44.488  67.788  1.00 78.16  ? 222  TYR C CE1 1 
ATOM   10052 C  CE2 . TYR B 2 228  ? 42.078  44.582  65.663  1.00 78.91  ? 222  TYR C CE2 1 
ATOM   10053 C  CZ  . TYR B 2 228  ? 41.166  43.977  66.513  1.00 76.91  ? 222  TYR C CZ  1 
ATOM   10054 O  OH  . TYR B 2 228  ? 40.442  42.891  66.114  1.00 73.36  ? 222  TYR C OH  1 
ATOM   10055 N  N   . GLN B 2 229  ? 43.914  47.246  70.892  1.00 87.38  ? 223  GLN C N   1 
ATOM   10056 C  CA  . GLN B 2 229  ? 43.537  46.733  72.195  1.00 88.06  ? 223  GLN C CA  1 
ATOM   10057 C  C   . GLN B 2 229  ? 42.040  46.454  72.186  1.00 84.67  ? 223  GLN C C   1 
ATOM   10058 O  O   . GLN B 2 229  ? 41.317  46.963  71.333  1.00 83.94  ? 223  GLN C O   1 
ATOM   10059 C  CB  . GLN B 2 229  ? 43.866  47.752  73.284  1.00 92.73  ? 223  GLN C CB  1 
ATOM   10060 C  CG  . GLN B 2 229  ? 45.267  47.619  73.856  1.00 97.02  ? 223  GLN C CG  1 
ATOM   10061 C  CD  . GLN B 2 229  ? 45.482  48.741  74.837  1.00 102.16 ? 223  GLN C CD  1 
ATOM   10062 O  OE1 . GLN B 2 229  ? 44.593  49.067  75.623  1.00 103.21 ? 223  GLN C OE1 1 
ATOM   10063 N  NE2 . GLN B 2 229  ? 46.656  49.352  74.784  1.00 106.86 ? 223  GLN C NE2 1 
ATOM   10064 N  N   . VAL B 2 230  ? 41.592  45.664  73.166  1.00 82.56  ? 224  VAL C N   1 
ATOM   10065 C  CA  . VAL B 2 230  ? 40.222  45.194  73.217  1.00 78.81  ? 224  VAL C CA  1 
ATOM   10066 C  C   . VAL B 2 230  ? 39.885  44.868  74.674  1.00 79.10  ? 224  VAL C C   1 
ATOM   10067 O  O   . VAL B 2 230  ? 40.759  44.454  75.432  1.00 80.47  ? 224  VAL C O   1 
ATOM   10068 C  CB  . VAL B 2 230  ? 40.075  44.005  72.249  1.00 76.27  ? 224  VAL C CB  1 
ATOM   10069 C  CG1 . VAL B 2 230  ? 40.524  42.686  72.849  1.00 76.07  ? 224  VAL C CG1 1 
ATOM   10070 C  CG2 . VAL B 2 230  ? 38.691  43.910  71.647  1.00 74.84  ? 224  VAL C CG2 1 
ATOM   10071 N  N   . VAL B 2 231  ? 38.628  45.105  75.079  1.00 77.90  ? 225  VAL C N   1 
ATOM   10072 C  CA  . VAL B 2 231  ? 38.263  45.023  76.488  1.00 78.72  ? 225  VAL C CA  1 
ATOM   10073 C  C   . VAL B 2 231  ? 37.078  44.073  76.681  1.00 76.91  ? 225  VAL C C   1 
ATOM   10074 O  O   . VAL B 2 231  ? 36.432  43.661  75.717  1.00 74.13  ? 225  VAL C O   1 
ATOM   10075 C  CB  . VAL B 2 231  ? 38.009  46.422  77.090  1.00 80.08  ? 225  VAL C CB  1 
ATOM   10076 C  CG1 . VAL B 2 231  ? 36.721  47.038  76.566  1.00 78.58  ? 225  VAL C CG1 1 
