data_6PSI
# 
_entry.id   6PSI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6PSI         
WWPDB D_1000242994 
BMRB  30638        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB  .                                                                          6PPT  unspecified 
BMRB 'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' 30638 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6PSI 
_pdbx_database_status.recvd_initial_deposition_date   2019-07-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jiang, Y.'       1 0000-0002-0886-292X 
'Rossi, P.'       2 0000-0001-8178-0122 
'Kalodimos, C.G.' 3 0000-0001-6354-2796 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            365 
_citation.language                  ? 
_citation.page_first                1313 
_citation.page_last                 1319 
_citation.title                     'Structural basis for client recognition and activity of Hsp40 chaperones.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aax1280 
_citation.pdbx_database_id_PubMed   31604242 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jiang, Y.'       1 ? 
primary 'Rossi, P.'       2 ? 
primary 'Kalodimos, C.G.' 3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Chaperone protein DnaJ 2' 31023.424 2 ?       ? ? ? 
2 polymer man 'Alkaline phosphatase'     49492.367 1 3.1.3.1 ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Bacterial alkaline phosphatase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPP
GGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSRKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIR
VPGMGGQGNPPGDLLLVVRLLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGF
PGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYARA
;
;MAAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPP
GGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSRKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIR
VPGMGGQGNPPGDLLLVVRLLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGF
PGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYARA
;
A,C ? 
2 'polypeptide(L)' no no 
;MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEI
TAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKA
AGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPT
LAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVA
PDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
;
;MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEI
TAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKA
AGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPT
LAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVA
PDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
;
B   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   LYS n 
1 5   LYS n 
1 6   ASP n 
1 7   TYR n 
1 8   TYR n 
1 9   ALA n 
1 10  ILE n 
1 11  LEU n 
1 12  GLY n 
1 13  VAL n 
1 14  PRO n 
1 15  ARG n 
1 16  ASN n 
1 17  ALA n 
1 18  THR n 
1 19  GLN n 
1 20  GLU n 
1 21  GLU n 
1 22  ILE n 
1 23  LYS n 
1 24  ARG n 
1 25  ALA n 
1 26  TYR n 
1 27  LYS n 
1 28  ARG n 
1 29  LEU n 
1 30  ALA n 
1 31  ARG n 
1 32  GLN n 
1 33  TYR n 
1 34  HIS n 
1 35  PRO n 
1 36  ASP n 
1 37  VAL n 
1 38  ASN n 
1 39  LYS n 
1 40  SER n 
1 41  PRO n 
1 42  GLU n 
1 43  ALA n 
1 44  GLU n 
1 45  GLU n 
1 46  LYS n 
1 47  PHE n 
1 48  LYS n 
1 49  GLU n 
1 50  ILE n 
1 51  ASN n 
1 52  GLU n 
1 53  ALA n 
1 54  TYR n 
1 55  ALA n 
1 56  VAL n 
1 57  LEU n 
1 58  SER n 
1 59  ASP n 
1 60  PRO n 
1 61  GLU n 
1 62  LYS n 
1 63  ARG n 
1 64  ARG n 
1 65  ILE n 
1 66  TYR n 
1 67  ASP n 
1 68  THR n 
1 69  TYR n 
1 70  GLY n 
1 71  THR n 
1 72  THR n 
1 73  GLU n 
1 74  ALA n 
1 75  PRO n 
1 76  PRO n 
1 77  PRO n 
1 78  PRO n 
1 79  PRO n 
1 80  PRO n 
1 81  GLY n 
1 82  GLY n 
1 83  TYR n 
1 84  ASP n 
1 85  PHE n 
1 86  SER n 
1 87  GLY n 
1 88  PHE n 
1 89  ASP n 
1 90  VAL n 
1 91  GLU n 
1 92  ASP n 
1 93  PHE n 
1 94  SER n 
1 95  GLU n 
1 96  PHE n 
1 97  PHE n 
1 98  GLN n 
1 99  GLU n 
1 100 LEU n 
1 101 PHE n 
1 102 GLY n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 PHE n 
1 107 GLY n 
1 108 GLY n 
1 109 PHE n 
1 110 GLY n 
1 111 ARG n 
1 112 ARG n 
1 113 SER n 
1 114 ARG n 
1 115 LYS n 
1 116 GLY n 
1 117 ARG n 
1 118 ASP n 
1 119 LEU n 
1 120 ARG n 
1 121 ALA n 
1 122 GLU n 
1 123 LEU n 
1 124 PRO n 
1 125 LEU n 
1 126 THR n 
1 127 LEU n 
1 128 GLU n 
1 129 GLU n 
1 130 ALA n 
1 131 PHE n 
1 132 HIS n 
1 133 GLY n 
1 134 GLY n 
1 135 GLU n 
1 136 ARG n 
1 137 VAL n 
1 138 VAL n 
1 139 GLU n 
1 140 VAL n 
1 141 ALA n 
1 142 GLY n 
1 143 ARG n 
1 144 ARG n 
1 145 VAL n 
1 146 SER n 
1 147 VAL n 
1 148 ARG n 
1 149 ILE n 
1 150 PRO n 
1 151 PRO n 
1 152 GLY n 
1 153 VAL n 
1 154 ARG n 
1 155 GLU n 
1 156 GLY n 
1 157 SER n 
1 158 VAL n 
1 159 ILE n 
1 160 ARG n 
1 161 VAL n 
1 162 PRO n 
1 163 GLY n 
1 164 MET n 
1 165 GLY n 
1 166 GLY n 
1 167 GLN n 
1 168 GLY n 
1 169 ASN n 
1 170 PRO n 
1 171 PRO n 
1 172 GLY n 
1 173 ASP n 
1 174 LEU n 
1 175 LEU n 
1 176 LEU n 
1 177 VAL n 
1 178 VAL n 
1 179 ARG n 
1 180 LEU n 
1 181 LEU n 
1 182 PRO n 
1 183 HIS n 
1 184 PRO n 
1 185 VAL n 
1 186 PHE n 
1 187 ARG n 
1 188 LEU n 
1 189 GLU n 
1 190 GLY n 
1 191 GLN n 
1 192 ASP n 
1 193 LEU n 
1 194 TYR n 
1 195 ALA n 
1 196 THR n 
1 197 LEU n 
1 198 ASP n 
1 199 VAL n 
1 200 PRO n 
1 201 ALA n 
1 202 PRO n 
1 203 ILE n 
1 204 ALA n 
1 205 VAL n 
1 206 VAL n 
1 207 GLY n 
1 208 GLY n 
1 209 LYS n 
1 210 VAL n 
1 211 ARG n 
1 212 ALA n 
1 213 MET n 
1 214 THR n 
1 215 LEU n 
1 216 GLU n 
1 217 GLY n 
1 218 PRO n 
1 219 VAL n 
1 220 GLU n 
1 221 VAL n 
1 222 ALA n 
1 223 VAL n 
1 224 PRO n 
1 225 PRO n 
1 226 ARG n 
1 227 THR n 
1 228 GLN n 
1 229 ALA n 
1 230 GLY n 
1 231 ARG n 
1 232 LYS n 
1 233 LEU n 
1 234 ARG n 
1 235 LEU n 
1 236 LYS n 
1 237 GLY n 
1 238 LYS n 
1 239 GLY n 
1 240 PHE n 
1 241 PRO n 
1 242 GLY n 
1 243 PRO n 
1 244 ALA n 
1 245 GLY n 
1 246 ARG n 
1 247 GLY n 
1 248 ASP n 
1 249 LEU n 
1 250 TYR n 
1 251 LEU n 
1 252 GLU n 
1 253 VAL n 
1 254 ARG n 
1 255 ILE n 
1 256 THR n 
1 257 ILE n 
1 258 PRO n 
1 259 GLU n 
1 260 ARG n 
1 261 LEU n 
1 262 THR n 
1 263 PRO n 
1 264 GLU n 
1 265 GLU n 
1 266 GLU n 
1 267 ALA n 
1 268 LEU n 
1 269 TRP n 
1 270 LYS n 
1 271 LYS n 
1 272 LEU n 
1 273 ALA n 
1 274 GLU n 
1 275 ALA n 
1 276 TYR n 
1 277 TYR n 
1 278 ALA n 
1 279 ARG n 
1 280 ALA n 
2 1   MET n 
2 2   LYS n 
2 3   GLN n 
2 4   SER n 
2 5   THR n 
2 6   ILE n 
2 7   ALA n 
2 8   LEU n 
2 9   ALA n 
2 10  LEU n 
2 11  LEU n 
2 12  PRO n 
2 13  LEU n 
2 14  LEU n 
2 15  PHE n 
2 16  THR n 
2 17  PRO n 
2 18  VAL n 
2 19  THR n 
2 20  LYS n 
2 21  ALA n 
2 22  ARG n 
2 23  THR n 
2 24  PRO n 
2 25  GLU n 
2 26  MET n 
2 27  PRO n 
2 28  VAL n 
2 29  LEU n 
2 30  GLU n 
2 31  ASN n 
2 32  ARG n 
2 33  ALA n 
2 34  ALA n 
2 35  GLN n 
2 36  GLY n 
2 37  ASP n 
2 38  ILE n 
2 39  THR n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  GLY n 
2 44  ALA n 
2 45  ARG n 
2 46  ARG n 
2 47  LEU n 
2 48  THR n 
2 49  GLY n 
2 50  ASP n 
2 51  GLN n 
2 52  THR n 
2 53  ALA n 
2 54  ALA n 
2 55  LEU n 
2 56  ARG n 
2 57  ASP n 
2 58  SER n 
2 59  LEU n 
2 60  SER n 
2 61  ASP n 
2 62  LYS n 
2 63  PRO n 
2 64  ALA n 
2 65  LYS n 
2 66  ASN n 
2 67  ILE n 
2 68  ILE n 
2 69  LEU n 
2 70  LEU n 
2 71  ILE n 
2 72  GLY n 
2 73  ASP n 
2 74  GLY n 
2 75  MET n 
2 76  GLY n 
2 77  ASP n 
2 78  SER n 
2 79  GLU n 
2 80  ILE n 
2 81  THR n 
2 82  ALA n 
2 83  ALA n 
2 84  ARG n 
2 85  ASN n 
2 86  TYR n 
2 87  ALA n 
2 88  GLU n 
2 89  GLY n 
2 90  ALA n 
2 91  GLY n 
2 92  GLY n 
2 93  PHE n 
2 94  PHE n 
2 95  LYS n 
2 96  GLY n 
2 97  ILE n 
2 98  ASP n 
2 99  ALA n 
2 100 LEU n 
2 101 PRO n 
2 102 LEU n 
2 103 THR n 
2 104 GLY n 
2 105 GLN n 
2 106 TYR n 
2 107 THR n 
2 108 HIS n 
2 109 TYR n 
2 110 ALA n 
2 111 LEU n 
2 112 ASN n 
2 113 LYS n 
2 114 LYS n 
2 115 THR n 
2 116 GLY n 
2 117 LYS n 
2 118 PRO n 
2 119 ASP n 
2 120 TYR n 
2 121 VAL n 
2 122 THR n 
2 123 ASP n 
2 124 SER n 
2 125 ALA n 
2 126 ALA n 
2 127 SER n 
2 128 ALA n 
2 129 THR n 
2 130 ALA n 
2 131 TRP n 
2 132 SER n 
2 133 THR n 
2 134 GLY n 
2 135 VAL n 
2 136 LYS n 
2 137 THR n 
2 138 TYR n 
2 139 ASN n 
2 140 GLY n 
2 141 ALA n 
2 142 LEU n 
2 143 GLY n 
2 144 VAL n 
2 145 ASP n 
2 146 ILE n 
2 147 HIS n 
2 148 GLU n 
2 149 LYS n 
2 150 ASP n 
2 151 HIS n 
2 152 PRO n 
2 153 THR n 
2 154 ILE n 
2 155 LEU n 
2 156 GLU n 
2 157 MET n 
2 158 ALA n 
2 159 LYS n 
2 160 ALA n 
2 161 ALA n 
2 162 GLY n 
2 163 LEU n 
2 164 ALA n 
2 165 THR n 
2 166 GLY n 
2 167 ASN n 
2 168 VAL n 
2 169 SER n 
2 170 THR n 
2 171 ALA n 
2 172 GLU n 
2 173 LEU n 
2 174 GLN n 
2 175 ASP n 
2 176 ALA n 
2 177 THR n 
2 178 PRO n 
2 179 ALA n 
2 180 ALA n 
2 181 LEU n 
2 182 VAL n 
2 183 ALA n 
2 184 HIS n 
2 185 VAL n 
2 186 THR n 
2 187 SER n 
2 188 ARG n 
2 189 LYS n 
2 190 CYS n 
2 191 TYR n 
2 192 GLY n 
2 193 PRO n 
2 194 SER n 
2 195 ALA n 
2 196 THR n 
2 197 SER n 
2 198 GLU n 
2 199 LYS n 
2 200 CYS n 
2 201 PRO n 
2 202 GLY n 
2 203 ASN n 
2 204 ALA n 
2 205 LEU n 
2 206 GLU n 
2 207 LYS n 
2 208 GLY n 
2 209 GLY n 
2 210 LYS n 
2 211 GLY n 
2 212 SER n 
2 213 ILE n 
2 214 THR n 
2 215 GLU n 
2 216 GLN n 
2 217 LEU n 
2 218 LEU n 
2 219 ASN n 
2 220 ALA n 
2 221 ARG n 
2 222 ALA n 
2 223 ASP n 
2 224 VAL n 
2 225 THR n 
2 226 LEU n 
2 227 GLY n 
2 228 GLY n 
2 229 GLY n 
2 230 ALA n 
2 231 LYS n 
2 232 THR n 
2 233 PHE n 
2 234 ALA n 
2 235 GLU n 
2 236 THR n 
2 237 ALA n 
2 238 THR n 
2 239 ALA n 
2 240 GLY n 
2 241 GLU n 
2 242 TRP n 
2 243 GLN n 
2 244 GLY n 
2 245 LYS n 
2 246 THR n 
2 247 LEU n 
2 248 ARG n 
2 249 GLU n 
2 250 GLN n 
2 251 ALA n 
2 252 GLN n 
2 253 ALA n 
2 254 ARG n 
2 255 GLY n 
2 256 TYR n 
2 257 GLN n 
2 258 LEU n 
2 259 VAL n 
2 260 SER n 
2 261 ASP n 
2 262 ALA n 
2 263 ALA n 
2 264 SER n 
2 265 LEU n 
2 266 ASN n 
2 267 SER n 
2 268 VAL n 
2 269 THR n 
2 270 GLU n 
2 271 ALA n 
2 272 ASN n 
2 273 GLN n 
2 274 GLN n 
2 275 LYS n 
2 276 PRO n 
2 277 LEU n 
2 278 LEU n 
2 279 GLY n 
2 280 LEU n 
2 281 PHE n 
2 282 ALA n 
2 283 ASP n 
2 284 GLY n 
2 285 ASN n 
2 286 MET n 
2 287 PRO n 
2 288 VAL n 
2 289 ARG n 
2 290 TRP n 
2 291 LEU n 
2 292 GLY n 
2 293 PRO n 
2 294 LYS n 
2 295 ALA n 
2 296 THR n 
2 297 TYR n 
2 298 HIS n 
2 299 GLY n 
2 300 ASN n 
2 301 ILE n 
2 302 ASP n 
2 303 LYS n 
2 304 PRO n 
2 305 ALA n 
2 306 VAL n 
2 307 THR n 
2 308 CYS n 
2 309 THR n 
2 310 PRO n 
2 311 ASN n 
2 312 PRO n 
2 313 GLN n 
2 314 ARG n 
2 315 ASN n 
2 316 ASP n 
2 317 SER n 
2 318 VAL n 
2 319 PRO n 
2 320 THR n 
2 321 LEU n 
2 322 ALA n 
2 323 GLN n 
2 324 MET n 
2 325 THR n 
2 326 ASP n 
2 327 LYS n 
2 328 ALA n 
2 329 ILE n 
2 330 GLU n 
2 331 LEU n 
2 332 LEU n 
2 333 SER n 
2 334 LYS n 
2 335 ASN n 
2 336 GLU n 
2 337 LYS n 
2 338 GLY n 
2 339 PHE n 
2 340 PHE n 
2 341 LEU n 
2 342 GLN n 
2 343 VAL n 
2 344 GLU n 
2 345 GLY n 
2 346 ALA n 
2 347 SER n 
2 348 ILE n 
2 349 ASP n 
2 350 LYS n 
2 351 GLN n 
2 352 ASP n 
2 353 HIS n 
2 354 ALA n 
2 355 ALA n 
2 356 ASN n 
2 357 PRO n 
2 358 CYS n 
2 359 GLY n 
2 360 GLN n 
2 361 ILE n 
2 362 GLY n 
2 363 GLU n 
2 364 THR n 
2 365 VAL n 
2 366 ASP n 
2 367 LEU n 
2 368 ASP n 
2 369 GLU n 
2 370 ALA n 
2 371 VAL n 
2 372 GLN n 
2 373 ARG n 
2 374 ALA n 
2 375 LEU n 
2 376 GLU n 
2 377 PHE n 
2 378 ALA n 
2 379 LYS n 
2 380 LYS n 
2 381 GLU n 
2 382 GLY n 
2 383 ASN n 
2 384 THR n 
2 385 LEU n 
2 386 VAL n 
2 387 ILE n 
2 388 VAL n 
2 389 THR n 
2 390 ALA n 
2 391 ASP n 
2 392 HIS n 
2 393 ALA n 
2 394 HIS n 
2 395 ALA n 
2 396 SER n 
2 397 GLN n 
2 398 ILE n 
2 399 VAL n 
2 400 ALA n 
2 401 PRO n 
2 402 ASP n 
2 403 THR n 
2 404 LYS n 
2 405 ALA n 
2 406 PRO n 
2 407 GLY n 
2 408 LEU n 
2 409 THR n 
2 410 GLN n 
2 411 ALA n 
2 412 LEU n 
2 413 ASN n 
2 414 THR n 
2 415 LYS n 
2 416 ASP n 
2 417 GLY n 
2 418 ALA n 
2 419 VAL n 
2 420 MET n 
2 421 VAL n 
2 422 MET n 
2 423 SER n 
2 424 TYR n 
2 425 GLY n 
2 426 ASN n 
2 427 SER n 
2 428 GLU n 
2 429 GLU n 
2 430 ASP n 
2 431 SER n 
2 432 GLN n 
2 433 GLU n 
2 434 HIS n 
2 435 THR n 
2 436 GLY n 
2 437 SER n 
2 438 GLN n 
2 439 LEU n 
2 440 ARG n 
2 441 ILE n 
2 442 ALA n 
2 443 ALA n 
2 444 TYR n 
2 445 GLY n 
2 446 PRO n 
2 447 HIS n 
2 448 ALA n 
2 449 ALA n 
2 450 ASN n 
2 451 VAL n 
2 452 VAL n 
2 453 GLY n 
2 454 LEU n 
2 455 THR n 
2 456 ASP n 
2 457 GLN n 
2 458 THR n 
2 459 ASP n 
2 460 LEU n 
2 461 PHE n 
2 462 TYR n 
2 463 THR n 
2 464 MET n 
2 465 LYS n 
2 466 ALA n 
2 467 ALA n 
2 468 LEU n 
2 469 GLY n 
2 470 LEU n 
2 471 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 280 ? ? 'dnaJ2, TTHA1489' ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? 
'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 
'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 471 ? ? 
;phoA, ACU57_12080, AUQ13_18595, BANRA_02023, BANRA_03586, BET08_14335, BHF46_20915, BUE81_15475, C4J69_09555, C5N07_12695, CA593_01230, D0X26_07375, D3821_12940, DNQ41_05820, EAI52_02910, EC3234A_4c00530, EC3426_01222, ECTO6_03716, ED648_16735, EEP23_01005, EL75_3367, EL79_3462, EL80_3416, NCTC13462_01945, NCTC9037_03964, NCTC9062_04458, RK56_026750, SAMEA3753300_00450, UN91_18770
;
? ?                            ? ? ? ? 'Escherichia coli'                                         562    ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DNAJ2_THET8      Q56237     ? 1 
;MAAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGTTEAPPPPPP
GGYDFSGFDVEDFSEFFQELFGPGLFGGFGRRSRKGRDLRAELPLTLEEAFHGGERVVEVAGRRVSVRIPPGVREGSVIR
VPGMGGQGNPPGDLLLVVRLLPHPVFRLEGQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGF
PGPAGRGDLYLEVRITIPERLTPEEEALWKKLAEAYYARA
;
1 
2 UNP A0A086VD57_ECOLX A0A086VD57 ? 2 
;MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEI
TAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKA
AGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPT
LAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVA
PDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6PSI A 1 ? 280 ? Q56237     1 ? 280 ? 1 280 
2 2 6PSI B 1 ? 471 ? A0A086VD57 1 ? 471 ? 1 471 
3 1 6PSI C 1 ? 280 ? Q56237     1 ? 280 ? 1 280 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-13C HSQC'                1 isotropic 
2  1 1 '2D 1H-15N HSQC'                1 isotropic 
3  1 1 '2D 1H-13C HMQC'                1 isotropic 
4  1 1 '3D 1H-13C NOESY'               1 isotropic 
5  1 1 '3D 1H-15N NOESY'               1 isotropic 
12 1 1 '3D HNCACB'                     1 isotropic 
11 1 1 '3D HNCO'                       1 isotropic 
10 1 1 '3D CCH-sofast hmqc-NOESY-hmqc' 1 isotropic 
9  1 1 '3D NCH-sofast hmqc-NOESY-hmqc' 1 isotropic 
8  1 1 '3D HCH-sofastNOESY-hmqc'       1 isotropic 
7  1 1 '3D HNH-sofastNOESY-hmqc'       1 isotropic 
6  1 1 '3D CNH-sofast hmqc-NOESY-hmqc' 1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            25 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         100 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1 mM [U-100% 13C; U-100% 15N; U-80% 2H] PhoA_DnaJ, 75 mM potassium chloride, 20 mM potassium phosphate, 0.04 % sodium azide, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.label            NCD_sample 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          'Highly deuterated selectively ILVMAT methyl labeled' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE NEO' 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           6PSI 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      6PSI 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6PSI 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 refinement                  CNS     ? 'Brunger, Adams, Clore, Gros, Nilges and Read'      
2 'structure calculation'     CYANA   ? 'Guntert, Mumenthaler and Wuthrich'                 
3 'chemical shift assignment' PINE    ? 'Bahrami, Markley, Assadi, and Eghbalnia'           
4 'peak picking'              Sparky  ? Goddard                                             
7 processing                  NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
6 'geometry optimization'     TALOS   ? 'Cornilescu, Delaglio and Bax'                      
5 collection                  TopSpin ? 'Bruker Biospin'                                    
8 processing                  PSVS    ? 'Bhattacharya and Montelione'                       
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6PSI 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6PSI 
_struct.title                        'Structural Basis for Client Recognition and Activity of Hsp40 Chaperones' 
_struct.pdbx_descriptor              'Alkaline phosphatase,Chaperone protein DnaJ 2 (E.C.3.1.3.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6PSI 
_struct_keywords.text            'Client Recognition, CHAPERONE' 
_struct_keywords.pdbx_keywords   CHAPERONE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 6   ? GLY A 12  ? ASP A 6   GLY A 12  1 ? 7  
HELX_P HELX_P2  AA2 THR A 18  ? TYR A 33  ? THR A 18  TYR A 33  1 ? 16 
HELX_P HELX_P3  AA3 SER A 40  ? ASP A 59  ? SER A 40  ASP A 59  1 ? 20 
HELX_P HELX_P4  AA4 ASP A 59  ? TYR A 69  ? ASP A 59  TYR A 69  1 ? 11 
HELX_P HELX_P5  AA5 ASP A 89  ? PHE A 93  ? ASP A 89  PHE A 93  5 ? 5  
HELX_P HELX_P6  AA6 SER A 94  ? PHE A 101 ? SER A 94  PHE A 101 1 ? 8  
HELX_P HELX_P7  AA7 GLY A 102 ? LEU A 105 ? GLY A 102 LEU A 105 5 ? 4  
HELX_P HELX_P8  AA8 THR A 126 ? GLY A 133 ? THR A 126 GLY A 133 1 ? 8  
HELX_P HELX_P9  AA9 ALA A 201 ? GLY A 207 ? ALA A 201 GLY A 207 1 ? 7  
HELX_P HELX_P10 AB1 THR A 262 ? ALA A 278 ? THR A 262 ALA A 278 1 ? 17 
HELX_P HELX_P11 AB2 GLU B 79  ? ARG B 84  ? GLU B 79  ARG B 84  1 ? 6  
HELX_P HELX_P12 AB3 GLY B 192 ? SER B 197 ? GLY B 192 SER B 197 1 ? 6  
HELX_P HELX_P13 AB4 ALA B 222 ? LEU B 226 ? ALA B 222 LEU B 226 5 ? 5  
HELX_P HELX_P14 AB5 ASP B 368 ? GLN B 372 ? ASP B 368 GLN B 372 5 ? 5  
HELX_P HELX_P15 AB6 HIS B 434 ? GLN B 438 ? HIS B 434 GLN B 438 5 ? 5  
HELX_P HELX_P16 AB7 ASP C 6   ? GLY C 12  ? ASP C 6   GLY C 12  1 ? 7  
HELX_P HELX_P17 AB8 THR C 18  ? TYR C 33  ? THR C 18  TYR C 33  1 ? 16 
HELX_P HELX_P18 AB9 SER C 40  ? SER C 58  ? SER C 40  SER C 58  1 ? 19 
HELX_P HELX_P19 AC1 ASP C 59  ? TYR C 69  ? ASP C 59  TYR C 69  1 ? 11 
HELX_P HELX_P20 AC2 ASP C 89  ? PHE C 93  ? ASP C 89  PHE C 93  5 ? 5  
HELX_P HELX_P21 AC3 SER C 94  ? PHE C 101 ? SER C 94  PHE C 101 1 ? 8  
HELX_P HELX_P22 AC4 GLY C 102 ? LEU C 105 ? GLY C 102 LEU C 105 5 ? 4  
HELX_P HELX_P23 AC5 LEU C 127 ? GLY C 133 ? LEU C 127 GLY C 133 1 ? 7  
HELX_P HELX_P24 AC6 ALA C 201 ? GLY C 207 ? ALA C 201 GLY C 207 1 ? 7  
HELX_P HELX_P25 AC7 THR C 262 ? ALA C 278 ? THR C 262 ALA C 278 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 119 ? LEU A 125 ? LEU A 119 LEU A 125 
AA1 2 LEU A 174 ? LEU A 180 ? LEU A 174 LEU A 180 
AA1 3 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
AA2 1 GLY A 134 ? VAL A 140 ? GLY A 134 VAL A 140 
AA2 2 ARG A 143 ? ILE A 149 ? ARG A 143 ILE A 149 
AA3 1 LEU A 193 ? PRO A 200 ? LEU A 193 PRO A 200 
AA3 2 LEU A 249 ? THR A 256 ? LEU A 249 THR A 256 
AA3 3 LYS A 232 ? LYS A 236 ? LYS A 232 LYS A 236 
AA3 4 ARG B 440 ? ILE B 441 ? ARG B 440 ILE B 441 
AA4 1 LYS A 209 ? ALA A 212 ? LYS A 209 ALA A 212 
AA4 2 VAL A 219 ? ALA A 222 ? VAL A 219 ALA A 222 
AA5 1 PRO A 241 ? GLY A 242 ? PRO A 241 GLY A 242 
AA5 2 GLY A 245 ? ARG A 246 ? GLY A 245 ARG A 246 
AA6 1 LEU C 119 ? LEU C 125 ? LEU C 119 LEU C 125 
AA6 2 LEU C 174 ? LEU C 180 ? LEU C 174 LEU C 180 
AA6 3 VAL C 158 ? VAL C 161 ? VAL C 158 VAL C 161 
AA7 1 GLY C 134 ? VAL C 140 ? GLY C 134 VAL C 140 
AA7 2 ARG C 143 ? ILE C 149 ? ARG C 143 ILE C 149 
AA8 1 LEU C 193 ? PRO C 200 ? LEU C 193 PRO C 200 
AA8 2 LEU C 249 ? THR C 256 ? LEU C 249 THR C 256 
AA8 3 LYS C 232 ? LEU C 235 ? LYS C 232 LEU C 235 
AA9 1 LYS C 209 ? THR C 214 ? LYS C 209 THR C 214 
AA9 2 GLY C 217 ? ALA C 222 ? GLY C 217 ALA C 222 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 121 ? N ALA A 121 O VAL A 177 ? O VAL A 177 
AA1 2 3 O LEU A 176 ? O LEU A 176 N ILE A 159 ? N ILE A 159 
AA2 1 2 N VAL A 138 ? N VAL A 138 O VAL A 145 ? O VAL A 145 
AA3 1 2 N LEU A 197 ? N LEU A 197 O GLU A 252 ? O GLU A 252 
AA3 2 3 O LEU A 249 ? O LEU A 249 N LEU A 235 ? N LEU A 235 
AA3 3 4 N LYS A 236 ? N LYS A 236 O ARG B 440 ? O ARG B 440 
AA4 1 2 N ALA A 212 ? N ALA A 212 O VAL A 219 ? O VAL A 219 
AA5 1 2 N GLY A 242 ? N GLY A 242 O GLY A 245 ? O GLY A 245 
AA6 1 2 N LEU C 123 ? N LEU C 123 O ARG C 179 ? O ARG C 179 
AA6 2 3 O LEU C 176 ? O LEU C 176 N ILE C 159 ? N ILE C 159 
AA7 1 2 N VAL C 138 ? N VAL C 138 O VAL C 145 ? O VAL C 145 
AA8 1 2 N ALA C 195 ? N ALA C 195 O GLU C 252 ? O GLU C 252 
AA8 2 3 O LEU C 249 ? O LEU C 249 N LEU C 235 ? N LEU C 235 
AA9 1 2 N VAL C 210 ? N VAL C 210 O VAL C 221 ? O VAL C 221 
# 
_atom_sites.entry_id                    6PSI 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? 11.704  53.140  35.844  1.00 0.00  ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? 12.814  53.816  36.529  1.00 52.33 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? 13.827  52.766  37.038  1.00 41.10 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? 14.689  53.084  37.861  1.00 53.32 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? 12.245  54.700  37.675  1.00 45.55 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? 11.170  55.706  37.221  1.00 3.30  ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? 10.416  56.631  38.581  1.00 64.12 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? 9.584   55.340  39.506  1.00 20.22 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? 11.318  52.396  36.450  1.00 37.66 ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? 12.042  52.712  34.966  1.00 37.66 ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? 10.949  53.810  35.613  1.00 37.66 ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? 13.318  54.449  35.802  1.00 35.32 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? 11.811  54.061  38.435  1.00 3.44  ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? 13.060  55.260  38.123  1.00 3.43  ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? 11.621  56.416  36.539  1.00 23.34 ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? 10.384  55.170  36.697  1.00 21.13 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? 8.889   54.819  38.863  1.00 14.40 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? 9.049   55.781  40.333  1.00 52.24 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? 10.313  54.641  39.884  1.00 14.45 ? 1   MET A HE3  1  
ATOM 20     N N    . ALA A 1 2   ? 13.710  51.516  36.506  1.00 1.20  ? 2   ALA A N    1  
ATOM 21     C CA   . ALA A 1 2   ? 14.608  50.378  36.810  1.00 51.40 ? 2   ALA A CA   1  
ATOM 22     C C    . ALA A 1 2   ? 14.498  49.913  38.277  1.00 24.34 ? 2   ALA A C    1  
ATOM 23     O O    . ALA A 1 2   ? 15.509  49.638  38.931  1.00 30.42 ? 2   ALA A O    1  
ATOM 24     C CB   . ALA A 1 2   ? 16.063  50.681  36.391  1.00 0.01  ? 2   ALA A CB   1  
ATOM 25     H H    . ALA A 1 2   ? 12.979  51.356  35.877  1.00 35.10 ? 2   ALA A H    1  
ATOM 26     H HA   . ALA A 1 2   ? 14.266  49.553  36.195  1.00 44.12 ? 2   ALA A HA   1  
ATOM 27     H HB1  . ALA A 1 2   ? 16.674  49.799  36.524  1.00 45.43 ? 2   ALA A HB1  1  
ATOM 28     H HB2  . ALA A 1 2   ? 16.457  51.484  37.001  1.00 22.53 ? 2   ALA A HB2  1  
ATOM 29     H HB3  . ALA A 1 2   ? 16.091  50.979  35.349  1.00 74.44 ? 2   ALA A HB3  1  
ATOM 30     N N    . ALA A 1 3   ? 13.253  49.827  38.775  1.00 74.04 ? 3   ALA A N    1  
ATOM 31     C CA   . ALA A 1 3   ? 12.945  49.310  40.127  1.00 65.24 ? 3   ALA A CA   1  
ATOM 32     C C    . ALA A 1 3   ? 13.269  47.798  40.241  1.00 2.10  ? 3   ALA A C    1  
ATOM 33     O O    . ALA A 1 3   ? 12.370  46.963  40.089  1.00 4.11  ? 3   ALA A O    1  
ATOM 34     C CB   . ALA A 1 3   ? 11.468  49.578  40.475  1.00 71.33 ? 3   ALA A CB   1  
ATOM 35     H H    . ALA A 1 3   ? 12.504  50.121  38.211  1.00 72.11 ? 3   ALA A H    1  
ATOM 36     H HA   . ALA A 1 3   ? 13.561  49.853  40.839  1.00 64.51 ? 3   ALA A HA   1  
ATOM 37     H HB1  . ALA A 1 3   ? 11.271  49.264  41.493  1.00 23.24 ? 3   ALA A HB1  1  
ATOM 38     H HB2  . ALA A 1 3   ? 10.826  49.027  39.802  1.00 54.44 ? 3   ALA A HB2  1  
ATOM 39     H HB3  . ALA A 1 3   ? 11.254  50.633  40.380  1.00 60.15 ? 3   ALA A HB3  1  
ATOM 40     N N    . LYS A 1 4   ? 14.583  47.483  40.409  1.00 20.42 ? 4   LYS A N    1  
ATOM 41     C CA   . LYS A 1 4   ? 15.141  46.106  40.505  1.00 25.41 ? 4   LYS A CA   1  
ATOM 42     C C    . LYS A 1 4   ? 14.214  45.118  41.251  1.00 3.24  ? 4   LYS A C    1  
ATOM 43     O O    . LYS A 1 4   ? 14.215  45.050  42.489  1.00 24.12 ? 4   LYS A O    1  
ATOM 44     C CB   . LYS A 1 4   ? 16.563  46.147  41.145  1.00 3.24  ? 4   LYS A CB   1  
ATOM 45     C CG   . LYS A 1 4   ? 17.252  44.770  41.387  1.00 53.14 ? 4   LYS A CG   1  
ATOM 46     C CD   . LYS A 1 4   ? 17.496  43.938  40.096  1.00 4.03  ? 4   LYS A CD   1  
ATOM 47     C CE   . LYS A 1 4   ? 18.453  44.610  39.087  1.00 62.43 ? 4   LYS A CE   1  
ATOM 48     N NZ   . LYS A 1 4   ? 19.790  44.894  39.663  1.00 1.32  ? 4   LYS A NZ   1  
ATOM 49     H H    . LYS A 1 4   ? 15.217  48.226  40.477  1.00 41.52 ? 4   LYS A H    1  
ATOM 50     H HA   . LYS A 1 4   ? 15.251  45.749  39.484  1.00 44.13 ? 4   LYS A HA   1  
ATOM 51     H HB2  . LYS A 1 4   ? 17.209  46.737  40.504  1.00 41.15 ? 4   LYS A HB2  1  
ATOM 52     H HB3  . LYS A 1 4   ? 16.486  46.656  42.100  1.00 44.23 ? 4   LYS A HB3  1  
ATOM 53     H HG2  . LYS A 1 4   ? 18.207  44.944  41.873  1.00 50.43 ? 4   LYS A HG2  1  
ATOM 54     H HG3  . LYS A 1 4   ? 16.626  44.190  42.059  1.00 12.32 ? 4   LYS A HG3  1  
ATOM 55     H HD2  . LYS A 1 4   ? 17.914  42.978  40.376  1.00 3.31  ? 4   LYS A HD2  1  
ATOM 56     H HD3  . LYS A 1 4   ? 16.540  43.769  39.607  1.00 41.33 ? 4   LYS A HD3  1  
ATOM 57     H HE2  . LYS A 1 4   ? 18.578  43.959  38.231  1.00 64.14 ? 4   LYS A HE2  1  
ATOM 58     H HE3  . LYS A 1 4   ? 18.014  45.542  38.756  1.00 53.51 ? 4   LYS A HE3  1  
ATOM 59     H HZ1  . LYS A 1 4   ? 20.417  45.289  38.933  1.00 44.21 ? 4   LYS A HZ1  1  
ATOM 60     H HZ2  . LYS A 1 4   ? 20.219  44.021  40.037  1.00 14.13 ? 4   LYS A HZ2  1  
ATOM 61     H HZ3  . LYS A 1 4   ? 19.706  45.586  40.435  1.00 24.44 ? 4   LYS A HZ3  1  
ATOM 62     N N    . LYS A 1 5   ? 13.376  44.417  40.469  1.00 71.01 ? 5   LYS A N    1  
ATOM 63     C CA   . LYS A 1 5   ? 12.611  43.270  40.951  1.00 42.42 ? 5   LYS A CA   1  
ATOM 64     C C    . LYS A 1 5   ? 13.582  42.125  41.258  1.00 72.31 ? 5   LYS A C    1  
ATOM 65     O O    . LYS A 1 5   ? 14.174  41.542  40.333  1.00 11.31 ? 5   LYS A O    1  
ATOM 66     C CB   . LYS A 1 5   ? 11.539  42.816  39.909  1.00 33.14 ? 5   LYS A CB   1  
ATOM 67     C CG   . LYS A 1 5   ? 10.227  43.630  39.898  1.00 74.32 ? 5   LYS A CG   1  
ATOM 68     C CD   . LYS A 1 5   ? 9.473   43.562  41.254  1.00 70.12 ? 5   LYS A CD   1  
ATOM 69     C CE   . LYS A 1 5   ? 7.978   43.903  41.137  1.00 45.22 ? 5   LYS A CE   1  
ATOM 70     N NZ   . LYS A 1 5   ? 7.229   42.874  40.358  1.00 73.25 ? 5   LYS A NZ   1  
ATOM 71     H H    . LYS A 1 5   ? 13.271  44.693  39.536  1.00 1.12  ? 5   LYS A H    1  
ATOM 72     H HA   . LYS A 1 5   ? 12.109  43.568  41.872  1.00 30.12 ? 5   LYS A HA   1  
ATOM 73     H HB2  . LYS A 1 5   ? 11.972  42.876  38.919  1.00 42.04 ? 5   LYS A HB2  1  
ATOM 74     H HB3  . LYS A 1 5   ? 11.279  41.776  40.100  1.00 41.43 ? 5   LYS A HB3  1  
ATOM 75     H HG2  . LYS A 1 5   ? 10.460  44.666  39.679  1.00 31.14 ? 5   LYS A HG2  1  
ATOM 76     H HG3  . LYS A 1 5   ? 9.581   43.240  39.113  1.00 54.44 ? 5   LYS A HG3  1  
ATOM 77     H HD2  . LYS A 1 5   ? 9.562   42.559  41.660  1.00 65.11 ? 5   LYS A HD2  1  
ATOM 78     H HD3  . LYS A 1 5   ? 9.937   44.260  41.943  1.00 62.01 ? 5   LYS A HD3  1  
ATOM 79     H HE2  . LYS A 1 5   ? 7.551   43.959  42.129  1.00 31.24 ? 5   LYS A HE2  1  
ATOM 80     H HE3  . LYS A 1 5   ? 7.867   44.863  40.647  1.00 14.41 ? 5   LYS A HE3  1  
ATOM 81     H HZ1  . LYS A 1 5   ? 7.611   42.797  39.389  1.00 12.33 ? 5   LYS A HZ1  1  
ATOM 82     H HZ2  . LYS A 1 5   ? 6.225   43.127  40.304  1.00 61.45 ? 5   LYS A HZ2  1  
ATOM 83     H HZ3  . LYS A 1 5   ? 7.315   41.946  40.816  1.00 50.34 ? 5   LYS A HZ3  1  
ATOM 84     N N    . ASP A 1 6   ? 13.786  41.864  42.560  1.00 40.15 ? 6   ASP A N    1  
ATOM 85     C CA   . ASP A 1 6   ? 14.587  40.733  43.029  1.00 33.43 ? 6   ASP A CA   1  
ATOM 86     C C    . ASP A 1 6   ? 13.771  39.462  42.786  1.00 43.43 ? 6   ASP A C    1  
ATOM 87     O O    . ASP A 1 6   ? 12.976  39.043  43.642  1.00 14.14 ? 6   ASP A O    1  
ATOM 88     C CB   . ASP A 1 6   ? 14.954  40.899  44.532  1.00 3.22  ? 6   ASP A CB   1  
ATOM 89     C CG   . ASP A 1 6   ? 16.028  39.917  45.067  1.00 31.52 ? 6   ASP A CG   1  
ATOM 90     O OD1  . ASP A 1 6   ? 16.171  38.780  44.549  1.00 61.41 ? 6   ASP A OD1  1  
ATOM 91     O OD2  . ASP A 1 6   ? 16.711  40.275  46.052  1.00 13.31 ? 6   ASP A OD2  1  
ATOM 92     H H    . ASP A 1 6   ? 13.370  42.452  43.224  1.00 4.32  ? 6   ASP A H    1  
ATOM 93     H HA   . ASP A 1 6   ? 15.500  40.690  42.435  1.00 62.43 ? 6   ASP A HA   1  
ATOM 94     H HB2  . ASP A 1 6   ? 15.318  41.910  44.679  1.00 1.40  ? 6   ASP A HB2  1  
ATOM 95     H HB3  . ASP A 1 6   ? 14.056  40.773  45.130  1.00 4.41  ? 6   ASP A HB3  1  
ATOM 96     N N    . TYR A 1 7   ? 13.947  38.903  41.584  1.00 32.43 ? 7   TYR A N    1  
ATOM 97     C CA   . TYR A 1 7   ? 13.193  37.741  41.108  1.00 33.23 ? 7   TYR A CA   1  
ATOM 98     C C    . TYR A 1 7   ? 13.406  36.516  42.013  1.00 30.23 ? 7   TYR A C    1  
ATOM 99     O O    . TYR A 1 7   ? 12.496  35.693  42.181  1.00 3.32  ? 7   TYR A O    1  
ATOM 100    C CB   . TYR A 1 7   ? 13.580  37.427  39.637  1.00 34.34 ? 7   TYR A CB   1  
ATOM 101    C CG   . TYR A 1 7   ? 13.174  38.506  38.605  1.00 31.52 ? 7   TYR A CG   1  
ATOM 102    C CD1  . TYR A 1 7   ? 11.926  39.140  38.664  1.00 62.41 ? 7   TYR A CD1  1  
ATOM 103    C CD2  . TYR A 1 7   ? 14.024  38.868  37.561  1.00 34.33 ? 7   TYR A CD2  1  
ATOM 104    C CE1  . TYR A 1 7   ? 11.555  40.080  37.722  1.00 73.32 ? 7   TYR A CE1  1  
ATOM 105    C CE2  . TYR A 1 7   ? 13.654  39.816  36.625  1.00 50.24 ? 7   TYR A CE2  1  
ATOM 106    C CZ   . TYR A 1 7   ? 12.420  40.418  36.711  1.00 73.34 ? 7   TYR A CZ   1  
ATOM 107    O OH   . TYR A 1 7   ? 12.043  41.355  35.771  1.00 0.42  ? 7   TYR A OH   1  
ATOM 108    H H    . TYR A 1 7   ? 14.615  39.300  40.987  1.00 13.34 ? 7   TYR A H    1  
ATOM 109    H HA   . TYR A 1 7   ? 12.143  38.002  41.133  1.00 34.22 ? 7   TYR A HA   1  
ATOM 110    H HB2  . TYR A 1 7   ? 14.656  37.290  39.577  1.00 4.51  ? 7   TYR A HB2  1  
ATOM 111    H HB3  . TYR A 1 7   ? 13.101  36.499  39.337  1.00 64.01 ? 7   TYR A HB3  1  
ATOM 112    H HD1  . TYR A 1 7   ? 11.236  38.885  39.462  1.00 1.24  ? 7   TYR A HD1  1  
ATOM 113    H HD2  . TYR A 1 7   ? 14.996  38.397  37.490  1.00 4.33  ? 7   TYR A HD2  1  
ATOM 114    H HE1  . TYR A 1 7   ? 10.585  40.554  37.788  1.00 13.35 ? 7   TYR A HE1  1  
ATOM 115    H HE2  . TYR A 1 7   ? 14.339  40.077  35.827  1.00 64.04 ? 7   TYR A HE2  1  
ATOM 116    H HH   . TYR A 1 7   ? 12.189  41.004  34.888  1.00 41.30 ? 7   TYR A HH   1  
ATOM 117    N N    . TYR A 1 8   ? 14.599  36.435  42.620  1.00 11.11 ? 8   TYR A N    1  
ATOM 118    C CA   . TYR A 1 8   ? 14.937  35.369  43.563  1.00 2.42  ? 8   TYR A CA   1  
ATOM 119    C C    . TYR A 1 8   ? 14.056  35.464  44.813  1.00 0.31  ? 8   TYR A C    1  
ATOM 120    O O    . TYR A 1 8   ? 13.410  34.494  45.189  1.00 45.54 ? 8   TYR A O    1  
ATOM 121    C CB   . TYR A 1 8   ? 16.415  35.447  43.983  1.00 43.24 ? 8   TYR A CB   1  
ATOM 122    C CG   . TYR A 1 8   ? 17.426  35.313  42.844  1.00 73.33 ? 8   TYR A CG   1  
ATOM 123    C CD1  . TYR A 1 8   ? 17.808  34.069  42.350  1.00 53.42 ? 8   TYR A CD1  1  
ATOM 124    C CD2  . TYR A 1 8   ? 18.039  36.431  42.304  1.00 43.35 ? 8   TYR A CD2  1  
ATOM 125    C CE1  . TYR A 1 8   ? 18.764  33.953  41.365  1.00 31.00 ? 8   TYR A CE1  1  
ATOM 126    C CE2  . TYR A 1 8   ? 18.989  36.321  41.311  1.00 51.30 ? 8   TYR A CE2  1  
ATOM 127    C CZ   . TYR A 1 8   ? 19.351  35.081  40.851  1.00 23.02 ? 8   TYR A CZ   1  
ATOM 128    O OH   . TYR A 1 8   ? 20.314  34.964  39.877  1.00 11.25 ? 8   TYR A OH   1  
ATOM 129    H H    . TYR A 1 8   ? 15.262  37.136  42.448  1.00 60.50 ? 8   TYR A H    1  
ATOM 130    H HA   . TYR A 1 8   ? 14.756  34.417  43.077  1.00 20.21 ? 8   TYR A HA   1  
ATOM 131    H HB2  . TYR A 1 8   ? 16.589  36.400  44.475  1.00 24.25 ? 8   TYR A HB2  1  
ATOM 132    H HB3  . TYR A 1 8   ? 16.620  34.655  44.699  1.00 53.21 ? 8   TYR A HB3  1  
ATOM 133    H HD1  . TYR A 1 8   ? 17.344  33.177  42.750  1.00 41.51 ? 8   TYR A HD1  1  
ATOM 134    H HD2  . TYR A 1 8   ? 17.753  37.413  42.665  1.00 24.21 ? 8   TYR A HD2  1  
ATOM 135    H HE1  . TYR A 1 8   ? 19.043  32.976  41.000  1.00 4.12  ? 8   TYR A HE1  1  
ATOM 136    H HE2  . TYR A 1 8   ? 19.455  37.213  40.911  1.00 60.11 ? 8   TYR A HE2  1  
ATOM 137    H HH   . TYR A 1 8   ? 21.068  35.522  40.100  1.00 0.20  ? 8   TYR A HH   1  
ATOM 138    N N    . ALA A 1 9   ? 14.038  36.650  45.443  1.00 24.34 ? 9   ALA A N    1  
ATOM 139    C CA   . ALA A 1 9   ? 13.267  36.885  46.678  1.00 22.11 ? 9   ALA A CA   1  
ATOM 140    C C    . ALA A 1 9   ? 11.755  36.692  46.440  1.00 60.32 ? 9   ALA A C    1  
ATOM 141    O O    . ALA A 1 9   ? 11.050  36.185  47.324  1.00 31.22 ? 9   ALA A O    1  
ATOM 142    C CB   . ALA A 1 9   ? 13.571  38.275  47.249  1.00 44.22 ? 9   ALA A CB   1  
ATOM 143    H H    . ALA A 1 9   ? 14.558  37.389  45.065  1.00 70.01 ? 9   ALA A H    1  
ATOM 144    H HA   . ALA A 1 9   ? 13.600  36.150  47.409  1.00 43.41 ? 9   ALA A HA   1  
ATOM 145    H HB1  . ALA A 1 9   ? 13.031  38.416  48.179  1.00 63.35 ? 9   ALA A HB1  1  
ATOM 146    H HB2  . ALA A 1 9   ? 13.271  39.034  46.542  1.00 31.11 ? 9   ALA A HB2  1  
ATOM 147    H HB3  . ALA A 1 9   ? 14.634  38.366  47.437  1.00 63.01 ? 9   ALA A HB3  1  
ATOM 148    N N    . ILE A 1 10  ? 11.276  37.062  45.228  1.00 5.42  ? 10  ILE A N    1  
ATOM 149    C CA   . ILE A 1 10  ? 9.884   36.795  44.803  1.00 64.40 ? 10  ILE A CA   1  
ATOM 150    C C    . ILE A 1 10  ? 9.614   35.268  44.812  1.00 55.13 ? 10  ILE A C    1  
ATOM 151    O O    . ILE A 1 10  ? 8.562   34.813  45.285  1.00 74.12 ? 10  ILE A O    1  
ATOM 152    C CB   . ILE A 1 10  ? 9.563   37.386  43.374  1.00 3.43  ? 10  ILE A CB   1  
ATOM 153    C CG1  . ILE A 1 10  ? 9.783   38.935  43.324  1.00 74.23 ? 10  ILE A CG1  1  
ATOM 154    C CG2  . ILE A 1 10  ? 8.115   37.041  42.960  1.00 42.51 ? 10  ILE A CG2  1  
ATOM 155    C CD1  . ILE A 1 10  ? 9.609   39.561  41.942  1.00 72.42 ? 10  ILE A CD1  1  
ATOM 156    H H    . ILE A 1 10  ? 11.876  37.524  44.608  1.00 21.12 ? 10  ILE A H    1  
ATOM 157    H HA   . ILE A 1 10  ? 9.223   37.268  45.525  1.00 14.03 ? 10  ILE A HA   1  
ATOM 158    H HB   . ILE A 1 10  ? 10.237  36.912  42.662  1.00 33.41 ? 10  ILE A HB   1  
ATOM 159    H HG12 . ILE A 1 10  ? 9.077   39.421  43.986  1.00 0.13  ? 10  ILE A HG12 1  
ATOM 160    H HG13 . ILE A 1 10  ? 10.787  39.164  43.661  1.00 51.42 ? 10  ILE A HG13 1  
ATOM 161    H HG21 . ILE A 1 10  ? 7.909   37.442  41.976  1.00 23.44 ? 10  ILE A HG21 1  
ATOM 162    H HG22 . ILE A 1 10  ? 7.416   37.464  43.671  1.00 71.33 ? 10  ILE A HG22 1  
ATOM 163    H HG23 . ILE A 1 10  ? 7.987   35.966  42.933  1.00 61.34 ? 10  ILE A HG23 1  
ATOM 164    H HD11 . ILE A 1 10  ? 8.603   39.388  41.589  1.00 13.35 ? 10  ILE A HD11 1  
ATOM 165    H HD12 . ILE A 1 10  ? 10.316  39.121  41.250  1.00 41.43 ? 10  ILE A HD12 1  
ATOM 166    H HD13 . ILE A 1 10  ? 9.787   40.624  42.007  1.00 62.25 ? 10  ILE A HD13 1  
ATOM 167    N N    . LEU A 1 11  ? 10.586  34.493  44.296  1.00 51.33 ? 11  LEU A N    1  
ATOM 168    C CA   . LEU A 1 11  ? 10.535  33.014  44.323  1.00 30.50 ? 11  LEU A CA   1  
ATOM 169    C C    . LEU A 1 11  ? 10.855  32.438  45.732  1.00 32.54 ? 11  LEU A C    1  
ATOM 170    O O    . LEU A 1 11  ? 10.606  31.261  45.980  1.00 5.45  ? 11  LEU A O    1  
ATOM 171    C CB   . LEU A 1 11  ? 11.490  32.426  43.249  1.00 21.04 ? 11  LEU A CB   1  
ATOM 172    C CG   . LEU A 1 11  ? 11.099  32.734  41.766  1.00 25.52 ? 11  LEU A CG   1  
ATOM 173    C CD1  . LEU A 1 11  ? 12.183  32.268  40.775  1.00 43.32 ? 11  LEU A CD1  1  
ATOM 174    C CD2  . LEU A 1 11  ? 9.722   32.121  41.414  1.00 23.23 ? 11  LEU A CD2  1  
ATOM 175    H H    . LEU A 1 11  ? 11.364  34.930  43.875  1.00 61.04 ? 11  LEU A H    1  
ATOM 176    H HA   . LEU A 1 11  ? 9.519   32.720  44.070  1.00 73.11 ? 11  LEU A HA   1  
ATOM 177    H HB2  . LEU A 1 11  ? 12.487  32.820  43.434  1.00 42.53 ? 11  LEU A HB2  1  
ATOM 178    H HB3  . LEU A 1 11  ? 11.526  31.349  43.372  1.00 2.43  ? 11  LEU A HB3  1  
ATOM 179    H HG   . LEU A 1 11  ? 11.011  33.809  41.655  1.00 65.12 ? 11  LEU A HG   1  
ATOM 180    H HD11 . LEU A 1 11  ? 11.895  32.537  39.769  1.00 73.03 ? 11  LEU A HD11 1  
ATOM 181    H HD12 . LEU A 1 11  ? 12.307  31.194  40.838  1.00 51.40 ? 11  LEU A HD12 1  
ATOM 182    H HD13 . LEU A 1 11  ? 13.124  32.749  41.014  1.00 45.11 ? 11  LEU A HD13 1  
ATOM 183    H HD21 . LEU A 1 11  ? 8.964   32.531  42.070  1.00 52.22 ? 11  LEU A HD21 1  
ATOM 184    H HD22 . LEU A 1 11  ? 9.753   31.046  41.533  1.00 41.43 ? 11  LEU A HD22 1  
ATOM 185    H HD23 . LEU A 1 11  ? 9.466   32.361  40.390  1.00 23.25 ? 11  LEU A HD23 1  
ATOM 186    N N    . GLY A 1 12  ? 11.372  33.279  46.652  1.00 12.13 ? 12  GLY A N    1  
ATOM 187    C CA   . GLY A 1 12  ? 11.726  32.836  48.009  1.00 1.43  ? 12  GLY A CA   1  
ATOM 188    C C    . GLY A 1 12  ? 13.045  32.064  48.079  1.00 53.33 ? 12  GLY A C    1  
ATOM 189    O O    . GLY A 1 12  ? 13.182  31.110  48.854  1.00 53.12 ? 12  GLY A O    1  
ATOM 190    H H    . GLY A 1 12  ? 11.495  34.222  46.410  1.00 63.31 ? 12  GLY A H    1  
ATOM 191    H HA2  . GLY A 1 12  ? 11.807  33.711  48.641  1.00 73.42 ? 12  GLY A HA2  1  
ATOM 192    H HA3  . GLY A 1 12  ? 10.927  32.211  48.393  1.00 24.11 ? 12  GLY A HA3  1  
ATOM 193    N N    . VAL A 1 13  ? 14.014  32.490  47.257  1.00 64.50 ? 13  VAL A N    1  
ATOM 194    C CA   . VAL A 1 13  ? 15.388  31.932  47.202  1.00 52.43 ? 13  VAL A CA   1  
ATOM 195    C C    . VAL A 1 13  ? 16.415  33.100  47.244  1.00 12.42 ? 13  VAL A C    1  
ATOM 196    O O    . VAL A 1 13  ? 16.036  34.246  46.990  1.00 21.44 ? 13  VAL A O    1  
ATOM 197    C CB   . VAL A 1 13  ? 15.608  31.025  45.915  1.00 71.43 ? 13  VAL A CB   1  
ATOM 198    C CG1  . VAL A 1 13  ? 14.864  29.671  46.034  1.00 20.42 ? 13  VAL A CG1  1  
ATOM 199    C CG2  . VAL A 1 13  ? 15.204  31.770  44.613  1.00 64.41 ? 13  VAL A CG2  1  
ATOM 200    H H    . VAL A 1 13  ? 13.810  33.233  46.664  1.00 13.43 ? 13  VAL A H    1  
ATOM 201    H HA   . VAL A 1 13  ? 15.545  31.318  48.088  1.00 1.34  ? 13  VAL A HA   1  
ATOM 202    H HB   . VAL A 1 13  ? 16.670  30.799  45.847  1.00 11.44 ? 13  VAL A HB   1  
ATOM 203    H HG11 . VAL A 1 13  ? 13.800  29.840  46.139  1.00 13.41 ? 13  VAL A HG11 1  
ATOM 204    H HG12 . VAL A 1 13  ? 15.222  29.131  46.904  1.00 23.33 ? 13  VAL A HG12 1  
ATOM 205    H HG13 . VAL A 1 13  ? 15.043  29.070  45.150  1.00 45.10 ? 13  VAL A HG13 1  
ATOM 206    H HG21 . VAL A 1 13  ? 14.156  32.047  44.657  1.00 72.52 ? 13  VAL A HG21 1  
ATOM 207    H HG22 . VAL A 1 13  ? 15.366  31.131  43.757  1.00 1.15  ? 13  VAL A HG22 1  
ATOM 208    H HG23 . VAL A 1 13  ? 15.804  32.666  44.503  1.00 70.35 ? 13  VAL A HG23 1  
ATOM 209    N N    . PRO A 1 14  ? 17.717  32.849  47.621  1.00 13.43 ? 14  PRO A N    1  
ATOM 210    C CA   . PRO A 1 14  ? 18.767  33.911  47.638  1.00 43.33 ? 14  PRO A CA   1  
ATOM 211    C C    . PRO A 1 14  ? 19.278  34.271  46.227  1.00 50.12 ? 14  PRO A C    1  
ATOM 212    O O    . PRO A 1 14  ? 19.103  33.503  45.281  1.00 44.14 ? 14  PRO A O    1  
ATOM 213    C CB   . PRO A 1 14  ? 19.887  33.257  48.478  1.00 33.41 ? 14  PRO A CB   1  
ATOM 214    C CG   . PRO A 1 14  ? 19.754  31.794  48.196  1.00 45.20 ? 14  PRO A CG   1  
ATOM 215    C CD   . PRO A 1 14  ? 18.264  31.542  48.100  1.00 32.20 ? 14  PRO A CD   1  
ATOM 216    H HA   . PRO A 1 14  ? 18.420  34.814  48.133  1.00 30.44 ? 14  PRO A HA   1  
ATOM 217    H HB2  . PRO A 1 14  ? 20.867  33.632  48.180  1.00 20.33 ? 14  PRO A HB2  1  
ATOM 218    H HB3  . PRO A 1 14  ? 19.727  33.451  49.531  1.00 24.05 ? 14  PRO A HB3  1  
ATOM 219    H HG2  . PRO A 1 14  ? 20.251  31.546  47.256  1.00 22.41 ? 14  PRO A HG2  1  
ATOM 220    H HG3  . PRO A 1 14  ? 20.180  31.215  49.004  1.00 12.31 ? 14  PRO A HG3  1  
ATOM 221    H HD2  . PRO A 1 14  ? 18.054  30.752  47.388  1.00 21.20 ? 14  PRO A HD2  1  
ATOM 222    H HD3  . PRO A 1 14  ? 17.854  31.291  49.072  1.00 43.14 ? 14  PRO A HD3  1  
ATOM 223    N N    . ARG A 1 15  ? 20.009  35.402  46.113  1.00 2.21  ? 15  ARG A N    1  
ATOM 224    C CA   . ARG A 1 15  ? 20.568  35.886  44.818  1.00 11.14 ? 15  ARG A CA   1  
ATOM 225    C C    . ARG A 1 15  ? 21.795  35.071  44.337  1.00 61.15 ? 15  ARG A C    1  
ATOM 226    O O    . ARG A 1 15  ? 22.559  35.526  43.486  1.00 43.53 ? 15  ARG A O    1  
ATOM 227    C CB   . ARG A 1 15  ? 20.889  37.404  44.906  1.00 31.41 ? 15  ARG A CB   1  
ATOM 228    C CG   . ARG A 1 15  ? 19.629  38.284  45.041  1.00 72.25 ? 15  ARG A CG   1  
ATOM 229    C CD   . ARG A 1 15  ? 19.926  39.787  45.114  1.00 75.43 ? 15  ARG A CD   1  
ATOM 230    N NE   . ARG A 1 15  ? 20.682  40.151  46.329  1.00 22.32 ? 15  ARG A NE   1  
ATOM 231    C CZ   . ARG A 1 15  ? 20.241  40.958  47.312  1.00 2.24  ? 15  ARG A CZ   1  
ATOM 232    N NH1  . ARG A 1 15  ? 19.037  41.504  47.255  1.00 51.32 ? 15  ARG A NH1  1  
ATOM 233    N NH2  . ARG A 1 15  ? 21.017  41.205  48.353  1.00 63.35 ? 15  ARG A NH2  1  
ATOM 234    H H    . ARG A 1 15  ? 20.170  35.937  46.917  1.00 71.04 ? 15  ARG A H    1  
ATOM 235    H HA   . ARG A 1 15  ? 19.792  35.755  44.071  1.00 51.13 ? 15  ARG A HA   1  
ATOM 236    H HB2  . ARG A 1 15  ? 21.527  37.577  45.764  1.00 32.42 ? 15  ARG A HB2  1  
ATOM 237    H HB3  . ARG A 1 15  ? 21.422  37.710  44.009  1.00 31.11 ? 15  ARG A HB3  1  
ATOM 238    H HG2  . ARG A 1 15  ? 18.985  38.102  44.190  1.00 73.43 ? 15  ARG A HG2  1  
ATOM 239    H HG3  . ARG A 1 15  ? 19.104  37.991  45.944  1.00 2.10  ? 15  ARG A HG3  1  
ATOM 240    H HD2  . ARG A 1 15  ? 20.511  40.071  44.245  1.00 61.21 ? 15  ARG A HD2  1  
ATOM 241    H HD3  . ARG A 1 15  ? 18.985  40.330  45.095  1.00 31.23 ? 15  ARG A HD3  1  
ATOM 242    H HE   . ARG A 1 15  ? 21.578  39.768  46.414  1.00 73.20 ? 15  ARG A HE   1  
ATOM 243    H HH11 . ARG A 1 15  ? 18.434  41.317  46.471  1.00 14.02 ? 15  ARG A HH11 1  
ATOM 244    H HH12 . ARG A 1 15  ? 18.718  42.104  47.994  1.00 41.43 ? 15  ARG A HH12 1  
ATOM 245    H HH21 . ARG A 1 15  ? 21.930  40.793  48.409  1.00 54.44 ? 15  ARG A HH21 1  
ATOM 246    H HH22 . ARG A 1 15  ? 20.697  41.805  49.093  1.00 74.44 ? 15  ARG A HH22 1  
ATOM 247    N N    . ASN A 1 16  ? 21.935  33.841  44.845  1.00 64.11 ? 16  ASN A N    1  
ATOM 248    C CA   . ASN A 1 16  ? 22.970  32.879  44.416  1.00 34.51 ? 16  ASN A CA   1  
ATOM 249    C C    . ASN A 1 16  ? 22.279  31.584  43.917  1.00 22.11 ? 16  ASN A C    1  
ATOM 250    O O    . ASN A 1 16  ? 22.935  30.590  43.591  1.00 54.15 ? 16  ASN A O    1  
ATOM 251    C CB   . ASN A 1 16  ? 23.947  32.604  45.599  1.00 54.44 ? 16  ASN A CB   1  
ATOM 252    C CG   . ASN A 1 16  ? 25.141  31.709  45.231  1.00 52.23 ? 16  ASN A CG   1  
ATOM 253    O OD1  . ASN A 1 16  ? 25.126  30.502  45.471  1.00 24.05 ? 16  ASN A OD1  1  
ATOM 254    N ND2  . ASN A 1 16  ? 26.153  32.290  44.604  1.00 44.44 ? 16  ASN A ND2  1  
ATOM 255    H H    . ASN A 1 16  ? 21.301  33.549  45.527  1.00 1.34  ? 16  ASN A H    1  
ATOM 256    H HA   . ASN A 1 16  ? 23.524  33.309  43.588  1.00 62.21 ? 16  ASN A HA   1  
ATOM 257    H HB2  . ASN A 1 16  ? 24.336  33.552  45.958  1.00 13.52 ? 16  ASN A HB2  1  
ATOM 258    H HB3  . ASN A 1 16  ? 23.400  32.133  46.409  1.00 60.22 ? 16  ASN A HB3  1  
ATOM 259    H HD21 . ASN A 1 16  ? 26.089  33.249  44.411  1.00 3.45  ? 16  ASN A HD21 1  
ATOM 260    H HD22 . ASN A 1 16  ? 26.930  31.742  44.373  1.00 71.20 ? 16  ASN A HD22 1  
ATOM 261    N N    . ALA A 1 17  ? 20.938  31.626  43.833  1.00 33.12 ? 17  ALA A N    1  
ATOM 262    C CA   . ALA A 1 17  ? 20.114  30.470  43.475  1.00 25.53 ? 17  ALA A CA   1  
ATOM 263    C C    . ALA A 1 17  ? 20.257  30.100  41.985  1.00 4.31  ? 17  ALA A C    1  
ATOM 264    O O    . ALA A 1 17  ? 20.251  30.975  41.113  1.00 64.31 ? 17  ALA A O    1  
ATOM 265    C CB   . ALA A 1 17  ? 18.654  30.742  43.842  1.00 0.22  ? 17  ALA A CB   1  
ATOM 266    H H    . ALA A 1 17  ? 20.485  32.476  44.015  1.00 62.41 ? 17  ALA A H    1  
ATOM 267    H HA   . ALA A 1 17  ? 20.450  29.628  44.079  1.00 53.42 ? 17  ALA A HA   1  
ATOM 268    H HB1  . ALA A 1 17  ? 18.048  29.869  43.633  1.00 13.24 ? 17  ALA A HB1  1  
ATOM 269    H HB2  . ALA A 1 17  ? 18.279  31.580  43.268  1.00 4.11  ? 17  ALA A HB2  1  
ATOM 270    H HB3  . ALA A 1 17  ? 18.582  30.978  44.897  1.00 74.14 ? 17  ALA A HB3  1  
ATOM 271    N N    . THR A 1 18  ? 20.383  28.791  41.721  1.00 12.10 ? 18  THR A N    1  
ATOM 272    C CA   . THR A 1 18  ? 20.518  28.226  40.365  1.00 20.51 ? 18  THR A CA   1  
