data_6PAX
# 
_entry.id   6PAX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6PAX         
NDB   PD0050       
RCSB  RCSB000927   
WWPDB D_1000000927 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        6PAX 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-22 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, H.E.'      1 
'Rould, M.A.'   2 
'Xu, W.'        3 
'Epstein, J.A.' 4 
'Maas, R.L.'    5 
'Pabo, C.O.'    6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding.
;
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            13 
_citation.page_first                1263 
_citation.page_last                 1275 
_citation.year                      1999 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10346815 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, H.E.'      1 
primary 'Rould, M.A.'   2 
primary 'Xu, W.'        3 
primary 'Epstein, J.A.' 4 
primary 'Maas, R.L.'    5 
primary 'Pabo, C.O.'    6 
# 
_cell.entry_id           6PAX 
_cell.length_a           33.840 
_cell.length_b           61.686 
_cell.length_c           171.111 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6PAX 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn '26 NUCLEOTIDE DNA'      7996.180  1  ? ? ? ? 
2 polymer syn '26 NUCLEOTIDE DNA'      7978.152  1  ? ? ? ? 
3 polymer man 'HOMEOBOX PROTEIN PAX-6' 14520.528 1  ? ? ? ? 
4 water   nat water                    18.015    84 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DA)(DG)(DC)(DA)(DT)(DT)(DT)(DT)(DC)(DA)(DC)(DG)(DC)(DA)(DT)(DG)(DA)(DG)(DT)
(DG)(DC)(DA)(DC)(DA)(DG)
;
AAGCATTTTCACGCATGAGTGCACAG B ? 
2 polydeoxyribonucleotide no no 
;(DT)(DT)(DC)(DT)(DG)(DT)(DG)(DC)(DA)(DC)(DT)(DC)(DA)(DT)(DG)(DC)(DG)(DT)(DG)(DA)
(DA)(DA)(DA)(DT)(DG)(DC)
;
TTCTGTGCACTCATGCGTGAAAATGC C ? 
3 'polypeptide(L)'        no no 
;SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEV
VSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
;
;SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEV
VSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQ
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DG  n 
1 4   DC  n 
1 5   DA  n 
1 6   DT  n 
1 7   DT  n 
1 8   DT  n 
1 9   DT  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DG  n 
1 14  DC  n 
1 15  DA  n 
1 16  DT  n 
1 17  DG  n 
1 18  DA  n 
1 19  DG  n 
1 20  DT  n 
1 21  DG  n 
1 22  DC  n 
1 23  DA  n 
1 24  DC  n 
1 25  DA  n 
1 26  DG  n 
2 1   DT  n 
2 2   DT  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DT  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DC  n 
2 11  DT  n 
2 12  DC  n 
2 13  DA  n 
2 14  DT  n 
2 15  DG  n 
2 16  DC  n 
2 17  DG  n 
2 18  DT  n 
2 19  DG  n 
2 20  DA  n 
2 21  DA  n 
2 22  DA  n 
2 23  DA  n 
2 24  DT  n 
2 25  DG  n 
2 26  DC  n 
3 1   SER n 
3 2   HIS n 
3 3   SER n 
3 4   GLY n 
3 5   VAL n 
3 6   ASN n 
3 7   GLN n 
3 8   LEU n 
3 9   GLY n 
3 10  GLY n 
3 11  VAL n 
3 12  PHE n 
3 13  VAL n 
3 14  ASN n 
3 15  GLY n 
3 16  ARG n 
3 17  PRO n 
3 18  LEU n 
3 19  PRO n 
3 20  ASP n 
3 21  SER n 
3 22  THR n 
3 23  ARG n 
3 24  GLN n 
3 25  ARG n 
3 26  ILE n 
3 27  VAL n 
3 28  GLU n 
3 29  LEU n 
3 30  ALA n 
3 31  HIS n 
3 32  SER n 
3 33  GLY n 
3 34  ALA n 
3 35  ARG n 
3 36  PRO n 
3 37  CYS n 
3 38  ASP n 
3 39  ILE n 
3 40  SER n 
3 41  ARG n 
3 42  ILE n 
3 43  LEU n 
3 44  GLN n 
3 45  VAL n 
3 46  SER n 
3 47  ASN n 
3 48  GLY n 
3 49  CYS n 
3 50  VAL n 
3 51  SER n 
3 52  LYS n 
3 53  ILE n 
3 54  LEU n 
3 55  GLY n 
3 56  ARG n 
3 57  TYR n 
3 58  TYR n 
3 59  ALA n 
3 60  THR n 
3 61  GLY n 
3 62  SER n 
3 63  ILE n 
3 64  ARG n 
3 65  PRO n 
3 66  ARG n 
3 67  ALA n 
3 68  ILE n 
3 69  GLY n 
3 70  GLY n 
3 71  SER n 
3 72  LYS n 
3 73  PRO n 
3 74  ARG n 
3 75  VAL n 
3 76  ALA n 
3 77  THR n 
3 78  PRO n 
3 79  GLU n 
3 80  VAL n 
3 81  VAL n 
3 82  SER n 
3 83  LYS n 
3 84  ILE n 
3 85  ALA n 
3 86  GLN n 
3 87  TYR n 
3 88  LYS n 
3 89  GLN n 
3 90  GLU n 
3 91  CYS n 
3 92  PRO n 
3 93  SER n 
3 94  ILE n 
3 95  PHE n 
3 96  ALA n 
3 97  TRP n 
3 98  GLU n 
3 99  ILE n 
3 100 ARG n 
3 101 ASP n 
3 102 ARG n 
3 103 LEU n 
3 104 LEU n 
3 105 SER n 
3 106 GLU n 
3 107 GLY n 
3 108 VAL n 
3 109 CYS n 
3 110 THR n 
3 111 ASN n 
3 112 ASP n 
3 113 ASN n 
3 114 ILE n 
3 115 PRO n 
3 116 SER n 
3 117 VAL n 
3 118 SER n 
3 119 SER n 
3 120 ILE n 
3 121 ASN n 
3 122 ARG n 
3 123 VAL n 
3 124 LEU n 
3 125 ARG n 
3 126 ASN n 
3 127 LEU n 
3 128 ALA n 
3 129 SER n 
3 130 GLU n 
3 131 LYS n 
3 132 GLN n 
3 133 GLN n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PAX6 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PAX6_HUMAN 3 ? ? P26367 ? 
2 PDB 6PAX       1 ? ? 6PAX   ? 
3 PDB 6PAX       2 ? ? 6PAX   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6PAX A 1 ? 133 ? P26367 4    ? 136  ? 1    133  
2 2 6PAX B 1 ? 26  ? 6PAX   1001 ? 1026 ? 1001 1026 
3 3 6PAX C 1 ? 26  ? 6PAX   2001 ? 2026 ? 2001 2026 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6PAX ARG A 25 ? UNP P26367 LYS 28 CONFLICT 25 1 
1 6PAX ALA A 59 ? UNP P26367 GLU 62 CONFLICT 59 2 
1 6PAX GLN A 89 ? UNP P26367 ARG 92 CONFLICT 89 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          6PAX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   6 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'pH 8.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     6PAX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   20530 
_reflns.number_all                   20530 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0500000 
_reflns.pdbx_Rsym_value              0.0500000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        53.0 
_reflns.pdbx_redundancy              5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 6PAX 
_refine.ls_number_reflns_obs                     12593 
_refine.ls_number_reflns_all                     12593 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               7123245.45 
_refine.pdbx_data_cutoff_low_absF                0.00000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.2330000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2330000 
_refine.ls_R_factor_R_free                       0.2560000 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  1241 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               44.9 
_refine.aniso_B[1][1]                            11.66 
_refine.aniso_B[2][2]                            7.25 
_refine.aniso_B[3][3]                            -18.9 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'PRD-DNA COMPLEX' 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        6PAX 
_refine_analyze.Luzzati_coordinate_error_obs    0.49 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.55 
_refine_analyze.Luzzati_sigma_a_free            0.51 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1278 
_refine_hist.pdbx_number_atoms_nucleic_acid   1166 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             84 
_refine_hist.number_atoms_total               2528 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.344 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      21.79 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.489 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             1791 
_refine_ls_shell.R_factor_R_work                  0.3750000 
_refine_ls_shell.percent_reflns_obs               92.8 
_refine_ls_shell.R_factor_R_free                  0.3930000 
_refine_ls_shell.R_factor_R_free_error            0.029 
_refine_ls_shell.percent_reflns_R_free            9.2 
_refine_ls_shell.number_reflns_R_free             182 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO PARHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARNDBX.DNA  PARNDBX.DNA  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  6PAX 
_struct.title                     
'CRYSTAL STRUCTURE OF THE HUMAN PAX-6 PAIRED DOMAIN-DNA COMPLEX REVEALS A GENERAL MODEL FOR PAX PROTEIN-DNA INTERACTIONS' 
_struct.pdbx_descriptor           'HOMEOBOX PROTEIN PAX-6/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        6PAX 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            'PAX, PAIRED DOMAIN, TRANSCRIPTION, PROTEIN-DNA INTERACTIONS, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP C 20  ? HIS C 31  ? ASP A 20  HIS A 31  1 ? 12 
HELX_P HELX_P2 2 PRO C 36  ? LEU C 43  ? PRO A 36  LEU A 43  1 ? 8  
HELX_P HELX_P3 3 ASN C 47  ? THR C 60  ? ASN A 47  THR A 60  1 ? 14 
HELX_P HELX_P4 4 PRO C 78  ? GLU C 90  ? PRO A 78  GLU A 90  1 ? 13 
HELX_P HELX_P5 5 ALA C 96  ? SER C 105 ? ALA A 96  SER A 105 1 ? 10 
HELX_P HELX_P6 6 VAL C 117 ? GLU C 130 ? VAL A 117 GLU A 130 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 26 N3 ? ? B DG 1003 C DC 2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 26 O2 ? ? B DG 1003 C DC 2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 26 N4 ? ? B DG 1003 C DC 2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 25 N1 ? ? B DC 1004 C DG 2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 25 O6 ? ? B DC 1004 C DG 2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 25 N2 ? ? B DC 1004 C DG 2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 24 N3 ? ? B DA 1005 C DT 2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 24 O4 ? ? B DA 1005 C DT 2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 23 N1 ? ? B DT 1006 C DA 2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 23 N6 ? ? B DT 1006 C DA 2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 22 N1 ? ? B DT 1007 C DA 2022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 22 N6 ? ? B DT 1007 C DA 2022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 21 N1 ? ? B DT 1008 C DA 2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 21 N6 ? ? B DT 1008 C DA 2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 20 N1 ? ? B DT 1009 C DA 2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 20 N6 ? ? B DT 1009 C DA 2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 19 N1 ? ? B DC 1010 C DG 2019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 19 O6 ? ? B DC 1010 C DG 2019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 19 N2 ? ? B DC 1010 C DG 2019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 18 N3 ? ? B DA 1011 C DT 2018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 18 O4 ? ? B DA 1011 C DT 2018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 17 N1 ? ? B DC 1012 C DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 17 O6 ? ? B DC 1012 C DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 17 N2 ? ? B DC 1012 C DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 16 N3 ? ? B DG 1013 C DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 16 O2 ? ? B DG 1013 C DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 16 N4 ? ? B DG 1013 C DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DC 14 N3 ? ? ? 1_555 B DG 15 N1 ? ? B DC 1014 C DG 2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG 15 O6 ? ? B DC 1014 C DG 2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DC 14 O2 ? ? ? 1_555 B DG 15 N2 ? ? B DC 1014 C DG 2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 14 N3 ? ? B DA 1015 C DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 14 O4 ? ? B DA 1015 C DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 16 N3 ? ? ? 1_555 B DA 13 N1 ? ? B DT 1016 C DA 2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DT 16 O4 ? ? ? 1_555 B DA 13 N6 ? ? B DT 1016 C DA 2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DG 17 N1 ? ? ? 1_555 B DC 12 N3 ? ? B DG 1017 C DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DG 17 N2 ? ? ? 1_555 B DC 12 O2 ? ? B DG 1017 C DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DG 17 O6 ? ? ? 1_555 B DC 12 N4 ? ? B DG 1017 C DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 11 N3 ? ? B DA 1018 C DT 2011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 11 O4 ? ? B DA 1018 C DT 2011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DG 19 N1 ? ? ? 1_555 B DC 10 N3 ? ? B DG 1019 C DC 2010 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DG 19 N2 ? ? ? 1_555 B DC 10 O2 ? ? B DG 1019 C DC 2010 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DG 19 O6 ? ? ? 1_555 B DC 10 N4 ? ? B DG 1019 C DC 2010 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 9  N1 ? ? B DT 1020 C DA 2009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DT 20 O4 ? ? ? 1_555 B DA 9  N6 ? ? B DT 1020 C DA 2009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC 8  N3 ? ? B DG 1021 C DC 2008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? A DG 21 N2 ? ? ? 1_555 B DC 8  O2 ? ? B DG 1021 C DC 2008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? A DG 21 O6 ? ? ? 1_555 B DC 8  N4 ? ? B DG 1021 C DC 2008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? A DC 22 N3 ? ? ? 1_555 B DG 7  N1 ? ? B DC 1022 C DG 2007 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? A DC 22 N4 ? ? ? 1_555 B DG 7  O6 ? ? B DC 1022 C DG 2007 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? A DC 22 O2 ? ? ? 1_555 B DG 7  N2 ? ? B DC 1022 C DG 2007 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? A DA 23 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 1023 C DT 2006 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? A DA 23 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 1023 C DT 2006 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? A DC 24 N3 ? ? ? 1_555 B DG 5  N1 ? ? B DC 1024 C DG 2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? A DC 24 N4 ? ? ? 1_555 B DG 5  O6 ? ? B DC 1024 C DG 2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? A DC 24 O2 ? ? ? 1_555 B DG 5  N2 ? ? B DC 1024 C DG 2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? A DA 25 N1 ? ? ? 1_555 B DT 4  N3 ? ? B DA 1025 C DT 2004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? A DA 25 N6 ? ? ? 1_555 B DT 4  O4 ? ? B DA 1025 C DT 2004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? A DG 26 N1 ? ? ? 1_555 B DC 3  N3 ? ? B DG 1026 C DC 2003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? A DG 26 N2 ? ? ? 1_555 B DC 3  O2 ? ? B DG 1026 C DC 2003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? A DG 26 O6 ? ? ? 1_555 B DC 3  N4 ? ? B DG 1026 C DC 2003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 3  ? VAL C 5  ? SER A 3  VAL A 5  
A 2 VAL C 11 ? VAL C 13 ? VAL A 11 VAL A 13 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   GLY 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    4 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    GLY 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     4 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    12 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     12 
# 
_database_PDB_matrix.entry_id          6PAX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    6PAX 
_atom_sites.fract_transf_matrix[1][1]   0.029551 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016211 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005844 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'"  . DA  A 1 1   ? 18.716  -4.214  131.958 1.00 100.50 ? 1001 DA  B "O5'"  1 
ATOM   2    C "C5'"  . DA  A 1 1   ? 17.922  -5.109  132.720 1.00 99.80  ? 1001 DA  B "C5'"  1 
ATOM   3    C "C4'"  . DA  A 1 1   ? 16.913  -5.813  131.847 1.00 97.09  ? 1001 DA  B "C4'"  1 
ATOM   4    O "O4'"  . DA  A 1 1   ? 16.081  -4.873  131.129 1.00 92.97  ? 1001 DA  B "O4'"  1 
ATOM   5    C "C3'"  . DA  A 1 1   ? 17.490  -6.744  130.795 1.00 97.07  ? 1001 DA  B "C3'"  1 
ATOM   6    O "O3'"  . DA  A 1 1   ? 16.559  -7.818  130.758 1.00 99.97  ? 1001 DA  B "O3'"  1 
ATOM   7    C "C2'"  . DA  A 1 1   ? 17.482  -5.889  129.532 1.00 93.33  ? 1001 DA  B "C2'"  1 
ATOM   8    C "C1'"  . DA  A 1 1   ? 16.209  -5.074  129.731 1.00 88.13  ? 1001 DA  B "C1'"  1 
ATOM   9    N N9     . DA  A 1 1   ? 16.098  -3.761  129.107 1.00 78.90  ? 1001 DA  B N9     1 
ATOM   10   C C8     . DA  A 1 1   ? 17.007  -2.779  128.774 1.00 75.73  ? 1001 DA  B C8     1 
ATOM   11   N N7     . DA  A 1 1   ? 16.452  -1.673  128.335 1.00 72.13  ? 1001 DA  B N7     1 
ATOM   12   C C5     . DA  A 1 1   ? 15.090  -1.961  128.361 1.00 67.09  ? 1001 DA  B C5     1 
ATOM   13   C C6     . DA  A 1 1   ? 13.958  -1.215  128.047 1.00 65.75  ? 1001 DA  B C6     1 
ATOM   14   N N6     . DA  A 1 1   ? 13.983  0.047   127.655 1.00 60.25  ? 1001 DA  B N6     1 
ATOM   15   N N1     . DA  A 1 1   ? 12.761  -1.823  128.175 1.00 66.97  ? 1001 DA  B N1     1 
ATOM   16   C C2     . DA  A 1 1   ? 12.725  -3.093  128.615 1.00 66.16  ? 1001 DA  B C2     1 
ATOM   17   N N3     . DA  A 1 1   ? 13.714  -3.880  128.952 1.00 67.15  ? 1001 DA  B N3     1 
ATOM   18   C C4     . DA  A 1 1   ? 14.879  -3.249  128.801 1.00 69.10  ? 1001 DA  B C4     1 
ATOM   19   H H61    . DA  A 1 1   ? 14.853  0.550   127.569 1.00 40.00  ? 1001 DA  B H61    1 
ATOM   20   H H62    . DA  A 1 1   ? 13.101  0.515   127.456 1.00 40.00  ? 1001 DA  B H62    1 
ATOM   21   H "HO5'" . DA  A 1 1   ? 18.081  -3.616  131.560 1.00 40.00  ? 1001 DA  B "HO5'" 1 
ATOM   22   P P      . DA  A 1 2   ? 16.616  -8.889  129.584 1.00 100.79 ? 1002 DA  B P      1 
ATOM   23   O OP1    . DA  A 1 2   ? 17.231  -10.138 130.104 1.00 102.72 ? 1002 DA  B OP1    1 
ATOM   24   O OP2    . DA  A 1 2   ? 17.163  -8.263  128.333 1.00 99.99  ? 1002 DA  B OP2    1 
ATOM   25   O "O5'"  . DA  A 1 2   ? 15.072  -9.130  129.335 1.00 97.46  ? 1002 DA  B "O5'"  1 
ATOM   26   C "C5'"  . DA  A 1 2   ? 14.723  -9.771  128.182 1.00 93.55  ? 1002 DA  B "C5'"  1 
ATOM   27   C "C4'"  . DA  A 1 2   ? 13.649  -9.033  127.435 1.00 89.09  ? 1002 DA  B "C4'"  1 
ATOM   28   O "O4'"  . DA  A 1 2   ? 13.804  -7.599  127.236 1.00 86.25  ? 1002 DA  B "O4'"  1 
ATOM   29   C "C3'"  . DA  A 1 2   ? 13.876  -9.647  126.077 1.00 88.07  ? 1002 DA  B "C3'"  1 
ATOM   30   O "O3'"  . DA  A 1 2   ? 12.913  -10.600 125.749 1.00 93.33  ? 1002 DA  B "O3'"  1 
ATOM   31   C "C2'"  . DA  A 1 2   ? 14.194  -8.512  125.113 1.00 83.20  ? 1002 DA  B "C2'"  1 
ATOM   32   C "C1'"  . DA  A 1 2   ? 13.602  -7.340  125.846 1.00 79.89  ? 1002 DA  B "C1'"  1 
ATOM   33   N N9     . DA  A 1 2   ? 14.037  -5.975  125.532 1.00 70.35  ? 1002 DA  B N9     1 
ATOM   34   C C8     . DA  A 1 2   ? 15.248  -5.331  125.361 1.00 63.10  ? 1002 DA  B C8     1 
ATOM   35   N N7     . DA  A 1 2   ? 15.125  -4.045  125.096 1.00 55.85  ? 1002 DA  B N7     1 
ATOM   36   C C5     . DA  A 1 2   ? 13.746  -3.838  125.100 1.00 57.89  ? 1002 DA  B C5     1 
ATOM   37   C C6     . DA  A 1 2   ? 12.944  -2.714  124.895 1.00 57.22  ? 1002 DA  B C6     1 
ATOM   38   N N6     . DA  A 1 2   ? 13.404  -1.488  124.641 1.00 60.06  ? 1002 DA  B N6     1 
ATOM   39   N N1     . DA  A 1 2   ? 11.604  -2.883  124.953 1.00 59.00  ? 1002 DA  B N1     1 
ATOM   40   C C2     . DA  A 1 2   ? 11.110  -4.099  125.193 1.00 59.92  ? 1002 DA  B C2     1 
ATOM   41   N N3     . DA  A 1 2   ? 11.755  -5.224  125.405 1.00 62.85  ? 1002 DA  B N3     1 
ATOM   42   C C4     . DA  A 1 2   ? 13.084  -5.021  125.349 1.00 63.11  ? 1002 DA  B C4     1 
ATOM   43   H H61    . DA  A 1 2   ? 12.739  -0.729  124.529 1.00 40.00  ? 1002 DA  B H61    1 
ATOM   44   H H62    . DA  A 1 2   ? 14.393  -1.318  124.575 1.00 40.00  ? 1002 DA  B H62    1 
ATOM   45   P P      . DG  A 1 3   ? 13.364  -11.806 124.817 1.00 95.24  ? 1003 DG  B P      1 
ATOM   46   O OP1    . DG  A 1 3   ? 12.944  -13.118 125.399 1.00 94.39  ? 1003 DG  B OP1    1 
ATOM   47   O OP2    . DG  A 1 3   ? 14.787  -11.526 124.540 1.00 93.52  ? 1003 DG  B OP2    1 
ATOM   48   O "O5'"  . DG  A 1 3   ? 12.563  -11.385 123.527 1.00 90.89  ? 1003 DG  B "O5'"  1 
ATOM   49   C "C5'"  . DG  A 1 3   ? 12.345  -9.996  123.391 1.00 83.65  ? 1003 DG  B "C5'"  1 
ATOM   50   C "C4'"  . DG  A 1 3   ? 10.892  -9.714  123.145 1.00 76.51  ? 1003 DG  B "C4'"  1 
ATOM   51   O "O4'"  . DG  A 1 3   ? 10.763  -8.276  123.199 1.00 73.63  ? 1003 DG  B "O4'"  1 
ATOM   52   C "C3'"  . DG  A 1 3   ? 10.653  -10.102 121.702 1.00 75.91  ? 1003 DG  B "C3'"  1 
ATOM   53   O "O3'"  . DG  A 1 3   ? 9.300   -10.375 121.387 1.00 75.67  ? 1003 DG  B "O3'"  1 
ATOM   54   C "C2'"  . DG  A 1 3   ? 11.198  -8.913  120.952 1.00 73.21  ? 1003 DG  B "C2'"  1 
ATOM   55   C "C1'"  . DG  A 1 3   ? 10.792  -7.776  121.878 1.00 68.18  ? 1003 DG  B "C1'"  1 
ATOM   56   N N9     . DG  A 1 3   ? 11.652  -6.611  121.848 1.00 58.39  ? 1003 DG  B N9     1 
ATOM   57   C C8     . DG  A 1 3   ? 13.031  -6.527  121.915 1.00 55.75  ? 1003 DG  B C8     1 
ATOM   58   N N7     . DG  A 1 3   ? 13.465  -5.295  121.816 1.00 52.14  ? 1003 DG  B N7     1 
ATOM   59   C C5     . DG  A 1 3   ? 12.302  -4.544  121.680 1.00 47.64  ? 1003 DG  B C5     1 
ATOM   60   C C6     . DG  A 1 3   ? 12.114  -3.139  121.517 1.00 47.35  ? 1003 DG  B C6     1 
ATOM   61   O O6     . DG  A 1 3   ? 12.971  -2.263  121.421 1.00 40.29  ? 1003 DG  B O6     1 
ATOM   62   N N1     . DG  A 1 3   ? 10.755  -2.800  121.452 1.00 46.26  ? 1003 DG  B N1     1 
ATOM   63   C C2     . DG  A 1 3   ? 9.718   -3.714  121.512 1.00 52.88  ? 1003 DG  B C2     1 
ATOM   64   N N2     . DG  A 1 3   ? 8.463   -3.247  121.459 1.00 53.13  ? 1003 DG  B N2     1 
ATOM   65   N N3     . DG  A 1 3   ? 9.889   -5.018  121.629 1.00 54.42  ? 1003 DG  B N3     1 
ATOM   66   C C4     . DG  A 1 3   ? 11.196  -5.349  121.714 1.00 52.52  ? 1003 DG  B C4     1 
ATOM   67   H H1     . DG  A 1 3   ? 10.508  -1.832  121.378 1.00 40.00  ? 1003 DG  B H1     1 
ATOM   68   H H21    . DG  A 1 3   ? 8.257   -2.270  121.387 1.00 40.00  ? 1003 DG  B H21    1 
ATOM   69   H H22    . DG  A 1 3   ? 7.710   -3.921  121.526 1.00 40.00  ? 1003 DG  B H22    1 
ATOM   70   P P      . DC  A 1 4   ? 9.003   -11.236 120.075 1.00 81.73  ? 1004 DC  B P      1 
ATOM   71   O OP1    . DC  A 1 4   ? 8.842   -12.644 120.508 1.00 83.06  ? 1004 DC  B OP1    1 
ATOM   72   O OP2    . DC  A 1 4   ? 10.059  -10.882 119.089 1.00 78.17  ? 1004 DC  B OP2    1 
ATOM   73   O "O5'"  . DC  A 1 4   ? 7.616   -10.699 119.506 1.00 82.69  ? 1004 DC  B "O5'"  1 
ATOM   74   C "C5'"  . DC  A 1 4   ? 6.551   -10.344 120.372 1.00 79.28  ? 1004 DC  B "C5'"  1 
ATOM   75   C "C4'"  . DC  A 1 4   ? 5.883   -9.109  119.831 1.00 72.77  ? 1004 DC  B "C4'"  1 
ATOM   76   O "O4'"  . DC  A 1 4   ? 6.797   -7.994  119.922 1.00 68.71  ? 1004 DC  B "O4'"  1 
ATOM   77   C "C3'"  . DC  A 1 4   ? 5.507   -9.218  118.355 1.00 70.48  ? 1004 DC  B "C3'"  1 
ATOM   78   O "O3'"  . DC  A 1 4   ? 4.343   -8.425  118.200 1.00 73.13  ? 1004 DC  B "O3'"  1 
ATOM   79   C "C2'"  . DC  A 1 4   ? 6.689   -8.567  117.657 1.00 66.19  ? 1004 DC  B "C2'"  1 
ATOM   80   C "C1'"  . DC  A 1 4   ? 6.970   -7.444  118.633 1.00 64.30  ? 1004 DC  B "C1'"  1 
ATOM   81   N N1     . DC  A 1 4   ? 8.286   -6.790  118.581 1.00 59.79  ? 1004 DC  B N1     1 
ATOM   82   C C2     . DC  A 1 4   ? 8.314   -5.399  118.609 1.00 60.57  ? 1004 DC  B C2     1 
ATOM   83   O O2     . DC  A 1 4   ? 7.235   -4.783  118.689 1.00 66.66  ? 1004 DC  B O2     1 
ATOM   84   N N3     . DC  A 1 4   ? 9.495   -4.758  118.535 1.00 52.32  ? 1004 DC  B N3     1 
ATOM   85   C C4     . DC  A 1 4   ? 10.625  -5.449  118.468 1.00 49.57  ? 1004 DC  B C4     1 
ATOM   86   N N4     . DC  A 1 4   ? 11.736  -4.753  118.394 1.00 45.84  ? 1004 DC  B N4     1 
ATOM   87   C C5     . DC  A 1 4   ? 10.642  -6.870  118.462 1.00 49.79  ? 1004 DC  B C5     1 
ATOM   88   C C6     . DC  A 1 4   ? 9.454   -7.498  118.520 1.00 56.08  ? 1004 DC  B C6     1 
ATOM   89   H H41    . DC  A 1 4   ? 11.587  -3.759  118.490 1.00 40.00  ? 1004 DC  B H41    1 
ATOM   90   H H42    . DC  A 1 4   ? 12.671  -5.113  118.292 1.00 40.00  ? 1004 DC  B H42    1 
ATOM   91   P P      . DA  A 1 5   ? 3.457   -8.553  116.884 1.00 74.41  ? 1005 DA  B P      1 
ATOM   92   O OP1    . DA  A 1 5   ? 2.119   -9.053  117.355 1.00 73.57  ? 1005 DA  B OP1    1 
ATOM   93   O OP2    . DA  A 1 5   ? 4.174   -9.280  115.815 1.00 71.87  ? 1005 DA  B OP2    1 
ATOM   94   O "O5'"  . DA  A 1 5   ? 3.305   -7.014  116.491 1.00 72.90  ? 1005 DA  B "O5'"  1 
ATOM   95   C "C5'"  . DA  A 1 5   ? 3.285   -6.015  117.513 1.00 66.26  ? 1005 DA  B "C5'"  1 
ATOM   96   C "C4'"  . DA  A 1 5   ? 3.365   -4.643  116.894 1.00 61.96  ? 1005 DA  B "C4'"  1 
ATOM   97   O "O4'"  . DA  A 1 5   ? 4.722   -4.177  116.769 1.00 55.57  ? 1005 DA  B "O4'"  1 
ATOM   98   C "C3'"  . DA  A 1 5   ? 2.737   -4.517  115.512 1.00 60.87  ? 1005 DA  B "C3'"  1 
ATOM   99   O "O3'"  . DA  A 1 5   ? 2.099   -3.247  115.501 1.00 64.93  ? 1005 DA  B "O3'"  1 
ATOM   100  C "C2'"  . DA  A 1 5   ? 3.947   -4.582  114.595 1.00 59.44  ? 1005 DA  B "C2'"  1 
ATOM   101  C "C1'"  . DA  A 1 5   ? 5.030   -3.910  115.417 1.00 51.68  ? 1005 DA  B "C1'"  1 
ATOM   102  N N9     . DA  A 1 5   ? 6.403   -4.337  115.204 1.00 45.00  ? 1005 DA  B N9     1 
ATOM   103  C C8     . DA  A 1 5   ? 6.911   -5.605  115.288 1.00 42.35  ? 1005 DA  B C8     1 
ATOM   104  N N7     . DA  A 1 5   ? 8.216   -5.656  115.174 1.00 42.36  ? 1005 DA  B N7     1 
ATOM   105  C C5     . DA  A 1 5   ? 8.592   -4.337  114.977 1.00 41.96  ? 1005 DA  B C5     1 
ATOM   106  C C6     . DA  A 1 5   ? 9.841   -3.723  114.831 1.00 43.34  ? 1005 DA  B C6     1 
ATOM   107  N N6     . DA  A 1 5   ? 11.009  -4.360  114.896 1.00 46.10  ? 1005 DA  B N6     1 
ATOM   108  N N1     . DA  A 1 5   ? 9.859   -2.392  114.642 1.00 40.20  ? 1005 DA  B N1     1 
ATOM   109  C C2     . DA  A 1 5   ? 8.692   -1.718  114.648 1.00 42.71  ? 1005 DA  B C2     1 
ATOM   110  N N3     . DA  A 1 5   ? 7.463   -2.173  114.816 1.00 44.79  ? 1005 DA  B N3     1 
ATOM   111  C C4     . DA  A 1 5   ? 7.479   -3.507  114.966 1.00 43.40  ? 1005 DA  B C4     1 
ATOM   112  H H61    . DA  A 1 5   ? 11.874  -3.841  114.777 1.00 40.00  ? 1005 DA  B H61    1 
ATOM   113  H H62    . DA  A 1 5   ? 11.055  -5.352  115.058 1.00 40.00  ? 1005 DA  B H62    1 
ATOM   114  P P      . DT  A 1 6   ? 0.991   -2.906  114.390 1.00 64.72  ? 1006 DT  B P      1 
ATOM   115  O OP1    . DT  A 1 6   ? -0.096  -2.191  115.118 1.00 64.68  ? 1006 DT  B OP1    1 
ATOM   116  O OP2    . DT  A 1 6   ? 0.676   -4.094  113.553 1.00 57.76  ? 1006 DT  B OP2    1 
ATOM   117  O "O5'"  . DT  A 1 6   ? 1.760   -1.841  113.507 1.00 58.38  ? 1006 DT  B "O5'"  1 
ATOM   118  C "C5'"  . DT  A 1 6   ? 3.173   -1.820  113.555 1.00 52.37  ? 1006 DT  B "C5'"  1 
ATOM   119  C "C4'"  . DT  A 1 6   ? 3.692   -0.483  113.110 1.00 42.88  ? 1006 DT  B "C4'"  1 
ATOM   120  O "O4'"  . DT  A 1 6   ? 5.124   -0.602  113.120 1.00 44.11  ? 1006 DT  B "O4'"  1 
ATOM   121  C "C3'"  . DT  A 1 6   ? 3.301   -0.147  111.671 1.00 36.98  ? 1006 DT  B "C3'"  1 
ATOM   122  O "O3'"  . DT  A 1 6   ? 3.172   1.260   111.520 1.00 35.28  ? 1006 DT  B "O3'"  1 
ATOM   123  C "C2'"  . DT  A 1 6   ? 4.431   -0.728  110.852 1.00 39.72  ? 1006 DT  B "C2'"  1 
ATOM   124  C "C1'"  . DT  A 1 6   ? 5.634   -0.694  111.800 1.00 42.05  ? 1006 DT  B "C1'"  1 
ATOM   125  N N1     . DT  A 1 6   ? 6.476   -1.910  111.764 1.00 41.10  ? 1006 DT  B N1     1 
ATOM   126  C C2     . DT  A 1 6   ? 7.819   -1.710  111.659 1.00 39.88  ? 1006 DT  B C2     1 
ATOM   127  O O2     . DT  A 1 6   ? 8.321   -0.612  111.617 1.00 40.63  ? 1006 DT  B O2     1 
ATOM   128  N N3     . DT  A 1 6   ? 8.566   -2.859  111.610 1.00 38.13  ? 1006 DT  B N3     1 
ATOM   129  C C4     . DT  A 1 6   ? 8.106   -4.170  111.652 1.00 37.04  ? 1006 DT  B C4     1 
ATOM   130  O O4     . DT  A 1 6   ? 8.902   -5.103  111.566 1.00 34.79  ? 1006 DT  B O4     1 
ATOM   131  C C5     . DT  A 1 6   ? 6.679   -4.312  111.781 1.00 38.16  ? 1006 DT  B C5     1 
ATOM   132  C C7     . DT  A 1 6   ? 6.104   -5.696  111.860 1.00 33.61  ? 1006 DT  B C7     1 
ATOM   133  C C6     . DT  A 1 6   ? 5.936   -3.188  111.824 1.00 37.57  ? 1006 DT  B C6     1 
ATOM   134  H H3     . DT  A 1 6   ? 9.558   -2.723  111.481 1.00 40.00  ? 1006 DT  B H3     1 
ATOM   135  P P      . DT  A 1 7   ? 2.810   1.870   110.087 1.00 40.87  ? 1007 DT  B P      1 
ATOM   136  O OP1    . DT  A 1 7   ? 2.195   3.218   110.334 1.00 39.21  ? 1007 DT  B OP1    1 
ATOM   137  O OP2    . DT  A 1 7   ? 2.090   0.875   109.253 1.00 39.92  ? 1007 DT  B OP2    1 
ATOM   138  O "O5'"  . DT  A 1 7   ? 4.236   2.124   109.433 1.00 40.58  ? 1007 DT  B "O5'"  1 
ATOM   139  C "C5'"  . DT  A 1 7   ? 5.220   2.889   110.142 1.00 47.87  ? 1007 DT  B "C5'"  1 
ATOM   140  C "C4'"  . DT  A 1 7   ? 6.548   2.846   109.430 1.00 47.26  ? 1007 DT  B "C4'"  1 
ATOM   141  O "O4'"  . DT  A 1 7   ? 7.180   1.549   109.556 1.00 47.86  ? 1007 DT  B "O4'"  1 
ATOM   142  C "C3'"  . DT  A 1 7   ? 6.459   3.147   107.941 1.00 47.36  ? 1007 DT  B "C3'"  1 
ATOM   143  O "O3'"  . DT  A 1 7   ? 7.508   4.026   107.623 1.00 55.15  ? 1007 DT  B "O3'"  1 
ATOM   144  C "C2'"  . DT  A 1 7   ? 6.684   1.790   107.301 1.00 42.36  ? 1007 DT  B "C2'"  1 
ATOM   145  C "C1'"  . DT  A 1 7   ? 7.648   1.162   108.284 1.00 45.32  ? 1007 DT  B "C1'"  1 
ATOM   146  N N1     . DT  A 1 7   ? 7.745   -0.299  108.268 1.00 45.84  ? 1007 DT  B N1     1 
ATOM   147  C C2     . DT  A 1 7   ? 8.994   -0.859  108.280 1.00 45.73  ? 1007 DT  B C2     1 
ATOM   148  O O2     . DT  A 1 7   ? 10.015  -0.201  108.251 1.00 51.84  ? 1007 DT  B O2     1 
ATOM   149  N N3     . DT  A 1 7   ? 9.006   -2.226  108.320 1.00 39.12  ? 1007 DT  B N3     1 
ATOM   150  C C4     . DT  A 1 7   ? 7.925   -3.073  108.329 1.00 37.42  ? 1007 DT  B C4     1 
ATOM   151  O O4     . DT  A 1 7   ? 8.109   -4.292  108.343 1.00 38.14  ? 1007 DT  B O4     1 
ATOM   152  C C5     . DT  A 1 7   ? 6.641   -2.411  108.303 1.00 36.89  ? 1007 DT  B C5     1 
ATOM   153  C C7     . DT  A 1 7   ? 5.395   -3.233  108.325 1.00 33.76  ? 1007 DT  B C7     1 
ATOM   154  C C6     . DT  A 1 7   ? 6.621   -1.076  108.267 1.00 40.27  ? 1007 DT  B C6     1 
ATOM   155  H H3     . DT  A 1 7   ? 9.921   -2.650  108.311 1.00 40.00  ? 1007 DT  B H3     1 
ATOM   156  P P      . DT  A 1 8   ? 7.595   4.672   106.165 1.00 59.58  ? 1008 DT  B P      1 
ATOM   157  O OP1    . DT  A 1 8   ? 7.751   6.132   106.410 1.00 63.52  ? 1008 DT  B OP1    1 
ATOM   158  O OP2    . DT  A 1 8   ? 6.504   4.191   105.283 1.00 60.49  ? 1008 DT  B OP2    1 
ATOM   159  O "O5'"  . DT  A 1 8   ? 8.973   4.079   105.638 1.00 56.42  ? 1008 DT  B "O5'"  1 
ATOM   160  C "C5'"  . DT  A 1 8   ? 10.105  4.015   106.520 1.00 45.28  ? 1008 DT  B "C5'"  1 
ATOM   161  C "C4'"  . DT  A 1 8   ? 11.226  3.235   105.879 1.00 44.96  ? 1008 DT  B "C4'"  1 
ATOM   162  O "O4'"  . DT  A 1 8   ? 10.972  1.817   105.988 1.00 43.69  ? 1008 DT  B "O4'"  1 
ATOM   163  C "C3'"  . DT  A 1 8   ? 11.424  3.520   104.393 1.00 41.71  ? 1008 DT  B "C3'"  1 
ATOM   164  O "O3'"  . DT  A 1 8   ? 12.807  3.743   104.154 1.00 43.93  ? 1008 DT  B "O3'"  1 
ATOM   165  C "C2'"  . DT  A 1 8   ? 10.888  2.272   103.701 1.00 39.16  ? 1008 DT  B "C2'"  1 
ATOM   166  C "C1'"  . DT  A 1 8   ? 11.147  1.196   104.737 1.00 39.31  ? 1008 DT  B "C1'"  1 
ATOM   167  N N1     . DT  A 1 8   ? 10.293  -0.002  104.711 1.00 38.37  ? 1008 DT  B N1     1 
ATOM   168  C C2     . DT  A 1 8   ? 10.944  -1.202  104.751 1.00 41.39  ? 1008 DT  B C2     1 
ATOM   169  O O2     . DT  A 1 8   ? 12.169  -1.281  104.788 1.00 44.13  ? 1008 DT  B O2     1 
ATOM   170  N N3     . DT  A 1 8   ? 10.120  -2.304  104.778 1.00 40.05  ? 1008 DT  B N3     1 
ATOM   171  C C4     . DT  A 1 8   ? 8.727   -2.305  104.784 1.00 42.99  ? 1008 DT  B C4     1 
ATOM   172  O O4     . DT  A 1 8   ? 8.102   -3.362  104.875 1.00 38.10  ? 1008 DT  B O4     1 
ATOM   173  C C5     . DT  A 1 8   ? 8.119   -1.003  104.714 1.00 40.97  ? 1008 DT  B C5     1 
ATOM   174  C C7     . DT  A 1 8   ? 6.628   -0.896  104.681 1.00 32.75  ? 1008 DT  B C7     1 
ATOM   175  C C6     . DT  A 1 8   ? 8.922   0.067   104.676 1.00 38.10  ? 1008 DT  B C6     1 
ATOM   176  H H3     . DT  A 1 8   ? 10.584  -3.204  104.813 1.00 40.00  ? 1008 DT  B H3     1 
ATOM   177  P P      . DT  A 1 9   ? 13.293  4.431   102.793 1.00 42.10  ? 1009 DT  B P      1 
ATOM   178  O OP1    . DT  A 1 9   ? 14.438  5.318   103.113 1.00 48.09  ? 1009 DT  B OP1    1 
ATOM   179  O OP2    . DT  A 1 9   ? 12.146  4.955   102.076 1.00 43.17  ? 1009 DT  B OP2    1 
ATOM   180  O "O5'"  . DT  A 1 9   ? 13.878  3.199   102.008 1.00 47.32  ? 1009 DT  B "O5'"  1 
ATOM   181  C "C5'"  . DT  A 1 9   ? 13.612  1.897   102.502 1.00 50.43  ? 1009 DT  B "C5'"  1 
ATOM   182  C "C4'"  . DT  A 1 9   ? 14.629  0.922   101.985 1.00 44.08  ? 1009 DT  B "C4'"  1 
ATOM   183  O "O4'"  . DT  A 1 9   ? 13.998  -0.343  102.180 1.00 46.67  ? 1009 DT  B "O4'"  1 
ATOM   184  C "C3'"  . DT  A 1 9   ? 14.845  1.064   100.482 1.00 42.87  ? 1009 DT  B "C3'"  1 
ATOM   185  O "O3'"  . DT  A 1 9   ? 16.200  0.741   100.149 1.00 45.48  ? 1009 DT  B "O3'"  1 
ATOM   186  C "C2'"  . DT  A 1 9   ? 13.828  0.114   99.875  1.00 43.75  ? 1009 DT  B "C2'"  1 
ATOM   187  C "C1'"  . DT  A 1 9   ? 13.605  -0.923  100.959 1.00 42.94  ? 1009 DT  B "C1'"  1 
ATOM   188  N N1     . DT  A 1 9   ? 12.206  -1.340  101.115 1.00 38.76  ? 1009 DT  B N1     1 
ATOM   189  C C2     . DT  A 1 9   ? 11.966  -2.677  101.365 1.00 37.37  ? 1009 DT  B C2     1 
ATOM   190  O O2     . DT  A 1 9   ? 12.853  -3.504  101.403 1.00 35.31  ? 1009 DT  B O2     1 
ATOM   191  N N3     . DT  A 1 9   ? 10.641  -3.005  101.548 1.00 38.30  ? 1009 DT  B N3     1 
ATOM   192  C C4     . DT  A 1 9   ? 9.568   -2.151  101.505 1.00 35.21  ? 1009 DT  B C4     1 
ATOM   193  O O4     . DT  A 1 9   ? 8.464   -2.575  101.715 1.00 38.23  ? 1009 DT  B O4     1 
ATOM   194  C C5     . DT  A 1 9   ? 9.881   -0.758  101.211 1.00 33.78  ? 1009 DT  B C5     1 
ATOM   195  C C7     . DT  A 1 9   ? 8.772   0.256   101.139 1.00 28.58  ? 1009 DT  B C7     1 
ATOM   196  C C6     . DT  A 1 9   ? 11.172  -0.431  101.032 1.00 32.89  ? 1009 DT  B C6     1 
ATOM   197  H H3     . DT  A 1 9   ? 10.445  -3.985  101.678 1.00 40.00  ? 1009 DT  B H3     1 
ATOM   198  P P      . DC  A 1 10  ? 16.707  0.967   98.648  1.00 48.62  ? 1010 DC  B P      1 
ATOM   199  O OP1    . DC  A 1 10  ? 18.171  1.194   98.778  1.00 51.61  ? 1010 DC  B OP1    1 
ATOM   200  O OP2    . DC  A 1 10  ? 15.852  1.976   97.978  1.00 44.98  ? 1010 DC  B OP2    1 
ATOM   201  O "O5'"  . DC  A 1 10  ? 16.449  -0.429  97.953  1.00 47.94  ? 1010 DC  B "O5'"  1 
ATOM   202  C "C5'"  . DC  A 1 10  ? 17.108  -1.587  98.449  1.00 50.77  ? 1010 DC  B "C5'"  1 
ATOM   203  C "C4'"  . DC  A 1 10  ? 16.630  -2.820  97.726  1.00 53.40  ? 1010 DC  B "C4'"  1 
ATOM   204  O "O4'"  . DC  A 1 10  ? 15.292  -3.176  98.159  1.00 51.52  ? 1010 DC  B "O4'"  1 
ATOM   205  C "C3'"  . DC  A 1 10  ? 16.561  -2.668  96.209  1.00 54.38  ? 1010 DC  B "C3'"  1 