ATOM   10077 C  CG2 . VAL B 2 231  ? 38.032  46.417  78.615  1.00 81.35  ? 225  VAL C CG2 1 
ATOM   10078 N  N   . TYR B 2 232  ? 36.813  43.732  77.952  1.00 78.37  ? 226  TYR C N   1 
ATOM   10079 C  CA  . TYR B 2 232  ? 35.735  42.841  78.354  1.00 77.72  ? 226  TYR C CA  1 
ATOM   10080 C  C   . TYR B 2 232  ? 34.371  43.408  77.962  1.00 76.97  ? 226  TYR C C   1 
ATOM   10081 O  O   . TYR B 2 232  ? 34.129  44.605  78.118  1.00 78.27  ? 226  TYR C O   1 
ATOM   10082 C  CB  . TYR B 2 232  ? 35.728  42.637  79.871  1.00 79.73  ? 226  TYR C CB  1 
ATOM   10083 C  CG  . TYR B 2 232  ? 34.735  41.595  80.323  1.00 79.64  ? 226  TYR C CG  1 
ATOM   10084 C  CD1 . TYR B 2 232  ? 35.073  40.250  80.324  1.00 79.98  ? 226  TYR C CD1 1 
ATOM   10085 C  CD2 . TYR B 2 232  ? 33.445  41.936  80.703  1.00 79.51  ? 226  TYR C CD2 1 
ATOM   10086 C  CE1 . TYR B 2 232  ? 34.170  39.271  80.705  1.00 79.31  ? 226  TYR C CE1 1 
ATOM   10087 C  CE2 . TYR B 2 232  ? 32.529  40.968  81.088  1.00 79.32  ? 226  TYR C CE2 1 
ATOM   10088 C  CZ  . TYR B 2 232  ? 32.893  39.633  81.092  1.00 78.81  ? 226  TYR C CZ  1 
ATOM   10089 O  OH  . TYR B 2 232  ? 32.000  38.676  81.478  1.00 78.65  ? 226  TYR C OH  1 
ATOM   10090 N  N   . PRO B 2 233  ? 33.416  42.568  77.493  1.00 75.29  ? 227  PRO C N   1 
ATOM   10091 C  CA  . PRO B 2 233  ? 33.677  41.155  77.214  1.00 74.52  ? 227  PRO C CA  1 
ATOM   10092 C  C   . PRO B 2 233  ? 34.472  41.047  75.920  1.00 73.61  ? 227  PRO C C   1 
ATOM   10093 O  O   . PRO B 2 233  ? 34.175  41.751  74.956  1.00 73.24  ? 227  PRO C O   1 
ATOM   10094 C  CB  . PRO B 2 233  ? 32.275  40.549  77.059  1.00 73.58  ? 227  PRO C CB  1 
ATOM   10095 C  CG  . PRO B 2 233  ? 31.404  41.713  76.613  1.00 73.38  ? 227  PRO C CG  1 
ATOM   10096 C  CD  . PRO B 2 233  ? 32.015  42.946  77.243  1.00 74.40  ? 227  PRO C CD  1 
ATOM   10097 N  N   . PHE B 2 234  ? 35.496  40.183  75.922  1.00 73.40  ? 228  PHE C N   1 
ATOM   10098 C  CA  . PHE B 2 234  ? 36.372  40.056  74.767  1.00 72.08  ? 228  PHE C CA  1 
ATOM   10099 C  C   . PHE B 2 234  ? 35.560  39.643  73.542  1.00 69.06  ? 228  PHE C C   1 
ATOM   10100 O  O   . PHE B 2 234  ? 34.937  38.584  73.536  1.00 67.78  ? 228  PHE C O   1 
ATOM   10101 C  CB  . PHE B 2 234  ? 37.555  39.125  75.052  1.00 72.94  ? 228  PHE C CB  1 
ATOM   10102 C  CG  . PHE B 2 234  ? 38.396  39.561  76.222  1.00 75.08  ? 228  PHE C CG  1 