ATOM 273    C C    . THR A 1 18  ? 19.131  28.000  39.728  1.00 61.00 ? 18  THR A C    1  
ATOM 274    O O    . THR A 1 18  ? 18.120  28.198  40.392  1.00 53.51 ? 18  THR A O    1  
ATOM 275    C CB   . THR A 1 18  ? 21.279  26.869  40.455  1.00 71.11 ? 18  THR A CB   1  
ATOM 276    O OG1  . THR A 1 18  ? 20.540  25.958  41.300  1.00 21.32 ? 18  THR A OG1  1  
ATOM 277    C CG2  . THR A 1 18  ? 22.702  27.049  41.018  1.00 30.11 ? 18  THR A CG2  1  
ATOM 278    H H    . THR A 1 18  ? 20.386  28.166  42.477  1.00 22.41 ? 18  THR A H    1  
ATOM 279    H HA   . THR A 1 18  ? 21.094  28.914  39.748  1.00 34.12 ? 18  THR A HA   1  
ATOM 280    H HB   . THR A 1 18  ? 21.353  26.439  39.459  1.00 43.00 ? 18  THR A HB   1  
ATOM 281    H HG1  . THR A 1 18  ? 21.132  25.578  41.960  1.00 72.52 ? 18  THR A HG1  1  
ATOM 282    H HG21 . THR A 1 18  ? 22.648  27.492  42.004  1.00 75.03 ? 18  THR A HG21 1  
ATOM 283    H HG22 . THR A 1 18  ? 23.278  27.694  40.366  1.00 63.31 ? 18  THR A HG22 1  
ATOM 284    H HG23 . THR A 1 18  ? 23.192  26.086  41.089  1.00 21.52 ? 18  THR A HG23 1  
ATOM 285    N N    . GLN A 1 19  ? 19.099  27.552  38.448  1.00 32.01 ? 19  GLN A N    1  
ATOM 286    C CA   . GLN A 1 19  ? 17.837  27.230  37.723  1.00 52.52 ? 19  GLN A CA   1  
ATOM 287    C C    . GLN A 1 19  ? 17.039  26.169  38.502  1.00 42.44 ? 19  GLN A C    1  
ATOM 288    O O    . GLN A 1 19  ? 15.807  26.232  38.559  1.00 21.31 ? 19  GLN A O    1  
ATOM 289    C CB   . GLN A 1 19  ? 18.160  26.749  36.268  1.00 64.21 ? 19  GLN A CB   1  
ATOM 290    C CG   . GLN A 1 19  ? 16.956  26.616  35.283  1.00 4.25  ? 19  GLN A CG   1  
ATOM 291    C CD   . GLN A 1 19  ? 16.069  25.374  35.482  1.00 43.12 ? 19  GLN A CD   1  
ATOM 292    O OE1  . GLN A 1 19  ? 16.530  24.327  35.937  1.00 22.20 ? 19  GLN A OE1  1  
ATOM 293    N NE2  . GLN A 1 19  ? 14.790  25.488  35.143  1.00 22.31 ? 19  GLN A NE2  1  
ATOM 294    H H    . GLN A 1 19  ? 19.951  27.435  37.974  1.00 23.55 ? 19  GLN A H    1  
ATOM 295    H HA   . GLN A 1 19  ? 17.247  28.144  37.669  1.00 21.23 ? 19  GLN A HA   1  
ATOM 296    H HB2  . GLN A 1 19  ? 18.858  27.456  35.832  1.00 71.11 ? 19  GLN A HB2  1  
ATOM 297    H HB3  . GLN A 1 19  ? 18.657  25.785  36.327  1.00 61.34 ? 19  GLN A HB3  1  
ATOM 298    H HG2  . GLN A 1 19  ? 16.334  27.496  35.381  1.00 50.40 ? 19  GLN A HG2  1  
ATOM 299    H HG3  . GLN A 1 19  ? 17.348  26.581  34.272  1.00 60.35 ? 19  GLN A HG3  1  
ATOM 300    H HE21 . GLN A 1 19  ? 14.483  26.347  34.784  1.00 14.33 ? 19  GLN A HE21 1  
ATOM 301    H HE22 . GLN A 1 19  ? 14.211  24.708  35.257  1.00 10.53 ? 19  GLN A HE22 1  
ATOM 302    N N    . GLU A 1 20  ? 17.768  25.208  39.101  1.00 43.42 ? 20  GLU A N    1  
ATOM 303    C CA   . GLU A 1 20  ? 17.179  24.182  39.978  1.00 14.00 ? 20  GLU A CA   1  
ATOM 304    C C    . GLU A 1 20  ? 16.408  24.827  41.143  1.00 30.23 ? 20  GLU A C    1  
ATOM 305    O O    . GLU A 1 20  ? 15.226  24.558  41.329  1.00 52.04 ? 20  GLU A O    1  
ATOM 306    C CB   . GLU A 1 20  ? 18.275  23.223  40.521  1.00 63.42 ? 20  GLU A CB   1  
ATOM 307    C CG   . GLU A 1 20  ? 18.728  22.129  39.529  1.00 72.43 ? 20  GLU A CG   1  
ATOM 308    C CD   . GLU A 1 20  ? 17.586  21.188  39.088  1.00 71.32 ? 20  GLU A CD   1  
ATOM 309    O OE1  . GLU A 1 20  ? 17.152  21.254  37.919  1.00 50.43 ? 20  GLU A OE1  1  
ATOM 310    O OE2  . GLU A 1 20  ? 17.108  20.379  39.924  1.00 34.04 ? 20  GLU A OE2  1  
ATOM 311    H H    . GLU A 1 20  ? 18.736  25.191  38.940  1.00 33.20 ? 20  GLU A H    1  
ATOM 312    H HA   . GLU A 1 20  ? 16.478  23.609  39.380  1.00 42.44 ? 20  GLU A HA   1  
ATOM 313    H HB2  . GLU A 1 20  ? 19.145  23.812  40.794  1.00 62.22 ? 20  GLU A HB2  1  
ATOM 314    H HB3  . GLU A 1 20  ? 17.909  22.729  41.418  1.00 71.23 ? 20  GLU A HB3  1  
ATOM 315    H HG2  . GLU A 1 20  ? 19.153  22.611  38.655  1.00 21.43 ? 20  GLU A HG2  1  
ATOM 316    H HG3  . GLU A 1 20  ? 19.499  21.535  40.006  1.00 64.13 ? 20  GLU A HG3  1  
ATOM 317    N N    . GLU A 1 21  ? 17.084  25.707  41.892  1.00 43.41 ? 21  GLU A N    1  
ATOM 318    C CA   . GLU A 1 21  ? 16.503  26.367  43.078  1.00 63.35 ? 21  GLU A CA   1  
ATOM 319    C C    . GLU A 1 21  ? 15.302  27.255  42.685  1.00 13.31 ? 21  GLU A C    1  
ATOM 320    O O    . GLU A 1 21  ? 14.291  27.272  43.386  1.00 23.14 ? 21  GLU A O    1  
ATOM 321    C CB   . GLU A 1 21  ? 17.600  27.175  43.807  1.00 53.01 ? 21  GLU A CB   1  
ATOM 322    C CG   . GLU A 1 21  ? 18.792  26.315  44.282  1.00 42.00 ? 21  GLU A CG   1  
ATOM 323    C CD   . GLU A 1 21  ? 19.889  27.116  45.004  1.00 34.34 ? 21  GLU A CD   1  
ATOM 324    O OE1  . GLU A 1 21  ? 19.669  27.523  46.169  1.00 30.12 ? 21  GLU A OE1  1  
ATOM 325    O OE2  . GLU A 1 21  ? 20.979  27.335  44.423  1.00 64.03 ? 21  GLU A OE2  1  
ATOM 326    H H    . GLU A 1 21  ? 18.004  25.932  41.629  1.00 42.04 ? 21  GLU A H    1  
ATOM 327    H HA   . GLU A 1 21  ? 16.148  25.582  43.746  1.00 21.52 ? 21  GLU A HA   1  
ATOM 328    H HB2  . GLU A 1 21  ? 17.976  27.937  43.134  1.00 42.13 ? 21  GLU A HB2  1  
ATOM 329    H HB3  . GLU A 1 21  ? 17.164  27.661  44.675  1.00 71.14 ? 21  GLU A HB3  1  
ATOM 330    H HG2  . GLU A 1 21  ? 18.421  25.553  44.962  1.00 11.52 ? 21  GLU A HG2  1  
ATOM 331    H HG3  . GLU A 1 21  ? 19.225  25.820  43.416  1.00 62.05 ? 21  GLU A HG3  1  
ATOM 332    N N    . ILE A 1 22  ? 15.427  27.939  41.534  1.00 12.02 ? 22  ILE A N    1  
ATOM 333    C CA   . ILE A 1 22  ? 14.344  28.742  40.910  1.00 32.53 ? 22  ILE A CA   1  
ATOM 334    C C    . ILE A 1 22  ? 13.120  27.852  40.594  1.00 5.22  ? 22  ILE A C    1  
ATOM 335    O O    . ILE A 1 22  ? 11.971  28.269  40.779  1.00 22.14 ? 22  ILE A O    1  
ATOM 336    C CB   . ILE A 1 22  ? 14.884  29.464  39.586  1.00 73.31 ? 22  ILE A CB   1  
ATOM 337    C CG1  . ILE A 1 22  ? 15.496  30.871  39.896  1.00 24.25 ? 22  ILE A CG1  1  
ATOM 338    C CG2  . ILE A 1 22  ? 13.812  29.589  38.463  1.00 50.13 ? 22  ILE A CG2  1  
ATOM 339    C CD1  . ILE A 1 22  ? 16.645  30.902  40.881  1.00 34.41 ? 22  ILE A CD1  1  
ATOM 340    H H    . ILE A 1 22  ? 16.285  27.892  41.069  1.00 22.21 ? 22  ILE A H    1  
ATOM 341    H HA   . ILE A 1 22  ? 14.044  29.505  41.623  1.00 11.44 ? 22  ILE A HA   1  
ATOM 342    H HB   . ILE A 1 22  ? 15.678  28.838  39.184  1.00 13.35 ? 22  ILE A HB   1  
ATOM 343    H HG12 . ILE A 1 22  ? 15.868  31.300  38.978  1.00 15.01 ? 22  ILE A HG12 1  
ATOM 344    H HG13 . ILE A 1 22  ? 14.719  31.519  40.288  1.00 1.11  ? 22  ILE A HG13 1  
ATOM 345    H HG21 . ILE A 1 22  ? 14.237  30.084  37.599  1.00 64.34 ? 22  ILE A HG21 1  
ATOM 346    H HG22 . ILE A 1 22  ? 12.966  30.164  38.823  1.00 72.44 ? 22  ILE A HG22 1  
ATOM 347    H HG23 . ILE A 1 22  ? 13.474  28.604  38.174  1.00 64.15 ? 22  ILE A HG23 1  
ATOM 348    H HD11 . ILE A 1 22  ? 17.477  30.334  40.490  1.00 42.01 ? 22  ILE A HD11 1  
ATOM 349    H HD12 . ILE A 1 22  ? 16.333  30.477  41.827  1.00 64.12 ? 22  ILE A HD12 1  
ATOM 350    H HD13 . ILE A 1 22  ? 16.954  31.924  41.037  1.00 61.03 ? 22  ILE A HD13 1  
ATOM 351    N N    . LYS A 1 23  ? 13.404  26.628  40.126  1.00 61.50 ? 23  LYS A N    1  
ATOM 352    C CA   . LYS A 1 23  ? 12.385  25.668  39.685  1.00 23.10 ? 23  LYS A CA   1  
ATOM 353    C C    . LYS A 1 23  ? 11.546  25.168  40.873  1.00 54.24 ? 23  LYS A C    1  
ATOM 354    O O    . LYS A 1 23  ? 10.325  25.306  40.859  1.00 41.52 ? 23  LYS A O    1  
ATOM 355    C CB   . LYS A 1 23  ? 13.062  24.485  38.950  1.00 45.01 ? 23  LYS A CB   1  
ATOM 356    C CG   . LYS A 1 23  ? 12.090  23.447  38.348  1.00 34.15 ? 23  LYS A CG   1  
ATOM 357    C CD   . LYS A 1 23  ? 12.830  22.240  37.731  1.00 51.42 ? 23  LYS A CD   1  
ATOM 358    C CE   . LYS A 1 23  ? 13.632  21.420  38.764  1.00 30.23 ? 23  LYS A CE   1  
ATOM 359    N NZ   . LYS A 1 23  ? 14.371  20.295  38.129  1.00 71.24 ? 23  LYS A NZ   1  
ATOM 360    H H    . LYS A 1 23  ? 14.345  26.362  40.078  1.00 44.52 ? 23  LYS A H    1  
ATOM 361    H HA   . LYS A 1 23  ? 11.731  26.180  38.984  1.00 72.54 ? 23  LYS A HA   1  
ATOM 362    H HB2  . LYS A 1 23  ? 13.671  24.884  38.145  1.00 1.11  ? 23  LYS A HB2  1  
ATOM 363    H HB3  . LYS A 1 23  ? 13.719  23.974  39.650  1.00 71.54 ? 23  LYS A HB3  1  
ATOM 364    H HG2  . LYS A 1 23  ? 11.423  23.094  39.124  1.00 43.32 ? 23  LYS A HG2  1  
ATOM 365    H HG3  . LYS A 1 23  ? 11.506  23.932  37.572  1.00 14.41 ? 23  LYS A HG3  1  
ATOM 366    H HD2  . LYS A 1 23  ? 12.100  21.589  37.265  1.00 63.44 ? 23  LYS A HD2  1  
ATOM 367    H HD3  . LYS A 1 23  ? 13.512  22.600  36.968  1.00 75.22 ? 23  LYS A HD3  1  
ATOM 368    H HE2  . LYS A 1 23  ? 14.349  22.065  39.252  1.00 13.01 ? 23  LYS A HE2  1  
ATOM 369    H HE3  . LYS A 1 23  ? 12.952  21.016  39.506  1.00 14.42 ? 23  LYS A HE3  1  
ATOM 370    H HZ1  . LYS A 1 23  ? 14.719  19.637  38.852  1.00 0.00  ? 23  LYS A HZ1  1  
ATOM 371    H HZ2  . LYS A 1 23  ? 15.192  20.661  37.594  1.00 31.23 ? 23  LYS A HZ2  1  
ATOM 372    H HZ3  . LYS A 1 23  ? 13.751  19.781  37.466  1.00 44.32 ? 23  LYS A HZ3  1  
ATOM 373    N N    . ARG A 1 24  ? 12.212  24.604  41.908  1.00 54.12 ? 24  ARG A N    1  
ATOM 374    C CA   . ARG A 1 24  ? 11.504  24.069  43.103  1.00 14.11 ? 24  ARG A CA   1  
ATOM 375    C C    . ARG A 1 24  ? 10.837  25.200  43.908  1.00 43.32 ? 24  ARG A C    1  
ATOM 376    O O    . ARG A 1 24  ? 9.828   24.963  44.580  1.00 3.10  ? 24  ARG A O    1  
ATOM 377    C CB   . ARG A 1 24  ? 12.432  23.239  44.036  1.00 23.54 ? 24  ARG A CB   1  
ATOM 378    C CG   . ARG A 1 24  ? 12.961  21.892  43.456  1.00 53.52 ? 24  ARG A CG   1  
ATOM 379    C CD   . ARG A 1 24  ? 14.316  22.018  42.742  1.00 53.41 ? 24  ARG A CD   1  
ATOM 380    N NE   . ARG A 1 24  ? 15.344  22.604  43.634  1.00 20.33 ? 24  ARG A NE   1  
ATOM 381    C CZ   . ARG A 1 24  ? 16.629  22.233  43.718  1.00 14.00 ? 24  ARG A CZ   1  
ATOM 382    N NH1  . ARG A 1 24  ? 17.123  21.264  42.951  1.00 44.10 ? 24  ARG A NH1  1  
ATOM 383    N NH2  . ARG A 1 24  ? 17.420  22.860  44.577  1.00 1.34  ? 24  ARG A NH2  1  
ATOM 384    H H    . ARG A 1 24  ? 13.194  24.570  41.877  1.00 73.12 ? 24  ARG A H    1  
ATOM 385    H HA   . ARG A 1 24  ? 10.715  23.418  42.739  1.00 43.14 ? 24  ARG A HA   1  
ATOM 386    H HB2  . ARG A 1 24  ? 13.287  23.850  44.302  1.00 5.12  ? 24  ARG A HB2  1  
ATOM 387    H HB3  . ARG A 1 24  ? 11.885  23.014  44.947  1.00 1.21  ? 24  ARG A HB3  1  
ATOM 388    H HG2  . ARG A 1 24  ? 13.072  21.185  44.272  1.00 41.30 ? 24  ARG A HG2  1  
ATOM 389    H HG3  . ARG A 1 24  ? 12.229  21.500  42.757  1.00 44.53 ? 24  ARG A HG3  1  
ATOM 390    H HD2  . ARG A 1 24  ? 14.632  21.035  42.414  1.00 62.34 ? 24  ARG A HD2  1  
ATOM 391    H HD3  . ARG A 1 24  ? 14.198  22.661  41.878  1.00 5.40  ? 24  ARG A HD3  1  
ATOM 392    H HE   . ARG A 1 24  ? 15.050  23.345  44.206  1.00 20.24 ? 24  ARG A HE   1  
ATOM 393    H HH11 . ARG A 1 24  ? 16.534  20.789  42.289  1.00 70.54 ? 24  ARG A HH11 1  
ATOM 394    H HH12 . ARG A 1 24  ? 18.089  21.003  43.029  1.00 31.32 ? 24  ARG A HH12 1  
ATOM 395    H HH21 . ARG A 1 24  ? 17.053  23.598  45.149  1.00 70.44 ? 24  ARG A HH21 1  
ATOM 396    H HH22 . ARG A 1 24  ? 18.387  22.604  44.656  1.00 32.03 ? 24  ARG A HH22 1  
ATOM 397    N N    . ALA A 1 25  ? 11.421  26.410  43.843  1.00 64.00 ? 25  ALA A N    1  
ATOM 398    C CA   . ALA A 1 25  ? 10.824  27.617  44.441  1.00 13.31 ? 25  ALA A CA   1  
ATOM 399    C C    . ALA A 1 25  ? 9.484   27.941  43.783  1.00 4.10  ? 25  ALA A C    1  
ATOM 400    O O    . ALA A 1 25  ? 8.458   28.108  44.469  1.00 11.13 ? 25  ALA A O    1  
ATOM 401    C CB   . ALA A 1 25  ? 11.781  28.800  44.301  1.00 14.12 ? 25  ALA A CB   1  
ATOM 402    H H    . ALA A 1 25  ? 12.289  26.490  43.385  1.00 12.10 ? 25  ALA A H    1  
ATOM 403    H HA   . ALA A 1 25  ? 10.668  27.431  45.502  1.00 25.44 ? 25  ALA A HA   1  
ATOM 404    H HB1  . ALA A 1 25  ? 11.357  29.676  44.770  1.00 42.35 ? 25  ALA A HB1  1  
ATOM 405    H HB2  . ALA A 1 25  ? 11.962  29.006  43.252  1.00 64.35 ? 25  ALA A HB2  1  
ATOM 406    H HB3  . ALA A 1 25  ? 12.720  28.559  44.780  1.00 72.43 ? 25  ALA A HB3  1  
ATOM 407    N N    . TYR A 1 26  ? 9.514   27.989  42.441  1.00 73.10 ? 26  TYR A N    1  
ATOM 408    C CA   . TYR A 1 26  ? 8.327   28.258  41.631  1.00 62.33 ? 26  TYR A CA   1  
ATOM 409    C C    . TYR A 1 26  ? 7.243   27.211  41.905  1.00 35.33 ? 26  TYR A C    1  
ATOM 410    O O    . TYR A 1 26  ? 6.099   27.573  42.099  1.00 41.30 ? 26  TYR A O    1  
ATOM 411    C CB   . TYR A 1 26  ? 8.668   28.288  40.116  1.00 63.33 ? 26  TYR A CB   1  
ATOM 412    C CG   . TYR A 1 26  ? 7.425   28.428  39.208  1.00 21.33 ? 26  TYR A CG   1  
ATOM 413    C CD1  . TYR A 1 26  ? 6.674   29.603  39.205  1.00 62.31 ? 26  TYR A CD1  1  
ATOM 414    C CD2  . TYR A 1 26  ? 6.996   27.380  38.385  1.00 44.25 ? 26  TYR A CD2  1  
ATOM 415    C CE1  . TYR A 1 26  ? 5.547   29.727  38.421  1.00 2.23  ? 26  TYR A CE1  1  
ATOM 416    C CE2  . TYR A 1 26  ? 5.873   27.503  37.597  1.00 50.03 ? 26  TYR A CE2  1  
ATOM 417    C CZ   . TYR A 1 26  ? 5.153   28.675  37.618  1.00 25.11 ? 26  TYR A CZ   1  
ATOM 418    O OH   . TYR A 1 26  ? 4.029   28.789  36.832  1.00 61.15 ? 26  TYR A OH   1  
ATOM 419    H H    . TYR A 1 26  ? 10.366  27.827  41.987  1.00 13.33 ? 26  TYR A H    1  
ATOM 420    H HA   . TYR A 1 26  ? 7.955   29.236  41.922  1.00 11.12 ? 26  TYR A HA   1  
ATOM 421    H HB2  . TYR A 1 26  ? 9.327   29.129  39.919  1.00 61.22 ? 26  TYR A HB2  1  
ATOM 422    H HB3  . TYR A 1 26  ? 9.188   27.373  39.850  1.00 51.32 ? 26  TYR A HB3  1  
ATOM 423    H HD1  . TYR A 1 26  ? 6.988   30.431  39.834  1.00 65.01 ? 26  TYR A HD1  1  
ATOM 424    H HD2  . TYR A 1 26  ? 7.563   26.460  38.371  1.00 53.42 ? 26  TYR A HD2  1  
ATOM 425    H HE1  . TYR A 1 26  ? 4.982   30.648  38.435  1.00 41.23 ? 26  TYR A HE1  1  
ATOM 426    H HE2  . TYR A 1 26  ? 5.562   26.681  36.967  1.00 55.44 ? 26  TYR A HE2  1  
ATOM 427    H HH   . TYR A 1 26  ? 4.017   29.659  36.419  1.00 41.14 ? 26  TYR A HH   1  
ATOM 428    N N    . LYS A 1 27  ? 7.639   25.923  41.935  1.00 54.35 ? 27  LYS A N    1  
ATOM 429    C CA   . LYS A 1 27  ? 6.706   24.791  42.127  1.00 31.03 ? 27  LYS A CA   1  
ATOM 430    C C    . LYS A 1 27  ? 6.024   24.862  43.504  1.00 3.22  ? 27  LYS A C    1  
ATOM 431    O O    . LYS A 1 27  ? 4.812   24.663  43.605  1.00 32.13 ? 27  LYS A O    1  
ATOM 432    C CB   . LYS A 1 27  ? 7.440   23.434  41.959  1.00 74.22 ? 27  LYS A CB   1  
ATOM 433    C CG   . LYS A 1 27  ? 7.985   23.172  40.533  1.00 1.35  ? 27  LYS A CG   1  
ATOM 434    C CD   . LYS A 1 27  ? 8.677   21.796  40.401  1.00 62.13 ? 27  LYS A CD   1  
ATOM 435    C CE   . LYS A 1 27  ? 7.711   20.628  40.672  1.00 22.10 ? 27  LYS A CE   1  
ATOM 436    N NZ   . LYS A 1 27  ? 8.373   19.307  40.554  1.00 63.53 ? 27  LYS A NZ   1  
ATOM 437    H H    . LYS A 1 27  ? 8.593   25.732  41.836  1.00 21.33 ? 27  LYS A H    1  
ATOM 438    H HA   . LYS A 1 27  ? 5.940   24.867  41.359  1.00 21.04 ? 27  LYS A HA   1  
ATOM 439    H HB2  . LYS A 1 27  ? 8.275   23.405  42.650  1.00 4.44  ? 27  LYS A HB2  1  
ATOM 440    H HB3  . LYS A 1 27  ? 6.753   22.631  42.211  1.00 54.14 ? 27  LYS A HB3  1  
ATOM 441    H HG2  . LYS A 1 27  ? 7.163   23.220  39.826  1.00 15.10 ? 27  LYS A HG2  1  
ATOM 442    H HG3  . LYS A 1 27  ? 8.703   23.947  40.288  1.00 53.13 ? 27  LYS A HG3  1  
ATOM 443    H HD2  . LYS A 1 27  ? 9.069   21.695  39.394  1.00 61.01 ? 27  LYS A HD2  1  
ATOM 444    H HD3  . LYS A 1 27  ? 9.501   21.742  41.106  1.00 71.53 ? 27  LYS A HD3  1  
ATOM 445    H HE2  . LYS A 1 27  ? 7.314   20.722  41.674  1.00 5.10  ? 27  LYS A HE2  1  
ATOM 446    H HE3  . LYS A 1 27  ? 6.894   20.672  39.962  1.00 13.20 ? 27  LYS A HE3  1  
ATOM 447    H HZ1  . LYS A 1 27  ? 7.666   18.546  40.623  1.00 54.41 ? 27  LYS A HZ1  1  
ATOM 448    H HZ2  . LYS A 1 27  ? 9.065   19.187  41.317  1.00 61.22 ? 27  LYS A HZ2  1  
ATOM 449    H HZ3  . LYS A 1 27  ? 8.862   19.229  39.640  1.00 62.05 ? 27  LYS A HZ3  1  
ATOM 450    N N    . ARG A 1 28  ? 6.821   25.161  44.543  1.00 44.23 ? 28  ARG A N    1  
ATOM 451    C CA   . ARG A 1 28  ? 6.327   25.359  45.924  1.00 1.11  ? 28  ARG A CA   1  
ATOM 452    C C    . ARG A 1 28  ? 5.223   26.433  45.956  1.00 54.20 ? 28  ARG A C    1  
ATOM 453    O O    . ARG A 1 28  ? 4.143   26.222  46.514  1.00 71.15 ? 28  ARG A O    1  
ATOM 454    C CB   . ARG A 1 28  ? 7.520   25.741  46.856  1.00 71.03 ? 28  ARG A CB   1  
ATOM 455    C CG   . ARG A 1 28  ? 7.132   26.355  48.221  1.00 33.32 ? 28  ARG A CG   1  
ATOM 456    C CD   . ARG A 1 28  ? 8.353   26.603  49.130  1.00 41.42 ? 28  ARG A CD   1  
ATOM 457    N NE   . ARG A 1 28  ? 9.465   27.288  48.426  1.00 64.35 ? 28  ARG A NE   1  
ATOM 458    C CZ   . ARG A 1 28  ? 9.611   28.615  48.273  1.00 3.42  ? 28  ARG A CZ   1  
ATOM 459    N NH1  . ARG A 1 28  ? 8.720   29.466  48.757  1.00 25.45 ? 28  ARG A NH1  1  
ATOM 460    N NH2  . ARG A 1 28  ? 10.668  29.078  47.634  1.00 14.03 ? 28  ARG A NH2  1  
ATOM 461    H H    . ARG A 1 28  ? 7.780   25.266  44.373  1.00 14.11 ? 28  ARG A H    1  
ATOM 462    H HA   . ARG A 1 28  ? 5.903   24.418  46.261  1.00 33.23 ? 28  ARG A HA   1  
ATOM 463    H HB2  . ARG A 1 28  ? 8.105   24.847  47.045  1.00 54.43 ? 28  ARG A HB2  1  
ATOM 464    H HB3  . ARG A 1 28  ? 8.151   26.455  46.335  1.00 75.52 ? 28  ARG A HB3  1  
ATOM 465    H HG2  . ARG A 1 28  ? 6.631   27.301  48.046  1.00 15.35 ? 28  ARG A HG2  1  
ATOM 466    H HG3  . ARG A 1 28  ? 6.446   25.681  48.727  1.00 33.23 ? 28  ARG A HG3  1  
ATOM 467    H HD2  . ARG A 1 28  ? 8.046   27.199  49.983  1.00 50.41 ? 28  ARG A HD2  1  
ATOM 468    H HD3  . ARG A 1 28  ? 8.716   25.647  49.489  1.00 5.34  ? 28  ARG A HD3  1  
ATOM 469    H HE   . ARG A 1 28  ? 10.153  26.704  48.036  1.00 55.35 ? 28  ARG A HE   1  
ATOM 470    H HH11 . ARG A 1 28  ? 7.915   29.127  49.248  1.00 13.55 ? 28  ARG A HH11 1  
ATOM 471    H HH12 . ARG A 1 28  ? 8.845   30.453  48.631  1.00 71.42 ? 28  ARG A HH12 1  
ATOM 472    H HH21 . ARG A 1 28  ? 11.352  28.441  47.271  1.00 34.04 ? 28  ARG A HH21 1  
ATOM 473    H HH22 . ARG A 1 28  ? 10.792  30.065  47.510  1.00 15.20 ? 28  ARG A HH22 1  
ATOM 474    N N    . LEU A 1 29  ? 5.500   27.563  45.308  1.00 74.11 ? 29  LEU A N    1  
ATOM 475    C CA   . LEU A 1 29  ? 4.566   28.702  45.234  1.00 25.41 ? 29  LEU A CA   1  
ATOM 476    C C    . LEU A 1 29  ? 3.436   28.449  44.206  1.00 11.04 ? 29  LEU A C    1  
ATOM 477    O O    . LEU A 1 29  ? 2.374   29.071  44.281  1.00 11.54 ? 29  LEU A O    1  
ATOM 478    C CB   . LEU A 1 29  ? 5.374   29.961  44.876  1.00 50.20 ? 29  LEU A CB   1  
ATOM 479    C CG   . LEU A 1 29  ? 6.512   30.334  45.883  1.00 71.12 ? 29  LEU A CG   1  
ATOM 480    C CD1  . LEU A 1 29  ? 7.350   31.518  45.364  1.00 31.42 ? 29  LEU A CD1  1  
ATOM 481    C CD2  . LEU A 1 29  ? 5.946   30.618  47.295  1.00 35.52 ? 29  LEU A CD2  1  
ATOM 482    H H    . LEU A 1 29  ? 6.374   27.641  44.851  1.00 32.54 ? 29  LEU A H    1  
ATOM 483    H HA   . LEU A 1 29  ? 4.116   28.840  46.214  1.00 32.53 ? 29  LEU A HA   1  
ATOM 484    H HB2  . LEU A 1 29  ? 5.822   29.806  43.894  1.00 52.44 ? 29  LEU A HB2  1  
ATOM 485    H HB3  . LEU A 1 29  ? 4.693   30.800  44.807  1.00 34.10 ? 29  LEU A HB3  1  
ATOM 486    H HG   . LEU A 1 29  ? 7.186   29.486  45.970  1.00 34.13 ? 29  LEU A HG   1  
ATOM 487    H HD11 . LEU A 1 29  ? 6.720   32.388  45.223  1.00 32.41 ? 29  LEU A HD11 1  
ATOM 488    H HD12 . LEU A 1 29  ? 7.806   31.254  44.417  1.00 63.51 ? 29  LEU A HD12 1  
ATOM 489    H HD13 . LEU A 1 29  ? 8.133   31.752  46.074  1.00 75.12 ? 29  LEU A HD13 1  
ATOM 490    H HD21 . LEU A 1 29  ? 6.759   30.849  47.975  1.00 21.01 ? 29  LEU A HD21 1  
ATOM 491    H HD22 . LEU A 1 29  ? 5.421   29.747  47.664  1.00 41.43 ? 29  LEU A HD22 1  
ATOM 492    H HD23 . LEU A 1 29  ? 5.262   31.456  47.256  1.00 11.50 ? 29  LEU A HD23 1  
ATOM 493    N N    . ALA A 1 30  ? 3.676   27.517  43.266  1.00 31.23 ? 30  ALA A N    1  
ATOM 494    C CA   . ALA A 1 30  ? 2.705   27.144  42.218  1.00 54.21 ? 30  ALA A CA   1  
ATOM 495    C C    . ALA A 1 30  ? 1.672   26.162  42.752  1.00 3.43  ? 30  ALA A C    1  
ATOM 496    O O    . ALA A 1 30  ? 0.611   26.019  42.165  1.00 63.30 ? 30  ALA A O    1  
ATOM 497    C CB   . ALA A 1 30  ? 3.411   26.555  40.981  1.00 62.31 ? 30  ALA A CB   1  
ATOM 498    H H    . ALA A 1 30  ? 4.535   27.054  43.287  1.00 71.54 ? 30  ALA A H    1  
ATOM 499    H HA   . ALA A 1 30  ? 2.192   28.047  41.903  1.00 3.33  ? 30  ALA A HA   1  
ATOM 500    H HB1  . ALA A 1 30  ? 2.684   26.342  40.205  1.00 32.54 ? 30  ALA A HB1  1  
ATOM 501    H HB2  . ALA A 1 30  ? 3.924   25.641  41.252  1.00 52.42 ? 30  ALA A HB2  1  
ATOM 502    H HB3  . ALA A 1 30  ? 4.133   27.267  40.605  1.00 24.51 ? 30  ALA A HB3  1  
ATOM 503    N N    . ARG A 1 31  ? 2.018   25.449  43.833  1.00 42.12 ? 31  ARG A N    1  
ATOM 504    C CA   . ARG A 1 31  ? 1.085   24.554  44.534  1.00 71.40 ? 31  ARG A CA   1  
ATOM 505    C C    . ARG A 1 31  ? 0.374   25.315  45.665  1.00 65.21 ? 31  ARG A C    1  
ATOM 506    O O    . ARG A 1 31  ? -0.833  25.158  45.865  1.00 13.44 ? 31  ARG A O    1  
ATOM 507    C CB   . ARG A 1 31  ? 1.826   23.317  45.102  1.00 1.35  ? 31  ARG A CB   1  
ATOM 508    C CG   . ARG A 1 31  ? 2.578   22.473  44.048  1.00 20.43 ? 31  ARG A CG   1  
ATOM 509    C CD   . ARG A 1 31  ? 3.160   21.172  44.634  1.00 41.30 ? 31  ARG A CD   1  
ATOM 510    N NE   . ARG A 1 31  ? 3.907   21.381  45.896  1.00 44.53 ? 31  ARG A NE   1  
ATOM 511    C CZ   . ARG A 1 31  ? 4.289   20.399  46.737  1.00 72.33 ? 31  ARG A CZ   1  
ATOM 512    N NH1  . ARG A 1 31  ? 4.018   19.124  46.464  1.00 0.13  ? 31  ARG A NH1  1  
ATOM 513    N NH2  . ARG A 1 31  ? 4.906   20.710  47.872  1.00 11.04 ? 31  ARG A NH2  1  
ATOM 514    H H    . ARG A 1 31  ? 2.940   25.519  44.162  1.00 23.02 ? 31  ARG A H    1  
ATOM 515    H HA   . ARG A 1 31  ? 0.335   24.215  43.820  1.00 53.00 ? 31  ARG A HA   1  
ATOM 516    H HB2  . ARG A 1 31  ? 2.550   23.652  45.842  1.00 33.22 ? 31  ARG A HB2  1  
ATOM 517    H HB3  . ARG A 1 31  ? 1.102   22.678  45.597  1.00 63.31 ? 31  ARG A HB3  1  
ATOM 518    H HG2  . ARG A 1 31  ? 1.892   22.218  43.242  1.00 65.21 ? 31  ARG A HG2  1  
ATOM 519    H HG3  . ARG A 1 31  ? 3.387   23.067  43.641  1.00 54.04 ? 31  ARG A HG3  1  
ATOM 520    H HD2  . ARG A 1 31  ? 2.345   20.484  44.821  1.00 64.14 ? 31  ARG A HD2  1  
ATOM 521    H HD3  . ARG A 1 31  ? 3.829   20.731  43.904  1.00 51.14 ? 31  ARG A HD3  1  
ATOM 522    H HE   . ARG A 1 31  ? 4.136   22.310  46.132  1.00 71.10 ? 31  ARG A HE   1  
ATOM 523    H HH11 . ARG A 1 31  ? 3.522   18.879  45.626  1.00 33.04 ? 31  ARG A HH11 1  
ATOM 524    H HH12 . ARG A 1 31  ? 4.306   18.401  47.098  1.00 0.44  ? 31  ARG A HH12 1  
ATOM 525    H HH21 . ARG A 1 31  ? 5.086   21.674  48.101  1.00 63.43 ? 31  ARG A HH21 1  
ATOM 526    H HH22 . ARG A 1 31  ? 5.196   19.988  48.508  1.00 63.04 ? 31  ARG A HH22 1  
ATOM 527    N N    . GLN A 1 32  ? 1.143   26.142  46.396  1.00 40.03 ? 32  GLN A N    1  
ATOM 528    C CA   . GLN A 1 32  ? 0.642   26.897  47.560  1.00 24.23 ? 32  GLN A CA   1  
ATOM 529    C C    . GLN A 1 32  ? -0.338  28.004  47.126  1.00 0.52  ? 32  GLN A C    1  
ATOM 530    O O    . GLN A 1 32  ? -1.486  28.046  47.583  1.00 25.41 ? 32  GLN A O    1  
ATOM 531    C CB   . GLN A 1 32  ? 1.833   27.493  48.353  1.00 35.23 ? 32  GLN A CB   1  
ATOM 532    C CG   . GLN A 1 32  ? 1.446   28.198  49.665  1.00 24.31 ? 32  GLN A CG   1  
ATOM 533    C CD   . GLN A 1 32  ? 2.647   28.744  50.442  1.00 63.33 ? 32  GLN A CD   1  
ATOM 534    O OE1  . GLN A 1 32  ? 3.748   28.202  50.369  1.00 55.41 ? 32  GLN A OE1  1  
ATOM 535    N NE2  . GLN A 1 32  ? 2.441   29.805  51.209  1.00 34.34 ? 32  GLN A NE2  1  
ATOM 536    H H    . GLN A 1 32  ? 2.081   26.247  46.143  1.00 60.12 ? 32  GLN A H    1  
ATOM 537    H HA   . GLN A 1 32  ? 0.114   26.197  48.203  1.00 44.31 ? 32  GLN A HA   1  
ATOM 538    H HB2  . GLN A 1 32  ? 2.518   26.689  48.594  1.00 14.40 ? 32  GLN A HB2  1  
ATOM 539    H HB3  . GLN A 1 32  ? 2.353   28.208  47.720  1.00 72.42 ? 32  GLN A HB3  1  
ATOM 540    H HG2  . GLN A 1 32  ? 0.779   29.022  49.432  1.00 34.44 ? 32  GLN A HG2  1  
ATOM 541    H HG3  . GLN A 1 32  ? 0.922   27.492  50.298  1.00 73.31 ? 32  GLN A HG3  1  
ATOM 542    H HE21 . GLN A 1 32  ? 1.535   30.186  51.242  1.00 11.41 ? 32  GLN A HE21 1  
ATOM 543    H HE22 . GLN A 1 32  ? 3.199   30.163  51.717  1.00 1.13  ? 32  GLN A HE22 1  
ATOM 544    N N    . TYR A 1 33  ? 0.118   28.882  46.218  1.00 13.43 ? 33  TYR A N    1  
ATOM 545    C CA   . TYR A 1 33  ? -0.709  29.989  45.685  1.00 62.14 ? 33  TYR A CA   1  
ATOM 546    C C    . TYR A 1 33  ? -1.337  29.585  44.336  1.00 62.40 ? 33  TYR A C    1  
ATOM 547    O O    . TYR A 1 33  ? -1.571  30.444  43.479  1.00 62.12 ? 33  TYR A O    1  
ATOM 548    C CB   . TYR A 1 33  ? 0.152   31.273  45.517  1.00 63.25 ? 33  TYR A CB   1  
ATOM 549    C CG   . TYR A 1 33  ? 0.917   31.710  46.781  1.00 3.51  ? 33  TYR A CG   1  
ATOM 550    C CD1  . TYR A 1 33  ? 0.288   31.762  48.026  1.00 11.12 ? 33  TYR A CD1  1  
ATOM 551    C CD2  . TYR A 1 33  ? 2.260   32.073  46.725  1.00 23.43 ? 33  TYR A CD2  1  
ATOM 552    C CE1  . TYR A 1 33  ? 0.972   32.156  49.163  1.00 62.41 ? 33  TYR A CE1  1  
ATOM 553    C CE2  . TYR A 1 33  ? 2.946   32.467  47.860  1.00 0.51  ? 33  TYR A CE2  1  
ATOM 554    C CZ   . TYR A 1 33  ? 2.299   32.507  49.073  1.00 31.53 ? 33  TYR A CZ   1  
ATOM 555    O OH   . TYR A 1 33  ? 2.987   32.901  50.203  1.00 24.21 ? 33  TYR A OH   1  
ATOM 556    H H    . TYR A 1 33  ? 1.036   28.782  45.887  1.00 21.41 ? 33  TYR A H    1  
ATOM 557    H HA   . TYR A 1 33  ? -1.512  30.192  46.388  1.00 32.42 ? 33  TYR A HA   1  
ATOM 558    H HB2  . TYR A 1 33  ? 0.871   31.108  44.724  1.00 72.41 ? 33  TYR A HB2  1  
ATOM 559    H HB3  . TYR A 1 33  ? -0.500  32.093  45.227  1.00 22.12 ? 33  TYR A HB3  1  
ATOM 560    H HD1  . TYR A 1 33  ? -0.758  31.485  48.102  1.00 52.42 ? 33  TYR A HD1  1  
ATOM 561    H HD2  . TYR A 1 33  ? 2.776   32.042  45.773  1.00 5.23  ? 33  TYR A HD2  1  
ATOM 562    H HE1  . TYR A 1 33  ? 0.461   32.186  50.115  1.00 14.24 ? 33  TYR A HE1  1  
ATOM 563    H HE2  . TYR A 1 33  ? 3.990   32.743  47.789  1.00 21.22 ? 33  TYR A HE2  1  
ATOM 564    H HH   . TYR A 1 33  ? 2.800   32.290  50.925  1.00 60.24 ? 33  TYR A HH   1  
ATOM 565    N N    . HIS A 1 34  ? -1.621  28.271  44.179  1.00 22.41 ? 34  HIS A N    1  
ATOM 566    C CA   . HIS A 1 34  ? -2.209  27.694  42.953  1.00 63.41 ? 34  HIS A CA   1  
ATOM 567    C C    . HIS A 1 34  ? -3.587  28.332  42.670  1.00 44.34 ? 34  HIS A C    1  
ATOM 568    O O    . HIS A 1 34  ? -4.568  27.924  43.279  1.00 42.21 ? 34  HIS A O    1  
ATOM 569    C CB   . HIS A 1 34  ? -2.333  26.152  43.108  1.00 21.53 ? 34  HIS A CB   1  
ATOM 570    C CG   . HIS A 1 34  ? -2.672  25.403  41.838  1.00 35.51 ? 34  HIS A CG   1  
ATOM 571    N ND1  . HIS A 1 34  ? -1.722  24.998  40.925  1.00 51.51 ? 34  HIS A ND1  1  
ATOM 572    C CD2  . HIS A 1 34  ? -3.859  24.997  41.333  1.00 2.04  ? 34  HIS A CD2  1  
ATOM 573    C CE1  . HIS A 1 34  ? -2.310  24.371  39.928  1.00 44.42 ? 34  HIS A CE1  1  
ATOM 574    N NE2  . HIS A 1 34  ? -3.603  24.359  40.149  1.00 14.42 ? 34  HIS A NE2  1  
ATOM 575    H H    . HIS A 1 34  ? -1.428  27.667  44.920  1.00 72.31 ? 34  HIS A H    1  
ATOM 576    H HA   . HIS A 1 34  ? -1.532  27.911  42.133  1.00 0.41  ? 34  HIS A HA   1  
ATOM 577    H HB2  . HIS A 1 34  ? -1.387  25.765  43.469  1.00 0.32  ? 34  HIS A HB2  1  
ATOM 578    H HB3  . HIS A 1 34  ? -3.094  25.924  43.844  1.00 42.50 ? 34  HIS A HB3  1  
ATOM 579    H HD1  . HIS A 1 34  ? -0.755  25.132  41.004  1.00 53.51 ? 34  HIS A HD1  1  
ATOM 580    H HD2  . HIS A 1 34  ? -4.833  25.153  41.785  1.00 73.54 ? 34  HIS A HD2  1  
ATOM 581    H HE1  . HIS A 1 34  ? -1.814  23.955  39.061  1.00 3.13  ? 34  HIS A HE1  1  
ATOM 582    H HE2  . HIS A 1 34  ? -4.271  23.923  39.576  1.00 37.66 ? 34  HIS A HE2  1  
ATOM 583    N N    . PRO A 1 35  ? -3.683  29.306  41.708  1.00 43.42 ? 35  PRO A N    1  
ATOM 584    C CA   . PRO A 1 35  ? -4.862  30.204  41.577  1.00 64.32 ? 35  PRO A CA   1  
ATOM 585    C C    . PRO A 1 35  ? -6.123  29.480  41.073  1.00 61.34 ? 35  PRO A C    1  
ATOM 586    O O    . PRO A 1 35  ? -7.216  30.025  41.133  1.00 14.44 ? 35  PRO A O    1  
ATOM 587    C CB   . PRO A 1 35  ? -4.372  31.255  40.558  1.00 2.32  ? 35  PRO A CB   1  
ATOM 588    C CG   . PRO A 1 35  ? -3.421  30.504  39.690  1.00 5.02  ? 35  PRO A CG   1  
ATOM 589    C CD   . PRO A 1 35  ? -2.684  29.576  40.634  1.00 74.13 ? 35  PRO A CD   1  
ATOM 590    H HA   . PRO A 1 35  ? -5.086  30.688  42.523  1.00 75.51 ? 35  PRO A HA   1  
ATOM 591    H HB2  . PRO A 1 35  ? -5.206  31.656  39.982  1.00 35.23 ? 35  PRO A HB2  1  
ATOM 592    H HB3  . PRO A 1 35  ? -3.856  32.067  41.067  1.00 51.03 ? 35  PRO A HB3  1  
ATOM 593    H HG2  . PRO A 1 35  ? -3.970  29.939  38.940  1.00 42.21 ? 35  PRO A HG2  1  
ATOM 594    H HG3  . PRO A 1 35  ? -2.725  31.184  39.216  1.00 13.42 ? 35  PRO A HG3  1  
ATOM 595    H HD2  . PRO A 1 35  ? -2.401  28.660  40.130  1.00 62.25 ? 35  PRO A HD2  1  
ATOM 596    H HD3  . PRO A 1 35  ? -1.807  30.064  41.043  1.00 2.42  ? 35  PRO A HD3  1  
ATOM 597    N N    . ASP A 1 36  ? -5.938  28.258  40.554  1.00 43.01 ? 36  ASP A N    1  
ATOM 598    C CA   . ASP A 1 36  ? -7.040  27.388  40.113  1.00 32.32 ? 36  ASP A CA   1  
ATOM 599    C C    . ASP A 1 36  ? -7.822  26.844  41.331  1.00 61.41 ? 36  ASP A C    1  
ATOM 600    O O    . ASP A 1 36  ? -9.045  26.696  41.278  1.00 33.14 ? 36  ASP A O    1  
ATOM 601    C CB   . ASP A 1 36  ? -6.453  26.243  39.254  1.00 33.43 ? 36  ASP A CB   1  
ATOM 602    C CG   . ASP A 1 36  ? -7.508  25.340  38.599  1.00 11.23 ? 36  ASP A CG   1  
ATOM 603    O OD1  . ASP A 1 36  ? -8.132  25.769  37.604  1.00 72.42 ? 36  ASP A OD1  1  
ATOM 604    O OD2  . ASP A 1 36  ? -7.700  24.195  39.060  1.00 72.45 ? 36  ASP A OD2  1  
ATOM 605    H H    . ASP A 1 36  ? -5.020  27.939  40.441  1.00 31.13 ? 36  ASP A H    1  
ATOM 606    H HA   . ASP A 1 36  ? -7.711  27.985  39.498  1.00 62.51 ? 36  ASP A HA   1  
ATOM 607    H HB2  . ASP A 1 36  ? -5.844  26.677  38.468  1.00 23.42 ? 36  ASP A HB2  1  
ATOM 608    H HB3  . ASP A 1 36  ? -5.809  25.635  39.882  1.00 73.23 ? 36  ASP A HB3  1  
ATOM 609    N N    . VAL A 1 37  ? -7.100  26.577  42.435  1.00 65.53 ? 37  VAL A N    1  
ATOM 610    C CA   . VAL A 1 37  ? -7.702  26.081  43.694  1.00 31.02 ? 37  VAL A CA   1  
ATOM 611    C C    . VAL A 1 37  ? -7.991  27.274  44.631  1.00 20.32 ? 37  VAL A C    1  
ATOM 612    O O    . VAL A 1 37  ? -9.093  27.418  45.163  1.00 25.12 ? 37  VAL A O    1  
ATOM 613    C CB   . VAL A 1 37  ? -6.760  25.037  44.417  1.00 5.34  ? 37  VAL A CB   1  
ATOM 614    C CG1  . VAL A 1 37  ? -7.360  24.539  45.755  1.00 3.03  ? 37  VAL A CG1  1  
ATOM 615    C CG2  . VAL A 1 37  ? -6.443  23.839  43.493  1.00 44.44 ? 37  VAL A CG2  1  
ATOM 616    H H    . VAL A 1 37  ? -6.134  26.746  42.412  1.00 44.20 ? 37  VAL A H    1  
ATOM 617    H HA   . VAL A 1 37  ? -8.641  25.586  43.453  1.00 3.04  ? 37  VAL A HA   1  
ATOM 618    H HB   . VAL A 1 37  ? -5.819  25.539  44.643  1.00 73.25 ? 37  VAL A HB   1  
ATOM 619    H HG11 . VAL A 1 37  ? -8.303  24.035  45.574  1.00 15.41 ? 37  VAL A HG11 1  
ATOM 620    H HG12 . VAL A 1 37  ? -7.527  25.377  46.417  1.00 55.23 ? 37  VAL A HG12 1  
ATOM 621    H HG13 . VAL A 1 37  ? -6.672  23.850  46.228  1.00 2.54  ? 37  VAL A HG13 1  
ATOM 622    H HG21 . VAL A 1 37  ? -5.982  24.195  42.581  1.00 35.12 ? 37  VAL A HG21 1  
ATOM 623    H HG22 . VAL A 1 37  ? -7.354  23.308  43.246  1.00 64.12 ? 37  VAL A HG22 1  
ATOM 624    H HG23 . VAL A 1 37  ? -5.760  23.162  43.993  1.00 53.42 ? 37  VAL A HG23 1  
ATOM 625    N N    . ASN A 1 38  ? -6.975  28.135  44.800  1.00 22.44 ? 38  ASN A N    1  
ATOM 626    C CA   . ASN A 1 38  ? -7.028  29.311  45.684  1.00 3.32  ? 38  ASN A CA   1  
ATOM 627    C C    . ASN A 1 38  ? -7.288  30.576  44.842  1.00 11.34 ? 38  ASN A C    1  
ATOM 628    O O    . ASN A 1 38  ? -6.382  31.399  44.595  1.00 55.00 ? 38  ASN A O    1  
ATOM 629    C CB   . ASN A 1 38  ? -5.700  29.415  46.501  1.00 51.23 ? 38  ASN A CB   1  
ATOM 630    C CG   . ASN A 1 38  ? -5.696  30.512  47.576  1.00 1.42  ? 38  ASN A CG   1  
ATOM 631    O OD1  . ASN A 1 38  ? -6.730  30.845  48.159  1.00 61.35 ? 38  ASN A OD1  1  
ATOM 632    N ND2  . ASN A 1 38  ? -4.524  31.064  47.860  1.00 0.12  ? 38  ASN A ND2  1  
ATOM 633    H H    . ASN A 1 38  ? -6.160  27.974  44.309  1.00 52.31 ? 38  ASN A H    1  
ATOM 634    H HA   . ASN A 1 38  ? -7.859  29.186  46.377  1.00 44.43 ? 38  ASN A HA   1  
ATOM 635    H HB2  . ASN A 1 38  ? -5.524  28.473  47.000  1.00 51.11 ? 38  ASN A HB2  1  
ATOM 636    H HB3  . ASN A 1 38  ? -4.882  29.601  45.813  1.00 33.24 ? 38  ASN A HB3  1  
ATOM 637    H HD21 . ASN A 1 38  ? -3.735  30.744  47.375  1.00 64.12 ? 38  ASN A HD21 1  
ATOM 638    H HD22 . ASN A 1 38  ? -4.496  31.772  48.537  1.00 34.00 ? 38  ASN A HD22 1  
ATOM 639    N N    . LYS A 1 39  ? -8.534  30.684  44.346  1.00 14.21 ? 39  LYS A N    1  
ATOM 640    C CA   . LYS A 1 39  ? -8.992  31.851  43.578  1.00 3.21  ? 39  LYS A CA   1  
ATOM 641    C C    . LYS A 1 39  ? -9.212  33.027  44.544  1.00 44.22 ? 39  LYS A C    1  
ATOM 642    O O    . LYS A 1 39  ? -10.328 33.257  45.029  1.00 11.12 ? 39  LYS A O    1  
ATOM 643    C CB   . LYS A 1 39  ? -10.300 31.527  42.801  1.00 62.53 ? 39  LYS A CB   1  
ATOM 644    C CG   . LYS A 1 39  ? -10.204 30.315  41.847  1.00 13.54 ? 39  LYS A CG   1  
ATOM 645    C CD   . LYS A 1 39  ? -11.527 30.027  41.103  1.00 11.12 ? 39  LYS A CD   1  
ATOM 646    C CE   . LYS A 1 39  ? -12.693 29.737  42.060  1.00 53.42 ? 39  LYS A CE   1  
ATOM 647    N NZ   . LYS A 1 39  ? -13.947 29.415  41.336  1.00 73.11 ? 39  LYS A NZ   1  
ATOM 648    H H    . LYS A 1 39  ? -9.169  29.956  44.512  1.00 63.34 ? 39  LYS A H    1  
ATOM 649    H HA   . LYS A 1 39  ? -8.213  32.122  42.865  1.00 31.14 ? 39  LYS A HA   1  
ATOM 650    H HB2  . LYS A 1 39  ? -11.089 31.331  43.520  1.00 1.01  ? 39  LYS A HB2  1  
ATOM 651    H HB3  . LYS A 1 39  ? -10.578 32.399  42.217  1.00 41.35 ? 39  LYS A HB3  1  
ATOM 652    H HG2  . LYS A 1 39  ? -9.434  30.515  41.111  1.00 34.44 ? 39  LYS A HG2  1  
ATOM 653    H HG3  . LYS A 1 39  ? -9.924  29.439  42.421  1.00 65.51 ? 39  LYS A HG3  1  
ATOM 654    H HD2  . LYS A 1 39  ? -11.783 30.888  40.494  1.00 33.13 ? 39  LYS A HD2  1  
ATOM 655    H HD3  . LYS A 1 39  ? -11.384 29.168  40.454  1.00 33.31 ? 39  LYS A HD3  1  
ATOM 656    H HE2  . LYS A 1 39  ? -12.434 28.897  42.688  1.00 14.23 ? 39  LYS A HE2  1  
ATOM 657    H HE3  . LYS A 1 39  ? -12.866 30.607  42.682  1.00 4.14  ? 39  LYS A HE3  1  
ATOM 658    H HZ1  . LYS A 1 39  ? -13.793 28.601  40.705  1.00 11.30 ? 39  LYS A HZ1  1  
ATOM 659    H HZ2  . LYS A 1 39  ? -14.252 30.227  40.763  1.00 42.22 ? 39  LYS A HZ2  1  
ATOM 660    H HZ3  . LYS A 1 39  ? -14.700 29.174  42.010  1.00 22.02 ? 39  LYS A HZ3  1  
ATOM 661    N N    . SER A 1 40  ? -8.116  33.705  44.890  1.00 54.41 ? 40  SER A N    1  
ATOM 662    C CA   . SER A 1 40  ? -8.134  34.887  45.761  1.00 44.02 ? 40  SER A CA   1  
ATOM 663    C C    . SER A 1 40  ? -7.156  35.933  45.195  1.00 15.14 ? 40  SER A C    1  
ATOM 664    O O    . SER A 1 40  ? -5.942  35.686  45.244  1.00 25.32 ? 40  SER A O    1  
ATOM 665    C CB   . SER A 1 40  ? -7.765  34.485  47.208  1.00 12.33 ? 40  SER A CB   1  
ATOM 666    O OG   . SER A 1 40  ? -8.711  33.565  47.735  1.00 34.14 ? 40  SER A OG   1  
ATOM 667    H H    . SER A 1 40  ? -7.248  33.388  44.551  1.00 4.50  ? 40  SER A H    1  
ATOM 668    H HA   . SER A 1 40  ? -9.137  35.296  45.760  1.00 12.25 ? 40  SER A HA   1  
ATOM 669    H HB2  . SER A 1 40  ? -6.789  34.020  47.226  1.00 41.22 ? 40  SER A HB2  1  
ATOM 670    H HB3  . SER A 1 40  ? -7.757  35.362  47.844  1.00 71.24 ? 40  SER A HB3  1  
ATOM 671    H HG   . SER A 1 40  ? -9.494  33.553  47.182  1.00 23.12 ? 40  SER A HG   1  
ATOM 672    N N    . PRO A 1 41  ? -7.683  37.081  44.610  1.00 43.24 ? 41  PRO A N    1  
ATOM 673    C CA   . PRO A 1 41  ? -6.890  38.139  43.925  1.00 35.35 ? 41  PRO A CA   1  
ATOM 674    C C    . PRO A 1 41  ? -5.461  38.359  44.461  1.00 72.23 ? 41  PRO A C    1  
ATOM 675    O O    . PRO A 1 41  ? -4.513  38.287  43.689  1.00 22.13 ? 41  PRO A O    1  
ATOM 676    C CB   . PRO A 1 41  ? -7.780  39.372  44.143  1.00 14.24 ? 41  PRO A CB   1  
ATOM 677    C CG   . PRO A 1 41  ? -9.176  38.844  44.012  1.00 64.11 ? 41  PRO A CG   1  
ATOM 678    C CD   . PRO A 1 41  ? -9.139  37.418  44.542  1.00 53.32 ? 41  PRO A CD   1  
ATOM 679    H HA   . PRO A 1 41  ? -6.828  37.930  42.862  1.00 34.23 ? 41  PRO A HA   1  
ATOM 680    H HB2  . PRO A 1 41  ? -7.608  39.790  45.136  1.00 52.04 ? 41  PRO A HB2  1  
ATOM 681    H HB3  . PRO A 1 41  ? -7.586  40.122  43.386  1.00 73.53 ? 41  PRO A HB3  1  
ATOM 682    H HG2  . PRO A 1 41  ? -9.855  39.455  44.601  1.00 22.32 ? 41  PRO A HG2  1  
ATOM 683    H HG3  . PRO A 1 41  ? -9.483  38.845  42.972  1.00 24.21 ? 41  PRO A HG3  1  
ATOM 684    H HD2  . PRO A 1 41  ? -9.589  37.366  45.528  1.00 35.30 ? 41  PRO A HD2  1  
ATOM 685    H HD3  . PRO A 1 41  ? -9.651  36.741  43.870  1.00 51.50 ? 41  PRO A HD3  1  
ATOM 686    N N    . GLU A 1 42  ? -5.322  38.566  45.786  1.00 10.51 ? 42  GLU A N    1  
ATOM 687    C CA   . GLU A 1 42  ? -4.008  38.781  46.450  1.00 44.41 ? 42  GLU A CA   1  
ATOM 688    C C    . GLU A 1 42  ? -2.990  37.680  46.075  1.00 24.53 ? 42  GLU A C    1  
ATOM 689    O O    . GLU A 1 42  ? -1.884  37.971  45.594  1.00 64.43 ? 42  GLU A O    1  
ATOM 690    C CB   . GLU A 1 42  ? -4.197  38.848  47.995  1.00 34.41 ? 42  GLU A CB   1  
ATOM 691    C CG   . GLU A 1 42  ? -2.898  38.946  48.832  1.00 35.12 ? 42  GLU A CG   1  
ATOM 692    C CD   . GLU A 1 42  ? -2.086  40.233  48.587  1.00 53.11 ? 42  GLU A CD   1  
ATOM 693    O OE1  . GLU A 1 42  ? -2.466  41.299  49.131  1.00 32.03 ? 42  GLU A OE1  1  
ATOM 694    O OE2  . GLU A 1 42  ? -1.068  40.194  47.852  1.00 14.03 ? 42  GLU A OE2  1  
ATOM 695    H H    . GLU A 1 42  ? -6.128  38.570  46.339  1.00 44.21 ? 42  GLU A H    1  
ATOM 696    H HA   . GLU A 1 42  ? -3.626  39.738  46.110  1.00 13.33 ? 42  GLU A HA   1  
ATOM 697    H HB2  . GLU A 1 42  ? -4.808  39.713  48.225  1.00 51.02 ? 42  GLU A HB2  1  
ATOM 698    H HB3  . GLU A 1 42  ? -4.734  37.960  48.315  1.00 23.25 ? 42  GLU A HB3  1  
ATOM 699    H HG2  . GLU A 1 42  ? -3.165  38.903  49.883  1.00 1.32  ? 42  GLU A HG2  1  
ATOM 700    H HG3  . GLU A 1 42  ? -2.277  38.085  48.604  1.00 0.14  ? 42  GLU A HG3  1  
ATOM 701    N N    . ALA A 1 43  ? -3.419  36.423  46.237  1.00 30.22 ? 43  ALA A N    1  
ATOM 702    C CA   . ALA A 1 43  ? -2.576  35.238  45.985  1.00 32.23 ? 43  ALA A CA   1  
ATOM 703    C C    . ALA A 1 43  ? -2.298  35.045  44.485  1.00 34.22 ? 43  ALA A C    1  
ATOM 704    O O    . ALA A 1 43  ? -1.306  34.416  44.118  1.00 31.10 ? 43  ALA A O    1  
ATOM 705    C CB   . ALA A 1 43  ? -3.248  33.984  46.571  1.00 72.14 ? 43  ALA A CB   1  
ATOM 706    H H    . ALA A 1 43  ? -4.349  36.285  46.512  1.00 30.13 ? 43  ALA A H    1  
ATOM 707    H HA   . ALA A 1 43  ? -1.629  35.382  46.502  1.00 72.32 ? 43  ALA A HA   1  
ATOM 708    H HB1  . ALA A 1 43  ? -2.609  33.119  46.425  1.00 22.32 ? 43  ALA A HB1  1  
ATOM 709    H HB2  . ALA A 1 43  ? -4.196  33.813  46.083  1.00 73.42 ? 43  ALA A HB2  1  
ATOM 710    H HB3  . ALA A 1 43  ? -3.421  34.129  47.632  1.00 4.43  ? 43  ALA A HB3  1  
ATOM 711    N N    . GLU A 1 44  ? -3.169  35.619  43.633  1.00 34.43 ? 44  GLU A N    1  
ATOM 712    C CA   . GLU A 1 44  ? -3.123  35.424  42.174  1.00 3.42  ? 44  GLU A CA   1  
ATOM 713    C C    . GLU A 1 44  ? -2.213  36.474  41.519  1.00 43.24 ? 44  GLU A C    1  
ATOM 714    O O    . GLU A 1 44  ? -1.486  36.161  40.577  1.00 13.53 ? 44  GLU A O    1  
ATOM 715    C CB   . GLU A 1 44  ? -4.557  35.472  41.589  1.00 44.45 ? 44  GLU A CB   1  
ATOM 716    C CG   . GLU A 1 44  ? -5.503  34.401  42.175  1.00 62.01 ? 44  GLU A CG   1  
ATOM 717    C CD   . GLU A 1 44  ? -6.916  34.450  41.579  1.00 10.34 ? 44  GLU A CD   1  
ATOM 718    O OE1  . GLU A 1 44  ? -7.676  35.381  41.918  1.00 33.01 ? 44  GLU A OE1  1  
ATOM 719    O OE2  . GLU A 1 44  ? -7.269  33.570  40.759  1.00 2.22  ? 44  GLU A OE2  1  
ATOM 720    H H    . GLU A 1 44  ? -3.851  36.230  43.998  1.00 42.24 ? 44  GLU A H    1  
ATOM 721    H HA   . GLU A 1 44  ? -2.701  34.443  41.977  1.00 63.35 ? 44  GLU A HA   1  
ATOM 722    H HB2  . GLU A 1 44  ? -4.983  36.449  41.792  1.00 3.44  ? 44  GLU A HB2  1  
ATOM 723    H HB3  . GLU A 1 44  ? -4.506  35.329  40.514  1.00 13.30 ? 44  GLU A HB3  1  
ATOM 724    H HG2  . GLU A 1 44  ? -5.073  33.421  41.995  1.00 61.45 ? 44  GLU A HG2  1  
ATOM 725    H HG3  . GLU A 1 44  ? -5.575  34.549  43.251  1.00 10.04 ? 44  GLU A HG3  1  
ATOM 726    N N    . GLU A 1 45  ? -2.246  37.714  42.035  1.00 2.31  ? 45  GLU A N    1  
ATOM 727    C CA   . GLU A 1 45  ? -1.356  38.794  41.577  1.00 34.41 ? 45  GLU A CA   1  
ATOM 728    C C    . GLU A 1 45  ? 0.076   38.484  42.037  1.00 22.23 ? 45  GLU A C    1  
ATOM 729    O O    . GLU A 1 45  ? 1.046   38.653  41.280  1.00 5.14  ? 45  GLU A O    1  
ATOM 730    C CB   . GLU A 1 45  ? -1.812  40.166  42.136  1.00 62.44 ? 45  GLU A CB   1  
ATOM 731    C CG   . GLU A 1 45  ? -3.266  40.563  41.807  1.00 21.21 ? 45  GLU A CG   1  
ATOM 732    C CD   . GLU A 1 45  ? -3.555  40.691  40.304  1.00 51.03 ? 45  GLU A CD   1  
ATOM 733    O OE1  . GLU A 1 45  ? -4.269  39.836  39.738  1.00 3.32  ? 45  GLU A OE1  1  
ATOM 734    O OE2  . GLU A 1 45  ? -3.066  41.658  39.675  1.00 0.12  ? 45  GLU A OE2  1  
ATOM 735    H H    . GLU A 1 45  ? -2.868  37.902  42.759  1.00 51.22 ? 45  GLU A H    1  
ATOM 736    H HA   . GLU A 1 45  ? -1.382  38.821  40.491  1.00 21.01 ? 45  GLU A HA   1  
ATOM 737    H HB2  . GLU A 1 45  ? -1.714  40.146  43.217  1.00 43.34 ? 45  GLU A HB2  1  
ATOM 738    H HB3  . GLU A 1 45  ? -1.155  40.936  41.747  1.00 2.35  ? 45  GLU A HB3  1  
ATOM 739    H HG2  . GLU A 1 45  ? -3.929  39.818  42.232  1.00 23.23 ? 45  GLU A HG2  1  
ATOM 740    H HG3  . GLU A 1 45  ? -3.476  41.517  42.283  1.00 22.22 ? 45  GLU A HG3  1  
ATOM 741    N N    . LYS A 1 46  ? 0.171   38.000  43.292  1.00 72.15 ? 46  LYS A N    1  
ATOM 742    C CA   . LYS A 1 46  ? 1.428   37.516  43.873  1.00 50.12 ? 46  LYS A CA   1  
ATOM 743    C C    . LYS A 1 46  ? 1.984   36.358  43.032  1.00 72.51 ? 46  LYS A C    1  
ATOM 744    O O    . LYS A 1 46  ? 3.173   36.344  42.701  1.00 72.02 ? 46  LYS A O    1  
ATOM 745    C CB   . LYS A 1 46  ? 1.213   37.078  45.350  1.00 13.31 ? 46  LYS A CB   1  
ATOM 746    C CG   . LYS A 1 46  ? 2.498   36.647  46.102  1.00 64.22 ? 46  LYS A CG   1  
ATOM 747    C CD   . LYS A 1 46  ? 3.598   37.740  46.113  1.00 42.20 ? 46  LYS A CD   1  
ATOM 748    C CE   . LYS A 1 46  ? 3.140   39.052  46.775  1.00 72.13 ? 46  LYS A CE   1  
ATOM 749    N NZ   . LYS A 1 46  ? 4.147   40.132  46.615  1.00 74.03 ? 46  LYS A NZ   1  
ATOM 750    H H    . LYS A 1 46  ? -0.642  37.979  43.849  1.00 50.31 ? 46  LYS A H    1  
ATOM 751    H HA   . LYS A 1 46  ? 2.136   38.340  43.851  1.00 30.33 ? 46  LYS A HA   1  
ATOM 752    H HB2  . LYS A 1 46  ? 0.761   37.901  45.891  1.00 44.24 ? 46  LYS A HB2  1  
ATOM 753    H HB3  . LYS A 1 46  ? 0.516   36.242  45.367  1.00 73.34 ? 46  LYS A HB3  1  
ATOM 754    H HG2  . LYS A 1 46  ? 2.235   36.404  47.127  1.00 34.42 ? 46  LYS A HG2  1  
ATOM 755    H HG3  . LYS A 1 46  ? 2.895   35.757  45.626  1.00 71.30 ? 46  LYS A HG3  1  
ATOM 756    H HD2  . LYS A 1 46  ? 4.457   37.360  46.658  1.00 41.11 ? 46  LYS A HD2  1  
ATOM 757    H HD3  . LYS A 1 46  ? 3.897   37.948  45.092  1.00 55.32 ? 46  LYS A HD3  1  
ATOM 758    H HE2  . LYS A 1 46  ? 2.215   39.376  46.317  1.00 72.43 ? 46  LYS A HE2  1  
ATOM 759    H HE3  . LYS A 1 46  ? 2.973   38.880  47.832  1.00 24.53 ? 46  LYS A HE3  1  
ATOM 760    H HZ1  . LYS A 1 46  ? 4.207   40.416  45.614  1.00 32.33 ? 46  LYS A HZ1  1  
ATOM 761    H HZ2  . LYS A 1 46  ? 5.082   39.803  46.925  1.00 52.43 ? 46  LYS A HZ2  1  
ATOM 762    H HZ3  . LYS A 1 46  ? 3.878   40.963  47.183  1.00 32.33 ? 46  LYS A HZ3  1  
ATOM 763    N N    . PHE A 1 47  ? 1.090   35.416  42.669  1.00 73.24 ? 47  PHE A N    1  
ATOM 764    C CA   . PHE A 1 47  ? 1.427   34.272  41.803  1.00 30.41 ? 47  PHE A CA   1  
ATOM 765    C C    . PHE A 1 47  ? 1.974   34.749  40.450  1.00 63.15 ? 47  PHE A C    1  
ATOM 766    O O    . PHE A 1 47  ? 2.925   34.177  39.933  1.00 35.13 ? 47  PHE A O    1  
ATOM 767    C CB   . PHE A 1 47  ? 0.194   33.358  41.594  1.00 0.04  ? 47  PHE A CB   1  
ATOM 768    C CG   . PHE A 1 47  ? 0.468   32.126  40.728  1.00 33.11 ? 47  PHE A CG   1  
ATOM 769    C CD1  . PHE A 1 47  ? 1.303   31.112  41.189  1.00 24.00 ? 47  PHE A CD1  1  
ATOM 770    C CD2  . PHE A 1 47  ? -0.098  31.993  39.460  1.00 4.21  ? 47  PHE A CD2  1  
ATOM 771    C CE1  . PHE A 1 47  ? 1.557   30.004  40.413  1.00 14.31 ? 47  PHE A CE1  1  