ATOM   206  O "O3'"  . DC  A 1 10  ? 16.947  -3.897  95.609  1.00 60.49  ? 1010 DC  B "O3'"  1 
ATOM   207  C "C2'"  . DC  A 1 10  ? 15.081  -2.453  95.954  1.00 51.73  ? 1010 DC  B "C2'"  1 
ATOM   208  C "C1'"  . DC  A 1 10  ? 14.488  -3.371  97.006  1.00 51.55  ? 1010 DC  B "C1'"  1 
ATOM   209  N N1     . DC  A 1 10  ? 13.084  -3.125  97.371  1.00 51.18  ? 1010 DC  B N1     1 
ATOM   210  C C2     . DC  A 1 10  ? 12.338  -4.182  97.900  1.00 47.68  ? 1010 DC  B C2     1 
ATOM   211  O O2     . DC  A 1 10  ? 12.885  -5.271  98.070  1.00 49.54  ? 1010 DC  B O2     1 
ATOM   212  N N3     . DC  A 1 10  ? 11.049  -3.992  98.210  1.00 43.98  ? 1010 DC  B N3     1 
ATOM   213  C C4     . DC  A 1 10  ? 10.484  -2.806  97.989  1.00 41.18  ? 1010 DC  B C4     1 
ATOM   214  N N4     . DC  A 1 10  ? 9.184   -2.686  98.258  1.00 40.35  ? 1010 DC  B N4     1 
ATOM   215  C C5     . DC  A 1 10  ? 11.223  -1.698  97.473  1.00 41.30  ? 1010 DC  B C5     1 
ATOM   216  C C6     . DC  A 1 10  ? 12.506  -1.901  97.183  1.00 43.27  ? 1010 DC  B C6     1 
ATOM   217  H H41    . DC  A 1 10  ? 8.666   -3.479  98.595  1.00 40.00  ? 1010 DC  B H41    1 
ATOM   218  H H42    . DC  A 1 10  ? 8.714   -1.798  98.128  1.00 40.00  ? 1010 DC  B H42    1 
ATOM   219  P P      . DA  A 1 11  ? 18.183  -3.925  94.596  1.00 58.31  ? 1011 DA  B P      1 
ATOM   220  O OP1    . DA  A 1 11  ? 19.342  -3.353  95.354  1.00 62.65  ? 1011 DA  B OP1    1 
ATOM   221  O OP2    . DA  A 1 11  ? 17.752  -3.291  93.324  1.00 53.93  ? 1011 DA  B OP2    1 
ATOM   222  O "O5'"  . DA  A 1 11  ? 18.404  -5.485  94.362  1.00 54.34  ? 1011 DA  B "O5'"  1 
ATOM   223  C "C5'"  . DA  A 1 11  ? 18.712  -6.344  95.472  1.00 55.66  ? 1011 DA  B "C5'"  1 
ATOM   224  C "C4'"  . DA  A 1 11  ? 17.872  -7.602  95.429  1.00 53.35  ? 1011 DA  B "C4'"  1 
ATOM   225  O "O4'"  . DA  A 1 11  ? 16.473  -7.334  95.684  1.00 55.63  ? 1011 DA  B "O4'"  1 
ATOM   226  C "C3'"  . DA  A 1 11  ? 17.892  -8.350  94.109  1.00 53.15  ? 1011 DA  B "C3'"  1 
ATOM   227  O "O3'"  . DA  A 1 11  ? 17.865  -9.746  94.408  1.00 59.46  ? 1011 DA  B "O3'"  1 
ATOM   228  C "C2'"  . DA  A 1 11  ? 16.606  -7.901  93.428  1.00 50.45  ? 1011 DA  B "C2'"  1 
ATOM   229  C "C1'"  . DA  A 1 11  ? 15.653  -7.761  94.591  1.00 47.15  ? 1011 DA  B "C1'"  1 
ATOM   230  N N9     . DA  A 1 11  ? 14.590  -6.786  94.438  1.00 46.20  ? 1011 DA  B N9     1 
ATOM   231  C C8     . DA  A 1 11  ? 14.702  -5.481  94.030  1.00 39.59  ? 1011 DA  B C8     1 
ATOM   232  N N7     . DA  A 1 11  ? 13.590  -4.804  94.100  1.00 42.67  ? 1011 DA  B N7     1 
ATOM   233  C C5     . DA  A 1 11  ? 12.665  -5.731  94.573  1.00 41.86  ? 1011 DA  B C5     1 
ATOM   234  C C6     . DA  A 1 11  ? 11.298  -5.628  94.867  1.00 41.38  ? 1011 DA  B C6     1 
ATOM   235  N N6     . DA  A 1 11  ? 10.586  -4.492  94.752  1.00 45.30  ? 1011 DA  B N6     1 
ATOM   236  N N1     . DA  A 1 11  ? 10.674  -6.746  95.304  1.00 42.58  ? 1011 DA  B N1     1 
ATOM   237  C C2     . DA  A 1 11  ? 11.385  -7.880  95.437  1.00 43.14  ? 1011 DA  B C2     1 
ATOM   238  N N3     . DA  A 1 11  ? 12.680  -8.096  95.191  1.00 37.59  ? 1011 DA  B N3     1 
ATOM   239  C C4     . DA  A 1 11  ? 13.270  -6.958  94.754  1.00 41.14  ? 1011 DA  B C4     1 
ATOM   240  H H61    . DA  A 1 11  ? 9.591   -4.491  94.940  1.00 40.00  ? 1011 DA  B H61    1 
ATOM   241  H H62    . DA  A 1 11  ? 11.026  -3.645  94.439  1.00 40.00  ? 1011 DA  B H62    1 
ATOM   242  P P      . DC  A 1 12  ? 18.343  -10.789 93.293  1.00 60.14  ? 1012 DC  B P      1 
ATOM   243  O OP1    . DC  A 1 12  ? 18.710  -12.085 93.916  1.00 56.22  ? 1012 DC  B OP1    1 
ATOM   244  O OP2    . DC  A 1 12  ? 19.357  -10.038 92.492  1.00 53.28  ? 1012 DC  B OP2    1 
ATOM   245  O "O5'"  . DC  A 1 12  ? 17.027  -11.029 92.431  1.00 60.46  ? 1012 DC  B "O5'"  1 
ATOM   246  C "C5'"  . DC  A 1 12  ? 15.775  -10.499 92.876  1.00 58.96  ? 1012 DC  B "C5'"  1 
ATOM   247  C "C4'"  . DC  A 1 12  ? 14.694  -11.551 92.816  1.00 57.33  ? 1012 DC  B "C4'"  1 
ATOM   248  O "O4'"  . DC  A 1 12  ? 13.453  -10.889 93.146  1.00 59.29  ? 1012 DC  B "O4'"  1 
ATOM   249  C "C3'"  . DC  A 1 12  ? 14.495  -12.150 91.423  1.00 57.75  ? 1012 DC  B "C3'"  1 
ATOM   250  O "O3'"  . DC  A 1 12  ? 14.129  -13.528 91.500  1.00 56.94  ? 1012 DC  B "O3'"  1 
ATOM   251  C "C2'"  . DC  A 1 12  ? 13.403  -11.306 90.802  1.00 56.77  ? 1012 DC  B "C2'"  1 
ATOM   252  C "C1'"  . DC  A 1 12  ? 12.634  -10.730 91.998  1.00 54.10  ? 1012 DC  B "C1'"  1 
ATOM   253  N N1     . DC  A 1 12  ? 12.379  -9.292  91.856  1.00 44.71  ? 1012 DC  B N1     1 
ATOM   254  C C2     . DC  A 1 12  ? 11.101  -8.788  92.073  1.00 43.88  ? 1012 DC  B C2     1 
ATOM   255  O O2     . DC  A 1 12  ? 10.204  -9.547  92.440  1.00 40.47  ? 1012 DC  B O2     1 
ATOM   256  N N3     . DC  A 1 12  ? 10.872  -7.475  91.884  1.00 44.01  ? 1012 DC  B N3     1 
ATOM   257  C C4     . DC  A 1 12  ? 11.864  -6.671  91.508  1.00 45.14  ? 1012 DC  B C4     1 
ATOM   258  N N4     . DC  A 1 12  ? 11.590  -5.372  91.335  1.00 42.91  ? 1012 DC  B N4     1 
ATOM   259  C C5     . DC  A 1 12  ? 13.180  -7.152  91.290  1.00 45.79  ? 1012 DC  B C5     1 
ATOM   260  C C6     . DC  A 1 12  ? 13.393  -8.456  91.483  1.00 46.77  ? 1012 DC  B C6     1 
ATOM   261  H H41    . DC  A 1 12  ? 10.648  -5.027  91.483  1.00 40.00  ? 1012 DC  B H41    1 
ATOM   262  H H42    . DC  A 1 12  ? 12.328  -4.731  91.091  1.00 40.00  ? 1012 DC  B H42    1 
ATOM   263  P P      . DG  A 1 13  ? 14.441  -14.500 90.256  1.00 53.92  ? 1013 DG  B P      1 
ATOM   264  O OP1    . DG  A 1 13  ? 14.785  -15.809 90.836  1.00 58.04  ? 1013 DG  B OP1    1 
ATOM   265  O OP2    . DG  A 1 13  ? 15.381  -13.850 89.331  1.00 49.40  ? 1013 DG  B OP2    1 
ATOM   266  O "O5'"  . DG  A 1 13  ? 13.032  -14.597 89.540  1.00 48.79  ? 1013 DG  B "O5'"  1 
ATOM   267  C "C5'"  . DG  A 1 13  ? 11.911  -15.084 90.257  1.00 50.45  ? 1013 DG  B "C5'"  1 
ATOM   268  C "C4'"  . DG  A 1 13  ? 10.637  -14.547 89.663  1.00 52.07  ? 1013 DG  B "C4'"  1 
ATOM   269  O "O4'"  . DG  A 1 13  ? 10.626  -13.102 89.794  1.00 54.82  ? 1013 DG  B "O4'"  1 
ATOM   270  C "C3'"  . DG  A 1 13  ? 10.432  -14.854 88.174  1.00 53.66  ? 1013 DG  B "C3'"  1 
ATOM   271  O "O3'"  . DG  A 1 13  ? 9.108   -15.337 87.985  1.00 62.87  ? 1013 DG  B "O3'"  1 
ATOM   272  C "C2'"  . DG  A 1 13  ? 10.586  -13.499 87.500  1.00 52.40  ? 1013 DG  B "C2'"  1 
ATOM   273  C "C1'"  . DG  A 1 13  ? 10.109  -12.554 88.588  1.00 53.06  ? 1013 DG  B "C1'"  1 
ATOM   274  N N9     . DG  A 1 13  ? 10.555  -11.163 88.482  1.00 51.53  ? 1013 DG  B N9     1 
ATOM   275  C C8     . DG  A 1 13  ? 11.822  -10.707 88.219  1.00 53.16  ? 1013 DG  B C8     1 
ATOM   276  N N7     . DG  A 1 13  ? 11.907  -9.409  88.205  1.00 53.49  ? 1013 DG  B N7     1 
ATOM   277  C C5     . DG  A 1 13  ? 10.611  -8.982  88.454  1.00 48.21  ? 1013 DG  B C5     1 
ATOM   278  C C6     . DG  A 1 13  ? 10.072  -7.679  88.530  1.00 45.08  ? 1013 DG  B C6     1 
ATOM   279  O O6     . DG  A 1 13  ? 10.651  -6.620  88.393  1.00 42.30  ? 1013 DG  B O6     1 
ATOM   280  N N1     . DG  A 1 13  ? 8.705   -7.694  88.801  1.00 39.35  ? 1013 DG  B N1     1 
ATOM   281  C C2     . DG  A 1 13  ? 7.958   -8.829  88.988  1.00 42.18  ? 1013 DG  B C2     1 
ATOM   282  N N2     . DG  A 1 13  ? 6.654   -8.642  89.235  1.00 37.38  ? 1013 DG  B N2     1 
ATOM   283  N N3     . DG  A 1 13  ? 8.456   -10.054 88.921  1.00 45.96  ? 1013 DG  B N3     1 
ATOM   284  C C4     . DG  A 1 13  ? 9.769   -10.055 88.639  1.00 47.04  ? 1013 DG  B C4     1 
ATOM   285  H H1     . DG  A 1 13  ? 8.225   -6.808  88.855  1.00 40.00  ? 1013 DG  B H1     1 
ATOM   286  H H21    . DG  A 1 13  ? 6.250   -7.709  89.265  1.00 40.00  ? 1013 DG  B H21    1 
ATOM   287  H H22    . DG  A 1 13  ? 6.038   -9.436  89.330  1.00 40.00  ? 1013 DG  B H22    1 
ATOM   288  P P      . DC  A 1 14  ? 8.649   -15.902 86.554  1.00 66.18  ? 1014 DC  B P      1 
ATOM   289  O OP1    . DC  A 1 14  ? 8.028   -17.234 86.770  1.00 65.28  ? 1014 DC  B OP1    1 
ATOM   290  O OP2    . DC  A 1 14  ? 9.774   -15.756 85.598  1.00 58.88  ? 1014 DC  B OP2    1 
ATOM   291  O "O5'"  . DC  A 1 14  ? 7.488   -14.906 86.141  1.00 62.74  ? 1014 DC  B "O5'"  1 
ATOM   292  C "C5'"  . DC  A 1 14  ? 7.540   -13.550 86.562  1.00 57.20  ? 1014 DC  B "C5'"  1 
ATOM   293  C "C4'"  . DC  A 1 14  ? 6.218   -12.861 86.323  1.00 53.16  ? 1014 DC  B "C4'"  1 
ATOM   294  O "O4'"  . DC  A 1 14  ? 6.430   -11.504 86.750  1.00 51.93  ? 1014 DC  B "O4'"  1 
ATOM   295  C "C3'"  . DC  A 1 14  ? 5.800   -12.777 84.852  1.00 47.98  ? 1014 DC  B "C3'"  1 
ATOM   296  O "O3'"  . DC  A 1 14  ? 4.402   -12.960 84.634  1.00 47.32  ? 1014 DC  B "O3'"  1 
ATOM   297  C "C2'"  . DC  A 1 14  ? 6.192   -11.380 84.413  1.00 51.50  ? 1014 DC  B "C2'"  1 
ATOM   298  C "C1'"  . DC  A 1 14  ? 6.330   -10.578 85.688  1.00 50.18  ? 1014 DC  B "C1'"  1 
ATOM   299  N N1     . DC  A 1 14  ? 7.595   -9.854  85.629  1.00 44.83  ? 1014 DC  B N1     1 
ATOM   300  C C2     . DC  A 1 14  ? 7.561   -8.457  85.578  1.00 42.99  ? 1014 DC  B C2     1 
ATOM   301  O O2     . DC  A 1 14  ? 6.475   -7.887  85.712  1.00 48.43  ? 1014 DC  B O2     1 
ATOM   302  N N3     . DC  A 1 14  ? 8.707   -7.774  85.402  1.00 37.00  ? 1014 DC  B N3     1 
ATOM   303  C C4     . DC  A 1 14  ? 9.864   -8.443  85.312  1.00 35.66  ? 1014 DC  B C4     1 
ATOM   304  N N4     . DC  A 1 14  ? 10.978  -7.740  85.136  1.00 32.58  ? 1014 DC  B N4     1 
ATOM   305  C C5     . DC  A 1 14  ? 9.932   -9.876  85.418  1.00 38.00  ? 1014 DC  B C5     1 
ATOM   306  C C6     . DC  A 1 14  ? 8.785   -10.531 85.575  1.00 42.44  ? 1014 DC  B C6     1 
ATOM   307  H H41    . DC  A 1 14  ? 10.918  -6.735  85.056  1.00 40.00  ? 1014 DC  B H41    1 
ATOM   308  H H42    . DC  A 1 14  ? 11.877  -8.199  85.098  1.00 40.00  ? 1014 DC  B H42    1 
ATOM   309  P P      . DA  A 1 15  ? 3.874   -13.124 83.136  1.00 47.34  ? 1015 DA  B P      1 
ATOM   310  O OP1    . DA  A 1 15  ? 2.616   -13.919 83.200  1.00 53.92  ? 1015 DA  B OP1    1 
ATOM   311  O OP2    . DA  A 1 15  ? 5.001   -13.587 82.298  1.00 40.47  ? 1015 DA  B OP2    1 
ATOM   312  O "O5'"  . DA  A 1 15  ? 3.537   -11.629 82.687  1.00 47.41  ? 1015 DA  B "O5'"  1 
ATOM   313  C "C5'"  . DA  A 1 15  ? 2.563   -10.877 83.407  1.00 44.49  ? 1015 DA  B "C5'"  1 
ATOM   314  C "C4'"  . DA  A 1 15  ? 2.416   -9.503  82.802  1.00 44.23  ? 1015 DA  B "C4'"  1 
ATOM   315  O "O4'"  . DA  A 1 15  ? 3.635   -8.747  82.945  1.00 42.85  ? 1015 DA  B "O4'"  1 
ATOM   316  C "C3'"  . DA  A 1 15  ? 2.100   -9.497  81.307  1.00 44.65  ? 1015 DA  B "C3'"  1 
ATOM   317  O "O3'"  . DA  A 1 15  ? 1.204   -8.432  81.039  1.00 51.95  ? 1015 DA  B "O3'"  1 
ATOM   318  C "C2'"  . DA  A 1 15  ? 3.443   -9.224  80.666  1.00 41.37  ? 1015 DA  B "C2'"  1 
ATOM   319  C "C1'"  . DA  A 1 15  ? 4.095   -8.317  81.664  1.00 36.58  ? 1015 DA  B "C1'"  1 
ATOM   320  N N9     . DA  A 1 15  ? 5.553   -8.340  81.681  1.00 37.62  ? 1015 DA  B N9     1 
ATOM   321  C C8     . DA  A 1 15  ? 6.376   -9.415  81.655  1.00 39.28  ? 1015 DA  B C8     1 
ATOM   322  N N7     . DA  A 1 15  ? 7.658   -9.103  81.718  1.00 40.00  ? 1015 DA  B N7     1 
ATOM   323  C C5     . DA  A 1 15  ? 7.668   -7.729  81.762  1.00 39.10  ? 1015 DA  B C5     1 
ATOM   324  C C6     . DA  A 1 15  ? 8.720   -6.794  81.833  1.00 40.28  ? 1015 DA  B C6     1 
ATOM   325  N N6     . DA  A 1 15  ? 10.006  -7.136  81.814  1.00 43.50  ? 1015 DA  B N6     1 
ATOM   326  N N1     . DA  A 1 15  ? 8.400   -5.491  81.913  1.00 38.52  ? 1015 DA  B N1     1 
ATOM   327  C C2     . DA  A 1 15  ? 7.095   -5.159  81.899  1.00 36.09  ? 1015 DA  B C2     1 
ATOM   328  N N3     . DA  A 1 15  ? 6.012   -5.956  81.816  1.00 39.76  ? 1015 DA  B N3     1 
ATOM   329  C C4     . DA  A 1 15  ? 6.376   -7.236  81.749  1.00 42.41  ? 1015 DA  B C4     1 
ATOM   330  H H61    . DA  A 1 15  ? 10.726  -6.432  81.877  1.00 40.00  ? 1015 DA  B H61    1 
ATOM   331  H H62    . DA  A 1 15  ? 10.265  -8.108  81.696  1.00 40.00  ? 1015 DA  B H62    1 
ATOM   332  P P      . DT  A 1 16  ? 0.312   -8.475  79.710  1.00 56.34  ? 1016 DT  B P      1 
ATOM   333  O OP1    . DT  A 1 16  ? -0.501  -7.214  79.710  1.00 56.67  ? 1016 DT  B OP1    1 
ATOM   334  O OP2    . DT  A 1 16  ? -0.383  -9.775  79.667  1.00 60.67  ? 1016 DT  B OP2    1 
ATOM   335  O "O5'"  . DT  A 1 16  ? 1.407   -8.360  78.559  1.00 47.96  ? 1016 DT  B "O5'"  1 
ATOM   336  C "C5'"  . DT  A 1 16  ? 1.585   -7.100  77.852  1.00 48.78  ? 1016 DT  B "C5'"  1 
ATOM   337  C "C4'"  . DT  A 1 16  ? 2.175   -6.049  78.770  1.00 45.82  ? 1016 DT  B "C4'"  1 
ATOM   338  O "O4'"  . DT  A 1 16  ? 3.551   -6.413  79.062  1.00 46.84  ? 1016 DT  B "O4'"  1 
ATOM   339  C "C3'"  . DT  A 1 16  ? 2.236   -4.637  78.163  1.00 44.03  ? 1016 DT  B "C3'"  1 
ATOM   340  O "O3'"  . DT  A 1 16  ? 1.988   -3.631  79.150  1.00 50.56  ? 1016 DT  B "O3'"  1 
ATOM   341  C "C2'"  . DT  A 1 16  ? 3.692   -4.490  77.789  1.00 40.11  ? 1016 DT  B "C2'"  1 
ATOM   342  C "C1'"  . DT  A 1 16  ? 4.323   -5.254  78.922  1.00 41.77  ? 1016 DT  B "C1'"  1 
ATOM   343  N N1     . DT  A 1 16  ? 5.707   -5.633  78.748  1.00 39.67  ? 1016 DT  B N1     1 
ATOM   344  C C2     . DT  A 1 16  ? 6.605   -4.614  78.768  1.00 44.94  ? 1016 DT  B C2     1 
ATOM   345  O O2     . DT  A 1 16  ? 6.276   -3.453  78.801  1.00 55.19  ? 1016 DT  B O2     1 
ATOM   346  N N3     . DT  A 1 16  ? 7.906   -4.997  78.706  1.00 47.40  ? 1016 DT  B N3     1 
ATOM   347  C C4     . DT  A 1 16  ? 8.383   -6.291  78.580  1.00 49.00  ? 1016 DT  B C4     1 
ATOM   348  O O4     . DT  A 1 16  ? 9.590   -6.516  78.587  1.00 51.35  ? 1016 DT  B O4     1 
ATOM   349  C C5     . DT  A 1 16  ? 7.382   -7.310  78.477  1.00 44.83  ? 1016 DT  B C5     1 
ATOM   350  C C7     . DT  A 1 16  ? 7.820   -8.717  78.219  1.00 38.52  ? 1016 DT  B C7     1 
ATOM   351  C C6     . DT  A 1 16  ? 6.100   -6.942  78.592  1.00 43.57  ? 1016 DT  B C6     1 
ATOM   352  H H3     . DT  A 1 16  ? 8.573   -4.235  78.768  1.00 40.00  ? 1016 DT  B H3     1 
ATOM   353  P P      . DG  A 1 17  ? 0.831   -2.540  78.898  1.00 49.39  ? 1017 DG  B P      1 
ATOM   354  O OP1    . DG  A 1 17  ? 0.633   -1.704  80.123  1.00 41.84  ? 1017 DG  B OP1    1 
ATOM   355  O OP2    . DG  A 1 17  ? -0.291  -3.304  78.357  1.00 48.25  ? 1017 DG  B OP2    1 
ATOM   356  O "O5'"  . DG  A 1 17  ? 1.412   -1.612  77.748  1.00 46.88  ? 1017 DG  B "O5'"  1 
ATOM   357  C "C5'"  . DG  A 1 17  ? 2.443   -0.664  78.007  1.00 46.68  ? 1017 DG  B "C5'"  1 
ATOM   358  C "C4'"  . DG  A 1 17  ? 3.169   -0.337  76.729  1.00 47.55  ? 1017 DG  B "C4'"  1 
ATOM   359  O "O4'"  . DG  A 1 17  ? 4.082   -1.399  76.347  1.00 53.38  ? 1017 DG  B "O4'"  1 
ATOM   360  C "C3'"  . DG  A 1 17  ? 2.257   -0.106  75.523  1.00 46.56  ? 1017 DG  B "C3'"  1 
ATOM   361  O "O3'"  . DG  A 1 17  ? 2.896   0.860   74.709  1.00 49.11  ? 1017 DG  B "O3'"  1 
ATOM   362  C "C2'"  . DG  A 1 17  ? 2.325   -1.432  74.797  1.00 46.81  ? 1017 DG  B "C2'"  1 
ATOM   363  C "C1'"  . DG  A 1 17  ? 3.804   -1.755  74.998  1.00 49.02  ? 1017 DG  B "C1'"  1 
ATOM   364  N N9     . DG  A 1 17  ? 4.247   -3.133  74.795  1.00 43.14  ? 1017 DG  B N9     1 
ATOM   365  C C8     . DG  A 1 17  ? 3.501   -4.259  74.517  1.00 43.60  ? 1017 DG  B C8     1 
ATOM   366  N N7     . DG  A 1 17  ? 4.214   -5.351  74.522  1.00 44.47  ? 1017 DG  B N7     1 
ATOM   367  C C5     . DG  A 1 17  ? 5.510   -4.914  74.774  1.00 38.82  ? 1017 DG  B C5     1 
ATOM   368  C C6     . DG  A 1 17  ? 6.715   -5.644  74.931  1.00 42.49  ? 1017 DG  B C6     1 
ATOM   369  O O6     . DG  A 1 17  ? 6.893   -6.855  74.868  1.00 47.35  ? 1017 DG  B O6     1 
ATOM   370  N N1     . DG  A 1 17  ? 7.785   -4.800  75.204  1.00 38.73  ? 1017 DG  B N1     1 
ATOM   371  C C2     . DG  A 1 17  ? 7.698   -3.419  75.303  1.00 40.38  ? 1017 DG  B C2     1 
ATOM   372  N N2     . DG  A 1 17  ? 8.841   -2.746  75.551  1.00 40.34  ? 1017 DG  B N2     1 
ATOM   373  N N3     . DG  A 1 17  ? 6.573   -2.736  75.164  1.00 39.54  ? 1017 DG  B N3     1 
ATOM   374  C C4     . DG  A 1 17  ? 5.531   -3.544  74.913  1.00 39.56  ? 1017 DG  B C4     1 
ATOM   375  H H1     . DG  A 1 17  ? 8.704   -5.196  75.328  1.00 40.00  ? 1017 DG  B H1     1 
ATOM   376  H H21    . DG  A 1 17  ? 9.721   -3.226  75.636  1.00 40.00  ? 1017 DG  B H21    1 
ATOM   377  H H22    . DG  A 1 17  ? 8.781   -1.746  75.622  1.00 40.00  ? 1017 DG  B H22    1 
ATOM   378  P P      . DA  A 1 18  ? 2.032   1.975   73.942  1.00 44.81  ? 1018 DA  B P      1 
ATOM   379  O OP1    . DA  A 1 18  ? 1.201   2.717   74.954  1.00 42.03  ? 1018 DA  B OP1    1 
ATOM   380  O OP2    . DA  A 1 18  ? 1.361   1.374   72.779  1.00 45.88  ? 1018 DA  B OP2    1 
ATOM   381  O "O5'"  . DA  A 1 18  ? 3.158   2.988   73.442  1.00 37.61  ? 1018 DA  B "O5'"  1 
ATOM   382  C "C5'"  . DA  A 1 18  ? 3.971   3.673   74.400  1.00 35.98  ? 1018 DA  B "C5'"  1 
ATOM   383  C "C4'"  . DA  A 1 18  ? 5.332   3.964   73.813  1.00 37.20  ? 1018 DA  B "C4'"  1 
ATOM   384  O "O4'"  . DA  A 1 18  ? 6.033   2.719   73.610  1.00 40.07  ? 1018 DA  B "O4'"  1 
ATOM   385  C "C3'"  . DA  A 1 18  ? 5.285   4.646   72.453  1.00 41.21  ? 1018 DA  B "C3'"  1 
ATOM   386  O "O3'"  . DA  A 1 18  ? 6.328   5.622   72.417  1.00 43.67  ? 1018 DA  B "O3'"  1 
ATOM   387  C "C2'"  . DA  A 1 18  ? 5.476   3.497   71.464  1.00 38.59  ? 1018 DA  B "C2'"  1 
ATOM   388  C "C1'"  . DA  A 1 18  ? 6.274   2.454   72.233  1.00 40.36  ? 1018 DA  B "C1'"  1 
ATOM   389  N N9     . DA  A 1 18  ? 5.875   1.064   71.984  1.00 42.42  ? 1018 DA  B N9     1 
ATOM   390  C C8     . DA  A 1 18  ? 4.607   0.583   71.786  1.00 43.59  ? 1018 DA  B C8     1 
ATOM   391  N N7     . DA  A 1 18  ? 4.549   -0.729  71.663  1.00 45.34  ? 1018 DA  B N7     1 
ATOM   392  C C5     . DA  A 1 18  ? 5.866   -1.127  71.775  1.00 42.11  ? 1018 DA  B C5     1 
ATOM   393  C C6     . DA  A 1 18  ? 6.486   -2.400  71.740  1.00 41.60  ? 1018 DA  B C6     1 
ATOM   394  N N6     . DA  A 1 18  ? 5.820   -3.565  71.640  1.00 39.21  ? 1018 DA  B N6     1 
ATOM   395  N N1     . DA  A 1 18  ? 7.832   -2.441  71.837  1.00 39.23  ? 1018 DA  B N1     1 
ATOM   396  C C2     . DA  A 1 18  ? 8.492   -1.305  71.978  1.00 38.81  ? 1018 DA  B C2     1 
ATOM   397  N N3     . DA  A 1 18  ? 8.028   -0.050  72.056  1.00 42.97  ? 1018 DA  B N3     1 
ATOM   398  C C4     . DA  A 1 18  ? 6.700   -0.032  71.948  1.00 41.21  ? 1018 DA  B C4     1 
ATOM   399  H H61    . DA  A 1 18  ? 6.340   -4.436  71.691  1.00 40.00  ? 1018 DA  B H61    1 
ATOM   400  H H62    . DA  A 1 18  ? 4.810   -3.596  71.626  1.00 40.00  ? 1018 DA  B H62    1 
ATOM   401  P P      . DG  A 1 19  ? 6.626   6.412   71.044  1.00 44.24  ? 1019 DG  B P      1 
ATOM   402  O OP1    . DG  A 1 19  ? 7.374   7.632   71.431  1.00 45.01  ? 1019 DG  B OP1    1 
ATOM   403  O OP2    . DG  A 1 19  ? 5.403   6.508   70.162  1.00 42.67  ? 1019 DG  B OP2    1 
ATOM   404  O "O5'"  . DG  A 1 19  ? 7.640   5.428   70.345  1.00 42.60  ? 1019 DG  B "O5'"  1 
ATOM   405  C "C5'"  . DG  A 1 19  ? 8.880   5.166   70.971  1.00 43.23  ? 1019 DG  B "C5'"  1 
ATOM   406  C "C4'"  . DG  A 1 19  ? 9.726   4.324   70.057  1.00 42.08  ? 1019 DG  B "C4'"  1 
ATOM   407  O "O4'"  . DG  A 1 19  ? 9.128   3.009   69.958  1.00 41.58  ? 1019 DG  B "O4'"  1 
ATOM   408  C "C3'"  . DG  A 1 19  ? 9.761   4.899   68.638  1.00 43.47  ? 1019 DG  B "C3'"  1 
ATOM   409  O "O3'"  . DG  A 1 19  ? 11.110  4.929   68.213  1.00 43.08  ? 1019 DG  B "O3'"  1 
ATOM   410  C "C2'"  . DG  A 1 19  ? 8.905   3.948   67.821  1.00 40.32  ? 1019 DG  B "C2'"  1 
ATOM   411  C "C1'"  . DG  A 1 19  ? 9.055   2.645   68.584  1.00 43.05  ? 1019 DG  B "C1'"  1 
ATOM   412  N N9     . DG  A 1 19  ? 7.986   1.667   68.431  1.00 41.12  ? 1019 DG  B N9     1 
ATOM   413  C C8     . DG  A 1 19  ? 6.638   1.892   68.379  1.00 37.39  ? 1019 DG  B C8     1 
ATOM   414  N N7     . DG  A 1 19  ? 5.944   0.792   68.340  1.00 40.44  ? 1019 DG  B N7     1 
ATOM   415  C C5     . DG  A 1 19  ? 6.907   -0.218  68.338  1.00 39.01  ? 1019 DG  B C5     1 
ATOM   416  C C6     . DG  A 1 19  ? 6.757   -1.632  68.309  1.00 37.90  ? 1019 DG  B C6     1 
ATOM   417  O O6     . DG  A 1 19  ? 5.711   -2.276  68.303  1.00 36.43  ? 1019 DG  B O6     1 
ATOM   418  N N1     . DG  A 1 19  ? 7.995   -2.286  68.298  1.00 38.23  ? 1019 DG  B N1     1 
ATOM   419  C C2     . DG  A 1 19  ? 9.210   -1.639  68.324  1.00 38.59  ? 1019 DG  B C2     1 
ATOM   420  N N2     . DG  A 1 19  ? 10.293  -2.402  68.303  1.00 36.80  ? 1019 DG  B N2     1 
ATOM   421  N N3     . DG  A 1 19  ? 9.347   -0.322  68.364  1.00 39.11  ? 1019 DG  B N3     1 
ATOM   422  C C4     . DG  A 1 19  ? 8.159   0.317   68.362  1.00 40.17  ? 1019 DG  B C4     1 
ATOM   423  H H1     . DG  A 1 19  ? 7.994   -3.291  68.275  1.00 40.00  ? 1019 DG  B H1     1 
ATOM   424  H H21    . DG  A 1 19  ? 10.221  -3.410  68.266  1.00 40.00  ? 1019 DG  B H21    1 
ATOM   425  H H22    . DG  A 1 19  ? 11.210  -1.975  68.332  1.00 40.00  ? 1019 DG  B H22    1 
ATOM   426  P P      . DT  A 1 20  ? 11.464  5.398   66.733  1.00 46.02  ? 1020 DT  B P      1 
ATOM   427  O OP1    . DT  A 1 20  ? 12.764  6.048   66.862  1.00 37.89  ? 1020 DT  B OP1    1 
ATOM   428  O OP2    . DT  A 1 20  ? 10.313  6.139   66.145  1.00 39.01  ? 1020 DT  B OP2    1 
ATOM   429  O "O5'"  . DT  A 1 20  ? 11.649  3.998   66.008  1.00 43.73  ? 1020 DT  B "O5'"  1 
ATOM   430  C "C5'"  . DT  A 1 20  ? 12.526  3.026   66.602  1.00 41.80  ? 1020 DT  B "C5'"  1 
ATOM   431  C "C4'"  . DT  A 1 20  ? 12.663  1.823   65.709  1.00 45.67  ? 1020 DT  B "C4'"  1 
ATOM   432  O "O4'"  . DT  A 1 20  ? 11.524  0.945   65.886  1.00 41.25  ? 1020 DT  B "O4'"  1 
ATOM   433  C "C3'"  . DT  A 1 20  ? 12.759  2.155   64.214  1.00 46.51  ? 1020 DT  B "C3'"  1 
ATOM   434  O "O3'"  . DT  A 1 20  ? 14.005  1.690   63.722  1.00 47.07  ? 1020 DT  B "O3'"  1 
ATOM   435  C "C2'"  . DT  A 1 20  ? 11.580  1.419   63.585  1.00 43.03  ? 1020 DT  B "C2'"  1 
ATOM   436  C "C1'"  . DT  A 1 20  ? 11.147  0.394   64.634  1.00 39.89  ? 1020 DT  B "C1'"  1 
ATOM   437  N N1     . DT  A 1 20  ? 9.695   0.130   64.689  1.00 39.23  ? 1020 DT  B N1     1 
ATOM   438  C C2     . DT  A 1 20  ? 9.261   -1.184  64.701  1.00 40.89  ? 1020 DT  B C2     1 
ATOM   439  O O2     . DT  A 1 20  ? 10.018  -2.147  64.631  1.00 46.88  ? 1020 DT  B O2     1 
ATOM   440  N N3     . DT  A 1 20  ? 7.895   -1.325  64.794  1.00 38.89  ? 1020 DT  B N3     1 
ATOM   441  C C4     . DT  A 1 20  ? 6.950   -0.306  64.857  1.00 34.91  ? 1020 DT  B C4     1 
ATOM   442  O O4     . DT  A 1 20  ? 5.740   -0.577  64.929  1.00 39.76  ? 1020 DT  B O4     1 
ATOM   443  C C5     . DT  A 1 20  ? 7.484   1.027   64.831  1.00 33.61  ? 1020 DT  B C5     1 
ATOM   444  C C7     . DT  A 1 20  ? 6.548   2.181   64.907  1.00 31.68  ? 1020 DT  B C7     1 
ATOM   445  C C6     . DT  A 1 20  ? 8.800   1.177   64.735  1.00 33.56  ? 1020 DT  B C6     1 
ATOM   446  H H3     . DT  A 1 20  ? 7.526   -2.268  64.792  1.00 40.00  ? 1020 DT  B H3     1 
ATOM   447  P P      . DG  A 1 21  ? 14.488  2.104   62.242  1.00 49.58  ? 1021 DG  B P      1 
ATOM   448  O OP1    . DG  A 1 21  ? 15.958  2.185   62.266  1.00 50.97  ? 1021 DG  B OP1    1 
ATOM   449  O OP2    . DG  A 1 21  ? 13.709  3.255   61.674  1.00 39.45  ? 1021 DG  B OP2    1 
ATOM   450  O "O5'"  . DG  A 1 21  ? 14.114  0.784   61.460  1.00 49.32  ? 1021 DG  B "O5'"  1 
ATOM   451  C "C5'"  . DG  A 1 21  ? 14.528  -0.476  61.960  1.00 44.42  ? 1021 DG  B "C5'"  1 
ATOM   452  C "C4'"  . DG  A 1 21  ? 13.955  -1.576  61.113  1.00 42.47  ? 1021 DG  B "C4'"  1 
ATOM   453  O "O4'"  . DG  A 1 21  ? 12.557  -1.761  61.403  1.00 42.88  ? 1021 DG  B "O4'"  1 
ATOM   454  C "C3'"  . DG  A 1 21  ? 14.037  -1.282  59.624  1.00 48.21  ? 1021 DG  B "C3'"  1 
ATOM   455  O "O3'"  . DG  A 1 21  ? 14.101  -2.550  58.994  1.00 57.30  ? 1021 DG  B "O3'"  1 
ATOM   456  C "C2'"  . DG  A 1 21  ? 12.697  -0.639  59.344  1.00 45.56  ? 1021 DG  B "C2'"  1 
ATOM   457  C "C1'"  . DG  A 1 21  ? 11.807  -1.490  60.233  1.00 42.52  ? 1021 DG  B "C1'"  1 
ATOM   458  N N9     . DG  A 1 21  ? 10.509  -0.930  60.628  1.00 42.41  ? 1021 DG  B N9     1 
ATOM   459  C C8     . DG  A 1 21  ? 10.173  0.389   60.725  1.00 45.67  ? 1021 DG  B C8     1 
ATOM   460  N N7     . DG  A 1 21  ? 8.932   0.574   61.090  1.00 46.39  ? 1021 DG  B N7     1 
ATOM   461  C C5     . DG  A 1 21  ? 8.424   -0.701  61.250  1.00 41.99  ? 1021 DG  B C5     1 
ATOM   462  C C6     . DG  A 1 21  ? 7.126   -1.132  61.620  1.00 43.74  ? 1021 DG  B C6     1 
ATOM   463  O O6     . DG  A 1 21  ? 6.133   -0.437  61.893  1.00 49.64  ? 1021 DG  B O6     1 
ATOM   464  N N1     . DG  A 1 21  ? 7.030   -2.527  61.646  1.00 44.99  ? 1021 DG  B N1     1 
ATOM   465  C C2     . DG  A 1 21  ? 8.057   -3.391  61.341  1.00 48.49  ? 1021 DG  B C2     1 
ATOM   466  N N2     . DG  A 1 21  ? 7.785   -4.684  61.435  1.00 46.76  ? 1021 DG  B N2     1 
ATOM   467  N N3     . DG  A 1 21  ? 9.268   -2.996  60.975  1.00 45.75  ? 1021 DG  B N3     1 
ATOM   468  C C4     . DG  A 1 21  ? 9.388   -1.649  60.961  1.00 41.11  ? 1021 DG  B C4     1 
ATOM   469  H H1     . DG  A 1 21  ? 6.136   -2.914  61.898  1.00 40.00  ? 1021 DG  B H1     1 
ATOM   470  H H21    . DG  A 1 21  ? 6.858   -5.019  61.684  1.00 40.00  ? 1021 DG  B H21    1 
ATOM   471  H H22    . DG  A 1 21  ? 8.489   -5.375  61.210  1.00 40.00  ? 1021 DG  B H22    1 
ATOM   472  P P      . DC  A 1 22  ? 14.961  -2.768  57.664  1.00 58.19  ? 1022 DC  B P      1 
ATOM   473  O OP1    . DC  A 1 22  ? 16.439  -2.834  57.959  1.00 58.42  ? 1022 DC  B OP1    1 
ATOM   474  O OP2    . DC  A 1 22  ? 14.481  -1.852  56.604  1.00 60.70  ? 1022 DC  B OP2    1 
ATOM   475  O "O5'"  . DC  A 1 22  ? 14.479  -4.218  57.286  1.00 53.48  ? 1022 DC  B "O5'"  1 
ATOM   476  C "C5'"  . DC  A 1 22  ? 13.228  -4.341  56.690  1.00 57.42  ? 1022 DC  B "C5'"  1 
ATOM   477  C "C4'"  . DC  A 1 22  ? 12.591  -5.646  57.070  1.00 61.32  ? 1022 DC  B "C4'"  1 
ATOM   478  O "O4'"  . DC  A 1 22  ? 11.569  -5.346  58.051  1.00 55.14  ? 1022 DC  B "O4'"  1 
ATOM   479  C "C3'"  . DC  A 1 22  ? 11.885  -6.161  55.832  1.00 65.81  ? 1022 DC  B "C3'"  1 
ATOM   480  O "O3'"  . DC  A 1 22  ? 12.143  -7.518  55.525  1.00 69.79  ? 1022 DC  B "O3'"  1 
ATOM   481  C "C2'"  . DC  A 1 22  ? 10.423  -5.858  56.052  1.00 61.00  ? 1022 DC  B "C2'"  1 
ATOM   482  C "C1'"  . DC  A 1 22  ? 10.279  -5.594  57.541  1.00 53.98  ? 1022 DC  B "C1'"  1 
ATOM   483  N N1     . DC  A 1 22  ? 9.486   -4.375  57.724  1.00 46.78  ? 1022 DC  B N1     1 
ATOM   484  C C2     . DC  A 1 22  ? 8.131   -4.515  57.976  1.00 42.84  ? 1022 DC  B C2     1 
ATOM   485  O O2     . DC  A 1 22  ? 7.668   -5.665  58.141  1.00 45.37  ? 1022 DC  B O2     1 
ATOM   486  N N3     . DC  A 1 22  ? 7.353   -3.420  58.046  1.00 46.25  ? 1022 DC  B N3     1 
ATOM   487  C C4     . DC  A 1 22  ? 7.891   -2.206  57.887  1.00 52.52  ? 1022 DC  B C4     1 
ATOM   488  N N4     . DC  A 1 22  ? 7.069   -1.158  57.939  1.00 48.09  ? 1022 DC  B N4     1 
ATOM   489  C C5     . DC  A 1 22  ? 9.287   -2.023  57.671  1.00 51.06  ? 1022 DC  B C5     1 
ATOM   490  C C6     . DC  A 1 22  ? 10.046  -3.127  57.602  1.00 46.88  ? 1022 DC  B C6     1 
ATOM   491  H H41    . DC  A 1 22  ? 6.079   -1.354  58.010  1.00 40.00  ? 1022 DC  B H41    1 
ATOM   492  H H42    . DC  A 1 22  ? 7.382   -0.210  57.841  1.00 40.00  ? 1022 DC  B H42    1 
ATOM   493  P P      . DA  A 1 23  ? 12.150  -7.938  53.985  1.00 68.45  ? 1023 DA  B P      1 
ATOM   494  O OP1    . DA  A 1 23  ? 13.049  -9.113  53.808  1.00 69.61  ? 1023 DA  B OP1    1 
ATOM   495  O OP2    . DA  A 1 23  ? 12.410  -6.687  53.206  1.00 65.34  ? 1023 DA  B OP2    1 
ATOM   496  O "O5'"  . DA  A 1 23  ? 10.642  -8.347  53.727  1.00 65.67  ? 1023 DA  B "O5'"  1 
ATOM   497  C "C5'"  . DA  A 1 23  ? 10.064  -9.455  54.407  1.00 67.87  ? 1023 DA  B "C5'"  1 
ATOM   498  C "C4'"  . DA  A 1 23  ? 8.585   -9.536  54.112  1.00 72.72  ? 1023 DA  B "C4'"  1 
ATOM   499  O "O4'"  . DA  A 1 23  ? 7.950   -8.330  54.588  1.00 67.83  ? 1023 DA  B "O4'"  1 
ATOM   500  C "C3'"  . DA  A 1 23  ? 8.216   -9.652  52.633  1.00 77.84  ? 1023 DA  B "C3'"  1 
ATOM   501  O "O3'"  . DA  A 1 23  ? 7.052   -10.481 52.547  1.00 85.80  ? 1023 DA  B "O3'"  1 
ATOM   502  C "C2'"  . DA  A 1 23  ? 7.914   -8.218  52.239  1.00 73.80  ? 1023 DA  B "C2'"  1 
ATOM   503  C "C1'"  . DA  A 1 23  ? 7.325   -7.651  53.516  1.00 67.26  ? 1023 DA  B "C1'"  1 
ATOM   504  N N9     . DA  A 1 23  ? 7.511   -6.216  53.732  1.00 63.10  ? 1023 DA  B N9     1 
ATOM   505  C C8     . DA  A 1 23  ? 8.649   -5.447  53.658  1.00 62.17  ? 1023 DA  B C8     1 
ATOM   506  N N7     . DA  A 1 23  ? 8.459   -4.189  53.980  1.00 58.40  ? 1023 DA  B N7     1 
ATOM   507  C C5     . DA  A 1 23  ? 7.102   -4.119  54.267  1.00 52.43  ? 1023 DA  B C5     1 
ATOM   508  C C6     . DA  A 1 23  ? 6.264   -3.066  54.704  1.00 48.91  ? 1023 DA  B C6     1 
ATOM   509  N N6     . DA  A 1 23  ? 6.693   -1.823  54.961  1.00 47.52  ? 1023 DA  B N6     1 
ATOM   510  N N1     . DA  A 1 23  ? 4.955   -3.345  54.884  1.00 49.59  ? 1023 DA  B N1     1 
ATOM   511  C C2     . DA  A 1 23  ? 4.530   -4.589  54.662  1.00 49.26  ? 1023 DA  B C2     1 
ATOM   512  N N3     . DA  A 1 23  ? 5.213   -5.659  54.278  1.00 51.72  ? 1023 DA  B N3     1 
ATOM   513  C C4     . DA  A 1 23  ? 6.506   -5.354  54.094  1.00 54.64  ? 1023 DA  B C4     1 
ATOM   514  H H61    . DA  A 1 23  ? 6.026   -1.120  55.254  1.00 40.00  ? 1023 DA  B H61    1 
ATOM   515  H H62    . DA  A 1 23  ? 7.661   -1.573  54.844  1.00 40.00  ? 1023 DA  B H62    1 
ATOM   516  P P      . DC  A 1 24  ? 6.306   -10.706 51.138  1.00 87.59  ? 1024 DC  B P      1 
ATOM   517  O OP1    . DC  A 1 24  ? 6.250   -12.192 50.940  1.00 86.26  ? 1024 DC  B OP1    1 
ATOM   518  O OP2    . DC  A 1 24  ? 6.872   -9.835  50.086  1.00 89.37  ? 1024 DC  B OP2    1 
ATOM   519  O "O5'"  . DC  A 1 24  ? 4.809   -10.254 51.461  1.00 82.82  ? 1024 DC  B "O5'"  1 
ATOM   520  C "C5'"  . DC  A 1 24  ? 4.561   -9.011  52.105  1.00 79.53  ? 1024 DC  B "C5'"  1 
ATOM   521  C "C4'"  . DC  A 1 24  ? 3.242   -8.462  51.635  1.00 77.84  ? 1024 DC  B "C4'"  1 
ATOM   522  O "O4'"  . DC  A 1 24  ? 3.210   -7.046  51.938  1.00 77.79  ? 1024 DC  B "O4'"  1 
ATOM   523  C "C3'"  . DC  A 1 24  ? 3.111   -8.566  50.119  1.00 77.37  ? 1024 DC  B "C3'"  1 
ATOM   524  O "O3'"  . DC  A 1 24  ? 1.735   -8.709  49.766  1.00 80.35  ? 1024 DC  B "O3'"  1 
ATOM   525  C "C2'"  . DC  A 1 24  ? 3.704   -7.262  49.625  1.00 73.40  ? 1024 DC  B "C2'"  1 
ATOM   526  C "C1'"  . DC  A 1 24  ? 3.316   -6.290  50.735  1.00 69.42  ? 1024 DC  B "C1'"  1 
ATOM   527  N N1     . DC  A 1 24  ? 4.302   -5.235  50.973  1.00 59.25  ? 1024 DC  B N1     1 
ATOM   528  C C2     . DC  A 1 24  ? 3.866   -4.055  51.528  1.00 54.12  ? 1024 DC  B C2     1 
ATOM   529  O O2     . DC  A 1 24  ? 2.680   -3.971  51.835  1.00 52.20  ? 1024 DC  B O2     1 
ATOM   530  N N3     . DC  A 1 24  ? 4.747   -3.045  51.734  1.00 52.96  ? 1024 DC  B N3     1 
ATOM   531  C C4     . DC  A 1 24  ? 6.038   -3.218  51.409  1.00 53.96  ? 1024 DC  B C4     1 
ATOM   532  N N4     . DC  A 1 24  ? 6.887   -2.208  51.610  1.00 52.66  ? 1024 DC  B N4     1 
ATOM   533  C C5     . DC  A 1 24  ? 6.520   -4.446  50.862  1.00 52.54  ? 1024 DC  B C5     1 
ATOM   534  C C6     . DC  A 1 24  ? 5.623   -5.415  50.653  1.00 53.74  ? 1024 DC  B C6     1 
ATOM   535  H H41    . DC  A 1 24  ? 6.566   -1.323  51.970  1.00 40.00  ? 1024 DC  B H41    1 
ATOM   536  H H42    . DC  A 1 24  ? 7.855   -2.340  51.374  1.00 40.00  ? 1024 DC  B H42    1 
ATOM   537  P P      . DA  A 1 25  ? 1.224   -8.181  48.336  1.00 83.51  ? 1025 DA  B P      1 
ATOM   538  O OP1    . DA  A 1 25  ? 0.123   -9.063  47.869  1.00 84.51  ? 1025 DA  B OP1    1 
ATOM   539  O OP2    . DA  A 1 25  ? 2.416   -7.963  47.467  1.00 82.54  ? 1025 DA  B OP2    1 
ATOM   540  O "O5'"  . DA  A 1 25  ? 0.637   -6.747  48.663  1.00 80.58  ? 1025 DA  B "O5'"  1 
ATOM   541  C "C5'"  . DA  A 1 25  ? -0.346  -6.561  49.676  1.00 78.76  ? 1025 DA  B "C5'"  1 
ATOM   542  C "C4'"  . DA  A 1 25  ? -0.926  -5.179  49.527  1.00 76.49  ? 1025 DA  B "C4'"  1 
ATOM   543  O "O4'"  . DA  A 1 25  ? 0.136   -4.218  49.737  1.00 73.27  ? 1025 DA  B "O4'"  1 
ATOM   544  C "C3'"  . DA  A 1 25  ? -1.398  -4.944  48.092  1.00 76.94  ? 1025 DA  B "C3'"  1 
ATOM   545  O "O3'"  . DA  A 1 25  ? -2.359  -3.891  48.125  1.00 81.77  ? 1025 DA  B "O3'"  1 
ATOM   546  C "C2'"  . DA  A 1 25  ? -0.135  -4.451  47.413  1.00 73.02  ? 1025 DA  B "C2'"  1 
ATOM   547  C "C1'"  . DA  A 1 25  ? 0.422   -3.558  48.511  1.00 69.21  ? 1025 DA  B "C1'"  1 
ATOM   548  N N9     . DA  A 1 25  ? 1.854   -3.251  48.468  1.00 61.94  ? 1025 DA  B N9     1 
ATOM   549  C C8     . DA  A 1 25  ? 2.924   -4.066  48.181  1.00 57.05  ? 1025 DA  B C8     1 
ATOM   550  N N7     . DA  A 1 25  ? 4.083   -3.450  48.229  1.00 53.03  ? 1025 DA  B N7     1 
ATOM   551  C C5     . DA  A 1 25  ? 3.751   -2.144  48.567  1.00 55.22  ? 1025 DA  B C5     1 
ATOM   552  C C6     . DA  A 1 25  ? 4.528   -0.991  48.760  1.00 51.13  ? 1025 DA  B C6     1 
ATOM   553  N N6     . DA  A 1 25  ? 5.850   -0.953  48.632  1.00 49.43  ? 1025 DA  B N6     1 
ATOM   554  N N1     . DA  A 1 25  ? 3.889   0.148   49.088  1.00 54.47  ? 1025 DA  B N1     1 
ATOM   555  C C2     . DA  A 1 25  ? 2.549   0.125   49.209  1.00 60.43  ? 1025 DA  B C2     1 
ATOM   556  N N3     . DA  A 1 25  ? 1.708   -0.890  49.050  1.00 59.83  ? 1025 DA  B N3     1 
ATOM   557  C C4     . DA  A 1 25  ? 2.384   -2.010  48.724  1.00 59.63  ? 1025 DA  B C4     1 
ATOM   558  H H61    . DA  A 1 25  ? 6.346   -0.091  48.831  1.00 40.00  ? 1025 DA  B H61    1 
ATOM   559  H H62    . DA  A 1 25  ? 6.350   -1.771  48.325  1.00 40.00  ? 1025 DA  B H62    1 
ATOM   560  P P      . DG  A 1 26  ? -3.581  -3.874  47.080  1.00 87.61  ? 1026 DG  B P      1 
ATOM   561  O OP1    . DG  A 1 26  ? -4.760  -4.384  47.833  1.00 87.08  ? 1026 DG  B OP1    1 
ATOM   562  O OP2    . DG  A 1 26  ? -3.198  -4.509  45.791  1.00 84.29  ? 1026 DG  B OP2    1 
ATOM   563  O "O5'"  . DG  A 1 26  ? -3.768  -2.306  46.820  1.00 87.98  ? 1026 DG  B "O5'"  1 
ATOM   564  C "C5'"  . DG  A 1 26  ? -3.715  -1.369  47.919  1.00 84.60  ? 1026 DG  B "C5'"  1 
ATOM   565  C "C4'"  . DG  A 1 26  ? -3.248  -0.014  47.439  1.00 81.28  ? 1026 DG  B "C4'"  1 
ATOM   566  O "O4'"  . DG  A 1 26  ? -1.800  0.072   47.375  1.00 79.60  ? 1026 DG  B "O4'"  1 