ATOM   10103 C  CD1 . PHE B 2 234  ? 38.908  40.850  76.282  1.00 76.30  ? 228  PHE C CD1 1 
ATOM   10104 C  CD2 . PHE B 2 234  ? 38.659  38.693  77.271  1.00 76.15  ? 228  PHE C CD2 1 
ATOM   10105 C  CE1 . PHE B 2 234  ? 39.663  41.265  77.368  1.00 78.27  ? 228  PHE C CE1 1 
ATOM   10106 C  CE2 . PHE B 2 234  ? 39.421  39.106  78.354  1.00 78.51  ? 228  PHE C CE2 1 
ATOM   10107 C  CZ  . PHE B 2 234  ? 39.919  40.390  78.401  1.00 79.61  ? 228  PHE C CZ  1 
ATOM   10108 N  N   . PRO B 2 235  ? 35.521  40.482  72.483  1.00 67.68  ? 229  PRO C N   1 
ATOM   10109 C  CA  . PRO B 2 235  ? 34.760  40.175  71.281  1.00 67.18  ? 229  PRO C CA  1 
ATOM   10110 C  C   . PRO B 2 235  ? 35.195  38.823  70.746  1.00 67.08  ? 229  PRO C C   1 
ATOM   10111 O  O   . PRO B 2 235  ? 36.354  38.442  70.881  1.00 69.34  ? 229  PRO C O   1 
ATOM   10112 C  CB  . PRO B 2 235  ? 35.126  41.283  70.284  1.00 66.70  ? 229  PRO C CB  1 
ATOM   10113 C  CG  . PRO B 2 235  ? 36.333  41.945  70.879  1.00 68.02  ? 229  PRO C CG  1 
ATOM   10114 C  CD  . PRO B 2 235  ? 36.194  41.779  72.378  1.00 69.06  ? 229  PRO C CD  1 
ATOM   10115 N  N   . THR B 2 236  ? 34.231  38.112  70.161  1.00 66.10  ? 230  THR C N   1 
ATOM   10116 C  CA  . THR B 2 236  ? 34.455  36.772  69.660  1.00 66.33  ? 230  THR C CA  1 
ATOM   10117 C  C   . THR B 2 236  ? 35.342  36.839  68.420  1.00 66.83  ? 230  THR C C   1 
ATOM   10118 O  O   . THR B 2 236  ? 35.519  37.905  67.827  1.00 65.96  ? 230  THR C O   1 
ATOM   10119 C  CB  . THR B 2 236  ? 33.112  36.108  69.350  1.00 65.52  ? 230  THR C CB  1 
ATOM   10120 O  OG1 . THR B 2 236  ? 32.490  36.959  68.389  1.00 66.74  ? 230  THR C OG1 1 
ATOM   10121 C  CG2 . THR B 2 236  ? 32.223  35.999  70.568  1.00 65.30  ? 230  THR C CG2 1 
ATOM   10122 N  N   . PHE B 2 237  ? 35.903  35.683  68.053  1.00 67.62  ? 231  PHE C N   1 
ATOM   10123 C  CA  . PHE B 2 237  ? 36.638  35.551  66.809  1.00 67.55  ? 231  PHE C CA  1 
ATOM   10124 C  C   . PHE B 2 237  ? 35.737  34.834  65.809  1.00 65.82  ? 231  PHE C C   1 
ATOM   10125 O  O   . PHE B 2 237  ? 35.328  33.708  66.051  1.00 65.54  ? 231  PHE C O   1 
ATOM   10126 C  CB  . PHE B 2 237  ? 37.989  34.868  67.049  1.00 69.41  ? 231  PHE C CB  1 
ATOM   10127 C  CG  . PHE B 2 237  ? 38.860  34.721  65.825  1.00 71.17  ? 231  PHE C CG  1 
ATOM   10128 C  CD1 . PHE B 2 237  ? 39.063  35.789  64.958  1.00 71.69  ? 231  PHE C CD1 1 