ATOM 772    C CE2  . PHE A 1 47  ? 0.158   30.877  38.684  1.00 51.42 ? 47  PHE A CE2  1  
ATOM 773    C CZ   . PHE A 1 47  ? 0.985   29.882  39.165  1.00 64.23 ? 47  PHE A CZ   1  
ATOM 774    H H    . PHE A 1 47  ? 0.169   35.495  42.999  1.00 73.32 ? 47  PHE A H    1  
ATOM 775    H HA   . PHE A 1 47  ? 2.198   33.699  42.308  1.00 64.45 ? 47  PHE A HA   1  
ATOM 776    H HB2  . PHE A 1 47  ? -0.154  33.014  42.564  1.00 55.53 ? 47  PHE A HB2  1  
ATOM 777    H HB3  . PHE A 1 47  ? -0.601  33.940  41.134  1.00 32.14 ? 47  PHE A HB3  1  
ATOM 778    H HD1  . PHE A 1 47  ? 1.755   31.196  42.174  1.00 35.22 ? 47  PHE A HD1  1  
ATOM 779    H HD2  . PHE A 1 47  ? -0.747  32.776  39.082  1.00 2.43  ? 47  PHE A HD2  1  
ATOM 780    H HE1  . PHE A 1 47  ? 2.209   29.231  40.783  1.00 42.35 ? 47  PHE A HE1  1  
ATOM 781    H HE2  . PHE A 1 47  ? -0.292  30.785  37.707  1.00 64.10 ? 47  PHE A HE2  1  
ATOM 782    H HZ   . PHE A 1 47  ? 1.188   29.009  38.560  1.00 42.31 ? 47  PHE A HZ   1  
ATOM 783    N N    . LYS A 1 48  ? 1.371   35.802  39.891  1.00 44.32 ? 48  LYS A N    1  
ATOM 784    C CA   . LYS A 1 48  ? 1.817   36.376  38.613  1.00 74.42 ? 48  LYS A CA   1  
ATOM 785    C C    . LYS A 1 48  ? 3.208   37.019  38.729  1.00 25.13 ? 48  LYS A C    1  
ATOM 786    O O    . LYS A 1 48  ? 3.966   36.994  37.764  1.00 75.14 ? 48  LYS A O    1  
ATOM 787    C CB   . LYS A 1 48  ? 0.797   37.395  38.076  1.00 0.54  ? 48  LYS A CB   1  
ATOM 788    C CG   . LYS A 1 48  ? -0.543  36.791  37.600  1.00 1.43  ? 48  LYS A CG   1  
ATOM 789    C CD   . LYS A 1 48  ? -1.450  37.846  36.925  1.00 1.41  ? 48  LYS A CD   1  
ATOM 790    C CE   . LYS A 1 48  ? -1.570  39.131  37.762  1.00 11.45 ? 48  LYS A CE   1  
ATOM 791    N NZ   . LYS A 1 48  ? -2.474  40.135  37.157  1.00 61.23 ? 48  LYS A NZ   1  
ATOM 792    H H    . LYS A 1 48  ? 0.609   36.210  40.355  1.00 12.04 ? 48  LYS A H    1  
ATOM 793    H HA   . LYS A 1 48  ? 1.888   35.557  37.900  1.00 71.05 ? 48  LYS A HA   1  
ATOM 794    H HB2  . LYS A 1 48  ? 0.586   38.115  38.860  1.00 55.32 ? 48  LYS A HB2  1  
ATOM 795    H HB3  . LYS A 1 48  ? 1.238   37.921  37.241  1.00 23.10 ? 48  LYS A HB3  1  
ATOM 796    H HG2  . LYS A 1 48  ? -0.340  35.999  36.885  1.00 13.12 ? 48  LYS A HG2  1  
ATOM 797    H HG3  . LYS A 1 48  ? -1.062  36.372  38.454  1.00 24.25 ? 48  LYS A HG3  1  
ATOM 798    H HD2  . LYS A 1 48  ? -1.038  38.100  35.954  1.00 22.13 ? 48  LYS A HD2  1  
ATOM 799    H HD3  . LYS A 1 48  ? -2.440  37.423  36.790  1.00 54.04 ? 48  LYS A HD3  1  
ATOM 800    H HE2  . LYS A 1 48  ? -1.948  38.880  38.742  1.00 11.41 ? 48  LYS A HE2  1  
ATOM 801    H HE3  . LYS A 1 48  ? -0.586  39.578  37.868  1.00 31.54 ? 48  LYS A HE3  1  
ATOM 802    H HZ1  . LYS A 1 48  ? -2.437  41.020  37.710  1.00 53.31 ? 48  LYS A HZ1  1  
ATOM 803    H HZ2  . LYS A 1 48  ? -3.449  39.785  37.157  1.00 42.11 ? 48  LYS A HZ2  1  
ATOM 804    H HZ3  . LYS A 1 48  ? -2.186  40.339  36.179  1.00 32.01 ? 48  LYS A HZ3  1  
ATOM 805    N N    . GLU A 1 49  ? 3.541   37.593  39.902  1.00 53.10 ? 49  GLU A N    1  
ATOM 806    C CA   . GLU A 1 49  ? 4.912   38.102  40.164  1.00 2.22  ? 49  GLU A CA   1  
ATOM 807    C C    . GLU A 1 49  ? 5.912   36.935  40.246  1.00 54.22 ? 49  GLU A C    1  
ATOM 808    O O    . GLU A 1 49  ? 7.072   37.070  39.858  1.00 71.44 ? 49  GLU A O    1  
ATOM 809    C CB   . GLU A 1 49  ? 4.975   38.944  41.460  1.00 64.12 ? 49  GLU A CB   1  
ATOM 810    C CG   . GLU A 1 49  ? 4.114   40.213  41.429  1.00 41.10 ? 49  GLU A CG   1  
ATOM 811    C CD   . GLU A 1 49  ? 4.291   41.077  42.686  1.00 64.22 ? 49  GLU A CD   1  
ATOM 812    O OE1  . GLU A 1 49  ? 5.095   42.043  42.651  1.00 61.11 ? 49  GLU A OE1  1  
ATOM 813    O OE2  . GLU A 1 49  ? 3.653   40.783  43.725  1.00 32.44 ? 49  GLU A OE2  1  
ATOM 814    H H    . GLU A 1 49  ? 2.852   37.685  40.600  1.00 64.11 ? 49  GLU A H    1  
ATOM 815    H HA   . GLU A 1 49  ? 5.192   38.732  39.322  1.00 10.11 ? 49  GLU A HA   1  
ATOM 816    H HB2  . GLU A 1 49  ? 4.645   38.330  42.290  1.00 22.22 ? 49  GLU A HB2  1  
ATOM 817    H HB3  . GLU A 1 49  ? 6.007   39.240  41.635  1.00 64.24 ? 49  GLU A HB3  1  
ATOM 818    H HG2  . GLU A 1 49  ? 4.380   40.798  40.551  1.00 61.02 ? 49  GLU A HG2  1  
ATOM 819    H HG3  . GLU A 1 49  ? 3.070   39.923  41.348  1.00 21.55 ? 49  GLU A HG3  1  
ATOM 820    N N    . ILE A 1 50  ? 5.444   35.802  40.783  1.00 44.24 ? 50  ILE A N    1  
ATOM 821    C CA   . ILE A 1 50  ? 6.204   34.536  40.836  1.00 54.35 ? 50  ILE A CA   1  
ATOM 822    C C    . ILE A 1 50  ? 6.404   33.987  39.404  1.00 70.53 ? 50  ILE A C    1  
ATOM 823    O O    . ILE A 1 50  ? 7.410   33.346  39.107  1.00 12.40 ? 50  ILE A O    1  
ATOM 824    C CB   . ILE A 1 50  ? 5.433   33.514  41.760  1.00 55.21 ? 50  ILE A CB   1  
ATOM 825    C CG1  . ILE A 1 50  ? 5.312   34.089  43.214  1.00 55.12 ? 50  ILE A CG1  1  
ATOM 826    C CG2  . ILE A 1 50  ? 6.079   32.111  41.769  1.00 52.14 ? 50  ILE A CG2  1  
ATOM 827    C CD1  . ILE A 1 50  ? 4.285   33.391  44.088  1.00 30.35 ? 50  ILE A CD1  1  
ATOM 828    H H    . ILE A 1 50  ? 4.541   35.815  41.166  1.00 62.21 ? 50  ILE A H    1  
ATOM 829    H HA   . ILE A 1 50  ? 7.178   34.736  41.275  1.00 4.15  ? 50  ILE A HA   1  
ATOM 830    H HB   . ILE A 1 50  ? 4.430   33.405  41.353  1.00 62.33 ? 50  ILE A HB   1  
ATOM 831    H HG12 . ILE A 1 50  ? 6.269   34.011  43.715  1.00 51.45 ? 50  ILE A HG12 1  
ATOM 832    H HG13 . ILE A 1 50  ? 5.033   35.136  43.164  1.00 70.20 ? 50  ILE A HG13 1  
ATOM 833    H HG21 . ILE A 1 50  ? 7.078   32.168  42.182  1.00 33.53 ? 50  ILE A HG21 1  
ATOM 834    H HG22 . ILE A 1 50  ? 6.136   31.730  40.759  1.00 61.40 ? 50  ILE A HG22 1  
ATOM 835    H HG23 . ILE A 1 50  ? 5.481   31.434  42.367  1.00 74.43 ? 50  ILE A HG23 1  
ATOM 836    H HD11 . ILE A 1 50  ? 4.556   32.354  44.209  1.00 64.53 ? 50  ILE A HD11 1  
ATOM 837    H HD12 . ILE A 1 50  ? 3.309   33.457  43.627  1.00 51.35 ? 50  ILE A HD12 1  
ATOM 838    H HD13 . ILE A 1 50  ? 4.255   33.868  45.056  1.00 11.31 ? 50  ILE A HD13 1  
ATOM 839    N N    . ASN A 1 51  ? 5.433   34.287  38.522  1.00 3.25  ? 51  ASN A N    1  
ATOM 840    C CA   . ASN A 1 51  ? 5.497   33.953  37.080  1.00 43.04 ? 51  ASN A CA   1  
ATOM 841    C C    . ASN A 1 51  ? 6.295   35.000  36.276  1.00 73.43 ? 51  ASN A C    1  
ATOM 842    O O    . ASN A 1 51  ? 6.708   34.699  35.178  1.00 34.04 ? 51  ASN A O    1  
ATOM 843    C CB   . ASN A 1 51  ? 4.062   33.786  36.495  1.00 32.41 ? 51  ASN A CB   1  
ATOM 844    C CG   . ASN A 1 51  ? 3.491   32.385  36.728  1.00 5.30  ? 51  ASN A CG   1  
ATOM 845    O OD1  . ASN A 1 51  ? 3.553   31.521  35.861  1.00 2.14  ? 51  ASN A OD1  1  
ATOM 846    N ND2  . ASN A 1 51  ? 2.974   32.138  37.904  1.00 23.23 ? 51  ASN A ND2  1  
ATOM 847    H H    . ASN A 1 51  ? 4.642   34.760  38.854  1.00 22.20 ? 51  ASN A H    1  
ATOM 848    H HA   . ASN A 1 51  ? 6.022   33.007  36.986  1.00 13.11 ? 51  ASN A HA   1  
ATOM 849    H HB2  . ASN A 1 51  ? 3.404   34.510  36.958  1.00 34.31 ? 51  ASN A HB2  1  
ATOM 850    H HB3  . ASN A 1 51  ? 4.077   33.971  35.426  1.00 31.53 ? 51  ASN A HB3  1  
ATOM 851    H HD21 . ASN A 1 51  ? 2.982   32.848  38.565  1.00 13.11 ? 51  ASN A HD21 1  
ATOM 852    H HD22 . ASN A 1 51  ? 2.620   31.247  38.072  1.00 2.20  ? 51  ASN A HD22 1  
ATOM 853    N N    . GLU A 1 52  ? 6.466   36.222  36.821  1.00 13.14 ? 52  GLU A N    1  
ATOM 854    C CA   . GLU A 1 52  ? 7.361   37.274  36.268  1.00 30.22 ? 52  GLU A CA   1  
ATOM 855    C C    . GLU A 1 52  ? 8.817   36.840  36.495  1.00 34.21 ? 52  GLU A C    1  
ATOM 856    O O    . GLU A 1 52  ? 9.655   36.783  35.566  1.00 63.42 ? 52  GLU A O    1  
ATOM 857    C CB   . GLU A 1 52  ? 7.073   38.615  37.011  1.00 23.43 ? 52  GLU A CB   1  
ATOM 858    C CG   . GLU A 1 52  ? 7.982   39.807  36.647  1.00 21.04 ? 52  GLU A CG   1  
ATOM 859    C CD   . GLU A 1 52  ? 7.878   40.964  37.665  1.00 40.01 ? 52  GLU A CD   1  
ATOM 860    O OE1  . GLU A 1 52  ? 7.181   41.967  37.398  1.00 2.23  ? 52  GLU A OE1  1  
ATOM 861    O OE2  . GLU A 1 52  ? 8.463   40.855  38.768  1.00 24.32 ? 52  GLU A OE2  1  
ATOM 862    H H    . GLU A 1 52  ? 5.974   36.430  37.636  1.00 71.13 ? 52  GLU A H    1  
ATOM 863    H HA   . GLU A 1 52  ? 7.166   37.389  35.207  1.00 14.12 ? 52  GLU A HA   1  
ATOM 864    H HB2  . GLU A 1 52  ? 6.047   38.903  36.804  1.00 12.43 ? 52  GLU A HB2  1  
ATOM 865    H HB3  . GLU A 1 52  ? 7.161   38.434  38.077  1.00 73.04 ? 52  GLU A HB3  1  
ATOM 866    H HG2  . GLU A 1 52  ? 9.009   39.462  36.613  1.00 35.32 ? 52  GLU A HG2  1  
ATOM 867    H HG3  . GLU A 1 52  ? 7.700   40.171  35.664  1.00 75.34 ? 52  GLU A HG3  1  
ATOM 868    N N    . ALA A 1 53  ? 9.067   36.511  37.765  1.00 64.52 ? 53  ALA A N    1  
ATOM 869    C CA   . ALA A 1 53  ? 10.335  35.995  38.248  1.00 45.10 ? 53  ALA A CA   1  
ATOM 870    C C    . ALA A 1 53  ? 10.751  34.743  37.473  1.00 60.15 ? 53  ALA A C    1  
ATOM 871    O O    . ALA A 1 53  ? 11.835  34.696  36.885  1.00 65.45 ? 53  ALA A O    1  
ATOM 872    C CB   . ALA A 1 53  ? 10.219  35.704  39.750  1.00 31.54 ? 53  ALA A CB   1  
ATOM 873    H H    . ALA A 1 53  ? 8.346   36.629  38.409  1.00 12.44 ? 53  ALA A H    1  
ATOM 874    H HA   . ALA A 1 53  ? 11.083  36.768  38.111  1.00 12.44 ? 53  ALA A HA   1  
ATOM 875    H HB1  . ALA A 1 53  ? 11.173  35.354  40.129  1.00 1.44  ? 53  ALA A HB1  1  
ATOM 876    H HB2  . ALA A 1 53  ? 9.467   34.945  39.922  1.00 3.13  ? 53  ALA A HB2  1  
ATOM 877    H HB3  . ALA A 1 53  ? 9.938   36.608  40.274  1.00 0.34  ? 53  ALA A HB3  1  
ATOM 878    N N    . TYR A 1 54  ? 9.844   33.762  37.445  1.00 31.25 ? 54  TYR A N    1  
ATOM 879    C CA   . TYR A 1 54  ? 10.046  32.510  36.714  1.00 43.42 ? 54  TYR A CA   1  
ATOM 880    C C    . TYR A 1 54  ? 10.172  32.763  35.205  1.00 23.55 ? 54  TYR A C    1  
ATOM 881    O O    . TYR A 1 54  ? 10.970  32.111  34.556  1.00 30.04 ? 54  TYR A O    1  
ATOM 882    C CB   . TYR A 1 54  ? 8.902   31.517  37.015  1.00 62.33 ? 54  TYR A CB   1  
ATOM 883    C CG   . TYR A 1 54  ? 9.024   30.171  36.275  1.00 15.24 ? 54  TYR A CG   1  
ATOM 884    C CD1  . TYR A 1 54  ? 10.019  29.250  36.623  1.00 14.15 ? 54  TYR A CD1  1  
ATOM 885    C CD2  . TYR A 1 54  ? 8.167   29.840  35.222  1.00 2.41  ? 54  TYR A CD2  1  
ATOM 886    C CE1  . TYR A 1 54  ? 10.148  28.053  35.949  1.00 13.02 ? 54  TYR A CE1  1  
ATOM 887    C CE2  . TYR A 1 54  ? 8.292   28.641  34.550  1.00 72.23 ? 54  TYR A CE2  1  
ATOM 888    C CZ   . TYR A 1 54  ? 9.281   27.753  34.914  1.00 72.32 ? 54  TYR A CZ   1  
ATOM 889    O OH   . TYR A 1 54  ? 9.414   26.562  34.236  1.00 11.21 ? 54  TYR A OH   1  
ATOM 890    H H    . TYR A 1 54  ? 9.008   33.888  37.938  1.00 44.33 ? 54  TYR A H    1  
ATOM 891    H HA   . TYR A 1 54  ? 10.978  32.079  37.065  1.00 52.44 ? 54  TYR A HA   1  
ATOM 892    H HB2  . TYR A 1 54  ? 8.892   31.317  38.082  1.00 51.02 ? 54  TYR A HB2  1  
ATOM 893    H HB3  . TYR A 1 54  ? 7.958   31.980  36.744  1.00 24.52 ? 54  TYR A HB3  1  
ATOM 894    H HD1  . TYR A 1 54  ? 10.698  29.486  37.442  1.00 41.33 ? 54  TYR A HD1  1  
ATOM 895    H HD2  . TYR A 1 54  ? 7.392   30.541  34.934  1.00 52.33 ? 54  TYR A HD2  1  
ATOM 896    H HE1  . TYR A 1 54  ? 10.922  27.356  36.236  1.00 31.54 ? 54  TYR A HE1  1  
ATOM 897    H HE2  . TYR A 1 54  ? 7.617   28.406  33.743  1.00 73.53 ? 54  TYR A HE2  1  
ATOM 898    H HH   . TYR A 1 54  ? 9.514   26.743  33.298  1.00 24.03 ? 54  TYR A HH   1  
ATOM 899    N N    . ALA A 1 55  ? 9.385   33.720  34.666  1.00 42.22 ? 55  ALA A N    1  
ATOM 900    C CA   . ALA A 1 55  ? 9.418   34.077  33.224  1.00 53.01 ? 55  ALA A CA   1  
ATOM 901    C C    . ALA A 1 55  ? 10.838  34.355  32.753  1.00 32.32 ? 55  ALA A C    1  
ATOM 902    O O    . ALA A 1 55  ? 11.315  33.761  31.778  1.00 50.33 ? 55  ALA A O    1  
ATOM 903    C CB   . ALA A 1 55  ? 8.566   35.319  32.949  1.00 41.43 ? 55  ALA A CB   1  
ATOM 904    H H    . ALA A 1 55  ? 8.762   34.201  35.255  1.00 22.50 ? 55  ALA A H    1  
ATOM 905    H HA   . ALA A 1 55  ? 9.001   33.244  32.662  1.00 72.52 ? 55  ALA A HA   1  
ATOM 906    H HB1  . ALA A 1 55  ? 8.579   35.544  31.888  1.00 54.34 ? 55  ALA A HB1  1  
ATOM 907    H HB2  . ALA A 1 55  ? 8.957   36.163  33.501  1.00 52.54 ? 55  ALA A HB2  1  
ATOM 908    H HB3  . ALA A 1 55  ? 7.547   35.134  33.258  1.00 31.32 ? 55  ALA A HB3  1  
ATOM 909    N N    . VAL A 1 56  ? 11.490  35.263  33.478  1.00 74.52 ? 56  VAL A N    1  
ATOM 910    C CA   . VAL A 1 56  ? 12.864  35.664  33.189  1.00 20.22 ? 56  VAL A CA   1  
ATOM 911    C C    . VAL A 1 56  ? 13.839  34.496  33.472  1.00 13.41 ? 56  VAL A C    1  
ATOM 912    O O    . VAL A 1 56  ? 14.700  34.187  32.652  1.00 1.23  ? 56  VAL A O    1  
ATOM 913    C CB   . VAL A 1 56  ? 13.238  36.941  34.025  1.00 22.53 ? 56  VAL A CB   1  
ATOM 914    C CG1  . VAL A 1 56  ? 14.690  37.404  33.767  1.00 12.11 ? 56  VAL A CG1  1  
ATOM 915    C CG2  . VAL A 1 56  ? 12.227  38.085  33.741  1.00 11.25 ? 56  VAL A CG2  1  
ATOM 916    H H    . VAL A 1 56  ? 11.020  35.684  34.243  1.00 55.13 ? 56  VAL A H    1  
ATOM 917    H HA   . VAL A 1 56  ? 12.923  35.918  32.131  1.00 64.33 ? 56  VAL A HA   1  
ATOM 918    H HB   . VAL A 1 56  ? 13.155  36.684  35.079  1.00 61.50 ? 56  VAL A HB   1  
ATOM 919    H HG11 . VAL A 1 56  ? 14.908  38.274  34.375  1.00 4.13  ? 56  VAL A HG11 1  
ATOM 920    H HG12 . VAL A 1 56  ? 14.821  37.658  32.721  1.00 12.04 ? 56  VAL A HG12 1  
ATOM 921    H HG13 . VAL A 1 56  ? 15.377  36.611  34.030  1.00 4.54  ? 56  VAL A HG13 1  
ATOM 922    H HG21 . VAL A 1 56  ? 11.222  37.752  33.980  1.00 14.22 ? 56  VAL A HG21 1  
ATOM 923    H HG22 . VAL A 1 56  ? 12.265  38.369  32.696  1.00 3.30  ? 56  VAL A HG22 1  
ATOM 924    H HG23 . VAL A 1 56  ? 12.467  38.946  34.351  1.00 43.51 ? 56  VAL A HG23 1  
ATOM 925    N N    . LEU A 1 57  ? 13.647  33.809  34.609  1.00 51.55 ? 57  LEU A N    1  
ATOM 926    C CA   . LEU A 1 57  ? 14.624  32.810  35.112  1.00 23.23 ? 57  LEU A CA   1  
ATOM 927    C C    . LEU A 1 57  ? 14.347  31.352  34.622  1.00 62.04 ? 57  LEU A C    1  
ATOM 928    O O    . LEU A 1 57  ? 15.037  30.419  35.057  1.00 53.12 ? 57  LEU A O    1  
ATOM 929    C CB   . LEU A 1 57  ? 14.679  32.885  36.666  1.00 41.23 ? 57  LEU A CB   1  
ATOM 930    C CG   . LEU A 1 57  ? 14.931  34.311  37.287  1.00 51.12 ? 57  LEU A CG   1  
ATOM 931    C CD1  . LEU A 1 57  ? 15.080  34.244  38.824  1.00 21.41 ? 57  LEU A CD1  1  
ATOM 932    C CD2  . LEU A 1 57  ? 16.139  35.025  36.637  1.00 2.15  ? 57  LEU A CD2  1  
ATOM 933    H H    . LEU A 1 57  ? 12.830  33.974  35.131  1.00 0.34  ? 57  LEU A H    1  
ATOM 934    H HA   . LEU A 1 57  ? 15.605  33.095  34.735  1.00 71.23 ? 57  LEU A HA   1  
ATOM 935    H HB2  . LEU A 1 57  ? 13.734  32.510  37.051  1.00 2.51  ? 57  LEU A HB2  1  
ATOM 936    H HB3  . LEU A 1 57  ? 15.466  32.223  37.005  1.00 14.45 ? 57  LEU A HB3  1  
ATOM 937    H HG   . LEU A 1 57  ? 14.059  34.921  37.088  1.00 23.32 ? 57  LEU A HG   1  
ATOM 938    H HD11 . LEU A 1 57  ? 14.178  33.827  39.258  1.00 41.02 ? 57  LEU A HD11 1  
ATOM 939    H HD12 . LEU A 1 57  ? 15.233  35.237  39.222  1.00 72.01 ? 57  LEU A HD12 1  
ATOM 940    H HD13 . LEU A 1 57  ? 15.925  33.619  39.087  1.00 74.35 ? 57  LEU A HD13 1  
ATOM 941    H HD21 . LEU A 1 57  ? 15.973  35.129  35.572  1.00 20.33 ? 57  LEU A HD21 1  
ATOM 942    H HD22 . LEU A 1 57  ? 17.041  34.451  36.803  1.00 64.01 ? 57  LEU A HD22 1  
ATOM 943    H HD23 . LEU A 1 57  ? 16.257  36.010  37.071  1.00 31.43 ? 57  LEU A HD23 1  
ATOM 944    N N    . SER A 1 58  ? 13.354  31.166  33.720  1.00 51.31 ? 58  SER A N    1  
ATOM 945    C CA   . SER A 1 58  ? 13.021  29.834  33.133  1.00 74.34 ? 58  SER A CA   1  
ATOM 946    C C    . SER A 1 58  ? 13.981  29.484  31.989  1.00 32.14 ? 58  SER A C    1  
ATOM 947    O O    . SER A 1 58  ? 14.515  28.367  31.922  1.00 25.45 ? 58  SER A O    1  
ATOM 948    C CB   . SER A 1 58  ? 11.561  29.825  32.601  1.00 73.02 ? 58  SER A CB   1  
ATOM 949    O OG   . SER A 1 58  ? 11.145  28.531  32.170  1.00 2.24  ? 58  SER A OG   1  
ATOM 950    H H    . SER A 1 58  ? 12.811  31.945  33.457  1.00 2.44  ? 58  SER A H    1  
ATOM 951    H HA   . SER A 1 58  ? 13.112  29.085  33.913  1.00 41.23 ? 58  SER A HA   1  
ATOM 952    H HB2  . SER A 1 58  ? 10.893  30.150  33.388  1.00 4.32  ? 58  SER A HB2  1  
ATOM 953    H HB3  . SER A 1 58  ? 11.475  30.513  31.765  1.00 54.20 ? 58  SER A HB3  1  
ATOM 954    H HG   . SER A 1 58  ? 11.776  28.183  31.531  1.00 61.45 ? 58  SER A HG   1  
ATOM 955    N N    . ASP A 1 59  ? 14.171  30.455  31.090  1.00 34.10 ? 59  ASP A N    1  
ATOM 956    C CA   . ASP A 1 59  ? 14.942  30.270  29.847  1.00 5.12  ? 59  ASP A CA   1  
ATOM 957    C C    . ASP A 1 59  ? 16.400  30.684  30.071  1.00 22.32 ? 59  ASP A C    1  
ATOM 958    O O    . ASP A 1 59  ? 16.609  31.749  30.638  1.00 74.34 ? 59  ASP A O    1  
ATOM 959    C CB   . ASP A 1 59  ? 14.329  31.128  28.722  1.00 23.23 ? 59  ASP A CB   1  
ATOM 960    C CG   . ASP A 1 59  ? 12.858  30.787  28.483  1.00 42.12 ? 59  ASP A CG   1  
ATOM 961    O OD1  . ASP A 1 59  ? 12.587  29.678  27.990  1.00 61.22 ? 59  ASP A OD1  1  
ATOM 962    O OD2  . ASP A 1 59  ? 11.968  31.608  28.815  1.00 20.11 ? 59  ASP A OD2  1  
ATOM 963    H H    . ASP A 1 59  ? 13.793  31.339  31.274  1.00 13.43 ? 59  ASP A H    1  
ATOM 964    H HA   . ASP A 1 59  ? 14.895  29.222  29.559  1.00 51.33 ? 59  ASP A HA   1  
ATOM 965    H HB2  . ASP A 1 59  ? 14.416  32.181  28.989  1.00 14.14 ? 59  ASP A HB2  1  
ATOM 966    H HB3  . ASP A 1 59  ? 14.880  30.958  27.800  1.00 25.42 ? 59  ASP A HB3  1  
ATOM 967    N N    . PRO A 1 60  ? 17.421  29.869  29.610  1.00 72.41 ? 60  PRO A N    1  
ATOM 968    C CA   . PRO A 1 60  ? 18.876  30.154  29.813  1.00 22.33 ? 60  PRO A CA   1  
ATOM 969    C C    . PRO A 1 60  ? 19.299  31.598  29.421  1.00 0.23  ? 60  PRO A C    1  
ATOM 970    O O    . PRO A 1 60  ? 20.020  32.247  30.172  1.00 62.14 ? 60  PRO A O    1  
ATOM 971    C CB   . PRO A 1 60  ? 19.598  29.071  28.938  1.00 41.32 ? 60  PRO A CB   1  
ATOM 972    C CG   . PRO A 1 60  ? 18.523  28.436  28.104  1.00 41.24 ? 60  PRO A CG   1  
ATOM 973    C CD   . PRO A 1 60  ? 17.239  28.589  28.884  1.00 14.11 ? 60  PRO A CD   1  
ATOM 974    H HA   . PRO A 1 60  ? 19.146  29.999  30.857  1.00 31.55 ? 60  PRO A HA   1  
ATOM 975    H HB2  . PRO A 1 60  ? 20.364  29.524  28.305  1.00 24.42 ? 60  PRO A HB2  1  
ATOM 976    H HB3  . PRO A 1 60  ? 20.059  28.325  29.576  1.00 24.24 ? 60  PRO A HB3  1  
ATOM 977    H HG2  . PRO A 1 60  ? 18.448  28.946  27.144  1.00 22.34 ? 60  PRO A HG2  1  
ATOM 978    H HG3  . PRO A 1 60  ? 18.738  27.384  27.943  1.00 63.25 ? 60  PRO A HG3  1  
ATOM 979    H HD2  . PRO A 1 60  ? 16.392  28.644  28.212  1.00 61.12 ? 60  PRO A HD2  1  
ATOM 980    H HD3  . PRO A 1 60  ? 17.110  27.770  29.581  1.00 42.11 ? 60  PRO A HD3  1  
ATOM 981    N N    . GLU A 1 61  ? 18.821  32.103  28.271  1.00 55.01 ? 61  GLU A N    1  
ATOM 982    C CA   . GLU A 1 61  ? 19.189  33.456  27.765  1.00 11.11 ? 61  GLU A CA   1  
ATOM 983    C C    . GLU A 1 61  ? 18.622  34.564  28.654  1.00 31.12 ? 61  GLU A C    1  
ATOM 984    O O    . GLU A 1 61  ? 19.368  35.416  29.125  1.00 15.03 ? 61  GLU A O    1  
ATOM 985    C CB   . GLU A 1 61  ? 18.722  33.653  26.291  1.00 34.41 ? 61  GLU A CB   1  
ATOM 986    C CG   . GLU A 1 61  ? 19.598  32.937  25.239  1.00 23.31 ? 61  GLU A CG   1  
ATOM 987    C CD   . GLU A 1 61  ? 19.814  31.451  25.543  1.00 72.30 ? 61  GLU A CD   1  
ATOM 988    O OE1  . GLU A 1 61  ? 18.841  30.688  25.507  1.00 14.40 ? 61  GLU A OE1  1  
ATOM 989    O OE2  . GLU A 1 61  ? 20.959  31.037  25.822  1.00 62.11 ? 61  GLU A OE2  1  
ATOM 990    H H    . GLU A 1 61  ? 18.215  31.548  27.736  1.00 61.42 ? 61  GLU A H    1  
ATOM 991    H HA   . GLU A 1 61  ? 20.276  33.523  27.788  1.00 65.24 ? 61  GLU A HA   1  
ATOM 992    H HB2  . GLU A 1 61  ? 17.708  33.283  26.194  1.00 45.45 ? 61  GLU A HB2  1  
ATOM 993    H HB3  . GLU A 1 61  ? 18.721  34.715  26.051  1.00 21.42 ? 61  GLU A HB3  1  
ATOM 994    H HG2  . GLU A 1 61  ? 19.119  33.027  24.270  1.00 30.21 ? 61  GLU A HG2  1  
ATOM 995    H HG3  . GLU A 1 61  ? 20.562  33.438  25.195  1.00 25.32 ? 61  GLU A HG3  1  
ATOM 996    N N    . LYS A 1 62  ? 17.301  34.524  28.876  1.00 40.01 ? 62  LYS A N    1  
ATOM 997    C CA   . LYS A 1 62  ? 16.576  35.532  29.684  1.00 22.22 ? 62  LYS A CA   1  
ATOM 998    C C    . LYS A 1 62  ? 17.096  35.545  31.141  1.00 74.54 ? 62  LYS A C    1  
ATOM 999    O O    . LYS A 1 62  ? 17.202  36.610  31.787  1.00 50.14 ? 62  LYS A O    1  
ATOM 1000   C CB   . LYS A 1 62  ? 15.058  35.238  29.601  1.00 42.54 ? 62  LYS A CB   1  
ATOM 1001   C CG   . LYS A 1 62  ? 14.466  35.401  28.175  1.00 65.32 ? 62  LYS A CG   1  
ATOM 1002   C CD   . LYS A 1 62  ? 13.079  34.729  28.006  1.00 24.43 ? 62  LYS A CD   1  
ATOM 1003   C CE   . LYS A 1 62  ? 12.038  35.193  29.038  1.00 33.54 ? 62  LYS A CE   1  
ATOM 1004   N NZ   . LYS A 1 62  ? 10.798  34.368  28.982  1.00 22.25 ? 62  LYS A NZ   1  
ATOM 1005   H H    . LYS A 1 62  ? 16.794  33.770  28.505  1.00 31.22 ? 62  LYS A H    1  
ATOM 1006   H HA   . LYS A 1 62  ? 16.768  36.504  29.248  1.00 21.42 ? 62  LYS A HA   1  
ATOM 1007   H HB2  . LYS A 1 62  ? 14.886  34.217  29.928  1.00 45.54 ? 62  LYS A HB2  1  
ATOM 1008   H HB3  . LYS A 1 62  ? 14.527  35.909  30.270  1.00 52.43 ? 62  LYS A HB3  1  
ATOM 1009   H HG2  . LYS A 1 62  ? 14.374  36.458  27.951  1.00 12.41 ? 62  LYS A HG2  1  
ATOM 1010   H HG3  . LYS A 1 62  ? 15.154  34.953  27.464  1.00 55.23 ? 62  LYS A HG3  1  
ATOM 1011   H HD2  . LYS A 1 62  ? 12.702  34.951  27.015  1.00 4.20  ? 62  LYS A HD2  1  
ATOM 1012   H HD3  . LYS A 1 62  ? 13.203  33.654  28.096  1.00 0.04  ? 62  LYS A HD3  1  
ATOM 1013   H HE2  . LYS A 1 62  ? 12.461  35.106  30.033  1.00 22.04 ? 62  LYS A HE2  1  
ATOM 1014   H HE3  . LYS A 1 62  ? 11.782  36.226  28.848  1.00 11.51 ? 62  LYS A HE3  1  
ATOM 1015   H HZ1  . LYS A 1 62  ? 10.308  34.511  28.076  1.00 42.55 ? 62  LYS A HZ1  1  
ATOM 1016   H HZ2  . LYS A 1 62  ? 10.157  34.629  29.753  1.00 31.32 ? 62  LYS A HZ2  1  
ATOM 1017   H HZ3  . LYS A 1 62  ? 11.041  33.353  29.074  1.00 34.23 ? 62  LYS A HZ3  1  
ATOM 1018   N N    . ARG A 1 63  ? 17.454  34.337  31.612  1.00 11.35 ? 63  ARG A N    1  
ATOM 1019   C CA   . ARG A 1 63  ? 18.138  34.109  32.892  1.00 62.42 ? 63  ARG A CA   1  
ATOM 1020   C C    . ARG A 1 63  ? 19.415  34.961  32.932  1.00 24.21 ? 63  ARG A C    1  
ATOM 1021   O O    . ARG A 1 63  ? 19.550  35.850  33.780  1.00 11.33 ? 63  ARG A O    1  
ATOM 1022   C CB   . ARG A 1 63  ? 18.482  32.592  33.020  1.00 72.13 ? 63  ARG A CB   1  
ATOM 1023   C CG   . ARG A 1 63  ? 19.158  32.155  34.336  1.00 23.14 ? 63  ARG A CG   1  
ATOM 1024   C CD   . ARG A 1 63  ? 18.222  32.243  35.546  1.00 63.15 ? 63  ARG A CD   1  
ATOM 1025   N NE   . ARG A 1 63  ? 18.906  31.913  36.805  1.00 64.12 ? 63  ARG A NE   1  
ATOM 1026   C CZ   . ARG A 1 63  ? 19.416  32.803  37.660  1.00 20.02 ? 63  ARG A CZ   1  
ATOM 1027   N NH1  . ARG A 1 63  ? 19.337  34.105  37.421  1.00 44.43 ? 63  ARG A NH1  1  
ATOM 1028   N NH2  . ARG A 1 63  ? 20.019  32.392  38.759  1.00 74.11 ? 63  ARG A NH2  1  
ATOM 1029   H H    . ARG A 1 63  ? 17.251  33.561  31.060  1.00 24.21 ? 63  ARG A H    1  
ATOM 1030   H HA   . ARG A 1 63  ? 17.474  34.402  33.697  1.00 31.42 ? 63  ARG A HA   1  
ATOM 1031   H HB2  . ARG A 1 63  ? 17.566  32.025  32.908  1.00 63.55 ? 63  ARG A HB2  1  
ATOM 1032   H HB3  . ARG A 1 63  ? 19.144  32.323  32.200  1.00 34.04 ? 63  ARG A HB3  1  
ATOM 1033   H HG2  . ARG A 1 63  ? 19.493  31.129  34.233  1.00 60.32 ? 63  ARG A HG2  1  
ATOM 1034   H HG3  . ARG A 1 63  ? 20.021  32.789  34.514  1.00 64.22 ? 63  ARG A HG3  1  
ATOM 1035   H HD2  . ARG A 1 63  ? 17.814  33.244  35.608  1.00 71.14 ? 63  ARG A HD2  1  
ATOM 1036   H HD3  . ARG A 1 63  ? 17.405  31.542  35.407  1.00 13.10 ? 63  ARG A HD3  1  
ATOM 1037   H HE   . ARG A 1 63  ? 18.989  30.961  37.022  1.00 52.32 ? 63  ARG A HE   1  
ATOM 1038   H HH11 . ARG A 1 63  ? 18.895  34.441  36.589  1.00 42.12 ? 63  ARG A HH11 1  
ATOM 1039   H HH12 . ARG A 1 63  ? 19.731  34.759  38.073  1.00 44.25 ? 63  ARG A HH12 1  
ATOM 1040   H HH21 . ARG A 1 63  ? 20.094  31.416  38.962  1.00 72.40 ? 63  ARG A HH21 1  
ATOM 1041   H HH22 . ARG A 1 63  ? 20.401  33.064  39.401  1.00 61.13 ? 63  ARG A HH22 1  
ATOM 1042   N N    . ARG A 1 64  ? 20.299  34.727  31.935  1.00 34.13 ? 64  ARG A N    1  
ATOM 1043   C CA   . ARG A 1 64  ? 21.587  35.431  31.813  1.00 31.32 ? 64  ARG A CA   1  
ATOM 1044   C C    . ARG A 1 64  ? 21.394  36.949  31.631  1.00 34.32 ? 64  ARG A C    1  
ATOM 1045   O O    . ARG A 1 64  ? 22.258  37.705  32.025  1.00 31.24 ? 64  ARG A O    1  
ATOM 1046   C CB   . ARG A 1 64  ? 22.441  34.869  30.639  1.00 4.35  ? 64  ARG A CB   1  
ATOM 1047   C CG   . ARG A 1 64  ? 22.830  33.369  30.717  1.00 22.30 ? 64  ARG A CG   1  
ATOM 1048   C CD   . ARG A 1 64  ? 23.678  32.977  31.946  1.00 31.42 ? 64  ARG A CD   1  
ATOM 1049   N NE   . ARG A 1 64  ? 22.882  32.846  33.196  1.00 74.25 ? 64  ARG A NE   1  
ATOM 1050   C CZ   . ARG A 1 64  ? 23.220  32.081  34.253  1.00 40.15 ? 64  ARG A CZ   1  
ATOM 1051   N NH1  . ARG A 1 64  ? 24.336  31.367  34.238  1.00 1.33  ? 64  ARG A NH1  1  
ATOM 1052   N NH2  . ARG A 1 64  ? 22.436  32.053  35.327  1.00 71.43 ? 64  ARG A NH2  1  
ATOM 1053   H H    . ARG A 1 64  ? 20.059  34.068  31.248  1.00 32.01 ? 64  ARG A H    1  
ATOM 1054   H HA   . ARG A 1 64  ? 22.130  35.267  32.738  1.00 23.43 ? 64  ARG A HA   1  
ATOM 1055   H HB2  . ARG A 1 64  ? 21.887  35.016  29.718  1.00 15.24 ? 64  ARG A HB2  1  
ATOM 1056   H HB3  . ARG A 1 64  ? 23.361  35.447  30.574  1.00 22.25 ? 64  ARG A HB3  1  
ATOM 1057   H HG2  . ARG A 1 64  ? 21.923  32.780  30.733  1.00 24.33 ? 64  ARG A HG2  1  
ATOM 1058   H HG3  . ARG A 1 64  ? 23.385  33.115  29.816  1.00 3.24  ? 64  ARG A HG3  1  
ATOM 1059   H HD2  . ARG A 1 64  ? 24.165  32.027  31.742  1.00 4.03  ? 64  ARG A HD2  1  
ATOM 1060   H HD3  . ARG A 1 64  ? 24.441  33.730  32.096  1.00 73.43 ? 64  ARG A HD3  1  
ATOM 1061   H HE   . ARG A 1 64  ? 22.050  33.365  33.248  1.00 52.11 ? 64  ARG A HE   1  
ATOM 1062   H HH11 . ARG A 1 64  ? 24.941  31.385  33.436  1.00 14.23 ? 64  ARG A HH11 1  
ATOM 1063   H HH12 . ARG A 1 64  ? 24.579  30.796  35.024  1.00 30.44 ? 64  ARG A HH12 1  
ATOM 1064   H HH21 . ARG A 1 64  ? 21.596  32.608  35.355  1.00 64.10 ? 64  ARG A HH21 1  
ATOM 1065   H HH22 . ARG A 1 64  ? 22.679  31.485  36.122  1.00 1.03  ? 64  ARG A HH22 1  
ATOM 1066   N N    . ILE A 1 65  ? 20.261  37.370  31.032  1.00 64.31 ? 65  ILE A N    1  
ATOM 1067   C CA   . ILE A 1 65  ? 19.924  38.802  30.863  1.00 31.31 ? 65  ILE A CA   1  
ATOM 1068   C C    . ILE A 1 65  ? 19.794  39.469  32.241  1.00 41.42 ? 65  ILE A C    1  
ATOM 1069   O O    . ILE A 1 65  ? 20.409  40.525  32.491  1.00 44.44 ? 65  ILE A O    1  
ATOM 1070   C CB   . ILE A 1 65  ? 18.611  38.990  30.002  1.00 64.42 ? 65  ILE A CB   1  
ATOM 1071   C CG1  . ILE A 1 65  ? 18.859  38.504  28.533  1.00 53.20 ? 65  ILE A CG1  1  
ATOM 1072   C CG2  . ILE A 1 65  ? 18.091  40.453  30.020  1.00 1.50  ? 65  ILE A CG2  1  
ATOM 1073   C CD1  . ILE A 1 65  ? 17.629  38.500  27.647  1.00 5.11  ? 65  ILE A CD1  1  
ATOM 1074   H H    . ILE A 1 65  ? 19.628  36.700  30.708  1.00 51.31 ? 65  ILE A H    1  
ATOM 1075   H HA   . ILE A 1 65  ? 20.748  39.276  30.331  1.00 23.25 ? 65  ILE A HA   1  
ATOM 1076   H HB   . ILE A 1 65  ? 17.838  38.365  30.443  1.00 31.05 ? 65  ILE A HB   1  
ATOM 1077   H HG12 . ILE A 1 65  ? 19.590  39.148  28.060  1.00 11.54 ? 65  ILE A HG12 1  
ATOM 1078   H HG13 . ILE A 1 65  ? 19.249  37.494  28.551  1.00 74.12 ? 65  ILE A HG13 1  
ATOM 1079   H HG21 . ILE A 1 65  ? 18.840  41.114  29.601  1.00 71.43 ? 65  ILE A HG21 1  
ATOM 1080   H HG22 . ILE A 1 65  ? 17.878  40.754  31.035  1.00 71.21 ? 65  ILE A HG22 1  
ATOM 1081   H HG23 . ILE A 1 65  ? 17.183  40.528  29.432  1.00 15.15 ? 65  ILE A HG23 1  
ATOM 1082   H HD11 . ILE A 1 65  ? 17.893  38.119  26.671  1.00 40.21 ? 65  ILE A HD11 1  
ATOM 1083   H HD12 . ILE A 1 65  ? 17.252  39.507  27.547  1.00 52.31 ? 65  ILE A HD12 1  
ATOM 1084   H HD13 . ILE A 1 65  ? 16.867  37.870  28.085  1.00 74.41 ? 65  ILE A HD13 1  
ATOM 1085   N N    . TYR A 1 66  ? 19.042  38.809  33.149  1.00 40.24 ? 66  TYR A N    1  
ATOM 1086   C CA   . TYR A 1 66  ? 18.920  39.285  34.542  1.00 5.15  ? 66  TYR A CA   1  
ATOM 1087   C C    . TYR A 1 66  ? 20.308  39.306  35.225  1.00 75.40 ? 66  TYR A C    1  
ATOM 1088   O O    . TYR A 1 66  ? 20.740  40.360  35.708  1.00 15.12 ? 66  TYR A O    1  
ATOM 1089   C CB   . TYR A 1 66  ? 17.919  38.421  35.354  1.00 5.34  ? 66  TYR A CB   1  
ATOM 1090   C CG   . TYR A 1 66  ? 17.658  38.929  36.793  1.00 4.43  ? 66  TYR A CG   1  
ATOM 1091   C CD1  . TYR A 1 66  ? 17.350  40.278  37.034  1.00 51.04 ? 66  TYR A CD1  1  
ATOM 1092   C CD2  . TYR A 1 66  ? 17.699  38.066  37.897  1.00 41.35 ? 66  TYR A CD2  1  
ATOM 1093   C CE1  . TYR A 1 66  ? 17.099  40.734  38.312  1.00 63.32 ? 66  TYR A CE1  1  
ATOM 1094   C CE2  . TYR A 1 66  ? 17.447  38.529  39.169  1.00 2.30  ? 66  TYR A CE2  1  
ATOM 1095   C CZ   . TYR A 1 66  ? 17.149  39.855  39.374  1.00 14.13 ? 66  TYR A CZ   1  
ATOM 1096   O OH   . TYR A 1 66  ? 16.898  40.304  40.650  1.00 13.05 ? 66  TYR A OH   1  
ATOM 1097   H H    . TYR A 1 66  ? 18.563  37.984  32.868  1.00 10.11 ? 66  TYR A H    1  
ATOM 1098   H HA   . TYR A 1 66  ? 18.541  40.304  34.499  1.00 13.54 ? 66  TYR A HA   1  
ATOM 1099   H HB2  . TYR A 1 66  ? 16.966  38.408  34.834  1.00 51.14 ? 66  TYR A HB2  1  
ATOM 1100   H HB3  . TYR A 1 66  ? 18.295  37.403  35.408  1.00 24.55 ? 66  TYR A HB3  1  
ATOM 1101   H HD1  . TYR A 1 66  ? 17.311  40.971  36.198  1.00 72.42 ? 66  TYR A HD1  1  
ATOM 1102   H HD2  . TYR A 1 66  ? 17.933  37.021  37.742  1.00 54.30 ? 66  TYR A HD2  1  
ATOM 1103   H HE1  . TYR A 1 66  ? 16.862  41.777  38.475  1.00 72.03 ? 66  TYR A HE1  1  
ATOM 1104   H HE2  . TYR A 1 66  ? 17.481  37.847  40.004  1.00 0.22  ? 66  TYR A HE2  1  
ATOM 1105   H HH   . TYR A 1 66  ? 16.177  40.942  40.634  1.00 1.14  ? 66  TYR A HH   1  
ATOM 1106   N N    . ASP A 1 67  ? 21.011  38.150  35.188  1.00 61.41 ? 67  ASP A N    1  
ATOM 1107   C CA   . ASP A 1 67  ? 22.331  37.970  35.848  1.00 42.50 ? 67  ASP A CA   1  
ATOM 1108   C C    . ASP A 1 67  ? 23.344  39.049  35.408  1.00 64.04 ? 67  ASP A C    1  
ATOM 1109   O O    . ASP A 1 67  ? 24.059  39.606  36.241  1.00 43.41 ? 67  ASP A O    1  
ATOM 1110   C CB   . ASP A 1 67  ? 22.925  36.569  35.535  1.00 32.50 ? 67  ASP A CB   1  
ATOM 1111   C CG   . ASP A 1 67  ? 22.156  35.389  36.162  1.00 42.30 ? 67  ASP A CG   1  
ATOM 1112   O OD1  . ASP A 1 67  ? 21.466  34.655  35.428  1.00 61.23 ? 67  ASP A OD1  1  
ATOM 1113   O OD2  . ASP A 1 67  ? 22.275  35.166  37.389  1.00 40.01 ? 67  ASP A OD2  1  
ATOM 1114   H H    . ASP A 1 67  ? 20.636  37.395  34.688  1.00 61.01 ? 67  ASP A H    1  
ATOM 1115   H HA   . ASP A 1 67  ? 22.176  38.052  36.921  1.00 25.32 ? 67  ASP A HA   1  
ATOM 1116   H HB2  . ASP A 1 67  ? 22.944  36.436  34.460  1.00 32.04 ? 67  ASP A HB2  1  
ATOM 1117   H HB3  . ASP A 1 67  ? 23.951  36.530  35.895  1.00 13.53 ? 67  ASP A HB3  1  
ATOM 1118   N N    . THR A 1 68  ? 23.398  39.324  34.095  1.00 64.34 ? 68  THR A N    1  
ATOM 1119   C CA   . THR A 1 68  ? 24.315  40.331  33.528  1.00 72.14 ? 68  THR A CA   1  
ATOM 1120   C C    . THR A 1 68  ? 23.842  41.756  33.842  1.00 31.55 ? 68  THR A C    1  
ATOM 1121   O O    . THR A 1 68  ? 24.666  42.662  33.925  1.00 63.32 ? 68  THR A O    1  
ATOM 1122   C CB   . THR A 1 68  ? 24.505  40.173  31.982  1.00 75.13 ? 68  THR A CB   1  
ATOM 1123   O OG1  . THR A 1 68  ? 23.230  40.222  31.335  1.00 11.43 ? 68  THR A OG1  1  
ATOM 1124   C CG2  . THR A 1 68  ? 25.217  38.857  31.616  1.00 50.30 ? 68  THR A CG2  1  
ATOM 1125   H H    . THR A 1 68  ? 22.799  38.845  33.498  1.00 75.44 ? 68  THR A H    1  
ATOM 1126   H HA   . THR A 1 68  ? 25.284  40.186  33.997  1.00 54.21 ? 68  THR A HA   1  
ATOM 1127   H HB   . THR A 1 68  ? 25.114  41.001  31.616  1.00 31.45 ? 68  THR A HB   1  
ATOM 1128   H HG1  . THR A 1 68  ? 22.556  39.883  31.933  1.00 25.24 ? 68  THR A HG1  1  
ATOM 1129   H HG21 . THR A 1 68  ? 26.203  38.833  32.065  1.00 72.11 ? 68  THR A HG21 1  
ATOM 1130   H HG22 . THR A 1 68  ? 25.316  38.782  30.542  1.00 52.11 ? 68  THR A HG22 1  
ATOM 1131   H HG23 . THR A 1 68  ? 24.638  38.016  31.979  1.00 14.33 ? 68  THR A HG23 1  
ATOM 1132   N N    . TYR A 1 69  ? 22.520  41.961  34.031  1.00 61.15 ? 69  TYR A N    1  
ATOM 1133   C CA   . TYR A 1 69  ? 21.994  43.302  34.332  1.00 24.11 ? 69  TYR A CA   1  
ATOM 1134   C C    . TYR A 1 69  ? 22.358  43.673  35.786  1.00 12.24 ? 69  TYR A C    1  
ATOM 1135   O O    . TYR A 1 69  ? 21.956  42.988  36.734  1.00 43.32 ? 69  TYR A O    1  
ATOM 1136   C CB   . TYR A 1 69  ? 20.472  43.379  34.085  1.00 52.32 ? 69  TYR A CB   1  
ATOM 1137   C CG   . TYR A 1 69  ? 19.915  44.811  34.130  1.00 11.43 ? 69  TYR A CG   1  
ATOM 1138   C CD1  . TYR A 1 69  ? 20.233  45.737  33.126  1.00 63.45 ? 69  TYR A CD1  1  
ATOM 1139   C CD2  . TYR A 1 69  ? 19.072  45.233  35.155  1.00 13.31 ? 69  TYR A CD2  1  
ATOM 1140   C CE1  . TYR A 1 69  ? 19.721  47.019  33.150  1.00 4.24  ? 69  TYR A CE1  1  
ATOM 1141   C CE2  . TYR A 1 69  ? 18.566  46.513  35.181  1.00 20.53 ? 69  TYR A CE2  1  
ATOM 1142   C CZ   . TYR A 1 69  ? 18.887  47.400  34.181  1.00 50.31 ? 69  TYR A CZ   1  
ATOM 1143   O OH   . TYR A 1 69  ? 18.365  48.675  34.212  1.00 63.41 ? 69  TYR A OH   1  
ATOM 1144   H H    . TYR A 1 69  ? 21.894  41.192  33.992  1.00 34.13 ? 69  TYR A H    1  
ATOM 1145   H HA   . TYR A 1 69  ? 22.490  44.000  33.656  1.00 50.41 ? 69  TYR A HA   1  
ATOM 1146   H HB2  . TYR A 1 69  ? 20.252  42.969  33.104  1.00 24.21 ? 69  TYR A HB2  1  
ATOM 1147   H HB3  . TYR A 1 69  ? 19.956  42.781  34.831  1.00 70.31 ? 69  TYR A HB3  1  
ATOM 1148   H HD1  . TYR A 1 69  ? 20.888  45.434  32.315  1.00 62.54 ? 69  TYR A HD1  1  
ATOM 1149   H HD2  . TYR A 1 69  ? 18.817  44.539  35.948  1.00 13.42 ? 69  TYR A HD2  1  
ATOM 1150   H HE1  . TYR A 1 69  ? 19.978  47.718  32.364  1.00 61.32 ? 69  TYR A HE1  1  
ATOM 1151   H HE2  . TYR A 1 69  ? 17.911  46.814  35.988  1.00 75.32 ? 69  TYR A HE2  1  
ATOM 1152   H HH   . TYR A 1 69  ? 17.946  48.866  33.364  1.00 31.24 ? 69  TYR A HH   1  
ATOM 1153   N N    . GLY A 1 70  ? 23.123  44.766  35.940  1.00 12.41 ? 70  GLY A N    1  
ATOM 1154   C CA   . GLY A 1 70  ? 23.763  45.109  37.214  1.00 52.54 ? 70  GLY A CA   1  
ATOM 1155   C C    . GLY A 1 70  ? 25.245  44.733  37.229  1.00 23.41 ? 70  GLY A C    1  
ATOM 1156   O O    . GLY A 1 70  ? 25.867  44.645  38.290  1.00 23.14 ? 70  GLY A O    1  
ATOM 1157   H H    . GLY A 1 70  ? 23.258  45.356  35.166  1.00 13.51 ? 70  GLY A H    1  
ATOM 1158   H HA2  . GLY A 1 70  ? 23.673  46.175  37.368  1.00 45.15 ? 70  GLY A HA2  1  
ATOM 1159   H HA3  . GLY A 1 70  ? 23.262  44.598  38.028  1.00 64.23 ? 70  GLY A HA3  1  
ATOM 1160   N N    . THR A 1 71  ? 25.792  44.488  36.032  1.00 71.23 ? 71  THR A N    1  
ATOM 1161   C CA   . THR A 1 71  ? 27.227  44.224  35.796  1.00 55.31 ? 71  THR A CA   1  
ATOM 1162   C C    . THR A 1 71  ? 27.514  44.907  34.463  1.00 21.32 ? 71  THR A C    1  
ATOM 1163   O O    . THR A 1 71  ? 28.361  45.798  34.346  1.00 23.44 ? 71  THR A O    1  
ATOM 1164   C CB   . THR A 1 71  ? 27.541  42.684  35.734  1.00 2.03  ? 71  THR A CB   1  
ATOM 1165   O OG1  . THR A 1 71  ? 27.098  42.039  36.942  1.00 60.51 ? 71  THR A OG1  1  
ATOM 1166   C CG2  . THR A 1 71  ? 29.042  42.398  35.526  1.00 21.00 ? 71  THR A CG2  1  
ATOM 1167   H H    . THR A 1 71  ? 25.192  44.513  35.235  1.00 24.41 ? 71  THR A H    1  
ATOM 1168   H HA   . THR A 1 71  ? 27.815  44.694  36.583  1.00 24.21 ? 71  THR A HA   1  
ATOM 1169   H HB   . THR A 1 71  ? 26.991  42.253  34.902  1.00 3.04  ? 71  THR A HB   1  
ATOM 1170   H HG1  . THR A 1 71  ? 26.443  42.590  37.385  1.00 52.43 ? 71  THR A HG1  1  
ATOM 1171   H HG21 . THR A 1 71  ? 29.614  42.808  36.350  1.00 33.45 ? 71  THR A HG21 1  
ATOM 1172   H HG22 . THR A 1 71  ? 29.376  42.850  34.603  1.00 60.11 ? 71  THR A HG22 1  
ATOM 1173   H HG23 . THR A 1 71  ? 29.205  41.328  35.474  1.00 50.13 ? 71  THR A HG23 1  
ATOM 1174   N N    . THR A 1 72  ? 26.769  44.440  33.459  1.00 74.23 ? 72  THR A N    1  
ATOM 1175   C CA   . THR A 1 72  ? 26.490  45.191  32.255  1.00 25.24 ? 72  THR A CA   1  
ATOM 1176   C C    . THR A 1 72  ? 25.287  46.100  32.612  1.00 24.24 ? 72  THR A C    1  
ATOM 1177   O O    . THR A 1 72  ? 24.466  45.733  33.479  1.00 44.40 ? 72  THR A O    1  
ATOM 1178   C CB   . THR A 1 72  ? 26.135  44.241  31.061  1.00 60.23 ? 72  THR A CB   1  
ATOM 1179   O OG1  . THR A 1 72  ? 27.154  43.230  30.938  1.00 50.33 ? 72  THR A OG1  1  
ATOM 1180   C CG2  . THR A 1 72  ? 26.007  44.998  29.720  1.00 62.43 ? 72  THR A CG2  1  
ATOM 1181   H H    . THR A 1 72  ? 26.395  43.542  33.533  1.00 34.33 ? 72  THR A H    1  
ATOM 1182   H HA   . THR A 1 72  ? 27.359  45.796  32.002  1.00 10.14 ? 72  THR A HA   1  
ATOM 1183   H HB   . THR A 1 72  ? 25.191  43.748  31.276  1.00 25.33 ? 72  THR A HB   1  
ATOM 1184   H HG1  . THR A 1 72  ? 27.992  43.649  30.710  1.00 20.10 ? 72  THR A HG1  1  
ATOM 1185   H HG21 . THR A 1 72  ? 26.942  45.489  29.483  1.00 74.21 ? 72  THR A HG21 1  
ATOM 1186   H HG22 . THR A 1 72  ? 25.221  45.741  29.791  1.00 2.22  ? 72  THR A HG22 1  
ATOM 1187   H HG23 . THR A 1 72  ? 25.763  44.299  28.931  1.00 4.14  ? 72  THR A HG23 1  
ATOM 1188   N N    . GLU A 1 73  ? 25.222  47.276  31.993  1.00 61.50 ? 73  GLU A N    1  
ATOM 1189   C CA   . GLU A 1 73  ? 24.181  48.304  32.256  1.00 55.43 ? 73  GLU A CA   1  
ATOM 1190   C C    . GLU A 1 73  ? 23.171  48.368  31.093  1.00 1.24  ? 73  GLU A C    1  
ATOM 1191   O O    . GLU A 1 73  ? 21.997  48.703  31.296  1.00 4.14  ? 73  GLU A O    1  
ATOM 1192   C CB   . GLU A 1 73  ? 24.850  49.704  32.529  1.00 15.12 ? 73  GLU A CB   1  
ATOM 1193   C CG   . GLU A 1 73  ? 26.250  49.923  31.892  1.00 34.24 ? 73  GLU A CG   1  
ATOM 1194   C CD   . GLU A 1 73  ? 26.292  49.804  30.351  1.00 74.04 ? 73  GLU A CD   1  
ATOM 1195   O OE1  . GLU A 1 73  ? 25.909  50.770  29.657  1.00 0.35  ? 73  GLU A OE1  1  
ATOM 1196   O OE2  . GLU A 1 73  ? 26.702  48.735  29.826  1.00 25.14 ? 73  GLU A OE2  1  
ATOM 1197   H H    . GLU A 1 73  ? 25.899  47.467  31.311  1.00 30.32 ? 73  GLU A H    1  
ATOM 1198   H HA   . GLU A 1 73  ? 23.633  48.003  33.148  1.00 72.41 ? 73  GLU A HA   1  
ATOM 1199   H HB2  . GLU A 1 73  ? 24.194  50.489  32.170  1.00 51.35 ? 73  GLU A HB2  1  
ATOM 1200   H HB3  . GLU A 1 73  ? 24.956  49.830  33.604  1.00 64.03 ? 73  GLU A HB3  1  
ATOM 1201   H HG2  . GLU A 1 73  ? 26.602  50.909  32.171  1.00 62.23 ? 73  GLU A HG2  1  
ATOM 1202   H HG3  . GLU A 1 73  ? 26.929  49.187  32.319  1.00 34.21 ? 73  GLU A HG3  1  
ATOM 1203   N N    . ALA A 1 74  ? 23.647  48.056  29.881  1.00 32.13 ? 74  ALA A N    1  
ATOM 1204   C CA   . ALA A 1 74  ? 22.809  47.980  28.683  1.00 75.10 ? 74  ALA A CA   1  
ATOM 1205   C C    . ALA A 1 74  ? 22.023  46.649  28.671  1.00 23.04 ? 74  ALA A C    1  
ATOM 1206   O O    . ALA A 1 74  ? 22.591  45.615  29.045  1.00 74.02 ? 74  ALA A O    1  
ATOM 1207   C CB   . ALA A 1 74  ? 23.688  48.107  27.429  1.00 62.31 ? 74  ALA A CB   1  
ATOM 1208   H H    . ALA A 1 74  ? 24.599  47.866  29.792  1.00 41.14 ? 74  ALA A H    1  
ATOM 1209   H HA   . ALA A 1 74  ? 22.115  48.816  28.698  1.00 52.32 ? 74  ALA A HA   1  
ATOM 1210   H HB1  . ALA A 1 74  ? 23.065  48.087  26.543  1.00 24.43 ? 74  ALA A HB1  1  
ATOM 1211   H HB2  . ALA A 1 74  ? 24.393  47.287  27.390  1.00 32.32 ? 74  ALA A HB2  1  
ATOM 1212   H HB3  . ALA A 1 74  ? 24.232  49.042  27.460  1.00 33.21 ? 74  ALA A HB3  1  
ATOM 1213   N N    . PRO A 1 75  ? 20.710  46.650  28.251  1.00 12.32 ? 75  PRO A N    1  
ATOM 1214   C CA   . PRO A 1 75  ? 19.919  45.404  28.120  1.00 41.23 ? 75  PRO A CA   1  
ATOM 1215   C C    . PRO A 1 75  ? 20.543  44.452  27.054  1.00 75.41 ? 75  PRO A C    1  
ATOM 1216   O O    . PRO A 1 75  ? 20.707  44.870  25.903  1.00 53.22 ? 75  PRO A O    1  
ATOM 1217   C CB   . PRO A 1 75  ? 18.508  45.915  27.699  1.00 42.11 ? 75  PRO A CB   1  
ATOM 1218   C CG   . PRO A 1 75  ? 18.730  47.283  27.129  1.00 51.25 ? 75  PRO A CG   1  
ATOM 1219   C CD   . PRO A 1 75  ? 19.900  47.855  27.892  1.00 45.12 ? 75  PRO A CD   1  
ATOM 1220   H HA   . PRO A 1 75  ? 19.850  44.889  29.074  1.00 22.22 ? 75  PRO A HA   1  
ATOM 1221   H HB2  . PRO A 1 75  ? 18.059  45.254  26.961  1.00 42.31 ? 75  PRO A HB2  1  
ATOM 1222   H HB3  . PRO A 1 75  ? 17.858  45.979  28.569  1.00 20.11 ? 75  PRO A HB3  1  
ATOM 1223   H HG2  . PRO A 1 75  ? 18.961  47.209  26.067  1.00 31.32 ? 75  PRO A HG2  1  
ATOM 1224   H HG3  . PRO A 1 75  ? 17.850  47.901  27.275  1.00 52.41 ? 75  PRO A HG3  1  
ATOM 1225   H HD2  . PRO A 1 75  ? 20.471  48.534  27.265  1.00 41.15 ? 75  PRO A HD2  1  
ATOM 1226   H HD3  . PRO A 1 75  ? 19.566  48.368  28.784  1.00 21.14 ? 75  PRO A HD3  1  
ATOM 1227   N N    . PRO A 1 76  ? 20.976  43.197  27.445  1.00 63.21 ? 76  PRO A N    1  
ATOM 1228   C CA   . PRO A 1 76  ? 21.565  42.198  26.499  1.00 22.03 ? 76  PRO A CA   1  
ATOM 1229   C C    . PRO A 1 76  ? 20.683  41.950  25.244  1.00 3.42  ? 76  PRO A C    1  
ATOM 1230   O O    . PRO A 1 76  ? 19.534  41.536  25.407  1.00 21.23 ? 76  PRO A O    1  
ATOM 1231   C CB   . PRO A 1 76  ? 21.695  40.925  27.374  1.00 74.25 ? 76  PRO A CB   1  
ATOM 1232   C CG   . PRO A 1 76  ? 21.857  41.451  28.764  1.00 4.44  ? 76  PRO A CG   1  
ATOM 1233   C CD   . PRO A 1 76  ? 20.955  42.662  28.839  1.00 14.24 ? 76  PRO A CD   1  
ATOM 1234   H HA   . PRO A 1 76  ? 22.553  42.518  26.186  1.00 71.43 ? 76  PRO A HA   1  
ATOM 1235   H HB2  . PRO A 1 76  ? 20.797  40.312  27.292  1.00 12.22 ? 76  PRO A HB2  1  
ATOM 1236   H HB3  . PRO A 1 76  ? 22.566  40.346  27.088  1.00 71.44 ? 76  PRO A HB3  1  
ATOM 1237   H HG2  . PRO A 1 76  ? 21.553  40.700  29.487  1.00 12.21 ? 76  PRO A HG2  1  
ATOM 1238   H HG3  . PRO A 1 76  ? 22.888  41.745  28.942  1.00 44.24 ? 76  PRO A HG3  1  
ATOM 1239   H HD2  . PRO A 1 76  ? 19.946  42.375  29.123  1.00 22.11 ? 76  PRO A HD2  1  
ATOM 1240   H HD3  . PRO A 1 76  ? 21.344  43.391  29.542  1.00 72.12 ? 76  PRO A HD3  1  
ATOM 1241   N N    . PRO A 1 77  ? 21.236  42.178  23.990  1.00 15.22 ? 77  PRO A N    1  
ATOM 1242   C CA   . PRO A 1 77  ? 20.452  42.226  22.711  1.00 44.11 ? 77  PRO A CA   1  
ATOM 1243   C C    . PRO A 1 77  ? 19.387  41.104  22.545  1.00 51.01 ? 77  PRO A C    1  
ATOM 1244   O O    . PRO A 1 77  ? 19.694  39.937  22.821  1.00 53.31 ? 77  PRO A O    1  
ATOM 1245   C CB   . PRO A 1 77  ? 21.558  42.104  21.633  1.00 62.44 ? 77  PRO A CB   1  
ATOM 1246   C CG   . PRO A 1 77  ? 22.745  42.772  22.250  1.00 14.05 ? 77  PRO A CG   1  
ATOM 1247   C CD   . PRO A 1 77  ? 22.697  42.390  23.717  1.00 2.14  ? 77  PRO A CD   1  
ATOM 1248   H HA   . PRO A 1 77  ? 19.966  43.192  22.613  1.00 73.45 ? 77  PRO A HA   1  
ATOM 1249   H HB2  . PRO A 1 77  ? 21.770  41.055  21.415  1.00 4.04  ? 77  PRO A HB2  1  
ATOM 1250   H HB3  . PRO A 1 77  ? 21.268  42.619  20.726  1.00 13.53 ? 77  PRO A HB3  1  
ATOM 1251   H HG2  . PRO A 1 77  ? 23.662  42.415  21.784  1.00 61.53 ? 77  PRO A HG2  1  
ATOM 1252   H HG3  . PRO A 1 77  ? 22.668  43.850  22.144  1.00 43.20 ? 77  PRO A HG3  1  
ATOM 1253   H HD2  . PRO A 1 77  ? 23.260  41.476  23.893  1.00 5.02  ? 77  PRO A HD2  1  
ATOM 1254   H HD3  . PRO A 1 77  ? 23.094  43.188  24.336  1.00 3.24  ? 77  PRO A HD3  1  
ATOM 1255   N N    . PRO A 1 78  ? 18.121  41.447  22.096  1.00 4.14  ? 78  PRO A N    1  
ATOM 1256   C CA   . PRO A 1 78  ? 17.016  40.462  21.962  1.00 2.35  ? 78  PRO A CA   1  
ATOM 1257   C C    . PRO A 1 78  ? 17.328  39.363  20.922  1.00 0.43  ? 78  PRO A C    1  
ATOM 1258   O O    . PRO A 1 78  ? 17.825  39.687  19.837  1.00 22.02 ? 78  PRO A O    1  
ATOM 1259   C CB   . PRO A 1 78  ? 15.796  41.330  21.528  1.00 43.51 ? 78  PRO A CB   1  
ATOM 1260   C CG   . PRO A 1 78  ? 16.391  42.562  20.925  1.00 25.42 ? 78  PRO A CG   1  
ATOM 1261   C CD   . PRO A 1 78  ? 17.676  42.812  21.684  1.00 41.52 ? 78  PRO A CD   1  
ATOM 1262   H HA   . PRO A 1 78  ? 16.804  40.002  22.922  1.00 73.20 ? 78  PRO A HA   1  
ATOM 1263   H HB2  . PRO A 1 78  ? 15.174  40.799  20.808  1.00 11.33 ? 78  PRO A HB2  1  
ATOM 1264   H HB3  . PRO A 1 78  ? 15.195  41.594  22.396  1.00 11.44 ? 78  PRO A HB3  1  
ATOM 1265   H HG2  . PRO A 1 78  ? 16.593  42.394  19.869  1.00 33.34 ? 78  PRO A HG2  1  
ATOM 1266   H HG3  . PRO A 1 78  ? 15.716  43.405  21.043  1.00 0.34  ? 78  PRO A HG3  1  
ATOM 1267   H HD2  . PRO A 1 78  ? 18.413  43.285  21.042  1.00 24.51 ? 78  PRO A HD2  1  
ATOM 1268   H HD3  . PRO A 1 78  ? 17.496  43.431  22.555  1.00 22.14 ? 78  PRO A HD3  1  
ATOM 1269   N N    . PRO A 1 79  ? 17.055  38.048  21.244  1.00 3.42  ? 79  PRO A N    1  
ATOM 1270   C CA   . PRO A 1 79  ? 17.229  36.923  20.279  1.00 54.12 ? 79  PRO A CA   1  
ATOM 1271   C C    . PRO A 1 79  ? 16.418  37.144  18.970  1.00 1.33  ? 79  PRO A C    1  