ATOM   567  C "C3'"  . DG  A 1 26  ? -3.757  0.390   46.052  1.00 80.46  ? 1026 DG  B "C3'"  1 
ATOM   568  O "O3'"  . DG  A 1 26  ? -4.024  1.800   46.068  1.00 81.09  ? 1026 DG  B "O3'"  1 
ATOM   569  C "C2'"  . DG  A 1 26  ? -2.545  0.164   45.162  1.00 76.66  ? 1026 DG  B "C2'"  1 
ATOM   570  C "C1'"  . DG  A 1 26  ? -1.431  0.590   46.100  1.00 74.36  ? 1026 DG  B "C1'"  1 
ATOM   571  N N9     . DG  A 1 26  ? -0.087  0.107   45.785  1.00 70.22  ? 1026 DG  B N9     1 
ATOM   572  C C8     . DG  A 1 26  ? 0.262   -1.127  45.295  1.00 66.45  ? 1026 DG  B C8     1 
ATOM   573  N N7     . DG  A 1 26  ? 1.553   -1.264  45.151  1.00 60.78  ? 1026 DG  B N7     1 
ATOM   574  C C5     . DG  A 1 26  ? 2.076   -0.051  45.562  1.00 57.30  ? 1026 DG  B C5     1 
ATOM   575  C C6     . DG  A 1 26  ? 3.421   0.385   45.638  1.00 52.76  ? 1026 DG  B C6     1 
ATOM   576  O O6     . DG  A 1 26  ? 4.444   -0.250  45.358  1.00 50.63  ? 1026 DG  B O6     1 
ATOM   577  N N1     . DG  A 1 26  ? 3.510   1.703   46.091  1.00 52.81  ? 1026 DG  B N1     1 
ATOM   578  C C2     . DG  A 1 26  ? 2.440   2.495   46.424  1.00 56.06  ? 1026 DG  B C2     1 
ATOM   579  N N2     . DG  A 1 26  ? 2.715   3.758   46.809  1.00 56.23  ? 1026 DG  B N2     1 
ATOM   580  N N3     . DG  A 1 26  ? 1.183   2.086   46.374  1.00 58.18  ? 1026 DG  B N3     1 
ATOM   581  C C4     . DG  A 1 26  ? 1.076   0.815   45.938  1.00 63.77  ? 1026 DG  B C4     1 
ATOM   582  H "HO3'" . DG  A 1 26  ? -3.222  2.240   46.355  1.00 40.00  ? 1026 DG  B "HO3'" 1 
ATOM   583  H H1     . DG  A 1 26  ? 4.428   2.123   46.160  1.00 40.00  ? 1026 DG  B H1     1 
ATOM   584  H H21    . DG  A 1 26  ? 3.649   4.138   46.809  1.00 40.00  ? 1026 DG  B H21    1 
ATOM   585  H H22    . DG  A 1 26  ? 1.940   4.351   47.067  1.00 40.00  ? 1026 DG  B H22    1 
ATOM   586  O "O5'"  . DT  B 2 1   ? 12.746  -2.292  39.324  1.00 69.76  ? 2001 DT  C "O5'"  1 
ATOM   587  C "C5'"  . DT  B 2 1   ? 12.118  -1.616  38.213  1.00 67.56  ? 2001 DT  C "C5'"  1 
ATOM   588  C "C4'"  . DT  B 2 1   ? 12.588  -0.182  38.262  1.00 69.32  ? 2001 DT  C "C4'"  1 
ATOM   589  O "O4'"  . DT  B 2 1   ? 11.574  0.638   37.637  1.00 67.57  ? 2001 DT  C "O4'"  1 
ATOM   590  C "C3'"  . DT  B 2 1   ? 12.697  0.297   39.706  1.00 72.82  ? 2001 DT  C "C3'"  1 
ATOM   591  O "O3'"  . DT  B 2 1   ? 13.898  0.987   40.028  1.00 75.67  ? 2001 DT  C "O3'"  1 
ATOM   592  C "C2'"  . DT  B 2 1   ? 11.491  1.179   39.932  1.00 69.95  ? 2001 DT  C "C2'"  1 
ATOM   593  C "C1'"  . DT  B 2 1   ? 10.918  1.483   38.576  1.00 63.05  ? 2001 DT  C "C1'"  1 
ATOM   594  N N1     . DT  B 2 1   ? 9.537   1.046   38.667  1.00 54.60  ? 2001 DT  C N1     1 
ATOM   595  C C2     . DT  B 2 1   ? 8.551   1.960   38.923  1.00 50.73  ? 2001 DT  C C2     1 
ATOM   596  O O2     . DT  B 2 1   ? 8.769   3.148   39.079  1.00 57.16  ? 2001 DT  C O2     1 
ATOM   597  N N3     . DT  B 2 1   ? 7.295   1.427   39.009  1.00 45.03  ? 2001 DT  C N3     1 
ATOM   598  C C4     . DT  B 2 1   ? 6.943   0.102   38.895  1.00 48.76  ? 2001 DT  C C4     1 
ATOM   599  O O4     . DT  B 2 1   ? 5.758   -0.236  39.001  1.00 46.24  ? 2001 DT  C O4     1 
ATOM   600  C C5     . DT  B 2 1   ? 8.048   -0.803  38.651  1.00 49.60  ? 2001 DT  C C5     1 
ATOM   601  C C7     . DT  B 2 1   ? 7.790   -2.270  38.567  1.00 48.65  ? 2001 DT  C C7     1 
ATOM   602  C C6     . DT  B 2 1   ? 9.264   -0.288  38.523  1.00 48.80  ? 2001 DT  C C6     1 
ATOM   603  H H3     . DT  B 2 1   ? 6.539   2.081   39.127  1.00 40.00  ? 2001 DT  C H3     1 
ATOM   604  H "HO5'" . DT  B 2 1   ? 12.178  -3.010  39.621  1.00 40.00  ? 2001 DT  C "HO5'" 1 
ATOM   605  P P      . DT  B 2 2   ? 14.233  1.247   41.583  1.00 76.16  ? 2002 DT  C P      1 
ATOM   606  O OP1    . DT  B 2 2   ? 15.707  1.234   41.782  1.00 77.07  ? 2002 DT  C OP1    1 
ATOM   607  O OP2    . DT  B 2 2   ? 13.378  0.307   42.378  1.00 65.98  ? 2002 DT  C OP2    1 
ATOM   608  O "O5'"  . DT  B 2 2   ? 13.663  2.713   41.841  1.00 74.40  ? 2002 DT  C "O5'"  1 
ATOM   609  C "C5'"  . DT  B 2 2   ? 12.288  2.979   41.610  1.00 70.42  ? 2002 DT  C "C5'"  1 
ATOM   610  C "C4'"  . DT  B 2 2   ? 11.974  4.436   41.831  1.00 67.48  ? 2002 DT  C "C4'"  1 
ATOM   611  O "O4'"  . DT  B 2 2   ? 10.590  4.630   41.460  1.00 65.31  ? 2002 DT  C "O4'"  1 
ATOM   612  C "C3'"  . DT  B 2 2   ? 12.050  4.880   43.287  1.00 66.41  ? 2002 DT  C "C3'"  1 
ATOM   613  O "O3'"  . DT  B 2 2   ? 12.185  6.298   43.323  1.00 72.34  ? 2002 DT  C "O3'"  1 
ATOM   614  C "C2'"  . DT  B 2 2   ? 10.702  4.468   43.837  1.00 63.35  ? 2002 DT  C "C2'"  1 
ATOM   615  C "C1'"  . DT  B 2 2   ? 9.770   4.606   42.630  1.00 59.08  ? 2002 DT  C "C1'"  1 
ATOM   616  N N1     . DT  B 2 2   ? 8.912   3.427   42.537  1.00 49.64  ? 2002 DT  C N1     1 
ATOM   617  C C2     . DT  B 2 2   ? 7.558   3.588   42.427  1.00 46.86  ? 2002 DT  C C2     1 
ATOM   618  O O2     . DT  B 2 2   ? 7.008   4.690   42.427  1.00 50.80  ? 2002 DT  C O2     1 
ATOM   619  N N3     . DT  B 2 2   ? 6.857   2.405   42.332  1.00 43.99  ? 2002 DT  C N3     1 
ATOM   620  C C4     . DT  B 2 2   ? 7.359   1.130   42.338  1.00 43.80  ? 2002 DT  C C4     1 
ATOM   621  O O4     . DT  B 2 2   ? 6.597   0.170   42.201  1.00 41.12  ? 2002 DT  C O4     1 
ATOM   622  C C5     . DT  B 2 2   ? 8.784   1.038   42.486  1.00 42.75  ? 2002 DT  C C5     1 
ATOM   623  C C7     . DT  B 2 2   ? 9.414   -0.316  42.541  1.00 44.89  ? 2002 DT  C C7     1 
ATOM   624  C C6     . DT  B 2 2   ? 9.486   2.176   42.566  1.00 42.92  ? 2002 DT  C C6     1 
ATOM   625  H H3     . DT  B 2 2   ? 5.876   2.459   42.175  1.00 40.00  ? 2002 DT  C H3     1 
ATOM   626  P P      . DC  B 2 3   ? 12.853  7.011   44.595  1.00 76.61  ? 2003 DC  C P      1 
ATOM   627  O OP1    . DC  B 2 3   ? 12.918  8.466   44.247  1.00 72.87  ? 2003 DC  C OP1    1 
ATOM   628  O OP2    . DC  B 2 3   ? 14.117  6.267   44.907  1.00 78.78  ? 2003 DC  C OP2    1 
ATOM   629  O "O5'"  . DC  B 2 3   ? 11.787  6.824   45.784  1.00 73.36  ? 2003 DC  C "O5'"  1 
ATOM   630  C "C5'"  . DC  B 2 3   ? 10.452  6.341   45.510  1.00 63.51  ? 2003 DC  C "C5'"  1 
ATOM   631  C "C4'"  . DC  B 2 3   ? 9.388   7.254   46.081  1.00 59.13  ? 2003 DC  C "C4'"  1 
ATOM   632  O "O4'"  . DC  B 2 3   ? 8.151   6.661   45.627  1.00 56.57  ? 2003 DC  C "O4'"  1 
ATOM   633  C "C3'"  . DC  B 2 3   ? 9.286   7.293   47.615  1.00 59.63  ? 2003 DC  C "C3'"  1 
ATOM   634  O "O3'"  . DC  B 2 3   ? 8.656   8.487   48.110  1.00 52.18  ? 2003 DC  C "O3'"  1 
ATOM   635  C "C2'"  . DC  B 2 3   ? 8.386   6.123   47.924  1.00 59.23  ? 2003 DC  C "C2'"  1 
ATOM   636  C "C1'"  . DC  B 2 3   ? 7.480   6.028   46.709  1.00 56.16  ? 2003 DC  C "C1'"  1 
ATOM   637  N N1     . DC  B 2 3   ? 7.325   4.620   46.376  1.00 51.07  ? 2003 DC  C N1     1 
ATOM   638  C C2     . DC  B 2 3   ? 6.053   4.102   46.203  1.00 53.64  ? 2003 DC  C C2     1 
ATOM   639  O O2     . DC  B 2 3   ? 5.069   4.874   46.198  1.00 56.57  ? 2003 DC  C O2     1 
ATOM   640  N N3     . DC  B 2 3   ? 5.911   2.771   46.033  1.00 50.09  ? 2003 DC  C N3     1 
ATOM   641  C C4     . DC  B 2 3   ? 6.984   1.979   46.010  1.00 50.89  ? 2003 DC  C C4     1 
ATOM   642  N N4     . DC  B 2 3   ? 6.778   0.669   45.906  1.00 54.88  ? 2003 DC  C N4     1 
ATOM   643  C C5     . DC  B 2 3   ? 8.299   2.498   46.109  1.00 48.38  ? 2003 DC  C C5     1 
ATOM   644  C C6     . DC  B 2 3   ? 8.422   3.813   46.289  1.00 50.39  ? 2003 DC  C C6     1 
ATOM   645  H H41    . DC  B 2 3   ? 5.841   0.333   45.883  1.00 40.00  ? 2003 DC  C H41    1 
ATOM   646  H H42    . DC  B 2 3   ? 7.549   0.017   45.894  1.00 40.00  ? 2003 DC  C H42    1 
ATOM   647  P P      . DT  B 2 4   ? 8.525   8.736   49.705  1.00 46.59  ? 2004 DT  C P      1 
ATOM   648  O OP1    . DT  B 2 4   ? 8.534   10.196  49.898  1.00 48.81  ? 2004 DT  C OP1    1 
ATOM   649  O OP2    . DT  B 2 4   ? 9.460   7.895   50.452  1.00 46.96  ? 2004 DT  C OP2    1 
ATOM   650  O "O5'"  . DT  B 2 4   ? 7.072   8.224   50.085  1.00 48.42  ? 2004 DT  C "O5'"  1 
ATOM   651  C "C5'"  . DT  B 2 4   ? 5.903   8.988   49.741  1.00 45.56  ? 2004 DT  C "C5'"  1 
ATOM   652  C "C4'"  . DT  B 2 4   ? 4.651   8.240   50.137  1.00 44.41  ? 2004 DT  C "C4'"  1 
ATOM   653  O "O4'"  . DT  B 2 4   ? 4.704   6.892   49.604  1.00 45.69  ? 2004 DT  C "O4'"  1 
ATOM   654  C "C3'"  . DT  B 2 4   ? 4.401   8.084   51.641  1.00 40.66  ? 2004 DT  C "C3'"  1 
ATOM   655  O "O3'"  . DT  B 2 4   ? 2.994   8.219   51.863  1.00 43.49  ? 2004 DT  C "O3'"  1 
ATOM   656  C "C2'"  . DT  B 2 4   ? 4.827   6.652   51.919  1.00 42.70  ? 2004 DT  C "C2'"  1 
ATOM   657  C "C1'"  . DT  B 2 4   ? 4.471   5.947   50.622  1.00 45.11  ? 2004 DT  C "C1'"  1 
ATOM   658  N N1     . DT  B 2 4   ? 5.258   4.743   50.303  1.00 45.44  ? 2004 DT  C N1     1 
ATOM   659  C C2     . DT  B 2 4   ? 4.567   3.584   49.993  1.00 44.24  ? 2004 DT  C C2     1 
ATOM   660  O O2     . DT  B 2 4   ? 3.353   3.505   49.994  1.00 41.13  ? 2004 DT  C O2     1 
ATOM   661  N N3     . DT  B 2 4   ? 5.359   2.514   49.685  1.00 45.20  ? 2004 DT  C N3     1 
ATOM   662  C C4     . DT  B 2 4   ? 6.736   2.484   49.654  1.00 48.35  ? 2004 DT  C C4     1 
ATOM   663  O O4     . DT  B 2 4   ? 7.314   1.460   49.300  1.00 48.74  ? 2004 DT  C O4     1 
ATOM   664  C C5     . DT  B 2 4   ? 7.394   3.713   50.038  1.00 46.40  ? 2004 DT  C C5     1 
ATOM   665  C C7     . DT  B 2 4   ? 8.890   3.749   50.103  1.00 47.03  ? 2004 DT  C C7     1 
ATOM   666  C C6     . DT  B 2 4   ? 6.634   4.772   50.321  1.00 45.93  ? 2004 DT  C C6     1 
ATOM   667  H H3     . DT  B 2 4   ? 4.885   1.638   49.492  1.00 40.00  ? 2004 DT  C H3     1 
ATOM   668  P P      . DG  B 2 5   ? 2.395   8.202   53.352  1.00 46.35  ? 2005 DG  C P      1 
ATOM   669  O OP1    . DG  B 2 5   ? 1.466   9.387   53.452  1.00 51.04  ? 2005 DG  C OP1    1 
ATOM   670  O OP2    . DG  B 2 5   ? 3.514   8.058   54.308  1.00 47.23  ? 2005 DG  C OP2    1 
ATOM   671  O "O5'"  . DG  B 2 5   ? 1.486   6.893   53.418  1.00 50.10  ? 2005 DG  C "O5'"  1 
ATOM   672  C "C5'"  . DG  B 2 5   ? 0.170   6.897   52.838  1.00 52.94  ? 2005 DG  C "C5'"  1 
ATOM   673  C "C4'"  . DG  B 2 5   ? -0.499  5.556   53.032  1.00 51.52  ? 2005 DG  C "C4'"  1 
ATOM   674  O "O4'"  . DG  B 2 5   ? 0.358   4.533   52.474  1.00 53.11  ? 2005 DG  C "O4'"  1 
ATOM   675  C "C3'"  . DG  B 2 5   ? -0.770  5.138   54.475  1.00 49.16  ? 2005 DG  C "C3'"  1 
ATOM   676  O "O3'"  . DG  B 2 5   ? -2.006  4.439   54.529  1.00 57.01  ? 2005 DG  C "O3'"  1 
ATOM   677  C "C2'"  . DG  B 2 5   ? 0.333   4.146   54.777  1.00 48.06  ? 2005 DG  C "C2'"  1 
ATOM   678  C "C1'"  . DG  B 2 5   ? 0.546   3.506   53.427  1.00 48.21  ? 2005 DG  C "C1'"  1 
ATOM   679  N N9     . DG  B 2 5   ? 1.893   2.988   53.257  1.00 45.78  ? 2005 DG  C N9     1 
ATOM   680  C C8     . DG  B 2 5   ? 3.061   3.701   53.273  1.00 42.45  ? 2005 DG  C C8     1 
ATOM   681  N N7     . DG  B 2 5   ? 4.115   2.969   53.081  1.00 43.35  ? 2005 DG  C N7     1 
ATOM   682  C C5     . DG  B 2 5   ? 3.611   1.679   52.949  1.00 44.92  ? 2005 DG  C C5     1 
ATOM   683  C C6     . DG  B 2 5   ? 4.268   0.465   52.678  1.00 45.19  ? 2005 DG  C C6     1 
ATOM   684  O O6     . DG  B 2 5   ? 5.482   0.264   52.532  1.00 46.96  ? 2005 DG  C O6     1 
ATOM   685  N N1     . DG  B 2 5   ? 3.366   -0.588  52.567  1.00 42.50  ? 2005 DG  C N1     1 
ATOM   686  C C2     . DG  B 2 5   ? 2.009   -0.485  52.711  1.00 48.29  ? 2005 DG  C C2     1 
ATOM   687  N N2     . DG  B 2 5   ? 1.309   -1.625  52.601  1.00 52.88  ? 2005 DG  C N2     1 
ATOM   688  N N3     . DG  B 2 5   ? 1.376   0.648   52.955  1.00 46.89  ? 2005 DG  C N3     1 
ATOM   689  C C4     . DG  B 2 5   ? 2.243   1.685   53.059  1.00 45.29  ? 2005 DG  C C4     1 
ATOM   690  H H1     . DG  B 2 5   ? 3.743   -1.509  52.363  1.00 40.00  ? 2005 DG  C H1     1 
ATOM   691  H H21    . DG  B 2 5   ? 1.753   -2.495  52.356  1.00 40.00  ? 2005 DG  C H21    1 
ATOM   692  H H22    . DG  B 2 5   ? 0.305   -1.598  52.712  1.00 40.00  ? 2005 DG  C H22    1 
ATOM   693  P P      . DT  B 2 6   ? -2.716  4.200   55.946  1.00 61.45  ? 2006 DT  C P      1 
ATOM   694  O OP1    . DT  B 2 6   ? -4.103  4.708   55.847  1.00 63.44  ? 2006 DT  C OP1    1 
ATOM   695  O OP2    . DT  B 2 6   ? -1.816  4.716   57.026  1.00 58.78  ? 2006 DT  C OP2    1 
ATOM   696  O "O5'"  . DT  B 2 6   ? -2.790  2.617   56.036  1.00 60.76  ? 2006 DT  C "O5'"  1 
ATOM   697  C "C5'"  . DT  B 2 6   ? -1.966  1.810   55.199  1.00 58.63  ? 2006 DT  C "C5'"  1 
ATOM   698  C "C4'"  . DT  B 2 6   ? -2.262  0.351   55.438  1.00 58.47  ? 2006 DT  C "C4'"  1 
ATOM   699  O "O4'"  . DT  B 2 6   ? -1.063  -0.368  55.107  1.00 59.40  ? 2006 DT  C "O4'"  1 
ATOM   700  C "C3'"  . DT  B 2 6   ? -2.590  -0.037  56.874  1.00 59.56  ? 2006 DT  C "C3'"  1 
ATOM   701  O "O3'"  . DT  B 2 6   ? -3.502  -1.134  56.781  1.00 69.23  ? 2006 DT  C "O3'"  1 
ATOM   702  C "C2'"  . DT  B 2 6   ? -1.240  -0.430  57.449  1.00 56.43  ? 2006 DT  C "C2'"  1 
ATOM   703  C "C1'"  . DT  B 2 6   ? -0.496  -0.999  56.245  1.00 54.89  ? 2006 DT  C "C1'"  1 
ATOM   704  N N1     . DT  B 2 6   ? 0.948   -0.695  56.227  1.00 54.12  ? 2006 DT  C N1     1 
ATOM   705  C C2     . DT  B 2 6   ? 1.834   -1.694  55.896  1.00 55.32  ? 2006 DT  C C2     1 
ATOM   706  O O2     . DT  B 2 6   ? 1.492   -2.838  55.678  1.00 58.99  ? 2006 DT  C O2     1 
ATOM   707  N N3     . DT  B 2 6   ? 3.150   -1.298  55.842  1.00 53.02  ? 2006 DT  C N3     1 
ATOM   708  C C4     . DT  B 2 6   ? 3.650   -0.025  56.088  1.00 47.62  ? 2006 DT  C C4     1 
ATOM   709  O O4     . DT  B 2 6   ? 4.849   0.198   55.964  1.00 52.18  ? 2006 DT  C O4     1 
ATOM   710  C C5     . DT  B 2 6   ? 2.665   0.957   56.471  1.00 49.06  ? 2006 DT  C C5     1 
ATOM   711  C C7     . DT  B 2 6   ? 3.111   2.337   56.821  1.00 47.21  ? 2006 DT  C C7     1 
ATOM   712  C C6     . DT  B 2 6   ? 1.384   0.581   56.512  1.00 51.67  ? 2006 DT  C C6     1 
ATOM   713  H H3     . DT  B 2 6   ? 3.827   -2.019  55.635  1.00 40.00  ? 2006 DT  C H3     1 
ATOM   714  P P      . DG  B 2 7   ? -4.277  -1.665  58.087  1.00 66.06  ? 2007 DG  C P      1 
ATOM   715  O OP1    . DG  B 2 7   ? -5.597  -2.103  57.555  1.00 66.40  ? 2007 DG  C OP1    1 
ATOM   716  O OP2    . DG  B 2 7   ? -4.236  -0.692  59.225  1.00 59.26  ? 2007 DG  C OP2    1 
ATOM   717  O "O5'"  . DG  B 2 7   ? -3.429  -2.960  58.481  1.00 65.44  ? 2007 DG  C "O5'"  1 
ATOM   718  C "C5'"  . DG  B 2 7   ? -2.895  -3.788  57.447  1.00 62.55  ? 2007 DG  C "C5'"  1 
ATOM   719  C "C4'"  . DG  B 2 7   ? -1.959  -4.833  58.010  1.00 62.25  ? 2007 DG  C "C4'"  1 
ATOM   720  O "O4'"  . DG  B 2 7   ? -0.568  -4.458  57.882  1.00 58.59  ? 2007 DG  C "O4'"  1 
ATOM   721  C "C3'"  . DG  B 2 7   ? -2.179  -5.234  59.467  1.00 67.13  ? 2007 DG  C "C3'"  1 
ATOM   722  O "O3'"  . DG  B 2 7   ? -2.097  -6.658  59.535  1.00 76.12  ? 2007 DG  C "O3'"  1 
ATOM   723  C "C2'"  . DG  B 2 7   ? -1.010  -4.579  60.179  1.00 61.34  ? 2007 DG  C "C2'"  1 
ATOM   724  C "C1'"  . DG  B 2 7   ? 0.097   -4.594  59.126  1.00 57.45  ? 2007 DG  C "C1'"  1 
ATOM   725  N N9     . DG  B 2 7   ? 1.039   -3.493  59.222  1.00 58.96  ? 2007 DG  C N9     1 
ATOM   726  C C8     . DG  B 2 7   ? 0.740   -2.190  59.543  1.00 59.49  ? 2007 DG  C C8     1 
ATOM   727  N N7     . DG  B 2 7   ? 1.773   -1.408  59.498  1.00 52.79  ? 2007 DG  C N7     1 
ATOM   728  C C5     . DG  B 2 7   ? 2.816   -2.243  59.139  1.00 50.11  ? 2007 DG  C C5     1 
ATOM   729  C C6     . DG  B 2 7   ? 4.161   -1.947  58.938  1.00 48.54  ? 2007 DG  C C6     1 
ATOM   730  O O6     . DG  B 2 7   ? 4.724   -0.846  59.021  1.00 51.62  ? 2007 DG  C O6     1 
ATOM   731  N N1     . DG  B 2 7   ? 4.882   -3.079  58.597  1.00 47.81  ? 2007 DG  C N1     1 
ATOM   732  C C2     . DG  B 2 7   ? 4.357   -4.329  58.434  1.00 44.16  ? 2007 DG  C C2     1 
ATOM   733  N N2     . DG  B 2 7   ? 5.227   -5.269  58.031  1.00 44.60  ? 2007 DG  C N2     1 
ATOM   734  N N3     . DG  B 2 7   ? 3.092   -4.624  58.634  1.00 39.40  ? 2007 DG  C N3     1 
ATOM   735  C C4     . DG  B 2 7   ? 2.380   -3.533  58.980  1.00 50.22  ? 2007 DG  C C4     1 
ATOM   736  H H1     . DG  B 2 7   ? 5.890   -3.005  58.572  1.00 40.00  ? 2007 DG  C H1     1 
ATOM   737  H H21    . DG  B 2 7   ? 6.195   -5.000  57.935  1.00 40.00  ? 2007 DG  C H21    1 
ATOM   738  H H22    . DG  B 2 7   ? 4.944   -6.220  57.845  1.00 40.00  ? 2007 DG  C H22    1 
ATOM   739  P P      . DC  B 2 8   ? -2.363  -7.410  60.929  1.00 76.54  ? 2008 DC  C P      1 
ATOM   740  O OP1    . DC  B 2 8   ? -3.261  -8.560  60.646  1.00 80.78  ? 2008 DC  C OP1    1 
ATOM   741  O OP2    . DC  B 2 8   ? -2.746  -6.417  61.965  1.00 70.13  ? 2008 DC  C OP2    1 
ATOM   742  O "O5'"  . DC  B 2 8   ? -0.921  -7.997  61.269  1.00 71.25  ? 2008 DC  C "O5'"  1 
ATOM   743  C "C5'"  . DC  B 2 8   ? 0.236   -7.442  60.665  1.00 71.70  ? 2008 DC  C "C5'"  1 
ATOM   744  C "C4'"  . DC  B 2 8   ? 1.391   -8.394  60.819  1.00 70.51  ? 2008 DC  C "C4'"  1 
ATOM   745  O "O4'"  . DC  B 2 8   ? 2.592   -7.660  60.481  1.00 69.89  ? 2008 DC  C "O4'"  1 
ATOM   746  C "C3'"  . DC  B 2 8   ? 1.590   -8.894  62.244  1.00 69.99  ? 2008 DC  C "C3'"  1 
ATOM   747  O "O3'"  . DC  B 2 8   ? 2.148   -10.198 62.219  1.00 71.51  ? 2008 DC  C "O3'"  1 
ATOM   748  C "C2'"  . DC  B 2 8   ? 2.577   -7.921  62.845  1.00 66.45  ? 2008 DC  C "C2'"  1 
ATOM   749  C "C1'"  . DC  B 2 8   ? 3.338   -7.356  61.648  1.00 64.59  ? 2008 DC  C "C1'"  1 
ATOM   750  N N1     . DC  B 2 8   ? 3.378   -5.900  61.772  1.00 55.69  ? 2008 DC  C N1     1 
ATOM   751  C C2     . DC  B 2 8   ? 4.589   -5.262  61.726  1.00 47.49  ? 2008 DC  C C2     1 
ATOM   752  O O2     . DC  B 2 8   ? 5.613   -5.919  61.486  1.00 50.90  ? 2008 DC  C O2     1 
ATOM   753  N N3     . DC  B 2 8   ? 4.634   -3.943  61.946  1.00 41.18  ? 2008 DC  C N3     1 
ATOM   754  C C4     . DC  B 2 8   ? 3.518   -3.262  62.211  1.00 42.76  ? 2008 DC  C C4     1 
ATOM   755  N N4     . DC  B 2 8   ? 3.634   -1.963  62.514  1.00 41.62  ? 2008 DC  C N4     1 
ATOM   756  C C5     . DC  B 2 8   ? 2.248   -3.880  62.199  1.00 42.54  ? 2008 DC  C C5     1 
ATOM   757  C C6     . DC  B 2 8   ? 2.223   -5.192  61.975  1.00 50.07  ? 2008 DC  C C6     1 
ATOM   758  H H41    . DC  B 2 8   ? 4.548   -1.544  62.512  1.00 40.00  ? 2008 DC  C H41    1 
ATOM   759  H H42    . DC  B 2 8   ? 2.809   -1.441  62.740  1.00 40.00  ? 2008 DC  C H42    1 
ATOM   760  P P      . DA  B 2 9   ? 2.285   -11.035 63.573  1.00 70.21  ? 2009 DA  C P      1 
ATOM   761  O OP1    . DA  B 2 9   ? 1.906   -12.416 63.187  1.00 74.88  ? 2009 DA  C OP1    1 
ATOM   762  O OP2    . DA  B 2 9   ? 1.596   -10.360 64.700  1.00 69.45  ? 2009 DA  C OP2    1 
ATOM   763  O "O5'"  . DA  B 2 9   ? 3.846   -11.006 63.853  1.00 65.43  ? 2009 DA  C "O5'"  1 
ATOM   764  C "C5'"  . DA  B 2 9   ? 4.750   -11.324 62.799  1.00 64.10  ? 2009 DA  C "C5'"  1 
ATOM   765  C "C4'"  . DA  B 2 9   ? 6.157   -10.992 63.218  1.00 64.01  ? 2009 DA  C "C4'"  1 
ATOM   766  O "O4'"  . DA  B 2 9   ? 6.290   -9.562  63.392  1.00 64.48  ? 2009 DA  C "O4'"  1 
ATOM   767  C "C3'"  . DA  B 2 9   ? 6.556   -11.605 64.547  1.00 64.57  ? 2009 DA  C "C3'"  1 
ATOM   768  O "O3'"  . DA  B 2 9   ? 7.913   -12.012 64.463  1.00 67.94  ? 2009 DA  C "O3'"  1 
ATOM   769  C "C2'"  . DA  B 2 9   ? 6.386   -10.467 65.543  1.00 64.23  ? 2009 DA  C "C2'"  1 
ATOM   770  C "C1'"  . DA  B 2 9   ? 6.688   -9.239  64.714  1.00 59.52  ? 2009 DA  C "C1'"  1 
ATOM   771  N N9     . DA  B 2 9   ? 5.944   -8.040  65.094  1.00 54.10  ? 2009 DA  C N9     1 
ATOM   772  C C8     . DA  B 2 9   ? 4.633   -7.947  65.494  1.00 56.32  ? 2009 DA  C C8     1 
ATOM   773  N N7     . DA  B 2 9   ? 4.216   -6.715  65.654  1.00 56.79  ? 2009 DA  C N7     1 
ATOM   774  C C5     . DA  B 2 9   ? 5.334   -5.950  65.358  1.00 51.28  ? 2009 DA  C C5     1 
ATOM   775  C C6     . DA  B 2 9   ? 5.541   -4.565  65.311  1.00 48.23  ? 2009 DA  C C6     1 
ATOM   776  N N6     . DA  B 2 9   ? 4.563   -3.668  65.543  1.00 45.01  ? 2009 DA  C N6     1 
ATOM   777  N N1     . DA  B 2 9   ? 6.788   -4.119  65.002  1.00 47.44  ? 2009 DA  C N1     1 
ATOM   778  C C2     . DA  B 2 9   ? 7.743   -5.016  64.752  1.00 47.81  ? 2009 DA  C C2     1 
ATOM   779  N N3     . DA  B 2 9   ? 7.662   -6.349  64.744  1.00 47.40  ? 2009 DA  C N3     1 
ATOM   780  C C4     . DA  B 2 9   ? 6.418   -6.753  65.055  1.00 50.41  ? 2009 DA  C C4     1 
ATOM   781  H H61    . DA  B 2 9   ? 4.758   -2.679  65.480  1.00 40.00  ? 2009 DA  C H61    1 
ATOM   782  H H62    . DA  B 2 9   ? 3.640   -4.004  65.745  1.00 40.00  ? 2009 DA  C H62    1 
ATOM   783  P P      . DC  B 2 10  ? 8.603   -12.705 65.723  1.00 75.32  ? 2010 DC  C P      1 
ATOM   784  O OP1    . DC  B 2 10  ? 9.240   -13.965 65.274  1.00 75.39  ? 2010 DC  C OP1    1 
ATOM   785  O OP2    . DC  B 2 10  ? 7.571   -12.741 66.811  1.00 73.94  ? 2010 DC  C OP2    1 
ATOM   786  O "O5'"  . DC  B 2 10  ? 9.776   -11.687 66.097  1.00 73.55  ? 2010 DC  C "O5'"  1 
ATOM   787  C "C5'"  . DC  B 2 10  ? 9.634   -10.284 65.856  1.00 71.11  ? 2010 DC  C "C5'"  1 
ATOM   788  C "C4'"  . DC  B 2 10  ? 10.884  -9.588  66.320  1.00 67.17  ? 2010 DC  C "C4'"  1 
ATOM   789  O "O4'"  . DC  B 2 10  ? 10.602  -8.174  66.398  1.00 69.82  ? 2010 DC  C "O4'"  1 
ATOM   790  C "C3'"  . DC  B 2 10  ? 11.289  -10.032 67.723  1.00 62.36  ? 2010 DC  C "C3'"  1 
ATOM   791  O "O3'"  . DC  B 2 10  ? 12.697  -10.240 67.809  1.00 61.60  ? 2010 DC  C "O3'"  1 
ATOM   792  C "C2'"  . DC  B 2 10  ? 10.794  -8.929  68.635  1.00 63.52  ? 2010 DC  C "C2'"  1 
ATOM   793  C "C1'"  . DC  B 2 10  ? 10.620  -7.707  67.743  1.00 62.60  ? 2010 DC  C "C1'"  1 
ATOM   794  N N1     . DC  B 2 10  ? 9.307   -7.095  67.997  1.00 59.09  ? 2010 DC  C N1     1 
ATOM   795  C C2     . DC  B 2 10  ? 9.178   -5.714  68.045  1.00 57.92  ? 2010 DC  C C2     1 
ATOM   796  O O2     . DC  B 2 10  ? 10.181  -5.011  67.859  1.00 58.80  ? 2010 DC  C O2     1 
ATOM   797  N N3     . DC  B 2 10  ? 7.957   -5.179  68.289  1.00 54.07  ? 2010 DC  C N3     1 
ATOM   798  C C4     . DC  B 2 10  ? 6.900   -5.982  68.486  1.00 48.39  ? 2010 DC  C C4     1 
ATOM   799  N N4     . DC  B 2 10  ? 5.717   -5.417  68.746  1.00 44.27  ? 2010 DC  C N4     1 
ATOM   800  C C5     . DC  B 2 10  ? 7.014   -7.398  68.438  1.00 54.35  ? 2010 DC  C C5     1 
ATOM   801  C C6     . DC  B 2 10  ? 8.220   -7.905  68.197  1.00 59.18  ? 2010 DC  C C6     1 
ATOM   802  H H41    . DC  B 2 10  ? 5.616   -4.420  68.765  1.00 40.00  ? 2010 DC  C H41    1 
ATOM   803  H H42    . DC  B 2 10  ? 4.940   -6.025  68.961  1.00 40.00  ? 2010 DC  C H42    1 
ATOM   804  P P      . DT  B 2 11  ? 13.389  -10.314 69.250  1.00 65.57  ? 2011 DT  C P      1 
ATOM   805  O OP1    . DT  B 2 11  ? 14.395  -11.405 69.229  1.00 73.29  ? 2011 DT  C OP1    1 
ATOM   806  O OP2    . DT  B 2 11  ? 12.308  -10.332 70.276  1.00 66.22  ? 2011 DT  C OP2    1 
ATOM   807  O "O5'"  . DT  B 2 11  ? 14.106  -8.908  69.336  1.00 62.66  ? 2011 DT  C "O5'"  1 
ATOM   808  C "C5'"  . DT  B 2 11  ? 13.321  -7.721  69.198  1.00 63.45  ? 2011 DT  C "C5'"  1 
ATOM   809  C "C4'"  . DT  B 2 11  ? 14.088  -6.498  69.632  1.00 56.47  ? 2011 DT  C "C4'"  1 
ATOM   810  O "O4'"  . DT  B 2 11  ? 13.093  -5.484  69.856  1.00 54.52  ? 2011 DT  C "O4'"  1 
ATOM   811  C "C3'"  . DT  B 2 11  ? 14.804  -6.637  70.970  1.00 52.63  ? 2011 DT  C "C3'"  1 
ATOM   812  O "O3'"  . DT  B 2 11  ? 15.820  -5.628  71.031  1.00 53.39  ? 2011 DT  C "O3'"  1 
ATOM   813  C "C2'"  . DT  B 2 11  ? 13.695  -6.388  71.973  1.00 53.33  ? 2011 DT  C "C2'"  1 
ATOM   814  C "C1'"  . DT  B 2 11  ? 12.819  -5.362  71.251  1.00 50.58  ? 2011 DT  C "C1'"  1 
ATOM   815  N N1     . DT  B 2 11  ? 11.373  -5.564  71.416  1.00 47.23  ? 2011 DT  C N1     1 
ATOM   816  C C2     . DT  B 2 11  ? 10.584  -4.448  71.435  1.00 45.05  ? 2011 DT  C C2     1 
ATOM   817  O O2     . DT  B 2 11  ? 11.038  -3.321  71.354  1.00 48.33  ? 2011 DT  C O2     1 
ATOM   818  N N3     . DT  B 2 11  ? 9.243   -4.698  71.565  1.00 41.32  ? 2011 DT  C N3     1 
ATOM   819  C C4     . DT  B 2 11  ? 8.627   -5.926  71.687  1.00 43.32  ? 2011 DT  C C4     1 
ATOM   820  O O4     . DT  B 2 11  ? 7.384   -5.987  71.826  1.00 42.38  ? 2011 DT  C O4     1 
ATOM   821  C C5     . DT  B 2 11  ? 9.530   -7.070  71.650  1.00 43.58  ? 2011 DT  C C5     1 
ATOM   822  C C7     . DT  B 2 11  ? 8.957   -8.457  71.742  1.00 43.14  ? 2011 DT  C C7     1 
ATOM   823  C C6     . DT  B 2 11  ? 10.842  -6.827  71.528  1.00 44.51  ? 2011 DT  C C6     1 
ATOM   824  H H3     . DT  B 2 11  ? 8.630   -3.891  71.600  1.00 40.00  ? 2011 DT  C H3     1 
ATOM   825  P P      . DC  B 2 12  ? 17.230  -5.933  71.742  1.00 57.14  ? 2012 DC  C P      1 
ATOM   826  O OP1    . DC  B 2 12  ? 18.307  -5.675  70.755  1.00 60.73  ? 2012 DC  C OP1    1 
ATOM   827  O OP2    . DC  B 2 12  ? 17.146  -7.246  72.429  1.00 54.53  ? 2012 DC  C OP2    1 
ATOM   828  O "O5'"  . DC  B 2 12  ? 17.350  -4.793  72.845  1.00 57.18  ? 2012 DC  C "O5'"  1 
ATOM   829  C "C5'"  . DC  B 2 12  ? 17.084  -5.088  74.198  1.00 61.25  ? 2012 DC  C "C5'"  1 
ATOM   830  C "C4'"  . DC  B 2 12  ? 16.283  -3.974  74.819  1.00 58.28  ? 2012 DC  C "C4'"  1 
ATOM   831  O "O4'"  . DC  B 2 12  ? 14.874  -4.163  74.532  1.00 55.41  ? 2012 DC  C "O4'"  1 
ATOM   832  C "C3'"  . DC  B 2 12  ? 16.409  -3.992  76.339  1.00 55.38  ? 2012 DC  C "C3'"  1 
ATOM   833  O "O3'"  . DC  B 2 12  ? 16.388  -2.663  76.825  1.00 59.35  ? 2012 DC  C "O3'"  1 
ATOM   834  C "C2'"  . DC  B 2 12  ? 15.154  -4.704  76.775  1.00 55.60  ? 2012 DC  C "C2'"  1 
ATOM   835  C "C1'"  . DC  B 2 12  ? 14.170  -4.210  75.758  1.00 52.54  ? 2012 DC  C "C1'"  1 
ATOM   836  N N1     . DC  B 2 12  ? 13.025  -5.099  75.615  1.00 50.67  ? 2012 DC  C N1     1 
ATOM   837  C C2     . DC  B 2 12  ? 11.741  -4.538  75.605  1.00 49.74  ? 2012 DC  C C2     1 
ATOM   838  O O2     . DC  B 2 12  ? 11.610  -3.300  75.730  1.00 57.20  ? 2012 DC  C O2     1 
ATOM   839  N N3     . DC  B 2 12  ? 10.677  -5.346  75.470  1.00 46.39  ? 2012 DC  C N3     1 
ATOM   840  C C4     . DC  B 2 12  ? 10.848  -6.660  75.350  1.00 50.26  ? 2012 DC  C C4     1 
ATOM   841  N N4     . DC  B 2 12  ? 9.761   -7.412  75.226  1.00 49.16  ? 2012 DC  C N4     1 
ATOM   842  C C5     . DC  B 2 12  ? 12.129  -7.254  75.356  1.00 47.20  ? 2012 DC  C C5     1 
ATOM   843  C C6     . DC  B 2 12  ? 13.187  -6.447  75.495  1.00 48.38  ? 2012 DC  C C6     1 
ATOM   844  H H41    . DC  B 2 12  ? 8.839   -6.972  75.199  1.00 40.00  ? 2012 DC  C H41    1 
ATOM   845  H H42    . DC  B 2 12  ? 9.843   -8.411  75.151  1.00 40.00  ? 2012 DC  C H42    1 
ATOM   846  P P      . DA  B 2 13  ? 17.753  -1.998  77.299  1.00 61.37  ? 2013 DA  C P      1 
ATOM   847  O OP1    . DA  B 2 13  ? 18.521  -1.675  76.058  1.00 61.21  ? 2013 DA  C OP1    1 
ATOM   848  O OP2    . DA  B 2 13  ? 18.344  -2.900  78.320  1.00 63.28  ? 2013 DA  C OP2    1 
ATOM   849  O "O5'"  . DA  B 2 13  ? 17.277  -0.644  77.998  1.00 62.02  ? 2013 DA  C "O5'"  1 
ATOM   850  C "C5'"  . DA  B 2 13  ? 16.564  0.356   77.254  1.00 55.44  ? 2013 DA  C "C5'"  1 
ATOM   851  C "C4'"  . DA  B 2 13  ? 15.295  0.724   77.983  1.00 51.01  ? 2013 DA  C "C4'"  1 
ATOM   852  O "O4'"  . DA  B 2 13  ? 14.378  -0.388  77.974  1.00 48.10  ? 2013 DA  C "O4'"  1 
ATOM   853  C "C3'"  . DA  B 2 13  ? 15.490  1.057   79.458  1.00 47.35  ? 2013 DA  C "C3'"  1 
ATOM   854  O "O3'"  . DA  B 2 13  ? 14.522  2.025   79.828  1.00 52.37  ? 2013 DA  C "O3'"  1 
ATOM   855  C "C2'"  . DA  B 2 13  ? 15.186  -0.253  80.158  1.00 47.73  ? 2013 DA  C "C2'"  1 
ATOM   856  C "C1'"  . DA  B 2 13  ? 14.057  -0.760  79.308  1.00 47.43  ? 2013 DA  C "C1'"  1 
ATOM   857  N N9     . DA  B 2 13  ? 13.851  -2.195  79.319  1.00 45.54  ? 2013 DA  C N9     1 
ATOM   858  C C8     . DA  B 2 13  ? 14.727  -3.229  79.515  1.00 48.31  ? 2013 DA  C C8     1 
ATOM   859  N N7     . DA  B 2 13  ? 14.170  -4.418  79.408  1.00 42.69  ? 2013 DA  C N7     1 
ATOM   860  C C5     . DA  B 2 13  ? 12.846  -4.139  79.133  1.00 38.07  ? 2013 DA  C C5     1 
ATOM   861  C C6     . DA  B 2 13  ? 11.744  -4.961  78.913  1.00 41.42  ? 2013 DA  C C6     1 
ATOM   862  N N6     . DA  B 2 13  ? 11.820  -6.291  78.935  1.00 42.80  ? 2013 DA  C N6     1 
ATOM   863  N N1     . DA  B 2 13  ? 10.554  -4.369  78.671  1.00 37.89  ? 2013 DA  C N1     1 
ATOM   864  C C2     . DA  B 2 13  ? 10.498  -3.034  78.663  1.00 38.80  ? 2013 DA  C C2     1 
ATOM   865  N N3     . DA  B 2 13  ? 11.470  -2.149  78.867  1.00 42.94  ? 2013 DA  C N3     1 
ATOM   866  C C4     . DA  B 2 13  ? 12.631  -2.779  79.091  1.00 41.87  ? 2013 DA  C C4     1 
ATOM   867  H H61    . DA  B 2 13  ? 10.975  -6.812  78.766  1.00 40.00  ? 2013 DA  C H61    1 
ATOM   868  H H62    . DA  B 2 13  ? 12.700  -6.745  79.123  1.00 40.00  ? 2013 DA  C H62    1 
ATOM   869  P P      . DT  B 2 14  ? 14.934  3.224   80.807  1.00 58.93  ? 2014 DT  C P      1 
ATOM   870  O OP1    . DT  B 2 14  ? 14.823  4.499   80.039  1.00 57.31  ? 2014 DT  C OP1    1 
ATOM   871  O OP2    . DT  B 2 14  ? 16.226  2.859   81.448  1.00 61.51  ? 2014 DT  C OP2    1 
ATOM   872  O "O5'"  . DT  B 2 14  ? 13.789  3.145   81.895  1.00 52.72  ? 2014 DT  C "O5'"  1 
ATOM   873  C "C5'"  . DT  B 2 14  ? 13.171  1.883   82.132  1.00 49.30  ? 2014 DT  C "C5'"  1 
ATOM   874  C "C4'"  . DT  B 2 14  ? 11.683  2.014   81.993  1.00 45.00  ? 2014 DT  C "C4'"  1 
ATOM   875  O "O4'"  . DT  B 2 14  ? 11.220  0.853   81.268  1.00 47.12  ? 2014 DT  C "O4'"  1 
ATOM   876  C "C3'"  . DT  B 2 14  ? 11.001  2.009   83.352  1.00 47.73  ? 2014 DT  C "C3'"  1 
ATOM   877  O "O3'"  . DT  B 2 14  ? 10.289  3.190   83.659  1.00 44.94  ? 2014 DT  C "O3'"  1 
ATOM   878  C "C2'"  . DT  B 2 14  ? 10.111  0.780   83.363  1.00 45.01  ? 2014 DT  C "C2'"  1 
ATOM   879  C "C1'"  . DT  B 2 14  ? 10.172  0.205   81.958  1.00 45.92  ? 2014 DT  C "C1'"  1 
ATOM   880  N N1     . DT  B 2 14  ? 10.513  -1.210  82.045  1.00 42.22  ? 2014 DT  C N1     1 
ATOM   881  C C2     . DT  B 2 14  ? 9.524   -2.134  81.886  1.00 39.20  ? 2014 DT  C C2     1 
ATOM   882  O O2     . DT  B 2 14  ? 8.383   -1.841  81.612  1.00 43.54  ? 2014 DT  C O2     1 
ATOM   883  N N3     . DT  B 2 14  ? 9.923   -3.439  82.067  1.00 41.97  ? 2014 DT  C N3     1 
ATOM   884  C C4     . DT  B 2 14  ? 11.198  -3.894  82.350  1.00 43.31  ? 2014 DT  C C4     1 
ATOM   885  O O4     . DT  B 2 14  ? 11.409  -5.109  82.493  1.00 45.10  ? 2014 DT  C O4     1 
ATOM   886  C C5     . DT  B 2 14  ? 12.195  -2.864  82.462  1.00 43.27  ? 2014 DT  C C5     1 
ATOM   887  C C7     . DT  B 2 14  ? 13.615  -3.264  82.729  1.00 38.68  ? 2014 DT  C C7     1 
ATOM   888  C C6     . DT  B 2 14  ? 11.807  -1.589  82.316  1.00 38.24  ? 2014 DT  C C6     1 
ATOM   889  H H3     . DT  B 2 14  ? 9.185   -4.128  82.037  1.00 40.00  ? 2014 DT  C H3     1 
ATOM   890  P P      . DG  B 2 15  ? 9.998   3.507   85.201  1.00 43.87  ? 2015 DG  C P      1 
ATOM   891  O OP1    . DG  B 2 15  ? 9.707   4.951   85.350  1.00 42.50  ? 2015 DG  C OP1    1 
ATOM   892  O OP2    . DG  B 2 15  ? 11.079  2.873   86.044  1.00 38.43  ? 2015 DG  C OP2    1 
ATOM   893  O "O5'"  . DG  B 2 15  ? 8.686   2.667   85.494  1.00 39.66  ? 2015 DG  C "O5'"  1 
ATOM   894  C "C5'"  . DG  B 2 15  ? 7.502   2.919   84.784  1.00 38.87  ? 2015 DG  C "C5'"  1 
ATOM   895  C "C4'"  . DG  B 2 15  ? 6.408   2.032   85.306  1.00 38.21  ? 2015 DG  C "C4'"  1 
ATOM   896  O "O4'"  . DG  B 2 15  ? 6.751   0.671   84.989  1.00 37.41  ? 2015 DG  C "O4'"  1 
ATOM   897  C "C3'"  . DG  B 2 15  ? 6.266   2.092   86.831  1.00 32.91  ? 2015 DG  C "C3'"  1 
ATOM   898  O "O3'"  . DG  B 2 15  ? 4.911   1.872   87.186  1.00 33.85  ? 2015 DG  C "O3'"  1 
ATOM   899  C "C2'"  . DG  B 2 15  ? 7.125   0.931   87.316  1.00 36.40  ? 2015 DG  C "C2'"  1 
ATOM   900  C "C1'"  . DG  B 2 15  ? 6.877   -0.086  86.197  1.00 35.14  ? 2015 DG  C "C1'"  1 
ATOM   901  N N9     . DG  B 2 15  ? 7.974   -1.026  86.011  1.00 37.06  ? 2015 DG  C N9     1 
ATOM   902  C C8     . DG  B 2 15  ? 9.330   -0.745  86.032  1.00 37.69  ? 2015 DG  C C8     1 
ATOM   903  N N7     . DG  B 2 15  ? 10.075  -1.802  85.829  1.00 36.84  ? 2015 DG  C N7     1 
ATOM   904  C C5     . DG  B 2 15  ? 9.159   -2.850  85.675  1.00 34.48  ? 2015 DG  C C5     1 
ATOM   905  C C6     . DG  B 2 15  ? 9.367   -4.229  85.457  1.00 33.74  ? 2015 DG  C C6     1 
ATOM   906  O O6     . DG  B 2 15  ? 10.417  -4.830  85.345  1.00 35.70  ? 2015 DG  C O6     1 
ATOM   907  N N1     . DG  B 2 15  ? 8.163   -4.923  85.373  1.00 35.68  ? 2015 DG  C N1     1 
ATOM   908  C C2     . DG  B 2 15  ? 6.903   -4.359  85.488  1.00 40.31  ? 2015 DG  C C2     1 
ATOM   909  N N2     . DG  B 2 15  ? 5.850   -5.175  85.402  1.00 32.88  ? 2015 DG  C N2     1 
ATOM   910  N N3     . DG  B 2 15  ? 6.699   -3.083  85.681  1.00 39.66  ? 2015 DG  C N3     1 
ATOM   911  C C4     . DG  B 2 15  ? 7.863   -2.390  85.774  1.00 36.57  ? 2015 DG  C C4     1 
ATOM   912  H H1     . DG  B 2 15  ? 8.215   -5.919  85.214  1.00 40.00  ? 2015 DG  C H1     1 
ATOM   913  H H21    . DG  B 2 15  ? 5.976   -6.176  85.265  1.00 40.00  ? 2015 DG  C H21    1 
ATOM   914  H H22    . DG  B 2 15  ? 4.915   -4.801  85.479  1.00 40.00  ? 2015 DG  C H22    1 
ATOM   915  P P      . DC  B 2 16  ? 4.454   1.894   88.717  1.00 36.09  ? 2016 DC  C P      1 
ATOM   916  O OP1    . DC  B 2 16  ? 3.230   2.760   88.766  1.00 36.76  ? 2016 DC  C OP1    1 
ATOM   917  O OP2    . DC  B 2 16  ? 5.610   2.200   89.608  1.00 37.05  ? 2016 DC  C OP2    1 
ATOM   918  O "O5'"  . DC  B 2 16  ? 3.969   0.410   88.975  1.00 38.91  ? 2016 DC  C "O5'"  1 
ATOM   919  C "C5'"  . DC  B 2 16  ? 3.773   -0.479  87.864  1.00 43.32  ? 2016 DC  C "C5'"  1 
ATOM   920  C "C4'"  . DC  B 2 16  ? 2.981   -1.684  88.300  1.00 42.09  ? 2016 DC  C "C4'"  1 
ATOM   921  O "O4'"  . DC  B 2 16  ? 3.670   -2.826  87.741  1.00 42.65  ? 2016 DC  C "O4'"  1 
ATOM   922  C "C3'"  . DC  B 2 16  ? 2.937   -1.896  89.808  1.00 38.38  ? 2016 DC  C "C3'"  1 
ATOM   923  O "O3'"  . DC  B 2 16  ? 1.620   -2.048  90.312  1.00 35.85  ? 2016 DC  C "O3'"  1 
ATOM   924  C "C2'"  . DC  B 2 16  ? 3.717   -3.166  90.083  1.00 40.67  ? 2016 DC  C "C2'"  1 
ATOM   925  C "C1'"  . DC  B 2 16  ? 4.084   -3.748  88.731  1.00 39.44  ? 2016 DC  C "C1'"  1 
ATOM   926  N N1     . DC  B 2 16  ? 5.548   -3.802  88.691  1.00 38.51  ? 2016 DC  C N1     1 
ATOM   927  C C2     . DC  B 2 16  ? 6.190   -5.045  88.772  1.00 38.00  ? 2016 DC  C C2     1 
ATOM   928  O O2     . DC  B 2 16  ? 5.510   -6.087  88.752  1.00 39.17  ? 2016 DC  C O2     1 