ATOM   10129 C  CD2 . PHE B 2 237  ? 39.497  33.517  65.544  1.00 72.30  ? 231  PHE C CD2 1 
ATOM   10130 C  CE1 . PHE B 2 237  ? 39.866  35.650  63.833  1.00 72.33  ? 231  PHE C CE1 1 
ATOM   10131 C  CE2 . PHE B 2 237  ? 40.303  33.378  64.422  1.00 72.56  ? 231  PHE C CE2 1 
ATOM   10132 C  CZ  . PHE B 2 237  ? 40.485  34.446  63.568  1.00 72.99  ? 231  PHE C CZ  1 
ATOM   10133 N  N   . GLN B 2 238  ? 35.426  35.515  64.703  1.00 65.44  ? 232  GLN C N   1 
ATOM   10134 C  CA  . GLN B 2 238  ? 34.450  35.051  63.732  1.00 65.49  ? 232  GLN C CA  1 
ATOM   10135 C  C   . GLN B 2 238  ? 35.068  35.060  62.335  1.00 66.39  ? 232  GLN C C   1 
ATOM   10136 O  O   . GLN B 2 238  ? 34.567  35.738  61.437  1.00 66.71  ? 232  GLN C O   1 
ATOM   10137 C  CB  . GLN B 2 238  ? 33.222  35.962  63.764  1.00 64.95  ? 232  GLN C CB  1 
ATOM   10138 C  CG  . GLN B 2 238  ? 32.388  35.843  65.030  1.00 64.99  ? 232  GLN C CG  1 
ATOM   10139 C  CD  . GLN B 2 238  ? 31.157  36.709  64.946  1.00 65.52  ? 232  GLN C CD  1 
ATOM   10140 O  OE1 . GLN B 2 238  ? 31.195  37.909  65.201  1.00 66.41  ? 232  GLN C OE1 1 
ATOM   10141 N  NE2 . GLN B 2 238  ? 30.044  36.100  64.578  1.00 66.63  ? 232  GLN C NE2 1 
ATOM   10142 N  N   . PRO B 2 239  ? 36.143  34.278  62.084  1.00 67.47  ? 233  PRO C N   1 
ATOM   10143 C  CA  . PRO B 2 239  ? 36.933  34.436  60.861  1.00 67.88  ? 233  PRO C CA  1 
ATOM   10144 C  C   . PRO B 2 239  ? 36.092  34.244  59.603  1.00 67.38  ? 233  PRO C C   1 
ATOM   10145 O  O   . PRO B 2 239  ? 36.263  34.962  58.623  1.00 68.01  ? 233  PRO C O   1 
ATOM   10146 C  CB  . PRO B 2 239  ? 38.045  33.380  60.979  1.00 68.40  ? 233  PRO C CB  1 
ATOM   10147 C  CG  . PRO B 2 239  ? 37.523  32.378  61.995  1.00 68.93  ? 233  PRO C CG  1 
ATOM   10148 C  CD  . PRO B 2 239  ? 36.629  33.173  62.926  1.00 68.41  ? 233  PRO C CD  1 
ATOM   10149 N  N   . ALA B 2 240  ? 35.160  33.292  59.653  1.00 67.14  ? 234  ALA C N   1 
ATOM   10150 C  CA  . ALA B 2 240  ? 34.389  32.950  58.471  1.00 68.39  ? 234  ALA C CA  1 
ATOM   10151 C  C   . ALA B 2 240  ? 33.573  34.155  58.002  1.00 68.47  ? 234  ALA C C   1 
ATOM   10152 O  O   . ALA B 2 240  ? 33.419  34.357  56.796  1.00 70.00  ? 234  ALA C O   1 
ATOM   10153 C  CB  . ALA B 2 240  ? 33.531  31.733  58.726  1.00 68.19  ? 234  ALA C CB  1 