ATOM 1272   O O    . PRO A 1 79  ? 15.469  37.940  18.979  1.00 71.05 ? 79  PRO A O    1  
ATOM 1273   C CB   . PRO A 1 79  ? 16.714  35.689  21.079  1.00 4.50  ? 79  PRO A CB   1  
ATOM 1274   C CG   . PRO A 1 79  ? 16.872  36.071  22.520  1.00 52.43 ? 79  PRO A CG   1  
ATOM 1275   C CD   . PRO A 1 79  ? 16.575  37.552  22.571  1.00 1.25  ? 79  PRO A CD   1  
ATOM 1276   H HA   . PRO A 1 79  ? 18.279  36.796  20.030  1.00 64.21 ? 79  PRO A HA   1  
ATOM 1277   H HB2  . PRO A 1 79  ? 15.667  35.489  20.843  1.00 22.44 ? 79  PRO A HB2  1  
ATOM 1278   H HB3  . PRO A 1 79  ? 17.313  34.815  20.856  1.00 1.01  ? 79  PRO A HB3  1  
ATOM 1279   H HG2  . PRO A 1 79  ? 16.167  35.513  23.135  1.00 31.03 ? 79  PRO A HG2  1  
ATOM 1280   H HG3  . PRO A 1 79  ? 17.887  35.883  22.856  1.00 62.34 ? 79  PRO A HG3  1  
ATOM 1281   H HD2  . PRO A 1 79  ? 15.508  37.728  22.684  1.00 50.41 ? 79  PRO A HD2  1  
ATOM 1282   H HD3  . PRO A 1 79  ? 17.116  38.026  23.382  1.00 34.41 ? 79  PRO A HD3  1  
ATOM 1283   N N    . PRO A 1 80  ? 16.800  36.485  17.819  1.00 20.20 ? 80  PRO A N    1  
ATOM 1284   C CA   . PRO A 1 80  ? 16.060  36.616  16.533  1.00 42.41 ? 80  PRO A CA   1  
ATOM 1285   C C    . PRO A 1 80  ? 14.589  36.141  16.653  1.00 11.53 ? 80  PRO A C    1  
ATOM 1286   O O    . PRO A 1 80  ? 14.260  34.981  16.392  1.00 33.12 ? 80  PRO A O    1  
ATOM 1287   C CB   . PRO A 1 80  ? 16.896  35.760  15.537  1.00 2.15  ? 80  PRO A CB   1  
ATOM 1288   C CG   . PRO A 1 80  ? 18.250  35.645  16.173  1.00 32.25 ? 80  PRO A CG   1  
ATOM 1289   C CD   . PRO A 1 80  ? 17.988  35.599  17.662  1.00 51.35 ? 80  PRO A CD   1  
ATOM 1290   H HA   . PRO A 1 80  ? 16.061  37.656  16.203  1.00 74.31 ? 80  PRO A HA   1  
ATOM 1291   H HB2  . PRO A 1 80  ? 16.442  34.776  15.404  1.00 62.20 ? 80  PRO A HB2  1  
ATOM 1292   H HB3  . PRO A 1 80  ? 16.971  36.260  14.579  1.00 33.43 ? 80  PRO A HB3  1  
ATOM 1293   H HG2  . PRO A 1 80  ? 18.746  34.734  15.841  1.00 23.12 ? 80  PRO A HG2  1  
ATOM 1294   H HG3  . PRO A 1 80  ? 18.856  36.510  15.928  1.00 71.32 ? 80  PRO A HG3  1  
ATOM 1295   H HD2  . PRO A 1 80  ? 17.762  34.587  17.984  1.00 24.10 ? 80  PRO A HD2  1  
ATOM 1296   H HD3  . PRO A 1 80  ? 18.837  35.986  18.212  1.00 44.35 ? 80  PRO A HD3  1  
ATOM 1297   N N    . GLY A 1 81  ? 13.743  37.068  17.118  1.00 21.43 ? 81  GLY A N    1  
ATOM 1298   C CA   . GLY A 1 81  ? 12.334  36.823  17.390  1.00 2.52  ? 81  GLY A CA   1  
ATOM 1299   C C    . GLY A 1 81  ? 11.828  37.812  18.437  1.00 62.41 ? 81  GLY A C    1  
ATOM 1300   O O    . GLY A 1 81  ? 10.735  38.374  18.312  1.00 21.22 ? 81  GLY A O    1  
ATOM 1301   H H    . GLY A 1 81  ? 14.105  37.963  17.314  1.00 22.03 ? 81  GLY A H    1  
ATOM 1302   H HA2  . GLY A 1 81  ? 11.771  36.943  16.473  1.00 34.11 ? 81  GLY A HA2  1  
ATOM 1303   H HA3  . GLY A 1 81  ? 12.200  35.815  17.763  1.00 54.01 ? 81  GLY A HA3  1  
ATOM 1304   N N    . GLY A 1 82  ? 12.668  38.030  19.473  1.00 23.30 ? 82  GLY A N    1  
ATOM 1305   C CA   . GLY A 1 82  ? 12.395  38.992  20.545  1.00 53.03 ? 82  GLY A CA   1  
ATOM 1306   C C    . GLY A 1 82  ? 12.541  38.361  21.920  1.00 4.10  ? 82  GLY A C    1  
ATOM 1307   O O    . GLY A 1 82  ? 13.197  37.321  22.068  1.00 10.31 ? 82  GLY A O    1  
ATOM 1308   H H    . GLY A 1 82  ? 13.503  37.512  19.509  1.00 35.32 ? 82  GLY A H    1  
ATOM 1309   H HA2  . GLY A 1 82  ? 13.099  39.809  20.461  1.00 50.53 ? 82  GLY A HA2  1  
ATOM 1310   H HA3  . GLY A 1 82  ? 11.389  39.385  20.443  1.00 3.34  ? 82  GLY A HA3  1  
ATOM 1311   N N    . TYR A 1 83  ? 11.939  39.001  22.933  1.00 73.51 ? 83  TYR A N    1  
ATOM 1312   C CA   . TYR A 1 83  ? 11.920  38.496  24.309  1.00 0.42  ? 83  TYR A CA   1  
ATOM 1313   C C    . TYR A 1 83  ? 10.594  37.769  24.560  1.00 25.02 ? 83  TYR A C    1  
ATOM 1314   O O    . TYR A 1 83  ? 9.530   38.401  24.634  1.00 54.35 ? 83  TYR A O    1  
ATOM 1315   C CB   . TYR A 1 83  ? 12.086  39.643  25.338  1.00 44.15 ? 83  TYR A CB   1  
ATOM 1316   C CG   . TYR A 1 83  ? 13.440  40.390  25.277  1.00 63.02 ? 83  TYR A CG   1  
ATOM 1317   C CD1  . TYR A 1 83  ? 14.644  39.729  25.403  1.00 11.03 ? 83  TYR A CD1  1  
ATOM 1318   C CD2  . TYR A 1 83  ? 13.497  41.763  25.125  1.00 74.41 ? 83  TYR A CD2  1  
ATOM 1319   C CE1  . TYR A 1 83  ? 15.851  40.415  25.384  1.00 54.34 ? 83  TYR A CE1  1  
ATOM 1320   C CE2  . TYR A 1 83  ? 14.689  42.455  25.097  1.00 43.03 ? 83  TYR A CE2  1  
ATOM 1321   C CZ   . TYR A 1 83  ? 15.857  41.782  25.228  1.00 70.53 ? 83  TYR A CZ   1  
ATOM 1322   O OH   . TYR A 1 83  ? 17.035  42.467  25.211  1.00 51.04 ? 83  TYR A OH   1  
ATOM 1323   H H    . TYR A 1 83  ? 11.474  39.831  22.744  1.00 3.22  ? 83  TYR A H    1  
ATOM 1324   H HA   . TYR A 1 83  ? 12.744  37.793  24.431  1.00 14.25 ? 83  TYR A HA   1  
ATOM 1325   H HB2  . TYR A 1 83  ? 11.289  40.362  25.185  1.00 5.12  ? 83  TYR A HB2  1  
ATOM 1326   H HB3  . TYR A 1 83  ? 11.986  39.230  26.339  1.00 51.13 ? 83  TYR A HB3  1  
ATOM 1327   H HD1  . TYR A 1 83  ? 14.648  38.646  25.526  1.00 23.33 ? 83  TYR A HD1  1  
ATOM 1328   H HD2  . TYR A 1 83  ? 12.570  42.309  25.018  1.00 14.01 ? 83  TYR A HD2  1  
ATOM 1329   H HE1  . TYR A 1 83  ? 16.780  39.870  25.481  1.00 11.12 ? 83  TYR A HE1  1  
ATOM 1330   H HE2  . TYR A 1 83  ? 14.683  43.536  24.974  1.00 30.22 ? 83  TYR A HE2  1  
ATOM 1331   H HH   . TYR A 1 83  ? 17.671  42.003  24.649  1.00 13.32 ? 83  TYR A HH   1  
ATOM 1332   N N    . ASP A 1 84  ? 10.671  36.437  24.640  1.00 1.02  ? 84  ASP A N    1  
ATOM 1333   C CA   . ASP A 1 84  ? 9.551   35.583  25.071  1.00 54.42 ? 84  ASP A CA   1  
ATOM 1334   C C    . ASP A 1 84  ? 9.004   36.006  26.452  1.00 63.51 ? 84  ASP A C    1  
ATOM 1335   O O    . ASP A 1 84  ? 9.736   36.563  27.283  1.00 44.33 ? 84  ASP A O    1  
ATOM 1336   C CB   . ASP A 1 84  ? 10.031  34.110  25.128  1.00 61.30 ? 84  ASP A CB   1  
ATOM 1337   C CG   . ASP A 1 84  ? 9.068   33.179  25.894  1.00 50.01 ? 84  ASP A CG   1  
ATOM 1338   O OD1  . ASP A 1 84  ? 8.092   32.693  25.301  1.00 21.25 ? 84  ASP A OD1  1  
ATOM 1339   O OD2  . ASP A 1 84  ? 9.268   32.969  27.116  1.00 71.31 ? 84  ASP A OD2  1  
ATOM 1340   H H    . ASP A 1 84  ? 11.516  36.005  24.397  1.00 55.40 ? 84  ASP A H    1  
ATOM 1341   H HA   . ASP A 1 84  ? 8.763   35.670  24.330  1.00 33.24 ? 84  ASP A HA   1  
ATOM 1342   H HB2  . ASP A 1 84  ? 10.140  33.741  24.115  1.00 25.30 ? 84  ASP A HB2  1  
ATOM 1343   H HB3  . ASP A 1 84  ? 11.008  34.073  25.609  1.00 55.31 ? 84  ASP A HB3  1  
ATOM 1344   N N    . PHE A 1 85  ? 7.727   35.677  26.700  1.00 70.22 ? 85  PHE A N    1  
ATOM 1345   C CA   . PHE A 1 85  ? 7.093   35.890  27.993  1.00 5.21  ? 85  PHE A CA   1  
ATOM 1346   C C    . PHE A 1 85  ? 5.915   34.902  28.128  1.00 12.44 ? 85  PHE A C    1  
ATOM 1347   O O    . PHE A 1 85  ? 4.779   35.316  28.319  1.00 52.10 ? 85  PHE A O    1  
ATOM 1348   C CB   . PHE A 1 85  ? 6.661   37.390  28.110  1.00 64.42 ? 85  PHE A CB   1  
ATOM 1349   C CG   . PHE A 1 85  ? 6.680   37.909  29.531  1.00 41.30 ? 85  PHE A CG   1  
ATOM 1350   C CD1  . PHE A 1 85  ? 7.859   37.843  30.270  1.00 11.54 ? 85  PHE A CD1  1  
ATOM 1351   C CD2  . PHE A 1 85  ? 5.551   38.445  30.130  1.00 20.23 ? 85  PHE A CD2  1  
ATOM 1352   C CE1  . PHE A 1 85  ? 7.906   38.291  31.568  1.00 33.21 ? 85  PHE A CE1  1  
ATOM 1353   C CE2  . PHE A 1 85  ? 5.602   38.896  31.426  1.00 53.54 ? 85  PHE A CE2  1  
ATOM 1354   C CZ   . PHE A 1 85  ? 6.781   38.815  32.146  1.00 63.43 ? 85  PHE A CZ   1  
ATOM 1355   H H    . PHE A 1 85  ? 7.193   35.280  25.974  1.00 22.30 ? 85  PHE A H    1  
ATOM 1356   H HA   . PHE A 1 85  ? 7.817   35.658  28.771  1.00 73.24 ? 85  PHE A HA   1  
ATOM 1357   H HB2  . PHE A 1 85  ? 7.345   38.006  27.527  1.00 53.43 ? 85  PHE A HB2  1  
ATOM 1358   H HB3  . PHE A 1 85  ? 5.662   37.511  27.703  1.00 21.45 ? 85  PHE A HB3  1  
ATOM 1359   H HD1  . PHE A 1 85  ? 8.754   37.429  29.816  1.00 34.25 ? 85  PHE A HD1  1  
ATOM 1360   H HD2  . PHE A 1 85  ? 4.625   38.509  29.567  1.00 23.51 ? 85  PHE A HD2  1  
ATOM 1361   H HE1  . PHE A 1 85  ? 8.830   38.233  32.131  1.00 1.02  ? 85  PHE A HE1  1  
ATOM 1362   H HE2  . PHE A 1 85  ? 4.714   39.309  31.886  1.00 54.52 ? 85  PHE A HE2  1  
ATOM 1363   H HZ   . PHE A 1 85  ? 6.814   39.165  33.169  1.00 14.23 ? 85  PHE A HZ   1  
ATOM 1364   N N    . SER A 1 86  ? 6.258   33.592  28.062  1.00 43.33 ? 86  SER A N    1  
ATOM 1365   C CA   . SER A 1 86  ? 5.327   32.431  27.933  1.00 74.44 ? 86  SER A CA   1  
ATOM 1366   C C    . SER A 1 86  ? 3.930   32.586  28.604  1.00 41.13 ? 86  SER A C    1  
ATOM 1367   O O    . SER A 1 86  ? 3.726   32.155  29.745  1.00 65.12 ? 86  SER A O    1  
ATOM 1368   C CB   . SER A 1 86  ? 6.016   31.172  28.508  1.00 22.04 ? 86  SER A CB   1  
ATOM 1369   O OG   . SER A 1 86  ? 7.266   30.933  27.917  1.00 31.25 ? 86  SER A OG   1  
ATOM 1370   H H    . SER A 1 86  ? 7.216   33.385  28.093  1.00 30.21 ? 86  SER A H    1  
ATOM 1371   H HA   . SER A 1 86  ? 5.182   32.271  26.874  1.00 44.13 ? 86  SER A HA   1  
ATOM 1372   H HB2  . SER A 1 86  ? 6.166   31.296  29.571  1.00 50.43 ? 86  SER A HB2  1  
ATOM 1373   H HB3  . SER A 1 86  ? 5.385   30.305  28.341  1.00 12.22 ? 86  SER A HB3  1  
ATOM 1374   H HG   . SER A 1 86  ? 7.470   31.622  27.269  1.00 64.10 ? 86  SER A HG   1  
ATOM 1375   N N    . GLY A 1 87  ? 2.977   33.188  27.863  1.00 3.23  ? 87  GLY A N    1  
ATOM 1376   C CA   . GLY A 1 87  ? 1.583   33.335  28.317  1.00 23.42 ? 87  GLY A CA   1  
ATOM 1377   C C    . GLY A 1 87  ? 1.411   34.074  29.652  1.00 53.34 ? 87  GLY A C    1  
ATOM 1378   O O    . GLY A 1 87  ? 0.411   33.870  30.352  1.00 70.11 ? 87  GLY A O    1  
ATOM 1379   H H    . GLY A 1 87  ? 3.228   33.547  26.988  1.00 12.42 ? 87  GLY A H    1  
ATOM 1380   H HA2  . GLY A 1 87  ? 1.042   33.880  27.560  1.00 64.44 ? 87  GLY A HA2  1  
ATOM 1381   H HA3  . GLY A 1 87  ? 1.141   32.346  28.404  1.00 42.41 ? 87  GLY A HA3  1  
ATOM 1382   N N    . PHE A 1 88  ? 2.388   34.928  30.002  1.00 64.15 ? 88  PHE A N    1  
ATOM 1383   C CA   . PHE A 1 88  ? 2.381   35.698  31.258  1.00 51.30 ? 88  PHE A CA   1  
ATOM 1384   C C    . PHE A 1 88  ? 1.826   37.110  31.008  1.00 72.34 ? 88  PHE A C    1  
ATOM 1385   O O    . PHE A 1 88  ? 1.938   37.649  29.902  1.00 4.13  ? 88  PHE A O    1  
ATOM 1386   C CB   . PHE A 1 88  ? 3.801   35.775  31.866  1.00 32.20 ? 88  PHE A CB   1  
ATOM 1387   C CG   . PHE A 1 88  ? 4.478   34.413  32.071  1.00 34.51 ? 88  PHE A CG   1  
ATOM 1388   C CD1  . PHE A 1 88  ? 3.881   33.418  32.840  1.00 62.35 ? 88  PHE A CD1  1  
ATOM 1389   C CD2  . PHE A 1 88  ? 5.713   34.137  31.495  1.00 61.13 ? 88  PHE A CD2  1  
ATOM 1390   C CE1  . PHE A 1 88  ? 4.502   32.193  33.022  1.00 31.14 ? 88  PHE A CE1  1  
ATOM 1391   C CE2  . PHE A 1 88  ? 6.330   32.916  31.678  1.00 51.12 ? 88  PHE A CE2  1  
ATOM 1392   C CZ   . PHE A 1 88  ? 5.726   31.943  32.443  1.00 53.11 ? 88  PHE A CZ   1  
ATOM 1393   H H    . PHE A 1 88  ? 3.139   35.047  29.393  1.00 43.01 ? 88  PHE A H    1  
ATOM 1394   H HA   . PHE A 1 88  ? 1.727   35.189  31.965  1.00 34.15 ? 88  PHE A HA   1  
ATOM 1395   H HB2  . PHE A 1 88  ? 4.426   36.373  31.212  1.00 3.14  ? 88  PHE A HB2  1  
ATOM 1396   H HB3  . PHE A 1 88  ? 3.746   36.268  32.832  1.00 65.34 ? 88  PHE A HB3  1  
ATOM 1397   H HD1  . PHE A 1 88  ? 2.916   33.606  33.302  1.00 4.15  ? 88  PHE A HD1  1  
ATOM 1398   H HD2  . PHE A 1 88  ? 6.195   34.899  30.888  1.00 70.34 ? 88  PHE A HD2  1  
ATOM 1399   H HE1  . PHE A 1 88  ? 4.025   31.431  33.624  1.00 4.04  ? 88  PHE A HE1  1  
ATOM 1400   H HE2  . PHE A 1 88  ? 7.291   32.726  31.222  1.00 34.21 ? 88  PHE A HE2  1  
ATOM 1401   H HZ   . PHE A 1 88  ? 6.212   30.987  32.587  1.00 11.23 ? 88  PHE A HZ   1  
ATOM 1402   N N    . ASP A 1 89  ? 1.272   37.712  32.070  1.00 34.11 ? 89  ASP A N    1  
ATOM 1403   C CA   . ASP A 1 89  ? 0.463   38.947  31.988  1.00 3.42  ? 89  ASP A CA   1  
ATOM 1404   C C    . ASP A 1 89  ? 1.364   40.216  31.929  1.00 53.22 ? 89  ASP A C    1  
ATOM 1405   O O    . ASP A 1 89  ? 1.439   40.985  32.890  1.00 42.22 ? 89  ASP A O    1  
ATOM 1406   C CB   . ASP A 1 89  ? -0.520  38.948  33.204  1.00 12.04 ? 89  ASP A CB   1  
ATOM 1407   C CG   . ASP A 1 89  ? -1.653  39.988  33.172  1.00 71.44 ? 89  ASP A CG   1  
ATOM 1408   O OD1  . ASP A 1 89  ? -1.954  40.555  32.095  1.00 14.34 ? 89  ASP A OD1  1  
ATOM 1409   O OD2  . ASP A 1 89  ? -2.297  40.197  34.232  1.00 33.14 ? 89  ASP A OD2  1  
ATOM 1410   H H    . ASP A 1 89  ? 1.413   37.309  32.953  1.00 4.55  ? 89  ASP A H    1  
ATOM 1411   H HA   . ASP A 1 89  ? -0.122  38.899  31.073  1.00 61.44 ? 89  ASP A HA   1  
ATOM 1412   H HB2  . ASP A 1 89  ? -0.988  37.973  33.266  1.00 33.33 ? 89  ASP A HB2  1  
ATOM 1413   H HB3  . ASP A 1 89  ? 0.062   39.099  34.112  1.00 22.22 ? 89  ASP A HB3  1  
ATOM 1414   N N    . VAL A 1 90  ? 2.025   40.405  30.760  1.00 1.32  ? 90  VAL A N    1  
ATOM 1415   C CA   . VAL A 1 90  ? 3.016   41.491  30.498  1.00 75.21 ? 90  VAL A CA   1  
ATOM 1416   C C    . VAL A 1 90  ? 2.543   42.889  30.974  1.00 14.45 ? 90  VAL A C    1  
ATOM 1417   O O    . VAL A 1 90  ? 3.248   43.562  31.743  1.00 34.15 ? 90  VAL A O    1  
ATOM 1418   C CB   . VAL A 1 90  ? 3.425   41.521  28.955  1.00 14.24 ? 90  VAL A CB   1  
ATOM 1419   C CG1  . VAL A 1 90  ? 2.190   41.433  28.024  1.00 74.10 ? 90  VAL A CG1  1  
ATOM 1420   C CG2  . VAL A 1 90  ? 4.280   42.769  28.600  1.00 43.41 ? 90  VAL A CG2  1  
ATOM 1421   H H    . VAL A 1 90  ? 1.837   39.777  30.031  1.00 13.44 ? 90  VAL A H    1  
ATOM 1422   H HA   . VAL A 1 90  ? 3.909   41.234  31.059  1.00 40.42 ? 90  VAL A HA   1  
ATOM 1423   H HB   . VAL A 1 90  ? 4.039   40.637  28.762  1.00 11.13 ? 90  VAL A HB   1  
ATOM 1424   H HG11 . VAL A 1 90  ? 1.541   42.282  28.195  1.00 1.31  ? 90  VAL A HG11 1  
ATOM 1425   H HG12 . VAL A 1 90  ? 1.645   40.521  28.231  1.00 12.50 ? 90  VAL A HG12 1  
ATOM 1426   H HG13 . VAL A 1 90  ? 2.506   41.428  26.987  1.00 35.52 ? 90  VAL A HG13 1  
ATOM 1427   H HG21 . VAL A 1 90  ? 4.577   42.730  27.560  1.00 24.12 ? 90  VAL A HG21 1  
ATOM 1428   H HG22 . VAL A 1 90  ? 5.164   42.798  29.220  1.00 10.33 ? 90  VAL A HG22 1  
ATOM 1429   H HG23 . VAL A 1 90  ? 3.700   43.671  28.767  1.00 42.14 ? 90  VAL A HG23 1  
ATOM 1430   N N    . GLU A 1 91  ? 1.321   43.273  30.580  1.00 51.12 ? 91  GLU A N    1  
ATOM 1431   C CA   . GLU A 1 91  ? 0.780   44.635  30.792  1.00 33.13 ? 91  GLU A CA   1  
ATOM 1432   C C    . GLU A 1 91  ? 0.432   44.938  32.265  1.00 25.03 ? 91  GLU A C    1  
ATOM 1433   O O    . GLU A 1 91  ? 0.033   46.063  32.590  1.00 33.11 ? 91  GLU A O    1  
ATOM 1434   C CB   . GLU A 1 91  ? -0.462  44.829  29.886  1.00 75.33 ? 91  GLU A CB   1  
ATOM 1435   C CG   . GLU A 1 91  ? -0.171  44.678  28.378  1.00 52.32 ? 91  GLU A CG   1  
ATOM 1436   C CD   . GLU A 1 91  ? 0.846   45.710  27.853  1.00 21.13 ? 91  GLU A CD   1  
ATOM 1437   O OE1  . GLU A 1 91  ? 2.071   45.446  27.894  1.00 1.44  ? 91  GLU A OE1  1  
ATOM 1438   O OE2  . GLU A 1 91  ? 0.424   46.806  27.419  1.00 24.24 ? 91  GLU A OE2  1  
ATOM 1439   H H    . GLU A 1 91  ? 0.754   42.617  30.125  1.00 4.51  ? 91  GLU A H    1  
ATOM 1440   H HA   . GLU A 1 91  ? 1.542   45.343  30.479  1.00 14.24 ? 91  GLU A HA   1  
ATOM 1441   H HB2  . GLU A 1 91  ? -1.211  44.092  30.161  1.00 24.12 ? 91  GLU A HB2  1  
ATOM 1442   H HB3  . GLU A 1 91  ? -0.877  45.820  30.054  1.00 25.53 ? 91  GLU A HB3  1  
ATOM 1443   H HG2  . GLU A 1 91  ? 0.215   43.677  28.198  1.00 20.01 ? 91  GLU A HG2  1  
ATOM 1444   H HG3  . GLU A 1 91  ? -1.104  44.790  27.833  1.00 33.41 ? 91  GLU A HG3  1  
ATOM 1445   N N    . ASP A 1 92  ? 0.574   43.935  33.146  1.00 22.14 ? 92  ASP A N    1  
ATOM 1446   C CA   . ASP A 1 92  ? 0.310   44.086  34.592  1.00 45.35 ? 92  ASP A CA   1  
ATOM 1447   C C    . ASP A 1 92  ? 1.621   44.092  35.402  1.00 15.15 ? 92  ASP A C    1  
ATOM 1448   O O    . ASP A 1 92  ? 1.644   44.554  36.551  1.00 11.24 ? 92  ASP A O    1  
ATOM 1449   C CB   . ASP A 1 92  ? -0.620  42.942  35.066  1.00 12.45 ? 92  ASP A CB   1  
ATOM 1450   C CG   . ASP A 1 92  ? -1.054  43.050  36.539  1.00 21.04 ? 92  ASP A CG   1  
ATOM 1451   O OD1  . ASP A 1 92  ? -0.555  42.273  37.382  1.00 25.51 ? 92  ASP A OD1  1  
ATOM 1452   O OD2  . ASP A 1 92  ? -1.893  43.921  36.862  1.00 14.01 ? 92  ASP A OD2  1  
ATOM 1453   H H    . ASP A 1 92  ? 0.863   43.058  32.816  1.00 22.32 ? 92  ASP A H    1  
ATOM 1454   H HA   . ASP A 1 92  ? -0.197  45.036  34.752  1.00 22.21 ? 92  ASP A HA   1  
ATOM 1455   H HB2  . ASP A 1 92  ? -1.514  42.944  34.450  1.00 61.35 ? 92  ASP A HB2  1  
ATOM 1456   H HB3  . ASP A 1 92  ? -0.110  41.992  34.915  1.00 30.14 ? 92  ASP A HB3  1  
ATOM 1457   N N    . PHE A 1 93  ? 2.725   43.604  34.800  1.00 5.52  ? 93  PHE A N    1  
ATOM 1458   C CA   . PHE A 1 93  ? 4.001   43.390  35.527  1.00 30.15 ? 93  PHE A CA   1  
ATOM 1459   C C    . PHE A 1 93  ? 4.843   44.680  35.563  1.00 15.25 ? 93  PHE A C    1  
ATOM 1460   O O    . PHE A 1 93  ? 4.465   45.696  34.969  1.00 31.02 ? 93  PHE A O    1  
ATOM 1461   C CB   . PHE A 1 93  ? 4.784   42.187  34.917  1.00 24.40 ? 93  PHE A CB   1  
ATOM 1462   C CG   . PHE A 1 93  ? 4.089   40.813  35.042  1.00 52.31 ? 93  PHE A CG   1  
ATOM 1463   C CD1  . PHE A 1 93  ? 2.819   40.672  35.602  1.00 71.01 ? 93  PHE A CD1  1  
ATOM 1464   C CD2  . PHE A 1 93  ? 4.709   39.670  34.566  1.00 63.12 ? 93  PHE A CD2  1  
ATOM 1465   C CE1  . PHE A 1 93  ? 2.208   39.445  35.670  1.00 23.23 ? 93  PHE A CE1  1  
ATOM 1466   C CE2  . PHE A 1 93  ? 4.098   38.433  34.640  1.00 53.11 ? 93  PHE A CE2  1  
ATOM 1467   C CZ   . PHE A 1 93  ? 2.848   38.323  35.185  1.00 42.52 ? 93  PHE A CZ   1  
ATOM 1468   H H    . PHE A 1 93  ? 2.693   43.409  33.835  1.00 31.22 ? 93  PHE A H    1  
ATOM 1469   H HA   . PHE A 1 93  ? 3.751   43.138  36.559  1.00 72.42 ? 93  PHE A HA   1  
ATOM 1470   H HB2  . PHE A 1 93  ? 4.948   42.373  33.864  1.00 20.11 ? 93  PHE A HB2  1  
ATOM 1471   H HB3  . PHE A 1 93  ? 5.747   42.109  35.413  1.00 13.13 ? 93  PHE A HB3  1  
ATOM 1472   H HD1  . PHE A 1 93  ? 2.298   41.544  35.983  1.00 21.33 ? 93  PHE A HD1  1  
ATOM 1473   H HD2  . PHE A 1 93  ? 5.698   39.748  34.138  1.00 44.23 ? 93  PHE A HD2  1  
ATOM 1474   H HE1  . PHE A 1 93  ? 1.222   39.356  36.106  1.00 53.32 ? 93  PHE A HE1  1  
ATOM 1475   H HE2  . PHE A 1 93  ? 4.608   37.557  34.259  1.00 73.34 ? 93  PHE A HE2  1  
ATOM 1476   H HZ   . PHE A 1 93  ? 2.364   37.356  35.242  1.00 15.14 ? 93  PHE A HZ   1  
ATOM 1477   N N    . SER A 1 94  ? 5.986   44.608  36.273  1.00 51.44 ? 94  SER A N    1  
ATOM 1478   C CA   . SER A 1 94  ? 6.792   45.777  36.670  1.00 25.22 ? 94  SER A CA   1  
ATOM 1479   C C    . SER A 1 94  ? 7.303   46.622  35.487  1.00 61.35 ? 94  SER A C    1  
ATOM 1480   O O    . SER A 1 94  ? 7.518   46.112  34.370  1.00 74.50 ? 94  SER A O    1  
ATOM 1481   C CB   . SER A 1 94  ? 7.995   45.314  37.523  1.00 41.14 ? 94  SER A CB   1  
ATOM 1482   O OG   . SER A 1 94  ? 8.866   44.459  36.793  1.00 71.42 ? 94  SER A OG   1  
ATOM 1483   H H    . SER A 1 94  ? 6.298   43.724  36.549  1.00 34.22 ? 94  SER A H    1  
ATOM 1484   H HA   . SER A 1 94  ? 6.163   46.403  37.291  1.00 11.11 ? 94  SER A HA   1  
ATOM 1485   H HB2  . SER A 1 94  ? 8.562   46.177  37.857  1.00 20.44 ? 94  SER A HB2  1  
ATOM 1486   H HB3  . SER A 1 94  ? 7.632   44.774  38.389  1.00 74.23 ? 94  SER A HB3  1  
ATOM 1487   H HG   . SER A 1 94  ? 8.517   43.559  36.794  1.00 63.43 ? 94  SER A HG   1  
ATOM 1488   N N    . GLU A 1 95  ? 7.481   47.930  35.768  1.00 4.04  ? 95  GLU A N    1  
ATOM 1489   C CA   . GLU A 1 95  ? 8.210   48.859  34.889  1.00 34.55 ? 95  GLU A CA   1  
ATOM 1490   C C    . GLU A 1 95  ? 9.607   48.295  34.569  1.00 60.41 ? 95  GLU A C    1  
ATOM 1491   O O    . GLU A 1 95  ? 10.011  48.278  33.415  1.00 72.34 ? 95  GLU A O    1  
ATOM 1492   C CB   . GLU A 1 95  ? 8.339   50.260  35.555  1.00 64.42 ? 95  GLU A CB   1  
ATOM 1493   C CG   . GLU A 1 95  ? 8.843   50.226  37.028  1.00 65.04 ? 95  GLU A CG   1  
ATOM 1494   C CD   . GLU A 1 95  ? 9.510   51.523  37.493  1.00 52.13 ? 95  GLU A CD   1  
ATOM 1495   O OE1  . GLU A 1 95  ? 8.872   52.592  37.439  1.00 74.31 ? 95  GLU A OE1  1  
ATOM 1496   O OE2  . GLU A 1 95  ? 10.684  51.481  37.919  1.00 14.41 ? 95  GLU A OE2  1  
ATOM 1497   H H    . GLU A 1 95  ? 7.102   48.280  36.602  1.00 14.04 ? 95  GLU A H    1  
ATOM 1498   H HA   . GLU A 1 95  ? 7.648   48.956  33.966  1.00 74.52 ? 95  GLU A HA   1  
ATOM 1499   H HB2  . GLU A 1 95  ? 9.028   50.865  34.969  1.00 13.24 ? 95  GLU A HB2  1  
ATOM 1500   H HB3  . GLU A 1 95  ? 7.368   50.743  35.540  1.00 0.31  ? 95  GLU A HB3  1  
ATOM 1501   H HG2  . GLU A 1 95  ? 8.000   50.028  37.682  1.00 23.02 ? 95  GLU A HG2  1  
ATOM 1502   H HG3  . GLU A 1 95  ? 9.553   49.409  37.126  1.00 31.24 ? 95  GLU A HG3  1  
ATOM 1503   N N    . PHE A 1 96  ? 10.283  47.784  35.620  1.00 63.12 ? 96  PHE A N    1  
ATOM 1504   C CA   . PHE A 1 96  ? 11.628  47.187  35.540  1.00 42.22 ? 96  PHE A CA   1  
ATOM 1505   C C    . PHE A 1 96  ? 11.712  46.146  34.410  1.00 11.02 ? 96  PHE A C    1  
ATOM 1506   O O    . PHE A 1 96  ? 12.622  46.198  33.574  1.00 41.14 ? 96  PHE A O    1  
ATOM 1507   C CB   . PHE A 1 96  ? 11.982  46.524  36.902  1.00 22.04 ? 96  PHE A CB   1  
ATOM 1508   C CG   . PHE A 1 96  ? 13.279  45.696  36.888  1.00 75.03 ? 96  PHE A CG   1  
ATOM 1509   C CD1  . PHE A 1 96  ? 14.518  46.324  36.860  1.00 42.34 ? 96  PHE A CD1  1  
ATOM 1510   C CD2  . PHE A 1 96  ? 13.247  44.298  36.880  1.00 11.40 ? 96  PHE A CD2  1  
ATOM 1511   C CE1  . PHE A 1 96  ? 15.678  45.587  36.827  1.00 71.32 ? 96  PHE A CE1  1  
ATOM 1512   C CE2  . PHE A 1 96  ? 14.417  43.561  36.851  1.00 13.10 ? 96  PHE A CE2  1  
ATOM 1513   C CZ   . PHE A 1 96  ? 15.630  44.206  36.821  1.00 22.32 ? 96  PHE A CZ   1  
ATOM 1514   H H    . PHE A 1 96  ? 9.844   47.806  36.492  1.00 3.42  ? 96  PHE A H    1  
ATOM 1515   H HA   . PHE A 1 96  ? 12.334  47.985  35.343  1.00 51.34 ? 96  PHE A HA   1  
ATOM 1516   H HB2  . PHE A 1 96  ? 12.090  47.303  37.653  1.00 23.12 ? 96  PHE A HB2  1  
ATOM 1517   H HB3  . PHE A 1 96  ? 11.164  45.876  37.201  1.00 20.13 ? 96  PHE A HB3  1  
ATOM 1518   H HD1  . PHE A 1 96  ? 14.568  47.408  36.868  1.00 71.20 ? 96  PHE A HD1  1  
ATOM 1519   H HD2  . PHE A 1 96  ? 12.287  43.788  36.901  1.00 44.31 ? 96  PHE A HD2  1  
ATOM 1520   H HE1  . PHE A 1 96  ? 16.632  46.092  36.810  1.00 23.31 ? 96  PHE A HE1  1  
ATOM 1521   H HE2  . PHE A 1 96  ? 14.374  42.481  36.847  1.00 21.50 ? 96  PHE A HE2  1  
ATOM 1522   H HZ   . PHE A 1 96  ? 16.549  43.634  36.796  1.00 13.35 ? 96  PHE A HZ   1  
ATOM 1523   N N    . PHE A 1 97  ? 10.749  45.210  34.414  1.00 20.11 ? 97  PHE A N    1  
ATOM 1524   C CA   . PHE A 1 97  ? 10.603  44.213  33.350  1.00 4.41  ? 97  PHE A CA   1  
ATOM 1525   C C    . PHE A 1 97  ? 10.392  44.913  31.983  1.00 30.40 ? 97  PHE A C    1  
ATOM 1526   O O    . PHE A 1 97  ? 11.143  44.658  31.035  1.00 22.00 ? 97  PHE A O    1  
ATOM 1527   C CB   . PHE A 1 97  ? 9.433   43.216  33.688  1.00 11.30 ? 97  PHE A CB   1  
ATOM 1528   C CG   . PHE A 1 97  ? 8.777   42.580  32.451  1.00 2.52  ? 97  PHE A CG   1  
ATOM 1529   C CD1  . PHE A 1 97  ? 9.517   41.781  31.581  1.00 14.23 ? 97  PHE A CD1  1  
ATOM 1530   C CD2  . PHE A 1 97  ? 7.454   42.861  32.127  1.00 0.13  ? 97  PHE A CD2  1  
ATOM 1531   C CE1  . PHE A 1 97  ? 8.955   41.292  30.426  1.00 35.12 ? 97  PHE A CE1  1  
ATOM 1532   C CE2  . PHE A 1 97  ? 6.889   42.357  30.982  1.00 63.23 ? 97  PHE A CE2  1  
ATOM 1533   C CZ   . PHE A 1 97  ? 7.639   41.580  30.125  1.00 32.24 ? 97  PHE A CZ   1  
ATOM 1534   H H    . PHE A 1 97  ? 10.113  45.195  35.164  1.00 62.14 ? 97  PHE A H    1  
ATOM 1535   H HA   . PHE A 1 97  ? 11.535  43.649  33.304  1.00 62.43 ? 97  PHE A HA   1  
ATOM 1536   H HB2  . PHE A 1 97  ? 9.820   42.416  34.314  1.00 43.40 ? 97  PHE A HB2  1  
ATOM 1537   H HB3  . PHE A 1 97  ? 8.671   43.749  34.249  1.00 45.22 ? 97  PHE A HB3  1  
ATOM 1538   H HD1  . PHE A 1 97  ? 10.550  41.549  31.820  1.00 31.14 ? 97  PHE A HD1  1  
ATOM 1539   H HD2  . PHE A 1 97  ? 6.859   43.475  32.800  1.00 62.43 ? 97  PHE A HD2  1  
ATOM 1540   H HE1  . PHE A 1 97  ? 9.542   40.674  29.763  1.00 72.32 ? 97  PHE A HE1  1  
ATOM 1541   H HE2  . PHE A 1 97  ? 5.861   42.582  30.748  1.00 60.22 ? 97  PHE A HE2  1  
ATOM 1542   H HZ   . PHE A 1 97  ? 7.198   41.196  29.216  1.00 34.34 ? 97  PHE A HZ   1  
ATOM 1543   N N    . GLN A 1 98  ? 9.377   45.793  31.897  1.00 73.05 ? 98  GLN A N    1  
ATOM 1544   C CA   . GLN A 1 98  ? 8.974   46.413  30.612  1.00 12.21 ? 98  GLN A CA   1  
ATOM 1545   C C    . GLN A 1 98  ? 10.000  47.441  30.078  1.00 71.43 ? 98  GLN A C    1  
ATOM 1546   O O    . GLN A 1 98  ? 9.809   47.959  28.985  1.00 5.44  ? 98  GLN A O    1  
ATOM 1547   C CB   . GLN A 1 98  ? 7.566   47.065  30.722  1.00 32.23 ? 98  GLN A CB   1  
ATOM 1548   C CG   . GLN A 1 98  ? 6.408   46.063  30.931  1.00 54.35 ? 98  GLN A CG   1  
ATOM 1549   C CD   . GLN A 1 98  ? 5.013   46.663  30.706  1.00 32.43 ? 98  GLN A CD   1  
ATOM 1550   O OE1  . GLN A 1 98  ? 4.781   47.849  30.930  1.00 41.01 ? 98  GLN A OE1  1  
ATOM 1551   N NE2  . GLN A 1 98  ? 4.075   45.847  30.254  1.00 72.23 ? 98  GLN A NE2  1  
ATOM 1552   H H    . GLN A 1 98  ? 8.895   46.042  32.722  1.00 54.43 ? 98  GLN A H    1  
ATOM 1553   H HA   . GLN A 1 98  ? 8.913   45.610  29.881  1.00 10.41 ? 98  GLN A HA   1  
ATOM 1554   H HB2  . GLN A 1 98  ? 7.571   47.755  31.557  1.00 12.45 ? 98  GLN A HB2  1  
ATOM 1555   H HB3  . GLN A 1 98  ? 7.368   47.622  29.813  1.00 64.44 ? 98  GLN A HB3  1  
ATOM 1556   H HG2  . GLN A 1 98  ? 6.539   45.237  30.241  1.00 3.21  ? 98  GLN A HG2  1  
ATOM 1557   H HG3  . GLN A 1 98  ? 6.458   45.681  31.945  1.00 14.11 ? 98  GLN A HG3  1  
ATOM 1558   H HE21 . GLN A 1 98  ? 4.316   44.915  30.095  1.00 74.14 ? 98  GLN A HE21 1  
ATOM 1559   H HE22 . GLN A 1 98  ? 3.181   46.211  30.078  1.00 53.24 ? 98  GLN A HE22 1  
ATOM 1560   N N    . GLU A 1 99  ? 11.044  47.766  30.863  1.00 70.02 ? 99  GLU A N    1  
ATOM 1561   C CA   . GLU A 1 99  ? 12.154  48.655  30.420  1.00 60.41 ? 99  GLU A CA   1  
ATOM 1562   C C    . GLU A 1 99  ? 13.411  47.854  30.038  1.00 13.21 ? 99  GLU A C    1  
ATOM 1563   O O    . GLU A 1 99  ? 14.117  48.216  29.092  1.00 2.21  ? 99  GLU A O    1  
ATOM 1564   C CB   . GLU A 1 99  ? 12.484  49.677  31.528  1.00 45.42 ? 99  GLU A CB   1  
ATOM 1565   C CG   . GLU A 1 99  ? 11.319  50.623  31.871  1.00 62.14 ? 99  GLU A CG   1  
ATOM 1566   C CD   . GLU A 1 99  ? 11.607  51.483  33.105  1.00 12.31 ? 99  GLU A CD   1  
ATOM 1567   O OE1  . GLU A 1 99  ? 11.683  50.917  34.223  1.00 62.30 ? 99  GLU A OE1  1  
ATOM 1568   O OE2  . GLU A 1 99  ? 11.769  52.717  32.976  1.00 42.31 ? 99  GLU A OE2  1  
ATOM 1569   H H    . GLU A 1 99  ? 11.063  47.418  31.784  1.00 42.52 ? 99  GLU A H    1  
ATOM 1570   H HA   . GLU A 1 99  ? 11.817  49.197  29.540  1.00 65.42 ? 99  GLU A HA   1  
ATOM 1571   H HB2  . GLU A 1 99  ? 12.757  49.136  32.430  1.00 43.33 ? 99  GLU A HB2  1  
ATOM 1572   H HB3  . GLU A 1 99  ? 13.329  50.282  31.214  1.00 43.03 ? 99  GLU A HB3  1  
ATOM 1573   H HG2  . GLU A 1 99  ? 11.128  51.262  31.013  1.00 31.52 ? 99  GLU A HG2  1  
ATOM 1574   H HG3  . GLU A 1 99  ? 10.426  50.030  32.063  1.00 22.43 ? 99  GLU A HG3  1  
ATOM 1575   N N    . LEU A 1 100 ? 13.702  46.789  30.808  1.00 14.11 ? 100 LEU A N    1  
ATOM 1576   C CA   . LEU A 1 100 ? 14.850  45.894  30.542  1.00 4.11  ? 100 LEU A CA   1  
ATOM 1577   C C    . LEU A 1 100 ? 14.595  45.087  29.256  1.00 20.42 ? 100 LEU A C    1  
ATOM 1578   O O    . LEU A 1 100 ? 15.442  45.028  28.355  1.00 11.24 ? 100 LEU A O    1  
ATOM 1579   C CB   . LEU A 1 100 ? 15.095  44.958  31.765  1.00 50.42 ? 100 LEU A CB   1  
ATOM 1580   C CG   . LEU A 1 100 ? 16.198  43.856  31.605  1.00 55.03 ? 100 LEU A CG   1  
ATOM 1581   C CD1  . LEU A 1 100 ? 17.554  44.449  31.154  1.00 0.24  ? 100 LEU A CD1  1  
ATOM 1582   C CD2  . LEU A 1 100 ? 16.353  43.032  32.909  1.00 41.43 ? 100 LEU A CD2  1  
ATOM 1583   H H    . LEU A 1 100 ? 13.128  46.599  31.575  1.00 72.04 ? 100 LEU A H    1  
ATOM 1584   H HA   . LEU A 1 100 ? 15.731  46.517  30.396  1.00 64.22 ? 100 LEU A HA   1  
ATOM 1585   H HB2  . LEU A 1 100 ? 15.360  45.582  32.613  1.00 71.12 ? 100 LEU A HB2  1  
ATOM 1586   H HB3  . LEU A 1 100 ? 14.156  44.462  31.999  1.00 11.31 ? 100 LEU A HB3  1  
ATOM 1587   H HG   . LEU A 1 100 ? 15.881  43.171  30.827  1.00 65.43 ? 100 LEU A HG   1  
ATOM 1588   H HD11 . LEU A 1 100 ? 17.899  45.182  31.872  1.00 60.35 ? 100 LEU A HD11 1  
ATOM 1589   H HD12 . LEU A 1 100 ? 17.441  44.923  30.188  1.00 10.40 ? 100 LEU A HD12 1  
ATOM 1590   H HD13 . LEU A 1 100 ? 18.290  43.658  31.070  1.00 63.40 ? 100 LEU A HD13 1  
ATOM 1591   H HD21 . LEU A 1 100 ? 16.640  43.683  33.728  1.00 61.41 ? 100 LEU A HD21 1  
ATOM 1592   H HD22 . LEU A 1 100 ? 17.113  42.273  32.775  1.00 74.33 ? 100 LEU A HD22 1  
ATOM 1593   H HD23 . LEU A 1 100 ? 15.414  42.550  33.146  1.00 0.14  ? 100 LEU A HD23 1  
ATOM 1594   N N    . PHE A 1 101 ? 13.410  44.489  29.188  1.00 71.22 ? 101 PHE A N    1  
ATOM 1595   C CA   . PHE A 1 101 ? 12.970  43.699  28.035  1.00 70.43 ? 101 PHE A CA   1  
ATOM 1596   C C    . PHE A 1 101 ? 12.192  44.569  27.017  1.00 54.51 ? 101 PHE A C    1  
ATOM 1597   O O    . PHE A 1 101 ? 11.929  44.124  25.898  1.00 72.11 ? 101 PHE A O    1  
ATOM 1598   C CB   . PHE A 1 101 ? 12.129  42.495  28.520  1.00 70.34 ? 101 PHE A CB   1  
ATOM 1599   C CG   . PHE A 1 101 ? 12.920  41.522  29.415  1.00 41.11 ? 101 PHE A CG   1  
ATOM 1600   C CD1  . PHE A 1 101 ? 13.650  40.469  28.868  1.00 63.31 ? 101 PHE A CD1  1  
ATOM 1601   C CD2  . PHE A 1 101 ? 12.949  41.681  30.797  1.00 13.24 ? 101 PHE A CD2  1  
ATOM 1602   C CE1  . PHE A 1 101 ? 14.377  39.608  29.668  1.00 23.44 ? 101 PHE A CE1  1  
ATOM 1603   C CE2  . PHE A 1 101 ? 13.672  40.819  31.600  1.00 40.31 ? 101 PHE A CE2  1  
ATOM 1604   C CZ   . PHE A 1 101 ? 14.386  39.783  31.032  1.00 1.51  ? 101 PHE A CZ   1  
ATOM 1605   H H    . PHE A 1 101 ? 12.804  44.587  29.944  1.00 2.13  ? 101 PHE A H    1  
ATOM 1606   H HA   . PHE A 1 101 ? 13.860  43.316  27.531  1.00 3.40  ? 101 PHE A HA   1  
ATOM 1607   H HB2  . PHE A 1 101 ? 11.272  42.864  29.080  1.00 32.11 ? 101 PHE A HB2  1  
ATOM 1608   H HB3  . PHE A 1 101 ? 11.767  41.947  27.658  1.00 60.41 ? 101 PHE A HB3  1  
ATOM 1609   H HD1  . PHE A 1 101 ? 13.643  40.324  27.795  1.00 31.31 ? 101 PHE A HD1  1  
ATOM 1610   H HD2  . PHE A 1 101 ? 12.390  42.495  31.250  1.00 10.33 ? 101 PHE A HD2  1  
ATOM 1611   H HE1  . PHE A 1 101 ? 14.937  38.798  29.221  1.00 43.25 ? 101 PHE A HE1  1  
ATOM 1612   H HE2  . PHE A 1 101 ? 13.677  40.956  32.674  1.00 22.44 ? 101 PHE A HE2  1  
ATOM 1613   H HZ   . PHE A 1 101 ? 14.955  39.110  31.661  1.00 4.21  ? 101 PHE A HZ   1  
ATOM 1614   N N    . GLY A 1 102 ? 11.878  45.824  27.399  1.00 51.13 ? 102 GLY A N    1  
ATOM 1615   C CA   . GLY A 1 102 ? 11.173  46.791  26.524  1.00 23.41 ? 102 GLY A CA   1  
ATOM 1616   C C    . GLY A 1 102 ? 11.692  46.881  25.083  1.00 72.43 ? 102 GLY A C    1  
ATOM 1617   O O    . GLY A 1 102 ? 10.926  46.573  24.147  1.00 64.01 ? 102 GLY A O    1  
ATOM 1618   H H    . GLY A 1 102 ? 12.133  46.111  28.302  1.00 62.14 ? 102 GLY A H    1  
ATOM 1619   H HA2  . GLY A 1 102 ? 10.123  46.522  26.505  1.00 41.31 ? 102 GLY A HA2  1  
ATOM 1620   H HA3  . GLY A 1 102 ? 11.266  47.770  26.974  1.00 23.33 ? 102 GLY A HA3  1  
ATOM 1621   N N    . PRO A 1 103 ? 13.019  47.234  24.880  1.00 21.21 ? 103 PRO A N    1  
ATOM 1622   C CA   . PRO A 1 103 ? 13.668  47.343  23.541  1.00 12.42 ? 103 PRO A CA   1  
ATOM 1623   C C    . PRO A 1 103 ? 13.373  46.175  22.559  1.00 1.35  ? 103 PRO A C    1  
ATOM 1624   O O    . PRO A 1 103 ? 13.465  46.358  21.335  1.00 5.04  ? 103 PRO A O    1  
ATOM 1625   C CB   . PRO A 1 103 ? 15.176  47.384  23.894  1.00 1.51  ? 103 PRO A CB   1  
ATOM 1626   C CG   . PRO A 1 103 ? 15.229  48.062  25.224  1.00 23.10 ? 103 PRO A CG   1  
ATOM 1627   C CD   . PRO A 1 103 ? 13.990  47.596  25.963  1.00 2.42  ? 103 PRO A CD   1  
ATOM 1628   H HA   . PRO A 1 103 ? 13.387  48.273  23.065  1.00 40.03 ? 103 PRO A HA   1  
ATOM 1629   H HB2  . PRO A 1 103 ? 15.582  46.371  23.957  1.00 64.43 ? 103 PRO A HB2  1  
ATOM 1630   H HB3  . PRO A 1 103 ? 15.729  47.954  23.159  1.00 51.31 ? 103 PRO A HB3  1  
ATOM 1631   H HG2  . PRO A 1 103 ? 16.131  47.765  25.757  1.00 62.11 ? 103 PRO A HG2  1  
ATOM 1632   H HG3  . PRO A 1 103 ? 15.206  49.137  25.101  1.00 2.40  ? 103 PRO A HG3  1  
ATOM 1633   H HD2  . PRO A 1 103 ? 14.222  46.731  26.583  1.00 52.31 ? 103 PRO A HD2  1  
ATOM 1634   H HD3  . PRO A 1 103 ? 13.587  48.392  26.579  1.00 44.25 ? 103 PRO A HD3  1  
ATOM 1635   N N    . GLY A 1 104 ? 12.998  44.986  23.086  1.00 43.45 ? 104 GLY A N    1  
ATOM 1636   C CA   . GLY A 1 104 ? 12.705  43.844  22.227  1.00 44.40 ? 104 GLY A CA   1  
ATOM 1637   C C    . GLY A 1 104 ? 11.580  42.977  22.744  1.00 33.42 ? 104 GLY A C    1  
ATOM 1638   O O    . GLY A 1 104 ? 11.673  41.760  22.641  1.00 33.44 ? 104 GLY A O    1  
ATOM 1639   H H    . GLY A 1 104 ? 12.895  44.894  24.066  1.00 31.30 ? 104 GLY A H    1  
ATOM 1640   H HA2  . GLY A 1 104 ? 12.434  44.191  21.237  1.00 54.40 ? 104 GLY A HA2  1  
ATOM 1641   H HA3  . GLY A 1 104 ? 13.605  43.245  22.146  1.00 44.22 ? 104 GLY A HA3  1  
ATOM 1642   N N    . LEU A 1 105 ? 10.512  43.589  23.297  1.00 70.14 ? 105 LEU A N    1  
ATOM 1643   C CA   . LEU A 1 105 ? 9.315   42.850  23.819  1.00 50.11 ? 105 LEU A CA   1  
ATOM 1644   C C    . LEU A 1 105 ? 8.474   42.104  22.725  1.00 72.31 ? 105 LEU A C    1  
ATOM 1645   O O    . LEU A 1 105 ? 7.247   42.095  22.820  1.00 62.41 ? 105 LEU A O    1  
ATOM 1646   C CB   . LEU A 1 105 ? 8.386   43.808  24.660  1.00 74.25 ? 105 LEU A CB   1  
ATOM 1647   C CG   . LEU A 1 105 ? 8.717   43.963  26.181  1.00 25.43 ? 105 LEU A CG   1  
ATOM 1648   C CD1  . LEU A 1 105 ? 7.720   44.911  26.886  1.00 60.54 ? 105 LEU A CD1  1  
ATOM 1649   C CD2  . LEU A 1 105 ? 8.780   42.586  26.892  1.00 70.12 ? 105 LEU A CD2  1  
ATOM 1650   H H    . LEU A 1 105 ? 10.531  44.568  23.386  1.00 64.14 ? 105 LEU A H    1  
ATOM 1651   H HA   . LEU A 1 105 ? 9.692   42.088  24.490  1.00 21.50 ? 105 LEU A HA   1  
ATOM 1652   H HB2  . LEU A 1 105 ? 8.430   44.795  24.209  1.00 43.21 ? 105 LEU A HB2  1  
ATOM 1653   H HB3  . LEU A 1 105 ? 7.360   43.458  24.581  1.00 33.24 ? 105 LEU A HB3  1  
ATOM 1654   H HG   . LEU A 1 105 ? 9.696   44.413  26.272  1.00 23.22 ? 105 LEU A HG   1  
ATOM 1655   H HD11 . LEU A 1 105 ? 7.745   45.884  26.409  1.00 64.40 ? 105 LEU A HD11 1  
ATOM 1656   H HD12 . LEU A 1 105 ? 8.000   45.025  27.923  1.00 74.23 ? 105 LEU A HD12 1  
ATOM 1657   H HD13 . LEU A 1 105 ? 6.715   44.509  26.828  1.00 3.15  ? 105 LEU A HD13 1  
ATOM 1658   H HD21 . LEU A 1 105 ? 7.830   42.077  26.801  1.00 11.51 ? 105 LEU A HD21 1  
ATOM 1659   H HD22 . LEU A 1 105 ? 9.013   42.725  27.940  1.00 51.20 ? 105 LEU A HD22 1  
ATOM 1660   H HD23 . LEU A 1 105 ? 9.556   41.980  26.440  1.00 33.34 ? 105 LEU A HD23 1  
ATOM 1661   N N    . PHE A 1 106 ? 9.137   41.499  21.705  1.00 22.33 ? 106 PHE A N    1  
ATOM 1662   C CA   . PHE A 1 106 ? 8.540   40.469  20.831  1.00 2.31  ? 106 PHE A CA   1  
ATOM 1663   C C    . PHE A 1 106 ? 7.238   41.001  20.167  1.00 40.32 ? 106 PHE A C    1  
ATOM 1664   O O    . PHE A 1 106 ? 7.312   41.754  19.201  1.00 23.31 ? 106 PHE A O    1  
ATOM 1665   C CB   . PHE A 1 106 ? 8.362   39.133  21.642  1.00 72.25 ? 106 PHE A CB   1  
ATOM 1666   C CG   . PHE A 1 106 ? 8.413   37.809  20.839  1.00 72.14 ? 106 PHE A CG   1  
ATOM 1667   C CD1  . PHE A 1 106 ? 7.719   37.655  19.641  1.00 61.43 ? 106 PHE A CD1  1  
ATOM 1668   C CD2  . PHE A 1 106 ? 9.142   36.712  21.310  1.00 35.20 ? 106 PHE A CD2  1  
ATOM 1669   C CE1  . PHE A 1 106 ? 7.752   36.458  18.938  1.00 61.45 ? 106 PHE A CE1  1  
ATOM 1670   C CE2  . PHE A 1 106 ? 9.179   35.521  20.610  1.00 34.32 ? 106 PHE A CE2  1  
ATOM 1671   C CZ   . PHE A 1 106 ? 8.484   35.393  19.425  1.00 5.13  ? 106 PHE A CZ   1  
ATOM 1672   H H    . PHE A 1 106 ? 10.038  41.777  21.517  1.00 64.00 ? 106 PHE A H    1  
ATOM 1673   H HA   . PHE A 1 106 ? 9.261   40.292  20.040  1.00 74.45 ? 106 PHE A HA   1  
ATOM 1674   H HB2  . PHE A 1 106 ? 9.150   39.087  22.386  1.00 44.15 ? 106 PHE A HB2  1  
ATOM 1675   H HB3  . PHE A 1 106 ? 7.412   39.163  22.170  1.00 50.33 ? 106 PHE A HB3  1  
ATOM 1676   H HD1  . PHE A 1 106 ? 7.144   38.487  19.250  1.00 11.32 ? 106 PHE A HD1  1  
ATOM 1677   H HD2  . PHE A 1 106 ? 9.695   36.802  22.240  1.00 23.11 ? 106 PHE A HD2  1  
ATOM 1678   H HE1  . PHE A 1 106 ? 7.204   36.360  18.009  1.00 42.34 ? 106 PHE A HE1  1  
ATOM 1679   H HE2  . PHE A 1 106 ? 9.753   34.689  20.995  1.00 1.35  ? 106 PHE A HE2  1  
ATOM 1680   H HZ   . PHE A 1 106 ? 8.510   34.458  18.880  1.00 10.43 ? 106 PHE A HZ   1  
ATOM 1681   N N    . GLY A 1 107 ? 6.052   40.574  20.683  1.00 44.00 ? 107 GLY A N    1  
ATOM 1682   C CA   . GLY A 1 107 ? 4.752   41.052  20.191  1.00 32.14 ? 107 GLY A CA   1  
ATOM 1683   C C    . GLY A 1 107 ? 4.423   40.537  18.797  1.00 11.33 ? 107 GLY A C    1  
ATOM 1684   O O    . GLY A 1 107 ? 3.494   41.028  18.153  1.00 32.01 ? 107 GLY A O    1  
ATOM 1685   H H    . GLY A 1 107 ? 6.066   39.923  21.410  1.00 23.32 ? 107 GLY A H    1  
ATOM 1686   H HA2  . GLY A 1 107 ? 3.983   40.718  20.872  1.00 3.31  ? 107 GLY A HA2  1  
ATOM 1687   H HA3  . GLY A 1 107 ? 4.753   42.134  20.173  1.00 22.34 ? 107 GLY A HA3  1  
ATOM 1688   N N    . GLY A 1 108 ? 5.198   39.532  18.349  1.00 5.31  ? 108 GLY A N    1  
ATOM 1689   C CA   . GLY A 1 108 ? 5.127   39.006  16.998  1.00 25.14 ? 108 GLY A CA   1  
ATOM 1690   C C    . GLY A 1 108 ? 5.457   40.051  15.948  1.00 71.34 ? 108 GLY A C    1  
ATOM 1691   O O    . GLY A 1 108 ? 6.606   40.484  15.827  1.00 64.20 ? 108 GLY A O    1  
ATOM 1692   H H    . GLY A 1 108 ? 5.840   39.142  18.968  1.00 1.15  ? 108 GLY A H    1  
ATOM 1693   H HA2  . GLY A 1 108 ? 5.831   38.189  16.912  1.00 63.24 ? 108 GLY A HA2  1  
ATOM 1694   H HA3  . GLY A 1 108 ? 4.130   38.619  16.824  1.00 51.14 ? 108 GLY A HA3  1  
ATOM 1695   N N    . PHE A 1 109 ? 4.434   40.459  15.191  1.00 14.34 ? 109 PHE A N    1  
ATOM 1696   C CA   . PHE A 1 109 ? 4.544   41.520  14.169  1.00 34.14 ? 109 PHE A CA   1  
ATOM 1697   C C    . PHE A 1 109 ? 3.836   42.802  14.649  1.00 43.34 ? 109 PHE A C    1  
ATOM 1698   O O    . PHE A 1 109 ? 3.904   43.846  13.992  1.00 35.32 ? 109 PHE A O    1  
ATOM 1699   C CB   . PHE A 1 109 ? 3.962   41.012  12.827  1.00 64.04 ? 109 PHE A CB   1  
ATOM 1700   C CG   . PHE A 1 109 ? 4.587   39.679  12.386  1.00 53.05 ? 109 PHE A CG   1  
ATOM 1701   C CD1  . PHE A 1 109 ? 5.832   39.639  11.762  1.00 54.30 ? 109 PHE A CD1  1  
ATOM 1702   C CD2  . PHE A 1 109 ? 3.947   38.469  12.643  1.00 54.35 ? 109 PHE A CD2  1  
ATOM 1703   C CE1  . PHE A 1 109 ? 6.414   38.436  11.408  1.00 63.33 ? 109 PHE A CE1  1  
ATOM 1704   C CE2  . PHE A 1 109 ? 4.526   37.270  12.283  1.00 64.11 ? 109 PHE A CE2  1  
ATOM 1705   C CZ   . PHE A 1 109 ? 5.759   37.251  11.668  1.00 21.14 ? 109 PHE A CZ   1  
ATOM 1706   H H    . PHE A 1 109 ? 3.566   40.026  15.317  1.00 73.13 ? 109 PHE A H    1  
ATOM 1707   H HA   . PHE A 1 109 ? 5.597   41.752  14.027  1.00 32.25 ? 109 PHE A HA   1  
ATOM 1708   H HB2  . PHE A 1 109 ? 2.887   40.879  12.926  1.00 55.55 ? 109 PHE A HB2  1  
ATOM 1709   H HB3  . PHE A 1 109 ? 4.152   41.748  12.055  1.00 63.12 ? 109 PHE A HB3  1  
ATOM 1710   H HD1  . PHE A 1 109 ? 6.349   40.565  11.549  1.00 63.22 ? 109 PHE A HD1  1  
ATOM 1711   H HD2  . PHE A 1 109 ? 2.976   38.473  13.127  1.00 74.55 ? 109 PHE A HD2  1  
ATOM 1712   H HE1  . PHE A 1 109 ? 7.382   38.425  10.924  1.00 32.44 ? 109 PHE A HE1  1  
ATOM 1713   H HE2  . PHE A 1 109 ? 4.010   36.341  12.489  1.00 12.41 ? 109 PHE A HE2  1  
ATOM 1714   H HZ   . PHE A 1 109 ? 6.213   36.307  11.392  1.00 71.14 ? 109 PHE A HZ   1  
ATOM 1715   N N    . GLY A 1 110 ? 3.162   42.702  15.810  1.00 33.23 ? 110 GLY A N    1  
ATOM 1716   C CA   . GLY A 1 110 ? 2.530   43.844  16.464  1.00 52.34 ? 110 GLY A CA   1  
ATOM 1717   C C    . GLY A 1 110 ? 3.532   44.666  17.267  1.00 55.25 ? 110 GLY A C    1  
ATOM 1718   O O    . GLY A 1 110 ? 3.433   45.893  17.325  1.00 41.33 ? 110 GLY A O    1  
ATOM 1719   H H    . GLY A 1 110 ? 3.089   41.821  16.229  1.00 24.44 ? 110 GLY A H    1  
ATOM 1720   H HA2  . GLY A 1 110 ? 2.053   44.472  15.724  1.00 11.15 ? 110 GLY A HA2  1  
ATOM 1721   H HA3  . GLY A 1 110 ? 1.769   43.472  17.140  1.00 32.02 ? 110 GLY A HA3  1  
ATOM 1722   N N    . ARG A 1 111 ? 4.457   43.945  17.933  1.00 30.05 ? 111 ARG A N    1  
ATOM 1723   C CA   . ARG A 1 111 ? 5.594   44.491  18.726  1.00 34.12 ? 111 ARG A CA   1  
ATOM 1724   C C    . ARG A 1 111 ? 5.166   45.063  20.106  1.00 71.44 ? 111 ARG A C    1  
ATOM 1725   O O    . ARG A 1 111 ? 5.932   44.983  21.076  1.00 52.00 ? 111 ARG A O    1  
ATOM 1726   C CB   . ARG A 1 111 ? 6.430   45.537  17.920  1.00 23.12 ? 111 ARG A CB   1  
ATOM 1727   C CG   . ARG A 1 111 ? 7.824   45.862  18.522  1.00 33.14 ? 111 ARG A CG   1  
ATOM 1728   C CD   . ARG A 1 111 ? 8.751   44.626  18.566  1.00 3.03  ? 111 ARG A CD   1  
ATOM 1729   N NE   . ARG A 1 111 ? 10.121  44.949  19.019  1.00 52.11 ? 111 ARG A NE   1  
ATOM 1730   C CZ   . ARG A 1 111 ? 11.234  44.274  18.662  1.00 40.23 ? 111 ARG A CZ   1  
ATOM 1731   N NH1  . ARG A 1 111 ? 11.166  43.223  17.845  1.00 33.40 ? 111 ARG A NH1  1  
ATOM 1732   N NH2  . ARG A 1 111 ? 12.418  44.680  19.105  1.00 1.13  ? 111 ARG A NH2  1  
ATOM 1733   H H    . ARG A 1 111 ? 4.378   42.975  17.881  1.00 53.54 ? 111 ARG A H    1  
ATOM 1734   H HA   . ARG A 1 111 ? 6.232   43.634  18.923  1.00 40.21 ? 111 ARG A HA   1  
ATOM 1735   H HB2  . ARG A 1 111 ? 6.572   45.165  16.911  1.00 14.02 ? 111 ARG A HB2  1  
ATOM 1736   H HB3  . ARG A 1 111 ? 5.862   46.462  17.861  1.00 75.52 ? 111 ARG A HB3  1  
ATOM 1737   H HG2  . ARG A 1 111 ? 8.295   46.631  17.920  1.00 54.33 ? 111 ARG A HG2  1  
ATOM 1738   H HG3  . ARG A 1 111 ? 7.689   46.236  19.530  1.00 24.40 ? 111 ARG A HG3  1  
ATOM 1739   H HD2  . ARG A 1 111 ? 8.325   43.897  19.248  1.00 72.35 ? 111 ARG A HD2  1  
ATOM 1740   H HD3  . ARG A 1 111 ? 8.796   44.193  17.572  1.00 52.52 ? 111 ARG A HD3  1  
ATOM 1741   H HE   . ARG A 1 111 ? 10.213  45.709  19.634  1.00 42.34 ? 111 ARG A HE   1  
ATOM 1742   H HH11 . ARG A 1 111 ? 10.277  42.919  17.482  1.00 30.33 ? 111 ARG A HH11 1  
ATOM 1743   H HH12 . ARG A 1 111 ? 12.000  42.729  17.585  1.00 63.44 ? 111 ARG A HH12 1  
ATOM 1744   H HH21 . ARG A 1 111 ? 12.489  45.484  19.703  1.00 42.52 ? 111 ARG A HH21 1  
ATOM 1745   H HH22 . ARG A 1 111 ? 13.250  44.183  18.842  1.00 20.14 ? 111 ARG A HH22 1  
ATOM 1746   N N    . ARG A 1 112 ? 3.936   45.608  20.199  1.00 25.40 ? 112 ARG A N    1  
ATOM 1747   C CA   . ARG A 1 112 ? 3.402   46.246  21.423  1.00 0.51  ? 112 ARG A CA   1  
ATOM 1748   C C    . ARG A 1 112 ? 2.785   45.183  22.377  1.00 62.13 ? 112 ARG A C    1  
ATOM 1749   O O    . ARG A 1 112 ? 1.611   45.270  22.764  1.00 52.23 ? 112 ARG A O    1  
ATOM 1750   C CB   . ARG A 1 112 ? 2.373   47.360  21.033  1.00 70.44 ? 112 ARG A CB   1  
ATOM 1751   C CG   . ARG A 1 112 ? 1.922   48.253  22.217  1.00 73.25 ? 112 ARG A CG   1  
ATOM 1752   C CD   . ARG A 1 112 ? 0.749   49.190  21.872  1.00 0.03  ? 112 ARG A CD   1  
ATOM 1753   N NE   . ARG A 1 112 ? 0.174   49.807  23.094  1.00 25.35 ? 112 ARG A NE   1  
ATOM 1754   C CZ   . ARG A 1 112 ? 0.006   51.123  23.319  1.00 13.12 ? 112 ARG A CZ   1  
ATOM 1755   N NH1  . ARG A 1 112 ? 0.369   52.028  22.419  1.00 30.53 ? 112 ARG A NH1  1  
ATOM 1756   N NH2  . ARG A 1 112 ? -0.517  51.525  24.468  1.00 11.34 ? 112 ARG A NH2  1  
ATOM 1757   H H    . ARG A 1 112 ? 3.365   45.592  19.415  1.00 54.14 ? 112 ARG A H    1  
ATOM 1758   H HA   . ARG A 1 112 ? 4.238   46.717  21.939  1.00 75.13 ? 112 ARG A HA   1  
ATOM 1759   H HB2  . ARG A 1 112 ? 2.821   47.996  20.278  1.00 13.02 ? 112 ARG A HB2  1  
ATOM 1760   H HB3  . ARG A 1 112 ? 1.496   46.885  20.609  1.00 23.45 ? 112 ARG A HB3  1  
ATOM 1761   H HG2  . ARG A 1 112 ? 1.615   47.611  23.034  1.00 51.34 ? 112 ARG A HG2  1  
ATOM 1762   H HG3  . ARG A 1 112 ? 2.767   48.853  22.545  1.00 72.13 ? 112 ARG A HG3  1  
ATOM 1763   H HD2  . ARG A 1 112 ? 1.094   49.963  21.192  1.00 51.03 ? 112 ARG A HD2  1  
ATOM 1764   H HD3  . ARG A 1 112 ? -0.028  48.613  21.385  1.00 12.23 ? 112 ARG A HD3  1  
ATOM 1765   H HE   . ARG A 1 112 ? -0.115  49.182  23.795  1.00 30.12 ? 112 ARG A HE   1  
ATOM 1766   H HH11 . ARG A 1 112 ? 0.780   51.742  21.549  1.00 13.50 ? 112 ARG A HH11 1  
ATOM 1767   H HH12 . ARG A 1 112 ? 0.235   53.001  22.606  1.00 24.12 ? 112 ARG A HH12 1  
ATOM 1768   H HH21 . ARG A 1 112 ? -0.784  50.852  25.162  1.00 41.23 ? 112 ARG A HH21 1  
ATOM 1769   H HH22 . ARG A 1 112 ? -0.649  52.505  24.650  1.00 50.14 ? 112 ARG A HH22 1  
ATOM 1770   N N    . SER A 1 113 ? 3.578   44.132  22.666  1.00 34.35 ? 113 SER A N    1  