ATOM   929  N N3     . DC  B 2 16  ? 7.537   -5.076  88.861  1.00 35.92  ? 2016 DC  C N3     1 
ATOM   930  C C4     . DC  B 2 16  ? 8.229   -3.946  88.877  1.00 37.53  ? 2016 DC  C C4     1 
ATOM   931  N N4     . DC  B 2 16  ? 9.556   -4.030  88.985  1.00 32.39  ? 2016 DC  C N4     1 
ATOM   932  C C5     . DC  B 2 16  ? 7.599   -2.678  88.764  1.00 37.28  ? 2016 DC  C C5     1 
ATOM   933  C C6     . DC  B 2 16  ? 6.274   -2.649  88.666  1.00 36.69  ? 2016 DC  C C6     1 
ATOM   934  H H41    . DC  B 2 16  ? 9.985   -4.937  89.056  1.00 40.00  ? 2016 DC  C H41    1 
ATOM   935  H H42    . DC  B 2 16  ? 10.108  -3.191  89.045  1.00 40.00  ? 2016 DC  C H42    1 
ATOM   936  P P      . DG  B 2 17  ? 1.387   -1.858  91.907  1.00 35.76  ? 2017 DG  C P      1 
ATOM   937  O OP1    . DG  B 2 17  ? -0.025  -1.488  92.095  1.00 32.90  ? 2017 DG  C OP1    1 
ATOM   938  O OP2    . DG  B 2 17  ? 2.488   -0.955  92.441  1.00 32.81  ? 2017 DG  C OP2    1 
ATOM   939  O "O5'"  . DG  B 2 17  ? 1.603   -3.330  92.477  1.00 38.79  ? 2017 DG  C "O5'"  1 
ATOM   940  C "C5'"  . DG  B 2 17  ? 0.806   -4.393  91.985  1.00 33.77  ? 2017 DG  C "C5'"  1 
ATOM   941  C "C4'"  . DG  B 2 17  ? 1.133   -5.658  92.722  1.00 36.90  ? 2017 DG  C "C4'"  1 
ATOM   942  O "O4'"  . DG  B 2 17  ? 2.481   -6.073  92.393  1.00 40.86  ? 2017 DG  C "O4'"  1 
ATOM   943  C "C3'"  . DG  B 2 17  ? 1.055   -5.561  94.245  1.00 36.22  ? 2017 DG  C "C3'"  1 
ATOM   944  O "O3'"  . DG  B 2 17  ? 0.302   -6.690  94.710  1.00 43.04  ? 2017 DG  C "O3'"  1 
ATOM   945  C "C2'"  . DG  B 2 17  ? 2.518   -5.487  94.678  1.00 35.89  ? 2017 DG  C "C2'"  1 
ATOM   946  C "C1'"  . DG  B 2 17  ? 3.320   -6.102  93.535  1.00 38.73  ? 2017 DG  C "C1'"  1 
ATOM   947  N N9     . DG  B 2 17  ? 4.568   -5.404  93.187  1.00 39.25  ? 2017 DG  C N9     1 
ATOM   948  C C8     . DG  B 2 17  ? 4.727   -4.047  92.990  1.00 33.53  ? 2017 DG  C C8     1 
ATOM   949  N N7     . DG  B 2 17  ? 5.936   -3.719  92.640  1.00 36.02  ? 2017 DG  C N7     1 
ATOM   950  C C5     . DG  B 2 17  ? 6.631   -4.925  92.614  1.00 37.71  ? 2017 DG  C C5     1 
ATOM   951  C C6     . DG  B 2 17  ? 7.983   -5.209  92.288  1.00 40.10  ? 2017 DG  C C6     1 
ATOM   952  O O6     . DG  B 2 17  ? 8.900   -4.431  91.988  1.00 40.97  ? 2017 DG  C O6     1 
ATOM   953  N N1     . DG  B 2 17  ? 8.244   -6.566  92.354  1.00 38.50  ? 2017 DG  C N1     1 
ATOM   954  C C2     . DG  B 2 17  ? 7.342   -7.532  92.716  1.00 40.40  ? 2017 DG  C C2     1 
ATOM   955  N N2     . DG  B 2 17  ? 7.789   -8.799  92.705  1.00 43.75  ? 2017 DG  C N2     1 
ATOM   956  N N3     . DG  B 2 17  ? 6.101   -7.280  93.054  1.00 38.93  ? 2017 DG  C N3     1 
ATOM   957  C C4     . DG  B 2 17  ? 5.803   -5.968  92.967  1.00 36.85  ? 2017 DG  C C4     1 
ATOM   958  H H1     . DG  B 2 17  ? 9.198   -6.855  92.162  1.00 40.00  ? 2017 DG  C H1     1 
ATOM   959  H H21    . DG  B 2 17  ? 8.748   -9.000  92.481  1.00 40.00  ? 2017 DG  C H21    1 
ATOM   960  H H22    . DG  B 2 17  ? 7.151   -9.548  92.933  1.00 40.00  ? 2017 DG  C H22    1 
ATOM   961  P P      . DT  B 2 18  ? 0.383   -7.179  96.231  1.00 43.71  ? 2018 DT  C P      1 
ATOM   962  O OP1    . DT  B 2 18  ? -0.675  -8.159  96.364  1.00 38.52  ? 2018 DT  C OP1    1 
ATOM   963  O OP2    . DT  B 2 18  ? 0.428   -6.032  97.160  1.00 43.53  ? 2018 DT  C OP2    1 
ATOM   964  O "O5'"  . DT  B 2 18  ? 1.758   -7.969  96.257  1.00 41.31  ? 2018 DT  C "O5'"  1 
ATOM   965  C "C5'"  . DT  B 2 18  ? 1.973   -8.972  95.255  1.00 36.02  ? 2018 DT  C "C5'"  1 
ATOM   966  C "C4'"  . DT  B 2 18  ? 3.115   -9.890  95.622  1.00 35.51  ? 2018 DT  C "C4'"  1 
ATOM   967  O "O4'"  . DT  B 2 18  ? 4.394   -9.278  95.300  1.00 36.37  ? 2018 DT  C "O4'"  1 
ATOM   968  C "C3'"  . DT  B 2 18  ? 3.199   -10.322 97.084  1.00 40.39  ? 2018 DT  C "C3'"  1 
ATOM   969  O "O3'"  . DT  B 2 18  ? 3.479   -11.731 97.140  1.00 44.55  ? 2018 DT  C "O3'"  1 
ATOM   970  C "C2'"  . DT  B 2 18  ? 4.356   -9.485  97.614  1.00 38.61  ? 2018 DT  C "C2'"  1 
ATOM   971  C "C1'"  . DT  B 2 18  ? 5.262   -9.289  96.411  1.00 37.32  ? 2018 DT  C "C1'"  1 
ATOM   972  N N1     . DT  B 2 18  ? 6.011   -8.026  96.375  1.00 40.14  ? 2018 DT  C N1     1 
ATOM   973  C C2     . DT  B 2 18  ? 7.359   -8.042  96.041  1.00 41.02  ? 2018 DT  C C2     1 
ATOM   974  O O2     . DT  B 2 18  ? 8.004   -9.056  95.897  1.00 41.01  ? 2018 DT  C O2     1 
ATOM   975  N N3     . DT  B 2 18  ? 7.925   -6.812  95.898  1.00 40.77  ? 2018 DT  C N3     1 
ATOM   976  C C4     . DT  B 2 18  ? 7.308   -5.586  96.088  1.00 37.88  ? 2018 DT  C C4     1 
ATOM   977  O O4     . DT  B 2 18  ? 7.928   -4.564  95.897  1.00 40.96  ? 2018 DT  C O4     1 
ATOM   978  C C5     . DT  B 2 18  ? 5.917   -5.631  96.519  1.00 39.76  ? 2018 DT  C C5     1 
ATOM   979  C C7     . DT  B 2 18  ? 5.202   -4.343  96.846  1.00 31.76  ? 2018 DT  C C7     1 
ATOM   980  C C6     . DT  B 2 18  ? 5.343   -6.840  96.627  1.00 40.44  ? 2018 DT  C C6     1 
ATOM   981  H H3     . DT  B 2 18  ? 8.897   -6.782  95.661  1.00 40.00  ? 2018 DT  C H3     1 
ATOM   982  P P      . DG  B 2 19  ? 3.178   -12.574 98.468  1.00 46.68  ? 2019 DG  C P      1 
ATOM   983  O OP1    . DG  B 2 19  ? 2.777   -13.917 98.046  1.00 48.71  ? 2019 DG  C OP1    1 
ATOM   984  O OP2    . DG  B 2 19  ? 2.296   -11.800 99.363  1.00 51.15  ? 2019 DG  C OP2    1 
ATOM   985  O "O5'"  . DG  B 2 19  ? 4.618   -12.696 99.126  1.00 38.05  ? 2019 DG  C "O5'"  1 
ATOM   986  C "C5'"  . DG  B 2 19  ? 5.733   -13.127 98.294  1.00 34.27  ? 2019 DG  C "C5'"  1 
ATOM   987  C "C4'"  . DG  B 2 19  ? 7.056   -12.851 98.976  1.00 44.05  ? 2019 DG  C "C4'"  1 
ATOM   988  O "O4'"  . DG  B 2 19  ? 7.498   -11.492 98.775  1.00 48.52  ? 2019 DG  C "O4'"  1 
ATOM   989  C "C3'"  . DG  B 2 19  ? 7.201   -13.141 100.475 1.00 44.52  ? 2019 DG  C "C3'"  1 
ATOM   990  O "O3'"  . DG  B 2 19  ? 8.482   -13.776 100.647 1.00 48.21  ? 2019 DG  C "O3'"  1 
ATOM   991  C "C2'"  . DG  B 2 19  ? 7.222   -11.745 101.078 1.00 44.66  ? 2019 DG  C "C2'"  1 
ATOM   992  C "C1'"  . DG  B 2 19  ? 7.920   -10.934 99.996  1.00 44.88  ? 2019 DG  C "C1'"  1 
ATOM   993  N N9     . DG  B 2 19  ? 7.611   -9.507  99.944  1.00 39.94  ? 2019 DG  C N9     1 
ATOM   994  C C8     . DG  B 2 19  ? 6.407   -8.924  100.210 1.00 36.82  ? 2019 DG  C C8     1 
ATOM   995  N N7     . DG  B 2 19  ? 6.406   -7.637  100.021 1.00 39.97  ? 2019 DG  C N7     1 
ATOM   996  C C5     . DG  B 2 19  ? 7.690   -7.345  99.611  1.00 40.43  ? 2019 DG  C C5     1 
ATOM   997  C C6     . DG  B 2 19  ? 8.276   -6.097  99.249  1.00 41.39  ? 2019 DG  C C6     1 
ATOM   998  O O6     . DG  B 2 19  ? 7.755   -4.987  99.176  1.00 42.55  ? 2019 DG  C O6     1 
ATOM   999  N N1     . DG  B 2 19  ? 9.605   -6.238  98.935  1.00 37.59  ? 2019 DG  C N1     1 
ATOM   1000 C C2     . DG  B 2 19  ? 10.290  -7.437  98.943  1.00 36.28  ? 2019 DG  C C2     1 
ATOM   1001 N N2     . DG  B 2 19  ? 11.575  -7.372  98.616  1.00 36.46  ? 2019 DG  C N2     1 
ATOM   1002 N N3     . DG  B 2 19  ? 9.753   -8.607  99.257  1.00 37.51  ? 2019 DG  C N3     1 
ATOM   1003 C C4     . DG  B 2 19  ? 8.463   -8.489  99.580  1.00 37.08  ? 2019 DG  C C4     1 
ATOM   1004 H H1     . DG  B 2 19  ? 10.121  -5.401  98.688  1.00 40.00  ? 2019 DG  C H1     1 
ATOM   1005 H H21    . DG  B 2 19  ? 11.992  -6.469  98.394  1.00 40.00  ? 2019 DG  C H21    1 
ATOM   1006 H H22    . DG  B 2 19  ? 12.151  -8.195  98.630  1.00 40.00  ? 2019 DG  C H22    1 
ATOM   1007 P P      . DA  B 2 20  ? 8.798   -14.672 101.949 1.00 51.64  ? 2020 DA  C P      1 
ATOM   1008 O OP1    . DA  B 2 20  ? 9.238   -15.987 101.416 1.00 57.75  ? 2020 DA  C OP1    1 
ATOM   1009 O OP2    . DA  B 2 20  ? 7.734   -14.600 102.973 1.00 50.12  ? 2020 DA  C OP2    1 
ATOM   1010 O "O5'"  . DA  B 2 20  ? 10.075  -13.963 102.553 1.00 52.05  ? 2020 DA  C "O5'"  1 
ATOM   1011 C "C5'"  . DA  B 2 20  ? 11.149  -13.580 101.691 1.00 53.44  ? 2020 DA  C "C5'"  1 
ATOM   1012 C "C4'"  . DA  B 2 20  ? 11.932  -12.460 102.320 1.00 59.03  ? 2020 DA  C "C4'"  1 
ATOM   1013 O "O4'"  . DA  B 2 20  ? 11.348  -11.168 102.040 1.00 59.25  ? 2020 DA  C "O4'"  1 
ATOM   1014 C "C3'"  . DA  B 2 20  ? 12.045  -12.557 103.836 1.00 61.02  ? 2020 DA  C "C3'"  1 
ATOM   1015 O "O3'"  . DA  B 2 20  ? 13.366  -12.182 104.144 1.00 67.99  ? 2020 DA  C "O3'"  1 
ATOM   1016 C "C2'"  . DA  B 2 20  ? 11.100  -11.480 104.335 1.00 58.49  ? 2020 DA  C "C2'"  1 
ATOM   1017 C "C1'"  . DA  B 2 20  ? 11.285  -10.444 103.248 1.00 59.04  ? 2020 DA  C "C1'"  1 
ATOM   1018 N N9     . DA  B 2 20  ? 10.266  -9.406  103.111 1.00 51.73  ? 2020 DA  C N9     1 
ATOM   1019 C C8     . DA  B 2 20  ? 8.924   -9.449  103.382 1.00 51.80  ? 2020 DA  C C8     1 
ATOM   1020 N N7     . DA  B 2 20  ? 8.305   -8.314  103.153 1.00 48.69  ? 2020 DA  C N7     1 
ATOM   1021 C C5     . DA  B 2 20  ? 9.304   -7.466  102.721 1.00 47.03  ? 2020 DA  C C5     1 
ATOM   1022 C C6     . DA  B 2 20  ? 9.299   -6.114  102.366 1.00 43.45  ? 2020 DA  C C6     1 
ATOM   1023 N N6     . DA  B 2 20  ? 8.221   -5.321  102.430 1.00 40.18  ? 2020 DA  C N6     1 
ATOM   1024 N N1     . DA  B 2 20  ? 10.472  -5.578  101.952 1.00 39.36  ? 2020 DA  C N1     1 
ATOM   1025 C C2     . DA  B 2 20  ? 11.578  -6.355  101.947 1.00 38.41  ? 2020 DA  C C2     1 
ATOM   1026 N N3     . DA  B 2 20  ? 11.708  -7.623  102.295 1.00 42.59  ? 2020 DA  C N3     1 
ATOM   1027 C C4     . DA  B 2 20  ? 10.519  -8.129  102.670 1.00 47.43  ? 2020 DA  C C4     1 
ATOM   1028 H H61    . DA  B 2 20  ? 8.336   -4.352  102.144 1.00 40.00  ? 2020 DA  C H61    1 
ATOM   1029 H H62    . DA  B 2 20  ? 7.331   -5.655  102.738 1.00 40.00  ? 2020 DA  C H62    1 
ATOM   1030 P P      . DA  B 2 21  ? 14.111  -12.759 105.433 1.00 70.82  ? 2021 DA  C P      1 
ATOM   1031 O OP1    . DA  B 2 21  ? 14.557  -14.158 105.147 1.00 76.69  ? 2021 DA  C OP1    1 
ATOM   1032 O OP2    . DA  B 2 21  ? 13.296  -12.485 106.647 1.00 69.76  ? 2021 DA  C OP2    1 
ATOM   1033 O "O5'"  . DA  B 2 21  ? 15.403  -11.854 105.410 1.00 64.18  ? 2021 DA  C "O5'"  1 
ATOM   1034 C "C5'"  . DA  B 2 21  ? 15.916  -11.399 104.136 1.00 63.41  ? 2021 DA  C "C5'"  1 
ATOM   1035 C "C4'"  . DA  B 2 21  ? 16.380  -9.971  104.247 1.00 62.28  ? 2021 DA  C "C4'"  1 
ATOM   1036 O "O4'"  . DA  B 2 21  ? 15.261  -9.064  104.173 1.00 58.68  ? 2021 DA  C "O4'"  1 
ATOM   1037 C "C3'"  . DA  B 2 21  ? 17.031  -9.742  105.600 1.00 61.74  ? 2021 DA  C "C3'"  1 
ATOM   1038 O "O3'"  . DA  B 2 21  ? 18.215  -8.991  105.447 1.00 65.56  ? 2021 DA  C "O3'"  1 
ATOM   1039 C "C2'"  . DA  B 2 21  ? 15.958  -9.028  106.407 1.00 55.90  ? 2021 DA  C "C2'"  1 
ATOM   1040 C "C1'"  . DA  B 2 21  ? 15.188  -8.272  105.336 1.00 53.51  ? 2021 DA  C "C1'"  1 
ATOM   1041 N N9     . DA  B 2 21  ? 13.777  -8.008  105.597 1.00 46.65  ? 2021 DA  C N9     1 
ATOM   1042 C C8     . DA  B 2 21  ? 12.821  -8.848  106.120 1.00 44.87  ? 2021 DA  C C8     1 
ATOM   1043 N N7     . DA  B 2 21  ? 11.636  -8.295  106.235 1.00 41.73  ? 2021 DA  C N7     1 
ATOM   1044 C C5     . DA  B 2 21  ? 11.818  -7.004  105.732 1.00 38.88  ? 2021 DA  C C5     1 
ATOM   1045 C C6     . DA  B 2 21  ? 10.931  -5.901  105.566 1.00 35.15  ? 2021 DA  C C6     1 
ATOM   1046 N N6     . DA  B 2 21  ? 9.624   -5.934  105.866 1.00 35.72  ? 2021 DA  C N6     1 
ATOM   1047 N N1     . DA  B 2 21  ? 11.443  -4.763  105.059 1.00 34.47  ? 2021 DA  C N1     1 
ATOM   1048 C C2     . DA  B 2 21  ? 12.738  -4.745  104.735 1.00 33.63  ? 2021 DA  C C2     1 
ATOM   1049 N N3     . DA  B 2 21  ? 13.661  -5.705  104.839 1.00 38.44  ? 2021 DA  C N3     1 
ATOM   1050 C C4     . DA  B 2 21  ? 13.131  -6.823  105.349 1.00 40.83  ? 2021 DA  C C4     1 
ATOM   1051 H H61    . DA  B 2 21  ? 9.051   -5.129  105.741 1.00 40.00  ? 2021 DA  C H61    1 
ATOM   1052 H H62    . DA  B 2 21  ? 9.220   -6.808  106.197 1.00 40.00  ? 2021 DA  C H62    1 
ATOM   1053 P P      . DA  B 2 22  ? 18.992  -8.502  106.755 1.00 69.40  ? 2022 DA  C P      1 
ATOM   1054 O OP1    . DA  B 2 22  ? 20.465  -8.543  106.480 1.00 70.65  ? 2022 DA  C OP1    1 
ATOM   1055 O OP2    . DA  B 2 22  ? 18.432  -9.259  107.904 1.00 68.74  ? 2022 DA  C OP2    1 
ATOM   1056 O "O5'"  . DA  B 2 22  ? 18.577  -6.971  106.840 1.00 65.25  ? 2022 DA  C "O5'"  1 
ATOM   1057 C "C5'"  . DA  B 2 22  ? 18.800  -6.147  105.709 1.00 62.67  ? 2022 DA  C "C5'"  1 
ATOM   1058 C "C4'"  . DA  B 2 22  ? 18.468  -4.720  106.042 1.00 62.73  ? 2022 DA  C "C4'"  1 
ATOM   1059 O "O4'"  . DA  B 2 22  ? 17.052  -4.585  106.266 1.00 62.96  ? 2022 DA  C "O4'"  1 
ATOM   1060 C "C3'"  . DA  B 2 22  ? 19.164  -4.156  107.272 1.00 62.99  ? 2022 DA  C "C3'"  1 
ATOM   1061 O "O3'"  . DA  B 2 22  ? 19.810  -2.960  106.795 1.00 62.16  ? 2022 DA  C "O3'"  1 
ATOM   1062 C "C2'"  . DA  B 2 22  ? 18.060  -4.040  108.327 1.00 58.74  ? 2022 DA  C "C2'"  1 
ATOM   1063 C "C1'"  . DA  B 2 22  ? 16.766  -3.984  107.526 1.00 58.44  ? 2022 DA  C "C1'"  1 
ATOM   1064 N N9     . DA  B 2 22  ? 15.548  -4.634  108.031 1.00 51.78  ? 2022 DA  C N9     1 
ATOM   1065 C C8     . DA  B 2 22  ? 15.350  -5.921  108.488 1.00 46.82  ? 2022 DA  C C8     1 
ATOM   1066 N N7     . DA  B 2 22  ? 14.079  -6.215  108.712 1.00 46.83  ? 2022 DA  C N7     1 
ATOM   1067 C C5     . DA  B 2 22  ? 13.406  -5.032  108.429 1.00 45.56  ? 2022 DA  C C5     1 
ATOM   1068 C C6     . DA  B 2 22  ? 12.038  -4.679  108.456 1.00 45.06  ? 2022 DA  C C6     1 
ATOM   1069 N N6     . DA  B 2 22  ? 11.036  -5.504  108.761 1.00 41.16  ? 2022 DA  C N6     1 
ATOM   1070 N N1     . DA  B 2 22  ? 11.722  -3.414  108.136 1.00 46.64  ? 2022 DA  C N1     1 
ATOM   1071 C C2     . DA  B 2 22  ? 12.696  -2.573  107.777 1.00 49.60  ? 2022 DA  C C2     1 
ATOM   1072 N N3     . DA  B 2 22  ? 14.006  -2.785  107.686 1.00 48.75  ? 2022 DA  C N3     1 
ATOM   1073 C C4     . DA  B 2 22  ? 14.303  -4.051  108.042 1.00 49.19  ? 2022 DA  C C4     1 
ATOM   1074 H H61    . DA  B 2 22  ? 10.092  -5.142  108.733 1.00 40.00  ? 2022 DA  C H61    1 
ATOM   1075 H H62    . DA  B 2 22  ? 11.186  -6.478  108.981 1.00 40.00  ? 2022 DA  C H62    1 
ATOM   1076 P P      . DA  B 2 23  ? 20.330  -1.856  107.823 1.00 62.30  ? 2023 DA  C P      1 
ATOM   1077 O OP1    . DA  B 2 23  ? 21.265  -0.971  107.073 1.00 62.03  ? 2023 DA  C OP1    1 
ATOM   1078 O OP2    . DA  B 2 23  ? 20.762  -2.481  109.117 1.00 59.85  ? 2023 DA  C OP2    1 
ATOM   1079 O "O5'"  . DA  B 2 23  ? 18.998  -1.043  108.060 1.00 63.61  ? 2023 DA  C "O5'"  1 
ATOM   1080 C "C5'"  . DA  B 2 23  ? 18.611  -0.635  109.336 1.00 68.53  ? 2023 DA  C "C5'"  1 
ATOM   1081 C "C4'"  . DA  B 2 23  ? 17.503  0.362   109.179 1.00 62.89  ? 2023 DA  C "C4'"  1 
ATOM   1082 O "O4'"  . DA  B 2 23  ? 16.242  -0.329  109.041 1.00 60.13  ? 2023 DA  C "O4'"  1 
ATOM   1083 C "C3'"  . DA  B 2 23  ? 17.381  1.284   110.369 1.00 63.30  ? 2023 DA  C "C3'"  1 
ATOM   1084 O "O3'"  . DA  B 2 23  ? 17.132  2.583   109.853 1.00 65.53  ? 2023 DA  C "O3'"  1 
ATOM   1085 C "C2'"  . DA  B 2 23  ? 16.240  0.676   111.168 1.00 62.29  ? 2023 DA  C "C2'"  1 
ATOM   1086 C "C1'"  . DA  B 2 23  ? 15.386  -0.036  110.131 1.00 57.50  ? 2023 DA  C "C1'"  1 
ATOM   1087 N N9     . DA  B 2 23  ? 14.795  -1.290  110.593 1.00 50.33  ? 2023 DA  C N9     1 
ATOM   1088 C C8     . DA  B 2 23  ? 15.444  -2.448  110.944 1.00 46.67  ? 2023 DA  C C8     1 
ATOM   1089 N N7     . DA  B 2 23  ? 14.648  -3.409  111.321 1.00 41.46  ? 2023 DA  C N7     1 
ATOM   1090 C C5     . DA  B 2 23  ? 13.373  -2.848  111.208 1.00 43.23  ? 2023 DA  C C5     1 
ATOM   1091 C C6     . DA  B 2 23  ? 12.086  -3.356  111.449 1.00 40.03  ? 2023 DA  C C6     1 
ATOM   1092 N N6     . DA  B 2 23  ? 11.821  -4.606  111.808 1.00 35.56  ? 2023 DA  C N6     1 
ATOM   1093 N N1     . DA  B 2 23  ? 11.049  -2.517  111.272 1.00 41.01  ? 2023 DA  C N1     1 
ATOM   1094 C C2     . DA  B 2 23  ? 11.287  -1.268  110.835 1.00 43.23  ? 2023 DA  C C2     1 
ATOM   1095 N N3     . DA  B 2 23  ? 12.438  -0.694  110.540 1.00 47.29  ? 2023 DA  C N3     1 
ATOM   1096 C C4     . DA  B 2 23  ? 13.460  -1.546  110.760 1.00 47.54  ? 2023 DA  C C4     1 
ATOM   1097 H H61    . DA  B 2 23  ? 10.855  -4.890  111.929 1.00 40.00  ? 2023 DA  C H61    1 
ATOM   1098 H H62    . DA  B 2 23  ? 12.561  -5.276  111.941 1.00 40.00  ? 2023 DA  C H62    1 
ATOM   1099 P P      . DT  B 2 24  ? 17.550  3.867   110.697 1.00 68.92  ? 2024 DT  C P      1 
ATOM   1100 O OP1    . DT  B 2 24  ? 17.825  4.972   109.723 1.00 62.60  ? 2024 DT  C OP1    1 
ATOM   1101 O OP2    . DT  B 2 24  ? 18.575  3.470   111.701 1.00 64.35  ? 2024 DT  C OP2    1 
ATOM   1102 O "O5'"  . DT  B 2 24  ? 16.211  4.174   111.483 1.00 67.41  ? 2024 DT  C "O5'"  1 
ATOM   1103 C "C5'"  . DT  B 2 24  ? 15.383  3.084   111.882 1.00 64.40  ? 2024 DT  C "C5'"  1 
ATOM   1104 C "C4'"  . DT  B 2 24  ? 13.977  3.563   112.116 1.00 59.69  ? 2024 DT  C "C4'"  1 
ATOM   1105 O "O4'"  . DT  B 2 24  ? 13.086  2.442   112.093 1.00 59.36  ? 2024 DT  C "O4'"  1 
ATOM   1106 C "C3'"  . DT  B 2 24  ? 13.793  4.253   113.460 1.00 57.92  ? 2024 DT  C "C3'"  1 
ATOM   1107 O "O3'"  . DT  B 2 24  ? 12.952  5.367   113.277 1.00 64.99  ? 2024 DT  C "O3'"  1 
ATOM   1108 C "C2'"  . DT  B 2 24  ? 13.149  3.199   114.331 1.00 57.44  ? 2024 DT  C "C2'"  1 
ATOM   1109 C "C1'"  . DT  B 2 24  ? 12.461  2.257   113.352 1.00 57.47  ? 2024 DT  C "C1'"  1 
ATOM   1110 N N1     . DT  B 2 24  ? 12.708  0.875   113.737 1.00 56.73  ? 2024 DT  C N1     1 
ATOM   1111 C C2     . DT  B 2 24  ? 11.676  -0.004  113.855 1.00 55.80  ? 2024 DT  C C2     1 
ATOM   1112 O O2     . DT  B 2 24  ? 10.513  0.297   113.656 1.00 58.08  ? 2024 DT  C O2     1 
ATOM   1113 N N3     . DT  B 2 24  ? 12.054  -1.271  114.203 1.00 53.86  ? 2024 DT  C N3     1 
ATOM   1114 C C4     . DT  B 2 24  ? 13.337  -1.725  114.457 1.00 54.06  ? 2024 DT  C C4     1 
ATOM   1115 O O4     . DT  B 2 24  ? 13.523  -2.903  114.765 1.00 49.03  ? 2024 DT  C O4     1 
ATOM   1116 C C5     . DT  B 2 24  ? 14.369  -0.735  114.331 1.00 58.01  ? 2024 DT  C C5     1 
ATOM   1117 C C7     . DT  B 2 24  ? 15.792  -1.109  114.621 1.00 58.27  ? 2024 DT  C C7     1 
ATOM   1118 C C6     . DT  B 2 24  ? 14.003  0.495   113.975 1.00 54.79  ? 2024 DT  C C6     1 
ATOM   1119 H H3     . DT  B 2 24  ? 11.306  -1.946  114.271 1.00 40.00  ? 2024 DT  C H3     1 
ATOM   1120 P P      . DG  B 2 25  ? 12.397  6.129   114.554 1.00 68.54  ? 2025 DG  C P      1 
ATOM   1121 O OP1    . DG  B 2 25  ? 12.019  7.477   114.066 1.00 66.30  ? 2025 DG  C OP1    1 
ATOM   1122 O OP2    . DG  B 2 25  ? 13.352  5.977   115.695 1.00 65.91  ? 2025 DG  C OP2    1 
ATOM   1123 O "O5'"  . DG  B 2 25  ? 11.102  5.299   114.940 1.00 61.01  ? 2025 DG  C "O5'"  1 
ATOM   1124 C "C5'"  . DG  B 2 25  ? 10.182  4.850   113.927 1.00 58.85  ? 2025 DG  C "C5'"  1 
ATOM   1125 C "C4'"  . DG  B 2 25  ? 8.966   4.250   114.587 1.00 57.43  ? 2025 DG  C "C4'"  1 
ATOM   1126 O "O4'"  . DG  B 2 25  ? 9.232   2.894   114.997 1.00 57.30  ? 2025 DG  C "O4'"  1 
ATOM   1127 C "C3'"  . DG  B 2 25  ? 8.616   4.982   115.871 1.00 56.19  ? 2025 DG  C "C3'"  1 
ATOM   1128 O "O3'"  . DG  B 2 25  ? 7.208   4.951   116.058 1.00 59.50  ? 2025 DG  C "O3'"  1 
ATOM   1129 C "C2'"  . DG  B 2 25  ? 9.316   4.160   116.940 1.00 56.35  ? 2025 DG  C "C2'"  1 
ATOM   1130 C "C1'"  . DG  B 2 25  ? 9.113   2.774   116.402 1.00 52.00  ? 2025 DG  C "C1'"  1 
ATOM   1131 N N9     . DG  B 2 25  ? 10.057  1.749   116.838 1.00 45.14  ? 2025 DG  C N9     1 
ATOM   1132 C C8     . DG  B 2 25  ? 11.431  1.820   116.843 1.00 39.08  ? 2025 DG  C C8     1 
ATOM   1133 N N7     . DG  B 2 25  ? 11.994  0.699   117.208 1.00 40.79  ? 2025 DG  C N7     1 
ATOM   1134 C C5     . DG  B 2 25  ? 10.935  -0.156  117.462 1.00 40.99  ? 2025 DG  C C5     1 
ATOM   1135 C C6     . DG  B 2 25  ? 10.938  -1.500  117.834 1.00 46.29  ? 2025 DG  C C6     1 
ATOM   1136 O O6     . DG  B 2 25  ? 11.905  -2.240  117.998 1.00 52.40  ? 2025 DG  C O6     1 
ATOM   1137 N N1     . DG  B 2 25  ? 9.643   -1.993  117.992 1.00 46.63  ? 2025 DG  C N1     1 
ATOM   1138 C C2     . DG  B 2 25  ? 8.489   -1.260  117.798 1.00 45.04  ? 2025 DG  C C2     1 
ATOM   1139 N N2     . DG  B 2 25  ? 7.312   -1.903  117.971 1.00 44.26  ? 2025 DG  C N2     1 
ATOM   1140 N N3     . DG  B 2 25  ? 8.484   0.002   117.447 1.00 44.17  ? 2025 DG  C N3     1 
ATOM   1141 C C4     . DG  B 2 25  ? 9.733   0.492   117.279 1.00 43.73  ? 2025 DG  C C4     1 
ATOM   1142 H H1     . DG  B 2 25  ? 9.532   -2.974  118.232 1.00 40.00  ? 2025 DG  C H1     1 
ATOM   1143 H H21    . DG  B 2 25  ? 7.269   -2.873  118.243 1.00 40.00  ? 2025 DG  C H21    1 
ATOM   1144 H H22    . DG  B 2 25  ? 6.463   -1.377  117.842 1.00 40.00  ? 2025 DG  C H22    1 
ATOM   1145 P P      . DC  B 2 26  ? 6.536   5.894   117.166 1.00 60.20  ? 2026 DC  C P      1 
ATOM   1146 O OP1    . DC  B 2 26  ? 5.323   6.417   116.500 1.00 62.68  ? 2026 DC  C OP1    1 
ATOM   1147 O OP2    . DC  B 2 26  ? 7.541   6.852   117.685 1.00 57.99  ? 2026 DC  C OP2    1 
ATOM   1148 O "O5'"  . DC  B 2 26  ? 6.138   4.877   118.324 1.00 59.70  ? 2026 DC  C "O5'"  1 
ATOM   1149 C "C5'"  . DC  B 2 26  ? 5.335   3.701   118.033 1.00 61.32  ? 2026 DC  C "C5'"  1 
ATOM   1150 C "C4'"  . DC  B 2 26  ? 5.287   2.754   119.215 1.00 60.21  ? 2026 DC  C "C4'"  1 
ATOM   1151 O "O4'"  . DC  B 2 26  ? 6.451   1.878   119.279 1.00 58.45  ? 2026 DC  C "O4'"  1 
ATOM   1152 C "C3'"  . DC  B 2 26  ? 5.171   3.416   120.586 1.00 59.01  ? 2026 DC  C "C3'"  1 
ATOM   1153 O "O3'"  . DC  B 2 26  ? 4.149   2.740   121.337 1.00 61.05  ? 2026 DC  C "O3'"  1 
ATOM   1154 C "C2'"  . DC  B 2 26  ? 6.539   3.168   121.207 1.00 55.82  ? 2026 DC  C "C2'"  1 
ATOM   1155 C "C1'"  . DC  B 2 26  ? 6.885   1.802   120.634 1.00 52.62  ? 2026 DC  C "C1'"  1 
ATOM   1156 N N1     . DC  B 2 26  ? 8.317   1.431   120.646 1.00 50.06  ? 2026 DC  C N1     1 
ATOM   1157 C C2     . DC  B 2 26  ? 8.691   0.112   120.945 1.00 50.08  ? 2026 DC  C C2     1 
ATOM   1158 O O2     . DC  B 2 26  ? 7.819   -0.730  121.177 1.00 48.77  ? 2026 DC  C O2     1 
ATOM   1159 N N3     . DC  B 2 26  ? 9.990   -0.217  120.970 1.00 48.41  ? 2026 DC  C N3     1 
ATOM   1160 C C4     . DC  B 2 26  ? 10.911  0.702   120.694 1.00 48.37  ? 2026 DC  C C4     1 
ATOM   1161 N N4     . DC  B 2 26  ? 12.196  0.331   120.735 1.00 47.09  ? 2026 DC  C N4     1 
ATOM   1162 C C5     . DC  B 2 26  ? 10.566  2.041   120.374 1.00 45.62  ? 2026 DC  C C5     1 
ATOM   1163 C C6     . DC  B 2 26  ? 9.271   2.363   120.366 1.00 45.87  ? 2026 DC  C C6     1 
ATOM   1164 H "HO3'" . DC  B 2 26  ? 3.331   2.750   120.856 1.00 40.00  ? 2026 DC  C "HO3'" 1 
ATOM   1165 H H41    . DC  B 2 26  ? 12.464  -0.615  120.937 1.00 40.00  ? 2026 DC  C H41    1 
ATOM   1166 H H42    . DC  B 2 26  ? 12.916  1.014   120.540 1.00 40.00  ? 2026 DC  C H42    1 
ATOM   1167 N N      . SER C 3 1   ? -1.985  -12.356 81.201  1.00 60.11  ? 1    SER A N      1 
ATOM   1168 C CA     . SER C 3 1   ? -1.709  -12.440 82.636  1.00 60.41  ? 1    SER A CA     1 
ATOM   1169 C C      . SER C 3 1   ? -2.774  -13.282 83.373  1.00 59.35  ? 1    SER A C      1 
ATOM   1170 O O      . SER C 3 1   ? -3.734  -13.763 82.751  1.00 58.16  ? 1    SER A O      1 
ATOM   1171 C CB     . SER C 3 1   ? -1.638  -11.029 83.229  1.00 64.08  ? 1    SER A CB     1 
ATOM   1172 O OG     . SER C 3 1   ? -2.862  -10.345 83.045  1.00 69.46  ? 1    SER A OG     1 
ATOM   1173 H H      . SER C 3 1   ? -2.431  -11.538 80.917  1.00 40.00  ? 1    SER A H      1 
ATOM   1174 H HG     . SER C 3 1   ? -2.887  -9.549  83.596  1.00 40.00  ? 1    SER A HG     1 
ATOM   1175 N N      . HIS C 3 2   ? -2.634  -13.393 84.701  1.00 59.45  ? 2    HIS A N      1 
ATOM   1176 C CA     . HIS C 3 2   ? -3.574  -14.162 85.536  1.00 57.62  ? 2    HIS A CA     1 
ATOM   1177 C C      . HIS C 3 2   ? -3.534  -13.715 86.985  1.00 58.49  ? 2    HIS A C      1 
ATOM   1178 O O      . HIS C 3 2   ? -2.487  -13.333 87.510  1.00 60.66  ? 2    HIS A O      1 
ATOM   1179 C CB     . HIS C 3 2   ? -3.272  -15.660 85.501  1.00 54.82  ? 2    HIS A CB     1 
ATOM   1180 C CG     . HIS C 3 2   ? -2.049  -16.046 86.280  1.00 53.81  ? 2    HIS A CG     1 
ATOM   1181 N ND1    . HIS C 3 2   ? -0.774  -15.653 85.916  1.00 51.20  ? 2    HIS A ND1    1 
ATOM   1182 C CD2    . HIS C 3 2   ? -1.894  -16.807 87.388  1.00 52.76  ? 2    HIS A CD2    1 
ATOM   1183 C CE1    . HIS C 3 2   ? 0.103   -16.166 86.750  1.00 52.69  ? 2    HIS A CE1    1 
ATOM   1184 N NE2    . HIS C 3 2   ? -0.550  -16.872 87.657  1.00 51.56  ? 2    HIS A NE2    1 
ATOM   1185 H H      . HIS C 3 2   ? -1.979  -12.855 85.169  1.00 40.00  ? 2    HIS A H      1 
ATOM   1186 H HD1    . HIS C 3 2   ? -0.582  -14.935 85.312  1.00 40.00  ? 2    HIS A HD1    1 
ATOM   1187 H HE2    . HIS C 3 2   ? -0.113  -17.359 88.381  1.00 40.00  ? 2    HIS A HE2    1 
ATOM   1188 N N      . SER C 3 3   ? -4.674  -13.854 87.647  1.00 57.83  ? 3    SER A N      1 
ATOM   1189 C CA     . SER C 3 3   ? -4.793  -13.484 89.039  1.00 55.15  ? 3    SER A CA     1 
ATOM   1190 C C      . SER C 3 3   ? -4.173  -14.524 89.968  1.00 53.16  ? 3    SER A C      1 
ATOM   1191 O O      . SER C 3 3   ? -4.008  -15.696 89.615  1.00 54.95  ? 3    SER A O      1 
ATOM   1192 C CB     . SER C 3 3   ? -6.251  -13.265 89.393  1.00 58.11  ? 3    SER A CB     1 
ATOM   1193 O OG     . SER C 3 3   ? -6.855  -12.393 88.449  1.00 65.36  ? 3    SER A OG     1 
ATOM   1194 H H      . SER C 3 3   ? -5.467  -14.180 87.171  1.00 40.00  ? 3    SER A H      1 
ATOM   1195 H HG     . SER C 3 3   ? -6.908  -12.932 87.657  1.00 40.00  ? 3    SER A HG     1 
ATOM   1196 N N      . GLY C 3 4   ? -3.766  -14.057 91.137  1.00 53.67  ? 4    GLY A N      1 
ATOM   1197 C CA     . GLY C 3 4   ? -3.170  -14.934 92.118  1.00 51.57  ? 4    GLY A CA     1 
ATOM   1198 C C      . GLY C 3 4   ? -3.540  -14.422 93.485  1.00 50.38  ? 4    GLY A C      1 
ATOM   1199 O O      . GLY C 3 4   ? -4.171  -13.360 93.622  1.00 52.27  ? 4    GLY A O      1 
ATOM   1200 H H      . GLY C 3 4   ? -3.780  -13.093 91.289  1.00 40.00  ? 4    GLY A H      1 
ATOM   1201 N N      . VAL C 3 5   ? -3.106  -15.144 94.503  1.00 48.92  ? 5    VAL A N      1 
ATOM   1202 C CA     . VAL C 3 5   ? -3.395  -14.760 95.880  1.00 49.87  ? 5    VAL A CA     1 
ATOM   1203 C C      . VAL C 3 5   ? -2.080  -14.462 96.563  1.00 50.75  ? 5    VAL A C      1 
ATOM   1204 O O      . VAL C 3 5   ? -1.084  -15.146 96.284  1.00 53.65  ? 5    VAL A O      1 
ATOM   1205 C CB     . VAL C 3 5   ? -4.140  -15.907 96.617  1.00 49.55  ? 5    VAL A CB     1 
ATOM   1206 C CG1    . VAL C 3 5   ? -4.307  -15.588 98.065  1.00 46.52  ? 5    VAL A CG1    1 
ATOM   1207 C CG2    . VAL C 3 5   ? -5.524  -16.126 95.976  1.00 51.05  ? 5    VAL A CG2    1 
ATOM   1208 H H      . VAL C 3 5   ? -2.523  -15.899 94.355  1.00 40.00  ? 5    VAL A H      1 
ATOM   1209 N N      . ASN C 3 6   ? -2.038  -13.412 97.384  1.00 46.48  ? 6    ASN A N      1 
ATOM   1210 C CA     . ASN C 3 6   ? -0.792  -13.118 98.104  1.00 46.43  ? 6    ASN A CA     1 
ATOM   1211 C C      . ASN C 3 6   ? -0.876  -13.708 99.504  1.00 47.06  ? 6    ASN A C      1 
ATOM   1212 O O      . ASN C 3 6   ? -1.918  -14.241 99.888  1.00 47.79  ? 6    ASN A O      1 
ATOM   1213 C CB     . ASN C 3 6   ? -0.514  -11.624 98.149  1.00 45.29  ? 6    ASN A CB     1 
ATOM   1214 C CG     . ASN C 3 6   ? -1.634  -10.822 98.811  1.00 45.84  ? 6    ASN A CG     1 
ATOM   1215 O OD1    . ASN C 3 6   ? -2.280  -11.265 99.742  1.00 48.60  ? 6    ASN A OD1    1 
ATOM   1216 N ND2    . ASN C 3 6   ? -1.834  -9.616  98.336  1.00 40.96  ? 6    ASN A ND2    1 
ATOM   1217 H H      . ASN C 3 6   ? -2.826  -12.882 97.578  1.00 40.00  ? 6    ASN A H      1 
ATOM   1218 H HD21   . ASN C 3 6   ? -2.540  -9.011  98.618  1.00 40.00  ? 6    ASN A HD21   1 
ATOM   1219 H HD22   . ASN C 3 6   ? -1.168  -9.432  97.632  1.00 40.00  ? 6    ASN A HD22   1 
ATOM   1220 N N      . GLN C 3 7   ? 0.213   -13.596 100.262 1.00 47.30  ? 7    GLN A N      1 
ATOM   1221 C CA     . GLN C 3 7   ? 0.263   -14.130 101.614 1.00 47.85  ? 7    GLN A CA     1 
ATOM   1222 C C      . GLN C 3 7   ? -0.851  -13.623 102.536 1.00 49.25  ? 7    GLN A C      1 
ATOM   1223 O O      . GLN C 3 7   ? -1.022  -14.135 103.646 1.00 51.58  ? 7    GLN A O      1 
ATOM   1224 C CB     . GLN C 3 7   ? 1.606   -13.807 102.259 1.00 48.66  ? 7    GLN A CB     1 
ATOM   1225 C CG     . GLN C 3 7   ? 2.787   -14.690 101.840 1.00 54.70  ? 7    GLN A CG     1 
ATOM   1226 C CD     . GLN C 3 7   ? 4.079   -14.216 102.488 1.00 62.03  ? 7    GLN A CD     1 
ATOM   1227 O OE1    . GLN C 3 7   ? 4.087   -13.225 103.208 1.00 64.32  ? 7    GLN A OE1    1 
ATOM   1228 N NE2    . GLN C 3 7   ? 5.176   -14.923 102.241 1.00 67.46  ? 7    GLN A NE2    1 
ATOM   1229 H H      . GLN C 3 7   ? 0.981   -13.147 99.883  1.00 40.00  ? 7    GLN A H      1 
ATOM   1230 H HE21   . GLN C 3 7   ? 6.025   -14.571 102.555 1.00 40.00  ? 7    GLN A HE21   1 
ATOM   1231 H HE22   . GLN C 3 7   ? 5.136   -15.767 101.742 1.00 40.00  ? 7    GLN A HE22   1 
ATOM   1232 N N      . LEU C 3 8   ? -1.621  -12.648 102.059 1.00 46.09  ? 8    LEU A N      1 
ATOM   1233 C CA     . LEU C 3 8   ? -2.701  -12.020 102.824 1.00 45.96  ? 8    LEU A CA     1 
ATOM   1234 C C      . LEU C 3 8   ? -4.081  -12.394 102.324 1.00 47.13  ? 8    LEU A C      1 
ATOM   1235 O O      . LEU C 3 8   ? -5.084  -12.011 102.917 1.00 46.17  ? 8    LEU A O      1 
ATOM   1236 C CB     . LEU C 3 8   ? -2.582  -10.507 102.730 1.00 47.87  ? 8    LEU A CB     1 
ATOM   1237 C CG     . LEU C 3 8   ? -1.721  -9.691  103.697 1.00 48.04  ? 8    LEU A CG     1 
ATOM   1238 C CD1    . LEU C 3 8   ? -0.375  -10.345 103.936 1.00 53.05  ? 8    LEU A CD1    1 
ATOM   1239 C CD2    . LEU C 3 8   ? -1.561  -8.288  103.093 1.00 39.13  ? 8    LEU A CD2    1 
ATOM   1240 H H      . LEU C 3 8   ? -1.509  -12.359 101.145 1.00 40.00  ? 8    LEU A H      1 
ATOM   1241 N N      . GLY C 3 9   ? -4.129  -13.174 101.250 1.00 47.37  ? 9    GLY A N      1 
ATOM   1242 C CA     . GLY C 3 9   ? -5.412  -13.551 100.680 1.00 51.16  ? 9    GLY A CA     1 
ATOM   1243 C C      . GLY C 3 9   ? -5.877  -12.531 99.648  1.00 52.21  ? 9    GLY A C      1 
ATOM   1244 O O      . GLY C 3 9   ? -6.989  -12.574 99.148  1.00 54.17  ? 9    GLY A O      1 
ATOM   1245 H H      . GLY C 3 9   ? -3.316  -13.503 100.837 1.00 40.00  ? 9    GLY A H      1 
ATOM   1246 N N      . GLY C 3 10  ? -5.007  -11.591 99.328  1.00 52.78  ? 10   GLY A N      1 
ATOM   1247 C CA     . GLY C 3 10  ? -5.341  -10.584 98.341  1.00 52.65  ? 10   GLY A CA     1 
ATOM   1248 C C      . GLY C 3 10  ? -5.091  -11.115 96.940  1.00 50.65  ? 10   GLY A C      1 
ATOM   1249 O O      . GLY C 3 10  ? -4.217  -11.936 96.728  1.00 46.74  ? 10   GLY A O      1 
ATOM   1250 H H      . GLY C 3 10  ? -4.115  -11.701 99.737  1.00 40.00  ? 10   GLY A H      1 
ATOM   1251 N N      . VAL C 3 11  ? -5.928  -10.716 95.995  1.00 49.53  ? 11   VAL A N      1 
ATOM   1252 C CA     . VAL C 3 11  ? -5.730  -11.137 94.615  1.00 52.24  ? 11   VAL A CA     1 
ATOM   1253 C C      . VAL C 3 11  ? -4.924  -10.045 93.902  1.00 50.76  ? 11   VAL A C      1 
ATOM   1254 O O      . VAL C 3 11  ? -5.233  -8.848  93.984  1.00 48.61  ? 11   VAL A O      1 
ATOM   1255 C CB     . VAL C 3 11  ? -7.059  -11.431 93.853  1.00 54.02  ? 11   VAL A CB     1 
ATOM   1256 C CG1    . VAL C 3 11  ? -8.019  -12.194 94.748  1.00 58.36  ? 11   VAL A CG1    1 
ATOM   1257 C CG2    . VAL C 3 11  ? -7.706  -10.152 93.315  1.00 55.02  ? 11   VAL A CG2    1 
ATOM   1258 H H      . VAL C 3 11  ? -6.685  -10.147 96.256  1.00 40.00  ? 11   VAL A H      1 
ATOM   1259 N N      . PHE C 3 12  ? -3.853  -10.473 93.250  1.00 46.85  ? 12   PHE A N      1 
ATOM   1260 C CA     . PHE C 3 12  ? -2.993  -9.573  92.502  1.00 45.96  ? 12   PHE A CA     1 
ATOM   1261 C C      . PHE C 3 12  ? -2.665  -10.211 91.162  1.00 48.10  ? 12   PHE A C      1 
ATOM   1262 O O      . PHE C 3 12  ? -2.725  -11.430 91.030  1.00 50.88  ? 12   PHE A O      1 
ATOM   1263 C CB     . PHE C 3 12  ? -1.697  -9.303  93.267  1.00 43.49  ? 12   PHE A CB     1 
ATOM   1264 C CG     . PHE C 3 12  ? -0.802  -10.526 93.434  1.00 42.51  ? 12   PHE A CG     1 
ATOM   1265 C CD1    . PHE C 3 12  ? 0.389   -10.646 92.703  1.00 39.95  ? 12   PHE A CD1    1 
ATOM   1266 C CD2    . PHE C 3 12  ? -1.121  -11.509 94.366  1.00 43.16  ? 12   PHE A CD2    1 
ATOM   1267 C CE1    . PHE C 3 12  ? 1.256   -11.709 92.901  1.00 38.60  ? 12   PHE A CE1    1 
ATOM   1268 C CE2    . PHE C 3 12  ? -0.264  -12.603 94.590  1.00 41.62  ? 12   PHE A CE2    1 
ATOM   1269 C CZ     . PHE C 3 12  ? 0.945   -12.705 93.849  1.00 39.20  ? 12   PHE A CZ     1 
ATOM   1270 H H      . PHE C 3 12  ? -3.712  -11.451 93.282  1.00 40.00  ? 12   PHE A H      1 
ATOM   1271 N N      . VAL C 3 13  ? -2.375  -9.381  90.171  1.00 46.97  ? 13   VAL A N      1 
ATOM   1272 C CA     . VAL C 3 13  ? -1.974  -9.865  88.855  1.00 46.38  ? 13   VAL A CA     1 
ATOM   1273 C C      . VAL C 3 13  ? -0.515  -9.513  88.669  1.00 46.22  ? 13   VAL A C      1 
ATOM   1274 O O      . VAL C 3 13  ? -0.187  -8.382  88.371  1.00 47.91  ? 13   VAL A O      1 
ATOM   1275 C CB     . VAL C 3 13  ? -2.826  -9.226  87.756  1.00 44.61  ? 13   VAL A CB     1 
ATOM   1276 C CG1    . VAL C 3 13  ? -2.447  -9.766  86.414  1.00 43.13  ? 13   VAL A CG1    1 
ATOM   1277 C CG2    . VAL C 3 13  ? -4.312  -9.512  88.041  1.00 47.70  ? 13   VAL A CG2    1 
ATOM   1278 H H      . VAL C 3 13  ? -2.447  -8.413  90.355  1.00 40.00  ? 13   VAL A H      1 
ATOM   1279 N N      . ASN C 3 14  ? 0.361   -10.499 88.834  1.00 45.40  ? 14   ASN A N      1 
ATOM   1280 C CA     . ASN C 3 14  ? 1.806   -10.304 88.734  1.00 45.87  ? 14   ASN A CA     1 
ATOM   1281 C C      . ASN C 3 14  ? 2.291   -9.510  87.524  1.00 47.20  ? 14   ASN A C      1 
ATOM   1282 O O      . ASN C 3 14  ? 2.136   -9.939  86.395  1.00 47.55  ? 14   ASN A O      1 
ATOM   1283 C CB     . ASN C 3 14  ? 2.510   -11.661 88.832  1.00 44.20  ? 14   ASN A CB     1 
ATOM   1284 C CG     . ASN C 3 14  ? 3.977   -11.538 89.266  1.00 46.20  ? 14   ASN A CG     1 
ATOM   1285 O OD1    . ASN C 3 14  ? 4.518   -10.434 89.416  1.00 49.30  ? 14   ASN A OD1    1 
ATOM   1286 N ND2    . ASN C 3 14  ? 4.608   -12.672 89.496  1.00 46.49  ? 14   ASN A ND2    1 
ATOM   1287 H H      . ASN C 3 14  ? 0.007   -11.409 88.916  1.00 40.00  ? 14   ASN A H      1 
ATOM   1288 H HD21   . ASN C 3 14  ? 5.552   -12.616 89.715  1.00 40.00  ? 14   ASN A HD21   1 
ATOM   1289 H HD22   . ASN C 3 14  ? 4.121   -13.516 89.405  1.00 40.00  ? 14   ASN A HD22   1 