ATOM   10154 N  N   . PHE B 2 241  ? 33.064  34.949  58.957  1.00 66.78  ? 235  PHE C N   1 
ATOM   10155 C  CA  . PHE B 2 241  ? 32.283  36.134  58.633  1.00 66.86  ? 235  PHE C CA  1 
ATOM   10156 C  C   . PHE B 2 241  ? 33.217  37.316  58.387  1.00 68.35  ? 235  PHE C C   1 
ATOM   10157 O  O   . PHE B 2 241  ? 33.093  37.993  57.368  1.00 69.83  ? 235  PHE C O   1 
ATOM   10158 C  CB  . PHE B 2 241  ? 31.280  36.485  59.737  1.00 65.01  ? 235  PHE C CB  1 
ATOM   10159 C  CG  . PHE B 2 241  ? 30.082  35.580  59.875  1.00 64.45  ? 235  PHE C CG  1 
ATOM   10160 C  CD1 . PHE B 2 241  ? 29.578  34.876  58.790  1.00 64.87  ? 235  PHE C CD1 1 
ATOM   10161 C  CD2 . PHE B 2 241  ? 29.429  35.455  61.094  1.00 63.63  ? 235  PHE C CD2 1 
ATOM   10162 C  CE1 . PHE B 2 241  ? 28.468  34.054  58.927  1.00 64.38  ? 235  PHE C CE1 1 
ATOM   10163 C  CE2 . PHE B 2 241  ? 28.318  34.633  61.229  1.00 63.65  ? 235  PHE C CE2 1 
ATOM   10164 C  CZ  . PHE B 2 241  ? 27.840  33.933  60.145  1.00 63.74  ? 235  PHE C CZ  1 
ATOM   10165 N  N   . GLN B 2 242  ? 34.154  37.544  59.323  1.00 67.99  ? 236  GLN C N   1 
ATOM   10166 C  CA  . GLN B 2 242  ? 35.083  38.664  59.268  1.00 68.23  ? 236  GLN C CA  1 
ATOM   10167 C  C   . GLN B 2 242  ? 35.689  38.794  57.869  1.00 68.63  ? 236  GLN C C   1 
ATOM   10168 O  O   . GLN B 2 242  ? 35.953  39.898  57.406  1.00 69.16  ? 236  GLN C O   1 
ATOM   10169 C  CB  . GLN B 2 242  ? 36.160  38.532  60.348  1.00 68.28  ? 236  GLN C CB  1 
ATOM   10170 C  CG  . GLN B 2 242  ? 35.652  38.768  61.766  1.00 68.29  ? 236  GLN C CG  1 
ATOM   10171 C  CD  . GLN B 2 242  ? 36.723  38.601  62.821  1.00 69.98  ? 236  GLN C CD  1 
ATOM   10172 O  OE1 . GLN B 2 242  ? 36.643  37.728  63.683  1.00 70.04  ? 236  GLN C OE1 1 
ATOM   10173 N  NE2 . GLN B 2 242  ? 37.743  39.446  62.777  1.00 71.56  ? 236  GLN C NE2 1 
ATOM   10174 N  N   . LEU B 2 243  ? 35.876  37.662  57.183  1.00 68.66  ? 237  LEU C N   1 
ATOM   10175 C  CA  . LEU B 2 243  ? 36.619  37.659  55.933  1.00 69.89  ? 237  LEU C CA  1 
ATOM   10176 C  C   . LEU B 2 243  ? 35.738  37.230  54.759  1.00 70.68  ? 237  LEU C C   1 
ATOM   10177 O  O   . LEU B 2 243  ? 36.272  36.844  53.723  1.00 72.89  ? 237  LEU C O   1 
ATOM   10178 C  CB  . LEU B 2 243  ? 37.837  36.733  56.078  1.00 69.10  ? 237  LEU C CB  1 
ATOM   10179 C  CG  . LEU B 2 243  ? 38.877  37.141  57.125  1.00 68.68  ? 237  LEU C CG  1 