ATOM 1771   C CA   . SER A 1 113 ? 3.283   43.131  23.706  1.00 61.44 ? 113 SER A CA   1  
ATOM 1772   C C    . SER A 1 113 ? 1.938   42.385  23.513  1.00 42.50 ? 113 SER A C    1  
ATOM 1773   O O    . SER A 1 113 ? 1.297   41.977  24.495  1.00 24.14 ? 113 SER A O    1  
ATOM 1774   C CB   . SER A 1 113 ? 3.394   43.793  25.105  1.00 74.21 ? 113 SER A CB   1  
ATOM 1775   O OG   . SER A 1 113 ? 4.717   44.255  25.349  1.00 12.55 ? 113 SER A OG   1  
ATOM 1776   H H    . SER A 1 113 ? 4.416   44.040  22.175  1.00 71.15 ? 113 SER A H    1  
ATOM 1777   H HA   . SER A 1 113 ? 4.062   42.390  23.632  1.00 15.31 ? 113 SER A HA   1  
ATOM 1778   H HB2  . SER A 1 113 ? 2.719   44.636  25.166  1.00 51.34 ? 113 SER A HB2  1  
ATOM 1779   H HB3  . SER A 1 113 ? 3.138   43.074  25.873  1.00 13.24 ? 113 SER A HB3  1  
ATOM 1780   H HG   . SER A 1 113 ? 5.232   43.544  25.743  1.00 23.43 ? 113 SER A HG   1  
ATOM 1781   N N    . ARG A 1 114 ? 1.542   42.167  22.239  1.00 74.52 ? 114 ARG A N    1  
ATOM 1782   C CA   . ARG A 1 114 ? 0.315   41.406  21.911  1.00 43.32 ? 114 ARG A CA   1  
ATOM 1783   C C    . ARG A 1 114 ? 0.511   39.897  22.213  1.00 72.32 ? 114 ARG A C    1  
ATOM 1784   O O    . ARG A 1 114 ? 1.626   39.399  22.179  1.00 12.45 ? 114 ARG A O    1  
ATOM 1785   C CB   . ARG A 1 114 ? -0.062  41.635  20.410  1.00 43.45 ? 114 ARG A CB   1  
ATOM 1786   C CG   . ARG A 1 114 ? -1.300  40.842  19.911  1.00 24.41 ? 114 ARG A CG   1  
ATOM 1787   C CD   . ARG A 1 114 ? -1.597  41.038  18.410  1.00 45.52 ? 114 ARG A CD   1  
ATOM 1788   N NE   . ARG A 1 114 ? -2.070  42.402  18.095  1.00 12.52 ? 114 ARG A NE   1  
ATOM 1789   C CZ   . ARG A 1 114 ? -2.471  42.823  16.878  1.00 52.32 ? 114 ARG A CZ   1  
ATOM 1790   N NH1  . ARG A 1 114 ? -2.461  42.001  15.827  1.00 4.04  ? 114 ARG A NH1  1  
ATOM 1791   N NH2  . ARG A 1 114 ? -2.884  44.078  16.728  1.00 20.42 ? 114 ARG A NH2  1  
ATOM 1792   H H    . ARG A 1 114 ? 2.084   42.531  21.509  1.00 2.44  ? 114 ARG A H    1  
ATOM 1793   H HA   . ARG A 1 114 ? -0.487  41.785  22.541  1.00 11.00 ? 114 ARG A HA   1  
ATOM 1794   H HB2  . ARG A 1 114 ? -0.258  42.693  20.260  1.00 64.21 ? 114 ARG A HB2  1  
ATOM 1795   H HB3  . ARG A 1 114 ? 0.787   41.357  19.795  1.00 63.12 ? 114 ARG A HB3  1  
ATOM 1796   H HG2  . ARG A 1 114 ? -1.126  39.783  20.092  1.00 33.22 ? 114 ARG A HG2  1  
ATOM 1797   H HG3  . ARG A 1 114 ? -2.168  41.153  20.485  1.00 71.13 ? 114 ARG A HG3  1  
ATOM 1798   H HD2  . ARG A 1 114 ? -0.690  40.842  17.845  1.00 2.34  ? 114 ARG A HD2  1  
ATOM 1799   H HD3  . ARG A 1 114 ? -2.357  40.326  18.110  1.00 63.03 ? 114 ARG A HD3  1  
ATOM 1800   H HE   . ARG A 1 114 ? -2.098  43.042  18.840  1.00 41.30 ? 114 ARG A HE   1  
ATOM 1801   H HH11 . ARG A 1 114 ? -2.152  41.049  15.930  1.00 73.14 ? 114 ARG A HH11 1  
ATOM 1802   H HH12 . ARG A 1 114 ? -2.760  42.326  14.927  1.00 70.50 ? 114 ARG A HH12 1  
ATOM 1803   H HH21 . ARG A 1 114 ? -2.897  44.703  17.513  1.00 5.24  ? 114 ARG A HH21 1  
ATOM 1804   H HH22 . ARG A 1 114 ? -3.188  44.407  15.827  1.00 52.33 ? 114 ARG A HH22 1  
ATOM 1805   N N    . LYS A 1 115 ? -0.602  39.185  22.449  1.00 24.34 ? 115 LYS A N    1  
ATOM 1806   C CA   . LYS A 1 115 ? -0.621  37.763  22.841  1.00 15.54 ? 115 LYS A CA   1  
ATOM 1807   C C    . LYS A 1 115 ? -0.442  36.841  21.617  1.00 34.44 ? 115 LYS A C    1  
ATOM 1808   O O    . LYS A 1 115 ? -0.891  37.161  20.508  1.00 72.15 ? 115 LYS A O    1  
ATOM 1809   C CB   . LYS A 1 115 ? -1.982  37.457  23.540  1.00 72.01 ? 115 LYS A CB   1  
ATOM 1810   C CG   . LYS A 1 115 ? -2.173  36.014  24.076  1.00 3.00  ? 115 LYS A CG   1  
ATOM 1811   C CD   . LYS A 1 115 ? -1.333  35.707  25.337  1.00 35.44 ? 115 LYS A CD   1  
ATOM 1812   C CE   . LYS A 1 115 ? -1.514  34.259  25.838  1.00 62.32 ? 115 LYS A CE   1  
ATOM 1813   N NZ   . LYS A 1 115 ? -1.086  33.243  24.836  1.00 63.14 ? 115 LYS A NZ   1  
ATOM 1814   H H    . LYS A 1 115 ? -1.464  39.640  22.356  1.00 73.31 ? 115 LYS A H    1  
ATOM 1815   H HA   . LYS A 1 115 ? 0.187   37.589  23.547  1.00 11.44 ? 115 LYS A HA   1  
ATOM 1816   H HB2  . LYS A 1 115 ? -2.099  38.139  24.373  1.00 53.02 ? 115 LYS A HB2  1  
ATOM 1817   H HB3  . LYS A 1 115 ? -2.781  37.657  22.830  1.00 44.21 ? 115 LYS A HB3  1  
ATOM 1818   H HG2  . LYS A 1 115 ? -3.220  35.876  24.320  1.00 63.13 ? 115 LYS A HG2  1  
ATOM 1819   H HG3  . LYS A 1 115 ? -1.901  35.313  23.292  1.00 35.23 ? 115 LYS A HG3  1  
ATOM 1820   H HD2  . LYS A 1 115 ? -0.286  35.867  25.111  1.00 62.30 ? 115 LYS A HD2  1  
ATOM 1821   H HD3  . LYS A 1 115 ? -1.630  36.389  26.129  1.00 62.23 ? 115 LYS A HD3  1  
ATOM 1822   H HE2  . LYS A 1 115 ? -0.922  34.121  26.735  1.00 62.13 ? 115 LYS A HE2  1  
ATOM 1823   H HE3  . LYS A 1 115 ? -2.557  34.094  26.077  1.00 30.31 ? 115 LYS A HE3  1  
ATOM 1824   H HZ1  . LYS A 1 115 ? -1.645  33.341  23.964  1.00 13.13 ? 115 LYS A HZ1  1  
ATOM 1825   H HZ2  . LYS A 1 115 ? -1.231  32.280  25.216  1.00 43.12 ? 115 LYS A HZ2  1  
ATOM 1826   H HZ3  . LYS A 1 115 ? -0.081  33.365  24.608  1.00 1.54  ? 115 LYS A HZ3  1  
ATOM 1827   N N    . GLY A 1 116 ? 0.224   35.699  21.844  1.00 45.24 ? 116 GLY A N    1  
ATOM 1828   C CA   . GLY A 1 116 ? 0.338   34.639  20.846  1.00 55.22 ? 116 GLY A CA   1  
ATOM 1829   C C    . GLY A 1 116 ? -0.835  33.658  20.902  1.00 25.50 ? 116 GLY A C    1  
ATOM 1830   O O    . GLY A 1 116 ? -1.322  33.341  21.997  1.00 41.25 ? 116 GLY A O    1  
ATOM 1831   H H    . GLY A 1 116 ? 0.649   35.577  22.713  1.00 73.40 ? 116 GLY A H    1  
ATOM 1832   H HA2  . GLY A 1 116 ? 0.401   35.078  19.858  1.00 62.23 ? 116 GLY A HA2  1  
ATOM 1833   H HA3  . GLY A 1 116 ? 1.251   34.091  21.031  1.00 14.23 ? 116 GLY A HA3  1  
ATOM 1834   N N    . ARG A 1 117 ? -1.263  33.153  19.733  1.00 63.41 ? 117 ARG A N    1  
ATOM 1835   C CA   . ARG A 1 117 ? -2.418  32.224  19.623  1.00 3.51  ? 117 ARG A CA   1  
ATOM 1836   C C    . ARG A 1 117 ? -1.991  30.751  19.816  1.00 21.43 ? 117 ARG A C    1  
ATOM 1837   O O    . ARG A 1 117 ? -0.831  30.417  19.614  1.00 54.31 ? 117 ARG A O    1  
ATOM 1838   C CB   . ARG A 1 117 ? -3.090  32.371  18.237  1.00 30.11 ? 117 ARG A CB   1  
ATOM 1839   C CG   . ARG A 1 117 ? -2.243  31.839  17.038  1.00 71.34 ? 117 ARG A CG   1  
ATOM 1840   C CD   . ARG A 1 117 ? -3.106  31.200  15.940  1.00 12.42 ? 117 ARG A CD   1  
ATOM 1841   N NE   . ARG A 1 117 ? -3.993  30.142  16.487  1.00 15.31 ? 117 ARG A NE   1  
ATOM 1842   C CZ   . ARG A 1 117 ? -5.038  29.582  15.850  1.00 13.42 ? 117 ARG A CZ   1  
ATOM 1843   N NH1  . ARG A 1 117 ? -5.374  29.959  14.617  1.00 51.14 ? 117 ARG A NH1  1  
ATOM 1844   N NH2  . ARG A 1 117 ? -5.746  28.636  16.463  1.00 61.50 ? 117 ARG A NH2  1  
ATOM 1845   H H    . ARG A 1 117 ? -0.794  33.414  18.912  1.00 62.50 ? 117 ARG A H    1  
ATOM 1846   H HA   . ARG A 1 117 ? -3.139  32.487  20.393  1.00 12.41 ? 117 ARG A HA   1  
ATOM 1847   H HB2  . ARG A 1 117 ? -4.039  31.847  18.258  1.00 5.13  ? 117 ARG A HB2  1  
ATOM 1848   H HB3  . ARG A 1 117 ? -3.283  33.417  18.071  1.00 12.42 ? 117 ARG A HB3  1  
ATOM 1849   H HG2  . ARG A 1 117 ? -1.685  32.663  16.608  1.00 62.24 ? 117 ARG A HG2  1  
ATOM 1850   H HG3  . ARG A 1 117 ? -1.540  31.095  17.399  1.00 34.13 ? 117 ARG A HG3  1  
ATOM 1851   H HD2  . ARG A 1 117 ? -3.704  31.968  15.459  1.00 2.23  ? 117 ARG A HD2  1  
ATOM 1852   H HD3  . ARG A 1 117 ? -2.443  30.749  15.211  1.00 74.43 ? 117 ARG A HD3  1  
ATOM 1853   H HE   . ARG A 1 117 ? -3.783  29.821  17.390  1.00 31.13 ? 117 ARG A HE   1  
ATOM 1854   H HH11 . ARG A 1 117 ? -4.846  30.673  14.144  1.00 52.21 ? 117 ARG A HH11 1  
ATOM 1855   H HH12 . ARG A 1 117 ? -6.155  29.534  14.152  1.00 70.45 ? 117 ARG A HH12 1  
ATOM 1856   H HH21 . ARG A 1 117 ? -5.502  28.340  17.397  1.00 25.54 ? 117 ARG A HH21 1  
ATOM 1857   H HH22 . ARG A 1 117 ? -6.526  28.210  15.999  1.00 64.13 ? 117 ARG A HH22 1  
ATOM 1858   N N    . ASP A 1 118 ? -2.953  29.870  20.137  1.00 20.01 ? 118 ASP A N    1  
ATOM 1859   C CA   . ASP A 1 118 ? -2.704  28.411  20.282  1.00 22.55 ? 118 ASP A CA   1  
ATOM 1860   C C    . ASP A 1 118 ? -2.173  27.795  18.959  1.00 71.34 ? 118 ASP A C    1  
ATOM 1861   O O    . ASP A 1 118 ? -2.627  28.157  17.869  1.00 74.23 ? 118 ASP A O    1  
ATOM 1862   C CB   . ASP A 1 118 ? -4.001  27.685  20.726  1.00 70.23 ? 118 ASP A CB   1  
ATOM 1863   C CG   . ASP A 1 118 ? -5.126  27.763  19.672  1.00 51.11 ? 118 ASP A CG   1  
ATOM 1864   O OD1  . ASP A 1 118 ? -5.703  28.864  19.498  1.00 41.31 ? 118 ASP A OD1  1  
ATOM 1865   O OD2  . ASP A 1 118 ? -5.416  26.750  18.993  1.00 71.10 ? 118 ASP A OD2  1  
ATOM 1866   H H    . ASP A 1 118 ? -3.863  30.202  20.285  1.00 44.12 ? 118 ASP A H    1  
ATOM 1867   H HA   . ASP A 1 118 ? -1.950  28.285  21.059  1.00 55.23 ? 118 ASP A HA   1  
ATOM 1868   H HB2  . ASP A 1 118 ? -3.773  26.641  20.929  1.00 42.14 ? 118 ASP A HB2  1  
ATOM 1869   H HB3  . ASP A 1 118 ? -4.360  28.139  21.644  1.00 3.43  ? 118 ASP A HB3  1  
ATOM 1870   N N    . LEU A 1 119 ? -1.193  26.891  19.065  1.00 65.31 ? 119 LEU A N    1  
ATOM 1871   C CA   . LEU A 1 119 ? -0.571  26.232  17.891  1.00 55.34 ? 119 LEU A CA   1  
ATOM 1872   C C    . LEU A 1 119 ? -0.201  24.793  18.294  1.00 61.31 ? 119 LEU A C    1  
ATOM 1873   O O    . LEU A 1 119 ? -0.127  24.489  19.484  1.00 62.04 ? 119 LEU A O    1  
ATOM 1874   C CB   . LEU A 1 119 ? 0.659   27.086  17.416  1.00 70.23 ? 119 LEU A CB   1  
ATOM 1875   C CG   . LEU A 1 119 ? 1.188   26.906  15.938  1.00 60.41 ? 119 LEU A CG   1  
ATOM 1876   C CD1  . LEU A 1 119 ? 1.854   28.209  15.427  1.00 54.31 ? 119 LEU A CD1  1  
ATOM 1877   C CD2  . LEU A 1 119 ? 2.184   25.729  15.802  1.00 54.31 ? 119 LEU A CD2  1  
ATOM 1878   H H    . LEU A 1 119 ? -0.882  26.632  19.966  1.00 12.54 ? 119 LEU A H    1  
ATOM 1879   H HA   . LEU A 1 119 ? -1.308  26.184  17.094  1.00 71.44 ? 119 LEU A HA   1  
ATOM 1880   H HB2  . LEU A 1 119 ? 0.384   28.128  17.539  1.00 64.23 ? 119 LEU A HB2  1  
ATOM 1881   H HB3  . LEU A 1 119 ? 1.484   26.893  18.094  1.00 1.41  ? 119 LEU A HB3  1  
ATOM 1882   H HG   . LEU A 1 119 ? 0.345   26.699  15.289  1.00 61.31 ? 119 LEU A HG   1  
ATOM 1883   H HD11 . LEU A 1 119 ? 2.705   28.458  16.051  1.00 0.11  ? 119 LEU A HD11 1  
ATOM 1884   H HD12 . LEU A 1 119 ? 1.138   29.018  15.466  1.00 51.23 ? 119 LEU A HD12 1  
ATOM 1885   H HD13 . LEU A 1 119 ? 2.182   28.077  14.405  1.00 74.22 ? 119 LEU A HD13 1  
ATOM 1886   H HD21 . LEU A 1 119 ? 1.696   24.809  16.091  1.00 75.42 ? 119 LEU A HD21 1  
ATOM 1887   H HD22 . LEU A 1 119 ? 3.044   25.892  16.441  1.00 12.11 ? 119 LEU A HD22 1  
ATOM 1888   H HD23 . LEU A 1 119 ? 2.512   25.645  14.774  1.00 65.43 ? 119 LEU A HD23 1  
ATOM 1889   N N    . ARG A 1 120 ? 0.004   23.903  17.316  1.00 21.40 ? 120 ARG A N    1  
ATOM 1890   C CA   . ARG A 1 120 ? 0.432   22.508  17.576  1.00 74.51 ? 120 ARG A CA   1  
ATOM 1891   C C    . ARG A 1 120 ? 1.715   22.210  16.787  1.00 52.24 ? 120 ARG A C    1  
ATOM 1892   O O    . ARG A 1 120 ? 1.744   22.373  15.560  1.00 25.20 ? 120 ARG A O    1  
ATOM 1893   C CB   . ARG A 1 120 ? -0.716  21.509  17.232  1.00 22.44 ? 120 ARG A CB   1  
ATOM 1894   C CG   . ARG A 1 120 ? -0.422  20.013  17.568  1.00 51.05 ? 120 ARG A CG   1  
ATOM 1895   C CD   . ARG A 1 120 ? 0.102   19.172  16.368  1.00 12.32 ? 120 ARG A CD   1  
ATOM 1896   N NE   . ARG A 1 120 ? -0.949  18.300  15.784  1.00 21.53 ? 120 ARG A NE   1  
ATOM 1897   C CZ   . ARG A 1 120 ? -0.721  17.141  15.137  1.00 2.42  ? 120 ARG A CZ   1  
ATOM 1898   N NH1  . ARG A 1 120 ? 0.516   16.691  14.962  1.00 53.45 ? 120 ARG A NH1  1  
ATOM 1899   N NH2  . ARG A 1 120 ? -1.744  16.430  14.679  1.00 23.35 ? 120 ARG A NH2  1  
ATOM 1900   H H    . ARG A 1 120 ? -0.134  24.187  16.389  1.00 32.32 ? 120 ARG A H    1  
ATOM 1901   H HA   . ARG A 1 120 ? 0.657   22.421  18.641  1.00 4.51  ? 120 ARG A HA   1  
ATOM 1902   H HB2  . ARG A 1 120 ? -1.599  21.809  17.788  1.00 20.32 ? 120 ARG A HB2  1  
ATOM 1903   H HB3  . ARG A 1 120 ? -0.945  21.587  16.173  1.00 53.41 ? 120 ARG A HB3  1  
ATOM 1904   H HG2  . ARG A 1 120 ? 0.314   19.972  18.368  1.00 11.32 ? 120 ARG A HG2  1  
ATOM 1905   H HG3  . ARG A 1 120 ? -1.336  19.556  17.934  1.00 61.31 ? 120 ARG A HG3  1  
ATOM 1906   H HD2  . ARG A 1 120 ? 0.471   19.835  15.595  1.00 73.44 ? 120 ARG A HD2  1  
ATOM 1907   H HD3  . ARG A 1 120 ? 0.921   18.548  16.712  1.00 54.43 ? 120 ARG A HD3  1  
ATOM 1908   H HE   . ARG A 1 120 ? -1.877  18.602  15.882  1.00 44.35 ? 120 ARG A HE   1  
ATOM 1909   H HH11 . ARG A 1 120 ? 1.302   17.214  15.313  1.00 60.03 ? 120 ARG A HH11 1  
ATOM 1910   H HH12 . ARG A 1 120 ? 0.676   15.829  14.480  1.00 32.11 ? 120 ARG A HH12 1  
ATOM 1911   H HH21 . ARG A 1 120 ? -2.683  16.752  14.814  1.00 33.20 ? 120 ARG A HH21 1  
ATOM 1912   H HH22 . ARG A 1 120 ? -1.582  15.562  14.199  1.00 63.41 ? 120 ARG A HH22 1  
ATOM 1913   N N    . ALA A 1 121 ? 2.775   21.781  17.502  1.00 4.32  ? 121 ALA A N    1  
ATOM 1914   C CA   . ALA A 1 121 ? 4.097   21.503  16.910  1.00 31.22 ? 121 ALA A CA   1  
ATOM 1915   C C    . ALA A 1 121 ? 4.597   20.126  17.342  1.00 41.51 ? 121 ALA A C    1  
ATOM 1916   O O    . ALA A 1 121 ? 4.101   19.544  18.317  1.00 5.43  ? 121 ALA A O    1  
ATOM 1917   C CB   . ALA A 1 121 ? 5.104   22.585  17.316  1.00 31.04 ? 121 ALA A CB   1  
ATOM 1918   H H    . ALA A 1 121 ? 2.661   21.622  18.465  1.00 32.43 ? 121 ALA A H    1  
ATOM 1919   H HA   . ALA A 1 121 ? 4.005   21.514  15.824  1.00 25.32 ? 121 ALA A HA   1  
ATOM 1920   H HB1  . ALA A 1 121 ? 5.220   22.601  18.393  1.00 23.21 ? 121 ALA A HB1  1  
ATOM 1921   H HB2  . ALA A 1 121 ? 4.749   23.554  16.985  1.00 54.41 ? 121 ALA A HB2  1  
ATOM 1922   H HB3  . ALA A 1 121 ? 6.068   22.388  16.858  1.00 51.31 ? 121 ALA A HB3  1  
ATOM 1923   N N    . GLU A 1 122 ? 5.619   19.630  16.637  1.00 42.51 ? 122 GLU A N    1  
ATOM 1924   C CA   . GLU A 1 122 ? 6.118   18.260  16.813  1.00 32.02 ? 122 GLU A CA   1  
ATOM 1925   C C    . GLU A 1 122 ? 7.445   18.362  17.543  1.00 43.45 ? 122 GLU A C    1  
ATOM 1926   O O    . GLU A 1 122 ? 8.359   19.016  17.030  1.00 54.14 ? 122 GLU A O    1  
ATOM 1927   C CB   . GLU A 1 122 ? 6.311   17.555  15.433  1.00 54.21 ? 122 GLU A CB   1  
ATOM 1928   C CG   . GLU A 1 122 ? 5.172   17.761  14.410  1.00 32.21 ? 122 GLU A CG   1  
ATOM 1929   C CD   . GLU A 1 122 ? 3.793   17.242  14.864  1.00 61.00 ? 122 GLU A CD   1  
ATOM 1930   O OE1  . GLU A 1 122 ? 3.442   16.088  14.548  1.00 25.33 ? 122 GLU A OE1  1  
ATOM 1931   O OE2  . GLU A 1 122 ? 3.044   17.991  15.520  1.00 13.40 ? 122 GLU A OE2  1  
ATOM 1932   H H    . GLU A 1 122 ? 6.097   20.223  16.022  1.00 34.11 ? 122 GLU A H    1  
ATOM 1933   H HA   . GLU A 1 122 ? 5.409   17.690  17.417  1.00 42.25 ? 122 GLU A HA   1  
ATOM 1934   H HB2  . GLU A 1 122 ? 7.228   17.918  14.977  1.00 11.34 ? 122 GLU A HB2  1  
ATOM 1935   H HB3  . GLU A 1 122 ? 6.418   16.489  15.602  1.00 72.42 ? 122 GLU A HB3  1  
ATOM 1936   H HG2  . GLU A 1 122 ? 5.090   18.824  14.196  1.00 51.43 ? 122 GLU A HG2  1  
ATOM 1937   H HG3  . GLU A 1 122 ? 5.449   17.253  13.492  1.00 53.22 ? 122 GLU A HG3  1  
ATOM 1938   N N    . LEU A 1 123 ? 7.553   17.743  18.729  1.00 54.05 ? 123 LEU A N    1  
ATOM 1939   C CA   . LEU A 1 123 ? 8.760   17.833  19.564  1.00 41.10 ? 123 LEU A CA   1  
ATOM 1940   C C    . LEU A 1 123 ? 9.612   16.574  19.315  1.00 24.12 ? 123 LEU A C    1  
ATOM 1941   O O    . LEU A 1 123 ? 9.308   15.520  19.873  1.00 13.21 ? 123 LEU A O    1  
ATOM 1942   C CB   . LEU A 1 123 ? 8.345   17.936  21.068  1.00 20.55 ? 123 LEU A CB   1  
ATOM 1943   C CG   . LEU A 1 123 ? 9.503   18.024  22.120  1.00 33.52 ? 123 LEU A CG   1  
ATOM 1944   C CD1  . LEU A 1 123 ? 10.267  19.362  22.031  1.00 11.54 ? 123 LEU A CD1  1  
ATOM 1945   C CD2  . LEU A 1 123 ? 8.988   17.770  23.559  1.00 51.24 ? 123 LEU A CD2  1  
ATOM 1946   H H    . LEU A 1 123 ? 6.801   17.201  19.048  1.00 34.22 ? 123 LEU A H    1  
ATOM 1947   H HA   . LEU A 1 123 ? 9.326   18.721  19.288  1.00 31.11 ? 123 LEU A HA   1  
ATOM 1948   H HB2  . LEU A 1 123 ? 7.713   18.812  21.185  1.00 51.14 ? 123 LEU A HB2  1  
ATOM 1949   H HB3  . LEU A 1 123 ? 7.746   17.065  21.302  1.00 63.25 ? 123 LEU A HB3  1  
ATOM 1950   H HG   . LEU A 1 123 ? 10.220  17.243  21.895  1.00 31.14 ? 123 LEU A HG   1  
ATOM 1951   H HD11 . LEU A 1 123 ? 9.590   20.191  22.191  1.00 3.11  ? 123 LEU A HD11 1  
ATOM 1952   H HD12 . LEU A 1 123 ? 10.729  19.456  21.058  1.00 30.42 ? 123 LEU A HD12 1  
ATOM 1953   H HD13 . LEU A 1 123 ? 11.045  19.382  22.795  1.00 74.14 ? 123 LEU A HD13 1  
ATOM 1954   H HD21 . LEU A 1 123 ? 8.513   16.800  23.612  1.00 72.22 ? 123 LEU A HD21 1  
ATOM 1955   H HD22 . LEU A 1 123 ? 8.270   18.535  23.840  1.00 12.23 ? 123 LEU A HD22 1  
ATOM 1956   H HD23 . LEU A 1 123 ? 9.820   17.793  24.251  1.00 23.03 ? 123 LEU A HD23 1  
ATOM 1957   N N    . PRO A 1 124 ? 10.693  16.651  18.459  1.00 73.30 ? 124 PRO A N    1  
ATOM 1958   C CA   . PRO A 1 124 ? 11.566  15.502  18.231  1.00 75.33 ? 124 PRO A CA   1  
ATOM 1959   C C    . PRO A 1 124 ? 12.521  15.345  19.418  1.00 22.41 ? 124 PRO A C    1  
ATOM 1960   O O    . PRO A 1 124 ? 13.404  16.161  19.605  1.00 74.51 ? 124 PRO A O    1  
ATOM 1961   C CB   . PRO A 1 124 ? 12.272  15.859  16.901  1.00 61.22 ? 124 PRO A CB   1  
ATOM 1962   C CG   . PRO A 1 124 ? 12.345  17.356  16.897  1.00 42.31 ? 124 PRO A CG   1  
ATOM 1963   C CD   . PRO A 1 124 ? 11.119  17.830  17.654  1.00 11.23 ? 124 PRO A CD   1  
ATOM 1964   H HA   . PRO A 1 124 ? 10.993  14.588  18.102  1.00 23.45 ? 124 PRO A HA   1  
ATOM 1965   H HB2  . PRO A 1 124 ? 13.260  15.410  16.863  1.00 14.44 ? 124 PRO A HB2  1  
ATOM 1966   H HB3  . PRO A 1 124 ? 11.681  15.514  16.056  1.00 5.13  ? 124 PRO A HB3  1  
ATOM 1967   H HG2  . PRO A 1 124 ? 13.256  17.681  17.400  1.00 33.24 ? 124 PRO A HG2  1  
ATOM 1968   H HG3  . PRO A 1 124 ? 12.330  17.736  15.882  1.00 41.22 ? 124 PRO A HG3  1  
ATOM 1969   H HD2  . PRO A 1 124 ? 11.364  18.665  18.298  1.00 13.14 ? 124 PRO A HD2  1  
ATOM 1970   H HD3  . PRO A 1 124 ? 10.336  18.117  16.962  1.00 24.34 ? 124 PRO A HD3  1  
ATOM 1971   N N    . LEU A 1 125 ? 12.338  14.277  20.211  1.00 64.01 ? 125 LEU A N    1  
ATOM 1972   C CA   . LEU A 1 125 ? 13.003  14.128  21.520  1.00 3.32  ? 125 LEU A CA   1  
ATOM 1973   C C    . LEU A 1 125 ? 13.884  12.879  21.544  1.00 23.12 ? 125 LEU A C    1  
ATOM 1974   O O    . LEU A 1 125 ? 13.476  11.811  21.086  1.00 34.11 ? 125 LEU A O    1  
ATOM 1975   C CB   . LEU A 1 125 ? 11.945  14.098  22.657  1.00 10.31 ? 125 LEU A CB   1  
ATOM 1976   C CG   . LEU A 1 125 ? 12.462  13.798  24.107  1.00 11.04 ? 125 LEU A CG   1  
ATOM 1977   C CD1  . LEU A 1 125 ? 13.543  14.791  24.569  1.00 12.44 ? 125 LEU A CD1  1  
ATOM 1978   C CD2  . LEU A 1 125 ? 11.289  13.773  25.106  1.00 51.41 ? 125 LEU A CD2  1  
ATOM 1979   H H    . LEU A 1 125 ? 11.736  13.560  19.910  1.00 23.24 ? 125 LEU A H    1  
ATOM 1980   H HA   . LEU A 1 125 ? 13.643  15.001  21.675  1.00 35.35 ? 125 LEU A HA   1  
ATOM 1981   H HB2  . LEU A 1 125 ? 11.437  15.058  22.672  1.00 12.43 ? 125 LEU A HB2  1  
ATOM 1982   H HB3  . LEU A 1 125 ? 11.211  13.338  22.404  1.00 34.11 ? 125 LEU A HB3  1  
ATOM 1983   H HG   . LEU A 1 125 ? 12.911  12.811  24.112  1.00 31.01 ? 125 LEU A HG   1  
ATOM 1984   H HD11 . LEU A 1 125 ? 13.885  14.522  25.560  1.00 14.05 ? 125 LEU A HD11 1  
ATOM 1985   H HD12 . LEU A 1 125 ? 13.138  15.796  24.593  1.00 21.33 ? 125 LEU A HD12 1  
ATOM 1986   H HD13 . LEU A 1 125 ? 14.382  14.761  23.887  1.00 72.43 ? 125 LEU A HD13 1  
ATOM 1987   H HD21 . LEU A 1 125 ? 11.656  13.538  26.098  1.00 34.43 ? 125 LEU A HD21 1  
ATOM 1988   H HD22 . LEU A 1 125 ? 10.573  13.016  24.812  1.00 70.21 ? 125 LEU A HD22 1  
ATOM 1989   H HD23 . LEU A 1 125 ? 10.796  14.739  25.128  1.00 12.22 ? 125 LEU A HD23 1  
ATOM 1990   N N    . THR A 1 126 ? 15.095  13.041  22.101  1.00 3.31  ? 126 THR A N    1  
ATOM 1991   C CA   . THR A 1 126 ? 16.091  11.981  22.206  1.00 34.43 ? 126 THR A CA   1  
ATOM 1992   C C    . THR A 1 126 ? 15.613  10.897  23.190  1.00 71.34 ? 126 THR A C    1  
ATOM 1993   O O    . THR A 1 126 ? 15.191  11.224  24.304  1.00 65.33 ? 126 THR A O    1  
ATOM 1994   C CB   . THR A 1 126 ? 17.467  12.592  22.631  1.00 64.43 ? 126 THR A CB   1  
ATOM 1995   O OG1  . THR A 1 126 ? 17.846  13.602  21.685  1.00 24.24 ? 126 THR A OG1  1  
ATOM 1996   C CG2  . THR A 1 126 ? 18.581  11.542  22.691  1.00 53.42 ? 126 THR A CG2  1  
ATOM 1997   H H    . THR A 1 126 ? 15.320  13.918  22.472  1.00 41.24 ? 126 THR A H    1  
ATOM 1998   H HA   . THR A 1 126 ? 16.207  11.539  21.217  1.00 70.21 ? 126 THR A HA   1  
ATOM 1999   H HB   . THR A 1 126 ? 17.369  13.065  23.608  1.00 33.20 ? 126 THR A HB   1  
ATOM 2000   H HG1  . THR A 1 126 ? 17.969  14.442  22.134  1.00 33.14 ? 126 THR A HG1  1  
ATOM 2001   H HG21 . THR A 1 126 ? 18.319  10.765  23.398  1.00 53.34 ? 126 THR A HG21 1  
ATOM 2002   H HG22 . THR A 1 126 ? 19.507  12.011  23.003  1.00 14.24 ? 126 THR A HG22 1  
ATOM 2003   H HG23 . THR A 1 126 ? 18.718  11.102  21.710  1.00 64.33 ? 126 THR A HG23 1  
ATOM 2004   N N    . LEU A 1 127 ? 15.666  9.621   22.736  1.00 64.25 ? 127 LEU A N    1  
ATOM 2005   C CA   . LEU A 1 127 ? 15.145  8.450   23.479  1.00 62.33 ? 127 LEU A CA   1  
ATOM 2006   C C    . LEU A 1 127 ? 15.766  8.364   24.891  1.00 21.01 ? 127 LEU A C    1  
ATOM 2007   O O    . LEU A 1 127 ? 15.080  8.083   25.875  1.00 61.00 ? 127 LEU A O    1  
ATOM 2008   C CB   . LEU A 1 127 ? 15.474  7.127   22.735  1.00 24.23 ? 127 LEU A CB   1  
ATOM 2009   C CG   . LEU A 1 127 ? 15.086  6.946   21.234  1.00 60.12 ? 127 LEU A CG   1  
ATOM 2010   C CD1  . LEU A 1 127 ? 15.651  5.600   20.714  1.00 70.54 ? 127 LEU A CD1  1  
ATOM 2011   C CD2  . LEU A 1 127 ? 13.564  7.006   20.999  1.00 42.23 ? 127 LEU A CD2  1  
ATOM 2012   H H    . LEU A 1 127 ? 16.086  9.464   21.870  1.00 75.21 ? 127 LEU A H    1  
ATOM 2013   H HA   . LEU A 1 127 ? 14.072  8.551   23.564  1.00 71.54 ? 127 LEU A HA   1  
ATOM 2014   H HB2  . LEU A 1 127 ? 16.547  6.975   22.802  1.00 0.34  ? 127 LEU A HB2  1  
ATOM 2015   H HB3  . LEU A 1 127 ? 15.002  6.313   23.291  1.00 31.32 ? 127 LEU A HB3  1  
ATOM 2016   H HG   . LEU A 1 127 ? 15.549  7.736   20.653  1.00 25.22 ? 127 LEU A HG   1  
ATOM 2017   H HD11 . LEU A 1 127 ? 15.401  5.476   19.668  1.00 24.53 ? 127 LEU A HD11 1  
ATOM 2018   H HD12 . LEU A 1 127 ? 15.230  4.775   21.279  1.00 60.42 ? 127 LEU A HD12 1  
ATOM 2019   H HD13 . LEU A 1 127 ? 16.728  5.590   20.822  1.00 74.54 ? 127 LEU A HD13 1  
ATOM 2020   H HD21 . LEU A 1 127 ? 13.066  6.254   21.596  1.00 12.44 ? 127 LEU A HD21 1  
ATOM 2021   H HD22 . LEU A 1 127 ? 13.361  6.818   19.950  1.00 21.52 ? 127 LEU A HD22 1  
ATOM 2022   H HD23 . LEU A 1 127 ? 13.191  7.987   21.261  1.00 1.23  ? 127 LEU A HD23 1  
ATOM 2023   N N    . GLU A 1 128 ? 17.086  8.595   24.939  1.00 61.41 ? 128 GLU A N    1  
ATOM 2024   C CA   . GLU A 1 128 ? 17.893  8.561   26.170  1.00 75.32 ? 128 GLU A CA   1  
ATOM 2025   C C    . GLU A 1 128 ? 17.337  9.558   27.206  1.00 32.51 ? 128 GLU A C    1  
ATOM 2026   O O    . GLU A 1 128 ? 17.142  9.221   28.383  1.00 52.52 ? 128 GLU A O    1  
ATOM 2027   C CB   . GLU A 1 128 ? 19.388  8.890   25.859  1.00 42.42 ? 128 GLU A CB   1  
ATOM 2028   C CG   . GLU A 1 128 ? 20.132  7.878   24.943  1.00 31.52 ? 128 GLU A CG   1  
ATOM 2029   C CD   . GLU A 1 128 ? 19.759  7.967   23.445  1.00 1.34  ? 128 GLU A CD   1  
ATOM 2030   O OE1  . GLU A 1 128 ? 18.815  7.275   23.003  1.00 62.50 ? 128 GLU A OE1  1  
ATOM 2031   O OE2  . GLU A 1 128 ? 20.408  8.736   22.704  1.00 31.10 ? 128 GLU A OE2  1  
ATOM 2032   H H    . GLU A 1 128 ? 17.543  8.790   24.096  1.00 2.25  ? 128 GLU A H    1  
ATOM 2033   H HA   . GLU A 1 128 ? 17.834  7.557   26.577  1.00 51.25 ? 128 GLU A HA   1  
ATOM 2034   H HB2  . GLU A 1 128 ? 19.431  9.863   25.382  1.00 13.02 ? 128 GLU A HB2  1  
ATOM 2035   H HB3  . GLU A 1 128 ? 19.929  8.951   26.799  1.00 11.02 ? 128 GLU A HB3  1  
ATOM 2036   H HG2  . GLU A 1 128 ? 21.200  8.052   25.044  1.00 31.40 ? 128 GLU A HG2  1  
ATOM 2037   H HG3  . GLU A 1 128 ? 19.920  6.873   25.299  1.00 64.21 ? 128 GLU A HG3  1  
ATOM 2038   N N    . GLU A 1 129 ? 17.051  10.777  26.732  1.00 24.32 ? 129 GLU A N    1  
ATOM 2039   C CA   . GLU A 1 129 ? 16.520  11.870  27.565  1.00 60.03 ? 129 GLU A CA   1  
ATOM 2040   C C    . GLU A 1 129 ? 15.054  11.604  27.941  1.00 23.55 ? 129 GLU A C    1  
ATOM 2041   O O    . GLU A 1 129 ? 14.604  12.014  29.013  1.00 60.20 ? 129 GLU A O    1  
ATOM 2042   C CB   . GLU A 1 129 ? 16.693  13.221  26.816  1.00 3.15  ? 129 GLU A CB   1  
ATOM 2043   C CG   . GLU A 1 129 ? 18.155  13.516  26.394  1.00 64.33 ? 129 GLU A CG   1  
ATOM 2044   C CD   . GLU A 1 129 ? 19.174  13.436  27.555  1.00 61.24 ? 129 GLU A CD   1  
ATOM 2045   O OE1  . GLU A 1 129 ? 19.754  12.342  27.787  1.00 31.54 ? 129 GLU A OE1  1  
ATOM 2046   O OE2  . GLU A 1 129 ? 19.393  14.457  28.247  1.00 41.53 ? 129 GLU A OE2  1  
ATOM 2047   H H    . GLU A 1 129 ? 17.191  10.946  25.778  1.00 52.54 ? 129 GLU A H    1  
ATOM 2048   H HA   . GLU A 1 129 ? 17.100  11.905  28.479  1.00 35.13 ? 129 GLU A HA   1  
ATOM 2049   H HB2  . GLU A 1 129 ? 16.081  13.204  25.917  1.00 2.13  ? 129 GLU A HB2  1  
ATOM 2050   H HB3  . GLU A 1 129 ? 16.348  14.032  27.447  1.00 31.45 ? 129 GLU A HB3  1  
ATOM 2051   H HG2  . GLU A 1 129 ? 18.436  12.796  25.631  1.00 43.52 ? 129 GLU A HG2  1  
ATOM 2052   H HG3  . GLU A 1 129 ? 18.193  14.511  25.958  1.00 25.52 ? 129 GLU A HG3  1  
ATOM 2053   N N    . ALA A 1 130 ? 14.337  10.876  27.063  1.00 5.31  ? 130 ALA A N    1  
ATOM 2054   C CA   . ALA A 1 130 ? 12.949  10.454  27.310  1.00 35.34 ? 130 ALA A CA   1  
ATOM 2055   C C    . ALA A 1 130 ? 12.890  9.437   28.467  1.00 41.43 ? 130 ALA A C    1  
ATOM 2056   O O    . ALA A 1 130 ? 11.918  9.415   29.226  1.00 11.05 ? 130 ALA A O    1  
ATOM 2057   C CB   . ALA A 1 130 ? 12.327  9.869   26.030  1.00 34.42 ? 130 ALA A CB   1  
ATOM 2058   H H    . ALA A 1 130 ? 14.766  10.600  26.232  1.00 34.33 ? 130 ALA A H    1  
ATOM 2059   H HA   . ALA A 1 130 ? 12.377  11.339  27.585  1.00 32.12 ? 130 ALA A HA   1  
ATOM 2060   H HB1  . ALA A 1 130 ? 11.292  9.603   26.210  1.00 24.15 ? 130 ALA A HB1  1  
ATOM 2061   H HB2  . ALA A 1 130 ? 12.874  8.985   25.724  1.00 22.34 ? 130 ALA A HB2  1  
ATOM 2062   H HB3  . ALA A 1 130 ? 12.373  10.603  25.234  1.00 65.44 ? 130 ALA A HB3  1  
ATOM 2063   N N    . PHE A 1 131 ? 13.953  8.605   28.581  1.00 71.31 ? 131 PHE A N    1  
ATOM 2064   C CA   . PHE A 1 131 ? 14.138  7.684   29.717  1.00 70.34 ? 131 PHE A CA   1  
ATOM 2065   C C    . PHE A 1 131 ? 14.379  8.487   31.001  1.00 64.34 ? 131 PHE A C    1  
ATOM 2066   O O    . PHE A 1 131 ? 13.660  8.326   31.995  1.00 13.32 ? 131 PHE A O    1  
ATOM 2067   C CB   . PHE A 1 131 ? 15.338  6.709   29.462  1.00 64.24 ? 131 PHE A CB   1  
ATOM 2068   C CG   . PHE A 1 131 ? 15.548  5.644   30.564  1.00 74.51 ? 131 PHE A CG   1  
ATOM 2069   C CD1  . PHE A 1 131 ? 16.241  5.942   31.741  1.00 61.20 ? 131 PHE A CD1  1  
ATOM 2070   C CD2  . PHE A 1 131 ? 15.027  4.360   30.426  1.00 45.13 ? 131 PHE A CD2  1  
ATOM 2071   C CE1  . PHE A 1 131 ? 16.398  4.999   32.735  1.00 55.05 ? 131 PHE A CE1  1  
ATOM 2072   C CE2  . PHE A 1 131 ? 15.189  3.415   31.417  1.00 41.24 ? 131 PHE A CE2  1  
ATOM 2073   C CZ   . PHE A 1 131 ? 15.873  3.736   32.573  1.00 35.24 ? 131 PHE A CZ   1  
ATOM 2074   H H    . PHE A 1 131 ? 14.628  8.612   27.868  1.00 74.25 ? 131 PHE A H    1  
ATOM 2075   H HA   . PHE A 1 131 ? 13.226  7.102   29.829  1.00 71.41 ? 131 PHE A HA   1  
ATOM 2076   H HB2  . PHE A 1 131 ? 15.171  6.196   28.521  1.00 44.51 ? 131 PHE A HB2  1  
ATOM 2077   H HB3  . PHE A 1 131 ? 16.252  7.290   29.373  1.00 23.53 ? 131 PHE A HB3  1  
ATOM 2078   H HD1  . PHE A 1 131 ? 16.658  6.937   31.872  1.00 54.44 ? 131 PHE A HD1  1  
ATOM 2079   H HD2  . PHE A 1 131 ? 14.490  4.100   29.520  1.00 64.33 ? 131 PHE A HD2  1  
ATOM 2080   H HE1  . PHE A 1 131 ? 16.939  5.251   33.635  1.00 13.52 ? 131 PHE A HE1  1  
ATOM 2081   H HE2  . PHE A 1 131 ? 14.779  2.422   31.289  1.00 11.41 ? 131 PHE A HE2  1  
ATOM 2082   H HZ   . PHE A 1 131 ? 15.996  2.995   33.352  1.00 42.42 ? 131 PHE A HZ   1  
ATOM 2083   N N    . HIS A 1 132 ? 15.413  9.343   30.947  1.00 11.15 ? 132 HIS A N    1  
ATOM 2084   C CA   . HIS A 1 132 ? 15.949  10.041  32.129  1.00 51.32 ? 132 HIS A CA   1  
ATOM 2085   C C    . HIS A 1 132 ? 14.899  10.953  32.791  1.00 21.45 ? 132 HIS A C    1  
ATOM 2086   O O    . HIS A 1 132 ? 14.691  10.880  34.007  1.00 23.42 ? 132 HIS A O    1  
ATOM 2087   C CB   . HIS A 1 132 ? 17.211  10.857  31.741  1.00 63.43 ? 132 HIS A CB   1  
ATOM 2088   C CG   . HIS A 1 132 ? 18.343  10.014  31.185  1.00 32.13 ? 132 HIS A CG   1  
ATOM 2089   N ND1  . HIS A 1 132 ? 19.169  10.423  30.148  1.00 12.50 ? 132 HIS A ND1  1  
ATOM 2090   C CD2  . HIS A 1 132 ? 18.768  8.770   31.523  1.00 41.12 ? 132 HIS A CD2  1  
ATOM 2091   C CE1  . HIS A 1 132 ? 20.043  9.465   29.883  1.00 23.41 ? 132 HIS A CE1  1  
ATOM 2092   N NE2  . HIS A 1 132 ? 19.817  8.454   30.700  1.00 75.25 ? 132 HIS A NE2  1  
ATOM 2093   H H    . HIS A 1 132 ? 15.828  9.514   30.070  1.00 62.12 ? 132 HIS A H    1  
ATOM 2094   H HA   . HIS A 1 132 ? 16.244  9.276   32.845  1.00 12.44 ? 132 HIS A HA   1  
ATOM 2095   H HB2  . HIS A 1 132 ? 16.939  11.590  30.990  1.00 44.32 ? 132 HIS A HB2  1  
ATOM 2096   H HB3  . HIS A 1 132 ? 17.584  11.374  32.618  1.00 55.33 ? 132 HIS A HB3  1  
ATOM 2097   H HD1  . HIS A 1 132 ? 19.119  11.285  29.670  1.00 3.51  ? 132 HIS A HD1  1  
ATOM 2098   H HD2  . HIS A 1 132 ? 18.351  8.140   32.296  1.00 12.53 ? 132 HIS A HD2  1  
ATOM 2099   H HE1  . HIS A 1 132 ? 20.808  9.502   29.119  1.00 12.14 ? 132 HIS A HE1  1  
ATOM 2100   H HE2  . HIS A 1 132 ? 20.431  7.694   30.835  1.00 37.66 ? 132 HIS A HE2  1  
ATOM 2101   N N    . GLY A 1 133 ? 14.249  11.800  31.975  1.00 42.32 ? 133 GLY A N    1  
ATOM 2102   C CA   . GLY A 1 133 ? 13.249  12.754  32.464  1.00 13.04 ? 133 GLY A CA   1  
ATOM 2103   C C    . GLY A 1 133 ? 13.870  13.950  33.188  1.00 71.54 ? 133 GLY A C    1  
ATOM 2104   O O    . GLY A 1 133 ? 14.722  13.776  34.073  1.00 31.50 ? 133 GLY A O    1  
ATOM 2105   H H    . GLY A 1 133 ? 14.450  11.770  31.020  1.00 25.43 ? 133 GLY A H    1  
ATOM 2106   H HA2  . GLY A 1 133 ? 12.673  13.106  31.617  1.00 33.22 ? 133 GLY A HA2  1  
ATOM 2107   H HA3  . GLY A 1 133 ? 12.580  12.244  33.145  1.00 44.12 ? 133 GLY A HA3  1  
ATOM 2108   N N    . GLY A 1 134 ? 13.431  15.162  32.831  1.00 53.34 ? 134 GLY A N    1  
ATOM 2109   C CA   . GLY A 1 134 ? 13.983  16.394  33.401  1.00 12.12 ? 134 GLY A CA   1  
ATOM 2110   C C    . GLY A 1 134 ? 13.824  17.568  32.457  1.00 70.42 ? 134 GLY A C    1  
ATOM 2111   O O    . GLY A 1 134 ? 13.011  17.508  31.537  1.00 0.14  ? 134 GLY A O    1  
ATOM 2112   H H    . GLY A 1 134 ? 12.705  15.225  32.175  1.00 22.23 ? 134 GLY A H    1  
ATOM 2113   H HA2  . GLY A 1 134 ? 13.463  16.614  34.322  1.00 10.32 ? 134 GLY A HA2  1  
ATOM 2114   H HA3  . GLY A 1 134 ? 15.038  16.255  33.617  1.00 12.14 ? 134 GLY A HA3  1  
ATOM 2115   N N    . GLU A 1 135 ? 14.607  18.637  32.676  1.00 73.14 ? 135 GLU A N    1  
ATOM 2116   C CA   . GLU A 1 135 ? 14.566  19.846  31.826  1.00 54.15 ? 135 GLU A CA   1  
ATOM 2117   C C    . GLU A 1 135 ? 15.181  19.539  30.456  1.00 1.05  ? 135 GLU A C    1  
ATOM 2118   O O    . GLU A 1 135 ? 16.234  18.882  30.377  1.00 53.24 ? 135 GLU A O    1  
ATOM 2119   C CB   . GLU A 1 135 ? 15.312  21.037  32.501  1.00 11.13 ? 135 GLU A CB   1  
ATOM 2120   C CG   . GLU A 1 135 ? 14.633  21.605  33.770  1.00 71.23 ? 135 GLU A CG   1  
ATOM 2121   C CD   . GLU A 1 135 ? 14.535  20.601  34.929  1.00 44.03 ? 135 GLU A CD   1  
ATOM 2122   O OE1  . GLU A 1 135 ? 13.426  20.118  35.239  1.00 61.04 ? 135 GLU A OE1  1  
ATOM 2123   O OE2  . GLU A 1 135 ? 15.577  20.257  35.522  1.00 65.43 ? 135 GLU A OE2  1  
ATOM 2124   H H    . GLU A 1 135 ? 15.226  18.617  33.432  1.00 30.20 ? 135 GLU A H    1  
ATOM 2125   H HA   . GLU A 1 135 ? 13.521  20.119  31.692  1.00 14.53 ? 135 GLU A HA   1  
ATOM 2126   H HB2  . GLU A 1 135 ? 16.317  20.723  32.766  1.00 44.04 ? 135 GLU A HB2  1  
ATOM 2127   H HB3  . GLU A 1 135 ? 15.392  21.847  31.779  1.00 61.50 ? 135 GLU A HB3  1  
ATOM 2128   H HG2  . GLU A 1 135 ? 15.202  22.465  34.108  1.00 64.21 ? 135 GLU A HG2  1  
ATOM 2129   H HG3  . GLU A 1 135 ? 13.632  21.941  33.504  1.00 50.12 ? 135 GLU A HG3  1  
ATOM 2130   N N    . ARG A 1 136 ? 14.513  19.979  29.377  1.00 35.05 ? 136 ARG A N    1  
ATOM 2131   C CA   . ARG A 1 136 ? 15.008  19.750  28.020  1.00 73.14 ? 136 ARG A CA   1  
ATOM 2132   C C    . ARG A 1 136 ? 15.237  21.073  27.302  1.00 21.25 ? 136 ARG A C    1  
ATOM 2133   O O    . ARG A 1 136 ? 14.324  21.898  27.191  1.00 64.23 ? 136 ARG A O    1  
ATOM 2134   C CB   . ARG A 1 136 ? 14.064  18.851  27.175  1.00 0.53  ? 136 ARG A CB   1  
ATOM 2135   C CG   . ARG A 1 136 ? 14.707  18.367  25.850  1.00 74.40 ? 136 ARG A CG   1  
ATOM 2136   C CD   . ARG A 1 136 ? 15.789  17.256  26.011  1.00 22.04 ? 136 ARG A CD   1  
ATOM 2137   N NE   . ARG A 1 136 ? 16.644  17.386  27.213  1.00 60.35 ? 136 ARG A NE   1  
ATOM 2138   C CZ   . ARG A 1 136 ? 17.984  17.338  27.244  1.00 50.02 ? 136 ARG A CZ   1  
ATOM 2139   N NH1  . ARG A 1 136 ? 18.693  17.139  26.144  1.00 3.14  ? 136 ARG A NH1  1  
ATOM 2140   N NH2  . ARG A 1 136 ? 18.608  17.506  28.399  1.00 54.32 ? 136 ARG A NH2  1  
ATOM 2141   H H    . ARG A 1 136 ? 13.686  20.485  29.502  1.00 43.34 ? 136 ARG A H    1  
ATOM 2142   H HA   . ARG A 1 136 ? 15.972  19.241  28.100  1.00 5.11  ? 136 ARG A HA   1  
ATOM 2143   H HB2  . ARG A 1 136 ? 13.770  17.984  27.750  1.00 61.11 ? 136 ARG A HB2  1  
ATOM 2144   H HB3  . ARG A 1 136 ? 13.170  19.413  26.930  1.00 24.11 ? 136 ARG A HB3  1  
ATOM 2145   H HG2  . ARG A 1 136 ? 13.920  17.981  25.210  1.00 63.34 ? 136 ARG A HG2  1  
ATOM 2146   H HG3  . ARG A 1 136 ? 15.160  19.221  25.358  1.00 43.44 ? 136 ARG A HG3  1  
ATOM 2147   H HD2  . ARG A 1 136 ? 15.291  16.295  26.069  1.00 3.31  ? 136 ARG A HD2  1  
ATOM 2148   H HD3  . ARG A 1 136 ? 16.416  17.269  25.127  1.00 22.33 ? 136 ARG A HD3  1  
ATOM 2149   H HE   . ARG A 1 136 ? 16.177  17.486  28.068  1.00 33.23 ? 136 ARG A HE   1  
ATOM 2150   H HH11 . ARG A 1 136 ? 18.232  17.016  25.262  1.00 41.35 ? 136 ARG A HH11 1  
ATOM 2151   H HH12 . ARG A 1 136 ? 19.693  17.100  26.191  1.00 74.13 ? 136 ARG A HH12 1  
ATOM 2152   H HH21 . ARG A 1 136 ? 18.082  17.668  29.238  1.00 41.41 ? 136 ARG A HH21 1  
ATOM 2153   H HH22 . ARG A 1 136 ? 19.610  17.468  28.441  1.00 75.05 ? 136 ARG A HH22 1  
ATOM 2154   N N    . VAL A 1 137 ? 16.470  21.247  26.811  1.00 64.15 ? 137 VAL A N    1  
ATOM 2155   C CA   . VAL A 1 137 ? 16.856  22.400  26.011  1.00 14.44 ? 137 VAL A CA   1  
ATOM 2156   C C    . VAL A 1 137 ? 16.336  22.222  24.568  1.00 2.54  ? 137 VAL A C    1  
ATOM 2157   O O    . VAL A 1 137 ? 16.848  21.400  23.799  1.00 41.41 ? 137 VAL A O    1  
ATOM 2158   C CB   . VAL A 1 137 ? 18.414  22.595  26.051  1.00 50.01 ? 137 VAL A CB   1  
ATOM 2159   C CG1  . VAL A 1 137 ? 18.869  23.776  25.178  1.00 71.24 ? 137 VAL A CG1  1  
ATOM 2160   C CG2  . VAL A 1 137 ? 18.913  22.762  27.511  1.00 70.23 ? 137 VAL A CG2  1  
ATOM 2161   H H    . VAL A 1 137 ? 17.148  20.569  27.005  1.00 61.50 ? 137 VAL A H    1  
ATOM 2162   H HA   . VAL A 1 137 ? 16.392  23.277  26.450  1.00 54.53 ? 137 VAL A HA   1  
ATOM 2163   H HB   . VAL A 1 137 ? 18.872  21.692  25.650  1.00 42.21 ? 137 VAL A HB   1  
ATOM 2164   H HG11 . VAL A 1 137 ? 19.947  23.857  25.205  1.00 32.32 ? 137 VAL A HG11 1  
ATOM 2165   H HG12 . VAL A 1 137 ? 18.433  24.698  25.546  1.00 2.40  ? 137 VAL A HG12 1  
ATOM 2166   H HG13 . VAL A 1 137 ? 18.552  23.618  24.154  1.00 75.04 ? 137 VAL A HG13 1  
ATOM 2167   H HG21 . VAL A 1 137 ? 19.992  22.848  27.521  1.00 62.04 ? 137 VAL A HG21 1  
ATOM 2168   H HG22 . VAL A 1 137 ? 18.621  21.901  28.096  1.00 24.51 ? 137 VAL A HG22 1  
ATOM 2169   H HG23 . VAL A 1 137 ? 18.477  23.654  27.949  1.00 62.24 ? 137 VAL A HG23 1  
ATOM 2170   N N    . VAL A 1 138 ? 15.253  22.951  24.261  1.00 22.44 ? 138 VAL A N    1  
ATOM 2171   C CA   . VAL A 1 138 ? 14.609  22.977  22.939  1.00 31.24 ? 138 VAL A CA   1  
ATOM 2172   C C    . VAL A 1 138 ? 14.743  24.400  22.380  1.00 33.13 ? 138 VAL A C    1  
ATOM 2173   O O    . VAL A 1 138 ? 14.161  25.331  22.936  1.00 35.30 ? 138 VAL A O    1  
ATOM 2174   C CB   . VAL A 1 138 ? 13.079  22.599  23.061  1.00 14.52 ? 138 VAL A CB   1  
ATOM 2175   C CG1  . VAL A 1 138 ? 12.362  22.602  21.689  1.00 14.14 ? 138 VAL A CG1  1  
ATOM 2176   C CG2  . VAL A 1 138 ? 12.900  21.247  23.783  1.00 73.14 ? 138 VAL A CG2  1  
ATOM 2177   H H    . VAL A 1 138 ? 14.863  23.508  24.960  1.00 65.34 ? 138 VAL A H    1  
ATOM 2178   H HA   . VAL A 1 138 ? 15.101  22.263  22.276  1.00 1.40  ? 138 VAL A HA   1  
ATOM 2179   H HB   . VAL A 1 138 ? 12.601  23.359  23.678  1.00 73.11 ? 138 VAL A HB   1  
ATOM 2180   H HG11 . VAL A 1 138 ? 12.438  23.584  21.241  1.00 73.34 ? 138 VAL A HG11 1  
ATOM 2181   H HG12 . VAL A 1 138 ? 11.314  22.355  21.819  1.00 35.31 ? 138 VAL A HG12 1  
ATOM 2182   H HG13 . VAL A 1 138 ? 12.819  21.872  21.032  1.00 33.12 ? 138 VAL A HG13 1  
ATOM 2183   H HG21 . VAL A 1 138 ? 13.350  21.296  24.767  1.00 11.35 ? 138 VAL A HG21 1  
ATOM 2184   H HG22 . VAL A 1 138 ? 13.377  20.461  23.214  1.00 34.45 ? 138 VAL A HG22 1  
ATOM 2185   H HG23 . VAL A 1 138 ? 11.845  21.019  23.887  1.00 60.24 ? 138 VAL A HG23 1  
ATOM 2186   N N    . GLU A 1 139 ? 15.529  24.572  21.308  1.00 42.05 ? 139 GLU A N    1  
ATOM 2187   C CA   . GLU A 1 139 ? 15.731  25.892  20.678  1.00 33.52 ? 139 GLU A CA   1  
ATOM 2188   C C    . GLU A 1 139 ? 15.089  25.931  19.282  1.00 64.10 ? 139 GLU A C    1  
ATOM 2189   O O    . GLU A 1 139 ? 15.300  25.031  18.458  1.00 64.20 ? 139 GLU A O    1  
ATOM 2190   C CB   . GLU A 1 139 ? 17.241  26.266  20.631  1.00 1.21  ? 139 GLU A CB   1  
ATOM 2191   C CG   . GLU A 1 139 ? 18.165  25.245  19.939  1.00 0.33  ? 139 GLU A CG   1  
ATOM 2192   C CD   . GLU A 1 139 ? 19.612  25.746  19.789  1.00 71.04 ? 139 GLU A CD   1  
ATOM 2193   O OE1  . GLU A 1 139 ? 19.966  26.279  18.716  1.00 10.13 ? 139 GLU A OE1  1  
ATOM 2194   O OE2  . GLU A 1 139 ? 20.401  25.618  20.743  1.00 71.30 ? 139 GLU A OE2  1  
ATOM 2195   H H    . GLU A 1 139 ? 15.984  23.795  20.929  1.00 31.44 ? 139 GLU A H    1  
ATOM 2196   H HA   . GLU A 1 139 ? 15.221  26.639  21.297  1.00 32.52 ? 139 GLU A HA   1  
ATOM 2197   H HB2  . GLU A 1 139 ? 17.345  27.217  20.122  1.00 44.22 ? 139 GLU A HB2  1  
ATOM 2198   H HB3  . GLU A 1 139 ? 17.585  26.391  21.651  1.00 22.14 ? 139 GLU A HB3  1  
ATOM 2199   H HG2  . GLU A 1 139 ? 18.172  24.329  20.523  1.00 33.11 ? 139 GLU A HG2  1  
ATOM 2200   H HG3  . GLU A 1 139 ? 17.766  25.020  18.954  1.00 22.53 ? 139 GLU A HG3  1  
ATOM 2201   N N    . VAL A 1 140 ? 14.283  26.983  19.057  1.00 22.34 ? 140 VAL A N    1  
ATOM 2202   C CA   . VAL A 1 140 ? 13.521  27.208  17.824  1.00 75.10 ? 140 VAL A CA   1  
ATOM 2203   C C    . VAL A 1 140 ? 12.937  28.644  17.865  1.00 45.41 ? 140 VAL A C    1  
ATOM 2204   O O    . VAL A 1 140 ? 12.689  29.177  18.958  1.00 35.04 ? 140 VAL A O    1  
ATOM 2205   C CB   . VAL A 1 140 ? 12.362  26.144  17.673  1.00 5.20  ? 140 VAL A CB   1  
ATOM 2206   C CG1  . VAL A 1 140 ? 11.250  26.358  18.731  1.00 2.00  ? 140 VAL A CG1  1  
ATOM 2207   C CG2  . VAL A 1 140 ? 11.792  26.113  16.233  1.00 54.12 ? 140 VAL A CG2  1  
ATOM 2208   H H    . VAL A 1 140 ? 14.191  27.649  19.767  1.00 13.45 ? 140 VAL A H    1  
ATOM 2209   H HA   . VAL A 1 140 ? 14.202  27.119  16.980  1.00 33.35 ? 140 VAL A HA   1  
ATOM 2210   H HB   . VAL A 1 140 ? 12.801  25.164  17.868  1.00 73.33 ? 140 VAL A HB   1  
ATOM 2211   H HG11 . VAL A 1 140 ? 10.790  27.326  18.589  1.00 24.21 ? 140 VAL A HG11 1  
ATOM 2212   H HG12 . VAL A 1 140 ? 11.675  26.309  19.726  1.00 45.33 ? 140 VAL A HG12 1  
ATOM 2213   H HG13 . VAL A 1 140 ? 10.497  25.588  18.631  1.00 31.11 ? 140 VAL A HG13 1  
ATOM 2214   H HG21 . VAL A 1 140 ? 12.583  25.880  15.530  1.00 14.15 ? 140 VAL A HG21 1  
ATOM 2215   H HG22 . VAL A 1 140 ? 11.369  27.077  15.983  1.00 73.05 ? 140 VAL A HG22 1  
ATOM 2216   H HG23 . VAL A 1 140 ? 11.019  25.356  16.159  1.00 71.32 ? 140 VAL A HG23 1  
ATOM 2217   N N    . ALA A 1 141 ? 12.763  29.270  16.682  1.00 32.22 ? 141 ALA A N    1  
ATOM 2218   C CA   . ALA A 1 141 ? 12.117  30.601  16.541  1.00 50.00 ? 141 ALA A CA   1  
ATOM 2219   C C    . ALA A 1 141 ? 12.864  31.728  17.303  1.00 74.24 ? 141 ALA A C    1  
ATOM 2220   O O    . ALA A 1 141 ? 12.295  32.799  17.563  1.00 61.51 ? 141 ALA A O    1  
ATOM 2221   C CB   . ALA A 1 141 ? 10.632  30.518  16.959  1.00 71.01 ? 141 ALA A CB   1  
ATOM 2222   H H    . ALA A 1 141 ? 13.079  28.824  15.868  1.00 64.44 ? 141 ALA A H    1  
ATOM 2223   H HA   . ALA A 1 141 ? 12.144  30.849  15.487  1.00 2.51  ? 141 ALA A HA   1  
ATOM 2224   H HB1  . ALA A 1 141 ? 10.140  29.732  16.398  1.00 64.43 ? 141 ALA A HB1  1  
ATOM 2225   H HB2  . ALA A 1 141 ? 10.140  31.461  16.754  1.00 12.13 ? 141 ALA A HB2  1  
ATOM 2226   H HB3  . ALA A 1 141 ? 10.563  30.298  18.014  1.00 43.31 ? 141 ALA A HB3  1  
ATOM 2227   N N    . GLY A 1 142 ? 14.149  31.483  17.626  1.00 1.34  ? 142 GLY A N    1  
ATOM 2228   C CA   . GLY A 1 142 ? 14.976  32.439  18.371  1.00 2.03  ? 142 GLY A CA   1  
ATOM 2229   C C    . GLY A 1 142 ? 15.059  32.109  19.855  1.00 31.10 ? 142 GLY A C    1  
ATOM 2230   O O    . GLY A 1 142 ? 16.077  32.389  20.505  1.00 24.51 ? 142 GLY A O    1  
ATOM 2231   H H    . GLY A 1 142 ? 14.543  30.629  17.349  1.00 31.22 ? 142 GLY A H    1  
ATOM 2232   H HA2  . GLY A 1 142 ? 15.973  32.424  17.949  1.00 30.22 ? 142 GLY A HA2  1  
ATOM 2233   H HA3  . GLY A 1 142 ? 14.574  33.441  18.257  1.00 54.15 ? 142 GLY A HA3  1  
ATOM 2234   N N    . ARG A 1 143 ? 13.981  31.508  20.393  1.00 72.12 ? 143 ARG A N    1  
ATOM 2235   C CA   . ARG A 1 143 ? 13.891  31.160  21.823  1.00 5.41  ? 143 ARG A CA   1  
ATOM 2236   C C    . ARG A 1 143 ? 14.511  29.779  22.089  1.00 31.00 ? 143 ARG A C    1  
ATOM 2237   O O    . ARG A 1 143 ? 14.288  28.837  21.334  1.00 14.13 ? 143 ARG A O    1  
ATOM 2238   C CB   . ARG A 1 143 ? 12.417  31.151  22.307  1.00 14.22 ? 143 ARG A CB   1  
ATOM 2239   C CG   . ARG A 1 143 ? 12.263  30.824  23.816  1.00 43.23 ? 143 ARG A CG   1  
ATOM 2240   C CD   . ARG A 1 143 ? 10.830  30.492  24.240  1.00 71.21 ? 143 ARG A CD   1  
ATOM 2241   N NE   . ARG A 1 143 ? 10.772  30.186  25.680  1.00 30.35 ? 143 ARG A NE   1  
ATOM 2242   C CZ   . ARG A 1 143 ? 9.669   29.870  26.366  1.00 64.34 ? 143 ARG A CZ   1  
ATOM 2243   N NH1  . ARG A 1 143 ? 8.497   29.804  25.772  1.00 31.02 ? 143 ARG A NH1  1  
ATOM 2244   N NH2  . ARG A 1 143 ? 9.744   29.688  27.672  1.00 40.41 ? 143 ARG A NH2  1  
ATOM 2245   H H    . ARG A 1 143 ? 13.228  31.276  19.806  1.00 33.13 ? 143 ARG A H    1  
ATOM 2246   H HA   . ARG A 1 143 ? 14.439  31.913  22.387  1.00 30.13 ? 143 ARG A HA   1  
ATOM 2247   H HB2  . ARG A 1 143 ? 11.985  32.130  22.119  1.00 72.15 ? 143 ARG A HB2  1  
ATOM 2248   H HB3  . ARG A 1 143 ? 11.862  30.414  21.733  1.00 14.13 ? 143 ARG A HB3  1  
ATOM 2249   H HG2  . ARG A 1 143 ? 12.887  29.972  24.054  1.00 0.35  ? 143 ARG A HG2  1  
ATOM 2250   H HG3  . ARG A 1 143 ? 12.609  31.679  24.392  1.00 53.44 ? 143 ARG A HG3  1  
ATOM 2251   H HD2  . ARG A 1 143 ? 10.191  31.351  24.034  1.00 72.43 ? 143 ARG A HD2  1  
ATOM 2252   H HD3  . ARG A 1 143 ? 10.477  29.638  23.678  1.00 42.01 ? 143 ARG A HD3  1  
ATOM 2253   H HE   . ARG A 1 143 ? 11.623  30.209  26.166  1.00 24.51 ? 143 ARG A HE   1  
ATOM 2254   H HH11 . ARG A 1 143 ? 8.419   29.993  24.791  1.00 11.44 ? 143 ARG A HH11 1  
ATOM 2255   H HH12 . ARG A 1 143 ? 7.677   29.578  26.302  1.00 63.54 ? 143 ARG A HH12 1  
ATOM 2256   H HH21 . ARG A 1 143 ? 10.626  29.788  28.145  1.00 14.13 ? 143 ARG A HH21 1  
ATOM 2257   H HH22 . ARG A 1 143 ? 8.922   29.464  28.196  1.00 24.43 ? 143 ARG A HH22 1  
ATOM 2258   N N    . ARG A 1 144 ? 15.272  29.672  23.178  1.00 71.40 ? 144 ARG A N    1  
ATOM 2259   C CA   . ARG A 1 144 ? 15.757  28.390  23.700  1.00 11.32 ? 144 ARG A CA   1  
ATOM 2260   C C    . ARG A 1 144 ? 15.065  28.128  25.049  1.00 10.21 ? 144 ARG A C    1  
ATOM 2261   O O    . ARG A 1 144 ? 15.453  28.689  26.082  1.00 42.01 ? 144 ARG A O    1  
ATOM 2262   C CB   . ARG A 1 144 ? 17.295  28.440  23.820  1.00 2.21  ? 144 ARG A CB   1  
ATOM 2263   C CG   . ARG A 1 144 ? 17.965  27.198  24.443  1.00 22.01 ? 144 ARG A CG   1  
ATOM 2264   C CD   . ARG A 1 144 ? 19.501  27.330  24.504  1.00 63.31 ? 144 ARG A CD   1  
ATOM 2265   N NE   . ARG A 1 144 ? 20.126  27.377  23.161  1.00 74.41 ? 144 ARG A NE   1  
ATOM 2266   C CZ   . ARG A 1 144 ? 20.656  28.470  22.582  1.00 3.55  ? 144 ARG A CZ   1  
ATOM 2267   N NH1  . ARG A 1 144 ? 20.646  29.634  23.203  1.00 15.54 ? 144 ARG A NH1  1  
ATOM 2268   N NH2  . ARG A 1 144 ? 21.212  28.380  21.386  1.00 62.51 ? 144 ARG A NH2  1  
ATOM 2269   H H    . ARG A 1 144 ? 15.524  30.490  23.653  1.00 40.42 ? 144 ARG A H    1  
ATOM 2270   H HA   . ARG A 1 144 ? 15.482  27.598  23.000  1.00 52.11 ? 144 ARG A HA   1  