ATOM   1290 N N      . GLY C 3 15  ? 2.855   -8.339  87.797  1.00 48.09  ? 15   GLY A N      1 
ATOM   1291 C CA     . GLY C 3 15  ? 3.384   -7.450  86.771  1.00 44.74  ? 15   GLY A CA     1 
ATOM   1292 C C      . GLY C 3 15  ? 2.436   -6.348  86.325  1.00 42.35  ? 15   GLY A C      1 
ATOM   1293 O O      . GLY C 3 15  ? 2.803   -5.495  85.503  1.00 44.34  ? 15   GLY A O      1 
ATOM   1294 H H      . GLY C 3 15  ? 2.890   -7.986  88.698  1.00 40.00  ? 15   GLY A H      1 
ATOM   1295 N N      . ARG C 3 16  ? 1.245   -6.312  86.910  1.00 38.58  ? 16   ARG A N      1 
ATOM   1296 C CA     . ARG C 3 16  ? 0.254   -5.314  86.517  1.00 38.04  ? 16   ARG A CA     1 
ATOM   1297 C C      . ARG C 3 16  ? -0.110  -4.451  87.712  1.00 39.59  ? 16   ARG A C      1 
ATOM   1298 O O      . ARG C 3 16  ? 0.101   -4.847  88.852  1.00 39.37  ? 16   ARG A O      1 
ATOM   1299 C CB     . ARG C 3 16  ? -1.010  -6.030  85.985  1.00 41.48  ? 16   ARG A CB     1 
ATOM   1300 C CG     . ARG C 3 16  ? -0.744  -6.840  84.706  1.00 41.23  ? 16   ARG A CG     1 
ATOM   1301 C CD     . ARG C 3 16  ? -0.007  -6.011  83.703  1.00 37.14  ? 16   ARG A CD     1 
ATOM   1302 N NE     . ARG C 3 16  ? -0.843  -4.948  83.169  1.00 37.27  ? 16   ARG A NE     1 
ATOM   1303 C CZ     . ARG C 3 16  ? -0.401  -3.952  82.417  1.00 37.03  ? 16   ARG A CZ     1 
ATOM   1304 N NH1    . ARG C 3 16  ? 0.887   -3.878  82.101  1.00 34.33  ? 16   ARG A NH1    1 
ATOM   1305 N NH2    . ARG C 3 16  ? -1.249  -3.023  81.981  1.00 34.79  ? 16   ARG A NH2    1 
ATOM   1306 H H      . ARG C 3 16  ? 1.101   -6.902  87.677  1.00 40.00  ? 16   ARG A H      1 
ATOM   1307 H HE     . ARG C 3 16  ? -1.788  -4.969  83.389  1.00 40.00  ? 16   ARG A HE     1 
ATOM   1308 H HH11   . ARG C 3 16  ? 1.560   -4.503  82.493  1.00 40.00  ? 16   ARG A HH11   1 
ATOM   1309 H HH12   . ARG C 3 16  ? 1.155   -3.060  81.578  1.00 40.00  ? 16   ARG A HH12   1 
ATOM   1310 H HH21   . ARG C 3 16  ? -2.217  -3.057  82.210  1.00 40.00  ? 16   ARG A HH21   1 
ATOM   1311 H HH22   . ARG C 3 16  ? -0.921  -2.257  81.409  1.00 40.00  ? 16   ARG A HH22   1 
ATOM   1312 N N      . PRO C 3 17  ? -0.678  -3.263  87.462  1.00 40.50  ? 17   PRO A N      1 
ATOM   1313 C CA     . PRO C 3 17  ? -1.039  -2.407  88.587  1.00 41.88  ? 17   PRO A CA     1 
ATOM   1314 C C      . PRO C 3 17  ? -2.254  -2.868  89.326  1.00 41.24  ? 17   PRO A C      1 
ATOM   1315 O O      . PRO C 3 17  ? -3.090  -3.585  88.793  1.00 43.48  ? 17   PRO A O      1 
ATOM   1316 C CB     . PRO C 3 17  ? -1.306  -1.049  87.938  1.00 44.73  ? 17   PRO A CB     1 
ATOM   1317 C CG     . PRO C 3 17  ? -0.901  -1.210  86.445  1.00 44.01  ? 17   PRO A CG     1 
ATOM   1318 C CD     . PRO C 3 17  ? -1.096  -2.661  86.188  1.00 40.66  ? 17   PRO A CD     1 
ATOM   1319 N N      . LEU C 3 18  ? -2.342  -2.434  90.565  1.00 40.60  ? 18   LEU A N      1 
ATOM   1320 C CA     . LEU C 3 18  ? -3.487  -2.731  91.395  1.00 40.55  ? 18   LEU A CA     1 
ATOM   1321 C C      . LEU C 3 18  ? -4.617  -1.927  90.768  1.00 42.38  ? 18   LEU A C      1 
ATOM   1322 O O      . LEU C 3 18  ? -4.370  -0.862  90.232  1.00 39.53  ? 18   LEU A O      1 
ATOM   1323 C CB     . LEU C 3 18  ? -3.201  -2.228  92.815  1.00 35.95  ? 18   LEU A CB     1 
ATOM   1324 C CG     . LEU C 3 18  ? -3.175  -3.311  93.863  1.00 40.02  ? 18   LEU A CG     1 
ATOM   1325 C CD1    . LEU C 3 18  ? -2.721  -4.630  93.302  1.00 44.49  ? 18   LEU A CD1    1 
ATOM   1326 C CD2    . LEU C 3 18  ? -2.292  -2.821  95.003  1.00 40.81  ? 18   LEU A CD2    1 
ATOM   1327 H H      . LEU C 3 18  ? -1.623  -1.861  90.899  1.00 40.00  ? 18   LEU A H      1 
ATOM   1328 N N      . PRO C 3 19  ? -5.852  -2.455  90.773  1.00 43.65  ? 19   PRO A N      1 
ATOM   1329 C CA     . PRO C 3 19  ? -7.000  -1.745  90.195  1.00 42.01  ? 19   PRO A CA     1 
ATOM   1330 C C      . PRO C 3 19  ? -7.167  -0.360  90.796  1.00 43.12  ? 19   PRO A C      1 
ATOM   1331 O O      . PRO C 3 19  ? -6.914  -0.153  91.997  1.00 43.72  ? 19   PRO A O      1 
ATOM   1332 C CB     . PRO C 3 19  ? -8.178  -2.632  90.605  1.00 45.49  ? 19   PRO A CB     1 
ATOM   1333 C CG     . PRO C 3 19  ? -7.580  -3.992  90.652  1.00 40.95  ? 19   PRO A CG     1 
ATOM   1334 C CD     . PRO C 3 19  ? -6.263  -3.759  91.322  1.00 44.09  ? 19   PRO A CD     1 
ATOM   1335 N N      . ASP C 3 20  ? -7.657  0.576   89.994  1.00 41.79  ? 20   ASP A N      1 
ATOM   1336 C CA     . ASP C 3 20  ? -7.859  1.947   90.469  1.00 46.53  ? 20   ASP A CA     1 
ATOM   1337 C C      . ASP C 3 20  ? -8.761  2.000   91.687  1.00 49.03  ? 20   ASP A C      1 
ATOM   1338 O O      . ASP C 3 20  ? -8.599  2.866   92.543  1.00 51.62  ? 20   ASP A O      1 
ATOM   1339 C CB     . ASP C 3 20  ? -8.492  2.805   89.377  1.00 52.63  ? 20   ASP A CB     1 
ATOM   1340 C CG     . ASP C 3 20  ? -7.521  3.185   88.293  1.00 58.59  ? 20   ASP A CG     1 
ATOM   1341 O OD1    . ASP C 3 20  ? -6.295  3.174   88.553  1.00 61.78  ? 20   ASP A OD1    1 
ATOM   1342 O OD2    . ASP C 3 20  ? -7.996  3.512   87.181  1.00 62.21  ? 20   ASP A OD2    1 
ATOM   1343 H H      . ASP C 3 20  ? -7.890  0.300   89.087  1.00 40.00  ? 20   ASP A H      1 
ATOM   1344 N N      . SER C 3 21  ? -9.700  1.068   91.763  1.00 47.83  ? 21   SER A N      1 
ATOM   1345 C CA     . SER C 3 21  ? -10.637 1.041   92.862  1.00 45.79  ? 21   SER A CA     1 
ATOM   1346 C C      . SER C 3 21  ? -9.878  0.833   94.174  1.00 44.98  ? 21   SER A C      1 
ATOM   1347 O O      . SER C 3 21  ? -10.159 1.531   95.167  1.00 46.92  ? 21   SER A O      1 
ATOM   1348 C CB     . SER C 3 21  ? -11.698 -0.042  92.640  1.00 44.87  ? 21   SER A CB     1 
ATOM   1349 O OG     . SER C 3 21  ? -11.116 -1.330  92.513  1.00 48.29  ? 21   SER A OG     1 
ATOM   1350 H H      . SER C 3 21  ? -9.660  0.338   91.103  1.00 40.00  ? 21   SER A H      1 
ATOM   1351 H HG     . SER C 3 21  ? -11.889 -1.895  92.498  1.00 40.00  ? 21   SER A HG     1 
ATOM   1352 N N      . THR C 3 22  ? -8.920  -0.100  94.163  1.00 43.50  ? 22   THR A N      1 
ATOM   1353 C CA     . THR C 3 22  ? -8.124  -0.402  95.332  1.00 41.59  ? 22   THR A CA     1 
ATOM   1354 C C      . THR C 3 22  ? -7.225  0.768   95.622  1.00 38.67  ? 22   THR A C      1 
ATOM   1355 O O      . THR C 3 22  ? -7.104  1.151   96.772  1.00 38.07  ? 22   THR A O      1 
ATOM   1356 C CB     . THR C 3 22  ? -7.295  -1.690  95.141  1.00 46.13  ? 22   THR A CB     1 
ATOM   1357 O OG1    . THR C 3 22  ? -8.157  -2.778  94.767  1.00 49.82  ? 22   THR A OG1    1 
ATOM   1358 C CG2    . THR C 3 22  ? -6.577  -2.063  96.417  1.00 44.86  ? 22   THR A CG2    1 
ATOM   1359 H H      . THR C 3 22  ? -8.720  -0.607  93.350  1.00 40.00  ? 22   THR A H      1 
ATOM   1360 H HG1    . THR C 3 22  ? -8.761  -2.899  95.476  1.00 40.00  ? 22   THR A HG1    1 
ATOM   1361 N N      . ARG C 3 23  ? -6.669  1.391   94.575  1.00 36.53  ? 23   ARG A N      1 
ATOM   1362 C CA     . ARG C 3 23  ? -5.817  2.556   94.783  1.00 35.42  ? 23   ARG A CA     1 
ATOM   1363 C C      . ARG C 3 23  ? -6.576  3.721   95.442  1.00 36.27  ? 23   ARG A C      1 
ATOM   1364 O O      . ARG C 3 23  ? -6.044  4.388   96.343  1.00 35.26  ? 23   ARG A O      1 
ATOM   1365 C CB     . ARG C 3 23  ? -5.137  2.981   93.471  1.00 29.41  ? 23   ARG A CB     1 
ATOM   1366 C CG     . ARG C 3 23  ? -4.342  1.880   92.804  1.00 33.59  ? 23   ARG A CG     1 
ATOM   1367 C CD     . ARG C 3 23  ? -3.986  2.213   91.350  1.00 37.16  ? 23   ARG A CD     1 
ATOM   1368 N NE     . ARG C 3 23  ? -2.631  2.756   91.248  1.00 40.80  ? 23   ARG A NE     1 
ATOM   1369 C CZ     . ARG C 3 23  ? -1.530  2.021   91.192  1.00 38.44  ? 23   ARG A CZ     1 
ATOM   1370 N NH1    . ARG C 3 23  ? -1.591  0.705   91.207  1.00 36.13  ? 23   ARG A NH1    1 
ATOM   1371 N NH2    . ARG C 3 23  ? -0.355  2.600   91.202  1.00 40.13  ? 23   ARG A NH2    1 
ATOM   1372 H H      . ARG C 3 23  ? -6.905  1.067   93.682  1.00 40.00  ? 23   ARG A H      1 
ATOM   1373 H HE     . ARG C 3 23  ? -2.444  3.715   91.269  1.00 40.00  ? 23   ARG A HE     1 
ATOM   1374 H HH11   . ARG C 3 23  ? -2.488  0.235   91.237  1.00 40.00  ? 23   ARG A HH11   1 
ATOM   1375 H HH12   . ARG C 3 23  ? -0.773  0.146   91.133  1.00 40.00  ? 23   ARG A HH12   1 
ATOM   1376 H HH21   . ARG C 3 23  ? -0.198  3.586   91.204  1.00 40.00  ? 23   ARG A HH21   1 
ATOM   1377 H HH22   . ARG C 3 23  ? 0.410   1.969   91.116  1.00 40.00  ? 23   ARG A HH22   1 
ATOM   1378 N N      . GLN C 3 24  ? -7.818  3.939   95.009  1.00 36.76  ? 24   GLN A N      1 
ATOM   1379 C CA     . GLN C 3 24  ? -8.658  4.977   95.604  1.00 39.36  ? 24   GLN A CA     1 
ATOM   1380 C C      . GLN C 3 24  ? -8.925  4.633   97.057  1.00 39.05  ? 24   GLN A C      1 
ATOM   1381 O O      . GLN C 3 24  ? -8.812  5.498   97.913  1.00 36.39  ? 24   GLN A O      1 
ATOM   1382 C CB     . GLN C 3 24  ? -9.996  5.133   94.876  1.00 43.71  ? 24   GLN A CB     1 
ATOM   1383 C CG     . GLN C 3 24  ? -10.080 6.282   93.897  1.00 54.69  ? 24   GLN A CG     1 
ATOM   1384 C CD     . GLN C 3 24  ? -9.865  7.672   94.520  1.00 59.61  ? 24   GLN A CD     1 
ATOM   1385 O OE1    . GLN C 3 24  ? -9.173  8.520   93.954  1.00 62.21  ? 24   GLN A OE1    1 
ATOM   1386 N NE2    . GLN C 3 24  ? -10.484 7.917   95.669  1.00 59.68  ? 24   GLN A NE2    1 
ATOM   1387 H H      . GLN C 3 24  ? -8.206  3.397   94.304  1.00 40.00  ? 24   GLN A H      1 
ATOM   1388 H HE21   . GLN C 3 24  ? -10.421 8.855   95.976  1.00 40.00  ? 24   GLN A HE21   1 
ATOM   1389 H HE22   . GLN C 3 24  ? -11.020 7.277   96.191  1.00 40.00  ? 24   GLN A HE22   1 
ATOM   1390 N N      . ARG C 3 25  ? -9.243  3.367   97.317  1.00 40.34  ? 25   ARG A N      1 
ATOM   1391 C CA     . ARG C 3 25  ? -9.535  2.876   98.660  1.00 42.11  ? 25   ARG A CA     1 
ATOM   1392 C C      . ARG C 3 25  ? -8.377  3.185   99.579  1.00 40.97  ? 25   ARG A C      1 
ATOM   1393 O O      . ARG C 3 25  ? -8.571  3.708   100.673 1.00 39.74  ? 25   ARG A O      1 
ATOM   1394 C CB     . ARG C 3 25  ? -9.748  1.344   98.686  1.00 47.44  ? 25   ARG A CB     1 
ATOM   1395 C CG     . ARG C 3 25  ? -11.168 0.896   98.411  1.00 58.77  ? 25   ARG A CG     1 
ATOM   1396 C CD     . ARG C 3 25  ? -12.149 1.703   99.226  1.00 67.55  ? 25   ARG A CD     1 
ATOM   1397 N NE     . ARG C 3 25  ? -11.968 1.549   100.673 1.00 71.87  ? 25   ARG A NE     1 
ATOM   1398 C CZ     . ARG C 3 25  ? -12.488 0.553   101.388 1.00 76.24  ? 25   ARG A CZ     1 
ATOM   1399 N NH1    . ARG C 3 25  ? -13.216 -0.374  100.787 1.00 75.89  ? 25   ARG A NH1    1 
ATOM   1400 N NH2    . ARG C 3 25  ? -12.267 0.471   102.695 1.00 80.98  ? 25   ARG A NH2    1 
ATOM   1401 H H      . ARG C 3 25  ? -9.366  2.766   96.536  1.00 40.00  ? 25   ARG A H      1 
ATOM   1402 H HE     . ARG C 3 25  ? -11.470 2.265   101.140 1.00 40.00  ? 25   ARG A HE     1 
ATOM   1403 H HH11   . ARG C 3 25  ? -13.346 -0.354  99.800  1.00 40.00  ? 25   ARG A HH11   1 
ATOM   1404 H HH12   . ARG C 3 25  ? -13.592 -1.096  101.361 1.00 40.00  ? 25   ARG A HH12   1 
ATOM   1405 H HH21   . ARG C 3 25  ? -11.675 1.136   103.159 1.00 40.00  ? 25   ARG A HH21   1 
ATOM   1406 H HH22   . ARG C 3 25  ? -12.666 -0.277  103.229 1.00 40.00  ? 25   ARG A HH22   1 
ATOM   1407 N N      . ILE C 3 26  ? -7.172  2.857   99.114  1.00 39.10  ? 26   ILE A N      1 
ATOM   1408 C CA     . ILE C 3 26  ? -5.955  3.054   99.866  1.00 36.08  ? 26   ILE A CA     1 
ATOM   1409 C C      . ILE C 3 26  ? -5.858  4.488   100.371 1.00 34.87  ? 26   ILE A C      1 
ATOM   1410 O O      . ILE C 3 26  ? -5.689  4.699   101.593 1.00 33.30  ? 26   ILE A O      1 
ATOM   1411 C CB     . ILE C 3 26  ? -4.731  2.708   99.027  1.00 34.60  ? 26   ILE A CB     1 
ATOM   1412 C CG1    . ILE C 3 26  ? -4.673  1.206   98.816  1.00 33.03  ? 26   ILE A CG1    1 
ATOM   1413 C CG2    . ILE C 3 26  ? -3.409  3.189   99.729  1.00 30.54  ? 26   ILE A CG2    1 
ATOM   1414 C CD1    . ILE C 3 26  ? -3.486  0.719   98.050  1.00 31.54  ? 26   ILE A CD1    1 
ATOM   1415 H H      . ILE C 3 26  ? -7.160  2.465   98.222  1.00 40.00  ? 26   ILE A H      1 
ATOM   1416 N N      . VAL C 3 27  ? -6.058  5.456   99.463  1.00 35.47  ? 27   VAL A N      1 
ATOM   1417 C CA     . VAL C 3 27  ? -5.982  6.850   99.840  1.00 39.44  ? 27   VAL A CA     1 
ATOM   1418 C C      . VAL C 3 27  ? -7.185  7.248   100.672 1.00 37.23  ? 27   VAL A C      1 
ATOM   1419 O O      . VAL C 3 27  ? -7.049  7.983   101.673 1.00 31.98  ? 27   VAL A O      1 
ATOM   1420 C CB     . VAL C 3 27  ? -5.760  7.791   98.630  1.00 42.04  ? 27   VAL A CB     1 
ATOM   1421 C CG1    . VAL C 3 27  ? -6.414  7.279   97.402  1.00 49.65  ? 27   VAL A CG1    1 
ATOM   1422 C CG2    . VAL C 3 27  ? -6.295  9.172   98.963  1.00 46.09  ? 27   VAL A CG2    1 
ATOM   1423 H H      . VAL C 3 27  ? -6.262  5.171   98.534  1.00 40.00  ? 27   VAL A H      1 
ATOM   1424 N N      . GLU C 3 28  ? -8.343  6.680   100.341 1.00 39.00  ? 28   GLU A N      1 
ATOM   1425 C CA     . GLU C 3 28  ? -9.571  6.948   101.114 1.00 42.45  ? 28   GLU A CA     1 
ATOM   1426 C C      . GLU C 3 28  ? -9.401  6.516   102.595 1.00 42.12  ? 28   GLU A C      1 
ATOM   1427 O O      . GLU C 3 28  ? -9.724  7.263   103.516 1.00 43.26  ? 28   GLU A O      1 
ATOM   1428 C CB     . GLU C 3 28  ? -10.763 6.244   100.463 1.00 47.98  ? 28   GLU A CB     1 
ATOM   1429 C CG     . GLU C 3 28  ? -11.493 7.138   99.462  1.00 54.14  ? 28   GLU A CG     1 
ATOM   1430 C CD     . GLU C 3 28  ? -12.504 6.390   98.563  1.00 56.91  ? 28   GLU A CD     1 
ATOM   1431 O OE1    . GLU C 3 28  ? -12.694 5.153   98.709  1.00 56.99  ? 28   GLU A OE1    1 
ATOM   1432 O OE2    . GLU C 3 28  ? -13.106 7.064   97.690  1.00 52.80  ? 28   GLU A OE2    1 
ATOM   1433 H H      . GLU C 3 28  ? -8.346  6.087   99.576  1.00 40.00  ? 28   GLU A H      1 
ATOM   1434 N N      . LEU C 3 29  ? -8.862  5.329   102.815 1.00 39.14  ? 29   LEU A N      1 
ATOM   1435 C CA     . LEU C 3 29  ? -8.645  4.813   104.160 1.00 35.63  ? 29   LEU A CA     1 
ATOM   1436 C C      . LEU C 3 29  ? -7.603  5.645   104.893 1.00 37.06  ? 29   LEU A C      1 
ATOM   1437 O O      . LEU C 3 29  ? -7.828  6.052   106.029 1.00 38.68  ? 29   LEU A O      1 
ATOM   1438 C CB     . LEU C 3 29  ? -8.251  3.339   104.098 1.00 35.14  ? 29   LEU A CB     1 
ATOM   1439 C CG     . LEU C 3 29  ? -9.367  2.312   103.825 1.00 34.97  ? 29   LEU A CG     1 
ATOM   1440 C CD1    . LEU C 3 29  ? -8.832  0.917   103.590 1.00 33.88  ? 29   LEU A CD1    1 
ATOM   1441 C CD2    . LEU C 3 29  ? -10.277 2.276   105.057 1.00 38.42  ? 29   LEU A CD2    1 
ATOM   1442 H H      . LEU C 3 29  ? -8.542  4.759   102.089 1.00 40.00  ? 29   LEU A H      1 
ATOM   1443 N N      . ALA C 3 30  ? -6.504  5.968   104.226 1.00 38.50  ? 30   ALA A N      1 
ATOM   1444 C CA     . ALA C 3 30  ? -5.472  6.816   104.831 1.00 39.41  ? 30   ALA A CA     1 
ATOM   1445 C C      . ALA C 3 30  ? -6.067  8.160   105.266 1.00 38.12  ? 30   ALA A C      1 
ATOM   1446 O O      . ALA C 3 30  ? -5.844  8.629   106.402 1.00 33.42  ? 30   ALA A O      1 
ATOM   1447 C CB     . ALA C 3 30  ? -4.313  7.056   103.821 1.00 38.24  ? 30   ALA A CB     1 
ATOM   1448 H H      . ALA C 3 30  ? -6.385  5.610   103.335 1.00 40.00  ? 30   ALA A H      1 
ATOM   1449 N N      . HIS C 3 31  ? -6.871  8.748   104.380 1.00 40.33  ? 31   HIS A N      1 
ATOM   1450 C CA     . HIS C 3 31  ? -7.504  10.026  104.660 1.00 41.91  ? 31   HIS A CA     1 
ATOM   1451 C C      . HIS C 3 31  ? -8.339  9.974   105.945 1.00 43.92  ? 31   HIS A C      1 
ATOM   1452 O O      . HIS C 3 31  ? -8.391  10.947  106.688 1.00 42.87  ? 31   HIS A O      1 
ATOM   1453 C CB     . HIS C 3 31  ? -8.418  10.455  103.525 1.00 39.61  ? 31   HIS A CB     1 
ATOM   1454 C CG     . HIS C 3 31  ? -9.036  11.801  103.734 1.00 39.81  ? 31   HIS A CG     1 
ATOM   1455 N ND1    . HIS C 3 31  ? -10.405 11.999  103.827 1.00 41.82  ? 31   HIS A ND1    1 
ATOM   1456 C CD2    . HIS C 3 31  ? -8.486  13.034  103.812 1.00 40.38  ? 31   HIS A CD2    1 
ATOM   1457 C CE1    . HIS C 3 31  ? -10.657 13.280  103.940 1.00 34.90  ? 31   HIS A CE1    1 
ATOM   1458 N NE2    . HIS C 3 31  ? -9.511  13.936  103.934 1.00 38.60  ? 31   HIS A NE2    1 
ATOM   1459 H H      . HIS C 3 31  ? -7.006  8.298   103.528 1.00 40.00  ? 31   HIS A H      1 
ATOM   1460 H HD1    . HIS C 3 31  ? -11.064 11.280  103.871 1.00 40.00  ? 31   HIS A HD1    1 
ATOM   1461 H HE2    . HIS C 3 31  ? -9.432  14.910  104.043 1.00 40.00  ? 31   HIS A HE2    1 
ATOM   1462 N N      . SER C 3 32  ? -9.022  8.854   106.174 1.00 47.41  ? 32   SER A N      1 
ATOM   1463 C CA     . SER C 3 32  ? -9.834  8.715   107.361 1.00 48.78  ? 32   SER A CA     1 
ATOM   1464 C C      . SER C 3 32  ? -9.040  8.335   108.618 1.00 47.89  ? 32   SER A C      1 
ATOM   1465 O O      . SER C 3 32  ? -9.611  8.056   109.655 1.00 48.60  ? 32   SER A O      1 
ATOM   1466 C CB     . SER C 3 32  ? -10.994 7.755   107.116 1.00 48.75  ? 32   SER A CB     1 
ATOM   1467 O OG     . SER C 3 32  ? -10.539 6.429   107.012 1.00 56.04  ? 32   SER A OG     1 
ATOM   1468 H H      . SER C 3 32  ? -9.041  8.140   105.494 1.00 40.00  ? 32   SER A H      1 
ATOM   1469 H HG     . SER C 3 32  ? -10.472 6.237   107.947 1.00 40.00  ? 32   SER A HG     1 
ATOM   1470 N N      . GLY C 3 33  ? -7.722  8.274   108.507 1.00 47.12  ? 33   GLY A N      1 
ATOM   1471 C CA     . GLY C 3 33  ? -6.909  7.989   109.678 1.00 45.61  ? 33   GLY A CA     1 
ATOM   1472 C C      . GLY C 3 33  ? -6.341  6.603   109.817 1.00 45.48  ? 33   GLY A C      1 
ATOM   1473 O O      . GLY C 3 33  ? -5.840  6.265   110.867 1.00 47.55  ? 33   GLY A O      1 
ATOM   1474 H H      . GLY C 3 33  ? -7.281  8.351   107.637 1.00 40.00  ? 33   GLY A H      1 
ATOM   1475 N N      . ALA C 3 34  ? -6.418  5.779   108.778 1.00 44.98  ? 34   ALA A N      1 
ATOM   1476 C CA     . ALA C 3 34  ? -5.866  4.439   108.898 1.00 44.22  ? 34   ALA A CA     1 
ATOM   1477 C C      . ALA C 3 34  ? -4.369  4.451   108.607 1.00 44.82  ? 34   ALA A C      1 
ATOM   1478 O O      . ALA C 3 34  ? -3.895  5.149   107.720 1.00 46.93  ? 34   ALA A O      1 
ATOM   1479 C CB     . ALA C 3 34  ? -6.570  3.485   107.984 1.00 40.69  ? 34   ALA A CB     1 
ATOM   1480 H H      . ALA C 3 34  ? -6.797  6.127   107.926 1.00 40.00  ? 34   ALA A H      1 
ATOM   1481 N N      . ARG C 3 35  ? -3.613  3.747   109.439 1.00 43.53  ? 35   ARG A N      1 
ATOM   1482 C CA     . ARG C 3 35  ? -2.165  3.630   109.252 1.00 44.99  ? 35   ARG A CA     1 
ATOM   1483 C C      . ARG C 3 35  ? -1.937  2.677   108.087 1.00 44.44  ? 35   ARG A C      1 
ATOM   1484 O O      . ARG C 3 35  ? -2.786  1.825   107.786 1.00 44.62  ? 35   ARG A O      1 
ATOM   1485 C CB     . ARG C 3 35  ? -1.515  3.007   110.487 1.00 45.37  ? 35   ARG A CB     1 
ATOM   1486 C CG     . ARG C 3 35  ? -1.515  3.856   111.746 1.00 43.00  ? 35   ARG A CG     1 
ATOM   1487 C CD     . ARG C 3 35  ? -1.094  2.988   112.928 1.00 44.79  ? 35   ARG A CD     1 
ATOM   1488 N NE     . ARG C 3 35  ? -1.994  1.836   113.066 1.00 46.97  ? 35   ARG A NE     1 
ATOM   1489 C CZ     . ARG C 3 35  ? -1.739  0.741   113.782 1.00 48.47  ? 35   ARG A CZ     1 
ATOM   1490 N NH1    . ARG C 3 35  ? -0.598  0.621   114.449 1.00 45.60  ? 35   ARG A NH1    1 
ATOM   1491 N NH2    . ARG C 3 35  ? -2.642  -0.234  113.851 1.00 48.14  ? 35   ARG A NH2    1 
ATOM   1492 H H      . ARG C 3 35  ? -4.046  3.366   110.228 1.00 40.00  ? 35   ARG A H      1 
ATOM   1493 H HE     . ARG C 3 35  ? -2.856  1.888   112.627 1.00 40.00  ? 35   ARG A HE     1 
ATOM   1494 H HH11   . ARG C 3 35  ? 0.064   1.385   114.415 1.00 40.00  ? 35   ARG A HH11   1 
ATOM   1495 H HH12   . ARG C 3 35  ? -0.429  -0.198  114.976 1.00 40.00  ? 35   ARG A HH12   1 
ATOM   1496 H HH21   . ARG C 3 35  ? -3.512  -0.231  113.367 1.00 40.00  ? 35   ARG A HH21   1 
ATOM   1497 H HH22   . ARG C 3 35  ? -2.394  -1.051  114.379 1.00 40.00  ? 35   ARG A HH22   1 
ATOM   1498 N N      . PRO C 3 36  ? -0.767  2.765   107.449 1.00 42.44  ? 36   PRO A N      1 
ATOM   1499 C CA     . PRO C 3 36  ? -0.462  1.888   106.327 1.00 40.14  ? 36   PRO A CA     1 
ATOM   1500 C C      . PRO C 3 36  ? -0.715  0.411   106.611 1.00 40.08  ? 36   PRO A C      1 
ATOM   1501 O O      . PRO C 3 36  ? -1.322  -0.272  105.800 1.00 37.37  ? 36   PRO A O      1 
ATOM   1502 C CB     . PRO C 3 36  ? 1.017   2.186   106.083 1.00 38.74  ? 36   PRO A CB     1 
ATOM   1503 C CG     . PRO C 3 36  ? 1.080   3.627   106.324 1.00 40.80  ? 36   PRO A CG     1 
ATOM   1504 C CD     . PRO C 3 36  ? 0.308   3.756   107.619 1.00 42.14  ? 36   PRO A CD     1 
ATOM   1505 N N      . CYS C 3 37  ? -0.290  -0.068  107.784 1.00 38.40  ? 37   CYS A N      1 
ATOM   1506 C CA     . CYS C 3 37  ? -0.488  -1.474  108.153 1.00 37.42  ? 37   CYS A CA     1 
ATOM   1507 C C      . CYS C 3 37  ? -1.971  -1.843  108.219 1.00 38.02  ? 37   CYS A C      1 
ATOM   1508 O O      . CYS C 3 37  ? -2.360  -2.936  107.815 1.00 36.37  ? 37   CYS A O      1 
ATOM   1509 C CB     . CYS C 3 37  ? 0.168   -1.769  109.493 1.00 39.23  ? 37   CYS A CB     1 
ATOM   1510 S SG     . CYS C 3 37  ? -0.437  -0.723  110.852 1.00 38.40  ? 37   CYS A SG     1 
ATOM   1511 H H      . CYS C 3 37  ? 0.173   0.526   108.424 1.00 40.00  ? 37   CYS A H      1 
ATOM   1512 N N      . ASP C 3 38  ? -2.795  -0.906  108.688 1.00 38.12  ? 38   ASP A N      1 
ATOM   1513 C CA     . ASP C 3 38  ? -4.238  -1.115  108.764 1.00 40.05  ? 38   ASP A CA     1 
ATOM   1514 C C      . ASP C 3 38  ? -4.798  -1.270  107.351 1.00 41.22  ? 38   ASP A C      1 
ATOM   1515 O O      . ASP C 3 38  ? -5.538  -2.201  107.065 1.00 43.89  ? 38   ASP A O      1 
ATOM   1516 C CB     . ASP C 3 38  ? -4.918  0.068   109.438 1.00 42.91  ? 38   ASP A CB     1 
ATOM   1517 C CG     . ASP C 3 38  ? -4.564  0.193   110.912 1.00 50.79  ? 38   ASP A CG     1 
ATOM   1518 O OD1    . ASP C 3 38  ? -4.556  -0.832  111.622 1.00 51.80  ? 38   ASP A OD1    1 
ATOM   1519 O OD2    . ASP C 3 38  ? -4.329  1.330   111.366 1.00 52.43  ? 38   ASP A OD2    1 
ATOM   1520 H H      . ASP C 3 38  ? -2.436  -0.038  108.955 1.00 40.00  ? 38   ASP A H      1 
ATOM   1521 N N      . ILE C 3 39  ? -4.399  -0.359  106.472 1.00 39.48  ? 39   ILE A N      1 
ATOM   1522 C CA     . ILE C 3 39  ? -4.839  -0.366  105.081 1.00 39.39  ? 39   ILE A CA     1 
ATOM   1523 C C      . ILE C 3 39  ? -4.450  -1.684  104.428 1.00 39.03  ? 39   ILE A C      1 
ATOM   1524 O O      . ILE C 3 39  ? -5.238  -2.301  103.749 1.00 38.99  ? 39   ILE A O      1 
ATOM   1525 C CB     . ILE C 3 39  ? -4.236  0.815   104.328 1.00 37.43  ? 39   ILE A CB     1 
ATOM   1526 C CG1    . ILE C 3 39  ? -4.769  2.118   104.924 1.00 36.60  ? 39   ILE A CG1    1 
ATOM   1527 C CG2    . ILE C 3 39  ? -4.605  0.747   102.857 1.00 33.90  ? 39   ILE A CG2    1 
ATOM   1528 C CD1    . ILE C 3 39  ? -4.054  3.371   104.445 1.00 32.25  ? 39   ILE A CD1    1 
ATOM   1529 H H      . ILE C 3 39  ? -3.798  0.358   106.774 1.00 40.00  ? 39   ILE A H      1 
ATOM   1530 N N      . SER C 3 40  ? -3.236  -2.131  104.712 1.00 37.82  ? 40   SER A N      1 
ATOM   1531 C CA     . SER C 3 40  ? -2.720  -3.371  104.193 1.00 35.68  ? 40   SER A CA     1 
ATOM   1532 C C      . SER C 3 40  ? -3.579  -4.550  104.604 1.00 37.39  ? 40   SER A C      1 
ATOM   1533 O O      . SER C 3 40  ? -3.995  -5.333  103.740 1.00 38.86  ? 40   SER A O      1 
ATOM   1534 C CB     . SER C 3 40  ? -1.304  -3.564  104.663 1.00 35.85  ? 40   SER A CB     1 
ATOM   1535 O OG     . SER C 3 40  ? -0.830  -4.831  104.301 1.00 37.25  ? 40   SER A OG     1 
ATOM   1536 H H      . SER C 3 40  ? -2.673  -1.613  105.325 1.00 40.00  ? 40   SER A H      1 
ATOM   1537 H HG     . SER C 3 40  ? 0.079   -4.824  104.583 1.00 40.00  ? 40   SER A HG     1 
ATOM   1538 N N      . ARG C 3 41  ? -3.914  -4.601  105.896 1.00 41.18  ? 41   ARG A N      1 
ATOM   1539 C CA     . ARG C 3 41  ? -4.725  -5.661  106.469 1.00 44.75  ? 41   ARG A CA     1 
ATOM   1540 C C      . ARG C 3 41  ? -6.119  -5.694  105.870 1.00 43.42  ? 41   ARG A C      1 
ATOM   1541 O O      . ARG C 3 41  ? -6.549  -6.710  105.345 1.00 46.23  ? 41   ARG A O      1 
ATOM   1542 C CB     . ARG C 3 41  ? -4.829  -5.495  107.996 1.00 48.50  ? 41   ARG A CB     1 
ATOM   1543 C CG     . ARG C 3 41  ? -5.480  -6.691  108.713 1.00 59.58  ? 41   ARG A CG     1 
ATOM   1544 C CD     . ARG C 3 41  ? -5.669  -6.463  110.224 1.00 65.48  ? 41   ARG A CD     1 
ATOM   1545 N NE     . ARG C 3 41  ? -6.707  -5.469  110.501 1.00 66.30  ? 41   ARG A NE     1 
ATOM   1546 C CZ     . ARG C 3 41  ? -6.465  -4.190  110.743 1.00 65.34  ? 41   ARG A CZ     1 
ATOM   1547 N NH1    . ARG C 3 41  ? -5.229  -3.759  110.761 1.00 65.66  ? 41   ARG A NH1    1 
ATOM   1548 N NH2    . ARG C 3 41  ? -7.446  -3.326  110.844 1.00 66.14  ? 41   ARG A NH2    1 
ATOM   1549 H H      . ARG C 3 41  ? -3.620  -3.868  106.476 1.00 40.00  ? 41   ARG A H      1 
ATOM   1550 H HE     . ARG C 3 41  ? -7.639  -5.763  110.496 1.00 40.00  ? 41   ARG A HE     1 
ATOM   1551 H HH11   . ARG C 3 41  ? -4.463  -4.404  110.630 1.00 40.00  ? 41   ARG A HH11   1 
ATOM   1552 H HH12   . ARG C 3 41  ? -5.006  -2.800  110.935 1.00 40.00  ? 41   ARG A HH12   1 
ATOM   1553 H HH21   . ARG C 3 41  ? -8.399  -3.551  110.695 1.00 40.00  ? 41   ARG A HH21   1 
ATOM   1554 H HH22   . ARG C 3 41  ? -7.138  -2.374  110.976 1.00 40.00  ? 41   ARG A HH22   1 
ATOM   1555 N N      . ILE C 3 42  ? -6.799  -4.552  105.913 1.00 40.43  ? 42   ILE A N      1 
ATOM   1556 C CA     . ILE C 3 42  ? -8.169  -4.413  105.415 1.00 40.40  ? 42   ILE A CA     1 
ATOM   1557 C C      . ILE C 3 42  ? -8.311  -4.739  103.958 1.00 40.67  ? 42   ILE A C      1 
ATOM   1558 O O      . ILE C 3 42  ? -9.200  -5.493  103.567 1.00 37.41  ? 42   ILE A O      1 
ATOM   1559 C CB     . ILE C 3 42  ? -8.708  -2.987  105.625 1.00 44.31  ? 42   ILE A CB     1 
ATOM   1560 C CG1    . ILE C 3 42  ? -8.745  -2.626  107.125 1.00 46.84  ? 42   ILE A CG1    1 
ATOM   1561 C CG2    . ILE C 3 42  ? -10.122 -2.835  105.018 1.00 44.03  ? 42   ILE A CG2    1 
ATOM   1562 C CD1    . ILE C 3 42  ? -8.938  -1.144  107.391 1.00 43.49  ? 42   ILE A CD1    1 
ATOM   1563 H H      . ILE C 3 42  ? -6.351  -3.748  106.232 1.00 40.00  ? 42   ILE A H      1 
ATOM   1564 N N      . LEU C 3 43  ? -7.417  -4.191  103.153 1.00 43.36  ? 43   LEU A N      1 
ATOM   1565 C CA     . LEU C 3 43  ? -7.469  -4.393  101.712 1.00 42.71  ? 43   LEU A CA     1 
ATOM   1566 C C      . LEU C 3 43  ? -6.670  -5.562  101.205 1.00 44.18  ? 43   LEU A C      1 
ATOM   1567 O O      . LEU C 3 43  ? -6.666  -5.829  100.009 1.00 44.47  ? 43   LEU A O      1 
ATOM   1568 C CB     . LEU C 3 43  ? -7.024  -3.114  100.992 1.00 41.14  ? 43   LEU A CB     1 
ATOM   1569 C CG     . LEU C 3 43  ? -7.832  -1.858  101.378 1.00 40.93  ? 43   LEU A CG     1 
ATOM   1570 C CD1    . LEU C 3 43  ? -7.284  -0.650  100.647 1.00 36.97  ? 43   LEU A CD1    1 
ATOM   1571 C CD2    . LEU C 3 43  ? -9.285  -2.044  101.065 1.00 44.56  ? 43   LEU A CD2    1 
ATOM   1572 H H      . LEU C 3 43  ? -6.680  -3.700  103.523 1.00 40.00  ? 43   LEU A H      1 
ATOM   1573 N N      . GLN C 3 44  ? -6.003  -6.266  102.112 1.00 43.44  ? 44   GLN A N      1 
ATOM   1574 C CA     . GLN C 3 44  ? -5.170  -7.425  101.766 1.00 44.44  ? 44   GLN A CA     1 
ATOM   1575 C C      . GLN C 3 44  ? -4.158  -7.120  100.655 1.00 44.68  ? 44   GLN A C      1 
ATOM   1576 O O      . GLN C 3 44  ? -3.993  -7.887  99.699  1.00 45.72  ? 44   GLN A O      1 
ATOM   1577 C CB     . GLN C 3 44  ? -6.041  -8.642  101.379 1.00 44.38  ? 44   GLN A CB     1 
ATOM   1578 C CG     . GLN C 3 44  ? -7.063  -9.026  102.457 1.00 49.29  ? 44   GLN A CG     1 
ATOM   1579 C CD     . GLN C 3 44  ? -8.079  -10.043 101.981 1.00 54.46  ? 44   GLN A CD     1 
ATOM   1580 O OE1    . GLN C 3 44  ? -8.152  -11.129 102.521 1.00 62.80  ? 44   GLN A OE1    1 
ATOM   1581 N NE2    . GLN C 3 44  ? -8.853  -9.700  100.954 1.00 54.62  ? 44   GLN A NE2    1 
ATOM   1582 H H      . GLN C 3 44  ? -6.138  -6.039  103.059 1.00 40.00  ? 44   GLN A H      1 
ATOM   1583 H HE21   . GLN C 3 44  ? -9.481  -10.396 100.686 1.00 40.00  ? 44   GLN A HE21   1 
ATOM   1584 H HE22   . GLN C 3 44  ? -8.736  -8.819  100.544 1.00 40.00  ? 44   GLN A HE22   1 
ATOM   1585 N N      . VAL C 3 45  ? -3.508  -5.965  100.793 1.00 41.72  ? 45   VAL A N      1 
ATOM   1586 C CA     . VAL C 3 45  ? -2.487  -5.499  99.866  1.00 36.68  ? 45   VAL A CA     1 
ATOM   1587 C C      . VAL C 3 45  ? -1.165  -5.515  100.605 1.00 35.30  ? 45   VAL A C      1 
ATOM   1588 O O      . VAL C 3 45  ? -1.103  -5.172  101.787 1.00 38.70  ? 45   VAL A O      1 
ATOM   1589 C CB     . VAL C 3 45  ? -2.796  -4.067  99.393  1.00 35.28  ? 45   VAL A CB     1 
ATOM   1590 C CG1    . VAL C 3 45  ? -1.721  -3.590  98.432  1.00 28.40  ? 45   VAL A CG1    1 
ATOM   1591 C CG2    . VAL C 3 45  ? -4.176  -4.038  98.725  1.00 32.38  ? 45   VAL A CG2    1 
ATOM   1592 H H      . VAL C 3 45  ? -3.803  -5.378  101.523 1.00 40.00  ? 45   VAL A H      1 
ATOM   1593 N N      . SER C 3 46  ? -0.083  -5.850  99.914  1.00 33.30  ? 46   SER A N      1 
ATOM   1594 C CA     . SER C 3 46  ? 1.221   -5.915  100.594 1.00 35.12  ? 46   SER A CA     1 
ATOM   1595 C C      . SER C 3 46  ? 1.633   -4.561  101.153 1.00 35.43  ? 46   SER A C      1 
ATOM   1596 O O      . SER C 3 46  ? 1.411   -3.525  100.533 1.00 38.91  ? 46   SER A O      1 
ATOM   1597 C CB     . SER C 3 46  ? 2.304   -6.425  99.643  1.00 30.53  ? 46   SER A CB     1 
ATOM   1598 O OG     . SER C 3 46  ? 2.585   -5.469  98.638  1.00 38.45  ? 46   SER A OG     1 
ATOM   1599 H H      . SER C 3 46  ? -0.207  -6.051  98.963  1.00 40.00  ? 46   SER A H      1 
ATOM   1600 H HG     . SER C 3 46  ? 3.023   -4.720  99.100  1.00 40.00  ? 46   SER A HG     1 
ATOM   1601 N N      . ASN C 3 47  ? 2.232   -4.585  102.334 1.00 33.50  ? 47   ASN A N      1 
ATOM   1602 C CA     . ASN C 3 47  ? 2.681   -3.352  102.972 1.00 29.52  ? 47   ASN A CA     1 
ATOM   1603 C C      . ASN C 3 47  ? 3.541   -2.475  102.086 1.00 30.81  ? 47   ASN A C      1 
ATOM   1604 O O      . ASN C 3 47  ? 3.334   -1.263  102.032 1.00 31.95  ? 47   ASN A O      1 
ATOM   1605 C CB     . ASN C 3 47  ? 3.404   -3.649  104.266 1.00 31.69  ? 47   ASN A CB     1 
ATOM   1606 C CG     . ASN C 3 47  ? 2.470   -3.583  105.463 1.00 40.60  ? 47   ASN A CG     1 
ATOM   1607 O OD1    . ASN C 3 47  ? 2.002   -2.500  105.809 1.00 44.40  ? 47   ASN A OD1    1 
ATOM   1608 N ND2    . ASN C 3 47  ? 2.130   -4.740  106.052 1.00 47.95  ? 47   ASN A ND2    1 
ATOM   1609 H H      . ASN C 3 47  ? 2.411   -5.455  102.719 1.00 40.00  ? 47   ASN A H      1 
ATOM   1610 H HD21   . ASN C 3 47  ? 1.557   -4.743  106.827 1.00 40.00  ? 47   ASN A HD21   1 
ATOM   1611 H HD22   . ASN C 3 47  ? 2.469   -5.592  105.680 1.00 40.00  ? 47   ASN A HD22   1 
ATOM   1612 N N      . GLY C 3 48  ? 4.478   -3.096  101.363 1.00 30.49  ? 48   GLY A N      1 
ATOM   1613 C CA     . GLY C 3 48  ? 5.364   -2.368  100.462 1.00 31.53  ? 48   GLY A CA     1 
ATOM   1614 C C      . GLY C 3 48  ? 4.601   -1.645  99.367  1.00 31.94  ? 48   GLY A C      1 
ATOM   1615 O O      . GLY C 3 48  ? 4.969   -0.547  98.958  1.00 33.36  ? 48   GLY A O      1 
ATOM   1616 H H      . GLY C 3 48  ? 4.574   -4.045  101.505 1.00 40.00  ? 48   GLY A H      1 
ATOM   1617 N N      . CYS C 3 49  ? 3.521   -2.263  98.917  1.00 32.28  ? 49   CYS A N      1 
ATOM   1618 C CA     . CYS C 3 49  ? 2.700   -1.688  97.865  1.00 33.46  ? 49   CYS A CA     1 
ATOM   1619 C C      . CYS C 3 49  ? 1.923   -0.512  98.405  1.00 35.10  ? 49   CYS A C      1 
ATOM   1620 O O      . CYS C 3 49  ? 1.910   0.561   97.816  1.00 36.92  ? 49   CYS A O      1 
ATOM   1621 C CB     . CYS C 3 49  ? 1.755   -2.727  97.254  1.00 32.87  ? 49   CYS A CB     1 
ATOM   1622 S SG     . CYS C 3 49  ? 0.687   -2.043  96.015  1.00 37.93  ? 49   CYS A SG     1 
ATOM   1623 H H      . CYS C 3 49  ? 3.292   -3.110  99.312  1.00 40.00  ? 49   CYS A H      1 
ATOM   1624 N N      . VAL C 3 50  ? 1.346   -0.691  99.585  1.00 32.75  ? 50   VAL A N      1 
ATOM   1625 C CA     . VAL C 3 50  ? 0.584   0.376   100.225 1.00 32.69  ? 50   VAL A CA     1 
ATOM   1626 C C      . VAL C 3 50  ? 1.478   1.576   100.393 1.00 36.20  ? 50   VAL A C      1 
ATOM   1627 O O      . VAL C 3 50  ? 1.130   2.676   100.029 1.00 34.65  ? 50   VAL A O      1 
ATOM   1628 C CB     . VAL C 3 50  ? 0.068   -0.061  101.635 1.00 30.99  ? 50   VAL A CB     1 
ATOM   1629 C CG1    . VAL C 3 50  ? -0.613  1.096   102.323 1.00 29.52  ? 50   VAL A CG1    1 
ATOM   1630 C CG2    . VAL C 3 50  ? -0.865  -1.232  101.448 1.00 34.80  ? 50   VAL A CG2    1 
ATOM   1631 H H      . VAL C 3 50  ? 1.445   -1.568  100.018 1.00 40.00  ? 50   VAL A H      1 
ATOM   1632 N N      . SER C 3 51  ? 2.692   1.303   100.837 1.00 38.58  ? 51   SER A N      1 
ATOM   1633 C CA     . SER C 3 51  ? 3.673   2.355   101.049 1.00 39.30  ? 51   SER A CA     1 
ATOM   1634 C C      . SER C 3 51  ? 4.000   3.147   99.770  1.00 40.54  ? 51   SER A C      1 
ATOM   1635 O O      . SER C 3 51  ? 4.019   4.378   99.781  1.00 41.76  ? 51   SER A O      1 
ATOM   1636 C CB     . SER C 3 51  ? 4.941   1.766   101.628 1.00 40.51  ? 51   SER A CB     1 
ATOM   1637 O OG     . SER C 3 51  ? 5.949   2.726   101.610 1.00 41.98  ? 51   SER A OG     1 
ATOM   1638 H H      . SER C 3 51  ? 2.984   0.379   100.957 1.00 40.00  ? 51   SER A H      1 
ATOM   1639 H HG     . SER C 3 51  ? 6.746   2.332   102.020 1.00 40.00  ? 51   SER A HG     1 
ATOM   1640 N N      . LYS C 3 52  ? 4.243   2.430   98.673  1.00 39.24  ? 52   LYS A N      1 
ATOM   1641 C CA     . LYS C 3 52  ? 4.595   3.052   97.405  1.00 39.05  ? 52   LYS A CA     1 
ATOM   1642 C C      . LYS C 3 52  ? 3.447   3.910   96.883  1.00 39.63  ? 52   LYS A C      1 
ATOM   1643 O O      . LYS C 3 52  ? 3.639   5.081   96.547  1.00 38.29  ? 52   LYS A O      1 
ATOM   1644 C CB     . LYS C 3 52  ? 4.949   1.984   96.353  1.00 40.08  ? 52   LYS A CB     1 
ATOM   1645 C CG     . LYS C 3 52  ? 5.934   2.456   95.286  1.00 43.22  ? 52   LYS A CG     1 
ATOM   1646 C CD     . LYS C 3 52  ? 5.374   2.389   93.903  1.00 46.76  ? 52   LYS A CD     1 
ATOM   1647 C CE     . LYS C 3 52  ? 5.219   0.974   93.423  1.00 50.11  ? 52   LYS A CE     1 
ATOM   1648 N NZ     . LYS C 3 52  ? 4.128   0.798   92.443  1.00 52.21  ? 52   LYS A NZ     1 
ATOM   1649 H H      . LYS C 3 52  ? 4.173   1.450   98.739  1.00 40.00  ? 52   LYS A H      1 
ATOM   1650 H HZ1    . LYS C 3 52  ? 3.203   1.091   92.848  1.00 40.00  ? 52   LYS A HZ1    1 