ATOM   10180 C  CD1 . LEU B 2 243  ? 39.782  35.976  57.495  1.00 68.02  ? 237  LEU C CD1 1 
ATOM   10181 C  CD2 . LEU B 2 243  ? 39.710  38.320  56.645  1.00 69.84  ? 237  LEU C CD2 1 
ATOM   10182 N  N   . LYS B 2 244  ? 34.407  37.306  54.895  1.00 69.86  ? 238  LYS C N   1 
ATOM   10183 C  CA  . LYS B 2 244  ? 33.549  36.734  53.865  1.00 71.04  ? 238  LYS C CA  1 
ATOM   10184 C  C   . LYS B 2 244  ? 33.530  37.599  52.606  1.00 72.81  ? 238  LYS C C   1 
ATOM   10185 O  O   . LYS B 2 244  ? 33.268  37.086  51.520  1.00 73.53  ? 238  LYS C O   1 
ATOM   10186 C  CB  . LYS B 2 244  ? 32.125  36.432  54.346  1.00 71.20  ? 238  LYS C CB  1 
ATOM   10187 C  CG  . LYS B 2 244  ? 31.372  35.444  53.457  1.00 72.00  ? 238  LYS C CG  1 
ATOM   10188 C  CD  . LYS B 2 244  ? 29.895  35.272  53.753  1.00 72.02  ? 238  LYS C CD  1 
ATOM   10189 C  CE  . LYS B 2 244  ? 29.599  34.277  54.856  1.00 71.46  ? 238  LYS C CE  1 
ATOM   10190 N  NZ  . LYS B 2 244  ? 28.455  33.392  54.521  1.00 72.06  ? 238  LYS C NZ  1 
ATOM   10191 N  N   . LYS B 2 245  ? 33.781  38.907  52.762  1.00 74.10  ? 239  LYS C N   1 
ATOM   10192 C  CA  . LYS B 2 245  ? 33.941  39.795  51.618  1.00 75.77  ? 239  LYS C CA  1 
ATOM   10193 C  C   . LYS B 2 245  ? 35.420  39.888  51.245  1.00 76.79  ? 239  LYS C C   1 
ATOM   10194 O  O   . LYS B 2 245  ? 36.260  40.176  52.101  1.00 76.06  ? 239  LYS C O   1 
ATOM   10195 C  CB  . LYS B 2 245  ? 33.350  41.182  51.892  1.00 75.73  ? 239  LYS C CB  1 
ATOM   10196 C  CG  . LYS B 2 245  ? 33.401  42.137  50.704  1.00 77.52  ? 239  LYS C CG  1 
ATOM   10197 C  CD  . LYS B 2 245  ? 33.068  43.571  51.049  1.00 78.07  ? 239  LYS C CD  1 
ATOM   10198 C  CE  . LYS B 2 245  ? 33.460  44.540  49.956  1.00 80.46  ? 239  LYS C CE  1 
ATOM   10199 N  NZ  . LYS B 2 245  ? 32.880  44.153  48.651  1.00 82.59  ? 239  LYS C NZ  1 
ATOM   10200 N  N   . ASP B 2 246  ? 35.712  39.641  49.958  1.00 78.08  ? 240  ASP C N   1 
ATOM   10201 C  CA  . ASP B 2 246  ? 37.066  39.653  49.428  1.00 78.74  ? 240  ASP C CA  1 
ATOM   10202 C  C   . ASP B 2 246  ? 37.716  41.011  49.670  1.00 79.65  ? 240  ASP C C   1 
ATOM   10203 O  O   . ASP B 2 246  ? 37.094  42.057  49.479  1.00 80.24  ? 240  ASP C O   1 
ATOM   10204 C  CB  . ASP B 2 246  ? 37.103  39.272  47.946  1.00 81.40  ? 240  ASP C CB  1 
ATOM   10205 C  CG  . ASP B 2 246  ? 37.165  37.773  47.716  1.00 82.82  ? 240  ASP C CG  1 