ATOM 2271   H HB2  . ARG A 1 144 ? 17.707  28.575  22.824  1.00 54.53 ? 144 ARG A HB2  1  
ATOM 2272   H HB3  . ARG A 1 144 ? 17.564  29.304  24.416  1.00 12.14 ? 144 ARG A HB3  1  
ATOM 2273   H HG2  . ARG A 1 144 ? 17.586  27.065  25.450  1.00 24.51 ? 144 ARG A HG2  1  
ATOM 2274   H HG3  . ARG A 1 144 ? 17.711  26.322  23.851  1.00 15.31 ? 144 ARG A HG3  1  
ATOM 2275   H HD2  . ARG A 1 144 ? 19.757  28.230  25.057  1.00 32.42 ? 144 ARG A HD2  1  
ATOM 2276   H HD3  . ARG A 1 144 ? 19.898  26.474  25.035  1.00 13.25 ? 144 ARG A HD3  1  
ATOM 2277   H HE   . ARG A 1 144 ? 20.155  26.535  22.663  1.00 24.34 ? 144 ARG A HE   1  
ATOM 2278   H HH11 . ARG A 1 144 ? 20.240  29.717  24.120  1.00 24.55 ? 144 ARG A HH11 1  
ATOM 2279   H HH12 . ARG A 1 144 ? 21.042  30.441  22.763  1.00 13.53 ? 144 ARG A HH12 1  
ATOM 2280   H HH21 . ARG A 1 144 ? 21.240  27.494  20.910  1.00 23.44 ? 144 ARG A HH21 1  
ATOM 2281   H HH22 . ARG A 1 144 ? 21.609  29.192  20.951  1.00 63.33 ? 144 ARG A HH22 1  
ATOM 2282   N N    . VAL A 1 145 ? 13.986  27.329  24.999  1.00 31.12 ? 145 VAL A N    1  
ATOM 2283   C CA   . VAL A 1 145 ? 13.163  26.996  26.178  1.00 73.53 ? 145 VAL A CA   1  
ATOM 2284   C C    . VAL A 1 145 ? 13.722  25.770  26.926  1.00 61.04 ? 145 VAL A C    1  
ATOM 2285   O O    . VAL A 1 145 ? 14.301  24.865  26.317  1.00 33.25 ? 145 VAL A O    1  
ATOM 2286   C CB   . VAL A 1 145 ? 11.644  26.763  25.784  1.00 71.22 ? 145 VAL A CB   1  
ATOM 2287   C CG1  . VAL A 1 145 ? 11.475  25.620  24.758  1.00 21.53 ? 145 VAL A CG1  1  
ATOM 2288   C CG2  . VAL A 1 145 ? 10.746  26.526  27.034  1.00 52.23 ? 145 VAL A CG2  1  
ATOM 2289   H H    . VAL A 1 145 ? 13.733  26.944  24.136  1.00 23.03 ? 145 VAL A H    1  
ATOM 2290   H HA   . VAL A 1 145 ? 13.197  27.851  26.848  1.00 43.24 ? 145 VAL A HA   1  
ATOM 2291   H HB   . VAL A 1 145 ? 11.294  27.677  25.303  1.00 21.21 ? 145 VAL A HB   1  
ATOM 2292   H HG11 . VAL A 1 145 ? 12.061  25.837  23.875  1.00 63.24 ? 145 VAL A HG11 1  
ATOM 2293   H HG12 . VAL A 1 145 ? 10.433  25.530  24.476  1.00 21.14 ? 145 VAL A HG12 1  
ATOM 2294   H HG13 . VAL A 1 145 ? 11.810  24.685  25.190  1.00 70.21 ? 145 VAL A HG13 1  
ATOM 2295   H HG21 . VAL A 1 145 ? 9.712   26.417  26.730  1.00 64.11 ? 145 VAL A HG21 1  
ATOM 2296   H HG22 . VAL A 1 145 ? 10.825  27.373  27.706  1.00 65.02 ? 145 VAL A HG22 1  
ATOM 2297   H HG23 . VAL A 1 145 ? 11.061  25.630  27.555  1.00 71.11 ? 145 VAL A HG23 1  
ATOM 2298   N N    . SER A 1 146 ? 13.578  25.785  28.258  1.00 31.45 ? 146 SER A N    1  
ATOM 2299   C CA   . SER A 1 146 ? 13.854  24.629  29.114  1.00 4.32  ? 146 SER A CA   1  
ATOM 2300   C C    . SER A 1 146 ? 12.508  24.000  29.536  1.00 23.33 ? 146 SER A C    1  
ATOM 2301   O O    . SER A 1 146 ? 11.905  24.408  30.540  1.00 13.22 ? 146 SER A O    1  
ATOM 2302   C CB   . SER A 1 146 ? 14.698  25.068  30.336  1.00 31.43 ? 146 SER A CB   1  
ATOM 2303   O OG   . SER A 1 146 ? 15.015  23.971  31.171  1.00 24.00 ? 146 SER A OG   1  
ATOM 2304   H H    . SER A 1 146 ? 13.271  26.613  28.683  1.00 12.14 ? 146 SER A H    1  
ATOM 2305   H HA   . SER A 1 146 ? 14.422  23.891  28.540  1.00 63.54 ? 146 SER A HA   1  
ATOM 2306   H HB2  . SER A 1 146 ? 15.625  25.507  29.991  1.00 64.43 ? 146 SER A HB2  1  
ATOM 2307   H HB3  . SER A 1 146 ? 14.152  25.801  30.916  1.00 4.20  ? 146 SER A HB3  1  
ATOM 2308   H HG   . SER A 1 146 ? 15.969  23.851  31.193  1.00 40.41 ? 146 SER A HG   1  
ATOM 2309   N N    . VAL A 1 147 ? 11.999  23.053  28.717  1.00 73.24 ? 147 VAL A N    1  
ATOM 2310   C CA   . VAL A 1 147 ? 10.722  22.360  29.004  1.00 1.22  ? 147 VAL A CA   1  
ATOM 2311   C C    . VAL A 1 147 ? 11.003  21.039  29.742  1.00 24.22 ? 147 VAL A C    1  
ATOM 2312   O O    . VAL A 1 147 ? 11.705  20.165  29.224  1.00 55.41 ? 147 VAL A O    1  
ATOM 2313   C CB   . VAL A 1 147 ? 9.854   22.104  27.699  1.00 11.43 ? 147 VAL A CB   1  
ATOM 2314   C CG1  . VAL A 1 147 ? 10.646  21.358  26.601  1.00 33.04 ? 147 VAL A CG1  1  
ATOM 2315   C CG2  . VAL A 1 147 ? 8.532   21.362  28.038  1.00 73.42 ? 147 VAL A CG2  1  
ATOM 2316   H H    . VAL A 1 147 ? 12.509  22.802  27.912  1.00 11.55 ? 147 VAL A H    1  
ATOM 2317   H HA   . VAL A 1 147 ? 10.138  23.006  29.664  1.00 1.42  ? 147 VAL A HA   1  
ATOM 2318   H HB   . VAL A 1 147 ? 9.585   23.076  27.294  1.00 72.11 ? 147 VAL A HB   1  
ATOM 2319   H HG11 . VAL A 1 147 ? 10.028  21.235  25.722  1.00 52.44 ? 147 VAL A HG11 1  
ATOM 2320   H HG12 . VAL A 1 147 ? 10.950  20.385  26.965  1.00 42.35 ? 147 VAL A HG12 1  
ATOM 2321   H HG13 . VAL A 1 147 ? 11.528  21.929  26.339  1.00 11.42 ? 147 VAL A HG13 1  
ATOM 2322   H HG21 . VAL A 1 147 ? 7.942   21.235  27.139  1.00 32.25 ? 147 VAL A HG21 1  
ATOM 2323   H HG22 . VAL A 1 147 ? 7.961   21.937  28.755  1.00 11.41 ? 147 VAL A HG22 1  
ATOM 2324   H HG23 . VAL A 1 147 ? 8.752   20.388  28.460  1.00 71.13 ? 147 VAL A HG23 1  
ATOM 2325   N N    . ARG A 1 148 ? 10.486  20.915  30.980  1.00 12.21 ? 148 ARG A N    1  
ATOM 2326   C CA   . ARG A 1 148 ? 10.637  19.685  31.764  1.00 20.14 ? 148 ARG A CA   1  
ATOM 2327   C C    . ARG A 1 148 ? 9.735   18.576  31.190  1.00 11.33 ? 148 ARG A C    1  
ATOM 2328   O O    . ARG A 1 148 ? 8.511   18.606  31.348  1.00 14.22 ? 148 ARG A O    1  
ATOM 2329   C CB   . ARG A 1 148 ? 10.350  19.924  33.267  1.00 22.12 ? 148 ARG A CB   1  
ATOM 2330   C CG   . ARG A 1 148 ? 10.490  18.650  34.135  1.00 2.43  ? 148 ARG A CG   1  
ATOM 2331   C CD   . ARG A 1 148 ? 10.373  18.922  35.642  1.00 74.14 ? 148 ARG A CD   1  
ATOM 2332   N NE   . ARG A 1 148 ? 10.469  17.680  36.431  1.00 5.50  ? 148 ARG A NE   1  
ATOM 2333   C CZ   . ARG A 1 148 ? 11.606  17.048  36.772  1.00 64.12 ? 148 ARG A CZ   1  
ATOM 2334   N NH1  . ARG A 1 148 ? 12.795  17.517  36.410  1.00 14.44 ? 148 ARG A NH1  1  
ATOM 2335   N NH2  . ARG A 1 148 ? 11.539  15.926  37.470  1.00 53.24 ? 148 ARG A NH2  1  
ATOM 2336   H H    . ARG A 1 148 ? 9.996   21.667  31.367  1.00 74.32 ? 148 ARG A H    1  
ATOM 2337   H HA   . ARG A 1 148 ? 11.678  19.367  31.666  1.00 20.13 ? 148 ARG A HA   1  
ATOM 2338   H HB2  . ARG A 1 148 ? 11.045  20.670  33.638  1.00 63.42 ? 148 ARG A HB2  1  
ATOM 2339   H HB3  . ARG A 1 148 ? 9.340   20.305  33.378  1.00 1.23  ? 148 ARG A HB3  1  
ATOM 2340   H HG2  . ARG A 1 148 ? 9.714   17.948  33.851  1.00 64.33 ? 148 ARG A HG2  1  
ATOM 2341   H HG3  . ARG A 1 148 ? 11.459  18.198  33.937  1.00 13.42 ? 148 ARG A HG3  1  
ATOM 2342   H HD2  . ARG A 1 148 ? 11.164  19.602  35.946  1.00 70.12 ? 148 ARG A HD2  1  
ATOM 2343   H HD3  . ARG A 1 148 ? 9.414   19.383  35.842  1.00 43.40 ? 148 ARG A HD3  1  
ATOM 2344   H HE   . ARG A 1 148 ? 9.618   17.280  36.717  1.00 43.52 ? 148 ARG A HE   1  
ATOM 2345   H HH11 . ARG A 1 148 ? 12.865  18.361  35.864  1.00 22.25 ? 148 ARG A HH11 1  
ATOM 2346   H HH12 . ARG A 1 148 ? 13.630  17.026  36.675  1.00 33.44 ? 148 ARG A HH12 1  
ATOM 2347   H HH21 . ARG A 1 148 ? 10.649  15.551  37.743  1.00 24.35 ? 148 ARG A HH21 1  
ATOM 2348   H HH22 . ARG A 1 148 ? 12.382  15.444  37.731  1.00 35.15 ? 148 ARG A HH22 1  
ATOM 2349   N N    . ILE A 1 149 ? 10.370  17.636  30.480  1.00 54.24 ? 149 ILE A N    1  
ATOM 2350   C CA   . ILE A 1 149 ? 9.712   16.449  29.927  1.00 13.15 ? 149 ILE A CA   1  
ATOM 2351   C C    . ILE A 1 149 ? 9.403   15.431  31.060  1.00 64.02 ? 149 ILE A C    1  
ATOM 2352   O O    . ILE A 1 149 ? 10.187  15.326  32.016  1.00 13.11 ? 149 ILE A O    1  
ATOM 2353   C CB   . ILE A 1 149 ? 10.599  15.777  28.801  1.00 72.10 ? 149 ILE A CB   1  
ATOM 2354   C CG1  . ILE A 1 149 ? 11.989  15.329  29.370  1.00 74.13 ? 149 ILE A CG1  1  
ATOM 2355   C CG2  . ILE A 1 149 ? 10.771  16.740  27.591  1.00 54.30 ? 149 ILE A CG2  1  
ATOM 2356   C CD1  . ILE A 1 149 ? 12.934  14.713  28.362  1.00 43.20 ? 149 ILE A CD1  1  
ATOM 2357   H H    . ILE A 1 149 ? 11.329  17.752  30.322  1.00 45.10 ? 149 ILE A H    1  
ATOM 2358   H HA   . ILE A 1 149 ? 8.776   16.771  29.475  1.00 53.32 ? 149 ILE A HA   1  
ATOM 2359   H HB   . ILE A 1 149 ? 10.066  14.899  28.443  1.00 60.44 ? 149 ILE A HB   1  
ATOM 2360   H HG12 . ILE A 1 149 ? 12.493  16.190  29.792  1.00 74.02 ? 149 ILE A HG12 1  
ATOM 2361   H HG13 . ILE A 1 149 ? 11.831  14.603  30.160  1.00 30.13 ? 149 ILE A HG13 1  
ATOM 2362   H HG21 . ILE A 1 149 ? 11.350  16.254  26.814  1.00 21.25 ? 149 ILE A HG21 1  
ATOM 2363   H HG22 . ILE A 1 149 ? 11.287  17.639  27.906  1.00 65.24 ? 149 ILE A HG22 1  
ATOM 2364   H HG23 . ILE A 1 149 ? 9.801   17.009  27.194  1.00 35.12 ? 149 ILE A HG23 1  
ATOM 2365   H HD11 . ILE A 1 149 ? 12.469  13.851  27.904  1.00 74.52 ? 149 ILE A HD11 1  
ATOM 2366   H HD12 . ILE A 1 149 ? 13.841  14.406  28.863  1.00 52.24 ? 149 ILE A HD12 1  
ATOM 2367   H HD13 . ILE A 1 149 ? 13.176  15.441  27.601  1.00 14.11 ? 149 ILE A HD13 1  
ATOM 2368   N N    . PRO A 1 150 ? 8.234   14.708  30.997  1.00 44.05 ? 150 PRO A N    1  
ATOM 2369   C CA   . PRO A 1 150 ? 7.894   13.639  31.975  1.00 35.23 ? 150 PRO A CA   1  
ATOM 2370   C C    . PRO A 1 150 ? 8.896   12.449  31.922  1.00 21.52 ? 150 PRO A C    1  
ATOM 2371   O O    . PRO A 1 150 ? 9.315   12.058  30.823  1.00 31.32 ? 150 PRO A O    1  
ATOM 2372   C CB   . PRO A 1 150 ? 6.462   13.193  31.544  1.00 60.34 ? 150 PRO A CB   1  
ATOM 2373   C CG   . PRO A 1 150 ? 5.933   14.325  30.714  1.00 54.54 ? 150 PRO A CG   1  
ATOM 2374   C CD   . PRO A 1 150 ? 7.139   14.893  30.003  1.00 15.14 ? 150 PRO A CD   1  
ATOM 2375   H HA   . PRO A 1 150 ? 7.864   14.042  32.984  1.00 21.41 ? 150 PRO A HA   1  
ATOM 2376   H HB2  . PRO A 1 150 ? 6.503   12.272  30.959  1.00 64.23 ? 150 PRO A HB2  1  
ATOM 2377   H HB3  . PRO A 1 150 ? 5.834   13.044  32.414  1.00 73.22 ? 150 PRO A HB3  1  
ATOM 2378   H HG2  . PRO A 1 150 ? 5.201   13.957  29.997  1.00 31.33 ? 150 PRO A HG2  1  
ATOM 2379   H HG3  . PRO A 1 150 ? 5.485   15.082  31.349  1.00 2.23  ? 150 PRO A HG3  1  
ATOM 2380   H HD2  . PRO A 1 150 ? 7.352   14.339  29.094  1.00 74.22 ? 150 PRO A HD2  1  
ATOM 2381   H HD3  . PRO A 1 150 ? 6.990   15.942  29.774  1.00 13.30 ? 150 PRO A HD3  1  
ATOM 2382   N N    . PRO A 1 151 ? 9.318   11.882  33.104  1.00 62.42 ? 151 PRO A N    1  
ATOM 2383   C CA   . PRO A 1 151 ? 10.183  10.675  33.154  1.00 41.44 ? 151 PRO A CA   1  
ATOM 2384   C C    . PRO A 1 151 ? 9.488   9.444   32.532  1.00 74.15 ? 151 PRO A C    1  
ATOM 2385   O O    . PRO A 1 151 ? 8.544   8.883   33.111  1.00 4.02  ? 151 PRO A O    1  
ATOM 2386   C CB   . PRO A 1 151 ? 10.473  10.490  34.674  1.00 42.02 ? 151 PRO A CB   1  
ATOM 2387   C CG   . PRO A 1 151 ? 10.176  11.829  35.282  1.00 1.15  ? 151 PRO A CG   1  
ATOM 2388   C CD   . PRO A 1 151 ? 9.030   12.384  34.471  1.00 0.33  ? 151 PRO A CD   1  
ATOM 2389   H HA   . PRO A 1 151 ? 11.120  10.857  32.626  1.00 61.25 ? 151 PRO A HA   1  
ATOM 2390   H HB2  . PRO A 1 151 ? 9.829   9.718   35.100  1.00 30.23 ? 151 PRO A HB2  1  
ATOM 2391   H HB3  . PRO A 1 151 ? 11.511  10.230  34.834  1.00 15.20 ? 151 PRO A HB3  1  
ATOM 2392   H HG2  . PRO A 1 151 ? 9.892   11.715  36.325  1.00 63.44 ? 151 PRO A HG2  1  
ATOM 2393   H HG3  . PRO A 1 151 ? 11.039  12.480  35.197  1.00 25.03 ? 151 PRO A HG3  1  
ATOM 2394   H HD2  . PRO A 1 151 ? 8.076   12.006  34.831  1.00 53.21 ? 151 PRO A HD2  1  
ATOM 2395   H HD3  . PRO A 1 151 ? 9.033   13.468  34.496  1.00 3.14  ? 151 PRO A HD3  1  
ATOM 2396   N N    . GLY A 1 152 ? 9.947   9.068   31.328  1.00 14.44 ? 152 GLY A N    1  
ATOM 2397   C CA   . GLY A 1 152 ? 9.355   7.969   30.570  1.00 45.04 ? 152 GLY A CA   1  
ATOM 2398   C C    . GLY A 1 152 ? 8.252   8.442   29.642  1.00 75.51 ? 152 GLY A C    1  
ATOM 2399   O O    . GLY A 1 152 ? 7.170   7.843   29.588  1.00 70.24 ? 152 GLY A O    1  
ATOM 2400   H H    . GLY A 1 152 ? 10.707  9.554   30.943  1.00 53.03 ? 152 GLY A H    1  
ATOM 2401   H HA2  . GLY A 1 152 ? 10.131  7.503   29.976  1.00 22.43 ? 152 GLY A HA2  1  
ATOM 2402   H HA3  . GLY A 1 152 ? 8.954   7.225   31.253  1.00 73.24 ? 152 GLY A HA3  1  
ATOM 2403   N N    . VAL A 1 153 ? 8.539   9.525   28.906  1.00 63.52 ? 153 VAL A N    1  
ATOM 2404   C CA   . VAL A 1 153 ? 7.553   10.199  28.034  1.00 62.22 ? 153 VAL A CA   1  
ATOM 2405   C C    . VAL A 1 153 ? 7.417   9.456   26.681  1.00 72.42 ? 153 VAL A C    1  
ATOM 2406   O O    . VAL A 1 153 ? 8.409   9.199   25.988  1.00 13.10 ? 153 VAL A O    1  
ATOM 2407   C CB   . VAL A 1 153 ? 7.919   11.718  27.850  1.00 22.21 ? 153 VAL A CB   1  
ATOM 2408   C CG1  . VAL A 1 153 ? 9.367   11.912  27.354  1.00 75.43 ? 153 VAL A CG1  1  
ATOM 2409   C CG2  . VAL A 1 153 ? 6.904   12.456  26.949  1.00 62.54 ? 153 VAL A CG2  1  
ATOM 2410   H H    . VAL A 1 153 ? 9.456   9.876   28.937  1.00 35.24 ? 153 VAL A H    1  
ATOM 2411   H HA   . VAL A 1 153 ? 6.588   10.154  28.549  1.00 64.34 ? 153 VAL A HA   1  
ATOM 2412   H HB   . VAL A 1 153 ? 7.866   12.174  28.840  1.00 12.43 ? 153 VAL A HB   1  
ATOM 2413   H HG11 . VAL A 1 153 ? 9.481   11.472  26.370  1.00 20.21 ? 153 VAL A HG11 1  
ATOM 2414   H HG12 . VAL A 1 153 ? 10.055  11.431  28.037  1.00 14.44 ? 153 VAL A HG12 1  
ATOM 2415   H HG13 . VAL A 1 153 ? 9.600   12.970  27.305  1.00 53.23 ? 153 VAL A HG13 1  
ATOM 2416   H HG21 . VAL A 1 153 ? 7.180   13.499  26.863  1.00 11.22 ? 153 VAL A HG21 1  
ATOM 2417   H HG22 . VAL A 1 153 ? 5.915   12.388  27.381  1.00 50.22 ? 153 VAL A HG22 1  
ATOM 2418   H HG23 . VAL A 1 153 ? 6.890   12.007  25.961  1.00 64.14 ? 153 VAL A HG23 1  
ATOM 2419   N N    . ARG A 1 154 ? 6.159   9.116   26.335  1.00 32.34 ? 154 ARG A N    1  
ATOM 2420   C CA   . ARG A 1 154 ? 5.817   8.174   25.249  1.00 44.41 ? 154 ARG A CA   1  
ATOM 2421   C C    . ARG A 1 154 ? 5.209   8.932   24.061  1.00 15.33 ? 154 ARG A C    1  
ATOM 2422   O O    . ARG A 1 154 ? 4.662   10.011  24.257  1.00 10.50 ? 154 ARG A O    1  
ATOM 2423   C CB   . ARG A 1 154 ? 4.807   7.137   25.818  1.00 44.14 ? 154 ARG A CB   1  
ATOM 2424   C CG   . ARG A 1 154 ? 5.239   6.535   27.183  1.00 60.43 ? 154 ARG A CG   1  
ATOM 2425   C CD   . ARG A 1 154 ? 4.134   5.724   27.877  1.00 2.31  ? 154 ARG A CD   1  
ATOM 2426   N NE   . ARG A 1 154 ? 2.857   6.471   27.965  1.00 73.23 ? 154 ARG A NE   1  
ATOM 2427   C CZ   . ARG A 1 154 ? 2.205   6.790   29.091  1.00 65.11 ? 154 ARG A CZ   1  
ATOM 2428   N NH1  . ARG A 1 154 ? 2.675   6.454   30.284  1.00 60.21 ? 154 ARG A NH1  1  
ATOM 2429   N NH2  . ARG A 1 154 ? 1.068   7.447   29.012  1.00 55.42 ? 154 ARG A NH2  1  
ATOM 2430   H H    . ARG A 1 154 ? 5.419   9.531   26.827  1.00 14.15 ? 154 ARG A H    1  
ATOM 2431   H HA   . ARG A 1 154 ? 6.720   7.661   24.923  1.00 52.41 ? 154 ARG A HA   1  
ATOM 2432   H HB2  . ARG A 1 154 ? 3.845   7.626   25.952  1.00 53.13 ? 154 ARG A HB2  1  
ATOM 2433   H HB3  . ARG A 1 154 ? 4.690   6.329   25.106  1.00 70.42 ? 154 ARG A HB3  1  
ATOM 2434   H HG2  . ARG A 1 154 ? 6.093   5.885   27.022  1.00 71.41 ? 154 ARG A HG2  1  
ATOM 2435   H HG3  . ARG A 1 154 ? 5.541   7.345   27.842  1.00 22.02 ? 154 ARG A HG3  1  
ATOM 2436   H HD2  . ARG A 1 154 ? 3.960   4.820   27.308  1.00 2.43  ? 154 ARG A HD2  1  
ATOM 2437   H HD3  . ARG A 1 154 ? 4.466   5.456   28.875  1.00 53.42 ? 154 ARG A HD3  1  
ATOM 2438   H HE   . ARG A 1 154 ? 2.457   6.747   27.109  1.00 44.51 ? 154 ARG A HE   1  
ATOM 2439   H HH11 . ARG A 1 154 ? 3.538   5.948   30.365  1.00 45.32 ? 154 ARG A HH11 1  
ATOM 2440   H HH12 . ARG A 1 154 ? 2.169   6.705   31.110  1.00 2.25  ? 154 ARG A HH12 1  
ATOM 2441   H HH21 . ARG A 1 154 ? 0.695   7.704   28.116  1.00 43.41 ? 154 ARG A HH21 1  
ATOM 2442   H HH22 . ARG A 1 154 ? 0.569   7.692   29.846  1.00 64.24 ? 154 ARG A HH22 1  
ATOM 2443   N N    . GLU A 1 155 ? 5.283   8.338   22.848  1.00 72.32 ? 155 GLU A N    1  
ATOM 2444   C CA   . GLU A 1 155 ? 4.799   8.961   21.584  1.00 71.35 ? 155 GLU A CA   1  
ATOM 2445   C C    . GLU A 1 155 ? 3.360   9.516   21.714  1.00 32.32 ? 155 GLU A C    1  
ATOM 2446   O O    . GLU A 1 155 ? 2.453   8.824   22.206  1.00 11.24 ? 155 GLU A O    1  
ATOM 2447   C CB   . GLU A 1 155 ? 4.871   7.928   20.424  1.00 24.02 ? 155 GLU A CB   1  
ATOM 2448   C CG   . GLU A 1 155 ? 4.259   8.364   19.075  1.00 3.31  ? 155 GLU A CG   1  
ATOM 2449   C CD   . GLU A 1 155 ? 4.881   9.639   18.480  1.00 42.24 ? 155 GLU A CD   1  
ATOM 2450   O OE1  . GLU A 1 155 ? 4.194   10.683  18.451  1.00 62.44 ? 155 GLU A OE1  1  
ATOM 2451   O OE2  . GLU A 1 155 ? 6.059   9.597   18.058  1.00 43.25 ? 155 GLU A OE2  1  
ATOM 2452   H H    . GLU A 1 155 ? 5.675   7.446   22.796  1.00 23.21 ? 155 GLU A H    1  
ATOM 2453   H HA   . GLU A 1 155 ? 5.474   9.779   21.357  1.00 11.33 ? 155 GLU A HA   1  
ATOM 2454   H HB2  . GLU A 1 155 ? 5.911   7.677   20.249  1.00 15.42 ? 155 GLU A HB2  1  
ATOM 2455   H HB3  . GLU A 1 155 ? 4.361   7.023   20.742  1.00 55.43 ? 155 GLU A HB3  1  
ATOM 2456   H HG2  . GLU A 1 155 ? 4.393   7.557   18.365  1.00 31.44 ? 155 GLU A HG2  1  
ATOM 2457   H HG3  . GLU A 1 155 ? 3.194   8.520   19.222  1.00 52.40 ? 155 GLU A HG3  1  
ATOM 2458   N N    . GLY A 1 156 ? 3.186   10.781  21.286  1.00 14.02 ? 156 GLY A N    1  
ATOM 2459   C CA   . GLY A 1 156 ? 1.878   11.438  21.283  1.00 14.21 ? 156 GLY A CA   1  
ATOM 2460   C C    . GLY A 1 156 ? 1.555   12.178  22.570  1.00 11.23 ? 156 GLY A C    1  
ATOM 2461   O O    . GLY A 1 156 ? 0.467   12.750  22.680  1.00 3.55  ? 156 GLY A O    1  
ATOM 2462   H H    . GLY A 1 156 ? 3.973   11.276  20.946  1.00 74.33 ? 156 GLY A H    1  
ATOM 2463   H HA2  . GLY A 1 156 ? 1.863   12.152  20.472  1.00 12.15 ? 156 GLY A HA2  1  
ATOM 2464   H HA3  . GLY A 1 156 ? 1.102   10.700  21.098  1.00 14.04 ? 156 GLY A HA3  1  
ATOM 2465   N N    . SER A 1 157 ? 2.478   12.159  23.553  1.00 23.45 ? 157 SER A N    1  
ATOM 2466   C CA   . SER A 1 157 ? 2.327   12.938  24.796  1.00 25.04 ? 157 SER A CA   1  
ATOM 2467   C C    . SER A 1 157 ? 2.415   14.447  24.481  1.00 73.14 ? 157 SER A C    1  
ATOM 2468   O O    . SER A 1 157 ? 3.453   14.932  24.015  1.00 74.23 ? 157 SER A O    1  
ATOM 2469   C CB   . SER A 1 157 ? 3.392   12.521  25.833  1.00 61.23 ? 157 SER A CB   1  
ATOM 2470   O OG   . SER A 1 157 ? 3.156   11.200  26.319  1.00 24.21 ? 157 SER A OG   1  
ATOM 2471   H H    . SER A 1 157 ? 3.283   11.612  23.434  1.00 35.45 ? 157 SER A H    1  
ATOM 2472   H HA   . SER A 1 157 ? 1.342   12.718  25.201  1.00 5.12  ? 157 SER A HA   1  
ATOM 2473   H HB2  . SER A 1 157 ? 4.368   12.540  25.369  1.00 42.14 ? 157 SER A HB2  1  
ATOM 2474   H HB3  . SER A 1 157 ? 3.389   13.208  26.666  1.00 5.03  ? 157 SER A HB3  1  
ATOM 2475   H HG   . SER A 1 157 ? 3.054   10.598  25.572  1.00 3.44  ? 157 SER A HG   1  
ATOM 2476   N N    . VAL A 1 158 ? 1.297   15.155  24.713  1.00 22.15 ? 158 VAL A N    1  
ATOM 2477   C CA   . VAL A 1 158 ? 1.137   16.574  24.380  1.00 72.34 ? 158 VAL A CA   1  
ATOM 2478   C C    . VAL A 1 158 ? 1.437   17.447  25.613  1.00 1.44  ? 158 VAL A C    1  
ATOM 2479   O O    . VAL A 1 158 ? 0.650   17.476  26.565  1.00 24.45 ? 158 VAL A O    1  
ATOM 2480   C CB   . VAL A 1 158 ? -0.319  16.848  23.844  1.00 63.34 ? 158 VAL A CB   1  
ATOM 2481   C CG1  . VAL A 1 158 ? -0.536  18.339  23.510  1.00 21.15 ? 158 VAL A CG1  1  
ATOM 2482   C CG2  . VAL A 1 158 ? -0.625  15.948  22.619  1.00 70.33 ? 158 VAL A CG2  1  
ATOM 2483   H H    . VAL A 1 158 ? 0.541   14.698  25.137  1.00 62.12 ? 158 VAL A H    1  
ATOM 2484   H HA   . VAL A 1 158 ? 1.841   16.827  23.584  1.00 22.02 ? 158 VAL A HA   1  
ATOM 2485   H HB   . VAL A 1 158 ? -1.019  16.580  24.633  1.00 1.53  ? 158 VAL A HB   1  
ATOM 2486   H HG11 . VAL A 1 158 ? -0.381  18.936  24.399  1.00 51.42 ? 158 VAL A HG11 1  
ATOM 2487   H HG12 . VAL A 1 158 ? -1.545  18.495  23.151  1.00 74.02 ? 158 VAL A HG12 1  
ATOM 2488   H HG13 . VAL A 1 158 ? 0.167   18.650  22.745  1.00 44.34 ? 158 VAL A HG13 1  
ATOM 2489   H HG21 . VAL A 1 158 ? -1.632  16.129  22.268  1.00 10.33 ? 158 VAL A HG21 1  
ATOM 2490   H HG22 . VAL A 1 158 ? -0.530  14.907  22.900  1.00 51.33 ? 158 VAL A HG22 1  
ATOM 2491   H HG23 . VAL A 1 158 ? 0.078   16.161  21.822  1.00 44.51 ? 158 VAL A HG23 1  
ATOM 2492   N N    . ILE A 1 159 ? 2.604   18.112  25.605  1.00 5.23  ? 159 ILE A N    1  
ATOM 2493   C CA   . ILE A 1 159 ? 2.964   19.106  26.626  1.00 75.24 ? 159 ILE A CA   1  
ATOM 2494   C C    . ILE A 1 159 ? 2.425   20.478  26.175  1.00 51.53 ? 159 ILE A C    1  
ATOM 2495   O O    . ILE A 1 159 ? 3.005   21.117  25.287  1.00 74.41 ? 159 ILE A O    1  
ATOM 2496   C CB   . ILE A 1 159 ? 4.529   19.191  26.851  1.00 14.31 ? 159 ILE A CB   1  
ATOM 2497   C CG1  . ILE A 1 159 ? 5.140   17.778  27.145  1.00 12.12 ? 159 ILE A CG1  1  
ATOM 2498   C CG2  . ILE A 1 159 ? 4.870   20.192  27.989  1.00 15.15 ? 159 ILE A CG2  1  
ATOM 2499   C CD1  . ILE A 1 159 ? 6.662   17.753  27.256  1.00 33.51 ? 159 ILE A CD1  1  
ATOM 2500   H H    . ILE A 1 159 ? 3.244   17.926  24.886  1.00 74.11 ? 159 ILE A H    1  
ATOM 2501   H HA   . ILE A 1 159 ? 2.493   18.826  27.569  1.00 14.04 ? 159 ILE A HA   1  
ATOM 2502   H HB   . ILE A 1 159 ? 4.971   19.574  25.931  1.00 71.13 ? 159 ILE A HB   1  
ATOM 2503   H HG12 . ILE A 1 159 ? 4.744   17.403  28.079  1.00 10.33 ? 159 ILE A HG12 1  
ATOM 2504   H HG13 . ILE A 1 159 ? 4.859   17.096  26.350  1.00 22.20 ? 159 ILE A HG13 1  
ATOM 2505   H HG21 . ILE A 1 159 ? 5.943   20.245  28.123  1.00 13.14 ? 159 ILE A HG21 1  
ATOM 2506   H HG22 . ILE A 1 159 ? 4.412   19.867  28.916  1.00 72.32 ? 159 ILE A HG22 1  
ATOM 2507   H HG23 . ILE A 1 159 ? 4.496   21.176  27.736  1.00 40.30 ? 159 ILE A HG23 1  
ATOM 2508   H HD11 . ILE A 1 159 ? 6.979   18.398  28.064  1.00 3.03  ? 159 ILE A HD11 1  
ATOM 2509   H HD12 . ILE A 1 159 ? 7.105   18.095  26.330  1.00 74.23 ? 159 ILE A HD12 1  
ATOM 2510   H HD13 . ILE A 1 159 ? 6.989   16.743  27.456  1.00 1.21  ? 159 ILE A HD13 1  
ATOM 2511   N N    . ARG A 1 160 ? 1.280   20.901  26.746  1.00 0.35  ? 160 ARG A N    1  
ATOM 2512   C CA   . ARG A 1 160 ? 0.699   22.220  26.455  1.00 22.04 ? 160 ARG A CA   1  
ATOM 2513   C C    . ARG A 1 160 ? 1.515   23.306  27.182  1.00 25.22 ? 160 ARG A C    1  
ATOM 2514   O O    . ARG A 1 160 ? 1.365   23.511  28.391  1.00 34.42 ? 160 ARG A O    1  
ATOM 2515   C CB   . ARG A 1 160 ? -0.793  22.279  26.879  1.00 60.14 ? 160 ARG A CB   1  
ATOM 2516   C CG   . ARG A 1 160 ? -1.519  23.586  26.467  1.00 54.45 ? 160 ARG A CG   1  
ATOM 2517   C CD   . ARG A 1 160 ? -2.950  23.677  27.030  1.00 1.53  ? 160 ARG A CD   1  
ATOM 2518   N NE   . ARG A 1 160 ? -3.700  24.849  26.532  1.00 61.32 ? 160 ARG A NE   1  
ATOM 2519   C CZ   . ARG A 1 160 ? -3.480  26.130  26.874  1.00 1.33  ? 160 ARG A CZ   1  
ATOM 2520   N NH1  . ARG A 1 160 ? -2.515  26.473  27.724  1.00 35.43 ? 160 ARG A NH1  1  
ATOM 2521   N NH2  . ARG A 1 160 ? -4.251  27.078  26.366  1.00 42.02 ? 160 ARG A NH2  1  
ATOM 2522   H H    . ARG A 1 160 ? 0.822   20.311  27.375  1.00 75.21 ? 160 ARG A H    1  
ATOM 2523   H HA   . ARG A 1 160 ? 0.762   22.385  25.380  1.00 20.32 ? 160 ARG A HA   1  
ATOM 2524   H HB2  . ARG A 1 160 ? -1.313  21.442  26.424  1.00 13.22 ? 160 ARG A HB2  1  
ATOM 2525   H HB3  . ARG A 1 160 ? -0.855  22.175  27.959  1.00 62.11 ? 160 ARG A HB3  1  
ATOM 2526   H HG2  . ARG A 1 160 ? -0.951  24.432  26.835  1.00 3.33  ? 160 ARG A HG2  1  
ATOM 2527   H HG3  . ARG A 1 160 ? -1.564  23.633  25.386  1.00 40.00 ? 160 ARG A HG3  1  
ATOM 2528   H HD2  . ARG A 1 160 ? -3.494  22.785  26.745  1.00 71.55 ? 160 ARG A HD2  1  
ATOM 2529   H HD3  . ARG A 1 160 ? -2.903  23.723  28.115  1.00 40.42 ? 160 ARG A HD3  1  
ATOM 2530   H HE   . ARG A 1 160 ? -4.420  24.663  25.890  1.00 20.12 ? 160 ARG A HE   1  
ATOM 2531   H HH11 . ARG A 1 160 ? -1.924  25.773  28.131  1.00 61.21 ? 160 ARG A HH11 1  
ATOM 2532   H HH12 . ARG A 1 160 ? -2.374  27.439  27.959  1.00 72.24 ? 160 ARG A HH12 1  
ATOM 2533   H HH21 . ARG A 1 160 ? -4.989  26.844  25.732  1.00 61.23 ? 160 ARG A HH21 1  
ATOM 2534   H HH22 . ARG A 1 160 ? -4.095  28.042  26.614  1.00 5.24  ? 160 ARG A HH22 1  
ATOM 2535   N N    . VAL A 1 161 ? 2.395   23.968  26.424  1.00 40.41 ? 161 VAL A N    1  
ATOM 2536   C CA   . VAL A 1 161 ? 3.294   25.008  26.933  1.00 54.30 ? 161 VAL A CA   1  
ATOM 2537   C C    . VAL A 1 161 ? 3.105   26.299  26.104  1.00 11.03 ? 161 VAL A C    1  
ATOM 2538   O O    . VAL A 1 161 ? 3.322   26.289  24.887  1.00 14.44 ? 161 VAL A O    1  
ATOM 2539   C CB   . VAL A 1 161 ? 4.800   24.512  26.894  1.00 61.33 ? 161 VAL A CB   1  
ATOM 2540   C CG1  . VAL A 1 161 ? 5.206   24.011  25.486  1.00 34.10 ? 161 VAL A CG1  1  
ATOM 2541   C CG2  . VAL A 1 161 ? 5.783   25.601  27.396  1.00 43.21 ? 161 VAL A CG2  1  
ATOM 2542   H H    . VAL A 1 161 ? 2.439   23.750  25.469  1.00 13.43 ? 161 VAL A H    1  
ATOM 2543   H HA   . VAL A 1 161 ? 3.035   25.213  27.972  1.00 30.24 ? 161 VAL A HA   1  
ATOM 2544   H HB   . VAL A 1 161 ? 4.876   23.662  27.569  1.00 51.20 ? 161 VAL A HB   1  
ATOM 2545   H HG11 . VAL A 1 161 ? 4.542   23.212  25.177  1.00 71.41 ? 161 VAL A HG11 1  
ATOM 2546   H HG12 . VAL A 1 161 ? 6.221   23.638  25.506  1.00 33.32 ? 161 VAL A HG12 1  
ATOM 2547   H HG13 . VAL A 1 161 ? 5.141   24.826  24.773  1.00 14.22 ? 161 VAL A HG13 1  
ATOM 2548   H HG21 . VAL A 1 161 ? 5.725   26.474  26.751  1.00 64.00 ? 161 VAL A HG21 1  
ATOM 2549   H HG22 . VAL A 1 161 ? 6.797   25.219  27.371  1.00 21.24 ? 161 VAL A HG22 1  
ATOM 2550   H HG23 . VAL A 1 161 ? 5.534   25.884  28.409  1.00 3.51  ? 161 VAL A HG23 1  
ATOM 2551   N N    . PRO A 1 162 ? 2.649   27.433  26.726  1.00 74.53 ? 162 PRO A N    1  
ATOM 2552   C CA   . PRO A 1 162 ? 2.662   28.744  26.045  1.00 72.13 ? 162 PRO A CA   1  
ATOM 2553   C C    . PRO A 1 162 ? 4.112   29.216  25.813  1.00 41.21 ? 162 PRO A C    1  
ATOM 2554   O O    . PRO A 1 162 ? 5.008   28.876  26.594  1.00 71.40 ? 162 PRO A O    1  
ATOM 2555   C CB   . PRO A 1 162 ? 1.888   29.667  27.017  1.00 42.30 ? 162 PRO A CB   1  
ATOM 2556   C CG   . PRO A 1 162 ? 2.024   29.019  28.362  1.00 60.52 ? 162 PRO A CG   1  
ATOM 2557   C CD   . PRO A 1 162 ? 2.071   27.527  28.097  1.00 3.32  ? 162 PRO A CD   1  
ATOM 2558   H HA   . PRO A 1 162 ? 2.141   28.698  25.090  1.00 43.12 ? 162 PRO A HA   1  
ATOM 2559   H HB2  . PRO A 1 162 ? 2.314   30.670  27.018  1.00 71.24 ? 162 PRO A HB2  1  
ATOM 2560   H HB3  . PRO A 1 162 ? 0.841   29.718  26.734  1.00 12.31 ? 162 PRO A HB3  1  
ATOM 2561   H HG2  . PRO A 1 162 ? 2.943   29.354  28.843  1.00 20.53 ? 162 PRO A HG2  1  
ATOM 2562   H HG3  . PRO A 1 162 ? 1.172   29.262  28.984  1.00 53.24 ? 162 PRO A HG3  1  
ATOM 2563   H HD2  . PRO A 1 162 ? 2.711   27.032  28.821  1.00 64.22 ? 162 PRO A HD2  1  
ATOM 2564   H HD3  . PRO A 1 162 ? 1.076   27.098  28.126  1.00 64.04 ? 162 PRO A HD3  1  
ATOM 2565   N N    . GLY A 1 163 ? 4.354   29.947  24.715  1.00 70.43 ? 163 GLY A N    1  
ATOM 2566   C CA   . GLY A 1 163 ? 5.675   30.532  24.465  1.00 5.00  ? 163 GLY A CA   1  
ATOM 2567   C C    . GLY A 1 163 ? 6.309   30.156  23.134  1.00 21.01 ? 163 GLY A C    1  
ATOM 2568   O O    . GLY A 1 163 ? 7.235   30.838  22.680  1.00 32.20 ? 163 GLY A O    1  
ATOM 2569   H H    . GLY A 1 163 ? 3.630   30.097  24.071  1.00 5.52  ? 163 GLY A H    1  
ATOM 2570   H HA2  . GLY A 1 163 ? 5.572   31.606  24.497  1.00 2.12  ? 163 GLY A HA2  1  
ATOM 2571   H HA3  . GLY A 1 163 ? 6.358   30.244  25.261  1.00 62.54 ? 163 GLY A HA3  1  
ATOM 2572   N N    . MET A 1 164 ? 5.847   29.059  22.510  1.00 14.10 ? 164 MET A N    1  
ATOM 2573   C CA   . MET A 1 164 ? 6.417   28.575  21.219  1.00 15.25 ? 164 MET A CA   1  
ATOM 2574   C C    . MET A 1 164 ? 5.327   28.445  20.125  1.00 4.32  ? 164 MET A C    1  
ATOM 2575   O O    . MET A 1 164 ? 5.603   27.905  19.052  1.00 64.15 ? 164 MET A O    1  
ATOM 2576   C CB   . MET A 1 164 ? 7.161   27.211  21.422  1.00 51.45 ? 164 MET A CB   1  
ATOM 2577   C CG   . MET A 1 164 ? 8.568   27.267  22.055  1.00 44.54 ? 164 MET A CG   1  
ATOM 2578   S SD   . MET A 1 164 ? 8.600   27.965  23.705  1.00 32.24 ? 164 MET A SD   1  
ATOM 2579   C CE   . MET A 1 164 ? 7.639   26.772  24.622  1.00 2.04  ? 164 MET A CE   1  
ATOM 2580   H H    . MET A 1 164 ? 5.116   28.554  22.924  1.00 14.14 ? 164 MET A H    1  
ATOM 2581   H HA   . MET A 1 164 ? 7.138   29.314  20.869  1.00 51.13 ? 164 MET A HA   1  
ATOM 2582   H HB2  . MET A 1 164 ? 6.546   26.581  22.052  1.00 41.42 ? 164 MET A HB2  1  
ATOM 2583   H HB3  . MET A 1 164 ? 7.259   26.719  20.456  1.00 3.40  ? 164 MET A HB3  1  
ATOM 2584   H HG2  . MET A 1 164 ? 8.953   26.258  22.128  1.00 1.23  ? 164 MET A HG2  1  
ATOM 2585   H HG3  . MET A 1 164 ? 9.218   27.851  21.422  1.00 52.23 ? 164 MET A HG3  1  
ATOM 2586   H HE1  . MET A 1 164 ? 7.595   27.067  25.662  1.00 2.20  ? 164 MET A HE1  1  
ATOM 2587   H HE2  . MET A 1 164 ? 8.101   25.800  24.549  1.00 14.34 ? 164 MET A HE2  1  
ATOM 2588   H HE3  . MET A 1 164 ? 6.636   26.728  24.218  1.00 61.02 ? 164 MET A HE3  1  
ATOM 2589   N N    . GLY A 1 165 ? 4.102   28.938  20.393  1.00 22.51 ? 165 GLY A N    1  
ATOM 2590   C CA   . GLY A 1 165 ? 2.993   28.860  19.421  1.00 73.33 ? 165 GLY A CA   1  
ATOM 2591   C C    . GLY A 1 165 ? 2.951   30.042  18.456  1.00 32.41 ? 165 GLY A C    1  
ATOM 2592   O O    . GLY A 1 165 ? 3.949   30.323  17.775  1.00 32.24 ? 165 GLY A O    1  
ATOM 2593   H H    . GLY A 1 165 ? 3.947   29.365  21.259  1.00 61.40 ? 165 GLY A H    1  
ATOM 2594   H HA2  . GLY A 1 165 ? 3.075   27.946  18.845  1.00 1.11  ? 165 GLY A HA2  1  
ATOM 2595   H HA3  . GLY A 1 165 ? 2.060   28.826  19.973  1.00 10.21 ? 165 GLY A HA3  1  
ATOM 2596   N N    . GLY A 1 166 ? 1.777   30.718  18.378  1.00 5.42  ? 166 GLY A N    1  
ATOM 2597   C CA   . GLY A 1 166 ? 1.620   31.924  17.577  1.00 13.23 ? 166 GLY A CA   1  
ATOM 2598   C C    . GLY A 1 166 ? 2.508   33.065  18.053  1.00 33.33 ? 166 GLY A C    1  
ATOM 2599   O O    . GLY A 1 166 ? 2.870   33.130  19.237  1.00 74.50 ? 166 GLY A O    1  
ATOM 2600   H H    . GLY A 1 166 ? 1.001   30.379  18.869  1.00 22.23 ? 166 GLY A H    1  
ATOM 2601   H HA2  . GLY A 1 166 ? 1.853   31.690  16.543  1.00 21.52 ? 166 GLY A HA2  1  
ATOM 2602   H HA3  . GLY A 1 166 ? 0.589   32.242  17.638  1.00 23.12 ? 166 GLY A HA3  1  
ATOM 2603   N N    . GLN A 1 167 ? 2.846   33.962  17.128  1.00 61.11 ? 167 GLN A N    1  
ATOM 2604   C CA   . GLN A 1 167 ? 3.799   35.053  17.377  1.00 62.24 ? 167 GLN A CA   1  
ATOM 2605   C C    . GLN A 1 167 ? 3.194   36.106  18.330  1.00 13.51 ? 167 GLN A C    1  
ATOM 2606   O O    . GLN A 1 167 ? 2.135   36.649  18.042  1.00 52.33 ? 167 GLN A O    1  
ATOM 2607   C CB   . GLN A 1 167 ? 4.220   35.689  16.026  1.00 21.41 ? 167 GLN A CB   1  
ATOM 2608   C CG   . GLN A 1 167 ? 4.826   34.699  15.011  1.00 75.42 ? 167 GLN A CG   1  
ATOM 2609   C CD   . GLN A 1 167 ? 5.996   33.882  15.572  1.00 54.12 ? 167 GLN A CD   1  
ATOM 2610   O OE1  . GLN A 1 167 ? 7.145   34.322  15.536  1.00 40.01 ? 167 GLN A OE1  1  
ATOM 2611   N NE2  . GLN A 1 167 ? 5.716   32.678  16.064  1.00 31.14 ? 167 GLN A NE2  1  
ATOM 2612   H H    . GLN A 1 167 ? 2.438   33.888  16.239  1.00 62.03 ? 167 GLN A H    1  
ATOM 2613   H HA   . GLN A 1 167 ? 4.681   34.621  17.840  1.00 4.22  ? 167 GLN A HA   1  
ATOM 2614   H HB2  . GLN A 1 167 ? 3.350   36.152  15.568  1.00 2.53  ? 167 GLN A HB2  1  
ATOM 2615   H HB3  . GLN A 1 167 ? 4.955   36.464  16.221  1.00 42.42 ? 167 GLN A HB3  1  
ATOM 2616   H HG2  . GLN A 1 167 ? 4.048   34.014  14.691  1.00 54.24 ? 167 GLN A HG2  1  
ATOM 2617   H HG3  . GLN A 1 167 ? 5.174   35.256  14.146  1.00 64.11 ? 167 GLN A HG3  1  
ATOM 2618   H HE21 . GLN A 1 167 ? 4.783   32.372  16.042  1.00 55.24 ? 167 GLN A HE21 1  
ATOM 2619   H HE22 . GLN A 1 167 ? 6.449   32.148  16.435  1.00 62.30 ? 167 GLN A HE22 1  
ATOM 2620   N N    . GLY A 1 168 ? 3.880   36.364  19.458  1.00 34.04 ? 168 GLY A N    1  
ATOM 2621   C CA   . GLY A 1 168 ? 3.428   37.335  20.462  1.00 3.33  ? 168 GLY A CA   1  
ATOM 2622   C C    . GLY A 1 168 ? 4.459   37.522  21.562  1.00 64.21 ? 168 GLY A C    1  
ATOM 2623   O O    . GLY A 1 168 ? 5.415   36.756  21.627  1.00 4.53  ? 168 GLY A O    1  
ATOM 2624   H H    . GLY A 1 168 ? 4.725   35.883  19.616  1.00 61.11 ? 168 GLY A H    1  
ATOM 2625   H HA2  . GLY A 1 168 ? 3.254   38.288  19.980  1.00 62.10 ? 168 GLY A HA2  1  
ATOM 2626   H HA3  . GLY A 1 168 ? 2.505   36.987  20.907  1.00 54.01 ? 168 GLY A HA3  1  
ATOM 2627   N N    . ASN A 1 169 ? 4.309   38.564  22.410  1.00 63.11 ? 169 ASN A N    1  
ATOM 2628   C CA   . ASN A 1 169 ? 5.198   38.755  23.576  1.00 0.12  ? 169 ASN A CA   1  
ATOM 2629   C C    . ASN A 1 169 ? 4.928   37.679  24.631  1.00 23.21 ? 169 ASN A C    1  
ATOM 2630   O O    . ASN A 1 169 ? 5.882   37.062  25.092  1.00 3.41  ? 169 ASN A O    1  
ATOM 2631   C CB   . ASN A 1 169 ? 5.132   40.185  24.160  1.00 44.40 ? 169 ASN A CB   1  
ATOM 2632   C CG   . ASN A 1 169 ? 6.052   40.440  25.366  1.00 40.14 ? 169 ASN A CG   1  
ATOM 2633   O OD1  . ASN A 1 169 ? 5.717   41.221  26.245  1.00 51.24 ? 169 ASN A OD1  1  
ATOM 2634   N ND2  . ASN A 1 169 ? 7.232   39.835  25.392  1.00 40.33 ? 169 ASN A ND2  1  
ATOM 2635   H H    . ASN A 1 169 ? 3.595   39.211  22.249  1.00 33.22 ? 169 ASN A H    1  
ATOM 2636   H HA   . ASN A 1 169 ? 6.210   38.599  23.206  1.00 41.01 ? 169 ASN A HA   1  
ATOM 2637   H HB2  . ASN A 1 169 ? 5.417   40.884  23.383  1.00 50.42 ? 169 ASN A HB2  1  
ATOM 2638   H HB3  . ASN A 1 169 ? 4.108   40.401  24.452  1.00 63.54 ? 169 ASN A HB3  1  
ATOM 2639   H HD21 . ASN A 1 169 ? 7.482   39.254  24.641  1.00 43.04 ? 169 ASN A HD21 1  
ATOM 2640   H HD22 . ASN A 1 169 ? 7.809   39.986  26.166  1.00 41.21 ? 169 ASN A HD22 1  
ATOM 2641   N N    . PRO A 1 170 ? 3.643   37.433  25.064  1.00 54.13 ? 170 PRO A N    1  
ATOM 2642   C CA   . PRO A 1 170 ? 3.284   36.186  25.729  1.00 63.23 ? 170 PRO A CA   1  
ATOM 2643   C C    . PRO A 1 170 ? 2.832   35.178  24.653  1.00 61.21 ? 170 PRO A C    1  
ATOM 2644   O O    . PRO A 1 170 ? 1.633   35.065  24.380  1.00 21.43 ? 170 PRO A O    1  
ATOM 2645   C CB   . PRO A 1 170 ? 2.148   36.599  26.704  1.00 42.52 ? 170 PRO A CB   1  
ATOM 2646   C CG   . PRO A 1 170 ? 1.765   38.016  26.335  1.00 71.13 ? 170 PRO A CG   1  
ATOM 2647   C CD   . PRO A 1 170 ? 2.466   38.333  25.032  1.00 44.43 ? 170 PRO A CD   1  
ATOM 2648   H HA   . PRO A 1 170 ? 4.123   35.768  26.282  1.00 43.42 ? 170 PRO A HA   1  
ATOM 2649   H HB2  . PRO A 1 170 ? 1.297   35.923  26.603  1.00 73.02 ? 170 PRO A HB2  1  
ATOM 2650   H HB3  . PRO A 1 170 ? 2.505   36.565  27.729  1.00 32.14 ? 170 PRO A HB3  1  
ATOM 2651   H HG2  . PRO A 1 170 ? 0.684   38.092  26.210  1.00 61.03 ? 170 PRO A HG2  1  
ATOM 2652   H HG3  . PRO A 1 170 ? 2.090   38.705  27.106  1.00 34.45 ? 170 PRO A HG3  1  
ATOM 2653   H HD2  . PRO A 1 170 ? 1.827   38.099  24.183  1.00 0.33  ? 170 PRO A HD2  1  
ATOM 2654   H HD3  . PRO A 1 170 ? 2.764   39.372  24.999  1.00 5.01  ? 170 PRO A HD3  1  
ATOM 2655   N N    . PRO A 1 171 ? 3.780   34.437  23.999  1.00 35.05 ? 171 PRO A N    1  
ATOM 2656   C CA   . PRO A 1 171 ? 3.500   33.727  22.739  1.00 71.25 ? 171 PRO A CA   1  
ATOM 2657   C C    . PRO A 1 171 ? 2.589   32.506  22.928  1.00 43.45 ? 171 PRO A C    1  
ATOM 2658   O O    . PRO A 1 171 ? 2.193   32.164  24.059  1.00 31.12 ? 171 PRO A O    1  
ATOM 2659   C CB   . PRO A 1 171 ? 4.913   33.364  22.181  1.00 4.12  ? 171 PRO A CB   1  
ATOM 2660   C CG   . PRO A 1 171 ? 5.892   34.024  23.114  1.00 32.23 ? 171 PRO A CG   1  
ATOM 2661   C CD   . PRO A 1 171 ? 5.167   34.166  24.433  1.00 62.44 ? 171 PRO A CD   1  
ATOM 2662   H HA   . PRO A 1 171 ? 3.012   34.402  22.037  1.00 21.42 ? 171 PRO A HA   1  
ATOM 2663   H HB2  . PRO A 1 171 ? 5.055   32.284  22.165  1.00 63.34 ? 171 PRO A HB2  1  
ATOM 2664   H HB3  . PRO A 1 171 ? 5.033   33.758  21.177  1.00 52.41 ? 171 PRO A HB3  1  
ATOM 2665   H HG2  . PRO A 1 171 ? 6.780   33.408  23.229  1.00 32.54 ? 171 PRO A HG2  1  
ATOM 2666   H HG3  . PRO A 1 171 ? 6.166   35.005  22.739  1.00 45.32 ? 171 PRO A HG3  1  
ATOM 2667   H HD2  . PRO A 1 171 ? 5.224   33.246  25.011  1.00 60.32 ? 171 PRO A HD2  1  
ATOM 2668   H HD3  . PRO A 1 171 ? 5.567   34.991  25.006  1.00 55.41 ? 171 PRO A HD3  1  
ATOM 2669   N N    . GLY A 1 172 ? 2.299   31.854  21.806  1.00 50.52 ? 172 GLY A N    1  
ATOM 2670   C CA   . GLY A 1 172 ? 1.186   30.935  21.701  1.00 4.12  ? 172 GLY A CA   1  
ATOM 2671   C C    . GLY A 1 172 ? 1.215   29.705  22.571  1.00 15.30 ? 172 GLY A C    1  
ATOM 2672   O O    . GLY A 1 172 ? 2.279   29.134  22.826  1.00 72.40 ? 172 GLY A O    1  
ATOM 2673   H H    . GLY A 1 172 ? 2.857   32.004  21.014  1.00 31.34 ? 172 GLY A H    1  
ATOM 2674   H HA2  . GLY A 1 172 ? 0.278   31.485  21.916  1.00 21.24 ? 172 GLY A HA2  1  
ATOM 2675   H HA3  . GLY A 1 172 ? 1.129   30.612  20.668  1.00 1.43  ? 172 GLY A HA3  1  
ATOM 2676   N N    . ASP A 1 173 ? 0.002   29.302  22.983  1.00 33.01 ? 173 ASP A N    1  
ATOM 2677   C CA   . ASP A 1 173 ? -0.257  28.092  23.754  1.00 25.11 ? 173 ASP A CA   1  
ATOM 2678   C C    . ASP A 1 173 ? -0.006  26.880  22.856  1.00 71.14 ? 173 ASP A C    1  
ATOM 2679   O O    . ASP A 1 173 ? -0.893  26.430  22.113  1.00 3.34  ? 173 ASP A O    1  
ATOM 2680   C CB   . ASP A 1 173 ? -1.711  28.124  24.295  1.00 5.22  ? 173 ASP A CB   1  
ATOM 2681   C CG   . ASP A 1 173 ? -1.977  29.331  25.220  1.00 23.13 ? 173 ASP A CG   1  
ATOM 2682   O OD1  . ASP A 1 173 ? -2.086  30.478  24.709  1.00 4.23  ? 173 ASP A OD1  1  
ATOM 2683   O OD2  . ASP A 1 173 ? -2.066  29.144  26.459  1.00 13.35 ? 173 ASP A OD2  1  
ATOM 2684   H H    . ASP A 1 173 ? -0.769  29.863  22.748  1.00 24.23 ? 173 ASP A H    1  
ATOM 2685   H HA   . ASP A 1 173 ? 0.435   28.067  24.595  1.00 22.53 ? 173 ASP A HA   1  
ATOM 2686   H HB2  . ASP A 1 173 ? -2.404  28.172  23.458  1.00 13.51 ? 173 ASP A HB2  1  
ATOM 2687   H HB3  . ASP A 1 173 ? -1.906  27.207  24.848  1.00 2.01  ? 173 ASP A HB3  1  
ATOM 2688   N N    . LEU A 1 174 ? 1.248   26.423  22.863  1.00 10.53 ? 174 LEU A N    1  
ATOM 2689   C CA   . LEU A 1 174 ? 1.713   25.368  21.968  1.00 52.42 ? 174 LEU A CA   1  
ATOM 2690   C C    . LEU A 1 174 ? 1.374   23.979  22.520  1.00 43.35 ? 174 LEU A C    1  
ATOM 2691   O O    . LEU A 1 174 ? 1.330   23.776  23.729  1.00 22.21 ? 174 LEU A O    1  
ATOM 2692   C CB   . LEU A 1 174 ? 3.237   25.473  21.739  1.00 64.32 ? 174 LEU A CB   1  
ATOM 2693   C CG   . LEU A 1 174 ? 3.777   24.552  20.608  1.00 32.23 ? 174 LEU A CG   1  
ATOM 2694   C CD1  . LEU A 1 174 ? 3.320   25.052  19.227  1.00 23.33 ? 174 LEU A CD1  1  
ATOM 2695   C CD2  . LEU A 1 174 ? 5.295   24.400  20.676  1.00 2.31  ? 174 LEU A CD2  1  
ATOM 2696   H H    . LEU A 1 174 ? 1.884   26.814  23.496  1.00 34.14 ? 174 LEU A H    1  
ATOM 2697   H HA   . LEU A 1 174 ? 1.209   25.500  21.011  1.00 63.34 ? 174 LEU A HA   1  
ATOM 2698   H HB2  . LEU A 1 174 ? 3.485   26.505  21.500  1.00 72.15 ? 174 LEU A HB2  1  
ATOM 2699   H HB3  . LEU A 1 174 ? 3.742   25.213  22.665  1.00 32.22 ? 174 LEU A HB3  1  
ATOM 2700   H HG   . LEU A 1 174 ? 3.349   23.563  20.740  1.00 14.41 ? 174 LEU A HG   1  
ATOM 2701   H HD11 . LEU A 1 174 ? 2.239   25.095  19.193  1.00 12.53 ? 174 LEU A HD11 1  
ATOM 2702   H HD12 . LEU A 1 174 ? 3.665   24.373  18.462  1.00 72.02 ? 174 LEU A HD12 1  
ATOM 2703   H HD13 . LEU A 1 174 ? 3.724   26.040  19.037  1.00 1.53  ? 174 LEU A HD13 1  
ATOM 2704   H HD21 . LEU A 1 174 ? 5.586   24.081  21.671  1.00 12.32 ? 174 LEU A HD21 1  
ATOM 2705   H HD22 . LEU A 1 174 ? 5.771   25.341  20.448  1.00 73.24 ? 174 LEU A HD22 1  
ATOM 2706   H HD23 . LEU A 1 174 ? 5.615   23.655  19.962  1.00 74.20 ? 174 LEU A HD23 1  
ATOM 2707   N N    . LEU A 1 175 ? 1.149   23.034  21.604  1.00 20.54 ? 175 LEU A N    1  
ATOM 2708   C CA   . LEU A 1 175 ? 0.932   21.628  21.919  1.00 31.20 ? 175 LEU A CA   1  
ATOM 2709   C C    . LEU A 1 175 ? 2.152   20.820  21.431  1.00 53.43 ? 175 LEU A C    1  
ATOM 2710   O O    . LEU A 1 175 ? 2.251   20.514  20.235  1.00 25.43 ? 175 LEU A O    1  
ATOM 2711   C CB   . LEU A 1 175 ? -0.377  21.146  21.233  1.00 54.44 ? 175 LEU A CB   1  
ATOM 2712   C CG   . LEU A 1 175 ? -1.677  21.945  21.582  1.00 41.13 ? 175 LEU A CG   1  
ATOM 2713   C CD1  . LEU A 1 175 ? -2.896  21.402  20.798  1.00 72.12 ? 175 LEU A CD1  1  
ATOM 2714   C CD2  . LEU A 1 175 ? -1.943  21.948  23.107  1.00 50.11 ? 175 LEU A CD2  1  
ATOM 2715   H H    . LEU A 1 175 ? 1.124   23.301  20.666  1.00 53.43 ? 175 LEU A H    1  
ATOM 2716   H HA   . LEU A 1 175 ? 0.834   21.510  22.998  1.00 51.54 ? 175 LEU A HA   1  
ATOM 2717   H HB2  . LEU A 1 175 ? -0.230  21.198  20.158  1.00 54.35 ? 175 LEU A HB2  1  
ATOM 2718   H HB3  . LEU A 1 175 ? -0.537  20.107  21.498  1.00 43.04 ? 175 LEU A HB3  1  
ATOM 2719   H HG   . LEU A 1 175 ? -1.537  22.977  21.277  1.00 20.54 ? 175 LEU A HG   1  
ATOM 2720   H HD11 . LEU A 1 175 ? -3.066  20.363  21.050  1.00 21.34 ? 175 LEU A HD11 1  
ATOM 2721   H HD12 . LEU A 1 175 ? -2.711  21.482  19.734  1.00 52.41 ? 175 LEU A HD12 1  
ATOM 2722   H HD13 . LEU A 1 175 ? -3.779  21.979  21.043  1.00 31.41 ? 175 LEU A HD13 1  
ATOM 2723   H HD21 . LEU A 1 175 ? -1.112  22.416  23.622  1.00 3.31  ? 175 LEU A HD21 1  
ATOM 2724   H HD22 . LEU A 1 175 ? -2.058  20.935  23.465  1.00 25.20 ? 175 LEU A HD22 1  
ATOM 2725   H HD23 . LEU A 1 175 ? -2.846  22.508  23.320  1.00 50.11 ? 175 LEU A HD23 1  
ATOM 2726   N N    . LEU A 1 176 ? 3.113   20.552  22.346  1.00 43.52 ? 176 LEU A N    1  
ATOM 2727   C CA   . LEU A 1 176 ? 4.281   19.700  22.048  1.00 4.45  ? 176 LEU A CA   1  
ATOM 2728   C C    . LEU A 1 176 ? 3.838   18.234  21.920  1.00 31.11 ? 176 LEU A C    1  
ATOM 2729   O O    . LEU A 1 176 ? 3.777   17.523  22.921  1.00 70.05 ? 176 LEU A O    1  
ATOM 2730   C CB   . LEU A 1 176 ? 5.376   19.803  23.158  1.00 54.24 ? 176 LEU A CB   1  
ATOM 2731   C CG   . LEU A 1 176 ? 6.116   21.162  23.328  1.00 52.20 ? 176 LEU A CG   1  
ATOM 2732   C CD1  . LEU A 1 176 ? 7.102   21.108  24.518  1.00 4.03  ? 176 LEU A CD1  1  
ATOM 2733   C CD2  . LEU A 1 176 ? 6.849   21.569  22.038  1.00 2.22  ? 176 LEU A CD2  1  
ATOM 2734   H H    . LEU A 1 176 ? 3.030   20.940  23.240  1.00 52.41 ? 176 LEU A H    1  
ATOM 2735   H HA   . LEU A 1 176 ? 4.707   20.028  21.103  1.00 43.05 ? 176 LEU A HA   1  
ATOM 2736   H HB2  . LEU A 1 176 ? 4.903   19.566  24.105  1.00 22.11 ? 176 LEU A HB2  1  
ATOM 2737   H HB3  . LEU A 1 176 ? 6.126   19.039  22.963  1.00 51.31 ? 176 LEU A HB3  1  
ATOM 2738   H HG   . LEU A 1 176 ? 5.386   21.932  23.548  1.00 34.22 ? 176 LEU A HG   1  
ATOM 2739   H HD11 . LEU A 1 176 ? 7.860   20.352  24.342  1.00 25.10 ? 176 LEU A HD11 1  
ATOM 2740   H HD12 . LEU A 1 176 ? 6.564   20.866  25.425  1.00 32.54 ? 176 LEU A HD12 1  
ATOM 2741   H HD13 . LEU A 1 176 ? 7.581   22.071  24.642  1.00 73.52 ? 176 LEU A HD13 1  
ATOM 2742   H HD21 . LEU A 1 176 ? 7.585   20.821  21.773  1.00 72.32 ? 176 LEU A HD21 1  
ATOM 2743   H HD22 . LEU A 1 176 ? 7.343   22.522  22.183  1.00 62.04 ? 176 LEU A HD22 1  
ATOM 2744   H HD23 . LEU A 1 176 ? 6.135   21.670  21.229  1.00 74.52 ? 176 LEU A HD23 1  
ATOM 2745   N N    . VAL A 1 177 ? 3.522   17.791  20.696  1.00 4.35  ? 177 VAL A N    1  
ATOM 2746   C CA   . VAL A 1 177 ? 3.226   16.378  20.428  1.00 61.43 ? 177 VAL A CA   1  
ATOM 2747   C C    . VAL A 1 177 ? 4.570   15.667  20.251  1.00 0.14  ? 177 VAL A C    1  
ATOM 2748   O O    . VAL A 1 177 ? 5.225   15.806  19.205  1.00 33.53 ? 177 VAL A O    1  
ATOM 2749   C CB   . VAL A 1 177 ? 2.328   16.191  19.147  1.00 25.20 ? 177 VAL A CB   1  
ATOM 2750   C CG1  . VAL A 1 177 ? 2.019   14.697  18.894  1.00 4.33  ? 177 VAL A CG1  1  
ATOM 2751   C CG2  . VAL A 1 177 ? 1.028   17.021  19.259  1.00 11.31 ? 177 VAL A CG2  1  
ATOM 2752   H H    . VAL A 1 177 ? 3.482   18.430  19.954  1.00 33.12 ? 177 VAL A H    1  
ATOM 2753   H HA   . VAL A 1 177 ? 2.698   15.960  21.290  1.00 41.01 ? 177 VAL A HA   1  
ATOM 2754   H HB   . VAL A 1 177 ? 2.886   16.564  18.288  1.00 41.45 ? 177 VAL A HB   1  
ATOM 2755   H HG11 . VAL A 1 177 ? 1.408   14.593  18.006  1.00 15.01 ? 177 VAL A HG11 1  
ATOM 2756   H HG12 . VAL A 1 177 ? 1.487   14.279  19.742  1.00 62.14 ? 177 VAL A HG12 1  
ATOM 2757   H HG13 . VAL A 1 177 ? 2.943   14.152  18.754  1.00 2.24  ? 177 VAL A HG13 1  
ATOM 2758   H HG21 . VAL A 1 177 ? 0.443   16.911  18.355  1.00 45.33 ? 177 VAL A HG21 1  
ATOM 2759   H HG22 . VAL A 1 177 ? 1.272   18.066  19.397  1.00 34.33 ? 177 VAL A HG22 1  
ATOM 2760   H HG23 . VAL A 1 177 ? 0.443   16.680  20.105  1.00 71.11 ? 177 VAL A HG23 1  
ATOM 2761   N N    . VAL A 1 178 ? 5.007   14.979  21.322  1.00 30.54 ? 178 VAL A N    1  
ATOM 2762   C CA   . VAL A 1 178 ? 6.347   14.396  21.386  1.00 64.12 ? 178 VAL A CA   1  
ATOM 2763   C C    . VAL A 1 178 ? 6.509   13.267  20.340  1.00 35.53 ? 178 VAL A C    1  
ATOM 2764   O O    . VAL A 1 178 ? 5.800   12.252  20.354  1.00 30.14 ? 178 VAL A O    1  
ATOM 2765   C CB   . VAL A 1 178 ? 6.713   13.904  22.845  1.00 70.33 ? 178 VAL A CB   1  
ATOM 2766   C CG1  . VAL A 1 178 ? 5.945   12.639  23.265  1.00 42.11 ? 178 VAL A CG1  1  
ATOM 2767   C CG2  . VAL A 1 178 ? 8.233   13.708  23.003  1.00 42.11 ? 178 VAL A CG2  1  
ATOM 2768   H H    . VAL A 1 178 ? 4.409   14.875  22.094  1.00 34.11 ? 178 VAL A H    1  
ATOM 2769   H HA   . VAL A 1 178 ? 7.044   15.201  21.133  1.00 63.44 ? 178 VAL A HA   1  