ATOM   1651 H HZ2    . LYS C 3 52  ? 4.269   1.343   91.567  1.00 40.00  ? 52   LYS A HZ2    1 
ATOM   1652 H HZ3    . LYS C 3 52  ? 4.000   -0.196  92.164  1.00 40.00  ? 52   LYS A HZ3    1 
ATOM   1653 N N      . ILE C 3 53  ? 2.244   3.353   96.898  1.00 38.98  ? 53   ILE A N      1 
ATOM   1654 C CA     . ILE C 3 53  ? 1.089   4.062   96.379  1.00 39.75  ? 53   ILE A CA     1 
ATOM   1655 C C      . ILE C 3 53  ? 0.792   5.295   97.220  1.00 36.79  ? 53   ILE A C      1 
ATOM   1656 O O      . ILE C 3 53  ? 0.650   6.402   96.690  1.00 37.54  ? 53   ILE A O      1 
ATOM   1657 C CB     . ILE C 3 53  ? -0.139  3.130   96.283  1.00 39.09  ? 53   ILE A CB     1 
ATOM   1658 C CG1    . ILE C 3 53  ? 0.132   2.069   95.216  1.00 38.77  ? 53   ILE A CG1    1 
ATOM   1659 C CG2    . ILE C 3 53  ? -1.405  3.934   95.907  1.00 35.80  ? 53   ILE A CG2    1 
ATOM   1660 C CD1    . ILE C 3 53  ? -0.949  1.058   95.090  1.00 44.39  ? 53   ILE A CD1    1 
ATOM   1661 H H      . ILE C 3 53  ? 2.148   2.442   97.226  1.00 40.00  ? 53   ILE A H      1 
ATOM   1662 N N      . LEU C 3 54  ? 0.760   5.122   98.532  1.00 33.69  ? 54   LEU A N      1 
ATOM   1663 C CA     . LEU C 3 54  ? 0.510   6.268   99.386  1.00 36.90  ? 54   LEU A CA     1 
ATOM   1664 C C      . LEU C 3 54  ? 1.575   7.353   99.174  1.00 38.19  ? 54   LEU A C      1 
ATOM   1665 O O      . LEU C 3 54  ? 1.274   8.521   98.969  1.00 35.10  ? 54   LEU A O      1 
ATOM   1666 C CB     . LEU C 3 54  ? 0.465   5.857   100.847 1.00 39.09  ? 54   LEU A CB     1 
ATOM   1667 C CG     . LEU C 3 54  ? -0.916  5.498   101.406 1.00 40.25  ? 54   LEU A CG     1 
ATOM   1668 C CD1    . LEU C 3 54  ? -0.805  5.466   102.941 1.00 40.29  ? 54   LEU A CD1    1 
ATOM   1669 C CD2    . LEU C 3 54  ? -1.949  6.518   100.966 1.00 45.55  ? 54   LEU A CD2    1 
ATOM   1670 H H      . LEU C 3 54  ? 0.843   4.220   98.874  1.00 40.00  ? 54   LEU A H      1 
ATOM   1671 N N      . GLY C 3 55  ? 2.822   6.911   99.160  1.00 38.45  ? 55   GLY A N      1 
ATOM   1672 C CA     . GLY C 3 55  ? 3.949   7.810   98.994  1.00 37.19  ? 55   GLY A CA     1 
ATOM   1673 C C      . GLY C 3 55  ? 3.857   8.623   97.720  1.00 39.79  ? 55   GLY A C      1 
ATOM   1674 O O      . GLY C 3 55  ? 3.984   9.839   97.745  1.00 40.81  ? 55   GLY A O      1 
ATOM   1675 H H      . GLY C 3 55  ? 2.954   5.930   99.276  1.00 40.00  ? 55   GLY A H      1 
ATOM   1676 N N      . ARG C 3 56  ? 3.574   7.946   96.615  1.00 39.02  ? 56   ARG A N      1 
ATOM   1677 C CA     . ARG C 3 56  ? 3.470   8.637   95.353  1.00 42.34  ? 56   ARG A CA     1 
ATOM   1678 C C      . ARG C 3 56  ? 2.269   9.582   95.338  1.00 41.29  ? 56   ARG A C      1 
ATOM   1679 O O      . ARG C 3 56  ? 2.340   10.638  94.730  1.00 41.31  ? 56   ARG A O      1 
ATOM   1680 C CB     . ARG C 3 56  ? 3.433   7.665   94.183  1.00 43.32  ? 56   ARG A CB     1 
ATOM   1681 C CG     . ARG C 3 56  ? 3.455   8.373   92.858  1.00 50.55  ? 56   ARG A CG     1 
ATOM   1682 C CD     . ARG C 3 56  ? 3.349   7.413   91.720  1.00 50.27  ? 56   ARG A CD     1 
ATOM   1683 N NE     . ARG C 3 56  ? 4.530   6.567   91.639  1.00 50.78  ? 56   ARG A NE     1 
ATOM   1684 C CZ     . ARG C 3 56  ? 4.558   5.422   90.967  1.00 52.20  ? 56   ARG A CZ     1 
ATOM   1685 N NH1    . ARG C 3 56  ? 3.470   5.011   90.335  1.00 50.23  ? 56   ARG A NH1    1 
ATOM   1686 N NH2    . ARG C 3 56  ? 5.666   4.706   90.916  1.00 48.83  ? 56   ARG A NH2    1 
ATOM   1687 H H      . ARG C 3 56  ? 3.394   6.978   96.686  1.00 40.00  ? 56   ARG A H      1 
ATOM   1688 H HE     . ARG C 3 56  ? 5.368   6.834   92.083  1.00 40.00  ? 56   ARG A HE     1 
ATOM   1689 H HH11   . ARG C 3 56  ? 2.614   5.538   90.389  1.00 40.00  ? 56   ARG A HH11   1 
ATOM   1690 H HH12   . ARG C 3 56  ? 3.489   4.134   89.874  1.00 40.00  ? 56   ARG A HH12   1 
ATOM   1691 H HH21   . ARG C 3 56  ? 6.539   4.960   91.336  1.00 40.00  ? 56   ARG A HH21   1 
ATOM   1692 H HH22   . ARG C 3 56  ? 5.630   3.846   90.400  1.00 40.00  ? 56   ARG A HH22   1 
ATOM   1693 N N      . TYR C 3 57  ? 1.183   9.197   95.999  1.00 44.01  ? 57   TYR A N      1 
ATOM   1694 C CA     . TYR C 3 57  ? 0.010   10.041  96.079  1.00 44.12  ? 57   TYR A CA     1 
ATOM   1695 C C      . TYR C 3 57  ? 0.358   11.329  96.796  1.00 43.26  ? 57   TYR A C      1 
ATOM   1696 O O      . TYR C 3 57  ? -0.011  12.393  96.365  1.00 43.84  ? 57   TYR A O      1 
ATOM   1697 C CB     . TYR C 3 57  ? -1.162  9.357   96.821  1.00 41.74  ? 57   TYR A CB     1 
ATOM   1698 C CG     . TYR C 3 57  ? -2.343  10.269  97.072  1.00 40.73  ? 57   TYR A CG     1 
ATOM   1699 C CD1    . TYR C 3 57  ? -3.097  10.781  96.015  1.00 40.80  ? 57   TYR A CD1    1 
ATOM   1700 C CD2    . TYR C 3 57  ? -2.684  10.637  98.357  1.00 44.23  ? 57   TYR A CD2    1 
ATOM   1701 C CE1    . TYR C 3 57  ? -4.179  11.663  96.247  1.00 40.76  ? 57   TYR A CE1    1 
ATOM   1702 C CE2    . TYR C 3 57  ? -3.769  11.515  98.611  1.00 40.47  ? 57   TYR A CE2    1 
ATOM   1703 C CZ     . TYR C 3 57  ? -4.490  12.010  97.566  1.00 41.04  ? 57   TYR A CZ     1 
ATOM   1704 O OH     . TYR C 3 57  ? -5.526  12.849  97.812  1.00 39.81  ? 57   TYR A OH     1 
ATOM   1705 H H      . TYR C 3 57  ? 1.160   8.303   96.426  1.00 40.00  ? 57   TYR A H      1 
ATOM   1706 H HH     . TYR C 3 57  ? -5.963  13.075  96.978  1.00 40.00  ? 57   TYR A HH     1 
ATOM   1707 N N      . TYR C 3 58  ? 1.088   11.230  97.897  1.00 41.87  ? 58   TYR A N      1 
ATOM   1708 C CA     . TYR C 3 58  ? 1.428   12.429  98.641  1.00 44.24  ? 58   TYR A CA     1 
ATOM   1709 C C      . TYR C 3 58  ? 2.413   13.315  97.893  1.00 48.26  ? 58   TYR A C      1 
ATOM   1710 O O      . TYR C 3 58  ? 2.389   14.541  98.047  1.00 48.13  ? 58   TYR A O      1 
ATOM   1711 C CB     . TYR C 3 58  ? 1.925   12.080  100.034 1.00 39.50  ? 58   TYR A CB     1 
ATOM   1712 C CG     . TYR C 3 58  ? 0.866   11.472  100.889 1.00 42.75  ? 58   TYR A CG     1 
ATOM   1713 C CD1    . TYR C 3 58  ? 1.144   10.380  101.726 1.00 40.00  ? 58   TYR A CD1    1 
ATOM   1714 C CD2    . TYR C 3 58  ? -0.433  11.966  100.861 1.00 41.54  ? 58   TYR A CD2    1 
ATOM   1715 C CE1    . TYR C 3 58  ? 0.154   9.800   102.509 1.00 36.02  ? 58   TYR A CE1    1 
ATOM   1716 C CE2    . TYR C 3 58  ? -1.447  11.379  101.648 1.00 38.25  ? 58   TYR A CE2    1 
ATOM   1717 C CZ     . TYR C 3 58  ? -1.142  10.310  102.457 1.00 39.76  ? 58   TYR A CZ     1 
ATOM   1718 O OH     . TYR C 3 58  ? -2.116  9.723   103.203 1.00 38.53  ? 58   TYR A OH     1 
ATOM   1719 H H      . TYR C 3 58  ? 1.400   10.332  98.170  1.00 40.00  ? 58   TYR A H      1 
ATOM   1720 H HH     . TYR C 3 58  ? -2.950  10.185  103.129 1.00 40.00  ? 58   TYR A HH     1 
ATOM   1721 N N      . ALA C 3 59  ? 3.214   12.715  97.022  1.00 52.04  ? 59   ALA A N      1 
ATOM   1722 C CA     . ALA C 3 59  ? 4.165   13.486  96.255  1.00 55.14  ? 59   ALA A CA     1 
ATOM   1723 C C      . ALA C 3 59  ? 3.549   14.074  94.995  1.00 55.98  ? 59   ALA A C      1 
ATOM   1724 O O      . ALA C 3 59  ? 3.826   15.212  94.662  1.00 59.15  ? 59   ALA A O      1 
ATOM   1725 C CB     . ALA C 3 59  ? 5.397   12.637  95.899  1.00 56.83  ? 59   ALA A CB     1 
ATOM   1726 H H      . ALA C 3 59  ? 3.145   11.742  96.901  1.00 40.00  ? 59   ALA A H      1 
ATOM   1727 N N      . THR C 3 60  ? 2.632   13.362  94.357  1.00 53.30  ? 60   THR A N      1 
ATOM   1728 C CA     . THR C 3 60  ? 2.089   13.847  93.098  1.00 51.86  ? 60   THR A CA     1 
ATOM   1729 C C      . THR C 3 60  ? 0.599   14.055  93.040  1.00 51.37  ? 60   THR A C      1 
ATOM   1730 O O      . THR C 3 60  ? 0.082   14.528  92.019  1.00 55.23  ? 60   THR A O      1 
ATOM   1731 C CB     . THR C 3 60  ? 2.449   12.876  91.988  1.00 55.86  ? 60   THR A CB     1 
ATOM   1732 O OG1    . THR C 3 60  ? 1.679   11.682  92.152  1.00 58.65  ? 60   THR A OG1    1 
ATOM   1733 C CG2    . THR C 3 60  ? 3.919   12.529  92.029  1.00 54.32  ? 60   THR A CG2    1 
ATOM   1734 H H      . THR C 3 60  ? 2.271   12.506  94.680  1.00 40.00  ? 60   THR A H      1 
ATOM   1735 H HG1    . THR C 3 60  ? 0.773   11.875  91.886  1.00 40.00  ? 60   THR A HG1    1 
ATOM   1736 N N      . GLY C 3 61  ? -0.100  13.645  94.094  1.00 48.98  ? 61   GLY A N      1 
ATOM   1737 C CA     . GLY C 3 61  ? -1.544  13.775  94.106  1.00 47.04  ? 61   GLY A CA     1 
ATOM   1738 C C      . GLY C 3 61  ? -2.221  12.812  93.130  1.00 47.90  ? 61   GLY A C      1 
ATOM   1739 O O      . GLY C 3 61  ? -3.436  12.859  92.965  1.00 48.73  ? 61   GLY A O      1 
ATOM   1740 H H      . GLY C 3 61  ? 0.426   13.198  94.782  1.00 40.00  ? 61   GLY A H      1 
ATOM   1741 N N      . SER C 3 62  ? -1.459  11.902  92.532  1.00 47.91  ? 62   SER A N      1 
ATOM   1742 C CA     . SER C 3 62  ? -2.017  10.968  91.583  1.00 47.46  ? 62   SER A CA     1 
ATOM   1743 C C      . SER C 3 62  ? -2.119  9.561   92.159  1.00 46.84  ? 62   SER A C      1 
ATOM   1744 O O      . SER C 3 62  ? -1.246  9.135   92.898  1.00 42.10  ? 62   SER A O      1 
ATOM   1745 C CB     . SER C 3 62  ? -1.168  10.944  90.307  1.00 49.80  ? 62   SER A CB     1 
ATOM   1746 O OG     . SER C 3 62  ? -1.720  10.035  89.377  1.00 52.07  ? 62   SER A OG     1 
ATOM   1747 H H      . SER C 3 62  ? -0.517  11.836  92.820  1.00 40.00  ? 62   SER A H      1 
ATOM   1748 H HG     . SER C 3 62  ? -2.543  10.397  89.092  1.00 40.00  ? 62   SER A HG     1 
ATOM   1749 N N      . ILE C 3 63  ? -3.222  8.880   91.869  1.00 47.91  ? 63   ILE A N      1 
ATOM   1750 C CA     . ILE C 3 63  ? -3.406  7.502   92.315  1.00 49.79  ? 63   ILE A CA     1 
ATOM   1751 C C      . ILE C 3 63  ? -3.191  6.556   91.115  1.00 51.13  ? 63   ILE A C      1 
ATOM   1752 O O      . ILE C 3 63  ? -3.196  5.315   91.272  1.00 51.68  ? 63   ILE A O      1 
ATOM   1753 C CB     . ILE C 3 63  ? -4.837  7.226   92.853  1.00 51.05  ? 63   ILE A CB     1 
ATOM   1754 C CG1    . ILE C 3 63  ? -5.791  6.957   91.684  1.00 60.03  ? 63   ILE A CG1    1 
ATOM   1755 C CG2    . ILE C 3 63  ? -5.382  8.434   93.608  1.00 56.71  ? 63   ILE A CG2    1 
ATOM   1756 C CD1    . ILE C 3 63  ? -7.143  6.422   92.097  1.00 63.90  ? 63   ILE A CD1    1 
ATOM   1757 H H      . ILE C 3 63  ? -3.929  9.313   91.358  1.00 40.00  ? 63   ILE A H      1 
ATOM   1758 N N      . ARG C 3 64  ? -3.078  7.148   89.921  1.00 50.25  ? 64   ARG A N      1 
ATOM   1759 C CA     . ARG C 3 64  ? -2.898  6.367   88.706  1.00 50.13  ? 64   ARG A CA     1 
ATOM   1760 C C      . ARG C 3 64  ? -1.506  5.766   88.635  1.00 47.26  ? 64   ARG A C      1 
ATOM   1761 O O      . ARG C 3 64  ? -0.533  6.353   89.065  1.00 49.21  ? 64   ARG A O      1 
ATOM   1762 C CB     . ARG C 3 64  ? -3.085  7.212   87.430  1.00 55.69  ? 64   ARG A CB     1 
ATOM   1763 C CG     . ARG C 3 64  ? -4.501  7.549   86.967  1.00 65.51  ? 64   ARG A CG     1 
ATOM   1764 C CD     . ARG C 3 64  ? -5.557  6.520   87.347  1.00 77.82  ? 64   ARG A CD     1 
ATOM   1765 N NE     . ARG C 3 64  ? -5.368  5.166   86.806  1.00 82.81  ? 64   ARG A NE     1 
ATOM   1766 C CZ     . ARG C 3 64  ? -5.328  4.852   85.520  1.00 85.77  ? 64   ARG A CZ     1 
ATOM   1767 N NH1    . ARG C 3 64  ? -5.431  5.799   84.599  1.00 88.31  ? 64   ARG A NH1    1 
ATOM   1768 N NH2    . ARG C 3 64  ? -5.292  3.575   85.151  1.00 86.63  ? 64   ARG A NH2    1 
ATOM   1769 H H      . ARG C 3 64  ? -3.067  8.111   89.927  1.00 40.00  ? 64   ARG A H      1 
ATOM   1770 H HE     . ARG C 3 64  ? -5.208  4.414   87.420  1.00 40.00  ? 64   ARG A HE     1 
ATOM   1771 H HH11   . ARG C 3 64  ? -5.502  6.740   84.928  1.00 40.00  ? 64   ARG A HH11   1 
ATOM   1772 H HH12   . ARG C 3 64  ? -5.405  5.579   83.628  1.00 40.00  ? 64   ARG A HH12   1 
ATOM   1773 H HH21   . ARG C 3 64  ? -5.304  2.782   85.780  1.00 40.00  ? 64   ARG A HH21   1 
ATOM   1774 H HH22   . ARG C 3 64  ? -5.299  3.395   84.172  1.00 40.00  ? 64   ARG A HH22   1 
ATOM   1775 N N      . PRO C 3 65  ? -1.409  4.551   88.105  1.00 42.81  ? 65   PRO A N      1 
ATOM   1776 C CA     . PRO C 3 65  ? -0.111  3.899   87.973  1.00 40.71  ? 65   PRO A CA     1 
ATOM   1777 C C      . PRO C 3 65  ? 0.678   4.584   86.867  1.00 39.15  ? 65   PRO A C      1 
ATOM   1778 O O      . PRO C 3 65  ? 0.129   5.308   86.061  1.00 37.50  ? 65   PRO A O      1 
ATOM   1779 C CB     . PRO C 3 65  ? -0.498  2.463   87.557  1.00 39.53  ? 65   PRO A CB     1 
ATOM   1780 C CG     . PRO C 3 65  ? -1.855  2.641   86.857  1.00 38.96  ? 65   PRO A CG     1 
ATOM   1781 C CD     . PRO C 3 65  ? -2.515  3.632   87.784  1.00 38.17  ? 65   PRO A CD     1 
ATOM   1782 N N      . ARG C 3 66  ? 1.990   4.433   86.852  1.00 39.59  ? 66   ARG A N      1 
ATOM   1783 C CA     . ARG C 3 66  ? 2.774   5.028   85.743  1.00 40.83  ? 66   ARG A CA     1 
ATOM   1784 C C      . ARG C 3 66  ? 2.786   4.061   84.540  1.00 42.96  ? 66   ARG A C      1 
ATOM   1785 O O      . ARG C 3 66  ? 2.427   2.875   84.696  1.00 44.91  ? 66   ARG A O      1 
ATOM   1786 C CB     . ARG C 3 66  ? 4.194   5.327   86.182  1.00 40.28  ? 66   ARG A CB     1 
ATOM   1787 C CG     . ARG C 3 66  ? 4.309   6.307   87.380  1.00 44.67  ? 66   ARG A CG     1 
ATOM   1788 C CD     . ARG C 3 66  ? 5.558   7.168   87.256  1.00 50.22  ? 66   ARG A CD     1 
ATOM   1789 N NE     . ARG C 3 66  ? 6.016   7.776   88.513  1.00 57.10  ? 66   ARG A NE     1 
ATOM   1790 C CZ     . ARG C 3 66  ? 7.064   7.328   89.212  1.00 57.32  ? 66   ARG A CZ     1 
ATOM   1791 N NH1    . ARG C 3 66  ? 7.737   6.267   88.776  1.00 61.36  ? 66   ARG A NH1    1 
ATOM   1792 N NH2    . ARG C 3 66  ? 7.472   7.945   90.316  1.00 55.58  ? 66   ARG A NH2    1 
ATOM   1793 H H      . ARG C 3 66  ? 2.366   3.913   87.568  1.00 40.00  ? 66   ARG A H      1 
ATOM   1794 H HE     . ARG C 3 66  ? 5.507   8.518   88.904  1.00 40.00  ? 66   ARG A HE     1 
ATOM   1795 H HH11   . ARG C 3 66  ? 7.464   5.788   87.937  1.00 40.00  ? 66   ARG A HH11   1 
ATOM   1796 H HH12   . ARG C 3 66  ? 8.521   5.956   89.304  1.00 40.00  ? 66   ARG A HH12   1 
ATOM   1797 H HH21   . ARG C 3 66  ? 7.028   8.776   90.668  1.00 40.00  ? 66   ARG A HH21   1 
ATOM   1798 H HH22   . ARG C 3 66  ? 8.273   7.593   90.794  1.00 40.00  ? 66   ARG A HH22   1 
ATOM   1799 N N      . ALA C 3 67  ? 3.156   4.562   83.366  1.00 42.99  ? 67   ALA A N      1 
ATOM   1800 C CA     . ALA C 3 67  ? 3.191   3.749   82.160  1.00 40.61  ? 67   ALA A CA     1 
ATOM   1801 C C      . ALA C 3 67  ? 4.264   2.678   82.193  1.00 41.12  ? 67   ALA A C      1 
ATOM   1802 O O      . ALA C 3 67  ? 5.467   2.945   82.400  1.00 42.47  ? 67   ALA A O      1 
ATOM   1803 C CB     . ALA C 3 67  ? 3.372   4.594   80.943  1.00 40.96  ? 67   ALA A CB     1 
ATOM   1804 H H      . ALA C 3 67  ? 3.466   5.487   83.364  1.00 40.00  ? 67   ALA A H      1 
ATOM   1805 N N      . ILE C 3 68  ? 3.809   1.453   82.003  1.00 41.31  ? 68   ILE A N      1 
ATOM   1806 C CA     . ILE C 3 68  ? 4.700   0.305   81.991  1.00 43.96  ? 68   ILE A CA     1 
ATOM   1807 C C      . ILE C 3 68  ? 5.135   0.050   80.551  1.00 45.23  ? 68   ILE A C      1 
ATOM   1808 O O      . ILE C 3 68  ? 4.430   0.429   79.600  1.00 48.04  ? 68   ILE A O      1 
ATOM   1809 C CB     . ILE C 3 68  ? 3.952   -0.889  82.522  1.00 42.68  ? 68   ILE A CB     1 
ATOM   1810 C CG1    . ILE C 3 68  ? 3.475   -0.603  83.975  1.00 42.69  ? 68   ILE A CG1    1 
ATOM   1811 C CG2    . ILE C 3 68  ? 4.792   -2.158  82.422  1.00 37.87  ? 68   ILE A CG2    1 
ATOM   1812 C CD1    . ILE C 3 68  ? 2.556   -1.615  84.555  1.00 38.11  ? 68   ILE A CD1    1 
ATOM   1813 H H      . ILE C 3 68  ? 2.887   1.299   81.845  1.00 40.00  ? 68   ILE A H      1 
ATOM   1814 N N      . GLY C 3 69  ? 6.337   -0.485  80.385  1.00 45.46  ? 69   GLY A N      1 
ATOM   1815 C CA     . GLY C 3 69  ? 6.802   -0.810  79.053  1.00 46.10  ? 69   GLY A CA     1 
ATOM   1816 C C      . GLY C 3 69  ? 7.026   0.280   78.034  1.00 45.68  ? 69   GLY A C      1 
ATOM   1817 O O      . GLY C 3 69  ? 7.498   1.379   78.351  1.00 44.23  ? 69   GLY A O      1 
ATOM   1818 H H      . GLY C 3 69  ? 6.967   -0.593  81.111  1.00 40.00  ? 69   GLY A H      1 
ATOM   1819 N N      . GLY C 3 70  ? 6.630   -0.031  76.802  1.00 44.50  ? 70   GLY A N      1 
ATOM   1820 C CA     . GLY C 3 70  ? 6.836   0.876   75.690  1.00 42.19  ? 70   GLY A CA     1 
ATOM   1821 C C      . GLY C 3 70  ? 8.332   1.030   75.556  1.00 41.32  ? 70   GLY A C      1 
ATOM   1822 O O      . GLY C 3 70  ? 9.081   0.160   76.013  1.00 42.19  ? 70   GLY A O      1 
ATOM   1823 H H      . GLY C 3 70  ? 6.021   -0.799  76.655  1.00 40.00  ? 70   GLY A H      1 
ATOM   1824 N N      . SER C 3 71  ? 8.763   2.109   74.922  1.00 40.93  ? 71   SER A N      1 
ATOM   1825 C CA     . SER C 3 71  ? 10.191  2.365   74.752  1.00 43.75  ? 71   SER A CA     1 
ATOM   1826 C C      . SER C 3 71  ? 10.392  3.843   74.449  1.00 46.66  ? 71   SER A C      1 
ATOM   1827 O O      . SER C 3 71  ? 9.444   4.569   74.200  1.00 46.92  ? 71   SER A O      1 
ATOM   1828 C CB     . SER C 3 71  ? 10.758  1.501   73.600  1.00 44.02  ? 71   SER A CB     1 
ATOM   1829 O OG     . SER C 3 71  ? 10.108  1.841   72.390  1.00 39.01  ? 71   SER A OG     1 
ATOM   1830 H H      . SER C 3 71  ? 8.150   2.784   74.572  1.00 40.00  ? 71   SER A H      1 
ATOM   1831 H HG     . SER C 3 71  ? 10.506  1.429   71.636  1.00 40.00  ? 71   SER A HG     1 
ATOM   1832 N N      . LYS C 3 72  ? 11.639  4.283   74.473  1.00 50.19  ? 72   LYS A N      1 
ATOM   1833 C CA     . LYS C 3 72  ? 11.937  5.657   74.142  1.00 51.99  ? 72   LYS A CA     1 
ATOM   1834 C C      . LYS C 3 72  ? 12.426  5.745   72.696  1.00 53.95  ? 72   LYS A C      1 
ATOM   1835 O O      . LYS C 3 72  ? 12.895  4.757   72.119  1.00 53.62  ? 72   LYS A O      1 
ATOM   1836 C CB     . LYS C 3 72  ? 12.974  6.230   75.092  1.00 55.55  ? 72   LYS A CB     1 
ATOM   1837 C CG     . LYS C 3 72  ? 12.440  6.463   76.515  1.00 61.49  ? 72   LYS A CG     1 
ATOM   1838 C CD     . LYS C 3 72  ? 12.124  7.935   76.810  1.00 68.56  ? 72   LYS A CD     1 
ATOM   1839 C CE     . LYS C 3 72  ? 10.717  8.368   76.389  1.00 68.01  ? 72   LYS A CE     1 
ATOM   1840 N NZ     . LYS C 3 72  ? 10.526  9.852   76.651  1.00 58.79  ? 72   LYS A NZ     1 
ATOM   1841 H H      . LYS C 3 72  ? 12.369  3.666   74.723  1.00 40.00  ? 72   LYS A H      1 
ATOM   1842 H HZ1    . LYS C 3 72  ? 10.690  10.098  77.648  1.00 40.00  ? 72   LYS A HZ1    1 
ATOM   1843 H HZ2    . LYS C 3 72  ? 11.237  10.352  76.107  1.00 40.00  ? 72   LYS A HZ2    1 
ATOM   1844 H HZ3    . LYS C 3 72  ? 9.595   10.193  76.337  1.00 40.00  ? 72   LYS A HZ3    1 
ATOM   1845 N N      . PRO C 3 73  ? 12.262  6.924   72.072  1.00 55.56  ? 73   PRO A N      1 
ATOM   1846 C CA     . PRO C 3 73  ? 12.673  7.163   70.693  1.00 53.99  ? 73   PRO A CA     1 
ATOM   1847 C C      . PRO C 3 73  ? 14.136  6.827   70.499  1.00 53.08  ? 73   PRO A C      1 
ATOM   1848 O O      . PRO C 3 73  ? 14.973  7.251   71.263  1.00 54.54  ? 73   PRO A O      1 
ATOM   1849 C CB     . PRO C 3 73  ? 12.402  8.658   70.523  1.00 55.26  ? 73   PRO A CB     1 
ATOM   1850 C CG     . PRO C 3 73  ? 11.232  8.879   71.402  1.00 57.82  ? 73   PRO A CG     1 
ATOM   1851 C CD     . PRO C 3 73  ? 11.645  8.134   72.635  1.00 57.41  ? 73   PRO A CD     1 
ATOM   1852 N N      . ARG C 3 74  ? 14.419  6.006   69.501  1.00 52.26  ? 74   ARG A N      1 
ATOM   1853 C CA     . ARG C 3 74  ? 15.788  5.598   69.191  1.00 48.75  ? 74   ARG A CA     1 
ATOM   1854 C C      . ARG C 3 74  ? 16.346  6.325   68.000  1.00 46.96  ? 74   ARG A C      1 
ATOM   1855 O O      . ARG C 3 74  ? 17.469  6.849   68.040  1.00 45.95  ? 74   ARG A O      1 
ATOM   1856 C CB     . ARG C 3 74  ? 15.834  4.109   68.941  1.00 52.39  ? 74   ARG A CB     1 
ATOM   1857 C CG     . ARG C 3 74  ? 15.772  3.279   70.209  1.00 54.06  ? 74   ARG A CG     1 
ATOM   1858 C CD     . ARG C 3 74  ? 14.959  2.011   69.943  1.00 62.91  ? 74   ARG A CD     1 
ATOM   1859 N NE     . ARG C 3 74  ? 13.544  2.257   70.197  1.00 67.22  ? 74   ARG A NE     1 
ATOM   1860 C CZ     . ARG C 3 74  ? 12.566  1.474   69.762  1.00 68.57  ? 74   ARG A CZ     1 
ATOM   1861 N NH1    . ARG C 3 74  ? 12.840  0.386   69.055  1.00 65.63  ? 74   ARG A NH1    1 
ATOM   1862 N NH2    . ARG C 3 74  ? 11.307  1.788   70.009  1.00 72.46  ? 74   ARG A NH2    1 
ATOM   1863 H H      . ARG C 3 74  ? 13.681  5.706   68.922  1.00 40.00  ? 74   ARG A H      1 
ATOM   1864 H HE     . ARG C 3 74  ? 13.281  3.016   70.753  1.00 40.00  ? 74   ARG A HE     1 
ATOM   1865 H HH11   . ARG C 3 74  ? 13.779  0.176   68.824  1.00 40.00  ? 74   ARG A HH11   1 
ATOM   1866 H HH12   . ARG C 3 74  ? 12.059  -0.128  68.690  1.00 40.00  ? 74   ARG A HH12   1 
ATOM   1867 H HH21   . ARG C 3 74  ? 11.032  2.604   70.524  1.00 40.00  ? 74   ARG A HH21   1 
ATOM   1868 H HH22   . ARG C 3 74  ? 10.584  1.215   69.633  1.00 40.00  ? 74   ARG A HH22   1 
ATOM   1869 N N      . VAL C 3 75  ? 15.577  6.350   66.917  1.00 45.83  ? 75   VAL A N      1 
ATOM   1870 C CA     . VAL C 3 75  ? 16.056  7.028   65.713  1.00 43.87  ? 75   VAL A CA     1 
ATOM   1871 C C      . VAL C 3 75  ? 15.346  8.356   65.537  1.00 43.83  ? 75   VAL A C      1 
ATOM   1872 O O      . VAL C 3 75  ? 15.970  9.348   65.236  1.00 41.85  ? 75   VAL A O      1 
ATOM   1873 C CB     . VAL C 3 75  ? 15.918  6.111   64.433  1.00 41.42  ? 75   VAL A CB     1 
ATOM   1874 C CG1    . VAL C 3 75  ? 16.607  4.812   64.694  1.00 37.48  ? 75   VAL A CG1    1 
ATOM   1875 C CG2    . VAL C 3 75  ? 14.469  5.836   64.119  1.00 39.87  ? 75   VAL A CG2    1 
ATOM   1876 H H      . VAL C 3 75  ? 14.707  5.915   66.932  1.00 40.00  ? 75   VAL A H      1 
ATOM   1877 N N      . ALA C 3 76  ? 14.033  8.358   65.758  1.00 41.63  ? 76   ALA A N      1 
ATOM   1878 C CA     . ALA C 3 76  ? 13.221  9.566   65.624  1.00 40.39  ? 76   ALA A CA     1 
ATOM   1879 C C      . ALA C 3 76  ? 13.291  10.436  66.887  1.00 41.51  ? 76   ALA A C      1 
ATOM   1880 O O      . ALA C 3 76  ? 12.287  10.665  67.536  1.00 43.11  ? 76   ALA A O      1 
ATOM   1881 C CB     . ALA C 3 76  ? 11.790  9.193   65.334  1.00 39.07  ? 76   ALA A CB     1 
ATOM   1882 H H      . ALA C 3 76  ? 13.619  7.540   66.075  1.00 40.00  ? 76   ALA A H      1 
ATOM   1883 N N      . THR C 3 77  ? 14.490  10.846  67.264  1.00 42.75  ? 77   THR A N      1 
ATOM   1884 C CA     . THR C 3 77  ? 14.676  11.679  68.436  1.00 41.74  ? 77   THR A CA     1 
ATOM   1885 C C      . THR C 3 77  ? 14.110  13.081  68.164  1.00 39.42  ? 77   THR A C      1 
ATOM   1886 O O      . THR C 3 77  ? 13.904  13.454  67.023  1.00 39.12  ? 77   THR A O      1 
ATOM   1887 C CB     . THR C 3 77  ? 16.175  11.764  68.821  1.00 40.35  ? 77   THR A CB     1 
ATOM   1888 O OG1    . THR C 3 77  ? 16.904  12.446  67.800  1.00 44.60  ? 77   THR A OG1    1 
ATOM   1889 C CG2    . THR C 3 77  ? 16.771  10.393  68.959  1.00 36.60  ? 77   THR A CG2    1 
ATOM   1890 H H      . THR C 3 77  ? 15.280  10.544  66.744  1.00 40.00  ? 77   THR A H      1 
ATOM   1891 H HG1    . THR C 3 77  ? 16.566  13.367  67.803  1.00 40.00  ? 77   THR A HG1    1 
ATOM   1892 N N      . PRO C 3 78  ? 13.858  13.884  69.209  1.00 36.42  ? 78   PRO A N      1 
ATOM   1893 C CA     . PRO C 3 78  ? 13.305  15.230  68.978  1.00 35.97  ? 78   PRO A CA     1 
ATOM   1894 C C      . PRO C 3 78  ? 14.057  16.100  67.982  1.00 37.52  ? 78   PRO A C      1 
ATOM   1895 O O      . PRO C 3 78  ? 13.452  16.688  67.082  1.00 35.88  ? 78   PRO A O      1 
ATOM   1896 C CB     . PRO C 3 78  ? 13.270  15.852  70.370  1.00 36.02  ? 78   PRO A CB     1 
ATOM   1897 C CG     . PRO C 3 78  ? 13.136  14.661  71.254  1.00 35.52  ? 78   PRO A CG     1 
ATOM   1898 C CD     . PRO C 3 78  ? 14.101  13.659  70.638  1.00 36.33  ? 78   PRO A CD     1 
ATOM   1899 N N      . GLU C 3 79  ? 15.379  16.171  68.102  1.00 39.26  ? 79   GLU A N      1 
ATOM   1900 C CA     . GLU C 3 79  ? 16.159  16.993  67.164  1.00 38.31  ? 79   GLU A CA     1 
ATOM   1901 C C      . GLU C 3 79  ? 16.009  16.511  65.707  1.00 39.35  ? 79   GLU A C      1 
ATOM   1902 O O      . GLU C 3 79  ? 15.844  17.308  64.788  1.00 38.12  ? 79   GLU A O      1 
ATOM   1903 C CB     . GLU C 3 79  ? 17.645  16.989  67.522  1.00 35.68  ? 79   GLU A CB     1 
ATOM   1904 C CG     . GLU C 3 79  ? 18.517  17.852  66.552  1.00 34.44  ? 79   GLU A CG     1 
ATOM   1905 C CD     . GLU C 3 79  ? 19.989  17.871  66.896  1.00 34.59  ? 79   GLU A CD     1 
ATOM   1906 O OE1    . GLU C 3 79  ? 20.751  18.524  66.156  1.00 38.36  ? 79   GLU A OE1    1 
ATOM   1907 O OE2    . GLU C 3 79  ? 20.428  17.222  67.861  1.00 36.96  ? 79   GLU A OE2    1 
ATOM   1908 H H      . GLU C 3 79  ? 15.843  15.637  68.764  1.00 40.00  ? 79   GLU A H      1 
ATOM   1909 N N      . VAL C 3 80  ? 15.963  15.186  65.530  1.00 40.07  ? 80   VAL A N      1 
ATOM   1910 C CA     . VAL C 3 80  ? 15.826  14.567  64.212  1.00 39.24  ? 80   VAL A CA     1 
ATOM   1911 C C      . VAL C 3 80  ? 14.453  14.913  63.663  1.00 39.11  ? 80   VAL A C      1 
ATOM   1912 O O      . VAL C 3 80  ? 14.308  15.317  62.497  1.00 38.03  ? 80   VAL A O      1 
ATOM   1913 C CB     . VAL C 3 80  ? 15.972  13.033  64.305  1.00 36.88  ? 80   VAL A CB     1 
ATOM   1914 C CG1    . VAL C 3 80  ? 15.596  12.395  62.943  1.00 35.62  ? 80   VAL A CG1    1 
ATOM   1915 C CG2    . VAL C 3 80  ? 17.335  12.653  64.646  1.00 32.91  ? 80   VAL A CG2    1 
ATOM   1916 H H      . VAL C 3 80  ? 16.080  14.571  66.293  1.00 40.00  ? 80   VAL A H      1 
ATOM   1917 N N      . VAL C 3 81  ? 13.449  14.804  64.524  1.00 38.35  ? 81   VAL A N      1 
ATOM   1918 C CA     . VAL C 3 81  ? 12.082  15.111  64.129  1.00 41.01  ? 81   VAL A CA     1 
ATOM   1919 C C      . VAL C 3 81  ? 11.979  16.581  63.696  1.00 42.56  ? 81   VAL A C      1 
ATOM   1920 O O      . VAL C 3 81  ? 11.390  16.873  62.664  1.00 40.76  ? 81   VAL A O      1 
ATOM   1921 C CB     . VAL C 3 81  ? 11.112  14.766  65.273  1.00 41.66  ? 81   VAL A CB     1 
ATOM   1922 C CG1    . VAL C 3 81  ? 9.696   15.230  64.950  1.00 43.13  ? 81   VAL A CG1    1 
ATOM   1923 C CG2    . VAL C 3 81  ? 11.122  13.266  65.505  1.00 34.06  ? 81   VAL A CG2    1 
ATOM   1924 H H      . VAL C 3 81  ? 13.626  14.534  65.448  1.00 40.00  ? 81   VAL A H      1 
ATOM   1925 N N      . SER C 3 82  ? 12.610  17.477  64.451  1.00 41.95  ? 82   SER A N      1 
ATOM   1926 C CA     . SER C 3 82  ? 12.612  18.894  64.112  1.00 41.65  ? 82   SER A CA     1 
ATOM   1927 C C      . SER C 3 82  ? 13.236  19.089  62.751  1.00 41.29  ? 82   SER A C      1 
ATOM   1928 O O      . SER C 3 82  ? 12.703  19.813  61.936  1.00 38.93  ? 82   SER A O      1 
ATOM   1929 C CB     . SER C 3 82  ? 13.389  19.708  65.139  1.00 39.19  ? 82   SER A CB     1 
ATOM   1930 O OG     . SER C 3 82  ? 12.685  19.833  66.351  1.00 43.88  ? 82   SER A OG     1 
ATOM   1931 H H      . SER C 3 82  ? 13.083  17.197  65.260  1.00 40.00  ? 82   SER A H      1 
ATOM   1932 H HG     . SER C 3 82  ? 11.999  20.428  66.075  1.00 40.00  ? 82   SER A HG     1 
ATOM   1933 N N      . LYS C 3 83  ? 14.356  18.416  62.507  1.00 41.07  ? 83   LYS A N      1 
ATOM   1934 C CA     . LYS C 3 83  ? 15.058  18.511  61.236  1.00 41.35  ? 83   LYS A CA     1 
ATOM   1935 C C      . LYS C 3 83  ? 14.189  18.023  60.084  1.00 38.72  ? 83   LYS A C      1 
ATOM   1936 O O      . LYS C 3 83  ? 14.072  18.668  59.047  1.00 35.79  ? 83   LYS A O      1 
ATOM   1937 C CB     . LYS C 3 83  ? 16.372  17.707  61.270  1.00 45.36  ? 83   LYS A CB     1 
ATOM   1938 C CG     . LYS C 3 83  ? 17.540  18.491  61.833  1.00 52.46  ? 83   LYS A CG     1 
ATOM   1939 C CD     . LYS C 3 83  ? 17.818  19.754  61.002  1.00 53.87  ? 83   LYS A CD     1 
ATOM   1940 C CE     . LYS C 3 83  ? 18.662  20.768  61.753  1.00 57.49  ? 83   LYS A CE     1 
ATOM   1941 N NZ     . LYS C 3 83  ? 18.948  21.940  60.868  1.00 62.22  ? 83   LYS A NZ     1 
ATOM   1942 H H      . LYS C 3 83  ? 14.735  17.835  63.209  1.00 40.00  ? 83   LYS A H      1 
ATOM   1943 H HZ1    . LYS C 3 83  ? 18.055  22.257  60.452  1.00 40.00  ? 83   LYS A HZ1    1 
ATOM   1944 H HZ2    . LYS C 3 83  ? 19.375  22.754  61.365  1.00 40.00  ? 83   LYS A HZ2    1 
ATOM   1945 H HZ3    . LYS C 3 83  ? 19.513  21.703  60.026  1.00 40.00  ? 83   LYS A HZ3    1 
ATOM   1946 N N      . ILE C 3 84  ? 13.557  16.879  60.272  1.00 37.28  ? 84   ILE A N      1 
ATOM   1947 C CA     . ILE C 3 84  ? 12.721  16.325  59.241  1.00 38.08  ? 84   ILE A CA     1 
ATOM   1948 C C      . ILE C 3 84  ? 11.651  17.345  58.877  1.00 36.70  ? 84   ILE A C      1 
ATOM   1949 O O      . ILE C 3 84  ? 11.475  17.662  57.691  1.00 34.33  ? 84   ILE A O      1 
ATOM   1950 C CB     . ILE C 3 84  ? 12.102  14.986  59.699  1.00 39.24  ? 84   ILE A CB     1 
ATOM   1951 C CG1    . ILE C 3 84  ? 13.196  13.907  59.724  1.00 38.50  ? 84   ILE A CG1    1 
ATOM   1952 C CG2    . ILE C 3 84  ? 10.977  14.559  58.745  1.00 38.11  ? 84   ILE A CG2    1 
ATOM   1953 C CD1    . ILE C 3 84  ? 12.692  12.575  60.251  1.00 31.82  ? 84   ILE A CD1    1 
ATOM   1954 H H      . ILE C 3 84  ? 13.739  16.388  61.103  1.00 40.00  ? 84   ILE A H      1 
ATOM   1955 N N      . ALA C 3 85  ? 11.020  17.923  59.908  1.00 37.51  ? 85   ALA A N      1 
ATOM   1956 C CA     . ALA C 3 85  ? 9.997   18.927  59.704  1.00 39.43  ? 85   ALA A CA     1 
ATOM   1957 C C      . ALA C 3 85  ? 10.620  20.110  58.983  1.00 43.60  ? 85   ALA A C      1 
ATOM   1958 O O      . ALA C 3 85  ? 9.997   20.709  58.098  1.00 48.23  ? 85   ALA A O      1 
ATOM   1959 C CB     . ALA C 3 85  ? 9.414   19.363  61.015  1.00 38.25  ? 85   ALA A CB     1 
ATOM   1960 H H      . ALA C 3 85  ? 11.227  17.600  60.816  1.00 40.00  ? 85   ALA A H      1 
ATOM   1961 N N      . GLN C 3 86  ? 11.842  20.441  59.376  1.00 45.76  ? 86   GLN A N      1 
ATOM   1962 C CA     . GLN C 3 86  ? 12.590  21.535  58.796  1.00 44.99  ? 86   GLN A CA     1 
ATOM   1963 C C      . GLN C 3 86  ? 12.792  21.314  57.297  1.00 42.81  ? 86   GLN A C      1 
ATOM   1964 O O      . GLN C 3 86  ? 12.567  22.224  56.517  1.00 42.07  ? 86   GLN A O      1 
ATOM   1965 C CB     . GLN C 3 86  ? 13.950  21.654  59.493  1.00 48.83  ? 86   GLN A CB     1 
ATOM   1966 C CG     . GLN C 3 86  ? 14.442  23.072  59.702  1.00 52.20  ? 86   GLN A CG     1 
ATOM   1967 C CD     . GLN C 3 86  ? 15.963  23.153  59.710  1.00 54.00  ? 86   GLN A CD     1 
ATOM   1968 O OE1    . GLN C 3 86  ? 16.590  23.208  60.751  1.00 58.81  ? 86   GLN A OE1    1 
ATOM   1969 N NE2    . GLN C 3 86  ? 16.553  23.152  58.529  1.00 49.80  ? 86   GLN A NE2    1 
ATOM   1970 H H      . GLN C 3 86  ? 12.200  19.964  60.152  1.00 40.00  ? 86   GLN A H      1 
ATOM   1971 H HE21   . GLN C 3 86  ? 17.531  23.226  58.492  1.00 40.00  ? 86   GLN A HE21   1 
ATOM   1972 H HE22   . GLN C 3 86  ? 15.959  23.061  57.748  1.00 40.00  ? 86   GLN A HE22   1 
ATOM   1973 N N      . TYR C 3 87  ? 13.166  20.102  56.900  1.00 41.09  ? 87   TYR A N      1 
ATOM   1974 C CA     . TYR C 3 87  ? 13.403  19.800  55.490  1.00 43.38  ? 87   TYR A CA     1 
ATOM   1975 C C      . TYR C 3 87  ? 12.116  19.883  54.684  1.00 48.06  ? 87   TYR A C      1 
ATOM   1976 O O      . TYR C 3 87  ? 12.060  20.562  53.669  1.00 48.22  ? 87   TYR A O      1 
ATOM   1977 C CB     . TYR C 3 87  ? 14.060  18.431  55.319  1.00 40.80  ? 87   TYR A CB     1 
ATOM   1978 C CG     . TYR C 3 87  ? 15.406  18.249  56.025  1.00 46.09  ? 87   TYR A CG     1 
ATOM   1979 C CD1    . TYR C 3 87  ? 15.896  16.975  56.302  1.00 48.00  ? 87   TYR A CD1    1 
ATOM   1980 C CD2    . TYR C 3 87  ? 16.171  19.347  56.429  1.00 51.57  ? 87   TYR A CD2    1 
ATOM   1981 C CE1    . TYR C 3 87  ? 17.107  16.796  56.960  1.00 47.41  ? 87   TYR A CE1    1 
ATOM   1982 C CE2    . TYR C 3 87  ? 17.379  19.187  57.082  1.00 50.94  ? 87   TYR A CE2    1 
ATOM   1983 C CZ     . TYR C 3 87  ? 17.850  17.914  57.349  1.00 47.47  ? 87   TYR A CZ     1 
ATOM   1984 O OH     . TYR C 3 87  ? 19.048  17.763  58.005  1.00 50.31  ? 87   TYR A OH     1 
ATOM   1985 H H      . TYR C 3 87  ? 13.238  19.425  57.601  1.00 40.00  ? 87   TYR A H      1 
ATOM   1986 H HH     . TYR C 3 87  ? 19.253  16.797  58.079  1.00 40.00  ? 87   TYR A HH     1 
ATOM   1987 N N      . LYS C 3 88  ? 11.059  19.242  55.174  1.00 50.06  ? 88   LYS A N      1 
ATOM   1988 C CA     . LYS C 3 88  ? 9.763   19.240  54.500  1.00 49.92  ? 88   LYS A CA     1 
ATOM   1989 C C      . LYS C 3 88  ? 9.212   20.623  54.349  1.00 51.85  ? 88   LYS A C      1 
ATOM   1990 O O      . LYS C 3 88  ? 8.619   20.962  53.319  1.00 54.48  ? 88   LYS A O      1 
ATOM   1991 C CB     . LYS C 3 88  ? 8.753   18.413  55.293  1.00 50.41  ? 88   LYS A CB     1 
ATOM   1992 C CG     . LYS C 3 88  ? 8.305   17.149  54.600  1.00 55.75  ? 88   LYS A CG     1 
ATOM   1993 C CD     . LYS C 3 88  ? 7.209   17.388  53.576  1.00 56.10  ? 88   LYS A CD     1 
ATOM   1994 C CE     . LYS C 3 88  ? 7.009   16.130  52.741  1.00 61.87  ? 88   LYS A CE     1 
ATOM   1995 N NZ     . LYS C 3 88  ? 5.642   15.981  52.169  1.00 61.24  ? 88   LYS A NZ     1 
ATOM   1996 H H      . LYS C 3 88  ? 11.176  18.759  56.018  1.00 40.00  ? 88   LYS A H      1 
ATOM   1997 H HZ1    . LYS C 3 88  ? 5.437   16.814  51.575  1.00 40.00  ? 88   LYS A HZ1    1 
ATOM   1998 H HZ2    . LYS C 3 88  ? 5.545   15.102  51.609  1.00 40.00  ? 88   LYS A HZ2    1 
ATOM   1999 H HZ3    . LYS C 3 88  ? 4.976   15.952  52.962  1.00 40.00  ? 88   LYS A HZ3    1 
ATOM   2000 N N      . GLN C 3 89  ? 9.389   21.422  55.389  1.00 54.57  ? 89   GLN A N      1 
ATOM   2001 C CA     . GLN C 3 89  ? 8.897   22.785  55.367  1.00 56.76  ? 89   GLN A CA     1 
ATOM   2002 C C      . GLN C 3 89  ? 9.436   23.590  54.171  1.00 57.14  ? 89   GLN A C      1 
ATOM   2003 O O      . GLN C 3 89  ? 8.661   24.109  53.366  1.00 55.67  ? 89   GLN A O      1 
ATOM   2004 C CB     . GLN C 3 89  ? 9.266   23.472  56.671  1.00 57.21  ? 89   GLN A CB     1 
ATOM   2005 C CG     . GLN C 3 89  ? 8.068   23.982  57.466  1.00 59.39  ? 89   GLN A CG     1 
ATOM   2006 C CD     . GLN C 3 89  ? 8.298   25.396  57.951  1.00 64.28  ? 89   GLN A CD     1 
ATOM   2007 O OE1    . GLN C 3 89  ? 9.053   26.152  57.330  1.00 69.40  ? 89   GLN A OE1    1 
ATOM   2008 N NE2    . GLN C 3 89  ? 7.669   25.764  59.068  1.00 64.60  ? 89   GLN A NE2    1 
ATOM   2009 H H      . GLN C 3 89  ? 9.872   21.123  56.183  1.00 40.00  ? 89   GLN A H      1 
ATOM   2010 H HE21   . GLN C 3 89  ? 7.825   26.663  59.414  1.00 40.00  ? 89   GLN A HE21   1 
ATOM   2011 H HE22   . GLN C 3 89  ? 7.085   25.124  59.512  1.00 40.00  ? 89   GLN A HE22   1 
ATOM   2012 N N      . GLU C 3 90  ? 10.749  23.546  53.976  1.00 58.59  ? 90   GLU A N      1 