ATOM   10206 O  OD1 . ASP B 2 246  ? 37.928  37.109  48.437  1.00 83.46  ? 240  ASP C OD1 1 
ATOM   10207 O  OD2 . ASP B 2 246  ? 36.442  37.272  46.826  1.00 84.66  ? 240  ASP C OD2 1 
ATOM   10208 N  N   . GLN B 2 247  ? 38.980  40.957  50.109  1.00 79.67  ? 241  GLN C N   1 
ATOM   10209 C  CA  . GLN B 2 247  ? 39.868  42.105  50.231  1.00 80.58  ? 241  GLN C CA  1 
ATOM   10210 C  C   . GLN B 2 247  ? 39.559  42.890  51.504  1.00 79.68  ? 241  GLN C C   1 
ATOM   10211 O  O   . GLN B 2 247  ? 40.196  43.912  51.767  1.00 81.15  ? 241  GLN C O   1 
ATOM   10212 C  CB  . GLN B 2 247  ? 39.829  42.987  48.977  1.00 82.62  ? 241  GLN C CB  1 
ATOM   10213 C  CG  . GLN B 2 247  ? 40.173  42.237  47.699  1.00 83.64  ? 241  GLN C CG  1 
ATOM   10214 C  CD  . GLN B 2 247  ? 40.564  43.156  46.573  1.00 86.61  ? 241  GLN C CD  1 
ATOM   10215 O  OE1 . GLN B 2 247  ? 41.653  43.721  46.556  1.00 88.52  ? 241  GLN C OE1 1 
ATOM   10216 N  NE2 . GLN B 2 247  ? 39.676  43.294  45.604  1.00 88.38  ? 241  GLN C NE2 1 
ATOM   10217 N  N   . VAL B 2 248  ? 38.597  42.393  52.296  1.00 77.34  ? 242  VAL C N   1 
ATOM   10218 C  CA  . VAL B 2 248  ? 38.103  43.109  53.464  1.00 75.84  ? 242  VAL C CA  1 
ATOM   10219 C  C   . VAL B 2 248  ? 38.169  42.205  54.692  1.00 73.30  ? 242  VAL C C   1 
ATOM   10220 O  O   . VAL B 2 248  ? 37.909  41.008  54.612  1.00 71.96  ? 242  VAL C O   1 
ATOM   10221 C  CB  . VAL B 2 248  ? 36.675  43.658  53.255  1.00 75.41  ? 242  VAL C CB  1 
ATOM   10222 C  CG1 . VAL B 2 248  ? 36.193  44.470  54.445  1.00 74.38  ? 242  VAL C CG1 1 
ATOM   10223 C  CG2 . VAL B 2 248  ? 36.555  44.474  51.982  1.00 77.79  ? 242  VAL C CG2 1 
ATOM   10224 N  N   . VAL B 2 249  ? 38.519  42.816  55.827  1.00 73.36  ? 243  VAL C N   1 
ATOM   10225 C  CA  . VAL B 2 249  ? 38.382  42.198  57.135  1.00 72.33  ? 243  VAL C CA  1 
ATOM   10226 C  C   . VAL B 2 249  ? 37.625  43.170  58.040  1.00 71.83  ? 243  VAL C C   1 
ATOM   10227 O  O   . VAL B 2 249  ? 37.893  44.372  58.027  1.00 72.52  ? 243  VAL C O   1 
ATOM   10228 C  CB  . VAL B 2 249  ? 39.743  41.773  57.727  1.00 72.64  ? 243  VAL C CB  1 
ATOM   10229 C  CG1 . VAL B 2 249  ? 40.637  42.964  58.044  1.00 73.88  ? 243  VAL C CG1 1 
ATOM   10230 C  CG2 . VAL B 2 249  ? 39.589  40.883  58.951  1.00 70.94  ? 243  VAL C CG2 1 
ATOM   10231 N  N   . LEU B 2 250  ? 3