ATOM 2770   H HB   . VAL A 1 178 ? 6.410   14.691  23.537  1.00 33.01 ? 178 VAL A HB   1  
ATOM 2771   H HG11 . VAL A 1 178 ? 4.879   12.818  23.193  1.00 12.20 ? 178 VAL A HG11 1  
ATOM 2772   H HG12 . VAL A 1 178 ? 6.191   12.382  24.287  1.00 44.43 ? 178 VAL A HG12 1  
ATOM 2773   H HG13 . VAL A 1 178 ? 6.214   11.812  22.615  1.00 74.13 ? 178 VAL A HG13 1  
ATOM 2774   H HG21 . VAL A 1 178 ? 8.746   14.639  22.797  1.00 1.20  ? 178 VAL A HG21 1  
ATOM 2775   H HG22 . VAL A 1 178 ? 8.582   12.949  22.313  1.00 12.22 ? 178 VAL A HG22 1  
ATOM 2776   H HG23 . VAL A 1 178 ? 8.457   13.398  24.017  1.00 24.41 ? 178 VAL A HG23 1  
ATOM 2777   N N    . ARG A 1 179 ? 7.381   13.536  19.366  1.00 15.21 ? 179 ARG A N    1  
ATOM 2778   C CA   . ARG A 1 179 ? 7.831   12.563  18.379  1.00 45.13 ? 179 ARG A CA   1  
ATOM 2779   C C    . ARG A 1 179 ? 9.220   12.118  18.806  1.00 23.44 ? 179 ARG A C    1  
ATOM 2780   O O    . ARG A 1 179 ? 10.155  12.896  18.696  1.00 12.42 ? 179 ARG A O    1  
ATOM 2781   C CB   . ARG A 1 179 ? 7.904   13.211  16.963  1.00 43.43 ? 179 ARG A CB   1  
ATOM 2782   C CG   . ARG A 1 179 ? 6.607   13.891  16.479  1.00 53.32 ? 179 ARG A CG   1  
ATOM 2783   C CD   . ARG A 1 179 ? 5.417   12.927  16.403  1.00 33.30 ? 179 ARG A CD   1  
ATOM 2784   N NE   . ARG A 1 179 ? 4.200   13.588  15.911  1.00 40.11 ? 179 ARG A NE   1  
ATOM 2785   C CZ   . ARG A 1 179 ? 2.987   13.022  15.827  1.00 0.33  ? 179 ARG A CZ   1  
ATOM 2786   N NH1  . ARG A 1 179 ? 2.797   11.765  16.212  1.00 33.33 ? 179 ARG A NH1  1  
ATOM 2787   N NH2  . ARG A 1 179 ? 1.972   13.738  15.357  1.00 11.25 ? 179 ARG A NH2  1  
ATOM 2788   H H    . ARG A 1 179 ? 7.748   14.441  19.314  1.00 14.02 ? 179 ARG A H    1  
ATOM 2789   H HA   . ARG A 1 179 ? 7.154   11.712  18.364  1.00 61.32 ? 179 ARG A HA   1  
ATOM 2790   H HB2  . ARG A 1 179 ? 8.686   13.965  16.966  1.00 42.11 ? 179 ARG A HB2  1  
ATOM 2791   H HB3  . ARG A 1 179 ? 8.175   12.444  16.241  1.00 32.04 ? 179 ARG A HB3  1  
ATOM 2792   H HG2  . ARG A 1 179 ? 6.358   14.699  17.159  1.00 24.42 ? 179 ARG A HG2  1  
ATOM 2793   H HG3  . ARG A 1 179 ? 6.785   14.308  15.492  1.00 55.13 ? 179 ARG A HG3  1  
ATOM 2794   H HD2  . ARG A 1 179 ? 5.668   12.114  15.732  1.00 71.14 ? 179 ARG A HD2  1  
ATOM 2795   H HD3  . ARG A 1 179 ? 5.224   12.527  17.392  1.00 64.20 ? 179 ARG A HD3  1  
ATOM 2796   H HE   . ARG A 1 179 ? 4.294   14.522  15.634  1.00 34.33 ? 179 ARG A HE   1  
ATOM 2797   H HH11 . ARG A 1 179 ? 3.570   11.228  16.577  1.00 11.22 ? 179 ARG A HH11 1  
ATOM 2798   H HH12 . ARG A 1 179 ? 1.890   11.345  16.152  1.00 73.42 ? 179 ARG A HH12 1  
ATOM 2799   H HH21 . ARG A 1 179 ? 2.126   14.691  15.066  1.00 12.44 ? 179 ARG A HH21 1  
ATOM 2800   H HH22 . ARG A 1 179 ? 1.057   13.338  15.282  1.00 13.14 ? 179 ARG A HH22 1  
ATOM 2801   N N    . LEU A 1 180 ? 9.374   10.905  19.332  1.00 62.01 ? 180 LEU A N    1  
ATOM 2802   C CA   . LEU A 1 180 ? 10.711  10.430  19.720  1.00 3.01  ? 180 LEU A CA   1  
ATOM 2803   C C    . LEU A 1 180 ? 11.564  10.169  18.456  1.00 0.20  ? 180 LEU A C    1  
ATOM 2804   O O    . LEU A 1 180 ? 11.024  9.726   17.434  1.00 54.34 ? 180 LEU A O    1  
ATOM 2805   C CB   . LEU A 1 180 ? 10.615  9.205   20.654  1.00 72.40 ? 180 LEU A CB   1  
ATOM 2806   C CG   . LEU A 1 180 ? 10.007  9.486   22.074  1.00 2.44  ? 180 LEU A CG   1  
ATOM 2807   C CD1  . LEU A 1 180 ? 10.147  8.267   22.995  1.00 41.22 ? 180 LEU A CD1  1  
ATOM 2808   C CD2  . LEU A 1 180 ? 10.639  10.727  22.737  1.00 30.12 ? 180 LEU A CD2  1  
ATOM 2809   H H    . LEU A 1 180 ? 8.590   10.321  19.452  1.00 32.44 ? 180 LEU A H    1  
ATOM 2810   H HA   . LEU A 1 180 ? 11.185  11.243  20.275  1.00 10.20 ? 180 LEU A HA   1  
ATOM 2811   H HB2  . LEU A 1 180 ? 10.002  8.455   20.166  1.00 24.10 ? 180 LEU A HB2  1  
ATOM 2812   H HB3  . LEU A 1 180 ? 11.611  8.800   20.785  1.00 24.23 ? 180 LEU A HB3  1  
ATOM 2813   H HG   . LEU A 1 180 ? 8.949   9.682   21.965  1.00 23.24 ? 180 LEU A HG   1  
ATOM 2814   H HD11 . LEU A 1 180 ? 9.702   8.480   23.958  1.00 33.12 ? 180 LEU A HD11 1  
ATOM 2815   H HD12 . LEU A 1 180 ? 11.195  8.021   23.132  1.00 74.04 ? 180 LEU A HD12 1  
ATOM 2816   H HD13 . LEU A 1 180 ? 9.640   7.420   22.553  1.00 51.13 ? 180 LEU A HD13 1  
ATOM 2817   H HD21 . LEU A 1 180 ? 11.712  10.598  22.829  1.00 50.11 ? 180 LEU A HD21 1  
ATOM 2818   H HD22 . LEU A 1 180 ? 10.214  10.873  23.723  1.00 41.25 ? 180 LEU A HD22 1  
ATOM 2819   H HD23 . LEU A 1 180 ? 10.434  11.604  22.137  1.00 73.24 ? 180 LEU A HD23 1  
ATOM 2820   N N    . LEU A 1 181 ? 12.886  10.481  18.549  1.00 4.42  ? 181 LEU A N    1  
ATOM 2821   C CA   . LEU A 1 181 ? 13.814  10.561  17.386  1.00 13.44 ? 181 LEU A CA   1  
ATOM 2822   C C    . LEU A 1 181 ? 13.815  9.275   16.531  1.00 12.44 ? 181 LEU A C    1  
ATOM 2823   O O    . LEU A 1 181 ? 13.499  8.194   17.038  1.00 62.51 ? 181 LEU A O    1  
ATOM 2824   C CB   . LEU A 1 181 ? 15.292  10.810  17.853  1.00 1.14  ? 181 LEU A CB   1  
ATOM 2825   C CG   . LEU A 1 181 ? 15.652  12.196  18.460  1.00 24.20 ? 181 LEU A CG   1  
ATOM 2826   C CD1  . LEU A 1 181 ? 17.169  12.273  18.742  1.00 73.14 ? 181 LEU A CD1  1  
ATOM 2827   C CD2  . LEU A 1 181 ? 15.199  13.365  17.559  1.00 3.04  ? 181 LEU A CD2  1  
ATOM 2828   H H    . LEU A 1 181 ? 13.254  10.648  19.438  1.00 73.22 ? 181 LEU A H    1  
ATOM 2829   H HA   . LEU A 1 181 ? 13.502  11.394  16.771  1.00 14.13 ? 181 LEU A HA   1  
ATOM 2830   H HB2  . LEU A 1 181 ? 15.533  10.055  18.595  1.00 62.12 ? 181 LEU A HB2  1  
ATOM 2831   H HB3  . LEU A 1 181 ? 15.947  10.649  16.997  1.00 35.40 ? 181 LEU A HB3  1  
ATOM 2832   H HG   . LEU A 1 181 ? 15.143  12.301  19.410  1.00 55.42 ? 181 LEU A HG   1  
ATOM 2833   H HD11 . LEU A 1 181 ? 17.449  11.483  19.429  1.00 22.41 ? 181 LEU A HD11 1  
ATOM 2834   H HD12 . LEU A 1 181 ? 17.409  13.227  19.188  1.00 5.23  ? 181 LEU A HD12 1  
ATOM 2835   H HD13 . LEU A 1 181 ? 17.724  12.159  17.818  1.00 23.33 ? 181 LEU A HD13 1  
ATOM 2836   H HD21 . LEU A 1 181 ? 14.126  13.340  17.441  1.00 5.50  ? 181 LEU A HD21 1  
ATOM 2837   H HD22 . LEU A 1 181 ? 15.670  13.288  16.588  1.00 4.31  ? 181 LEU A HD22 1  
ATOM 2838   H HD23 . LEU A 1 181 ? 15.482  14.304  18.020  1.00 3.11  ? 181 LEU A HD23 1  
ATOM 2839   N N    . PRO A 1 182 ? 14.243  9.368   15.224  1.00 62.44 ? 182 PRO A N    1  
ATOM 2840   C CA   . PRO A 1 182 ? 14.636  8.189   14.408  1.00 11.05 ? 182 PRO A CA   1  
ATOM 2841   C C    . PRO A 1 182 ? 16.046  7.668   14.821  1.00 23.11 ? 182 PRO A C    1  
ATOM 2842   O O    . PRO A 1 182 ? 16.879  7.332   13.972  1.00 54.21 ? 182 PRO A O    1  
ATOM 2843   C CB   . PRO A 1 182 ? 14.605  8.740   12.945  1.00 53.11 ? 182 PRO A CB   1  
ATOM 2844   C CG   . PRO A 1 182 ? 13.967  10.099  13.032  1.00 52.34 ? 182 PRO A CG   1  
ATOM 2845   C CD   . PRO A 1 182 ? 14.306  10.606  14.410  1.00 71.42 ? 182 PRO A CD   1  
ATOM 2846   H HA   . PRO A 1 182 ? 13.921  7.382   14.513  1.00 71.34 ? 182 PRO A HA   1  
ATOM 2847   H HB2  . PRO A 1 182 ? 15.617  8.815   12.542  1.00 1.21  ? 182 PRO A HB2  1  
ATOM 2848   H HB3  . PRO A 1 182 ? 14.014  8.093   12.311  1.00 11.33 ? 182 PRO A HB3  1  
ATOM 2849   H HG2  . PRO A 1 182 ? 14.383  10.754  12.272  1.00 12.40 ? 182 PRO A HG2  1  
ATOM 2850   H HG3  . PRO A 1 182 ? 12.889  10.027  12.915  1.00 42.04 ? 182 PRO A HG3  1  
ATOM 2851   H HD2  . PRO A 1 182 ? 15.303  11.033  14.435  1.00 45.33 ? 182 PRO A HD2  1  
ATOM 2852   H HD3  . PRO A 1 182 ? 13.575  11.330  14.746  1.00 74.32 ? 182 PRO A HD3  1  
ATOM 2853   N N    . HIS A 1 183 ? 16.271  7.592   16.144  1.00 44.11 ? 183 HIS A N    1  
ATOM 2854   C CA   . HIS A 1 183 ? 17.489  7.077   16.767  1.00 21.41 ? 183 HIS A CA   1  
ATOM 2855   C C    . HIS A 1 183 ? 17.506  5.548   16.541  1.00 33.15 ? 183 HIS A C    1  
ATOM 2856   O O    . HIS A 1 183 ? 16.490  4.892   16.801  1.00 72.33 ? 183 HIS A O    1  
ATOM 2857   C CB   . HIS A 1 183 ? 17.471  7.464   18.272  1.00 52.22 ? 183 HIS A CB   1  
ATOM 2858   C CG   . HIS A 1 183 ? 18.712  7.125   19.070  1.00 52.51 ? 183 HIS A CG   1  
ATOM 2859   N ND1  . HIS A 1 183 ? 18.964  5.870   19.583  1.00 11.05 ? 183 HIS A ND1  1  
ATOM 2860   C CD2  . HIS A 1 183 ? 19.753  7.900   19.466  1.00 65.23 ? 183 HIS A CD2  1  
ATOM 2861   C CE1  . HIS A 1 183 ? 20.098  5.893   20.260  1.00 34.10 ? 183 HIS A CE1  1  
ATOM 2862   N NE2  . HIS A 1 183 ? 20.600  7.113   20.208  1.00 73.35 ? 183 HIS A NE2  1  
ATOM 2863   H H    . HIS A 1 183 ? 15.562  7.869   16.733  1.00 35.10 ? 183 HIS A H    1  
ATOM 2864   H HA   . HIS A 1 183 ? 18.343  7.535   16.283  1.00 10.11 ? 183 HIS A HA   1  
ATOM 2865   H HB2  . HIS A 1 183 ? 17.320  8.534   18.355  1.00 41.20 ? 183 HIS A HB2  1  
ATOM 2866   H HB3  . HIS A 1 183 ? 16.633  6.971   18.745  1.00 14.35 ? 183 HIS A HB3  1  
ATOM 2867   H HD1  . HIS A 1 183 ? 18.388  5.084   19.488  1.00 72.32 ? 183 HIS A HD1  1  
ATOM 2868   H HD2  . HIS A 1 183 ? 19.889  8.950   19.240  1.00 41.12 ? 183 HIS A HD2  1  
ATOM 2869   H HE1  . HIS A 1 183 ? 20.545  5.050   20.764  1.00 73.01 ? 183 HIS A HE1  1  
ATOM 2870   H HE2  . HIS A 1 183 ? 21.229  7.471   20.879  1.00 37.66 ? 183 HIS A HE2  1  
ATOM 2871   N N    . PRO A 1 184 ? 18.652  4.962   16.072  1.00 30.23 ? 184 PRO A N    1  
ATOM 2872   C CA   . PRO A 1 184 ? 18.693  3.598   15.465  1.00 40.55 ? 184 PRO A CA   1  
ATOM 2873   C C    . PRO A 1 184 ? 18.334  2.406   16.373  1.00 61.24 ? 184 PRO A C    1  
ATOM 2874   O O    . PRO A 1 184 ? 18.572  1.266   15.961  1.00 10.21 ? 184 PRO A O    1  
ATOM 2875   C CB   . PRO A 1 184 ? 20.162  3.473   14.964  1.00 54.10 ? 184 PRO A CB   1  
ATOM 2876   C CG   . PRO A 1 184 ? 20.686  4.869   14.930  1.00 14.14 ? 184 PRO A CG   1  
ATOM 2877   C CD   . PRO A 1 184 ? 20.007  5.571   16.074  1.00 23.24 ? 184 PRO A CD   1  
ATOM 2878   H HA   . PRO A 1 184 ? 18.033  3.559   14.607  1.00 14.25 ? 184 PRO A HA   1  
ATOM 2879   H HB2  . PRO A 1 184 ? 20.752  2.859   15.648  1.00 23.33 ? 184 PRO A HB2  1  
ATOM 2880   H HB3  . PRO A 1 184 ? 20.186  3.039   13.973  1.00 41.20 ? 184 PRO A HB3  1  
ATOM 2881   H HG2  . PRO A 1 184 ? 21.766  4.868   15.061  1.00 12.15 ? 184 PRO A HG2  1  
ATOM 2882   H HG3  . PRO A 1 184 ? 20.428  5.352   13.988  1.00 35.14 ? 184 PRO A HG3  1  
ATOM 2883   H HD2  . PRO A 1 184 ? 20.521  5.369   17.007  1.00 40.35 ? 184 PRO A HD2  1  
ATOM 2884   H HD3  . PRO A 1 184 ? 19.960  6.638   15.894  1.00 3.14  ? 184 PRO A HD3  1  
ATOM 2885   N N    . VAL A 1 185 ? 17.764  2.612   17.579  1.00 31.11 ? 185 VAL A N    1  
ATOM 2886   C CA   . VAL A 1 185 ? 17.427  1.475   18.441  1.00 24.14 ? 185 VAL A CA   1  
ATOM 2887   C C    . VAL A 1 185 ? 15.916  1.341   18.563  1.00 11.22 ? 185 VAL A C    1  
ATOM 2888   O O    . VAL A 1 185 ? 15.349  0.410   18.033  1.00 64.21 ? 185 VAL A O    1  
ATOM 2889   C CB   . VAL A 1 185 ? 18.057  1.595   19.873  1.00 14.02 ? 185 VAL A CB   1  
ATOM 2890   C CG1  . VAL A 1 185 ? 18.006  0.232   20.588  1.00 54.31 ? 185 VAL A CG1  1  
ATOM 2891   C CG2  . VAL A 1 185 ? 19.494  2.137   19.806  1.00 13.43 ? 185 VAL A CG2  1  
ATOM 2892   H H    . VAL A 1 185 ? 17.533  3.517   17.864  1.00 44.23 ? 185 VAL A H    1  
ATOM 2893   H HA   . VAL A 1 185 ? 17.818  0.563   17.978  1.00 25.34 ? 185 VAL A HA   1  
ATOM 2894   H HB   . VAL A 1 185 ? 17.459  2.299   20.459  1.00 65.14 ? 185 VAL A HB   1  
ATOM 2895   H HG11 . VAL A 1 185 ? 18.411  0.324   21.587  1.00 61.40 ? 185 VAL A HG11 1  
ATOM 2896   H HG12 . VAL A 1 185 ? 18.585  -0.497  20.035  1.00 24.10 ? 185 VAL A HG12 1  
ATOM 2897   H HG13 . VAL A 1 185 ? 16.978  -0.111  20.653  1.00 54.10 ? 185 VAL A HG13 1  
ATOM 2898   H HG21 . VAL A 1 185 ? 20.105  1.473   19.206  1.00 32.43 ? 185 VAL A HG21 1  
ATOM 2899   H HG22 . VAL A 1 185 ? 19.908  2.204   20.803  1.00 72.34 ? 185 VAL A HG22 1  
ATOM 2900   H HG23 . VAL A 1 185 ? 19.490  3.121   19.355  1.00 63.33 ? 185 VAL A HG23 1  
ATOM 2901   N N    . PHE A 1 186 ? 15.261  2.341   19.165  1.00 3.43  ? 186 PHE A N    1  
ATOM 2902   C CA   . PHE A 1 186 ? 13.842  2.232   19.564  1.00 71.20 ? 186 PHE A CA   1  
ATOM 2903   C C    . PHE A 1 186 ? 13.003  3.380   19.003  1.00 31.33 ? 186 PHE A C    1  
ATOM 2904   O O    . PHE A 1 186 ? 13.527  4.409   18.557  1.00 24.13 ? 186 PHE A O    1  
ATOM 2905   C CB   . PHE A 1 186 ? 13.687  2.257   21.111  1.00 45.15 ? 186 PHE A CB   1  
ATOM 2906   C CG   . PHE A 1 186 ? 14.488  1.208   21.882  1.00 72.31 ? 186 PHE A CG   1  
ATOM 2907   C CD1  . PHE A 1 186 ? 14.317  -0.138  21.655  1.00 51.11 ? 186 PHE A CD1  1  
ATOM 2908   C CD2  . PHE A 1 186 ? 15.381  1.584   22.861  1.00 51.12 ? 186 PHE A CD2  1  
ATOM 2909   C CE1  . PHE A 1 186 ? 15.019  -1.086  22.388  1.00 42.15 ? 186 PHE A CE1  1  
ATOM 2910   C CE2  . PHE A 1 186 ? 16.088  0.654   23.596  1.00 62.34 ? 186 PHE A CE2  1  
ATOM 2911   C CZ   . PHE A 1 186 ? 15.905  -0.686  23.361  1.00 23.03 ? 186 PHE A CZ   1  
ATOM 2912   H H    . PHE A 1 186 ? 15.728  3.178   19.327  1.00 71.35 ? 186 PHE A H    1  
ATOM 2913   H HA   . PHE A 1 186 ? 13.445  1.293   19.188  1.00 4.32  ? 186 PHE A HA   1  
ATOM 2914   H HB2  . PHE A 1 186 ? 13.983  3.236   21.478  1.00 70.35 ? 186 PHE A HB2  1  
ATOM 2915   H HB3  . PHE A 1 186 ? 12.636  2.108   21.358  1.00 13.02 ? 186 PHE A HB3  1  
ATOM 2916   H HD1  . PHE A 1 186 ? 13.618  -0.459  20.894  1.00 11.11 ? 186 PHE A HD1  1  
ATOM 2917   H HD2  . PHE A 1 186 ? 15.533  2.634   23.051  1.00 52.32 ? 186 PHE A HD2  1  
ATOM 2918   H HE1  . PHE A 1 186 ? 14.868  -2.141  22.195  1.00 23.03 ? 186 PHE A HE1  1  
ATOM 2919   H HE2  . PHE A 1 186 ? 16.783  0.982   24.358  1.00 4.52  ? 186 PHE A HE2  1  
ATOM 2920   H HZ   . PHE A 1 186 ? 16.456  -1.419  23.936  1.00 51.14 ? 186 PHE A HZ   1  
ATOM 2921   N N    . ARG A 1 187 ? 11.685  3.161   19.031  1.00 0.31  ? 187 ARG A N    1  
ATOM 2922   C CA   . ARG A 1 187 ? 10.690  4.229   18.915  1.00 63.55 ? 187 ARG A CA   1  
ATOM 2923   C C    . ARG A 1 187 ? 9.542   3.885   19.881  1.00 70.31 ? 187 ARG A C    1  
ATOM 2924   O O    . ARG A 1 187 ? 8.687   3.045   19.571  1.00 24.43 ? 187 ARG A O    1  
ATOM 2925   C CB   . ARG A 1 187 ? 10.186  4.399   17.457  1.00 32.23 ? 187 ARG A CB   1  
ATOM 2926   C CG   . ARG A 1 187 ? 9.476   5.751   17.191  1.00 75.51 ? 187 ARG A CG   1  
ATOM 2927   C CD   . ARG A 1 187 ? 8.730   5.769   15.847  1.00 41.24 ? 187 ARG A CD   1  
ATOM 2928   N NE   . ARG A 1 187 ? 7.534   4.898   15.883  1.00 74.33 ? 187 ARG A NE   1  
ATOM 2929   C CZ   . ARG A 1 187 ? 7.303   3.832   15.107  1.00 75.24 ? 187 ARG A CZ   1  
ATOM 2930   N NH1  . ARG A 1 187 ? 8.185   3.444   14.190  1.00 31.12 ? 187 ARG A NH1  1  
ATOM 2931   N NH2  . ARG A 1 187 ? 6.178   3.150   15.267  1.00 25.34 ? 187 ARG A NH2  1  
ATOM 2932   H H    . ARG A 1 187 ? 11.369  2.226   19.096  1.00 41.35 ? 187 ARG A H    1  
ATOM 2933   H HA   . ARG A 1 187 ? 11.153  5.163   19.249  1.00 3.22  ? 187 ARG A HA   1  
ATOM 2934   H HB2  . ARG A 1 187 ? 11.039  4.327   16.790  1.00 10.25 ? 187 ARG A HB2  1  
ATOM 2935   H HB3  . ARG A 1 187 ? 9.498   3.591   17.222  1.00 62.31 ? 187 ARG A HB3  1  
ATOM 2936   H HG2  . ARG A 1 187 ? 8.762   5.938   17.984  1.00 22.11 ? 187 ARG A HG2  1  
ATOM 2937   H HG3  . ARG A 1 187 ? 10.221  6.542   17.192  1.00 13.30 ? 187 ARG A HG3  1  
ATOM 2938   H HD2  . ARG A 1 187 ? 8.407   6.784   15.648  1.00 70.23 ? 187 ARG A HD2  1  
ATOM 2939   H HD3  . ARG A 1 187 ? 9.400   5.446   15.056  1.00 43.42 ? 187 ARG A HD3  1  
ATOM 2940   H HE   . ARG A 1 187 ? 6.841   5.148   16.531  1.00 15.12 ? 187 ARG A HE   1  
ATOM 2941   H HH11 . ARG A 1 187 ? 9.045   3.952   14.066  1.00 41.41 ? 187 ARG A HH11 1  
ATOM 2942   H HH12 . ARG A 1 187 ? 7.995   2.644   13.619  1.00 44.40 ? 187 ARG A HH12 1  
ATOM 2943   H HH21 . ARG A 1 187 ? 5.508   3.435   15.963  1.00 73.32 ? 187 ARG A HH21 1  
ATOM 2944   H HH22 . ARG A 1 187 ? 5.987   2.348   14.693  1.00 2.44  ? 187 ARG A HH22 1  
ATOM 2945   N N    . LEU A 1 188 ? 9.606   4.476   21.086  1.00 21.14 ? 188 LEU A N    1  
ATOM 2946   C CA   . LEU A 1 188 ? 8.612   4.270   22.153  1.00 41.34 ? 188 LEU A CA   1  
ATOM 2947   C C    . LEU A 1 188 ? 7.252   4.847   21.738  1.00 61.25 ? 188 LEU A C    1  
ATOM 2948   O O    . LEU A 1 188 ? 7.129   6.055   21.526  1.00 14.33 ? 188 LEU A O    1  
ATOM 2949   C CB   . LEU A 1 188 ? 9.111   4.936   23.458  1.00 42.11 ? 188 LEU A CB   1  
ATOM 2950   C CG   . LEU A 1 188 ? 8.128   4.975   24.670  1.00 74.21 ? 188 LEU A CG   1  
ATOM 2951   C CD1  . LEU A 1 188 ? 7.795   3.565   25.191  1.00 72.14 ? 188 LEU A CD1  1  
ATOM 2952   C CD2  . LEU A 1 188 ? 8.686   5.883   25.793  1.00 3.10  ? 188 LEU A CD2  1  
ATOM 2953   H H    . LEU A 1 188 ? 10.355  5.084   21.261  1.00 72.55 ? 188 LEU A H    1  
ATOM 2954   H HA   . LEU A 1 188 ? 8.516   3.201   22.318  1.00 34.15 ? 188 LEU A HA   1  
ATOM 2955   H HB2  . LEU A 1 188 ? 10.014  4.425   23.773  1.00 35.05 ? 188 LEU A HB2  1  
ATOM 2956   H HB3  . LEU A 1 188 ? 9.382   5.955   23.219  1.00 53.43 ? 188 LEU A HB3  1  
ATOM 2957   H HG   . LEU A 1 188 ? 7.195   5.415   24.339  1.00 61.21 ? 188 LEU A HG   1  
ATOM 2958   H HD11 . LEU A 1 188 ? 8.698   3.063   25.515  1.00 61.41 ? 188 LEU A HD11 1  
ATOM 2959   H HD12 . LEU A 1 188 ? 7.330   2.987   24.402  1.00 21.44 ? 188 LEU A HD12 1  
ATOM 2960   H HD13 . LEU A 1 188 ? 7.106   3.638   26.022  1.00 72.40 ? 188 LEU A HD13 1  
ATOM 2961   H HD21 . LEU A 1 188 ? 9.647   5.513   26.125  1.00 63.23 ? 188 LEU A HD21 1  
ATOM 2962   H HD22 . LEU A 1 188 ? 7.999   5.893   26.628  1.00 52.42 ? 188 LEU A HD22 1  
ATOM 2963   H HD23 . LEU A 1 188 ? 8.800   6.892   25.419  1.00 73.14 ? 188 LEU A HD23 1  
ATOM 2964   N N    . GLU A 1 189 ? 6.255   3.966   21.631  1.00 44.11 ? 189 GLU A N    1  
ATOM 2965   C CA   . GLU A 1 189 ? 4.904   4.306   21.196  1.00 1.14  ? 189 GLU A CA   1  
ATOM 2966   C C    . GLU A 1 189 ? 3.890   3.559   22.076  1.00 13.03 ? 189 GLU A C    1  
ATOM 2967   O O    . GLU A 1 189 ? 4.073   2.364   22.380  1.00 12.34 ? 189 GLU A O    1  
ATOM 2968   C CB   . GLU A 1 189 ? 4.744   3.959   19.693  1.00 41.11 ? 189 GLU A CB   1  
ATOM 2969   C CG   . GLU A 1 189 ? 3.418   4.403   19.046  1.00 32.02 ? 189 GLU A CG   1  
ATOM 2970   C CD   . GLU A 1 189 ? 3.309   4.019   17.555  1.00 41.51 ? 189 GLU A CD   1  
ATOM 2971   O OE1  . GLU A 1 189 ? 4.039   4.600   16.723  1.00 70.31 ? 189 GLU A OE1  1  
ATOM 2972   O OE2  . GLU A 1 189 ? 2.494   3.132   17.211  1.00 1.15  ? 189 GLU A OE2  1  
ATOM 2973   H H    . GLU A 1 189 ? 6.437   3.031   21.848  1.00 53.42 ? 189 GLU A H    1  
ATOM 2974   H HA   . GLU A 1 189 ? 4.759   5.377   21.332  1.00 41.42 ? 189 GLU A HA   1  
ATOM 2975   H HB2  . GLU A 1 189 ? 5.555   4.433   19.147  1.00 52.32 ? 189 GLU A HB2  1  
ATOM 2976   H HB3  . GLU A 1 189 ? 4.838   2.887   19.576  1.00 11.43 ? 189 GLU A HB3  1  
ATOM 2977   H HG2  . GLU A 1 189 ? 2.600   3.947   19.595  1.00 44.34 ? 189 GLU A HG2  1  
ATOM 2978   H HG3  . GLU A 1 189 ? 3.330   5.482   19.132  1.00 21.20 ? 189 GLU A HG3  1  
ATOM 2979   N N    . GLY A 1 190 ? 2.878   4.300   22.555  1.00 33.44 ? 190 GLY A N    1  
ATOM 2980   C CA   . GLY A 1 190 ? 1.862   3.751   23.443  1.00 21.44 ? 190 GLY A CA   1  
ATOM 2981   C C    . GLY A 1 190 ? 2.376   3.623   24.869  1.00 65.41 ? 190 GLY A C    1  
ATOM 2982   O O    . GLY A 1 190 ? 2.131   4.495   25.705  1.00 1.41  ? 190 GLY A O    1  
ATOM 2983   H H    . GLY A 1 190 ? 2.821   5.240   22.294  1.00 20.31 ? 190 GLY A H    1  
ATOM 2984   H HA2  . GLY A 1 190 ? 1.001   4.405   23.430  1.00 15.33 ? 190 GLY A HA2  1  
ATOM 2985   H HA3  . GLY A 1 190 ? 1.556   2.774   23.084  1.00 24.53 ? 190 GLY A HA3  1  
ATOM 2986   N N    . GLN A 1 191 ? 3.097   2.522   25.134  1.00 64.24 ? 191 GLN A N    1  
ATOM 2987   C CA   . GLN A 1 191 ? 3.779   2.272   26.419  1.00 14.21 ? 191 GLN A CA   1  
ATOM 2988   C C    . GLN A 1 191 ? 5.069   1.466   26.200  1.00 32.22 ? 191 GLN A C    1  
ATOM 2989   O O    . GLN A 1 191 ? 5.862   1.285   27.135  1.00 3.15  ? 191 GLN A O    1  
ATOM 2990   C CB   . GLN A 1 191 ? 2.848   1.535   27.432  1.00 23.02 ? 191 GLN A CB   1  
ATOM 2991   C CG   . GLN A 1 191 ? 2.272   0.169   26.970  1.00 50.40 ? 191 GLN A CG   1  
ATOM 2992   C CD   . GLN A 1 191 ? 1.124   0.268   25.950  1.00 4.21  ? 191 GLN A CD   1  
ATOM 2993   O OE1  . GLN A 1 191 ? 0.357   1.225   25.947  1.00 44.15 ? 191 GLN A OE1  1  
ATOM 2994   N NE2  . GLN A 1 191 ? 1.006   -0.717  25.079  1.00 72.32 ? 191 GLN A NE2  1  
ATOM 2995   H H    . GLN A 1 191 ? 3.170   1.833   24.428  1.00 43.20 ? 191 GLN A H    1  
ATOM 2996   H HA   . GLN A 1 191 ? 4.059   3.232   26.839  1.00 71.12 ? 191 GLN A HA   1  
ATOM 2997   H HB2  . GLN A 1 191 ? 3.403   1.369   28.350  1.00 63.01 ? 191 GLN A HB2  1  
ATOM 2998   H HB3  . GLN A 1 191 ? 2.015   2.193   27.662  1.00 22.54 ? 191 GLN A HB3  1  
ATOM 2999   H HG2  . GLN A 1 191 ? 3.075   -0.410  26.531  1.00 0.23  ? 191 GLN A HG2  1  
ATOM 3000   H HG3  . GLN A 1 191 ? 1.900   -0.356  27.842  1.00 12.54 ? 191 GLN A HG3  1  
ATOM 3001   H HE21 . GLN A 1 191 ? 1.650   -1.452  25.124  1.00 41.13 ? 191 GLN A HE21 1  
ATOM 3002   H HE22 . GLN A 1 191 ? 0.282   -0.670  24.422  1.00 30.43 ? 191 GLN A HE22 1  
ATOM 3003   N N    . ASP A 1 192 ? 5.307   1.047   24.947  1.00 53.21 ? 192 ASP A N    1  
ATOM 3004   C CA   . ASP A 1 192 ? 6.304   0.013   24.623  1.00 21.32 ? 192 ASP A CA   1  
ATOM 3005   C C    . ASP A 1 192 ? 7.238   0.448   23.483  1.00 70.53 ? 192 ASP A C    1  
ATOM 3006   O O    . ASP A 1 192 ? 6.889   1.296   22.666  1.00 24.23 ? 192 ASP A O    1  
ATOM 3007   C CB   . ASP A 1 192 ? 5.573   -1.306  24.276  1.00 34.23 ? 192 ASP A CB   1  
ATOM 3008   C CG   . ASP A 1 192 ? 4.517   -1.148  23.170  1.00 24.01 ? 192 ASP A CG   1  
ATOM 3009   O OD1  . ASP A 1 192 ? 4.769   -1.547  22.027  1.00 72.32 ? 192 ASP A OD1  1  
ATOM 3010   O OD2  . ASP A 1 192 ? 3.417   -0.623  23.459  1.00 1.21  ? 192 ASP A OD2  1  
ATOM 3011   H H    . ASP A 1 192 ? 4.805   1.458   24.201  1.00 63.41 ? 192 ASP A H    1  
ATOM 3012   H HA   . ASP A 1 192 ? 6.915   -0.157  25.508  1.00 22.21 ? 192 ASP A HA   1  
ATOM 3013   H HB2  . ASP A 1 192 ? 6.306   -2.048  23.970  1.00 31.22 ? 192 ASP A HB2  1  
ATOM 3014   H HB3  . ASP A 1 192 ? 5.079   -1.674  25.173  1.00 50.43 ? 192 ASP A HB3  1  
ATOM 3015   N N    . LEU A 1 193 ? 8.429   -0.160  23.453  1.00 32.41 ? 193 LEU A N    1  
ATOM 3016   C CA   . LEU A 1 193 ? 9.507   0.188   22.514  1.00 52.14 ? 193 LEU A CA   1  
ATOM 3017   C C    . LEU A 1 193 ? 9.390   -0.656  21.226  1.00 63.44 ? 193 LEU A C    1  
ATOM 3018   O O    . LEU A 1 193 ? 8.999   -1.826  21.283  1.00 11.34 ? 193 LEU A O    1  
ATOM 3019   C CB   . LEU A 1 193 ? 10.880  -0.098  23.181  1.00 62.10 ? 193 LEU A CB   1  
ATOM 3020   C CG   . LEU A 1 193 ? 11.216  0.675   24.495  1.00 44.52 ? 193 LEU A CG   1  
ATOM 3021   C CD1  . LEU A 1 193 ? 12.486  0.099   25.167  1.00 52.41 ? 193 LEU A CD1  1  
ATOM 3022   C CD2  . LEU A 1 193 ? 11.377  2.186   24.230  1.00 4.25  ? 193 LEU A CD2  1  
ATOM 3023   H H    . LEU A 1 193 ? 8.588   -0.888  24.087  1.00 51.35 ? 193 LEU A H    1  
ATOM 3024   H HA   . LEU A 1 193 ? 9.438   1.247   22.270  1.00 22.53 ? 193 LEU A HA   1  
ATOM 3025   H HB2  . LEU A 1 193 ? 10.925  -1.162  23.399  1.00 5.53  ? 193 LEU A HB2  1  
ATOM 3026   H HB3  . LEU A 1 193 ? 11.660  0.120   22.453  1.00 54.41 ? 193 LEU A HB3  1  
ATOM 3027   H HG   . LEU A 1 193 ? 10.399  0.547   25.192  1.00 13.24 ? 193 LEU A HG   1  
ATOM 3028   H HD11 . LEU A 1 193 ? 13.340  0.209   24.508  1.00 74.25 ? 193 LEU A HD11 1  
ATOM 3029   H HD12 . LEU A 1 193 ? 12.338  -0.952  25.382  1.00 34.42 ? 193 LEU A HD12 1  
ATOM 3030   H HD13 . LEU A 1 193 ? 12.677  0.623   26.095  1.00 60.23 ? 193 LEU A HD13 1  
ATOM 3031   H HD21 . LEU A 1 193 ? 11.595  2.697   25.160  1.00 54.10 ? 193 LEU A HD21 1  
ATOM 3032   H HD22 . LEU A 1 193 ? 10.458  2.583   23.822  1.00 21.12 ? 193 LEU A HD22 1  
ATOM 3033   H HD23 . LEU A 1 193 ? 12.184  2.360   23.528  1.00 54.52 ? 193 LEU A HD23 1  
ATOM 3034   N N    . TYR A 1 194 ? 9.730   -0.050  20.072  1.00 23.24 ? 194 TYR A N    1  
ATOM 3035   C CA   . TYR A 1 194 ? 9.847   -0.766  18.783  1.00 2.15  ? 194 TYR A CA   1  
ATOM 3036   C C    . TYR A 1 194 ? 11.295  -0.675  18.290  1.00 73.14 ? 194 TYR A C    1  
ATOM 3037   O O    . TYR A 1 194 ? 11.762  0.413   17.941  1.00 71.42 ? 194 TYR A O    1  
ATOM 3038   C CB   . TYR A 1 194 ? 8.864   -0.180  17.728  1.00 35.51 ? 194 TYR A CB   1  
ATOM 3039   C CG   . TYR A 1 194 ? 7.395   -0.358  18.129  1.00 30.21 ? 194 TYR A CG   1  
ATOM 3040   C CD1  . TYR A 1 194 ? 6.567   0.732   18.395  1.00 31.22 ? 194 TYR A CD1  1  
ATOM 3041   C CD2  . TYR A 1 194 ? 6.857   -1.640  18.294  1.00 43.41 ? 194 TYR A CD2  1  
ATOM 3042   C CE1  . TYR A 1 194 ? 5.263   0.546   18.806  1.00 45.45 ? 194 TYR A CE1  1  
ATOM 3043   C CE2  . TYR A 1 194 ? 5.551   -1.820  18.696  1.00 15.33 ? 194 TYR A CE2  1  
ATOM 3044   C CZ   . TYR A 1 194 ? 4.763   -0.724  18.950  1.00 61.55 ? 194 TYR A CZ   1  
ATOM 3045   O OH   . TYR A 1 194 ? 3.476   -0.899  19.385  1.00 24.03 ? 194 TYR A OH   1  
ATOM 3046   H H    . TYR A 1 194 ? 9.897   0.914   20.085  1.00 52.32 ? 194 TYR A H    1  
ATOM 3047   H HA   . TYR A 1 194 ? 9.600   -1.817  18.947  1.00 13.31 ? 194 TYR A HA   1  
ATOM 3048   H HB2  . TYR A 1 194 ? 9.067   0.879   17.601  1.00 43.02 ? 194 TYR A HB2  1  
ATOM 3049   H HB3  . TYR A 1 194 ? 9.016   -0.680  16.774  1.00 43.23 ? 194 TYR A HB3  1  
ATOM 3050   H HD1  . TYR A 1 194 ? 6.955   1.740   18.274  1.00 60.52 ? 194 TYR A HD1  1  
ATOM 3051   H HD2  . TYR A 1 194 ? 7.478   -2.508  18.098  1.00 12.44 ? 194 TYR A HD2  1  
ATOM 3052   H HE1  . TYR A 1 194 ? 4.641   1.403   19.008  1.00 0.34  ? 194 TYR A HE1  1  
ATOM 3053   H HE2  . TYR A 1 194 ? 5.155   -2.820  18.813  1.00 54.13 ? 194 TYR A HE2  1  
ATOM 3054   H HH   . TYR A 1 194 ? 3.498   -1.340  20.246  1.00 10.51 ? 194 TYR A HH   1  
ATOM 3055   N N    . ALA A 1 195 ? 12.003  -1.821  18.310  1.00 32.23 ? 195 ALA A N    1  
ATOM 3056   C CA   . ALA A 1 195 ? 13.397  -1.934  17.838  1.00 12.42 ? 195 ALA A CA   1  
ATOM 3057   C C    . ALA A 1 195 ? 13.515  -2.976  16.710  1.00 74.34 ? 195 ALA A C    1  
ATOM 3058   O O    . ALA A 1 195 ? 12.514  -3.520  16.242  1.00 25.02 ? 195 ALA A O    1  
ATOM 3059   C CB   . ALA A 1 195 ? 14.321  -2.321  18.996  1.00 74.32 ? 195 ALA A CB   1  
ATOM 3060   H H    . ALA A 1 195 ? 11.568  -2.630  18.646  1.00 54.33 ? 195 ALA A H    1  
ATOM 3061   H HA   . ALA A 1 195 ? 13.716  -0.968  17.456  1.00 50.11 ? 195 ALA A HA   1  
ATOM 3062   H HB1  . ALA A 1 195 ? 15.327  -2.486  18.627  1.00 63.41 ? 195 ALA A HB1  1  
ATOM 3063   H HB2  . ALA A 1 195 ? 13.960  -3.221  19.474  1.00 30.32 ? 195 ALA A HB2  1  
ATOM 3064   H HB3  . ALA A 1 195 ? 14.345  -1.524  19.720  1.00 20.52 ? 195 ALA A HB3  1  
ATOM 3065   N N    . THR A 1 196 ? 14.766  -3.233  16.278  1.00 42.24 ? 196 THR A N    1  
ATOM 3066   C CA   . THR A 1 196 ? 15.092  -4.274  15.279  1.00 0.42  ? 196 THR A CA   1  
ATOM 3067   C C    . THR A 1 196 ? 16.153  -5.226  15.867  1.00 31.53 ? 196 THR A C    1  
ATOM 3068   O O    . THR A 1 196 ? 17.013  -4.785  16.645  1.00 13.44 ? 196 THR A O    1  
ATOM 3069   C CB   . THR A 1 196 ? 15.633  -3.618  13.961  1.00 30.25 ? 196 THR A CB   1  
ATOM 3070   O OG1  . THR A 1 196 ? 14.736  -2.581  13.536  1.00 70.21 ? 196 THR A OG1  1  
ATOM 3071   C CG2  . THR A 1 196 ? 15.806  -4.634  12.811  1.00 64.55 ? 196 THR A CG2  1  
ATOM 3072   H H    . THR A 1 196 ? 15.512  -2.698  16.650  1.00 41.01 ? 196 THR A H    1  
ATOM 3073   H HA   . THR A 1 196 ? 14.190  -4.841  15.046  1.00 13.21 ? 196 THR A HA   1  
ATOM 3074   H HB   . THR A 1 196 ? 16.599  -3.163  14.168  1.00 43.13 ? 196 THR A HB   1  
ATOM 3075   H HG1  . THR A 1 196 ? 14.818  -1.831  14.134  1.00 64.45 ? 196 THR A HG1  1  
ATOM 3076   H HG21 . THR A 1 196 ? 14.848  -5.082  12.566  1.00 34.55 ? 196 THR A HG21 1  
ATOM 3077   H HG22 . THR A 1 196 ? 16.494  -5.414  13.108  1.00 23.23 ? 196 THR A HG22 1  
ATOM 3078   H HG23 . THR A 1 196 ? 16.201  -4.131  11.937  1.00 41.01 ? 196 THR A HG23 1  
ATOM 3079   N N    . LEU A 1 197 ? 16.083  -6.524  15.515  1.00 50.44 ? 197 LEU A N    1  
ATOM 3080   C CA   . LEU A 1 197 ? 17.083  -7.514  15.942  1.00 11.51 ? 197 LEU A CA   1  
ATOM 3081   C C    . LEU A 1 197 ? 17.508  -8.378  14.746  1.00 54.43 ? 197 LEU A C    1  
ATOM 3082   O O    . LEU A 1 197 ? 16.769  -9.276  14.318  1.00 22.42 ? 197 LEU A O    1  
ATOM 3083   C CB   . LEU A 1 197 ? 16.543  -8.419  17.087  1.00 72.21 ? 197 LEU A CB   1  
ATOM 3084   C CG   . LEU A 1 197 ? 17.625  -9.286  17.811  1.00 61.51 ? 197 LEU A CG   1  
ATOM 3085   C CD1  . LEU A 1 197 ? 18.617  -8.388  18.592  1.00 54.22 ? 197 LEU A CD1  1  
ATOM 3086   C CD2  . LEU A 1 197 ? 16.985  -10.357 18.730  1.00 52.32 ? 197 LEU A CD2  1  
ATOM 3087   H H    . LEU A 1 197 ? 15.345  -6.819  14.949  1.00 44.43 ? 197 LEU A H    1  
ATOM 3088   H HA   . LEU A 1 197 ? 17.957  -6.976  16.307  1.00 4.13  ? 197 LEU A HA   1  
ATOM 3089   H HB2  . LEU A 1 197 ? 16.058  -7.784  17.823  1.00 71.20 ? 197 LEU A HB2  1  
ATOM 3090   H HB3  . LEU A 1 197 ? 15.792  -9.084  16.673  1.00 23.31 ? 197 LEU A HB3  1  
ATOM 3091   H HG   . LEU A 1 197 ? 18.201  -9.810  17.057  1.00 74.10 ? 197 LEU A HG   1  
ATOM 3092   H HD11 . LEU A 1 197 ? 19.348  -9.003  19.095  1.00 4.32  ? 197 LEU A HD11 1  
ATOM 3093   H HD12 . LEU A 1 197 ? 18.085  -7.798  19.328  1.00 30.33 ? 197 LEU A HD12 1  
ATOM 3094   H HD13 . LEU A 1 197 ? 19.129  -7.725  17.907  1.00 31.41 ? 197 LEU A HD13 1  
ATOM 3095   H HD21 . LEU A 1 197 ? 17.758  -10.963 19.182  1.00 61.12 ? 197 LEU A HD21 1  
ATOM 3096   H HD22 . LEU A 1 197 ? 16.332  -10.994 18.150  1.00 23.13 ? 197 LEU A HD22 1  
ATOM 3097   H HD23 . LEU A 1 197 ? 16.406  -9.880  19.514  1.00 12.22 ? 197 LEU A HD23 1  
ATOM 3098   N N    . ASP A 1 198 ? 18.677  -8.061  14.182  1.00 43.01 ? 198 ASP A N    1  
ATOM 3099   C CA   . ASP A 1 198 ? 19.371  -8.933  13.221  1.00 14.42 ? 198 ASP A CA   1  
ATOM 3100   C C    . ASP A 1 198 ? 20.123  -10.021 14.010  1.00 61.43 ? 198 ASP A C    1  
ATOM 3101   O O    . ASP A 1 198 ? 21.048  -9.734  14.777  1.00 51.33 ? 198 ASP A O    1  
ATOM 3102   C CB   . ASP A 1 198 ? 20.305  -8.122  12.264  1.00 53.33 ? 198 ASP A CB   1  
ATOM 3103   C CG   . ASP A 1 198 ? 21.132  -7.035  12.974  1.00 33.23 ? 198 ASP A CG   1  
ATOM 3104   O OD1  . ASP A 1 198 ? 20.521  -6.027  13.388  1.00 23.35 ? 198 ASP A OD1  1  
ATOM 3105   O OD2  . ASP A 1 198 ? 22.373  -7.162  13.104  1.00 11.44 ? 198 ASP A OD2  1  
ATOM 3106   H H    . ASP A 1 198 ? 19.097  -7.210  14.428  1.00 63.30 ? 198 ASP A H    1  
ATOM 3107   H HA   . ASP A 1 198 ? 18.602  -9.418  12.615  1.00 41.31 ? 198 ASP A HA   1  
ATOM 3108   H HB2  . ASP A 1 198 ? 20.980  -8.807  11.759  1.00 52.52 ? 198 ASP A HB2  1  
ATOM 3109   H HB3  . ASP A 1 198 ? 19.692  -7.640  11.507  1.00 54.23 ? 198 ASP A HB3  1  
ATOM 3110   N N    . VAL A 1 199 ? 19.675  -11.272 13.843  1.00 21.33 ? 199 VAL A N    1  
ATOM 3111   C CA   . VAL A 1 199 ? 20.138  -12.424 14.650  1.00 43.11 ? 199 VAL A CA   1  
ATOM 3112   C C    . VAL A 1 199 ? 20.460  -13.605 13.707  1.00 25.04 ? 199 VAL A C    1  
ATOM 3113   O O    . VAL A 1 199 ? 19.690  -13.867 12.793  1.00 64.40 ? 199 VAL A O    1  
ATOM 3114   C CB   . VAL A 1 199 ? 19.039  -12.819 15.730  1.00 20.22 ? 199 VAL A CB   1  
ATOM 3115   C CG1  . VAL A 1 199 ? 17.661  -13.103 15.074  1.00 55.11 ? 199 VAL A CG1  1  
ATOM 3116   C CG2  . VAL A 1 199 ? 19.497  -14.012 16.604  1.00 43.42 ? 199 VAL A CG2  1  
ATOM 3117   H H    . VAL A 1 199 ? 19.010  -11.438 13.131  1.00 51.53 ? 199 VAL A H    1  
ATOM 3118   H HA   . VAL A 1 199 ? 21.046  -12.135 15.178  1.00 22.34 ? 199 VAL A HA   1  
ATOM 3119   H HB   . VAL A 1 199 ? 18.907  -11.958 16.388  1.00 15.40 ? 199 VAL A HB   1  
ATOM 3120   H HG11 . VAL A 1 199 ? 17.748  -13.940 14.393  1.00 31.43 ? 199 VAL A HG11 1  
ATOM 3121   H HG12 . VAL A 1 199 ? 17.333  -12.230 14.521  1.00 74.33 ? 199 VAL A HG12 1  
ATOM 3122   H HG13 . VAL A 1 199 ? 16.930  -13.335 15.836  1.00 11.23 ? 199 VAL A HG13 1  
ATOM 3123   H HG21 . VAL A 1 199 ? 20.422  -13.762 17.108  1.00 21.01 ? 199 VAL A HG21 1  
ATOM 3124   H HG22 . VAL A 1 199 ? 19.656  -14.883 15.982  1.00 23.41 ? 199 VAL A HG22 1  
ATOM 3125   H HG23 . VAL A 1 199 ? 18.739  -14.238 17.346  1.00 0.21  ? 199 VAL A HG23 1  
ATOM 3126   N N    . PRO A 1 200 ? 21.632  -14.308 13.857  1.00 51.54 ? 200 PRO A N    1  
ATOM 3127   C CA   . PRO A 1 200 ? 21.946  -15.474 13.002  1.00 15.34 ? 200 PRO A CA   1  
ATOM 3128   C C    . PRO A 1 200 ? 21.068  -16.696 13.340  1.00 64.51 ? 200 PRO A C    1  
ATOM 3129   O O    . PRO A 1 200 ? 20.642  -16.860 14.485  1.00 31.44 ? 200 PRO A O    1  
ATOM 3130   C CB   . PRO A 1 200 ? 23.437  -15.725 13.280  1.00 44.21 ? 200 PRO A CB   1  
ATOM 3131   C CG   . PRO A 1 200 ? 23.670  -15.190 14.657  1.00 35.30 ? 200 PRO A CG   1  
ATOM 3132   C CD   . PRO A 1 200 ? 22.736  -14.011 14.816  1.00 25.21 ? 200 PRO A CD   1  
ATOM 3133   H HA   . PRO A 1 200 ? 21.812  -15.224 11.951  1.00 0.20  ? 200 PRO A HA   1  
ATOM 3134   H HB2  . PRO A 1 200 ? 23.666  -16.791 13.226  1.00 32.22 ? 200 PRO A HB2  1  
ATOM 3135   H HB3  . PRO A 1 200 ? 24.049  -15.188 12.564  1.00 3.01  ? 200 PRO A HB3  1  
ATOM 3136   H HG2  . PRO A 1 200 ? 23.443  -15.961 15.393  1.00 70.05 ? 200 PRO A HG2  1  
ATOM 3137   H HG3  . PRO A 1 200 ? 24.699  -14.870 14.767  1.00 13.43 ? 200 PRO A HG3  1  
ATOM 3138   H HD2  . PRO A 1 200 ? 22.358  -13.955 15.832  1.00 14.21 ? 200 PRO A HD2  1  
ATOM 3139   H HD3  . PRO A 1 200 ? 23.234  -13.089 14.552  1.00 42.01 ? 200 PRO A HD3  1  
ATOM 3140   N N    . ALA A 1 201 ? 20.837  -17.552 12.328  1.00 71.34 ? 201 ALA A N    1  
ATOM 3141   C CA   . ALA A 1 201 ? 19.883  -18.680 12.399  1.00 70.12 ? 201 ALA A CA   1  
ATOM 3142   C C    . ALA A 1 201 ? 20.134  -19.663 13.575  1.00 34.12 ? 201 ALA A C    1  
ATOM 3143   O O    . ALA A 1 201 ? 19.168  -20.031 14.246  1.00 62.24 ? 201 ALA A O    1  
ATOM 3144   C CB   . ALA A 1 201 ? 19.832  -19.408 11.052  1.00 51.43 ? 201 ALA A CB   1  
ATOM 3145   H H    . ALA A 1 201 ? 21.326  -17.417 11.487  1.00 60.04 ? 201 ALA A H    1  
ATOM 3146   H HA   . ALA A 1 201 ? 18.904  -18.234 12.547  1.00 34.44 ? 201 ALA A HA   1  
ATOM 3147   H HB1  . ALA A 1 201 ? 19.634  -18.696 10.262  1.00 15.31 ? 201 ALA A HB1  1  
ATOM 3148   H HB2  . ALA A 1 201 ? 19.050  -20.155 11.065  1.00 40.50 ? 201 ALA A HB2  1  
ATOM 3149   H HB3  . ALA A 1 201 ? 20.784  -19.892 10.862  1.00 12.14 ? 201 ALA A HB3  1  
ATOM 3150   N N    . PRO A 1 202 ? 21.403  -20.119 13.855  1.00 1.34  ? 202 PRO A N    1  
ATOM 3151   C CA   . PRO A 1 202 ? 21.674  -20.982 15.034  1.00 33.20 ? 202 PRO A CA   1  
ATOM 3152   C C    . PRO A 1 202 ? 21.250  -20.323 16.367  1.00 22.13 ? 202 PRO A C    1  
ATOM 3153   O O    . PRO A 1 202 ? 20.592  -20.951 17.195  1.00 50.14 ? 202 PRO A O    1  
ATOM 3154   C CB   . PRO A 1 202 ? 23.201  -21.193 14.969  1.00 54.42 ? 202 PRO A CB   1  
ATOM 3155   C CG   . PRO A 1 202 ? 23.547  -21.010 13.531  1.00 30.14 ? 202 PRO A CG   1  
ATOM 3156   C CD   . PRO A 1 202 ? 22.642  -19.907 13.050  1.00 63.54 ? 202 PRO A CD   1  
ATOM 3157   H HA   . PRO A 1 202 ? 21.167  -21.941 14.934  1.00 63.22 ? 202 PRO A HA   1  
ATOM 3158   H HB2  . PRO A 1 202 ? 23.717  -20.457 15.593  1.00 61.11 ? 202 PRO A HB2  1  
ATOM 3159   H HB3  . PRO A 1 202 ? 23.461  -22.194 15.295  1.00 21.00 ? 202 PRO A HB3  1  
ATOM 3160   H HG2  . PRO A 1 202 ? 24.589  -20.724 13.429  1.00 73.32 ? 202 PRO A HG2  1  
ATOM 3161   H HG3  . PRO A 1 202 ? 23.351  -21.919 12.973  1.00 0.11  ? 202 PRO A HG3  1  
ATOM 3162   H HD2  . PRO A 1 202 ? 23.073  -18.929 13.253  1.00 42.01 ? 202 PRO A HD2  1  
ATOM 3163   H HD3  . PRO A 1 202 ? 22.435  -20.010 11.991  1.00 41.12 ? 202 PRO A HD3  1  
ATOM 3164   N N    . ILE A 1 203 ? 21.604  -19.038 16.530  1.00 14.44 ? 203 ILE A N    1  
ATOM 3165   C CA   . ILE A 1 203 ? 21.301  -18.271 17.757  1.00 55.54 ? 203 ILE A CA   1  
ATOM 3166   C C    . ILE A 1 203 ? 19.783  -17.960 17.862  1.00 33.42 ? 203 ILE A C    1  
ATOM 3167   O O    . ILE A 1 203 ? 19.242  -17.864 18.963  1.00 25.41 ? 203 ILE A O    1  
ATOM 3168   C CB   . ILE A 1 203 ? 22.196  -16.964 17.813  1.00 24.14 ? 203 ILE A CB   1  
ATOM 3169   C CG1  . ILE A 1 203 ? 23.708  -17.369 17.967  1.00 32.42 ? 203 ILE A CG1  1  
ATOM 3170   C CG2  . ILE A 1 203 ? 21.761  -15.985 18.935  1.00 64.32 ? 203 ILE A CG2  1  
ATOM 3171   C CD1  . ILE A 1 203 ? 24.679  -16.206 18.134  1.00 64.12 ? 203 ILE A CD1  1  
ATOM 3172   H H    . ILE A 1 203 ? 22.064  -18.579 15.794  1.00 42.32 ? 203 ILE A H    1  
ATOM 3173   H HA   . ILE A 1 203 ? 21.571  -18.892 18.606  1.00 10.41 ? 203 ILE A HA   1  
ATOM 3174   H HB   . ILE A 1 203 ? 22.077  -16.444 16.865  1.00 23.21 ? 203 ILE A HB   1  
ATOM 3175   H HG12 . ILE A 1 203 ? 23.821  -18.002 18.839  1.00 30.02 ? 203 ILE A HG12 1  
ATOM 3176   H HG13 . ILE A 1 203 ? 24.018  -17.929 17.091  1.00 71.02 ? 203 ILE A HG13 1  
ATOM 3177   H HG21 . ILE A 1 203 ? 22.386  -15.101 18.914  1.00 44.01 ? 203 ILE A HG21 1  
ATOM 3178   H HG22 . ILE A 1 203 ? 21.857  -16.466 19.900  1.00 32.10 ? 203 ILE A HG22 1  
ATOM 3179   H HG23 . ILE A 1 203 ? 20.731  -15.691 18.785  1.00 12.11 ? 203 ILE A HG23 1  
ATOM 3180   H HD11 . ILE A 1 203 ? 25.690  -16.585 18.160  1.00 55.11 ? 203 ILE A HD11 1  
ATOM 3181   H HD12 . ILE A 1 203 ? 24.468  -15.691 19.059  1.00 23.25 ? 203 ILE A HD12 1  
ATOM 3182   H HD13 . ILE A 1 203 ? 24.572  -15.520 17.306  1.00 14.51 ? 203 ILE A HD13 1  
ATOM 3183   N N    . ALA A 1 204 ? 19.105  -17.872 16.704  1.00 52.14 ? 204 ALA A N    1  
ATOM 3184   C CA   . ALA A 1 204 ? 17.651  -17.611 16.633  1.00 13.12 ? 204 ALA A CA   1  
ATOM 3185   C C    . ALA A 1 204 ? 16.832  -18.846 17.082  1.00 61.32 ? 204 ALA A C    1  
ATOM 3186   O O    . ALA A 1 204 ? 15.875  -18.727 17.853  1.00 42.43 ? 204 ALA A O    1  
ATOM 3187   C CB   . ALA A 1 204 ? 17.270  -17.191 15.201  1.00 71.51 ? 204 ALA A CB   1  
ATOM 3188   H H    . ALA A 1 204 ? 19.598  -17.992 15.869  1.00 54.34 ? 204 ALA A H    1  
ATOM 3189   H HA   . ALA A 1 204 ? 17.428  -16.778 17.297  1.00 5.33  ? 204 ALA A HA   1  
ATOM 3190   H HB1  . ALA A 1 204 ? 17.849  -16.323 14.911  1.00 3.22  ? 204 ALA A HB1  1  
ATOM 3191   H HB2  . ALA A 1 204 ? 16.217  -16.945 15.154  1.00 74.14 ? 204 ALA A HB2  1  
ATOM 3192   H HB3  . ALA A 1 204 ? 17.478  -18.003 14.513  1.00 61.12 ? 204 ALA A HB3  1  
ATOM 3193   N N    . VAL A 1 205 ? 17.235  -20.028 16.588  1.00 4.53  ? 205 VAL A N    1  
ATOM 3194   C CA   . VAL A 1 205 ? 16.558  -21.308 16.888  1.00 61.33 ? 205 VAL A CA   1  
ATOM 3195   C C    . VAL A 1 205 ? 16.808  -21.753 18.345  1.00 63.23 ? 205 VAL A C    1  
ATOM 3196   O O    . VAL A 1 205 ? 15.866  -22.100 19.069  1.00 44.01 ? 205 VAL A O    1  
ATOM 3197   C CB   . VAL A 1 205 ? 17.037  -22.442 15.899  1.00 41.42 ? 205 VAL A CB   1  
ATOM 3198   C CG1  . VAL A 1 205 ? 16.481  -23.832 16.290  1.00 12.31 ? 205 VAL A CG1  1  
ATOM 3199   C CG2  . VAL A 1 205 ? 16.664  -22.095 14.439  1.00 51.24 ? 205 VAL A CG2  1  
ATOM 3200   H H    . VAL A 1 205 ? 18.016  -20.042 15.999  1.00 44.41 ? 205 VAL A H    1  
ATOM 3201   H HA   . VAL A 1 205 ? 15.488  -21.163 16.745  1.00 25.12 ? 205 VAL A HA   1  
ATOM 3202   H HB   . VAL A 1 205 ? 18.123  -22.494 15.959  1.00 3.30  ? 205 VAL A HB   1  
ATOM 3203   H HG11 . VAL A 1 205 ? 15.397  -23.818 16.270  1.00 53.10 ? 205 VAL A HG11 1  
ATOM 3204   H HG12 . VAL A 1 205 ? 16.813  -24.089 17.287  1.00 54.53 ? 205 VAL A HG12 1  
ATOM 3205   H HG13 . VAL A 1 205 ? 16.843  -24.581 15.596  1.00 3.02  ? 205 VAL A HG13 1  
ATOM 3206   H HG21 . VAL A 1 205 ? 17.038  -22.863 13.774  1.00 42.12 ? 205 VAL A HG21 1  
ATOM 3207   H HG22 . VAL A 1 205 ? 17.110  -21.146 14.166  1.00 0.02  ? 205 VAL A HG22 1  
ATOM 3208   H HG23 . VAL A 1 205 ? 15.588  -22.024 14.336  1.00 64.22 ? 205 VAL A HG23 1  
ATOM 3209   N N    . VAL A 1 206 ? 18.081  -21.748 18.747  1.00 74.41 ? 206 VAL A N    1  
ATOM 3210   C CA   . VAL A 1 206 ? 18.522  -22.301 20.045  1.00 13.23 ? 206 VAL A CA   1  
ATOM 3211   C C    . VAL A 1 206 ? 18.338  -21.268 21.174  1.00 2.34  ? 206 VAL A C    1  
ATOM 3212   O O    . VAL A 1 206 ? 17.993  -21.629 22.309  1.00 33.32 ? 206 VAL A O    1  
ATOM 3213   C CB   . VAL A 1 206 ? 20.018  -22.774 19.944  1.00 2.12  ? 206 VAL A CB   1  
ATOM 3214   C CG1  . VAL A 1 206 ? 20.531  -23.434 21.248  1.00 64.40 ? 206 VAL A CG1  1  
ATOM 3215   C CG2  . VAL A 1 206 ? 20.192  -23.723 18.732  1.00 3.53  ? 206 VAL A CG2  1  
ATOM 3216   H H    . VAL A 1 206 ? 18.755  -21.356 18.154  1.00 24.31 ? 206 VAL A H    1  
ATOM 3217   H HA   . VAL A 1 206 ? 17.906  -23.172 20.266  1.00 0.22  ? 206 VAL A HA   1  
ATOM 3218   H HB   . VAL A 1 206 ? 20.631  -21.893 19.758  1.00 42.23 ? 206 VAL A HB   1  
ATOM 3219   H HG11 . VAL A 1 206 ? 21.572  -23.708 21.133  1.00 73.50 ? 206 VAL A HG11 1  
ATOM 3220   H HG12 . VAL A 1 206 ? 19.951  -24.324 21.468  1.00 11.41 ? 206 VAL A HG12 1  
ATOM 3221   H HG13 . VAL A 1 206 ? 20.436  -22.738 22.069  1.00 64.32 ? 206 VAL A HG13 1  
ATOM 3222   H HG21 . VAL A 1 206 ? 19.586  -24.612 18.866  1.00 0.03  ? 206 VAL A HG21 1  
ATOM 3223   H HG22 . VAL A 1 206 ? 21.230  -24.009 18.638  1.00 64.11 ? 206 VAL A HG22 1  
ATOM 3224   H HG23 . VAL A 1 206 ? 19.883  -23.216 17.825  1.00 2.31  ? 206 VAL A HG23 1  
ATOM 3225   N N    . GLY A 1 207 ? 18.550  -19.980 20.839  1.00 3.02  ? 207 GLY A N    1  
ATOM 3226   C CA   . GLY A 1 207 ? 18.336  -18.888 21.785  1.00 41.05 ? 207 GLY A CA   1  
ATOM 3227   C C    . GLY A 1 207 ? 19.589  -18.514 22.570  1.00 13.21 ? 207 GLY A C    1  
ATOM 3228   O O    . GLY A 1 207 ? 19.703  -18.826 23.766  1.00 72.35 ? 207 GLY A O    1  
ATOM 3229   H H    . GLY A 1 207 ? 18.850  -19.769 19.927  1.00 1.50  ? 207 GLY A H    1  
ATOM 3230   H HA2  . GLY A 1 207 ? 18.006  -18.020 21.226  1.00 1.31  ? 207 GLY A HA2  1  
ATOM 3231   H HA3  . GLY A 1 207 ? 17.547  -19.157 22.480  1.00 11.22 ? 207 GLY A HA3  1  
ATOM 3232   N N    . GLY A 1 208 ? 20.532  -17.837 21.890  1.00 55.24 ? 208 GLY A N    1  
ATOM 3233   C CA   . GLY A 1 208 ? 21.791  -17.384 22.506  1.00 23.14 ? 208 GLY A CA   1  
ATOM 3234   C C    . GLY A 1 208 ? 21.857  -15.871 22.660  1.00 53.44 ? 208 GLY A C    1  
ATOM 3235   O O    . GLY A 1 208 ? 21.019  -15.153 22.114  1.00 35.51 ? 208 GLY A O    1  
ATOM 3236   H H    . GLY A 1 208 ? 20.368  -17.628 20.948  1.00 63.22 ? 208 GLY A H    1  
ATOM 3237   H HA2  . GLY A 1 208 ? 21.908  -17.839 23.483  1.00 50.04 ? 208 GLY A HA2  1  
ATOM 3238   H HA3  . GLY A 1 208 ? 22.613  -17.702 21.879  1.00 73.32 ? 208 GLY A HA3  1  
ATOM 3239   N N    . LYS A 1 209 ? 22.874  -15.385 23.390  1.00 13.35 ? 209 LYS A N    1  
ATOM 3240   C CA   . LYS A 1 209 ? 23.024  -13.948 23.707  1.00 45.21 ? 209 LYS A CA   1  
ATOM 3241   C C    . LYS A 1 209 ? 23.658  -13.166 22.543  1.00 33.14 ? 209 LYS A C    1  
ATOM 3242   O O    . LYS A 1 209 ? 24.710  -13.552 22.016  1.00 44.11 ? 209 LYS A O    1  
ATOM 3243   C CB   . LYS A 1 209 ? 23.873  -13.743 24.989  1.00 25.01 ? 209 LYS A CB   1  
ATOM 3244   C CG   . LYS A 1 209 ? 23.300  -14.411 26.255  1.00 3.03  ? 209 LYS A CG   1  
ATOM 3245   C CD   . LYS A 1 209 ? 24.167  -14.164 27.508  1.00 21.24 ? 209 LYS A CD   1  
ATOM 3246   C CE   . LYS A 1 209 ? 25.604  -14.697 27.362  1.00 10.50 ? 209 LYS A CE   1  
ATOM 3247   N NZ   . LYS A 1 209 ? 26.419  -14.446 28.582  1.00 21.12 ? 209 LYS A NZ   1  
ATOM 3248   H H    . LYS A 1 209 ? 23.544  -16.011 23.723  1.00 35.22 ? 209 LYS A H    1  
ATOM 3249   H HA   . LYS A 1 209 ? 22.029  -13.552 23.893  1.00 14.34 ? 209 LYS A HA   1  
ATOM 3250   H HB2  . LYS A 1 209 ? 24.868  -14.142 24.818  1.00 73.34 ? 209 LYS A HB2  1  
ATOM 3251   H HB3  . LYS A 1 209 ? 23.959  -12.678 25.184  1.00 43.23 ? 209 LYS A HB3  1  
ATOM 3252   H HG2  . LYS A 1 209 ? 22.309  -14.010 26.439  1.00 2.42  ? 209 LYS A HG2  1  
ATOM 3253   H HG3  . LYS A 1 209 ? 23.220  -15.480 26.082  1.00 23.12 ? 209 LYS A HG3  1  
ATOM 3254   H HD2  . LYS A 1 209 ? 24.212  -13.099 27.698  1.00 11.23 ? 209 LYS A HD2  1  
ATOM 3255   H HD3  . LYS A 1 209 ? 23.698  -14.654 28.356  1.00 52.41 ? 209 LYS A HD3  1  
ATOM 3256   H HE2  . LYS A 1 209 ? 25.571  -15.764 27.185  1.00 22.44 ? 209 LYS A HE2  1  
ATOM 3257   H HE3  . LYS A 1 209 ? 26.081  -14.212 26.518  1.00 1.44  ? 209 LYS A HE3  1  
ATOM 3258   H HZ1  . LYS A 1 209 ? 26.005  -14.941 29.393  1.00 42.11 ? 209 LYS A HZ1  1  
ATOM 3259   H HZ2  . LYS A 1 209 ? 26.449  -13.425 28.790  1.00 23.22 ? 209 LYS A HZ2  1  
ATOM 3260   H HZ3  . LYS A 1 209 ? 27.393  -14.786 28.435  1.00 54.10 ? 209 LYS A HZ3  1  
ATOM 3261   N N    . VAL A 1 210 ? 22.987  -12.073 22.152  1.00 42.42 ? 210 VAL A N    1  
ATOM 3262   C CA   . VAL A 1 210 ? 23.524  -11.060 21.221  1.00 2.41  ? 210 VAL A CA   1  
ATOM 3263   C C    . VAL A 1 210 ? 23.656  -9.722  21.970  1.00 2.23  ? 210 VAL A C    1  
ATOM 3264   O O    . VAL A 1 210 ? 23.139  -9.577  23.085  1.00 63.11 ? 210 VAL A O    1  
ATOM 3265   C CB   . VAL A 1 210 ? 22.590  -10.874 19.963  1.00 24.13 ? 210 VAL A CB   1  
ATOM 3266   C CG1  . VAL A 1 210 ? 22.460  -12.190 19.150  1.00 21.23 ? 210 VAL A CG1  1  
ATOM 3267   C CG2  . VAL A 1 210 ? 21.198  -10.336 20.386  1.00 5.52  ? 210 VAL A CG2  1  
ATOM 3268   H H    . VAL A 1 210 ? 22.084  -11.932 22.511  1.00 15.24 ? 210 VAL A H    1  
ATOM 3269   H HA   . VAL A 1 210 ? 24.513  -11.369 20.885  1.00 1.21  ? 210 VAL A HA   1  