ATOM   2013 C CA     . GLU C 3 90  ? 11.402  24.301  52.914  1.00 62.57  ? 90   GLU A CA     1 
ATOM   2014 C C      . GLU C 3 90  ? 11.327  23.659  51.537  1.00 64.66  ? 90   GLU A C      1 
ATOM   2015 O O      . GLU C 3 90  ? 11.623  24.309  50.535  1.00 68.00  ? 90   GLU A O      1 
ATOM   2016 C CB     . GLU C 3 90  ? 12.844  24.652  53.308  1.00 63.12  ? 90   GLU A CB     1 
ATOM   2017 C CG     . GLU C 3 90  ? 13.402  23.742  54.375  1.00 67.50  ? 90   GLU A CG     1 
ATOM   2018 C CD     . GLU C 3 90  ? 14.700  24.219  55.017  1.00 69.99  ? 90   GLU A CD     1 
ATOM   2019 O OE1    . GLU C 3 90  ? 14.674  25.204  55.790  1.00 68.32  ? 90   GLU A OE1    1 
ATOM   2020 O OE2    . GLU C 3 90  ? 15.740  23.561  54.784  1.00 68.59  ? 90   GLU A OE2    1 
ATOM   2021 H H      . GLU C 3 90  ? 11.224  22.857  54.478  1.00 40.00  ? 90   GLU A H      1 
ATOM   2022 N N      . CYS C 3 91  ? 10.983  22.380  51.489  1.00 63.41  ? 91   CYS A N      1 
ATOM   2023 C CA     . CYS C 3 91  ? 10.817  21.692  50.215  1.00 62.97  ? 91   CYS A CA     1 
ATOM   2024 C C      . CYS C 3 91  ? 9.845   20.532  50.362  1.00 60.85  ? 91   CYS A C      1 
ATOM   2025 O O      . CYS C 3 91  ? 10.243  19.379  50.545  1.00 59.47  ? 91   CYS A O      1 
ATOM   2026 C CB     . CYS C 3 91  ? 12.136  21.177  49.641  1.00 62.90  ? 91   CYS A CB     1 
ATOM   2027 S SG     . CYS C 3 91  ? 11.813  20.316  48.085  1.00 70.77  ? 91   CYS A SG     1 
ATOM   2028 H H      . CYS C 3 91  ? 10.920  21.853  52.311  1.00 40.00  ? 91   CYS A H      1 
ATOM   2029 N N      . PRO C 3 92  ? 8.547   20.829  50.276  1.00 60.42  ? 92   PRO A N      1 
ATOM   2030 C CA     . PRO C 3 92  ? 7.453   19.864  50.393  1.00 61.44  ? 92   PRO A CA     1 
ATOM   2031 C C      . PRO C 3 92  ? 7.534   18.666  49.459  1.00 63.00  ? 92   PRO A C      1 
ATOM   2032 O O      . PRO C 3 92  ? 7.158   17.556  49.829  1.00 65.59  ? 92   PRO A O      1 
ATOM   2033 C CB     . PRO C 3 92  ? 6.224   20.717  50.069  1.00 61.11  ? 92   PRO A CB     1 
ATOM   2034 C CG     . PRO C 3 92  ? 6.613   22.045  50.604  1.00 61.57  ? 92   PRO A CG     1 
ATOM   2035 C CD     . PRO C 3 92  ? 8.013   22.188  50.093  1.00 60.56  ? 92   PRO A CD     1 
ATOM   2036 N N      . SER C 3 93  ? 8.065   18.891  48.261  1.00 62.33  ? 93   SER A N      1 
ATOM   2037 C CA     . SER C 3 93  ? 8.160   17.848  47.248  1.00 59.86  ? 93   SER A CA     1 
ATOM   2038 C C      . SER C 3 93  ? 9.276   16.841  47.501  1.00 58.97  ? 93   SER A C      1 
ATOM   2039 O O      . SER C 3 93  ? 9.498   15.948  46.692  1.00 60.96  ? 93   SER A O      1 
ATOM   2040 C CB     . SER C 3 93  ? 8.407   18.485  45.885  1.00 61.67  ? 93   SER A CB     1 
ATOM   2041 O OG     . SER C 3 93  ? 9.656   19.165  45.879  1.00 62.41  ? 93   SER A OG     1 
ATOM   2042 H H      . SER C 3 93  ? 8.493   19.744  48.062  1.00 40.00  ? 93   SER A H      1 
ATOM   2043 H HG     . SER C 3 93  ? 10.440  18.644  46.152  1.00 40.00  ? 93   SER A HG     1 
ATOM   2044 N N      . ILE C 3 94  ? 9.989   17.009  48.607  1.00 56.67  ? 94   ILE A N      1 
ATOM   2045 C CA     . ILE C 3 94  ? 11.114  16.147  48.947  1.00 54.75  ? 94   ILE A CA     1 
ATOM   2046 C C      . ILE C 3 94  ? 10.714  14.716  49.296  1.00 51.72  ? 94   ILE A C      1 
ATOM   2047 O O      . ILE C 3 94  ? 9.688   14.491  49.928  1.00 47.20  ? 94   ILE A O      1 
ATOM   2048 C CB     . ILE C 3 94  ? 11.949  16.781  50.106  1.00 55.21  ? 94   ILE A CB     1 
ATOM   2049 C CG1    . ILE C 3 94  ? 13.306  16.102  50.213  1.00 53.43  ? 94   ILE A CG1    1 
ATOM   2050 C CG2    . ILE C 3 94  ? 11.210  16.672  51.426  1.00 55.06  ? 94   ILE A CG2    1 
ATOM   2051 C CD1    . ILE C 3 94  ? 14.330  16.908  50.969  1.00 50.21  ? 94   ILE A CD1    1 
ATOM   2052 H H      . ILE C 3 94  ? 9.751   17.708  49.254  1.00 40.00  ? 94   ILE A H      1 
ATOM   2053 N N      . PHE C 3 95  ? 11.536  13.761  48.873  1.00 50.47  ? 95   PHE A N      1 
ATOM   2054 C CA     . PHE C 3 95  ? 11.317  12.338  49.131  1.00 51.07  ? 95   PHE A CA     1 
ATOM   2055 C C      . PHE C 3 95  ? 11.935  11.916  50.464  1.00 52.64  ? 95   PHE A C      1 
ATOM   2056 O O      . PHE C 3 95  ? 12.941  12.497  50.896  1.00 52.44  ? 95   PHE A O      1 
ATOM   2057 C CB     . PHE C 3 95  ? 11.969  11.499  48.028  1.00 51.53  ? 95   PHE A CB     1 
ATOM   2058 C CG     . PHE C 3 95  ? 11.282  11.586  46.712  1.00 52.28  ? 95   PHE A CG     1 
ATOM   2059 C CD1    . PHE C 3 95  ? 10.044  10.996  46.529  1.00 57.83  ? 95   PHE A CD1    1 
ATOM   2060 C CD2    . PHE C 3 95  ? 11.894  12.219  45.640  1.00 53.45  ? 95   PHE A CD2    1 
ATOM   2061 C CE1    . PHE C 3 95  ? 9.417   11.022  45.304  1.00 54.20  ? 95   PHE A CE1    1 
ATOM   2062 C CE2    . PHE C 3 95  ? 11.282  12.254  44.403  1.00 51.38  ? 95   PHE A CE2    1 
ATOM   2063 C CZ     . PHE C 3 95  ? 10.034  11.651  44.232  1.00 52.74  ? 95   PHE A CZ     1 
ATOM   2064 H H      . PHE C 3 95  ? 12.339  14.001  48.358  1.00 40.00  ? 95   PHE A H      1 
ATOM   2065 N N      . ALA C 3 96  ? 11.398  10.858  51.069  1.00 52.92  ? 96   ALA A N      1 
ATOM   2066 C CA     . ALA C 3 96  ? 11.927  10.375  52.345  1.00 51.68  ? 96   ALA A CA     1 
ATOM   2067 C C      . ALA C 3 96  ? 13.413  10.058  52.260  1.00 52.02  ? 96   ALA A C      1 
ATOM   2068 O O      . ALA C 3 96  ? 14.191  10.464  53.132  1.00 50.61  ? 96   ALA A O      1 
ATOM   2069 C CB     . ALA C 3 96  ? 11.155  9.135   52.823  1.00 49.41  ? 96   ALA A CB     1 
ATOM   2070 H H      . ALA C 3 96  ? 10.612  10.430  50.679  1.00 40.00  ? 96   ALA A H      1 
ATOM   2071 N N      . TRP C 3 97  ? 13.807  9.376   51.194  1.00 52.63  ? 97   TRP A N      1 
ATOM   2072 C CA     . TRP C 3 97  ? 15.210  9.019   51.024  1.00 53.15  ? 97   TRP A CA     1 
ATOM   2073 C C      . TRP C 3 97  ? 16.069  10.275  50.879  1.00 53.22  ? 97   TRP A C      1 
ATOM   2074 O O      . TRP C 3 97  ? 17.201  10.301  51.371  1.00 54.22  ? 97   TRP A O      1 
ATOM   2075 C CB     . TRP C 3 97  ? 15.385  8.084   49.838  1.00 52.23  ? 97   TRP A CB     1 
ATOM   2076 C CG     . TRP C 3 97  ? 15.180  8.738   48.534  1.00 51.08  ? 97   TRP A CG     1 
ATOM   2077 C CD1    . TRP C 3 97  ? 13.999  8.900   47.875  1.00 47.80  ? 97   TRP A CD1    1 
ATOM   2078 C CD2    . TRP C 3 97  ? 16.194  9.320   47.712  1.00 52.36  ? 97   TRP A CD2    1 
ATOM   2079 N NE1    . TRP C 3 97  ? 14.204  9.557   46.697  1.00 47.35  ? 97   TRP A NE1    1 
ATOM   2080 C CE2    . TRP C 3 97  ? 15.521  9.840   46.577  1.00 51.55  ? 97   TRP A CE2    1 
ATOM   2081 C CE3    . TRP C 3 97  ? 17.574  9.468   47.840  1.00 53.19  ? 97   TRP A CE3    1 
ATOM   2082 C CZ2    . TRP C 3 97  ? 16.236  10.474  45.531  1.00 54.60  ? 97   TRP A CZ2    1 
ATOM   2083 C CZ3    . TRP C 3 97  ? 18.277  10.096  46.797  1.00 55.67  ? 97   TRP A CZ3    1 
ATOM   2084 C CH2    . TRP C 3 97  ? 17.600  10.607  45.669  1.00 56.61  ? 97   TRP A CH2    1 
ATOM   2085 H H      . TRP C 3 97  ? 13.116  9.081   50.569  1.00 40.00  ? 97   TRP A H      1 
ATOM   2086 H HE1    . TRP C 3 97  ? 13.533  9.716   45.997  1.00 40.00  ? 97   TRP A HE1    1 
ATOM   2087 N N      . GLU C 3 98  ? 15.512  11.313  50.253  1.00 52.31  ? 98   GLU A N      1 
ATOM   2088 C CA     . GLU C 3 98  ? 16.231  12.574  50.084  1.00 51.14  ? 98   GLU A CA     1 
ATOM   2089 C C      . GLU C 3 98  ? 16.422  13.176  51.473  1.00 50.54  ? 98   GLU A C      1 
ATOM   2090 O O      . GLU C 3 98  ? 17.500  13.657  51.828  1.00 49.12  ? 98   GLU A O      1 
ATOM   2091 C CB     . GLU C 3 98  ? 15.462  13.533  49.176  1.00 52.43  ? 98   GLU A CB     1 
ATOM   2092 C CG     . GLU C 3 98  ? 15.262  13.030  47.752  1.00 57.65  ? 98   GLU A CG     1 
ATOM   2093 C CD     . GLU C 3 98  ? 14.882  14.132  46.777  1.00 61.57  ? 98   GLU A CD     1 
ATOM   2094 O OE1    . GLU C 3 98  ? 13.820  14.770  46.975  1.00 65.98  ? 98   GLU A OE1    1 
ATOM   2095 O OE2    . GLU C 3 98  ? 15.645  14.358  45.802  1.00 61.49  ? 98   GLU A OE2    1 
ATOM   2096 H H      . GLU C 3 98  ? 14.603  11.188  49.906  1.00 40.00  ? 98   GLU A H      1 
ATOM   2097 N N      . ILE C 3 99  ? 15.391  13.067  52.297  1.00 50.23  ? 99   ILE A N      1 
ATOM   2098 C CA     . ILE C 3 99  ? 15.457  13.562  53.670  1.00 49.16  ? 99   ILE A CA     1 
ATOM   2099 C C      . ILE C 3 99  ? 16.506  12.749  54.432  1.00 47.89  ? 99   ILE A C      1 
ATOM   2100 O O      . ILE C 3 99  ? 17.307  13.304  55.194  1.00 44.14  ? 99   ILE A O      1 
ATOM   2101 C CB     . ILE C 3 99  ? 14.091  13.436  54.348  1.00 49.42  ? 99   ILE A CB     1 
ATOM   2102 C CG1    . ILE C 3 99  ? 13.117  14.492  53.803  1.00 47.77  ? 99   ILE A CG1    1 
ATOM   2103 C CG2    . ILE C 3 99  ? 14.209  13.562  55.869  1.00 45.58  ? 99   ILE A CG2    1 
ATOM   2104 C CD1    . ILE C 3 99  ? 11.758  14.397  54.430  1.00 46.61  ? 99   ILE A CD1    1 
ATOM   2105 H H      . ILE C 3 99  ? 14.576  12.627  51.974  1.00 40.00  ? 99   ILE A H      1 
ATOM   2106 N N      . ARG C 3 100 ? 16.539  11.441  54.191  1.00 44.25  ? 100  ARG A N      1 
ATOM   2107 C CA     . ARG C 3 100 ? 17.506  10.559  54.867  1.00 47.80  ? 100  ARG A CA     1 
ATOM   2108 C C      . ARG C 3 100 ? 18.918  11.029  54.579  1.00 46.83  ? 100  ARG A C      1 
ATOM   2109 O O      . ARG C 3 100 ? 19.673  11.377  55.490  1.00 47.32  ? 100  ARG A O      1 
ATOM   2110 C CB     . ARG C 3 100 ? 17.339  9.105   54.401  1.00 49.92  ? 100  ARG A CB     1 
ATOM   2111 C CG     . ARG C 3 100 ? 18.010  8.072   55.305  1.00 55.59  ? 100  ARG A CG     1 
ATOM   2112 C CD     . ARG C 3 100 ? 17.707  6.652   54.810  1.00 67.04  ? 100  ARG A CD     1 
ATOM   2113 N NE     . ARG C 3 100 ? 17.907  5.641   55.845  1.00 71.45  ? 100  ARG A NE     1 
ATOM   2114 C CZ     . ARG C 3 100 ? 18.746  4.606   55.744  1.00 74.15  ? 100  ARG A CZ     1 
ATOM   2115 N NH1    . ARG C 3 100 ? 19.475  4.423   54.651  1.00 74.95  ? 100  ARG A NH1    1 
ATOM   2116 N NH2    . ARG C 3 100 ? 18.870  3.754   56.751  1.00 75.89  ? 100  ARG A NH2    1 
ATOM   2117 H H      . ARG C 3 100 ? 15.990  11.067  53.475  1.00 40.00  ? 100  ARG A H      1 
ATOM   2118 H HE     . ARG C 3 100 ? 17.352  5.720   56.646  1.00 40.00  ? 100  ARG A HE     1 
ATOM   2119 H HH11   . ARG C 3 100 ? 19.460  5.068   53.884  1.00 40.00  ? 100  ARG A HH11   1 
ATOM   2120 H HH12   . ARG C 3 100 ? 20.133  3.671   54.648  1.00 40.00  ? 100  ARG A HH12   1 
ATOM   2121 H HH21   . ARG C 3 100 ? 18.356  3.867   57.605  1.00 40.00  ? 100  ARG A HH21   1 
ATOM   2122 H HH22   . ARG C 3 100 ? 19.532  3.007   56.678  1.00 40.00  ? 100  ARG A HH22   1 
ATOM   2123 N N      . ASP C 3 101 ? 19.242  11.068  53.288  1.00 47.77  ? 101  ASP A N      1 
ATOM   2124 C CA     . ASP C 3 101 ? 20.538  11.525  52.787  1.00 49.76  ? 101  ASP A CA     1 
ATOM   2125 C C      . ASP C 3 101 ? 20.965  12.831  53.430  1.00 51.48  ? 101  ASP A C      1 
ATOM   2126 O O      . ASP C 3 101 ? 22.117  12.994  53.798  1.00 52.94  ? 101  ASP A O      1 
ATOM   2127 C CB     . ASP C 3 101 ? 20.497  11.694  51.257  1.00 53.85  ? 101  ASP A CB     1 
ATOM   2128 C CG     . ASP C 3 101 ? 20.377  10.376  50.517  1.00 56.83  ? 101  ASP A CG     1 
ATOM   2129 O OD1    . ASP C 3 101 ? 20.407  9.308   51.168  1.00 61.08  ? 101  ASP A OD1    1 
ATOM   2130 O OD2    . ASP C 3 101 ? 20.263  10.412  49.269  1.00 58.34  ? 101  ASP A OD2    1 
ATOM   2131 H H      . ASP C 3 101 ? 18.537  10.748  52.682  1.00 40.00  ? 101  ASP A H      1 
ATOM   2132 N N      . ARG C 3 102 ? 20.012  13.744  53.596  1.00 50.91  ? 102  ARG A N      1 
ATOM   2133 C CA     . ARG C 3 102 ? 20.269  15.032  54.226  1.00 47.57  ? 102  ARG A CA     1 
ATOM   2134 C C      . ARG C 3 102 ? 20.700  14.850  55.677  1.00 45.16  ? 102  ARG A C      1 
ATOM   2135 O O      . ARG C 3 102 ? 21.770  15.286  56.070  1.00 45.82  ? 102  ARG A O      1 
ATOM   2136 C CB     . ARG C 3 102 ? 19.020  15.897  54.179  1.00 50.69  ? 102  ARG A CB     1 
ATOM   2137 C CG     . ARG C 3 102 ? 19.076  17.059  53.208  1.00 56.27  ? 102  ARG A CG     1 
ATOM   2138 C CD     . ARG C 3 102 ? 19.069  18.381  53.954  1.00 52.65  ? 102  ARG A CD     1 
ATOM   2139 N NE     . ARG C 3 102 ? 18.191  19.366  53.319  1.00 57.15  ? 102  ARG A NE     1 
ATOM   2140 C CZ     . ARG C 3 102 ? 18.069  20.621  53.731  1.00 60.85  ? 102  ARG A CZ     1 
ATOM   2141 N NH1    . ARG C 3 102 ? 18.768  21.050  54.767  1.00 61.36  ? 102  ARG A NH1    1 
ATOM   2142 N NH2    . ARG C 3 102 ? 17.217  21.446  53.147  1.00 66.08  ? 102  ARG A NH2    1 
ATOM   2143 H H      . ARG C 3 102 ? 19.084  13.504  53.401  1.00 40.00  ? 102  ARG A H      1 
ATOM   2144 H HE     . ARG C 3 102 ? 17.669  19.083  52.531  1.00 40.00  ? 102  ARG A HE     1 
ATOM   2145 H HH11   . ARG C 3 102 ? 19.368  20.410  55.253  1.00 40.00  ? 102  ARG A HH11   1 
ATOM   2146 H HH12   . ARG C 3 102 ? 18.678  21.993  55.059  1.00 40.00  ? 102  ARG A HH12   1 
ATOM   2147 H HH21   . ARG C 3 102 ? 16.636  21.158  52.387  1.00 40.00  ? 102  ARG A HH21   1 
ATOM   2148 H HH22   . ARG C 3 102 ? 17.153  22.387  53.489  1.00 40.00  ? 102  ARG A HH22   1 
ATOM   2149 N N      . LEU C 3 103 ? 19.881  14.168  56.467  1.00 43.75  ? 103  LEU A N      1 
ATOM   2150 C CA     . LEU C 3 103 ? 20.190  13.922  57.891  1.00 47.54  ? 103  LEU A CA     1 
ATOM   2151 C C      . LEU C 3 103 ? 21.596  13.362  58.027  1.00 50.10  ? 103  LEU A C      1 
ATOM   2152 O O      . LEU C 3 103 ? 22.297  13.645  59.006  1.00 48.78  ? 103  LEU A O      1 
ATOM   2153 C CB     . LEU C 3 103 ? 19.256  12.868  58.504  1.00 46.55  ? 103  LEU A CB     1 
ATOM   2154 C CG     . LEU C 3 103 ? 17.904  13.241  59.127  1.00 46.25  ? 103  LEU A CG     1 
ATOM   2155 C CD1    . LEU C 3 103 ? 18.097  14.362  60.133  1.00 47.70  ? 103  LEU A CD1    1 
ATOM   2156 C CD2    . LEU C 3 103 ? 16.963  13.672  58.068  1.00 53.19  ? 103  LEU A CD2    1 
ATOM   2157 H H      . LEU C 3 103 ? 19.064  13.782  56.088  1.00 40.00  ? 103  LEU A H      1 
ATOM   2158 N N      . LEU C 3 104 ? 21.992  12.565  57.042  1.00 51.00  ? 104  LEU A N      1 
ATOM   2159 C CA     . LEU C 3 104 ? 23.302  11.946  57.040  1.00 50.61  ? 104  LEU A CA     1 
ATOM   2160 C C      . LEU C 3 104 ? 24.400  12.928  56.707  1.00 49.00  ? 104  LEU A C      1 
ATOM   2161 O O      . LEU C 3 104 ? 25.292  13.163  57.523  1.00 49.07  ? 104  LEU A O      1 
ATOM   2162 C CB     . LEU C 3 104 ? 23.324  10.768  56.077  1.00 46.55  ? 104  LEU A CB     1 
ATOM   2163 C CG     . LEU C 3 104 ? 23.008  9.458   56.780  1.00 50.96  ? 104  LEU A CG     1 
ATOM   2164 C CD1    . LEU C 3 104 ? 22.625  8.435   55.758  1.00 45.66  ? 104  LEU A CD1    1 
ATOM   2165 C CD2    . LEU C 3 104 ? 24.224  8.994   57.616  1.00 54.49  ? 104  LEU A CD2    1 
ATOM   2166 H H      . LEU C 3 104 ? 21.441  12.467  56.229  1.00 40.00  ? 104  LEU A H      1 
ATOM   2167 N N      . SER C 3 105 ? 24.285  13.566  55.550  1.00 48.43  ? 105  SER A N      1 
ATOM   2168 C CA     . SER C 3 105 ? 25.292  14.512  55.079  1.00 50.09  ? 105  SER A CA     1 
ATOM   2169 C C      . SER C 3 105 ? 25.493  15.680  56.022  1.00 53.43  ? 105  SER A C      1 
ATOM   2170 O O      . SER C 3 105 ? 26.627  16.106  56.242  1.00 57.34  ? 105  SER A O      1 
ATOM   2171 C CB     . SER C 3 105 ? 24.923  15.043  53.694  1.00 50.08  ? 105  SER A CB     1 
ATOM   2172 O OG     . SER C 3 105 ? 23.809  15.911  53.742  1.00 52.94  ? 105  SER A OG     1 
ATOM   2173 H H      . SER C 3 105 ? 23.521  13.404  54.968  1.00 40.00  ? 105  SER A H      1 
ATOM   2174 H HG     . SER C 3 105 ? 23.016  15.549  54.158  1.00 40.00  ? 105  SER A HG     1 
ATOM   2175 N N      . GLU C 3 106 ? 24.398  16.201  56.560  1.00 53.42  ? 106  GLU A N      1 
ATOM   2176 C CA     . GLU C 3 106 ? 24.458  17.324  57.483  1.00 52.85  ? 106  GLU A CA     1 
ATOM   2177 C C      . GLU C 3 106 ? 24.956  16.907  58.857  1.00 53.47  ? 106  GLU A C      1 
ATOM   2178 O O      . GLU C 3 106 ? 25.196  17.759  59.732  1.00 54.97  ? 106  GLU A O      1 
ATOM   2179 C CB     . GLU C 3 106 ? 23.100  17.999  57.602  1.00 55.40  ? 106  GLU A CB     1 
ATOM   2180 C CG     . GLU C 3 106 ? 22.557  18.496  56.275  1.00 62.35  ? 106  GLU A CG     1 
ATOM   2181 C CD     . GLU C 3 106 ? 21.471  19.541  56.450  1.00 68.89  ? 106  GLU A CD     1 
ATOM   2182 O OE1    . GLU C 3 106 ? 20.913  19.666  57.564  1.00 67.03  ? 106  GLU A OE1    1 
ATOM   2183 O OE2    . GLU C 3 106 ? 21.188  20.256  55.472  1.00 69.46  ? 106  GLU A OE2    1 
ATOM   2184 H H      . GLU C 3 106 ? 23.567  15.723  56.348  1.00 40.00  ? 106  GLU A H      1 
ATOM   2185 N N      . GLY C 3 107 ? 24.998  15.596  59.077  1.00 51.84  ? 107  GLY A N      1 
ATOM   2186 C CA     . GLY C 3 107 ? 25.494  15.072  60.335  1.00 52.29  ? 107  GLY A CA     1 
ATOM   2187 C C      . GLY C 3 107 ? 24.562  15.030  61.515  1.00 53.25  ? 107  GLY A C      1 
ATOM   2188 O O      . GLY C 3 107 ? 25.001  14.942  62.659  1.00 50.68  ? 107  GLY A O      1 
ATOM   2189 H H      . GLY C 3 107 ? 24.565  14.980  58.440  1.00 40.00  ? 107  GLY A H      1 
ATOM   2190 N N      . VAL C 3 108 ? 23.265  15.044  61.235  1.00 51.92  ? 108  VAL A N      1 
ATOM   2191 C CA     . VAL C 3 108 ? 22.257  14.996  62.274  1.00 47.91  ? 108  VAL A CA     1 
ATOM   2192 C C      . VAL C 3 108 ? 22.190  13.563  62.794  1.00 48.94  ? 108  VAL A C      1 
ATOM   2193 O O      . VAL C 3 108 ? 21.840  13.342  63.943  1.00 49.02  ? 108  VAL A O      1 
ATOM   2194 C CB     . VAL C 3 108 ? 20.884  15.420  61.725  1.00 44.82  ? 108  VAL A CB     1 
ATOM   2195 C CG1    . VAL C 3 108 ? 19.871  15.530  62.849  1.00 40.92  ? 108  VAL A CG1    1 
ATOM   2196 C CG2    . VAL C 3 108 ? 20.999  16.747  60.952  1.00 44.95  ? 108  VAL A CG2    1 
ATOM   2197 H H      . VAL C 3 108 ? 22.996  15.015  60.289  1.00 40.00  ? 108  VAL A H      1 
ATOM   2198 N N      . CYS C 3 109 ? 22.569  12.597  61.962  1.00 52.53  ? 109  CYS A N      1 
ATOM   2199 C CA     . CYS C 3 109 ? 22.572  11.191  62.372  1.00 55.21  ? 109  CYS A CA     1 
ATOM   2200 C C      . CYS C 3 109 ? 23.823  10.493  61.847  1.00 60.21  ? 109  CYS A C      1 
ATOM   2201 O O      . CYS C 3 109 ? 24.372  10.886  60.822  1.00 61.37  ? 109  CYS A O      1 
ATOM   2202 C CB     . CYS C 3 109 ? 21.362  10.448  61.786  1.00 53.90  ? 109  CYS A CB     1 
ATOM   2203 S SG     . CYS C 3 109 ? 19.710  11.159  62.045  1.00 50.78  ? 109  CYS A SG     1 
ATOM   2204 H H      . CYS C 3 109 ? 22.911  12.790  61.067  1.00 40.00  ? 109  CYS A H      1 
ATOM   2205 N N      . THR C 3 110 ? 24.243  9.440   62.545  1.00 62.17  ? 110  THR A N      1 
ATOM   2206 C CA     . THR C 3 110 ? 25.386  8.628   62.135  1.00 64.55  ? 110  THR A CA     1 
ATOM   2207 C C      . THR C 3 110 ? 24.774  7.386   61.469  1.00 67.35  ? 110  THR A C      1 
ATOM   2208 O O      . THR C 3 110 ? 23.564  7.146   61.604  1.00 68.06  ? 110  THR A O      1 
ATOM   2209 C CB     . THR C 3 110 ? 26.234  8.181   63.358  1.00 62.08  ? 110  THR A CB     1 
ATOM   2210 O OG1    . THR C 3 110 ? 25.511  7.232   64.155  1.00 66.58  ? 110  THR A OG1    1 
ATOM   2211 C CG2    . THR C 3 110 ? 26.578  9.374   64.218  1.00 65.54  ? 110  THR A CG2    1 
ATOM   2212 H H      . THR C 3 110 ? 23.790  9.148   63.363  1.00 40.00  ? 110  THR A H      1 
ATOM   2213 H HG1    . THR C 3 110 ? 25.505  6.338   63.790  1.00 40.00  ? 110  THR A HG1    1 
ATOM   2214 N N      . ASN C 3 111 ? 25.574  6.614   60.737  1.00 69.31  ? 111  ASN A N      1 
ATOM   2215 C CA     . ASN C 3 111 ? 25.051  5.412   60.095  1.00 68.45  ? 111  ASN A CA     1 
ATOM   2216 C C      . ASN C 3 111 ? 24.463  4.443   61.104  1.00 66.65  ? 111  ASN A C      1 
ATOM   2217 O O      . ASN C 3 111 ? 23.855  3.436   60.731  1.00 66.64  ? 111  ASN A O      1 
ATOM   2218 C CB     . ASN C 3 111 ? 26.131  4.706   59.274  1.00 71.70  ? 111  ASN A CB     1 
ATOM   2219 C CG     . ASN C 3 111 ? 26.426  5.412   57.966  1.00 75.53  ? 111  ASN A CG     1 
ATOM   2220 O OD1    . ASN C 3 111 ? 25.519  5.682   57.168  1.00 75.67  ? 111  ASN A OD1    1 
ATOM   2221 N ND2    . ASN C 3 111 ? 27.698  5.706   57.727  1.00 78.10  ? 111  ASN A ND2    1 
ATOM   2222 H H      . ASN C 3 111 ? 26.478  6.916   60.541  1.00 40.00  ? 111  ASN A H      1 
ATOM   2223 H HD21   . ASN C 3 111 ? 27.846  6.204   56.894  1.00 40.00  ? 111  ASN A HD21   1 
ATOM   2224 H HD22   . ASN C 3 111 ? 28.418  5.459   58.338  1.00 40.00  ? 111  ASN A HD22   1 
ATOM   2225 N N      . ASP C 3 112 ? 24.654  4.744   62.380  1.00 66.54  ? 112  ASP A N      1 
ATOM   2226 C CA     . ASP C 3 112 ? 24.139  3.902   63.450  1.00 68.07  ? 112  ASP A CA     1 
ATOM   2227 C C      . ASP C 3 112 ? 22.767  4.329   63.928  1.00 66.94  ? 112  ASP A C      1 
ATOM   2228 O O      . ASP C 3 112 ? 21.972  3.499   64.382  1.00 69.55  ? 112  ASP A O      1 
ATOM   2229 C CB     . ASP C 3 112 ? 25.113  3.882   64.619  1.00 71.34  ? 112  ASP A CB     1 
ATOM   2230 C CG     . ASP C 3 112 ? 26.472  3.345   64.220  1.00 76.29  ? 112  ASP A CG     1 
ATOM   2231 O OD1    . ASP C 3 112 ? 26.571  2.132   63.920  1.00 76.39  ? 112  ASP A OD1    1 
ATOM   2232 O OD2    . ASP C 3 112 ? 27.430  4.147   64.180  1.00 78.05  ? 112  ASP A OD2    1 
ATOM   2233 H H      . ASP C 3 112 ? 25.190  5.509   62.626  1.00 40.00  ? 112  ASP A H      1 
ATOM   2234 N N      . ASN C 3 113 ? 22.482  5.624   63.859  1.00 62.72  ? 113  ASN A N      1 
ATOM   2235 C CA     . ASN C 3 113 ? 21.166  6.080   64.296  1.00 59.61  ? 113  ASN A CA     1 
ATOM   2236 C C      . ASN C 3 113 ? 20.264  6.659   63.189  1.00 59.08  ? 113  ASN A C      1 
ATOM   2237 O O      . ASN C 3 113 ? 19.230  7.257   63.470  1.00 58.13  ? 113  ASN A O      1 
ATOM   2238 C CB     . ASN C 3 113 ? 21.284  7.020   65.516  1.00 56.59  ? 113  ASN A CB     1 
ATOM   2239 C CG     . ASN C 3 113 ? 22.097  8.270   65.235  1.00 55.76  ? 113  ASN A CG     1 
ATOM   2240 O OD1    . ASN C 3 113 ? 22.064  8.812   64.125  1.00 53.11  ? 113  ASN A OD1    1 
ATOM   2241 N ND2    . ASN C 3 113 ? 22.815  8.750   66.252  1.00 57.45  ? 113  ASN A ND2    1 
ATOM   2242 H H      . ASN C 3 113 ? 23.125  6.295   63.525  1.00 40.00  ? 113  ASN A H      1 
ATOM   2243 H HD21   . ASN C 3 113 ? 23.344  9.555   66.092  1.00 40.00  ? 113  ASN A HD21   1 
ATOM   2244 H HD22   . ASN C 3 113 ? 22.833  8.311   67.125  1.00 40.00  ? 113  ASN A HD22   1 
ATOM   2245 N N      . ILE C 3 114 ? 20.630  6.442   61.931  1.00 58.67  ? 114  ILE A N      1 
ATOM   2246 C CA     . ILE C 3 114 ? 19.822  6.953   60.838  1.00 56.17  ? 114  ILE A CA     1 
ATOM   2247 C C      . ILE C 3 114 ? 18.504  6.172   60.782  1.00 54.32  ? 114  ILE A C      1 
ATOM   2248 O O      . ILE C 3 114 ? 18.492  4.938   60.863  1.00 53.23  ? 114  ILE A O      1 
ATOM   2249 C CB     . ILE C 3 114 ? 20.538  6.845   59.469  1.00 56.90  ? 114  ILE A CB     1 
ATOM   2250 C CG1    . ILE C 3 114 ? 19.726  7.590   58.388  1.00 53.49  ? 114  ILE A CG1    1 
ATOM   2251 C CG2    . ILE C 3 114 ? 20.730  5.389   59.092  1.00 57.22  ? 114  ILE A CG2    1 
ATOM   2252 C CD1    . ILE C 3 114 ? 19.694  9.098   58.568  1.00 53.76  ? 114  ILE A CD1    1 
ATOM   2253 H H      . ILE C 3 114 ? 21.447  5.921   61.759  1.00 40.00  ? 114  ILE A H      1 
ATOM   2254 N N      . PRO C 3 115 ? 17.377  6.891   60.699  1.00 52.23  ? 115  PRO A N      1 
ATOM   2255 C CA     . PRO C 3 115 ? 16.069  6.236   60.643  1.00 49.47  ? 115  PRO A CA     1 
ATOM   2256 C C      . PRO C 3 115 ? 15.883  5.521   59.331  1.00 46.60  ? 115  PRO A C      1 
ATOM   2257 O O      . PRO C 3 115 ? 16.510  5.862   58.324  1.00 45.04  ? 115  PRO A O      1 
ATOM   2258 C CB     . PRO C 3 115 ? 15.086  7.408   60.712  1.00 48.22  ? 115  PRO A CB     1 
ATOM   2259 C CG     . PRO C 3 115 ? 15.871  8.502   61.351  1.00 48.53  ? 115  PRO A CG     1 
ATOM   2260 C CD     . PRO C 3 115 ? 17.221  8.354   60.726  1.00 50.01  ? 115  PRO A CD     1 
ATOM   2261 N N      . SER C 3 116 ? 15.016  4.520   59.352  1.00 46.10  ? 116  SER A N      1 
ATOM   2262 C CA     . SER C 3 116 ? 14.698  3.788   58.131  1.00 43.90  ? 116  SER A CA     1 
ATOM   2263 C C      . SER C 3 116 ? 13.769  4.748   57.388  1.00 44.01  ? 116  SER A C      1 
ATOM   2264 O O      . SER C 3 116 ? 13.132  5.630   58.018  1.00 42.07  ? 116  SER A O      1 
ATOM   2265 C CB     . SER C 3 116 ? 13.929  2.526   58.477  1.00 42.63  ? 116  SER A CB     1 
ATOM   2266 O OG     . SER C 3 116 ? 12.657  2.886   58.990  1.00 43.94  ? 116  SER A OG     1 
ATOM   2267 H H      . SER C 3 116 ? 14.670  4.175   60.194  1.00 40.00  ? 116  SER A H      1 
ATOM   2268 H HG     . SER C 3 116 ? 12.162  3.254   58.236  1.00 40.00  ? 116  SER A HG     1 
ATOM   2269 N N      . VAL C 3 117 ? 13.666  4.567   56.070  1.00 44.62  ? 117  VAL A N      1 
ATOM   2270 C CA     . VAL C 3 117 ? 12.806  5.410   55.247  1.00 42.41  ? 117  VAL A CA     1 
ATOM   2271 C C      . VAL C 3 117 ? 11.375  5.330   55.753  1.00 42.45  ? 117  VAL A C      1 
ATOM   2272 O O      . VAL C 3 117 ? 10.681  6.317   55.804  1.00 40.61  ? 117  VAL A O      1 
ATOM   2273 C CB     . VAL C 3 117 ? 12.895  4.967   53.762  1.00 43.08  ? 117  VAL A CB     1 
ATOM   2274 C CG1    . VAL C 3 117 ? 11.650  5.417   52.978  1.00 40.20  ? 117  VAL A CG1    1 
ATOM   2275 C CG2    . VAL C 3 117 ? 14.138  5.548   53.130  1.00 37.98  ? 117  VAL A CG2    1 
ATOM   2276 H H      . VAL C 3 117 ? 14.164  3.850   55.653  1.00 40.00  ? 117  VAL A H      1 
ATOM   2277 N N      . SER C 3 118 ? 10.994  4.122   56.158  1.00 41.37  ? 118  SER A N      1 
ATOM   2278 C CA     . SER C 3 118 ? 9.694   3.813   56.697  1.00 40.34  ? 118  SER A CA     1 
ATOM   2279 C C      . SER C 3 118 ? 9.440   4.718   57.888  1.00 39.76  ? 118  SER A C      1 
ATOM   2280 O O      . SER C 3 118 ? 8.407   5.381   57.974  1.00 36.51  ? 118  SER A O      1 
ATOM   2281 C CB     . SER C 3 118 ? 9.668   2.371   57.185  1.00 40.27  ? 118  SER A CB     1 
ATOM   2282 O OG     . SER C 3 118 ? 8.401   2.051   57.727  1.00 47.31  ? 118  SER A OG     1 
ATOM   2283 H H      . SER C 3 118 ? 11.620  3.385   56.098  1.00 40.00  ? 118  SER A H      1 
ATOM   2284 H HG     . SER C 3 118 ? 8.053   2.694   58.355  1.00 40.00  ? 118  SER A HG     1 
ATOM   2285 N N      . SER C 3 119 ? 10.391  4.730   58.810  1.00 38.40  ? 119  SER A N      1 
ATOM   2286 C CA     . SER C 3 119 ? 10.295  5.547   60.005  1.00 40.82  ? 119  SER A CA     1 
ATOM   2287 C C      . SER C 3 119 ? 10.205  7.009   59.632  1.00 41.02  ? 119  SER A C      1 
ATOM   2288 O O      . SER C 3 119 ? 9.435   7.744   60.221  1.00 40.33  ? 119  SER A O      1 
ATOM   2289 C CB     . SER C 3 119 ? 11.491  5.283   60.933  1.00 39.27  ? 119  SER A CB     1 
ATOM   2290 O OG     . SER C 3 119 ? 11.404  3.975   61.439  1.00 41.95  ? 119  SER A OG     1 
ATOM   2291 H H      . SER C 3 119 ? 11.148  4.126   58.690  1.00 40.00  ? 119  SER A H      1 
ATOM   2292 H HG     . SER C 3 119 ? 12.089  3.883   62.111  1.00 40.00  ? 119  SER A HG     1 
ATOM   2293 N N      . ILE C 3 120 ? 10.985  7.419   58.637  1.00 40.45  ? 120  ILE A N      1 
ATOM   2294 C CA     . ILE C 3 120 ? 10.958  8.797   58.163  1.00 38.30  ? 120  ILE A CA     1 
ATOM   2295 C C      . ILE C 3 120 ? 9.533   9.173   57.700  1.00 39.56  ? 120  ILE A C      1 
ATOM   2296 O O      . ILE C 3 120 ? 8.965   10.199  58.124  1.00 38.71  ? 120  ILE A O      1 
ATOM   2297 C CB     . ILE C 3 120 ? 11.984  9.018   57.021  1.00 35.65  ? 120  ILE A CB     1 
ATOM   2298 C CG1    . ILE C 3 120 ? 13.405  9.052   57.580  1.00 32.74  ? 120  ILE A CG1    1 
ATOM   2299 C CG2    . ILE C 3 120 ? 11.697  10.302  56.304  1.00 32.00  ? 120  ILE A CG2    1 
ATOM   2300 C CD1    . ILE C 3 120 ? 14.453  9.289   56.555  1.00 31.74  ? 120  ILE A CD1    1 
ATOM   2301 H H      . ILE C 3 120 ? 11.543  6.728   58.222  1.00 40.00  ? 120  ILE A H      1 
ATOM   2302 N N      . ASN C 3 121 ? 8.923   8.310   56.882  1.00 39.22  ? 121  ASN A N      1 
ATOM   2303 C CA     . ASN C 3 121 ? 7.569   8.603   56.414  1.00 41.14  ? 121  ASN A CA     1 
ATOM   2304 C C      . ASN C 3 121 ? 6.572   8.528   57.577  1.00 41.17  ? 121  ASN A C      1 
ATOM   2305 O O      . ASN C 3 121 ? 5.590   9.255   57.593  1.00 41.91  ? 121  ASN A O      1 
ATOM   2306 C CB     . ASN C 3 121 ? 7.177   7.699   55.243  1.00 40.17  ? 121  ASN A CB     1 
ATOM   2307 C CG     . ASN C 3 121 ? 7.847   8.106   53.943  1.00 41.53  ? 121  ASN A CG     1 
ATOM   2308 O OD1    . ASN C 3 121 ? 7.787   9.250   53.555  1.00 41.16  ? 121  ASN A OD1    1 
ATOM   2309 N ND2    . ASN C 3 121 ? 8.470   7.154   53.254  1.00 41.06  ? 121  ASN A ND2    1 
ATOM   2310 H H      . ASN C 3 121 ? 9.402   7.510   56.612  1.00 40.00  ? 121  ASN A H      1 
ATOM   2311 H HD21   . ASN C 3 121 ? 8.850   7.454   52.397  1.00 40.00  ? 121  ASN A HD21   1 
ATOM   2312 H HD22   . ASN C 3 121 ? 8.541   6.237   53.575  1.00 40.00  ? 121  ASN A HD22   1 
ATOM   2313 N N      . ARG C 3 122 ? 6.860   7.657   58.544  1.00 40.29  ? 122  ARG A N      1 
ATOM   2314 C CA     . ARG C 3 122 ? 6.025   7.524   59.721  1.00 37.23  ? 122  ARG A CA     1 
ATOM   2315 C C      . ARG C 3 122 ? 6.133   8.839   60.506  1.00 38.99  ? 122  ARG A C      1 
ATOM   2316 O O      . ARG C 3 122 ? 5.135   9.412   60.947  1.00 39.23  ? 122  ARG A O      1 
ATOM   2317 C CB     . ARG C 3 122 ? 6.469   6.337   60.583  1.00 37.64  ? 122  ARG A CB     1 
ATOM   2318 C CG     . ARG C 3 122 ? 5.743   6.210   61.924  1.00 37.30  ? 122  ARG A CG     1 
ATOM   2319 C CD     . ARG C 3 122 ? 6.109   4.921   62.595  1.00 42.32  ? 122  ARG A CD     1 
ATOM   2320 N NE     . ARG C 3 122 ? 7.557   4.723   62.721  1.00 40.66  ? 122  ARG A NE     1 
ATOM   2321 C CZ     . ARG C 3 122 ? 8.319   5.210   63.689  1.00 46.85  ? 122  ARG A CZ     1 
ATOM   2322 N NH1    . ARG C 3 122 ? 7.783   5.941   64.651  1.00 44.36  ? 122  ARG A NH1    1 
ATOM   2323 N NH2    . ARG C 3 122 ? 9.614   4.934   63.714  1.00 47.75  ? 122  ARG A NH2    1 
ATOM   2324 H H      . ARG C 3 122 ? 7.650   7.085   58.430  1.00 40.00  ? 122  ARG A H      1 
ATOM   2325 H HE     . ARG C 3 122 ? 8.049   4.093   62.165  1.00 40.00  ? 122  ARG A HE     1 
ATOM   2326 H HH11   . ARG C 3 122 ? 6.820   6.159   64.598  1.00 40.00  ? 122  ARG A HH11   1 
ATOM   2327 H HH12   . ARG C 3 122 ? 8.343   6.341   65.375  1.00 40.00  ? 122  ARG A HH12   1 
ATOM   2328 H HH21   . ARG C 3 122 ? 10.076  4.309   63.077  1.00 40.00  ? 122  ARG A HH21   1 
ATOM   2329 H HH22   . ARG C 3 122 ? 10.120  5.305   64.489  1.00 40.00  ? 122  ARG A HH22   1 
ATOM   2330 N N      . VAL C 3 123 ? 7.350   9.344   60.626  1.00 38.25  ? 123  VAL A N      1 
ATOM   2331 C CA     . VAL C 3 123 ? 7.570   10.596  61.304  1.00 37.12  ? 123  VAL A CA     1 
ATOM   2332 C C      . VAL C 3 123 ? 6.755   11.660  60.611  1.00 39.39  ? 123  VAL A C      1 
ATOM   2333 O O      . VAL C 3 123 ? 6.045   12.445  61.256  1.00 38.36  ? 123  VAL A O      1 
ATOM   2334 C CB     . VAL C 3 123 ? 9.055   10.993  61.310  1.00 37.58  ? 123  VAL A CB     1 
ATOM   2335 C CG1    . VAL C 3 123 ? 9.199   12.470  61.659  1.00 28.85  ? 123  VAL A CG1    1 
ATOM   2336 C CG2    . VAL C 3 123 ? 9.804   10.133  62.356  1.00 31.60  ? 123  VAL A CG2    1 
ATOM   2337 H H      . VAL C 3 123 ? 8.090   8.861   60.232  1.00 40.00  ? 123  VAL A H      1 
ATOM   2338 N N      . LEU C 3 124 ? 6.861   11.687  59.292  1.00 38.89  ? 124  LEU A N      1 
ATOM   2339 C CA     . LEU C 3 124 ? 6.141   12.659  58.480  1.00 38.35  ? 124  LEU A CA     1 
ATOM   2340 C C      . LEU C 3 124 ? 4.646   12.522  58.674  1.00 40.10  ? 124  LEU A C      1 
ATOM   2341 O O      . LEU C 3 124 ? 3.934   13.516  58.804  1.00 39.28  ? 124  LEU A O      1 
ATOM   2342 C CB     . LEU C 3 124 ? 6.525   12.512  56.988  1.00 39.43  ? 124  LEU A CB     1 
ATOM   2343 C CG     . LEU C 3 124 ? 7.869   13.152  56.649  1.00 38.14  ? 124  LEU A CG     1 
ATOM   2344 C CD1    . LEU C 3 124 ? 8.266   12.816  55.203  1.00 35.56  ? 124  LEU A CD1    1 
ATOM   2345 C CD2    . LEU C 3 124 ? 7.759   14.664  56.846  1.00 31.87  ? 124  LEU A CD2    1 
ATOM   2346 H H      . LEU C 3 124 ? 7.493   11.045  58.875  1.00 40.00  ? 124  LEU A H      1 
ATOM   2347 N N      . ARG C 3 125 ? 4.162   11.296  58.753  1.00 38.91  ? 125  ARG A N      1 
ATOM   2348 C CA     . ARG C 3 125 ? 2.727   11.127  58.933  1.00 40.74  ? 125  ARG A CA     1 
ATOM   2349 C C      . ARG C 3 125 ? 2.310   11.605  60.310  1.00 43.99  ? 125  ARG A C      1 
ATOM   2350 O O      . ARG C 3 125 ? 1.307   12.316  60.462  1.00 42.88  ? 125  ARG A O      1 
ATOM   2351 C CB     . ARG C 3 125 ? 2.270   9.686   58.691  1.00 38.28  ? 125  ARG A CB     1 
ATOM   2352 C CG     . ARG C 3 125 ? 2.188   9.338   57.219  1.00 44.57  ? 125  ARG A CG     1 
ATOM   2353 C CD     . ARG C 3 125 ? 1.483   8.024   57.031  1.00 40.77  ? 125  ARG A CD     1 
ATOM   2354 N NE     . ARG C 3 125 ? 1.910   7.051   58.025  1.00 38.81  ? 125  ARG A NE     1 
ATOM   2355 C CZ     . ARG C 3 125 ? 2.940   6.223   57.879  1.00 32.84  ? 125  ARG A CZ     1 
ATOM   2356 N NH1    . ARG C 3 125 ? 3.667   6.248   56.763  1.00 32.45  ? 125  ARG A NH1    1 
ATOM   2357 N NH2    . ARG C 3 125 ? 3.263   5.383   58.861  1.00 37.10  ? 125  ARG A NH2    1 
ATOM   2358 H H      . ARG C 3 125 ? 4.798   10.559  58.701  1.00 40.00  ? 125  ARG A H      1 
ATOM   2359 H HE     . ARG C 3 125 ? 1.400   7.052   58.854  1.00 40.00  ? 125  ARG A HE     1 
ATOM   2360 H HH11   . ARG C 3 125 ? 3.491   6.832   55.990  1.00 40.00  ? 125  ARG A HH11   1 
ATOM   2361 H HH12   . ARG C 3 125 ? 4.414   5.578   56.700  1.00 40.00  ? 125  ARG A HH12   1 
ATOM   2362 H HH21   . ARG C 3 125 ? 2.723   5.368   59.702  1.00 40.00  ? 125  ARG A HH21   1 
ATOM   2363 H HH22   . ARG C 3 125 ? 4.034   4.778   58.721  1.00 40.00  ? 125  ARG A HH22   1 
ATOM   2364 N N      . ASN C 3 126 ? 3.128   11.271  61.307  1.00 44.54  ? 126  ASN A N      1 
ATOM   2365 C CA     . ASN C 3 126 ? 2.853   11.672  62.684  1.00 41.55  ? 126  ASN A CA     1 
ATOM   2366 C C      . ASN C 3 126 ? 2.774   13.196  62.771  1.00 41.83  ? 126  ASN A C      1 
ATOM   2367 O O      . ASN C 3 126 ? 1.893   13.736  63.431  1.00 43.30  ? 126  ASN A O      1 
ATOM   2368 C CB     . ASN C 3 126 ? 3.930   11.140  63.640  1.00 40.50  ? 126  ASN A CB     1 
ATOM   2369 C CG     . ASN C 3 126 ? 3.845   9.651   63.838  1.00 41.13  ? 126  ASN A CG     1 
ATOM   2370 O OD1    . ASN C 3 126 ? 2.816   9.033   63.550  1.00 37.32  ? 126  ASN A OD1    1 
ATOM   2371 N ND2    . ASN C 3 126 ? 4.935   9.042   64.301  1.00 46.40  ? 126  ASN A ND2    1 
ATOM   2372 H H      . ASN C 3 126 ? 3.942   10.753  61.111  1.00 40.00  ? 126  ASN A H      1 
ATOM   2373 H HD21   . ASN C 3 126 ? 4.751   8.088   64.449  1.00 40.00  ? 126  ASN A HD21   1 
ATOM   2374 H HD22   . ASN C 3 126 ? 5.819   9.416   64.497  1.00 40.00  ? 126  ASN A HD22   1 
ATOM   2375 N N      . LEU C 3 127 ? 3.677   13.891  62.087  1.00 38.72  ? 127  LEU A N      1 
ATOM   2376 C CA     . LEU C 3 127 ? 3.637   15.355  62.098  1.00 42.72  ? 127  LEU A CA     1 
ATOM   2377 C C      . LEU C 3 127 ? 2.376   15.911  61.436  1.00 46.87  ? 127  LEU A C      1 
ATOM   2378 O O      . LEU C 3 127 ? 1.830   16.914  61.886  1.00 46.61  ? 127  LEU A O      1 
ATOM   2379 C CB     . LEU C 3 127 ? 4.857   15.929  61.383  1.00 44.56  ? 127  LEU A CB     1 
ATOM   2380 C CG     . LEU C 3 127 ? 6.197   15.774  62.112  1.00 48.96  ? 127  LEU A CG     1 
ATOM   2381 C CD1    . LEU C 3 127 ? 7.336   15.983  61.137  1.00 49.33  ? 127  LEU A CD1    1 
ATOM   2382 C CD2    . LEU C 3 127 ? 6.291   16.729  63.259  1.00 46.10  ? 127  LEU A CD2    1 
ATOM   2383 H H      . LEU C 3 127 ? 4.376   13.430  61.591  1.00 40.00  ? 127  LEU A H      1 
ATOM   2384 N N      . ALA C 3 128 ? 1.977   15.278  60.333  1.00 49.50  ? 128  ALA A N      1 
ATOM   2385 C CA     . ALA C 3 128 ? 0.803   15.679  59.565  1.00 49.07  ? 128  ALA A CA     1 
ATOM   2386 C C      . ALA C 3 128 ? -0.482  15.734  60.378  1.00 48.81  ? 128  ALA A C      1 
ATOM   2387 O O      . ALA C 3 128 ? -1.200  16.740  60.361  1.00 45.71  ? 128  ALA A O      1 
ATOM   2388 C CB     . ALA C 3 128 ? 0.620   14.780  58.386  1.00 47.99  ? 128  ALA A CB     1 
ATOM   2389 H H      . ALA C 3 128 ? 2.501   14.492  60.041  1.00 40.00  ? 128  ALA A H      1 
ATOM   2390 N N      . SER C 3 129 ? -0.765  14.656  61.095  1.00 48.54  ? 129  SER A N      1 
ATOM   2391 C CA     . SER C 3 129 ? -1.964  14.600  61.907  1.00 52.50  ? 129  SER A CA     1 
ATOM   2392 C C      . SER C 3 129 ? -1.791  15.471  63.127  1.00 54.39  ? 129  SER A C      1 
ATOM   2393 O O      . SER C 3 129 ? -2.734  16.116  63.559  1.00 56.90  ? 129  SER A O      1 
ATOM   2394 C CB     . SER C 3 129 ? -2.314  13.154  62.309  1.00 51.45  ? 129  SER A CB     1 
ATOM   2395 O OG     . SER C 3 129 ? -1.201  12.482  62.895  1.00 60.43  ? 129  SER A OG     1 
ATOM   2396 H H      . SER C 3 129 ? -0.118  13.909  61.138  1.00 40.00  ? 129  SER A H      1 
ATOM   2397 H HG     . SER C 3 129 ? -1.501  11.592  63.111  1.00 40.00  ? 129  SER A HG     1 
ATOM   2398 N N      . GLU C 3 130 ? -0.576  15.524  63.658  1.00 56.83  ? 130  GLU A N      1 
ATOM   2399 C CA     . GLU C 3 130 ? -0.290  16.344  64.816  1.00 58.57  ? 130  GLU A CA     1 
ATOM   2400 C C      . GLU C 3 130 ? -0.791  17.750  64.604  1.00 56.19  ? 130  GLU A C      1 
ATOM   2401 O O      . GLU C 3 130 ? -1.413  18.315  65.504  1.00 56.42  ? 130  GLU A O      1 
ATOM   2402 C CB     . GLU C 3 130 ? 1.203   16.425  65.026  1.00 62.66  ? 130  GLU A CB     1 
ATOM   2403 C CG     . GLU C 3 130 ? 1.680   16.304  66.432  1.00 64.27  ? 130  GLU A CG     1 
ATOM   2404 C CD     . GLU C 3 130 ? 3.181   16.277  66.441  1.00 64.36  ? 130  GLU A CD     1 
ATOM   2405 O OE1    . GLU C 3 130 ? 3.776   17.147  65.779  1.00 59.54  ? 130  GLU A OE1    1 
ATOM   2406 O OE2    . GLU C 3 130 ? 3.770   15.360  67.050  1.00 69.13  ? 130  GLU A OE2    1 
ATOM   2407 H H      . GLU C 3 130 ? 0.160   14.970  63.296  1.00 40.00  ? 130  GLU A H      1 
ATOM   2408 N N      . LYS C 3 131 ? -0.542  18.319  63.423  1.00 56.57  ? 131  LYS A N      1 
ATOM   2409 C CA     . LYS C 3 131 ? -1.003  19.674  63.201  1.00 62.13  ? 131  LYS A CA     1 
ATOM   2410 C C      . LYS C 3 131 ? -2.460  19.785  62.774  1.00 65.39  ? 131  LYS A C      1 
ATOM   2411 O O      . LYS C 3 131 ? -2.977  20.885  62.550  1.00 64.31  ? 131  LYS A O      1 
ATOM   2412 C CB     . LYS C 3 131 ? -0.046  20.500  62.341  1.00 66.78  ? 131  LYS A CB     1 
ATOM   2413 C CG     . LYS C 3 131 ? 0.110   20.152  60.882  1.00 73.97  ? 131  LYS A CG     1 
ATOM   2414 C CD     . LYS C 3 131 ? 0.531   21.440  60.152  1.00 78.52  ? 131  LYS A CD     1 
ATOM   2415 C CE     . LYS C 3 131 ? 1.109   21.214  58.763  1.00 82.35  ? 131  LYS A CE     1 
ATOM   2416 N NZ     . LYS C 3 131 ? 0.993   22.440  57.896  1.00 82.03  ? 131  LYS A NZ     1 
ATOM   2417 H H      . LYS C 3 131 ? -0.105  17.811  62.701  1.00 40.00  ? 131  LYS A H      1 
ATOM   2418 H HZ1    . LYS C 3 131 ? 1.435   23.296  58.297  1.00 40.00  ? 131  LYS A HZ1    1 
ATOM   2419 H HZ2    . LYS C 3 131 ? 1.495   22.193  57.024  1.00 40.00  ? 131  LYS A HZ2    1 
ATOM   2420 H HZ3    . LYS C 3 131 ? -0.006  22.620  57.643  1.00 40.00  ? 131  LYS A HZ3    1 
ATOM   2421 N N      . GLN C 3 132 ? -3.124  18.637  62.671  1.00 67.57  ? 132  GLN A N      1 
ATOM   2422 C CA     . GLN C 3 132 ? -4.544  18.617  62.371  1.00 66.86  ? 132  GLN A CA     1 
ATOM   2423 C C      . GLN C 3 132 ? -5.231  18.734  63.731  1.00 69.56  ? 132  GLN A C      1 
ATOM   2424 O O      . GLN C 3 132 ? -6.251  19.420  63.861  1.00 71.66  ? 132  GLN A O      1 
ATOM   2425 C CB     . GLN C 3 132 ? -4.950  17.325  61.656  1.00 62.00  ? 132  GLN A CB     1 
ATOM   2426 C CG     . GLN C 3 132 ? -4.639  17.339  60.172  1.00 59.80  ? 132  GLN A CG     1 
ATOM   2427 C CD     . GLN C 3 132 ? -5.233  16.138  59.439  1.00 59.51  ? 132  GLN A CD     1 
ATOM   2428 O OE1    . GLN C 3 132 ? -5.321  15.023  59.986  1.00 57.20  ? 132  GLN A OE1    1 
ATOM   2429 N NE2    . GLN C 3 132 ? -5.670  16.366  58.204  1.00 60.29  ? 132  GLN A NE2    1 
ATOM   2430 H H      . GLN C 3 132 ? -2.607  17.815  62.753  1.00 40.00  ? 132  GLN A H      1 
ATOM   2431 H HE21   . GLN C 3 132 ? -6.077  15.606  57.729  1.00 40.00  ? 132  GLN A HE21   1 
ATOM   2432 H HE22   . GLN C 3 132 ? -5.611  17.254  57.813  1.00 40.00  ? 132  GLN A HE22   1 
ATOM   2433 N N      . GLN C 3 133 ? -4.646  18.086  64.743  1.00 69.65  ? 133  GLN A N      1 
ATOM   2434 C CA     . GLN C 3 133 ? -5.154  18.121  66.116  1.00 71.59  ? 133  GLN A CA     1 
ATOM   2435 C C      . GLN C 3 133 ? -5.665  19.511  66.515  1.00 74.14  ? 133  GLN A C      1 
ATOM   2436 O O      . GLN C 3 133 ? -5.424  19.973  67.634  1.00 77.99  ? 133  GLN A O      1 
ATOM   2437 C CB     . GLN C 3 133 ? -4.035  17.735  67.076  1.00 75.05  ? 133  GLN A CB     1 
ATOM   2438 C CG     . GLN C 3 133 ? -4.334  16.515  67.898  1.00 84.35  ? 133  GLN A CG     1 
ATOM   2439 C CD     . GLN C 3 133 ? -4.270  15.256  67.072  1.00 92.34  ? 133  GLN A CD     1 
ATOM   2440 O OE1    . GLN C 3 133 ? -4.911  15.151  66.021  1.00 93.91  ? 133  GLN A OE1    1 
ATOM   2441 N NE2    . GLN C 3 133 ? -3.475  14.292  67.529  1.00 95.80  ? 133  GLN A NE2    1 
ATOM   2442 H H      . GLN C 3 133 ? -3.893  17.489  64.581  1.00 40.00  ? 133  GLN A H      1 
ATOM   2443 H HE21   . GLN C 3 133 ? -3.437  13.483  66.979  1.00 40.00  ? 133  GLN A HE21   1 
ATOM   2444 H HE22   . GLN C 3 133 ? -2.973  14.394  68.367  1.00 40.00  ? 133  GLN A HE22   1 
HETATM 2445 O O      . HOH D 4 .   ? 14.654  -11.989 87.115  1.00 62.55  ? 703  HOH B O      1 
HETATM 2446 O O      . HOH D 4 .   ? 7.368   -12.031 90.578  1.00 58.91  ? 715  HOH B O      1 
HETATM 2447 O O      . HOH D 4 .   ? 3.117   -0.167  107.068 1.00 43.09  ? 737  HOH B O      1 
HETATM 2448 O O      . HOH D 4 .   ? 2.881   0.526   68.291  1.00 48.34  ? 756  HOH B O      1 
HETATM 2449 O O      . HOH D 4 .   ? 4.996   1.429   60.384  1.00 39.89  ? 778  HOH B O      1 
HETATM 2450 O O      . HOH D 4 .   ? 18.761  -7.116  126.354 1.00 51.17  ? 788  HOH B O      1 
HETATM 2451 O O      . HOH D 4 .   ? 19.152  -4.016  128.214 1.00 61.83  ? 789  HOH B O      1 
HETATM 2452 O O      . HOH D 4 .   ? 11.472  1.930   98.284  1.00 46.79  ? 795  HOH B O      1 
HETATM 2453 O O      . HOH D 4 .   ? 13.511  1.455   96.407  1.00 45.85  ? 796  HOH B O      1 
HETATM 2454 O O      . HOH D 4 .   ? 17.165  4.853   96.290  1.00 60.16  ? 797  HOH B O      1 
HETATM 2455 O O      . HOH D 4 .   ? 15.338  -4.347  101.249 1.00 62.86  ? 799  HOH B O      1 
HETATM 2456 O O      . HOH D 4 .   ? 14.130  -8.429  87.430  1.00 44.42  ? 800  HOH B O      1 
HETATM 2457 O O      . HOH D 4 .   ? 12.142  -2.216  93.553  1.00 38.33  ? 803  HOH B O      1 
HETATM 2458 O O      . HOH D 4 .   ? 10.188  -18.502 89.496  1.00 59.28  ? 810  HOH B O      1 
HETATM 2459 O O      . HOH D 4 .   ? 0.840   0.631   81.092  1.00 50.31  ? 811  HOH B O      1 
HETATM 2460 O O      . HOH E 4 .   ? 1.445   -16.031 97.804  1.00 47.21  ? 704  HOH C O      1 
HETATM 2461 O O      . HOH E 4 .   ? 13.304  -14.175 68.514  1.00 65.32  ? 709  HOH C O      1 
HETATM 2462 O O      . HOH E 4 .   ? -3.377  -7.325  96.277  1.00 49.43  ? 710  HOH C O      1 
HETATM 2463 O O      . HOH E 4 .   ? 3.548   -7.321  90.268  1.00 32.83  ? 713  HOH C O      1 
HETATM 2464 O O      . HOH E 4 .   ? 4.590   -9.270  92.472  1.00 39.09  ? 714  HOH C O      1 
HETATM 2465 O O      . HOH E 4 .   ? 6.196   -1.073  91.743  1.00 54.63  ? 722  HOH C O      1 
HETATM 2466 O O      . HOH E 4 .   ? 8.985   -1.748  92.738  1.00 39.05  ? 723  HOH C O      1 
HETATM 2467 O O      . HOH E 4 .   ? 4.431   -1.627  94.929  1.00 40.05  ? 724  HOH C O      1 
HETATM 2468 O O      . HOH E 4 .   ? 7.133   -1.967  95.398  1.00 36.66  ? 725  HOH C O      1 
HETATM 2469 O O      . HOH E 4 .   ? 6.362   0.638   115.554 1.00 57.78  ? 740  HOH C O      1 
HETATM 2470 O O      . HOH E 4 .   ? 5.011   -5.875  101.563 1.00 40.43  ? 742  HOH C O      1 
HETATM 2471 O O      . HOH E 4 .   ? 3.138   5.471   116.511 1.00 50.80  ? 763  HOH C O      1 
HETATM 2472 O O      . HOH E 4 .   ? 6.809   12.312  48.428  1.00 50.61  ? 767  HOH C O      1 
HETATM 2473 O O      . HOH E 4 .   ? 2.921   12.773  55.298  1.00 51.48  ? 768  HOH C O      1 
HETATM 2474 O O      . HOH E 4 .   ? 4.398   10.525  55.318  1.00 40.59  ? 769  HOH C O      1 
HETATM 2475 O O      . HOH E 4 .   ? 11.703  7.936   49.390  1.00 38.08  ? 770  HOH C O      1 
HETATM 2476 O O      . HOH E 4 .   ? 13.152  5.883   49.316  1.00 39.75  ? 771  HOH C O      1 
HETATM 2477 O O      . HOH E 4 .   ? 11.950  4.310   46.499  1.00 44.08  ? 772  HOH C O      1 
HETATM 2478 O O      . HOH E 4 .   ? 6.778   4.496   53.435  1.00 48.25  ? 775  HOH C O      1 
HETATM 2479 O O      . HOH E 4 .   ? 0.241   12.297  56.109  1.00 46.28  ? 784  HOH C O      1 
HETATM 2480 O O      . HOH E 4 .   ? 13.002  -8.278  109.825 1.00 48.71  ? 790  HOH C O      1 
HETATM 2481 O O      . HOH E 4 .   ? 8.871   1.828   112.432 1.00 37.40  ? 791  HOH C O      1 
HETATM 2482 O O      . HOH E 4 .   ? 12.099  1.207   109.011 1.00 41.54  ? 792  HOH C O      1 
HETATM 2483 O O      . HOH E 4 .   ? 14.763  -0.731  106.126 1.00 41.60  ? 793  HOH C O      1 
HETATM 2484 O O      . HOH E 4 .   ? 13.004  -4.754  86.493  1.00 51.19  ? 801  HOH C O      1 
HETATM 2485 O O      . HOH E 4 .   ? 11.298  -1.484  89.490  1.00 43.84  ? 802  HOH C O      1 
HETATM 2486 O O      . HOH E 4 .   ? 9.873   -7.849  63.296  1.00 51.25  ? 806  HOH C O      1 
HETATM 2487 O O      . HOH E 4 .   ? 0.340   4.508   49.300  1.00 48.42  ? 807  HOH C O      1 
HETATM 2488 O O      . HOH E 4 .   ? 12.984  6.241   79.206  1.00 60.88  ? 814  HOH C O      1 
HETATM 2489 O O      . HOH F 4 .   ? 0.624   -12.078 85.663  1.00 53.63  ? 701  HOH A O      1 
HETATM 2490 O O      . HOH F 4 .   ? -0.092  -14.648 83.695  1.00 53.08  ? 702  HOH A O      1 
HETATM 2491 O O      . HOH F 4 .   ? 2.727   -7.479  103.454 1.00 61.78  ? 707  HOH A O      1 
HETATM 2492 O O      . HOH F 4 .   ? -2.213  -6.265  90.238  1.00 55.21  ? 711  HOH A O      1 
HETATM 2493 O O      . HOH F 4 .   ? 3.469   -5.377  82.962  1.00 47.30  ? 716  HOH A O      1 
HETATM 2494 O O      . HOH F 4 .   ? -4.498  0.674   88.229  1.00 40.84  ? 717  HOH A O      1 
HETATM 2495 O O      . HOH F 4 .   ? 4.798   2.837   77.696  1.00 51.80  ? 718  HOH A O      1 
HETATM 2496 O O      . HOH F 4 .   ? 7.454   2.632   80.785  1.00 49.49  ? 720  HOH A O      1 
HETATM 2497 O O      . HOH F 4 .   ? 2.226   2.124   91.405  1.00 41.75  ? 721  HOH A O      1 
HETATM 2498 O O      . HOH F 4 .   ? 7.240   -0.438  97.588  1.00 30.55  ? 726  HOH A O      1 
HETATM 2499 O O      . HOH F 4 .   ? 8.348   2.665   97.554  1.00 66.93  ? 727  HOH A O      1 
HETATM 2500 O O      . HOH F 4 .   ? -10.923 -0.317  89.098  1.00 39.94  ? 729  HOH A O      1 
HETATM 2501 O O      . HOH F 4 .   ? -8.079  -0.319  87.169  1.00 70.46  ? 730  HOH A O      1 
HETATM 2502 O O      . HOH F 4 .   ? -11.497 -3.354  94.033  1.00 60.73  ? 731  HOH A O      1 
HETATM 2503 O O      . HOH F 4 .   ? -0.242  6.727   93.619  1.00 40.47  ? 732  HOH A O      1 
HETATM 2504 O O      . HOH F 4 .   ? 0.329   5.243   91.763  1.00 39.56  ? 733  HOH A O      1 
HETATM 2505 O O      . HOH F 4 .   ? -1.232  8.398   105.310 1.00 48.63  ? 736  HOH A O      1 
HETATM 2506 O O      . HOH F 4 .   ? -3.345  -2.974  111.739 1.00 51.73  ? 738  HOH A O      1 
HETATM 2507 O O      . HOH F 4 .   ? 2.680   -0.040  104.161 1.00 58.80  ? 745  HOH A O      1 
HETATM 2508 O O      . HOH F 4 .   ? 6.226   6.115   96.334  1.00 48.16  ? 746  HOH A O      1 
HETATM 2509 O O      . HOH F 4 .   ? 4.468   5.847   101.860 1.00 43.50  ? 747  HOH A O      1 
HETATM 2510 O O      . HOH F 4 .   ? 3.878   8.691   102.397 1.00 35.16  ? 748  HOH A O      1 
HETATM 2511 O O      . HOH F 4 .   ? 17.169  15.194  70.271  1.00 58.52  ? 750  HOH A O      1 
HETATM 2512 O O      . HOH F 4 .   ? -1.347  14.680  97.769  1.00 56.05  ? 751  HOH A O      1 
HETATM 2513 O O      . HOH F 4 .   ? 20.183  15.372  69.574  1.00 43.34  ? 752  HOH A O      1 
HETATM 2514 O O      . HOH F 4 .   ? -5.227  9.998   90.053  1.00 43.22  ? 753  HOH A O      1 
HETATM 2515 O O      . HOH F 4 .   ? 5.389   6.478   65.469  1.00 51.32  ? 757  HOH A O      1 
HETATM 2516 O O      . HOH F 4 .   ? 13.030  -1.570  67.435  1.00 52.06  ? 758  HOH A O      1 
HETATM 2517 O O      . HOH F 4 .   ? 10.793  12.517  69.339  1.00 58.40  ? 760  HOH A O      1 
HETATM 2518 O O      . HOH F 4 .   ? 8.429   13.762  51.875  1.00 39.03  ? 765  HOH A O      1 
HETATM 2519 O O      . HOH F 4 .   ? 7.424   11.271  52.184  1.00 41.28  ? 766  HOH A O      1 
HETATM 2520 O O      . HOH F 4 .   ? 11.912  1.584   54.890  1.00 47.91  ? 773  HOH A O      1 
HETATM 2521 O O      . HOH F 4 .   ? 15.518  2.382   54.906  1.00 50.75  ? 774  HOH A O      1 
HETATM 2522 O O      . HOH F 4 .   ? 8.024   3.245   60.645  1.00 42.53  ? 777  HOH A O      1 
HETATM 2523 O O      . HOH F 4 .   ? 6.137   3.426   58.724  1.00 61.24  ? 779  HOH A O      1 
HETATM 2524 O O      . HOH F 4 .   ? 5.980   4.872   56.589  1.00 46.05  ? 780  HOH A O      1 
HETATM 2525 O O      . HOH F 4 .   ? 2.343   12.623  66.483  1.00 54.30  ? 781  HOH A O      1 
HETATM 2526 O O      . HOH F 4 .   ? 7.305   11.037  65.357  1.00 36.26  ? 782  HOH A O      1 
HETATM 2527 O O      . HOH F 4 .   ? -0.094  9.277   62.798  1.00 48.06  ? 785  HOH A O      1 
HETATM 2528 O O      . HOH F 4 .   ? -5.274  12.604  60.843  1.00 52.20  ? 786  HOH A O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1001 1001 DA  A   B . n 
A 1 2   DA  2   1002 1002 DA  A   B . n 
A 1 3   DG  3   1003 1003 DG  G   B . n 
A 1 4   DC  4   1004 1004 DC  C   B . n 
A 1 5   DA  5   1005 1005 DA  A   B . n 
A 1 6   DT  6   1006 1006 DT  T   B . n 
A 1 7   DT  7   1007 1007 DT  T   B . n 
A 1 8   DT  8   1008 1008 DT  T   B . n 
A 1 9   DT  9   1009 1009 DT  T   B . n 
A 1 10  DC  10  1010 1010 DC  C   B . n 
A 1 11  DA  11  1011 1011 DA  A   B . n 
A 1 12  DC  12  1012 1012 DC  C   B . n 
A 1 13  DG  13  1013 1013 DG  G   B . n 
A 1 14  DC  14  1014 1014 DC  C   B . n 
A 1 15  DA  15  1015 1015 DA  A   B . n 
A 1 16  DT  16  1016 1016 DT  T   B . n 
A 1 17  DG  17  1017 1017 DG  G   B . n 
A 1 18  DA  18  1018 1018 DA  A   B . n 
A 1 19  DG  19  1019 1019 DG  G   B . n 
A 1 20  DT  20  1020 1020 DT  T   B . n 
A 1 21  DG  21  1021 1021 DG  G   B . n 
A 1 22  DC  22  1022 1022 DC  C   B . n 
A 1 23  DA  23  1023 1023 DA  A   B . n 
A 1 24  DC  24  1024 1024 DC  C   B . n 
A 1 25  DA  25  1025 1025 DA  A   B . n 
A 1 26  DG  26  1026 1026 DG  G   B . n 
B 2 1   DT  1   2001 2001 DT  T   C . n 
B 2 2   DT  2   2002 2002 DT  T   C . n 
B 2 3   DC  3   2003 2003 DC  C   C . n 
B 2 4   DT  4   2004 2004 DT  T   C . n 
B 2 5   DG  5   2005 2005 DG  G   C . n 
B 2 6   DT  6   2006 2006 DT  T   C . n 
B 2 7   DG  7   2007 2007 DG  G   C . n 
B 2 8   DC  8   2008 2008 DC  C   C . n 
B 2 9   DA  9   2009 2009 DA  A   C . n 
B 2 10  DC  10  2010 2010 DC  C   C . n 
B 2 11  DT  11  2011 2011 DT  T   C . n 
B 2 12  DC  12  2012 2012 DC  C   C . n 
B 2 13  DA  13  2013 2013 DA  A   C . n 
B 2 14  DT  14  2014 2014 DT  T   C . n 
B 2 15  DG  15  2015 2015 DG  G   C . n 
B 2 16  DC  16  2016 2016 DC  C   C . n 
B 2 17  DG  17  2017 2017 DG  G   C . n 
B 2 18  DT  18  2018 2018 DT  T   C . n 
B 2 19  DG  19  2019 2019 DG  G   C . n 
B 2 20  DA  20  2020 2020 DA  A   C . n 
B 2 21  DA  21  2021 2021 DA  A   C . n 
B 2 22  DA  22  2022 2022 DA  A   C . n 
B 2 23  DA  23  2023 2023 DA  A   C . n 
B 2 24  DT  24  2024 2024 DT  T   C . n 
B 2 25  DG  25  2025 2025 DG  G   C . n 
B 2 26  DC  26  2026 2026 DC  C   C . n 
C 3 1   SER 1   1    1    SER SER A . n 
C 3 2   HIS 2   2    2    HIS HIS A . n 
C 3 3   SER 3   3    3    SER SER A . n 
C 3 4   GLY 4   4    4    GLY GLY A . n 
C 3 5   VAL 5   5    5    VAL VAL A . n 
C 3 6   ASN 6   6    6    ASN ASN A . n 
C 3 7   GLN 7   7    7    GLN GLN A . n 
C 3 8   LEU 8   8    8    LEU LEU A . n 
C 3 9   GLY 9   9    9    GLY GLY A . n 
C 3 10  GLY 10  10   10   GLY GLY A . n 
C 3 11  VAL 11  11   11   VAL VAL A . n 
C 3 12  PHE 12  12   12   PHE PHE A . n 
C 3 13  VAL 13  13   13   VAL VAL A . n 
C 3 14  ASN 14  14   14   ASN ASN A . n 
C 3 15  GLY 15  15   15   GLY GLY A . n 
C 3 16  ARG 16  16   16   ARG ARG A . n 
C 3 17  PRO 17  17   17   PRO PRO A . n 
C 3 18  LEU 18  18   18   LEU LEU A . n 
C 3 19  PRO 19  19   19   PRO PRO A . n 
C 3 20  ASP 20  20   20   ASP ASP A . n 
C 3 21  SER 21  21   21   SER SER A . n 
C 3 22  THR 22  22   22   THR THR A . n 
C 3 23  ARG 23  23   23   ARG ARG A . n 
C 3 24  GLN 24  24   24   GLN GLN A . n 
C 3 25  ARG 25  25   25   ARG ARG A . n 
C 3 26  ILE 26  26   26   ILE ILE A . n 
C 3 27  VAL 27  27   27   VAL VAL A . n 
C 3 28  GLU 28  28   28   GLU GLU A . n 
C 3 29  LEU 29  29   29   LEU LEU A . n 
C 3 30  ALA 30  30   30   ALA ALA A . n 
C 3 31  HIS 31  31   31   HIS HIS A . n 
C 3 32  SER 32  32   32   SER SER A . n 
C 3 33  GLY 33  33   33   GLY GLY A . n 
C 3 34  ALA 34  34   34   ALA ALA A . n 
C 3 35  ARG 35  35   35   ARG ARG A . n 
C 3 36  PRO 36  36   36   PRO PRO A . n 
C 3 37  CYS 37  37   37   CYS CYS A . n 
C 3 38  ASP 38  38   38   ASP ASP A . n 
C 3 39  ILE 39  39   39   ILE ILE A . n 
C 3 40  SER 40  40   40   SER SER A . n 
C 3 41  ARG 41  41   41   ARG ARG A . n 
C 3 42  ILE 42  42   42   ILE ILE A . n 
C 3 43  LEU 43  43   43   LEU LEU A . n 
C 3 44  GLN 44  44   44   GLN GLN A . n 
C 3 45  VAL 45  45   45   VAL VAL A . n 
C 3 46  SER 46  46   46   SER SER A . n 
C 3 47  ASN 47  47   47   ASN ASN A . n 
C 3 48  GLY 48  48   48   GLY GLY A . n 
C 3 49  CYS 49  49   49   CYS CYS A . n 
C 3 50  VAL 50  50   50   VAL VAL A . n 
C 3 51  SER 51  51   51   SER SER A . n 
C 3 52  LYS 52  52   52   LYS LYS A . n 
C 3 53  ILE 53  53   53   ILE ILE A . n 
C 3 54  LEU 54  54   54   LEU LEU A . n 
C 3 55  GLY 55  55   55   GLY GLY A . n 
C 3 56  ARG 56  56   56   ARG ARG A . n 
C 3 57  TYR 57  57   57   TYR TYR A . n 
C 3 58  TYR 58  58   58   TYR TYR A . n 
C 3 59  ALA 59  59   59   ALA ALA A . n 
C 3 60  THR 60  60   60   THR THR A . n 
C 3 61  GLY 61  61   61   GLY GLY A . n 
C 3 62  SER 62  62   62   SER SER A . n 
C 3 63  ILE 63  63   63   ILE ILE A . n 
C 3 64  ARG 64  64   64   ARG ARG A . n 
C 3 65  PRO 65  65   65   PRO PRO A . n 
C 3 66  ARG 66  66   66   ARG ARG A . n 
C 3 67  ALA 67  67   67   ALA ALA A . n 
C 3 68  ILE 68  68   68   ILE ILE A . n 
C 3 69  GLY 69  69   69   GLY GLY A . n 
C 3 70  GLY 70  70   70   GLY GLY A . n 
C 3 71  SER 71  71   71   SER SER A . n 
C 3 72  LYS 72  72   72   LYS LYS A . n 
C 3 73  PRO 73  73   73   PRO PRO A . n 
C 3 74  ARG 74  74   74   ARG ARG A . n 
C 3 75  VAL 75  75   75   VAL VAL A . n 
C 3 76  ALA 76  76   76   ALA ALA A . n 
C 3 77  THR 77  77   77   THR THR A . n 
C 3 78  PRO 78  78   78   PRO PRO A . n 
C 3 79  GLU 79  79   79   GLU GLU A . n 
C 3 80  VAL 80  80   80   VAL VAL A . n 
C 3 81  VAL 81  81   81   VAL VAL A . n 
C 3 82  SER 82  82   82   SER SER A . n 
C 3 83  LYS 83  83   83   LYS LYS A . n 
C 3 84  ILE 84  84   84   ILE ILE A . n 
C 3 85  ALA 85  85   85   ALA ALA A . n 
C 3 86  GLN 86  86   86   GLN GLN A . n 
C 3 87  TYR 87  87   87   TYR TYR A . n 
C 3 88  LYS 88  88   88   LYS LYS A . n 
C 3 89  GLN 89  89   89   GLN GLN A . n 
C 3 90  GLU 90  90   90   GLU GLU A . n 
C 3 91  CYS 91  91   91   CYS CYS A . n 
C 3 92  PRO 92  92   92   PRO PRO A . n 
C 3 93  SER 93  93   93   SER SER A . n 
C 3 94  ILE 94  94   94   ILE ILE A . n 
C 3 95  PHE 95  95   95   PHE PHE A . n 
C 3 96  ALA 96  96   96   ALA ALA A . n 
C 3 97  TRP 97  97   97   TRP TRP A . n 
C 3 98  GLU 98  98   98   GLU GLU A . n 
C 3 99  ILE 99  99   99   ILE ILE A . n 
C 3 100 ARG 100 100  100  ARG ARG A . n 
C 3 101 ASP 101 101  101  ASP ASP A . n 
C 3 102 ARG 102 102  102  ARG ARG A . n 
C 3 103 LEU 103 103  103  LEU LEU A . n 
C 3 104 LEU 104 104  104  LEU LEU A . n 
C 3 105 SER 105 105  105  SER SER A . n 
C 3 106 GLU 106 106  106  GLU GLU A . n 
C 3 107 GLY 107 107  107  GLY GLY A . n 
C 3 108 VAL 108 108  108  VAL VAL A . n 
C 3 109 CYS 109 109  109  CYS CYS A . n 
C 3 110 THR 110 110  110  THR THR A . n 
C 3 111 ASN 111 111  111  ASN ASN A . n 
C 3 112 ASP 112 112  112  ASP ASP A . n 
C 3 113 ASN 113 113  113  ASN ASN A . n 
C 3 114 ILE 114 114  114  ILE ILE A . n 
C 3 115 PRO 115 115  115  PRO PRO A . n 
C 3 116 SER 116 116  116  SER SER A . n 
C 3 117 VAL 117 117  117  VAL VAL A . n 
C 3 118 SER 118 118  118  SER SER A . n 
C 3 119 SER 119 119  119  SER SER A . n 
C 3 120 ILE 120 120  120  ILE ILE A . n 
C 3 121 ASN 121 121  121  ASN ASN A . n 
C 3 122 ARG 122 122  122  ARG ARG A . n 
C 3 123 VAL 123 123  123  VAL VAL A . n 
C 3 124 LEU 124 124  124  LEU LEU A . n 
C 3 125 ARG 125 125  125  ARG ARG A . n 
C 3 126 ASN 126 126  126  ASN ASN A . n 
C 3 127 LEU 127 127  127  LEU LEU A . n 
C 3 128 ALA 128 128  128  ALA ALA A . n 
C 3 129 SER 129 129  129  SER SER A . n 
C 3 130 GLU 130 130  130  GLU GLU A . n 
C 3 131 LYS 131 131  131  LYS LYS A . n 
C 3 132 GLN 132 132  132  GLN GLN A . n 
C 3 133 GLN 133 133  133  GLN GLN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1  703 703 HOH HOH B . 
D 4 HOH 2  715 715 HOH HOH B . 
D 4 HOH 3  737 737 HOH HOH B . 
D 4 HOH 4  756 756 HOH HOH B . 
D 4 HOH 5  778 778 HOH HOH B . 
D 4 HOH 6  788 788 HOH HOH B . 
D 4 HOH 7  789 789 HOH HOH B . 
D 4 HOH 8  795 795 HOH HOH B . 
D 4 HOH 9  796 796 HOH HOH B . 
D 4 HOH 10 797 797 HOH HOH B . 
D 4 HOH 11 799 799 HOH HOH B . 
D 4 HOH 12 800 800 HOH HOH B . 
D 4 HOH 13 803 803 HOH HOH B . 
D 4 HOH 14 810 810 HOH HOH B . 
D 4 HOH 15 811 811 HOH HOH B . 
E 4 HOH 1  704 704 HOH HOH C . 
E 4 HOH 2  709 709 HOH HOH C . 
E 4 HOH 3  710 710 HOH HOH C . 
E 4 HOH 4  713 713 HOH HOH C . 
E 4 HOH 5  714 714 HOH HOH C . 
E 4 HOH 6  722 722 HOH HOH C . 
E 4 HOH 7  723 723 HOH HOH C . 
E 4 HOH 8  724 724 HOH HOH C . 
E 4 HOH 9  725 725 HOH HOH C . 
E 4 HOH 10 740 740 HOH HOH C . 
E 4 HOH 11 742 742 HOH HOH C . 
E 4 HOH 12 763 763 HOH HOH C . 
E 4 HOH 13 767 767 HOH HOH C . 
E 4 HOH 14 768 768 HOH HOH C . 
E 4 HOH 15 769 769 HOH HOH C . 
E 4 HOH 16 770 770 HOH HOH C . 
E 4 HOH 17 771 771 HOH HOH C . 
E 4 HOH 18 772 772 HOH HOH C . 
E 4 HOH 19 775 775 HOH HOH C . 
E 4 HOH 20 784 784 HOH HOH C . 
E 4 HOH 21 790 790 HOH HOH C . 
E 4 HOH 22 791 791 HOH HOH C . 
E 4 HOH 23 792 792 HOH HOH C . 
E 4 HOH 24 793 793 HOH HOH C . 
E 4 HOH 25 801 801 HOH HOH C . 
E 4 HOH 26 802 802 HOH HOH C . 
E 4 HOH 27 806 806 HOH HOH C . 
E 4 HOH 28 807 807 HOH HOH C . 
E 4 HOH 29 814 814 HOH HOH C . 
F 4 HOH 1  701 701 HOH HOH A . 
F 4 HOH 2  702 702 HOH HOH A . 
F 4 HOH 3  707 707 HOH HOH A . 
F 4 HOH 4  711 711 HOH HOH A . 
F 4 HOH 5  716 716 HOH HOH A . 
F 4 HOH 6  717 717 HOH HOH A . 
F 4 HOH 7  718 718 HOH HOH A . 
F 4 HOH 8  720 720 HOH HOH A . 
F 4 HOH 9  721 721 HOH HOH A . 
F 4 HOH 10 726 726 HOH HOH A . 
F 4 HOH 11 727 727 HOH HOH A . 
F 4 HOH 12 729 729 HOH HOH A . 
F 4 HOH 13 730 730 HOH HOH A . 
F 4 HOH 14 731 731 HOH HOH A . 
F 4 HOH 15 732 732 HOH HOH A . 
F 4 HOH 16 733 733 HOH HOH A . 
F 4 HOH 17 736 736 HOH HOH A . 
F 4 HOH 18 738 738 HOH HOH A . 
F 4 HOH 19 745 745 HOH HOH A . 
F 4 HOH 20 746 746 HOH HOH A . 
F 4 HOH 21 747 747 HOH HOH A . 
F 4 HOH 22 748 748 HOH HOH A . 
F 4 HOH 23 750 750 HOH HOH A . 
F 4 HOH 24 751 751 HOH HOH A . 
F 4 HOH 25 752 752 HOH HOH A . 
F 4 HOH 26 753 753 HOH HOH A . 
F 4 HOH 27 757 757 HOH HOH A . 
F 4 HOH 28 758 758 HOH HOH A . 
F 4 HOH 29 760 760 HOH HOH A . 
F 4 HOH 30 765 765 HOH HOH A . 
F 4 HOH 31 766 766 HOH HOH A . 
F 4 HOH 32 773 773 HOH HOH A . 
F 4 HOH 33 774 774 HOH HOH A . 
F 4 HOH 34 777 777 HOH HOH A . 
F 4 HOH 35 779 779 HOH HOH A . 
F 4 HOH 36 780 780 HOH HOH A . 
F 4 HOH 37 781 781 HOH HOH A . 
F 4 HOH 38 782 782 HOH HOH A . 
F 4 HOH 39 785 785 HOH HOH A . 
F 4 HOH 40 786 786 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-13 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          .   ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O4  B DT 1016 ? ? H61 C DA 2013 ? ? 1.43 
2 1 H3  B DT 1006 ? ? N1  C DA 2023 ? ? 1.52 
3 1 O2  B DC 1010 ? ? H21 C DG 2019 ? ? 1.53 
4 1 H21 B DG 1021 ? ? O2  C DC 2008 ? ? 1.55 
5 1 O2  B DC 1012 ? ? H21 C DG 2017 ? ? 1.56 
6 1 N1  B DA 1005 ? ? H3  C DT 2024 ? ? 1.56 
7 1 N1  B DA 1015 ? ? H3  C DT 2014 ? ? 1.58 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    N1 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    DA 
_pdbx_validate_symm_contact.auth_seq_id_1     1002 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    H3 
_pdbx_validate_symm_contact.auth_asym_id_2    C 
_pdbx_validate_symm_contact.auth_comp_id_2    DT 
_pdbx_validate_symm_contact.auth_seq_id_2     2001 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              1.49 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C5'" B DA 1002 ? ? "C4'" B DA 1002 ? ? "C3'" B DA 1002 ? ? 98.06  114.10 -16.04 1.80 N 
2 1 "C5'" B DA 1002 ? ? "C4'" B DA 1002 ? ? "O4'" B DA 1002 ? ? 118.41 109.80 8.61   1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 7   ? ? -55.24  -7.97 
2 1 CYS A 91  ? ? -153.57 83.62 
3 1 ASN A 111 ? ? -58.75  -7.83 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA B 1005 ? ? 0.056 'SIDE CHAIN' 
2 1 DC C 2003 ? ? 0.062 'SIDE CHAIN' 
3 1 DA C 2009 ? ? 0.055 'SIDE CHAIN' 
4 1 DA C 2022 ? ? 0.055 'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6PAX 'double helix'        
6PAX 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 3  1_555 B DC 26 1_555 0.005  -0.244 -0.030 5.708   7.825   1.084   1  B_DG1003:DC2026_C B 1003 ? C 2026 ? 19 1 
1 A DC 4  1_555 B DG 25 1_555 0.018  -0.237 -0.318 16.315  -6.125  -6.715  2  B_DC1004:DG2025_C B 1004 ? C 2025 ? 19 1 
1 A DA 5  1_555 B DT 24 1_555 -0.457 -0.467 -0.165 -3.088  -12.541 9.236   3  B_DA1005:DT2024_C B 1005 ? C 2024 ? 20 1 
1 A DT 6  1_555 B DA 23 1_555 -0.098 -0.345 0.065  0.964   -17.931 8.750   4  B_DT1006:DA2023_C B 1006 ? C 2023 ? 20 1 
1 A DT 7  1_555 B DA 22 1_555 0.022  0.043  -0.047 -1.463  -16.679 5.224   5  B_DT1007:DA2022_C B 1007 ? C 2022 ? 20 1 
1 A DT 8  1_555 B DA 21 1_555 -0.076 -0.077 0.307  -9.696  -19.208 4.820   6  B_DT1008:DA2021_C B 1008 ? C 2021 ? 20 1 
1 A DT 9  1_555 B DA 20 1_555 0.224  -0.347 -0.065 -6.968  -4.010  4.379   7  B_DT1009:DA2020_C B 1009 ? C 2020 ? 20 1 
1 A DC 10 1_555 B DG 19 1_555 0.187  -0.225 -0.187 5.754   -5.027  3.143   8  B_DC1010:DG2019_C B 1010 ? C 2019 ? 19 1 
1 A DA 11 1_555 B DT 18 1_555 0.062  -0.150 0.015  -0.661  -16.554 -1.257  9  B_DA1011:DT2018_C B 1011 ? C 2018 ? 20 1 
1 A DC 12 1_555 B DG 17 1_555 0.152  -0.175 0.043  -3.083  -2.050  3.534   10 B_DC1012:DG2017_C B 1012 ? C 2017 ? 19 1 
1 A DG 13 1_555 B DC 16 1_555 -0.237 -0.193 0.315  10.354  -11.545 -2.062  11 B_DG1013:DC2016_C B 1013 ? C 2016 ? 19 1 
1 A DC 14 1_555 B DG 15 1_555 0.550  -0.178 0.021  -13.271 -3.388  1.249   12 B_DC1014:DG2015_C B 1014 ? C 2015 ? 19 1 
1 A DA 15 1_555 B DT 14 1_555 0.479  -0.407 0.074  -0.758  -11.571 -3.880  13 B_DA1015:DT2014_C B 1015 ? C 2014 ? 20 1 
1 A DT 16 1_555 B DA 13 1_555 -1.532 -0.500 -0.079 -8.453  -11.980 -16.682 14 B_DT1016:DA2013_C B 1016 ? C 2013 ? 20 1 
1 A DG 17 1_555 B DC 12 1_555 0.596  -0.051 0.132  6.242   -1.755  -0.257  15 B_DG1017:DC2012_C B 1017 ? C 2012 ? 19 1 
1 A DA 18 1_555 B DT 11 1_555 -0.094 -0.259 -0.090 0.936   -12.880 4.818   16 B_DA1018:DT2011_C B 1018 ? C 2011 ? 20 1 
1 A DG 19 1_555 B DC 10 1_555 -0.356 -0.095 0.204  1.614   -11.793 4.867   17 B_DG1019:DC2010_C B 1019 ? C 2010 ? 19 1 
1 A DT 20 1_555 B DA 9  1_555 -0.213 0.120  0.236  -3.293  -10.697 4.937   18 B_DT1020:DA2009_C B 1020 ? C 2009 ? 20 1 
1 A DG 21 1_555 B DC 8  1_555 0.062  -0.138 0.201  14.135  -1.897  4.488   19 B_DG1021:DC2008_C B 1021 ? C 2008 ? 19 1 
1 A DC 22 1_555 B DG 7  1_555 -0.570 -0.481 0.242  -1.956  -13.300 -0.840  20 B_DC1022:DG2007_C B 1022 ? C 2007 ? 19 1 
1 A DA 23 1_555 B DT 6  1_555 -0.036 -0.091 0.253  2.779   -3.710  -1.324  21 B_DA1023:DT2006_C B 1023 ? C 2006 ? 20 1 
1 A DC 24 1_555 B DG 5  1_555 0.511  -0.137 -0.154 12.886  -2.880  0.865   22 B_DC1024:DG2005_C B 1024 ? C 2005 ? 19 1 
1 A DA 25 1_555 B DT 4  1_555 -0.067 -0.130 -0.002 -4.337  -3.762  -0.813  23 B_DA1025:DT2004_C B 1025 ? C 2004 ? 20 1 
1 A DG 26 1_555 B DC 3  1_555 -0.059 -0.430 -0.139 0.852   -13.672 -1.813  24 B_DG1026:DC2003_C B 1026 ? C 2003 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 3  1_555 B DC 26 1_555 A DC 4  1_555 B DG 25 1_555 -0.978 -0.010 3.076 1.782  -1.387 33.726 0.193  1.951  3.020 -2.387  
-3.067 33.799 1  BB_DG1003DC1004:DG2025DC2026_CC B 1003 ? C 2026 ? B 1004 ? C 2025 ? 
1 A DC 4  1_555 B DG 25 1_555 A DA 5  1_555 B DT 24 1_555 0.303  -0.553 3.797 -0.946 3.292  34.878 -1.487 -0.668 3.722 5.476   
1.573  35.040 2  BB_DC1004DA1005:DT2024DG2025_CC B 1004 ? C 2025 ? B 1005 ? C 2024 ? 
1 A DA 5  1_555 B DT 24 1_555 A DT 6  1_555 B DA 23 1_555 -0.160 -0.326 3.094 -3.952 -2.916 37.437 -0.146 -0.239 3.110 -4.520  
6.125  37.746 3  BB_DA1005DT1006:DA2023DT2024_CC B 1005 ? C 2024 ? B 1006 ? C 2023 ? 
1 A DT 6  1_555 B DA 23 1_555 A DT 7  1_555 B DA 22 1_555 -0.006 -0.323 3.162 1.163  -0.808 34.916 -0.419 0.179  3.167 -1.347  
-1.938 34.944 4  BB_DT1006DT1007:DA2022DA2023_CC B 1006 ? C 2023 ? B 1007 ? C 2022 ? 
1 A DT 7  1_555 B DA 22 1_555 A DT 8  1_555 B DA 21 1_555 0.194  -0.218 3.420 -1.218 3.494  37.683 -0.804 -0.462 3.379 5.393   
1.879  37.858 5  BB_DT1007DT1008:DA2021DA2022_CC B 1007 ? C 2022 ? B 1008 ? C 2021 ? 
1 A DT 8  1_555 B DA 21 1_555 A DT 9  1_555 B DA 20 1_555 0.450  0.251  3.190 2.498  1.928  38.745 0.147  -0.378 3.220 2.901   
-3.758 38.868 6  BB_DT1008DT1009:DA2020DA2021_CC B 1008 ? C 2021 ? B 1009 ? C 2020 ? 
1 A DT 9  1_555 B DA 20 1_555 A DC 10 1_555 B DG 19 1_555 0.023  0.440  3.009 2.701  6.303  25.751 -0.591 0.612  3.015 13.833  
-5.928 26.634 7  BB_DT1009DC1010:DG2019DA2020_CC B 1009 ? C 2020 ? B 1010 ? C 2019 ? 
1 A DC 10 1_555 B DG 19 1_555 A DA 11 1_555 B DT 18 1_555 -1.044 1.309  3.457 -3.338 4.693  38.848 1.336  1.119  3.658 7.008   
4.985  39.257 8  BB_DC1010DA1011:DT2018DG2019_CC B 1010 ? C 2019 ? B 1011 ? C 2018 ? 
1 A DA 11 1_555 B DT 18 1_555 A DC 12 1_555 B DG 17 1_555 0.476  -0.333 3.330 -0.714 -1.783 34.998 -0.279 -0.899 3.332 -2.962  
1.186  35.049 9  BB_DA1011DC1012:DG2017DT2018_CC B 1011 ? C 2018 ? B 1012 ? C 2017 ? 
1 A DC 12 1_555 B DG 17 1_555 A DG 13 1_555 B DC 16 1_555 0.032  0.604  3.178 -3.347 11.540 27.288 -1.265 -0.771 3.145 23.092  
6.699  29.770 10 BB_DC1012DG1013:DC2016DG2017_CC B 1012 ? C 2017 ? B 1013 ? C 2016 ? 
1 A DG 13 1_555 B DC 16 1_555 A DC 14 1_555 B DG 15 1_555 0.566  -1.054 3.695 4.330  1.541  42.146 -1.636 -0.283 3.694 2.136   
-5.999 42.385 11 BB_DG1013DC1014:DG2015DC2016_CC B 1013 ? C 2016 ? B 1014 ? C 2015 ? 
1 A DC 14 1_555 B DG 15 1_555 A DA 15 1_555 B DT 14 1_555 -0.230 0.063  3.279 0.765  10.302 31.796 -1.610 0.527  3.141 18.213  
-1.352 33.391 12 BB_DC1014DA1015:DT2014DG2015_CC B 1014 ? C 2015 ? B 1015 ? C 2014 ? 
1 A DA 15 1_555 B DT 14 1_555 A DT 16 1_555 B DA 13 1_555 -0.123 -1.319 3.360 0.743  -3.483 19.546 -2.075 0.730  3.531 -10.152 
-2.167 19.864 13 BB_DA1015DT1016:DA2013DT2014_CC B 1015 ? C 2014 ? B 1016 ? C 2013 ? 
1 A DT 16 1_555 B DA 13 1_555 A DG 17 1_555 B DC 12 1_555 0.851  2.323  3.153 2.067  -2.602 48.569 3.008  -0.882 3.064 -3.159  
-2.510 48.675 14 BB_DT1016DG1017:DC2012DA2013_CC B 1016 ? C 2013 ? B 1017 ? C 2012 ? 
1 A DG 17 1_555 B DC 12 1_555 A DA 18 1_555 B DT 11 1_555 -1.120 1.854  3.642 -2.752 7.137  33.739 1.813  1.382  4.015 12.105  
4.667  34.570 15 BB_DG1017DA1018:DT2011DC2012_CC B 1017 ? C 2012 ? B 1018 ? C 2011 ? 
1 A DA 18 1_555 B DT 11 1_555 A DG 19 1_555 B DC 10 1_555 0.074  0.182  3.332 -2.362 4.559  29.353 -0.620 -0.648 3.306 8.910   
4.617  29.789 16 BB_DA1018DG1019:DC2010DT2011_CC B 1018 ? C 2011 ? B 1019 ? C 2010 ? 
1 A DG 19 1_555 B DC 10 1_555 A DT 20 1_555 B DA 9  1_555 0.270  -0.461 3.437 0.880  4.103  34.671 -1.416 -0.311 3.367 6.854   
-1.469 34.916 17 BB_DG1019DT1020:DA2009DC2010_CC B 1019 ? C 2010 ? B 1020 ? C 2009 ? 
1 A DT 20 1_555 B DA 9  1_555 A DG 21 1_555 B DC 8  1_555 0.363  0.930  3.062 -2.005 4.086  32.382 0.980  -0.974 3.125 7.281   
3.573  32.692 18 BB_DT1020DG1021:DC2008DA2009_CC B 1020 ? C 2009 ? B 1021 ? C 2008 ? 
1 A DG 21 1_555 B DC 8  1_555 A DC 22 1_555 B DG 7  1_555 -0.598 -0.463 3.568 -0.937 -1.157 36.235 -0.567 0.818  3.595 -1.859  
1.505  36.264 19 BB_DG1021DC1022:DG2007DC2008_CC B 1021 ? C 2008 ? B 1022 ? C 2007 ? 
1 A DC 22 1_555 B DG 7  1_555 A DA 23 1_555 B DT 6  1_555 -0.246 0.396  3.291 2.287  9.175  37.136 -0.570 0.668  3.274 14.128  
-3.521 38.280 20 BB_DC1022DA1023:DT2006DG2007_CC B 1022 ? C 2007 ? B 1023 ? C 2006 ? 
1 A DA 23 1_555 B DT 6  1_555 A DC 24 1_555 B DG 5  1_555 0.296  -0.879 3.029 0.586  1.500  35.864 -1.624 -0.403 2.995 2.434   
-0.951 35.899 21 BB_DA1023DC1024:DG2005DT2006_CC B 1023 ? C 2006 ? B 1024 ? C 2005 ? 
1 A DC 24 1_555 B DG 5  1_555 A DA 25 1_555 B DT 4  1_555 0.553  -0.401 3.636 0.095  5.017  34.620 -1.503 -0.905 3.546 8.376   
-0.159 34.971 22 BB_DC1024DA1025:DT2004DG2005_CC B 1024 ? C 2005 ? B 1025 ? C 2004 ? 
1 A DA 25 1_555 B DT 4  1_555 A DG 26 1_555 B DC 3  1_555 -0.419 0.062  3.375 0.502  2.326  36.106 -0.239 0.748  3.366 3.749   
-0.808 36.182 23 BB_DA1025DG1026:DC2003DT2004_CC B 1025 ? C 2004 ? B 1026 ? C 2003 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#