ATOM 3270   H HB   . VAL A 1 210 ? 23.050  -10.132 19.312  1.00 11.15 ? 210 VAL A HB   1  
ATOM 3271   H HG11 . VAL A 1 210 ? 23.437  -12.507 18.805  1.00 12.33 ? 210 VAL A HG11 1  
ATOM 3272   H HG12 . VAL A 1 210 ? 21.818  -12.031 18.291  1.00 31.43 ? 210 VAL A HG12 1  
ATOM 3273   H HG13 . VAL A 1 210 ? 22.033  -12.967 19.773  1.00 2.24  ? 210 VAL A HG13 1  
ATOM 3274   H HG21 . VAL A 1 210 ? 21.303  -9.350  20.826  1.00 34.41 ? 210 VAL A HG21 1  
ATOM 3275   H HG22 . VAL A 1 210 ? 20.752  -11.001 21.115  1.00 24.31 ? 210 VAL A HG22 1  
ATOM 3276   H HG23 . VAL A 1 210 ? 20.552  -10.271 19.522  1.00 62.41 ? 210 VAL A HG23 1  
ATOM 3277   N N    . ARG A 1 211 ? 24.345  -8.748  21.365  1.00 71.41 ? 211 ARG A N    1  
ATOM 3278   C CA   . ARG A 1 211 ? 24.429  -7.391  21.929  1.00 71.34 ? 211 ARG A CA   1  
ATOM 3279   C C    . ARG A 1 211 ? 23.241  -6.565  21.403  1.00 53.55 ? 211 ARG A C    1  
ATOM 3280   O O    . ARG A 1 211 ? 23.216  -6.182  20.233  1.00 51.45 ? 211 ARG A O    1  
ATOM 3281   C CB   . ARG A 1 211 ? 25.788  -6.728  21.550  1.00 20.14 ? 211 ARG A CB   1  
ATOM 3282   C CG   . ARG A 1 211 ? 26.032  -5.335  22.185  1.00 60.43 ? 211 ARG A CG   1  
ATOM 3283   C CD   . ARG A 1 211 ? 27.357  -4.676  21.726  1.00 65.31 ? 211 ARG A CD   1  
ATOM 3284   N NE   . ARG A 1 211 ? 27.358  -4.340  20.284  1.00 31.21 ? 211 ARG A NE   1  
ATOM 3285   C CZ   . ARG A 1 211 ? 28.003  -5.022  19.314  1.00 43.21 ? 211 ARG A CZ   1  
ATOM 3286   N NH1  . ARG A 1 211 ? 28.725  -6.104  19.598  1.00 3.32  ? 211 ARG A NH1  1  
ATOM 3287   N NH2  . ARG A 1 211 ? 27.917  -4.614  18.058  1.00 12.41 ? 211 ARG A NH2  1  
ATOM 3288   H H    . ARG A 1 211 ? 24.800  -8.942  20.521  1.00 61.23 ? 211 ARG A H    1  
ATOM 3289   H HA   . ARG A 1 211 ? 24.361  -7.463  23.015  1.00 23.54 ? 211 ARG A HA   1  
ATOM 3290   H HB2  . ARG A 1 211 ? 26.589  -7.386  21.868  1.00 52.44 ? 211 ARG A HB2  1  
ATOM 3291   H HB3  . ARG A 1 211 ? 25.838  -6.625  20.471  1.00 51.42 ? 211 ARG A HB3  1  
ATOM 3292   H HG2  . ARG A 1 211 ? 25.213  -4.680  21.911  1.00 63.40 ? 211 ARG A HG2  1  
ATOM 3293   H HG3  . ARG A 1 211 ? 26.049  -5.441  23.266  1.00 74.32 ? 211 ARG A HG3  1  
ATOM 3294   H HD2  . ARG A 1 211 ? 27.492  -3.756  22.283  1.00 65.23 ? 211 ARG A HD2  1  
ATOM 3295   H HD3  . ARG A 1 211 ? 28.184  -5.343  21.946  1.00 64.24 ? 211 ARG A HD3  1  
ATOM 3296   H HE   . ARG A 1 211 ? 26.857  -3.535  20.028  1.00 1.02  ? 211 ARG A HE   1  
ATOM 3297   H HH11 . ARG A 1 211 ? 28.801  -6.428  20.544  1.00 72.33 ? 211 ARG A HH11 1  
ATOM 3298   H HH12 . ARG A 1 211 ? 29.199  -6.599  18.865  1.00 1.12  ? 211 ARG A HH12 1  
ATOM 3299   H HH21 . ARG A 1 211 ? 27.378  -3.802  17.827  1.00 12.21 ? 211 ARG A HH21 1  
ATOM 3300   H HH22 . ARG A 1 211 ? 28.395  -5.119  17.328  1.00 23.55 ? 211 ARG A HH22 1  
ATOM 3301   N N    . ALA A 1 212 ? 22.246  -6.322  22.271  1.00 24.43 ? 212 ALA A N    1  
ATOM 3302   C CA   . ALA A 1 212 ? 21.077  -5.491  21.939  1.00 62.04 ? 212 ALA A CA   1  
ATOM 3303   C C    . ALA A 1 212 ? 21.245  -4.120  22.595  1.00 61.11 ? 212 ALA A C    1  
ATOM 3304   O O    . ALA A 1 212 ? 21.427  -4.030  23.811  1.00 41.40 ? 212 ALA A O    1  
ATOM 3305   C CB   . ALA A 1 212 ? 19.779  -6.164  22.408  1.00 1.04  ? 212 ALA A CB   1  
ATOM 3306   H H    . ALA A 1 212 ? 22.299  -6.710  23.168  1.00 44.32 ? 212 ALA A H    1  
ATOM 3307   H HA   . ALA A 1 212 ? 21.025  -5.373  20.854  1.00 74.31 ? 212 ALA A HA   1  
ATOM 3308   H HB1  . ALA A 1 212 ? 19.690  -7.141  21.952  1.00 74.41 ? 212 ALA A HB1  1  
ATOM 3309   H HB2  . ALA A 1 212 ? 18.926  -5.560  22.122  1.00 30.43 ? 212 ALA A HB2  1  
ATOM 3310   H HB3  . ALA A 1 212 ? 19.791  -6.275  23.487  1.00 14.43 ? 212 ALA A HB3  1  
ATOM 3311   N N    . MET A 1 213 ? 21.200  -3.063  21.777  1.00 50.14 ? 213 MET A N    1  
ATOM 3312   C CA   . MET A 1 213 ? 21.396  -1.680  22.245  1.00 71.23 ? 213 MET A CA   1  
ATOM 3313   C C    . MET A 1 213 ? 20.221  -1.235  23.140  1.00 50.31 ? 213 MET A C    1  
ATOM 3314   O O    . MET A 1 213 ? 19.074  -1.634  22.915  1.00 20.51 ? 213 MET A O    1  
ATOM 3315   C CB   . MET A 1 213 ? 21.556  -0.735  21.031  1.00 55.33 ? 213 MET A CB   1  
ATOM 3316   C CG   . MET A 1 213 ? 22.739  -1.076  20.111  1.00 44.23 ? 213 MET A CG   1  
ATOM 3317   S SD   . MET A 1 213 ? 22.741  -0.110  18.581  1.00 54.30 ? 213 MET A SD   1  
ATOM 3318   C CE   . MET A 1 213 ? 21.259  -0.709  17.753  1.00 3.22  ? 213 MET A CE   1  
ATOM 3319   H H    . MET A 1 213 ? 21.011  -3.216  20.827  1.00 3.33  ? 213 MET A H    1  
ATOM 3320   H HA   . MET A 1 213 ? 22.313  -1.654  22.832  1.00 20.13 ? 213 MET A HA   1  
ATOM 3321   H HB2  . MET A 1 213 ? 20.648  -0.770  20.438  1.00 45.44 ? 213 MET A HB2  1  
ATOM 3322   H HB3  . MET A 1 213 ? 21.690  0.280   21.391  1.00 0.20  ? 213 MET A HB3  1  
ATOM 3323   H HG2  . MET A 1 213 ? 23.664  -0.876  20.639  1.00 74.15 ? 213 MET A HG2  1  
ATOM 3324   H HG3  . MET A 1 213 ? 22.697  -2.127  19.856  1.00 43.13 ? 213 MET A HG3  1  
ATOM 3325   H HE1  . MET A 1 213 ? 20.394  -0.513  18.372  1.00 13.11 ? 213 MET A HE1  1  
ATOM 3326   H HE2  . MET A 1 213 ? 21.345  -1.772  17.580  1.00 34.34 ? 213 MET A HE2  1  
ATOM 3327   H HE3  . MET A 1 213 ? 21.146  -0.200  16.808  1.00 53.04 ? 213 MET A HE3  1  
ATOM 3328   N N    . THR A 1 214 ? 20.525  -0.437  24.176  1.00 32.24 ? 214 THR A N    1  
ATOM 3329   C CA   . THR A 1 214 ? 19.520  0.091   25.119  1.00 73.23 ? 214 THR A CA   1  
ATOM 3330   C C    . THR A 1 214 ? 19.827  1.590   25.389  1.00 55.21 ? 214 THR A C    1  
ATOM 3331   O O    . THR A 1 214 ? 20.921  2.066   25.061  1.00 74.10 ? 214 THR A O    1  
ATOM 3332   C CB   . THR A 1 214 ? 19.525  -0.761  26.446  1.00 53.34 ? 214 THR A CB   1  
ATOM 3333   O OG1  . THR A 1 214 ? 19.539  -2.165  26.127  1.00 42.52 ? 214 THR A OG1  1  
ATOM 3334   C CG2  . THR A 1 214 ? 18.304  -0.499  27.335  1.00 2.10  ? 214 THR A CG2  1  
ATOM 3335   H H    . THR A 1 214 ? 21.464  -0.190  24.322  1.00 70.23 ? 214 THR A H    1  
ATOM 3336   H HA   . THR A 1 214 ? 18.534  0.017   24.657  1.00 72.22 ? 214 THR A HA   1  
ATOM 3337   H HB   . THR A 1 214 ? 20.426  -0.527  27.007  1.00 3.45  ? 214 THR A HB   1  
ATOM 3338   H HG1  . THR A 1 214 ? 20.217  -2.338  25.470  1.00 12.23 ? 214 THR A HG1  1  
ATOM 3339   H HG21 . THR A 1 214 ? 18.286  0.540   27.638  1.00 13.33 ? 214 THR A HG21 1  
ATOM 3340   H HG22 . THR A 1 214 ? 18.354  -1.128  28.218  1.00 2.22  ? 214 THR A HG22 1  
ATOM 3341   H HG23 . THR A 1 214 ? 17.396  -0.731  26.789  1.00 51.03 ? 214 THR A HG23 1  
ATOM 3342   N N    . LEU A 1 215 ? 18.863  2.320   25.991  1.00 43.12 ? 215 LEU A N    1  
ATOM 3343   C CA   . LEU A 1 215 ? 18.916  3.803   26.146  1.00 1.24  ? 215 LEU A CA   1  
ATOM 3344   C C    . LEU A 1 215 ? 20.039  4.307   27.061  1.00 5.25  ? 215 LEU A C    1  
ATOM 3345   O O    . LEU A 1 215 ? 20.321  5.509   27.095  1.00 52.23 ? 215 LEU A O    1  
ATOM 3346   C CB   . LEU A 1 215 ? 17.541  4.330   26.641  1.00 23.10 ? 215 LEU A CB   1  
ATOM 3347   C CG   . LEU A 1 215 ? 16.354  4.038   25.678  1.00 10.25 ? 215 LEU A CG   1  
ATOM 3348   C CD1  . LEU A 1 215 ? 15.042  4.725   26.137  1.00 63.31 ? 215 LEU A CD1  1  
ATOM 3349   C CD2  . LEU A 1 215 ? 16.742  4.432   24.238  1.00 33.11 ? 215 LEU A CD2  1  
ATOM 3350   H H    . LEU A 1 215 ? 18.079  1.853   26.340  1.00 43.10 ? 215 LEU A H    1  
ATOM 3351   H HA   . LEU A 1 215 ? 19.099  4.215   25.160  1.00 32.04 ? 215 LEU A HA   1  
ATOM 3352   H HB2  . LEU A 1 215 ? 17.326  3.878   27.607  1.00 4.13  ? 215 LEU A HB2  1  
ATOM 3353   H HB3  . LEU A 1 215 ? 17.611  5.404   26.777  1.00 65.43 ? 215 LEU A HB3  1  
ATOM 3354   H HG   . LEU A 1 215 ? 16.167  2.969   25.678  1.00 73.14 ? 215 LEU A HG   1  
ATOM 3355   H HD11 . LEU A 1 215 ? 14.784  4.393   27.135  1.00 0.31  ? 215 LEU A HD11 1  
ATOM 3356   H HD12 . LEU A 1 215 ? 14.236  4.465   25.464  1.00 25.31 ? 215 LEU A HD12 1  
ATOM 3357   H HD13 . LEU A 1 215 ? 15.168  5.801   26.141  1.00 63.42 ? 215 LEU A HD13 1  
ATOM 3358   H HD21 . LEU A 1 215 ? 17.534  3.783   23.885  1.00 23.35 ? 215 LEU A HD21 1  
ATOM 3359   H HD22 . LEU A 1 215 ? 17.086  5.459   24.214  1.00 22.32 ? 215 LEU A HD22 1  
ATOM 3360   H HD23 . LEU A 1 215 ? 15.887  4.328   23.584  1.00 23.22 ? 215 LEU A HD23 1  
ATOM 3361   N N    . GLU A 1 216 ? 20.659  3.402   27.810  1.00 34.44 ? 216 GLU A N    1  
ATOM 3362   C CA   . GLU A 1 216 ? 21.772  3.735   28.711  1.00 63.03 ? 216 GLU A CA   1  
ATOM 3363   C C    . GLU A 1 216 ? 22.960  2.796   28.424  1.00 42.20 ? 216 GLU A C    1  
ATOM 3364   O O    . GLU A 1 216 ? 23.744  2.460   29.320  1.00 20.13 ? 216 GLU A O    1  
ATOM 3365   C CB   . GLU A 1 216 ? 21.289  3.674   30.185  1.00 64.44 ? 216 GLU A CB   1  
ATOM 3366   C CG   . GLU A 1 216 ? 20.077  4.587   30.508  1.00 4.04  ? 216 GLU A CG   1  
ATOM 3367   C CD   . GLU A 1 216 ? 19.859  4.802   32.013  1.00 21.50 ? 216 GLU A CD   1  
ATOM 3368   O OE1  . GLU A 1 216 ? 20.174  5.900   32.521  1.00 21.44 ? 216 GLU A OE1  1  
ATOM 3369   O OE2  . GLU A 1 216 ? 19.410  3.864   32.703  1.00 63.21 ? 216 GLU A OE2  1  
ATOM 3370   H H    . GLU A 1 216 ? 20.370  2.469   27.753  1.00 43.23 ? 216 GLU A H    1  
ATOM 3371   H HA   . GLU A 1 216 ? 22.102  4.751   28.494  1.00 40.24 ? 216 GLU A HA   1  
ATOM 3372   H HB2  . GLU A 1 216 ? 21.016  2.651   30.422  1.00 13.11 ? 216 GLU A HB2  1  
ATOM 3373   H HB3  . GLU A 1 216 ? 22.116  3.966   30.824  1.00 4.51  ? 216 GLU A HB3  1  
ATOM 3374   H HG2  . GLU A 1 216 ? 20.226  5.552   30.028  1.00 51.21 ? 216 GLU A HG2  1  
ATOM 3375   H HG3  . GLU A 1 216 ? 19.182  4.135   30.091  1.00 32.00 ? 216 GLU A HG3  1  
ATOM 3376   N N    . GLY A 1 217 ? 23.065  2.388   27.140  1.00 12.14 ? 217 GLY A N    1  
ATOM 3377   C CA   . GLY A 1 217 ? 24.167  1.555   26.642  1.00 20.31 ? 217 GLY A CA   1  
ATOM 3378   C C    . GLY A 1 217 ? 23.713  0.157   26.223  1.00 33.00 ? 217 GLY A C    1  
ATOM 3379   O O    . GLY A 1 217 ? 22.641  -0.284  26.641  1.00 25.45 ? 217 GLY A O    1  
ATOM 3380   H H    . GLY A 1 217 ? 22.367  2.665   26.509  1.00 63.05 ? 217 GLY A H    1  
ATOM 3381   H HA2  . GLY A 1 217 ? 24.597  2.050   25.780  1.00 53.45 ? 217 GLY A HA2  1  
ATOM 3382   H HA3  . GLY A 1 217 ? 24.934  1.461   27.401  1.00 53.34 ? 217 GLY A HA3  1  
ATOM 3383   N N    . PRO A 1 218 ? 24.513  -0.580  25.387  1.00 32.14 ? 218 PRO A N    1  
ATOM 3384   C CA   . PRO A 1 218 ? 24.149  -1.933  24.901  1.00 44.30 ? 218 PRO A CA   1  
ATOM 3385   C C    . PRO A 1 218 ? 24.304  -3.000  26.001  1.00 30.52 ? 218 PRO A C    1  
ATOM 3386   O O    . PRO A 1 218 ? 25.243  -2.937  26.796  1.00 5.42  ? 218 PRO A O    1  
ATOM 3387   C CB   . PRO A 1 218 ? 25.139  -2.186  23.725  1.00 32.34 ? 218 PRO A CB   1  
ATOM 3388   C CG   . PRO A 1 218 ? 25.882  -0.897  23.527  1.00 11.34 ? 218 PRO A CG   1  
ATOM 3389   C CD   . PRO A 1 218 ? 25.831  -0.171  24.849  1.00 70.23 ? 218 PRO A CD   1  
ATOM 3390   H HA   . PRO A 1 218 ? 23.126  -1.949  24.524  1.00 25.33 ? 218 PRO A HA   1  
ATOM 3391   H HB2  . PRO A 1 218 ? 25.829  -2.997  23.970  1.00 71.21 ? 218 PRO A HB2  1  
ATOM 3392   H HB3  . PRO A 1 218 ? 24.595  -2.442  22.823  1.00 14.32 ? 218 PRO A HB3  1  
ATOM 3393   H HG2  . PRO A 1 218 ? 26.915  -1.100  23.245  1.00 35.35 ? 218 PRO A HG2  1  
ATOM 3394   H HG3  . PRO A 1 218 ? 25.404  -0.299  22.761  1.00 34.35 ? 218 PRO A HG3  1  
ATOM 3395   H HD2  . PRO A 1 218 ? 26.637  -0.496  25.506  1.00 74.13 ? 218 PRO A HD2  1  
ATOM 3396   H HD3  . PRO A 1 218 ? 25.883  0.901   24.698  1.00 53.24 ? 218 PRO A HD3  1  
ATOM 3397   N N    . VAL A 1 219 ? 23.383  -3.976  26.026  1.00 43.40 ? 219 VAL A N    1  
ATOM 3398   C CA   . VAL A 1 219 ? 23.367  -5.070  27.014  1.00 73.32 ? 219 VAL A CA   1  
ATOM 3399   C C    . VAL A 1 219 ? 23.259  -6.431  26.290  1.00 62.24 ? 219 VAL A C    1  
ATOM 3400   O O    . VAL A 1 219 ? 22.724  -6.502  25.176  1.00 22.23 ? 219 VAL A O    1  
ATOM 3401   C CB   . VAL A 1 219 ? 22.183  -4.895  28.049  1.00 61.10 ? 219 VAL A CB   1  
ATOM 3402   C CG1  . VAL A 1 219 ? 22.329  -3.576  28.859  1.00 73.40 ? 219 VAL A CG1  1  
ATOM 3403   C CG2  . VAL A 1 219 ? 20.794  -4.962  27.355  1.00 54.42 ? 219 VAL A CG2  1  
ATOM 3404   H H    . VAL A 1 219 ? 22.687  -3.972  25.347  1.00 72.42 ? 219 VAL A H    1  
ATOM 3405   H HA   . VAL A 1 219 ? 24.310  -5.050  27.563  1.00 21.34 ? 219 VAL A HA   1  
ATOM 3406   H HB   . VAL A 1 219 ? 22.238  -5.719  28.756  1.00 50.41 ? 219 VAL A HB   1  
ATOM 3407   H HG11 . VAL A 1 219 ? 22.286  -2.726  28.189  1.00 4.25  ? 219 VAL A HG11 1  
ATOM 3408   H HG12 . VAL A 1 219 ? 23.280  -3.569  29.378  1.00 54.35 ? 219 VAL A HG12 1  
ATOM 3409   H HG13 . VAL A 1 219 ? 21.530  -3.499  29.587  1.00 33.11 ? 219 VAL A HG13 1  
ATOM 3410   H HG21 . VAL A 1 219 ? 20.008  -4.839  28.091  1.00 63.50 ? 219 VAL A HG21 1  
ATOM 3411   H HG22 . VAL A 1 219 ? 20.670  -5.923  26.869  1.00 43.44 ? 219 VAL A HG22 1  
ATOM 3412   H HG23 . VAL A 1 219 ? 20.713  -4.178  26.612  1.00 31.44 ? 219 VAL A HG23 1  
ATOM 3413   N N    . GLU A 1 220 ? 23.794  -7.500  26.915  1.00 13.51 ? 220 GLU A N    1  
ATOM 3414   C CA   . GLU A 1 220 ? 23.700  -8.874  26.372  1.00 21.25 ? 220 GLU A CA   1  
ATOM 3415   C C    . GLU A 1 220 ? 22.303  -9.473  26.655  1.00 74.41 ? 220 GLU A C    1  
ATOM 3416   O O    . GLU A 1 220 ? 21.894  -9.626  27.809  1.00 61.14 ? 220 GLU A O    1  
ATOM 3417   C CB   . GLU A 1 220 ? 24.826  -9.790  26.940  1.00 33.14 ? 220 GLU A CB   1  
ATOM 3418   C CG   . GLU A 1 220 ? 24.944  -9.823  28.488  1.00 62.10 ? 220 GLU A CG   1  
ATOM 3419   C CD   . GLU A 1 220 ? 25.864  -10.938 29.015  1.00 42.03 ? 220 GLU A CD   1  
ATOM 3420   O OE1  . GLU A 1 220 ? 25.367  -11.894 29.653  1.00 53.35 ? 220 GLU A OE1  1  
ATOM 3421   O OE2  . GLU A 1 220 ? 27.084  -10.877 28.773  1.00 75.04 ? 220 GLU A OE2  1  
ATOM 3422   H H    . GLU A 1 220 ? 24.274  -7.360  27.755  1.00 52.43 ? 220 GLU A H    1  
ATOM 3423   H HA   . GLU A 1 220 ? 23.831  -8.803  25.290  1.00 63.44 ? 220 GLU A HA   1  
ATOM 3424   H HB2  . GLU A 1 220 ? 24.653  -10.803 26.590  1.00 33.24 ? 220 GLU A HB2  1  
ATOM 3425   H HB3  . GLU A 1 220 ? 25.775  -9.452  26.537  1.00 32.52 ? 220 GLU A HB3  1  
ATOM 3426   H HG2  . GLU A 1 220 ? 25.338  -8.870  28.828  1.00 24.30 ? 220 GLU A HG2  1  
ATOM 3427   H HG3  . GLU A 1 220 ? 23.951  -9.954  28.907  1.00 63.33 ? 220 GLU A HG3  1  
ATOM 3428   N N    . VAL A 1 221 ? 21.568  -9.790  25.581  1.00 32.01 ? 221 VAL A N    1  
ATOM 3429   C CA   . VAL A 1 221 ? 20.197  -10.314 25.655  1.00 34.03 ? 221 VAL A CA   1  
ATOM 3430   C C    . VAL A 1 221 ? 20.163  -11.720 25.036  1.00 22.45 ? 221 VAL A C    1  
ATOM 3431   O O    . VAL A 1 221 ? 20.431  -11.871 23.837  1.00 74.13 ? 221 VAL A O    1  
ATOM 3432   C CB   . VAL A 1 221 ? 19.198  -9.358  24.892  1.00 22.32 ? 221 VAL A CB   1  
ATOM 3433   C CG1  . VAL A 1 221 ? 17.746  -9.884  24.943  1.00 33.35 ? 221 VAL A CG1  1  
ATOM 3434   C CG2  . VAL A 1 221 ? 19.284  -7.916  25.453  1.00 24.14 ? 221 VAL A CG2  1  
ATOM 3435   H H    . VAL A 1 221 ? 21.964  -9.674  24.696  1.00 12.40 ? 221 VAL A H    1  
ATOM 3436   H HA   . VAL A 1 221 ? 19.890  -10.371 26.701  1.00 74.51 ? 221 VAL A HA   1  
ATOM 3437   H HB   . VAL A 1 221 ? 19.499  -9.323  23.846  1.00 22.23 ? 221 VAL A HB   1  
ATOM 3438   H HG11 . VAL A 1 221 ? 17.089  -9.211  24.404  1.00 12.04 ? 221 VAL A HG11 1  
ATOM 3439   H HG12 . VAL A 1 221 ? 17.416  -9.952  25.974  1.00 41.31 ? 221 VAL A HG12 1  
ATOM 3440   H HG13 . VAL A 1 221 ? 17.699  -10.864 24.491  1.00 64.32 ? 221 VAL A HG13 1  
ATOM 3441   H HG21 . VAL A 1 221 ? 18.590  -7.271  24.925  1.00 52.14 ? 221 VAL A HG21 1  
ATOM 3442   H HG22 . VAL A 1 221 ? 20.287  -7.534  25.320  1.00 51.31 ? 221 VAL A HG22 1  
ATOM 3443   H HG23 . VAL A 1 221 ? 19.042  -7.914  26.509  1.00 21.01 ? 221 VAL A HG23 1  
ATOM 3444   N N    . ALA A 1 222 ? 19.880  -12.744 25.867  1.00 55.52 ? 222 ALA A N    1  
ATOM 3445   C CA   . ALA A 1 222 ? 19.664  -14.113 25.382  1.00 51.12 ? 222 ALA A CA   1  
ATOM 3446   C C    . ALA A 1 222 ? 18.370  -14.169 24.569  1.00 60.25 ? 222 ALA A C    1  
ATOM 3447   O O    . ALA A 1 222 ? 17.293  -14.180 25.148  1.00 21.12 ? 222 ALA A O    1  
ATOM 3448   C CB   . ALA A 1 222 ? 19.623  -15.105 26.557  1.00 12.12 ? 222 ALA A CB   1  
ATOM 3449   H H    . ALA A 1 222 ? 19.815  -12.571 26.833  1.00 54.32 ? 222 ALA A H    1  
ATOM 3450   H HA   . ALA A 1 222 ? 20.505  -14.387 24.744  1.00 41.34 ? 222 ALA A HA   1  
ATOM 3451   H HB1  . ALA A 1 222 ? 19.490  -16.114 26.186  1.00 70.40 ? 222 ALA A HB1  1  
ATOM 3452   H HB2  . ALA A 1 222 ? 18.805  -14.856 27.218  1.00 64.21 ? 222 ALA A HB2  1  
ATOM 3453   H HB3  . ALA A 1 222 ? 20.554  -15.049 27.112  1.00 14.34 ? 222 ALA A HB3  1  
ATOM 3454   N N    . VAL A 1 223 ? 18.511  -14.183 23.231  1.00 61.04 ? 223 VAL A N    1  
ATOM 3455   C CA   . VAL A 1 223 ? 17.384  -14.219 22.273  1.00 25.50 ? 223 VAL A CA   1  
ATOM 3456   C C    . VAL A 1 223 ? 16.450  -15.416 22.603  1.00 13.41 ? 223 VAL A C    1  
ATOM 3457   O O    . VAL A 1 223 ? 16.956  -16.472 22.978  1.00 55.21 ? 223 VAL A O    1  
ATOM 3458   C CB   . VAL A 1 223 ? 17.945  -14.347 20.794  1.00 0.25  ? 223 VAL A CB   1  
ATOM 3459   C CG1  . VAL A 1 223 ? 16.823  -14.434 19.732  1.00 10.24 ? 223 VAL A CG1  1  
ATOM 3460   C CG2  . VAL A 1 223 ? 18.909  -13.178 20.468  1.00 63.14 ? 223 VAL A CG2  1  
ATOM 3461   H H    . VAL A 1 223 ? 19.414  -14.170 22.869  1.00 51.21 ? 223 VAL A H    1  
ATOM 3462   H HA   . VAL A 1 223 ? 16.832  -13.285 22.357  1.00 62.15 ? 223 VAL A HA   1  
ATOM 3463   H HB   . VAL A 1 223 ? 18.523  -15.270 20.740  1.00 44.13 ? 223 VAL A HB   1  
ATOM 3464   H HG11 . VAL A 1 223 ? 16.203  -15.296 19.931  1.00 42.33 ? 223 VAL A HG11 1  
ATOM 3465   H HG12 . VAL A 1 223 ? 17.255  -14.529 18.742  1.00 41.41 ? 223 VAL A HG12 1  
ATOM 3466   H HG13 . VAL A 1 223 ? 16.215  -13.539 19.770  1.00 4.13  ? 223 VAL A HG13 1  
ATOM 3467   H HG21 . VAL A 1 223 ? 19.726  -13.166 21.182  1.00 71.01 ? 223 VAL A HG21 1  
ATOM 3468   H HG22 . VAL A 1 223 ? 18.379  -12.236 20.524  1.00 71.22 ? 223 VAL A HG22 1  
ATOM 3469   H HG23 . VAL A 1 223 ? 19.315  -13.299 19.471  1.00 33.35 ? 223 VAL A HG23 1  
ATOM 3470   N N    . PRO A 1 224 ? 15.082  -15.253 22.565  1.00 75.51 ? 224 PRO A N    1  
ATOM 3471   C CA   . PRO A 1 224 ? 14.134  -16.390 22.743  1.00 70.34 ? 224 PRO A CA   1  
ATOM 3472   C C    . PRO A 1 224 ? 14.394  -17.524 21.719  1.00 72.10 ? 224 PRO A C    1  
ATOM 3473   O O    . PRO A 1 224 ? 14.991  -17.276 20.662  1.00 60.11 ? 224 PRO A O    1  
ATOM 3474   C CB   . PRO A 1 224 ? 12.734  -15.735 22.542  1.00 31.53 ? 224 PRO A CB   1  
ATOM 3475   C CG   . PRO A 1 224 ? 13.011  -14.426 21.871  1.00 25.20 ? 224 PRO A CG   1  
ATOM 3476   C CD   . PRO A 1 224 ? 14.353  -13.975 22.392  1.00 21.35 ? 224 PRO A CD   1  
ATOM 3477   H HA   . PRO A 1 224 ? 14.208  -16.796 23.746  1.00 31.14 ? 224 PRO A HA   1  
ATOM 3478   H HB2  . PRO A 1 224 ? 12.092  -16.366 21.926  1.00 64.14 ? 224 PRO A HB2  1  
ATOM 3479   H HB3  . PRO A 1 224 ? 12.258  -15.566 23.503  1.00 71.22 ? 224 PRO A HB3  1  
ATOM 3480   H HG2  . PRO A 1 224 ? 13.046  -14.562 20.790  1.00 25.23 ? 224 PRO A HG2  1  
ATOM 3481   H HG3  . PRO A 1 224 ? 12.249  -13.700 22.128  1.00 35.44 ? 224 PRO A HG3  1  
ATOM 3482   H HD2  . PRO A 1 224 ? 14.848  -13.335 21.671  1.00 1.33  ? 224 PRO A HD2  1  
ATOM 3483   H HD3  . PRO A 1 224 ? 14.249  -13.463 23.341  1.00 71.43 ? 224 PRO A HD3  1  
ATOM 3484   N N    . PRO A 1 225 ? 13.987  -18.792 22.021  1.00 15.21 ? 225 PRO A N    1  
ATOM 3485   C CA   . PRO A 1 225 ? 14.154  -19.900 21.073  1.00 52.12 ? 225 PRO A CA   1  
ATOM 3486   C C    . PRO A 1 225 ? 13.081  -19.865 19.966  1.00 14.12 ? 225 PRO A C    1  
ATOM 3487   O O    . PRO A 1 225 ? 11.972  -19.345 20.170  1.00 72.53 ? 225 PRO A O    1  
ATOM 3488   C CB   . PRO A 1 225 ? 14.029  -21.146 21.972  1.00 51.41 ? 225 PRO A CB   1  
ATOM 3489   C CG   . PRO A 1 225 ? 13.108  -20.732 23.081  1.00 34.23 ? 225 PRO A CG   1  
ATOM 3490   C CD   . PRO A 1 225 ? 13.343  -19.246 23.294  1.00 62.04 ? 225 PRO A CD   1  
ATOM 3491   H HA   . PRO A 1 225 ? 15.142  -19.878 20.610  1.00 3.24  ? 225 PRO A HA   1  
ATOM 3492   H HB2  . PRO A 1 225 ? 13.620  -21.986 21.410  1.00 52.13 ? 225 PRO A HB2  1  
ATOM 3493   H HB3  . PRO A 1 225 ? 15.001  -21.417 22.374  1.00 0.23  ? 225 PRO A HB3  1  
ATOM 3494   H HG2  . PRO A 1 225 ? 12.076  -20.916 22.789  1.00 65.20 ? 225 PRO A HG2  1  
ATOM 3495   H HG3  . PRO A 1 225 ? 13.341  -21.280 23.985  1.00 2.12  ? 225 PRO A HG3  1  
ATOM 3496   H HD2  . PRO A 1 225 ? 12.401  -18.729 23.453  1.00 34.21 ? 225 PRO A HD2  1  
ATOM 3497   H HD3  . PRO A 1 225 ? 14.002  -19.076 24.138  1.00 3.51  ? 225 PRO A HD3  1  
ATOM 3498   N N    . ARG A 1 226 ? 13.458  -20.407 18.789  1.00 12.21 ? 226 ARG A N    1  
ATOM 3499   C CA   . ARG A 1 226 ? 12.574  -20.588 17.613  1.00 41.35 ? 226 ARG A CA   1  
ATOM 3500   C C    . ARG A 1 226 ? 12.154  -19.229 17.005  1.00 10.12 ? 226 ARG A C    1  
ATOM 3501   O O    . ARG A 1 226 ? 11.119  -19.124 16.337  1.00 61.11 ? 226 ARG A O    1  
ATOM 3502   C CB   . ARG A 1 226 ? 11.350  -21.493 17.966  1.00 61.21 ? 226 ARG A CB   1  
ATOM 3503   C CG   . ARG A 1 226 ? 11.745  -22.781 18.723  1.00 3.04  ? 226 ARG A CG   1  
ATOM 3504   C CD   . ARG A 1 226 ? 10.620  -23.828 18.831  1.00 53.23 ? 226 ARG A CD   1  
ATOM 3505   N NE   . ARG A 1 226 ? 10.988  -24.956 19.713  1.00 51.24 ? 226 ARG A NE   1  
ATOM 3506   C CZ   . ARG A 1 226 ? 11.842  -25.962 19.420  1.00 61.15 ? 226 ARG A CZ   1  
ATOM 3507   N NH1  . ARG A 1 226 ? 12.469  -26.041 18.248  1.00 74.04 ? 226 ARG A NH1  1  
ATOM 3508   N NH2  . ARG A 1 226 ? 12.077  -26.887 20.336  1.00 11.34 ? 226 ARG A NH2  1  
ATOM 3509   H H    . ARG A 1 226 ? 14.391  -20.683 18.696  1.00 31.21 ? 226 ARG A H    1  
ATOM 3510   H HA   . ARG A 1 226 ? 13.168  -21.102 16.863  1.00 72.22 ? 226 ARG A HA   1  
ATOM 3511   H HB2  . ARG A 1 226 ? 10.661  -20.929 18.588  1.00 42.10 ? 226 ARG A HB2  1  
ATOM 3512   H HB3  . ARG A 1 226 ? 10.843  -21.774 17.052  1.00 34.12 ? 226 ARG A HB3  1  
ATOM 3513   H HG2  . ARG A 1 226 ? 12.594  -23.240 18.226  1.00 41.51 ? 226 ARG A HG2  1  
ATOM 3514   H HG3  . ARG A 1 226 ? 12.043  -22.487 19.722  1.00 11.14 ? 226 ARG A HG3  1  
ATOM 3515   H HD2  . ARG A 1 226 ? 9.738   -23.352 19.238  1.00 44.43 ? 226 ARG A HD2  1  
ATOM 3516   H HD3  . ARG A 1 226 ? 10.395  -24.211 17.843  1.00 33.02 ? 226 ARG A HD3  1  
ATOM 3517   H HE   . ARG A 1 226 ? 10.559  -24.967 20.596  1.00 71.21 ? 226 ARG A HE   1  
ATOM 3518   H HH11 . ARG A 1 226 ? 12.319  -25.343 17.542  1.00 61.14 ? 226 ARG A HH11 1  
ATOM 3519   H HH12 . ARG A 1 226 ? 13.099  -26.806 18.068  1.00 22.42 ? 226 ARG A HH12 1  
ATOM 3520   H HH21 . ARG A 1 226 ? 11.627  -26.838 21.232  1.00 75.13 ? 226 ARG A HH21 1  
ATOM 3521   H HH22 . ARG A 1 226 ? 12.712  -27.645 20.137  1.00 3.41  ? 226 ARG A HH22 1  
ATOM 3522   N N    . THR A 1 227 ? 13.019  -18.226 17.215  1.00 64.32 ? 227 THR A N    1  
ATOM 3523   C CA   . THR A 1 227 ? 12.861  -16.868 16.689  1.00 42.20 ? 227 THR A CA   1  
ATOM 3524   C C    . THR A 1 227 ? 12.913  -16.850 15.136  1.00 4.23  ? 227 THR A C    1  
ATOM 3525   O O    . THR A 1 227 ? 13.961  -17.092 14.541  1.00 22.34 ? 227 THR A O    1  
ATOM 3526   C CB   . THR A 1 227 ? 13.953  -15.939 17.329  1.00 31.50 ? 227 THR A CB   1  
ATOM 3527   O OG1  . THR A 1 227 ? 13.675  -15.782 18.728  1.00 23.31 ? 227 THR A OG1  1  
ATOM 3528   C CG2  . THR A 1 227 ? 14.050  -14.553 16.684  1.00 13.12 ? 227 THR A CG2  1  
ATOM 3529   H H    . THR A 1 227 ? 13.810  -18.411 17.763  1.00 4.51  ? 227 THR A H    1  
ATOM 3530   H HA   . THR A 1 227 ? 11.888  -16.508 17.009  1.00 11.24 ? 227 THR A HA   1  
ATOM 3531   H HB   . THR A 1 227 ? 14.918  -16.434 17.229  1.00 13.02 ? 227 THR A HB   1  
ATOM 3532   H HG1  . THR A 1 227 ? 13.831  -16.616 19.177  1.00 2.03  ? 227 THR A HG1  1  
ATOM 3533   H HG21 . THR A 1 227 ? 14.812  -13.972 17.189  1.00 64.14 ? 227 THR A HG21 1  
ATOM 3534   H HG22 . THR A 1 227 ? 13.101  -14.041 16.766  1.00 55.42 ? 227 THR A HG22 1  
ATOM 3535   H HG23 . THR A 1 227 ? 14.311  -14.651 15.637  1.00 12.42 ? 227 THR A HG23 1  
ATOM 3536   N N    . GLN A 1 228 ? 11.745  -16.599 14.505  1.00 71.41 ? 228 GLN A N    1  
ATOM 3537   C CA   . GLN A 1 228 ? 11.582  -16.562 13.034  1.00 41.02 ? 228 GLN A CA   1  
ATOM 3538   C C    . GLN A 1 228 ? 11.538  -15.099 12.528  1.00 33.02 ? 228 GLN A C    1  
ATOM 3539   O O    . GLN A 1 228 ? 11.018  -14.216 13.219  1.00 41.24 ? 228 GLN A O    1  
ATOM 3540   C CB   . GLN A 1 228 ? 10.279  -17.309 12.652  1.00 33.44 ? 228 GLN A CB   1  
ATOM 3541   C CG   . GLN A 1 228 ? 9.975   -17.349 11.144  1.00 31.44 ? 228 GLN A CG   1  
ATOM 3542   C CD   . GLN A 1 228 ? 8.634   -18.006 10.814  1.00 32.44 ? 228 GLN A CD   1  
ATOM 3543   O OE1  . GLN A 1 228 ? 7.601   -17.335 10.749  1.00 2.13  ? 228 GLN A OE1  1  
ATOM 3544   N NE2  . GLN A 1 228 ? 8.633   -19.313 10.602  1.00 75.32 ? 228 GLN A NE2  1  
ATOM 3545   H H    . GLN A 1 228 ? 10.953  -16.430 15.057  1.00 40.52 ? 228 GLN A H    1  
ATOM 3546   H HA   . GLN A 1 228 ? 12.430  -17.071 12.577  1.00 70.13 ? 228 GLN A HA   1  
ATOM 3547   H HB2  . GLN A 1 228 ? 10.350  -18.331 13.010  1.00 14.13 ? 228 GLN A HB2  1  
ATOM 3548   H HB3  . GLN A 1 228 ? 9.448   -16.826 13.155  1.00 62.10 ? 228 GLN A HB3  1  
ATOM 3549   H HG2  . GLN A 1 228 ? 9.961   -16.333 10.765  1.00 52.41 ? 228 GLN A HG2  1  
ATOM 3550   H HG3  . GLN A 1 228 ? 10.767  -17.896 10.643  1.00 63.53 ? 228 GLN A HG3  1  
ATOM 3551   H HE21 . GLN A 1 228 ? 9.483   -19.789 10.671  1.00 5.10  ? 228 GLN A HE21 1  
ATOM 3552   H HE22 . GLN A 1 228 ? 7.787   -19.747 10.379  1.00 74.41 ? 228 GLN A HE22 1  
ATOM 3553   N N    . ALA A 1 229 ? 12.076  -14.859 11.306  1.00 33.24 ? 229 ALA A N    1  
ATOM 3554   C CA   . ALA A 1 229 ? 12.119  -13.513 10.688  1.00 1.23  ? 229 ALA A CA   1  
ATOM 3555   C C    . ALA A 1 229 ? 10.732  -13.029 10.246  1.00 20.53 ? 229 ALA A C    1  
ATOM 3556   O O    . ALA A 1 229 ? 9.899   -13.819 9.780   1.00 60.51 ? 229 ALA A O    1  
ATOM 3557   C CB   . ALA A 1 229 ? 13.088  -13.481 9.502   1.00 62.31 ? 229 ALA A CB   1  
ATOM 3558   H H    . ALA A 1 229 ? 12.459  -15.613 10.810  1.00 65.12 ? 229 ALA A H    1  
ATOM 3559   H HA   . ALA A 1 229 ? 12.503  -12.826 11.440  1.00 42.34 ? 229 ALA A HA   1  
ATOM 3560   H HB1  . ALA A 1 229 ? 12.742  -14.148 8.722   1.00 41.32 ? 229 ALA A HB1  1  
ATOM 3561   H HB2  . ALA A 1 229 ? 14.071  -13.798 9.829   1.00 42.21 ? 229 ALA A HB2  1  
ATOM 3562   H HB3  . ALA A 1 229 ? 13.155  -12.474 9.109   1.00 44.10 ? 229 ALA A HB3  1  
ATOM 3563   N N    . GLY A 1 230 ? 10.521  -11.709 10.367  1.00 73.32 ? 230 GLY A N    1  
ATOM 3564   C CA   . GLY A 1 230 ? 9.233   -11.082 10.056  1.00 71.55 ? 230 GLY A CA   1  
ATOM 3565   C C    . GLY A 1 230 ? 8.361   -10.908 11.290  1.00 12.45 ? 230 GLY A C    1  
ATOM 3566   O O    . GLY A 1 230 ? 7.257   -10.359 11.202  1.00 13.20 ? 230 GLY A O    1  
ATOM 3567   H H    . GLY A 1 230 ? 11.260  -11.142 10.687  1.00 75.54 ? 230 GLY A H    1  
ATOM 3568   H HA2  . GLY A 1 230 ? 9.420   -10.109 9.627   1.00 73.43 ? 230 GLY A HA2  1  
ATOM 3569   H HA3  . GLY A 1 230 ? 8.696   -11.683 9.327   1.00 71.45 ? 230 GLY A HA3  1  
ATOM 3570   N N    . ARG A 1 231 ? 8.866   -11.365 12.452  1.00 43.33 ? 231 ARG A N    1  
ATOM 3571   C CA   . ARG A 1 231 ? 8.125   -11.354 13.726  1.00 42.03 ? 231 ARG A CA   1  
ATOM 3572   C C    . ARG A 1 231 ? 8.703   -10.322 14.702  1.00 54.41 ? 231 ARG A C    1  
ATOM 3573   O O    . ARG A 1 231 ? 9.778   -9.770  14.473  1.00 32.51 ? 231 ARG A O    1  
ATOM 3574   C CB   . ARG A 1 231 ? 8.147   -12.763 14.354  1.00 74.00 ? 231 ARG A CB   1  
ATOM 3575   C CG   . ARG A 1 231 ? 7.496   -13.857 13.475  1.00 31.42 ? 231 ARG A CG   1  
ATOM 3576   C CD   . ARG A 1 231 ? 7.400   -15.200 14.200  1.00 24.43 ? 231 ARG A CD   1  
ATOM 3577   N NE   . ARG A 1 231 ? 6.829   -16.255 13.358  1.00 72.35 ? 231 ARG A NE   1  
ATOM 3578   C CZ   . ARG A 1 231 ? 6.422   -17.448 13.805  1.00 2.44  ? 231 ARG A CZ   1  
ATOM 3579   N NH1  . ARG A 1 231 ? 6.515   -17.765 15.093  1.00 54.41 ? 231 ARG A NH1  1  
ATOM 3580   N NH2  . ARG A 1 231 ? 5.953   -18.335 12.945  1.00 63.11 ? 231 ARG A NH2  1  
ATOM 3581   H H    . ARG A 1 231 ? 9.780   -11.722 12.455  1.00 71.11 ? 231 ARG A H    1  
ATOM 3582   H HA   . ARG A 1 231 ? 7.091   -11.082 13.520  1.00 34.02 ? 231 ARG A HA   1  
ATOM 3583   H HB2  . ARG A 1 231 ? 9.180   -13.049 14.540  1.00 43.42 ? 231 ARG A HB2  1  
ATOM 3584   H HB3  . ARG A 1 231 ? 7.621   -12.733 15.305  1.00 40.43 ? 231 ARG A HB3  1  
ATOM 3585   H HG2  . ARG A 1 231 ? 6.496   -13.537 13.197  1.00 11.25 ? 231 ARG A HG2  1  
ATOM 3586   H HG3  . ARG A 1 231 ? 8.091   -13.982 12.578  1.00 55.11 ? 231 ARG A HG3  1  
ATOM 3587   H HD2  . ARG A 1 231 ? 8.394   -15.506 14.509  1.00 0.34  ? 231 ARG A HD2  1  
ATOM 3588   H HD3  . ARG A 1 231 ? 6.778   -15.078 15.083  1.00 74.44 ? 231 ARG A HD3  1  
ATOM 3589   H HE   . ARG A 1 231 ? 6.763   -16.068 12.395  1.00 41.44 ? 231 ARG A HE   1  
ATOM 3590   H HH11 . ARG A 1 231 ? 6.893   -17.111 15.749  1.00 12.22 ? 231 ARG A HH11 1  
ATOM 3591   H HH12 . ARG A 1 231 ? 6.206   -18.666 15.414  1.00 65.44 ? 231 ARG A HH12 1  
ATOM 3592   H HH21 . ARG A 1 231 ? 5.906   -18.112 11.970  1.00 14.40 ? 231 ARG A HH21 1  
ATOM 3593   H HH22 . ARG A 1 231 ? 5.645   -19.239 13.267  1.00 12.42 ? 231 ARG A HH22 1  
ATOM 3594   N N    . LYS A 1 232 ? 7.949   -10.059 15.785  1.00 62.30 ? 232 LYS A N    1  
ATOM 3595   C CA   . LYS A 1 232 ? 8.299   -9.057  16.815  1.00 43.25 ? 232 LYS A CA   1  
ATOM 3596   C C    . LYS A 1 232 ? 8.472   -9.749  18.185  1.00 72.22 ? 232 LYS A C    1  
ATOM 3597   O O    . LYS A 1 232 ? 7.519   -10.323 18.723  1.00 14.22 ? 232 LYS A O    1  
ATOM 3598   C CB   . LYS A 1 232 ? 7.201   -7.934  16.861  1.00 41.01 ? 232 LYS A CB   1  
ATOM 3599   C CG   . LYS A 1 232 ? 7.535   -6.629  16.076  1.00 33.53 ? 232 LYS A CG   1  
ATOM 3600   C CD   . LYS A 1 232 ? 7.874   -6.838  14.581  1.00 61.24 ? 232 LYS A CD   1  
ATOM 3601   C CE   . LYS A 1 232 ? 6.715   -7.423  13.751  1.00 51.21 ? 232 LYS A CE   1  
ATOM 3602   N NZ   . LYS A 1 232 ? 7.150   -7.749  12.362  1.00 2.53  ? 232 LYS A NZ   1  
ATOM 3603   H H    . LYS A 1 232 ? 7.117   -10.564 15.901  1.00 51.22 ? 232 LYS A H    1  
ATOM 3604   H HA   . LYS A 1 232 ? 9.250   -8.605  16.541  1.00 31.52 ? 232 LYS A HA   1  
ATOM 3605   H HB2  . LYS A 1 232 ? 6.272   -8.335  16.464  1.00 34.30 ? 232 LYS A HB2  1  
ATOM 3606   H HB3  . LYS A 1 232 ? 7.022   -7.655  17.895  1.00 21.22 ? 232 LYS A HB3  1  
ATOM 3607   H HG2  . LYS A 1 232 ? 6.687   -5.958  16.145  1.00 1.43  ? 232 LYS A HG2  1  
ATOM 3608   H HG3  . LYS A 1 232 ? 8.386   -6.155  16.557  1.00 33.34 ? 232 LYS A HG3  1  
ATOM 3609   H HD2  . LYS A 1 232 ? 8.150   -5.880  14.155  1.00 42.11 ? 232 LYS A HD2  1  
ATOM 3610   H HD3  . LYS A 1 232 ? 8.726   -7.505  14.510  1.00 32.12 ? 232 LYS A HD3  1  
ATOM 3611   H HE2  . LYS A 1 232 ? 6.364   -8.331  14.220  1.00 21.53 ? 232 LYS A HE2  1  
ATOM 3612   H HE3  . LYS A 1 232 ? 5.909   -6.703  13.707  1.00 2.03  ? 232 LYS A HE3  1  
ATOM 3613   H HZ1  . LYS A 1 232 ? 7.975   -8.386  12.383  1.00 32.10 ? 232 LYS A HZ1  1  
ATOM 3614   H HZ2  . LYS A 1 232 ? 7.422   -6.883  11.852  1.00 1.31  ? 232 LYS A HZ2  1  
ATOM 3615   H HZ3  . LYS A 1 232 ? 6.379   -8.216  11.842  1.00 72.02 ? 232 LYS A HZ3  1  
ATOM 3616   N N    . LEU A 1 233 ? 9.702   -9.711  18.730  1.00 44.24 ? 233 LEU A N    1  
ATOM 3617   C CA   . LEU A 1 233 ? 10.021  -10.342 20.021  1.00 64.12 ? 233 LEU A CA   1  
ATOM 3618   C C    . LEU A 1 233 ? 9.577   -9.439  21.178  1.00 14.31 ? 233 LEU A C    1  
ATOM 3619   O O    . LEU A 1 233 ? 10.166  -8.372  21.375  1.00 33.15 ? 233 LEU A O    1  
ATOM 3620   C CB   . LEU A 1 233 ? 11.540  -10.634 20.131  1.00 71.31 ? 233 LEU A CB   1  
ATOM 3621   C CG   . LEU A 1 233 ? 12.148  -11.508 18.996  1.00 71.40 ? 233 LEU A CG   1  
ATOM 3622   C CD1  . LEU A 1 233 ? 13.660  -11.730 19.212  1.00 10.02 ? 233 LEU A CD1  1  
ATOM 3623   C CD2  . LEU A 1 233 ? 11.391  -12.847 18.856  1.00 15.22 ? 233 LEU A CD2  1  
ATOM 3624   H H    . LEU A 1 233 ? 10.415  -9.244  18.247  1.00 61.33 ? 233 LEU A H    1  
ATOM 3625   H HA   . LEU A 1 233 ? 9.481   -11.286 20.080  1.00 1.31  ? 233 LEU A HA   1  
ATOM 3626   H HB2  . LEU A 1 233 ? 12.065  -9.683  20.146  1.00 11.22 ? 233 LEU A HB2  1  
ATOM 3627   H HB3  . LEU A 1 233 ? 11.721  -11.132 21.079  1.00 1.11  ? 233 LEU A HB3  1  
ATOM 3628   H HG   . LEU A 1 233 ? 12.037  -10.976 18.060  1.00 44.12 ? 233 LEU A HG   1  
ATOM 3629   H HD11 . LEU A 1 233 ? 14.064  -12.313 18.396  1.00 34.22 ? 233 LEU A HD11 1  
ATOM 3630   H HD12 . LEU A 1 233 ? 13.830  -12.254 20.144  1.00 60.32 ? 233 LEU A HD12 1  
ATOM 3631   H HD13 . LEU A 1 233 ? 14.165  -10.772 19.247  1.00 31.44 ? 233 LEU A HD13 1  
ATOM 3632   H HD21 . LEU A 1 233 ? 10.352  -12.654 18.618  1.00 50.44 ? 233 LEU A HD21 1  
ATOM 3633   H HD22 . LEU A 1 233 ? 11.448  -13.408 19.780  1.00 12.14 ? 233 LEU A HD22 1  
ATOM 3634   H HD23 . LEU A 1 233 ? 11.829  -13.430 18.055  1.00 41.11 ? 233 LEU A HD23 1  
ATOM 3635   N N    . ARG A 1 234 ? 8.525   -9.876  21.909  1.00 44.12 ? 234 ARG A N    1  
ATOM 3636   C CA   . ARG A 1 234 ? 8.023   -9.192  23.115  1.00 32.41 ? 234 ARG A CA   1  
ATOM 3637   C C    . ARG A 1 234 ? 8.982   -9.424  24.304  1.00 43.34 ? 234 ARG A C    1  
ATOM 3638   O O    . ARG A 1 234 ? 9.076   -10.544 24.816  1.00 33.00 ? 234 ARG A O    1  
ATOM 3639   C CB   . ARG A 1 234 ? 6.581   -9.678  23.454  1.00 53.23 ? 234 ARG A CB   1  
ATOM 3640   C CG   . ARG A 1 234 ? 6.030   -9.181  24.814  1.00 3.51  ? 234 ARG A CG   1  
ATOM 3641   C CD   . ARG A 1 234 ? 4.560   -9.578  25.054  1.00 55.24 ? 234 ARG A CD   1  
ATOM 3642   N NE   . ARG A 1 234 ? 3.637   -8.841  24.170  1.00 14.01 ? 234 ARG A NE   1  
ATOM 3643   C CZ   . ARG A 1 234 ? 2.319   -9.087  24.031  1.00 60.44 ? 234 ARG A CZ   1  
ATOM 3644   N NH1  . ARG A 1 234 ? 1.721   -10.062 24.711  1.00 31.13 ? 234 ARG A NH1  1  
ATOM 3645   N NH2  . ARG A 1 234 ? 1.602   -8.339  23.203  1.00 64.14 ? 234 ARG A NH2  1  
ATOM 3646   H H    . ARG A 1 234 ? 8.062   -10.687 21.614  1.00 32.40 ? 234 ARG A H    1  
ATOM 3647   H HA   . ARG A 1 234 ? 7.983   -8.124  22.896  1.00 23.22 ? 234 ARG A HA   1  
ATOM 3648   H HB2  . ARG A 1 234 ? 5.910   -9.339  22.670  1.00 73.15 ? 234 ARG A HB2  1  
ATOM 3649   H HB3  . ARG A 1 234 ? 6.576   -10.763 23.462  1.00 0.24  ? 234 ARG A HB3  1  
ATOM 3650   H HG2  . ARG A 1 234 ? 6.637   -9.603  25.608  1.00 61.12 ? 234 ARG A HG2  1  
ATOM 3651   H HG3  . ARG A 1 234 ? 6.110   -8.099  24.851  1.00 23.21 ? 234 ARG A HG3  1  
ATOM 3652   H HD2  . ARG A 1 234 ? 4.447   -10.644 24.881  1.00 41.31 ? 234 ARG A HD2  1  
ATOM 3653   H HD3  . ARG A 1 234 ? 4.306   -9.358  26.084  1.00 4.24  ? 234 ARG A HD3  1  
ATOM 3654   H HE   . ARG A 1 234 ? 4.021   -8.093  23.661  1.00 73.41 ? 234 ARG A HE   1  
ATOM 3655   H HH11 . ARG A 1 234 ? 2.246   -10.633 25.345  1.00 51.44 ? 234 ARG A HH11 1  
ATOM 3656   H HH12 . ARG A 1 234 ? 0.738   -10.227 24.593  1.00 0.10  ? 234 ARG A HH12 1  
ATOM 3657   H HH21 . ARG A 1 234 ? 2.042   -7.595  22.689  1.00 24.33 ? 234 ARG A HH21 1  
ATOM 3658   H HH22 . ARG A 1 234 ? 0.619   -8.511  23.091  1.00 22.42 ? 234 ARG A HH22 1  
ATOM 3659   N N    . LEU A 1 235 ? 9.749   -8.382  24.689  1.00 12.10 ? 235 LEU A N    1  
ATOM 3660   C CA   . LEU A 1 235 ? 10.600  -8.414  25.896  1.00 61.12 ? 235 LEU A CA   1  
ATOM 3661   C C    . LEU A 1 235 ? 10.017  -7.423  26.928  1.00 24.25 ? 235 LEU A C    1  
ATOM 3662   O O    . LEU A 1 235 ? 10.200  -6.209  26.798  1.00 51.24 ? 235 LEU A O    1  
ATOM 3663   C CB   . LEU A 1 235 ? 12.098  -8.045  25.598  1.00 54.24 ? 235 LEU A CB   1  
ATOM 3664   C CG   . LEU A 1 235 ? 12.767  -8.549  24.265  1.00 42.12 ? 235 LEU A CG   1  
ATOM 3665   C CD1  . LEU A 1 235 ? 14.298  -8.320  24.319  1.00 4.24  ? 235 LEU A CD1  1  
ATOM 3666   C CD2  . LEU A 1 235 ? 12.443  -10.023 23.924  1.00 11.34 ? 235 LEU A CD2  1  
ATOM 3667   H H    . LEU A 1 235 ? 9.748   -7.575  24.141  1.00 3.41  ? 235 LEU A H    1  
ATOM 3668   H HA   . LEU A 1 235 ? 10.563  -9.419  26.319  1.00 22.13 ? 235 LEU A HA   1  
ATOM 3669   H HB2  . LEU A 1 235 ? 12.183  -6.961  25.601  1.00 74.14 ? 235 LEU A HB2  1  
ATOM 3670   H HB3  . LEU A 1 235 ? 12.690  -8.418  26.428  1.00 62.43 ? 235 LEU A HB3  1  
ATOM 3671   H HG   . LEU A 1 235 ? 12.391  -7.942  23.448  1.00 5.41  ? 235 LEU A HG   1  
ATOM 3672   H HD11 . LEU A 1 235 ? 14.723  -8.861  25.156  1.00 72.14 ? 235 LEU A HD11 1  
ATOM 3673   H HD12 . LEU A 1 235 ? 14.506  -7.264  24.436  1.00 74.24 ? 235 LEU A HD12 1  
ATOM 3674   H HD13 . LEU A 1 235 ? 14.756  -8.666  23.401  1.00 42.34 ? 235 LEU A HD13 1  
ATOM 3675   H HD21 . LEU A 1 235 ? 12.784  -10.670 24.717  1.00 5.12  ? 235 LEU A HD21 1  
ATOM 3676   H HD22 . LEU A 1 235 ? 12.937  -10.300 23.000  1.00 14.35 ? 235 LEU A HD22 1  
ATOM 3677   H HD23 . LEU A 1 235 ? 11.376  -10.142 23.797  1.00 71.32 ? 235 LEU A HD23 1  
ATOM 3678   N N    . LYS A 1 236 ? 9.300   -7.946  27.931  1.00 31.31 ? 236 LYS A N    1  
ATOM 3679   C CA   . LYS A 1 236 ? 8.636   -7.128  28.971  1.00 53.34 ? 236 LYS A CA   1  
ATOM 3680   C C    . LYS A 1 236 ? 9.657   -6.417  29.882  1.00 52.34 ? 236 LYS A C    1  
ATOM 3681   O O    . LYS A 1 236 ? 10.806  -6.846  29.989  1.00 64.13 ? 236 LYS A O    1  
ATOM 3682   C CB   . LYS A 1 236 ? 7.699   -8.018  29.821  1.00 42.34 ? 236 LYS A CB   1  
ATOM 3683   C CG   . LYS A 1 236 ? 6.656   -8.796  28.989  1.00 31.41 ? 236 LYS A CG   1  
ATOM 3684   C CD   . LYS A 1 236 ? 5.576   -9.495  29.844  1.00 64.43 ? 236 LYS A CD   1  
ATOM 3685   C CE   . LYS A 1 236 ? 4.830   -8.521  30.772  1.00 3.12  ? 236 LYS A CE   1  
ATOM 3686   N NZ   . LYS A 1 236 ? 4.276   -7.357  30.031  1.00 32.13 ? 236 LYS A NZ   1  
ATOM 3687   H H    . LYS A 1 236 ? 9.216   -8.922  27.984  1.00 71.01 ? 236 LYS A H    1  
ATOM 3688   H HA   . LYS A 1 236 ? 8.036   -6.376  28.465  1.00 51.04 ? 236 LYS A HA   1  
ATOM 3689   H HB2  . LYS A 1 236 ? 8.296   -8.735  30.375  1.00 65.12 ? 236 LYS A HB2  1  
ATOM 3690   H HB3  . LYS A 1 236 ? 7.170   -7.386  30.531  1.00 10.33 ? 236 LYS A HB3  1  
ATOM 3691   H HG2  . LYS A 1 236 ? 6.164   -8.102  28.312  1.00 42.40 ? 236 LYS A HG2  1  
ATOM 3692   H HG3  . LYS A 1 236 ? 7.175   -9.544  28.400  1.00 31.01 ? 236 LYS A HG3  1  
ATOM 3693   H HD2  . LYS A 1 236 ? 4.857   -9.958  29.179  1.00 15.35 ? 236 LYS A HD2  1  
ATOM 3694   H HD3  . LYS A 1 236 ? 6.046   -10.265 30.446  1.00 51.52 ? 236 LYS A HD3  1  
ATOM 3695   H HE2  . LYS A 1 236 ? 4.018   -9.046  31.252  1.00 21.50 ? 236 LYS A HE2  1  
ATOM 3696   H HE3  . LYS A 1 236 ? 5.516   -8.159  31.530  1.00 52.25 ? 236 LYS A HE3  1  
ATOM 3697   H HZ1  . LYS A 1 236 ? 5.000   -6.946  29.406  1.00 40.01 ? 236 LYS A HZ1  1  
ATOM 3698   H HZ2  . LYS A 1 236 ? 3.960   -6.627  30.702  1.00 34.43 ? 236 LYS A HZ2  1  
ATOM 3699   H HZ3  . LYS A 1 236 ? 3.466   -7.648  29.452  1.00 51.42 ? 236 LYS A HZ3  1  
ATOM 3700   N N    . GLY A 1 237 ? 9.230   -5.304  30.510  1.00 65.03 ? 237 GLY A N    1  
ATOM 3701   C CA   . GLY A 1 237 ? 10.075  -4.554  31.456  1.00 24.31 ? 237 GLY A CA   1  
ATOM 3702   C C    . GLY A 1 237 ? 11.067  -3.610  30.776  1.00 2.34  ? 237 GLY A C    1  
ATOM 3703   O O    . GLY A 1 237 ? 11.759  -2.840  31.449  1.00 74.20 ? 237 GLY A O    1  
ATOM 3704   H H    . GLY A 1 237 ? 8.325   -4.976  30.323  1.00 24.34 ? 237 GLY A H    1  
ATOM 3705   H HA2  . GLY A 1 237 ? 9.431   -3.967  32.097  1.00 33.12 ? 237 GLY A HA2  1  
ATOM 3706   H HA3  . GLY A 1 237 ? 10.625  -5.254  32.075  1.00 13.25 ? 237 GLY A HA3  1  
ATOM 3707   N N    . LYS A 1 238 ? 11.144  -3.686  29.435  1.00 13.54 ? 238 LYS A N    1  
ATOM 3708   C CA   . LYS A 1 238 ? 11.984  -2.799  28.615  1.00 44.03 ? 238 LYS A CA   1  
ATOM 3709   C C    . LYS A 1 238 ? 11.253  -1.487  28.351  1.00 25.40 ? 238 LYS A C    1  
ATOM 3710   O O    . LYS A 1 238 ? 11.866  -0.410  28.389  1.00 1.35  ? 238 LYS A O    1  
ATOM 3711   C CB   . LYS A 1 238 ? 12.361  -3.501  27.281  1.00 73.01 ? 238 LYS A CB   1  
ATOM 3712   C CG   . LYS A 1 238 ? 13.321  -4.724  27.439  1.00 41.23 ? 238 LYS A CG   1  
ATOM 3713   C CD   . LYS A 1 238 ? 14.747  -4.499  26.846  1.00 3.43  ? 238 LYS A CD   1  
ATOM 3714   C CE   . LYS A 1 238 ? 15.466  -3.236  27.378  1.00 1.55  ? 238 LYS A CE   1  
ATOM 3715   N NZ   . LYS A 1 238 ? 15.669  -3.258  28.851  1.00 72.15 ? 238 LYS A NZ   1  
ATOM 3716   H H    . LYS A 1 238 ? 10.605  -4.359  28.980  1.00 65.24 ? 238 LYS A H    1  
ATOM 3717   H HA   . LYS A 1 238 ? 12.897  -2.585  29.167  1.00 74.10 ? 238 LYS A HA   1  
ATOM 3718   H HB2  . LYS A 1 238 ? 11.444  -3.842  26.802  1.00 41.04 ? 238 LYS A HB2  1  
ATOM 3719   H HB3  . LYS A 1 238 ? 12.831  -2.775  26.625  1.00 23.43 ? 238 LYS A HB3  1  
ATOM 3720   H HG2  . LYS A 1 238 ? 13.418  -4.963  28.494  1.00 12.10 ? 238 LYS A HG2  1  
ATOM 3721   H HG3  . LYS A 1 238 ? 12.876  -5.582  26.941  1.00 60.13 ? 238 LYS A HG3  1  
ATOM 3722   H HD2  . LYS A 1 238 ? 15.360  -5.364  27.072  1.00 23.14 ? 238 LYS A HD2  1  
ATOM 3723   H HD3  . LYS A 1 238 ? 14.657  -4.414  25.767  1.00 22.54 ? 238 LYS A HD3  1  
ATOM 3724   H HE2  . LYS A 1 238 ? 16.436  -3.151  26.902  1.00 72.04 ? 238 LYS A HE2  1  
ATOM 3725   H HE3  . LYS A 1 238 ? 14.877  -2.364  27.125  1.00 62.12 ? 238 LYS A HE3  1  
ATOM 3726   H HZ1  . LYS A 1 238 ? 16.233  -4.089  29.129  1.00 23.12 ? 238 LYS A HZ1  1  
ATOM 3727   H HZ2  . LYS A 1 238 ? 14.751  -3.305  29.338  1.00 35.04 ? 238 LYS A HZ2  1  
ATOM 3728   H HZ3  . LYS A 1 238 ? 16.166  -2.398  29.159  1.00 32.23 ? 238 LYS A HZ3  1  
ATOM 3729   N N    . GLY A 1 239 ? 9.934   -1.587  28.098  1.00 44.31 ? 239 GLY A N    1  
ATOM 3730   C CA   . GLY A 1 239 ? 9.114   -0.414  27.866  1.00 21.23 ? 239 GLY A CA   1  
ATOM 3731   C C    . GLY A 1 239 ? 8.741   0.288   29.169  1.00 72.35 ? 239 GLY A C    1  
ATOM 3732   O O    . GLY A 1 239 ? 8.996   -0.220  30.281  1.00 74.43 ? 239 GLY A O    1  
ATOM 3733   H H    . GLY A 1 239 ? 9.504   -2.476  28.098  1.00 3.14  ? 239 GLY A H    1  
ATOM 3734   H HA2  . GLY A 1 239 ? 9.648   0.277   27.217  1.00 71.43 ? 239 GLY A HA2  1  
ATOM 3735   H HA3  . GLY A 1 239 ? 8.210   -0.728  27.368  1.00 42.32 ? 239 GLY A HA3  1  
ATOM 3736   N N    . PHE A 1 240 ? 8.100   1.438   29.024  1.00 73.13 ? 240 PHE A N    1  
ATOM 3737   C CA   . PHE A 1 240 ? 7.878   2.398   30.119  1.00 21.23 ? 240 PHE A CA   1  
ATOM 3738   C C    . PHE A 1 240 ? 6.486   2.218   30.753  1.00 12.22 ? 240 PHE A C    1  
ATOM 3739   O O    . PHE A 1 240 ? 5.614   1.601   30.129  1.00 40.45 ? 240 PHE A O    1  
ATOM 3740   C CB   . PHE A 1 240 ? 8.088   3.825   29.554  1.00 21.52 ? 240 PHE A CB   1  
ATOM 3741   C CG   . PHE A 1 240 ? 9.548   4.075   29.148  1.00 12.40 ? 240 PHE A CG   1  
ATOM 3742   C CD1  . PHE A 1 240 ? 10.061  3.571   27.952  1.00 24.42 ? 240 PHE A CD1  1  
ATOM 3743   C CD2  . PHE A 1 240 ? 10.399  4.803   29.965  1.00 25.30 ? 240 PHE A CD2  1  
ATOM 3744   C CE1  . PHE A 1 240 ? 11.372  3.792   27.592  1.00 54.51 ? 240 PHE A CE1  1  
ATOM 3745   C CE2  . PHE A 1 240 ? 11.707  5.023   29.603  1.00 62.30 ? 240 PHE A CE2  1  
ATOM 3746   C CZ   . PHE A 1 240 ? 12.189  4.525   28.414  1.00 23.24 ? 240 PHE A CZ   1  
ATOM 3747   H H    . PHE A 1 240 ? 7.722   1.651   28.141  1.00 73.41 ? 240 PHE A H    1  
ATOM 3748   H HA   . PHE A 1 240 ? 8.627   2.221   30.892  1.00 52.22 ? 240 PHE A HA   1  
ATOM 3749   H HB2  . PHE A 1 240 ? 7.454   3.964   28.680  1.00 24.14 ? 240 PHE A HB2  1  
ATOM 3750   H HB3  . PHE A 1 240 ? 7.810   4.555   30.305  1.00 52.34 ? 240 PHE A HB3  1  
ATOM 3751   H HD1  . PHE A 1 240 ? 9.414   2.997   27.294  1.00 51.34 ? 240 PHE A HD1  1  
ATOM 3752   H HD2  . PHE A 1 240 ? 10.026  5.196   30.904  1.00 63.35 ? 240 PHE A HD2  1  
ATOM 3753   H HE1  . PHE A 1 240 ? 11.755  3.395   26.662  1.00 10.31 ? 240 PHE A HE1  1  
ATOM 3754   H HE2  . PHE A 1 240 ? 12.354  5.603   30.248  1.00 10.05 ? 240 PHE A HE2  1  
ATOM 3755   H HZ   . PHE A 1 240 ? 13.220  4.703   28.135  1.00 41.45 ? 240 PHE A HZ   1  
ATOM 3756   N N    . PRO A 1 241 ? 6.262   2.728   32.023  1.00 42.04 ? 241 PRO A N    1  
ATOM 3757   C CA   . PRO A 1 241 ? 4.933   2.685   32.684  1.00 22.41 ? 241 PRO A CA   1  
ATOM 3758   C C    . PRO A 1 241 ? 3.817   3.284   31.799  1.00 73.33 ? 241 PRO A C    1  
ATOM 3759   O O    . PRO A 1 241 ? 4.038   4.278   31.112  1.00 52.10 ? 241 PRO A O    1  
ATOM 3760   C CB   . PRO A 1 241 ? 5.138   3.503   33.990  1.00 55.33 ? 241 PRO A CB   1  
ATOM 3761   C CG   . PRO A 1 241 ? 6.426   4.245   33.793  1.00 33.24 ? 241 PRO A CG   1  
ATOM 3762   C CD   . PRO A 1 241 ? 7.272   3.353   32.922  1.00 15.43 ? 241 PRO A CD   1  
ATOM 3763   H HA   . PRO A 1 241 ? 4.671   1.659   32.940  1.00 52.11 ? 241 PRO A HA   1  
ATOM 3764   H HB2  . PRO A 1 241 ? 4.310   4.194   34.151  1.00 1.54  ? 241 PRO A HB2  1  
ATOM 3765   H HB3  . PRO A 1 241 ? 5.221   2.837   34.843  1.00 24.12 ? 241 PRO A HB3  1  
ATOM 3766   H HG2  . PRO A 1 241 ? 6.234   5.198   33.295  1.00 22.24 ? 241 PRO A HG2  1  
ATOM 3767   H HG3  . PRO A 1 241 ? 6.917   4.417   34.743  1.00 64.55 ? 241 PRO A HG3  1  
ATOM 3768   H HD2  . PRO A 1 241 ? 7.991   3.939   32.359  1.00 13.42 ? 241 PRO A HD2  1  
ATOM 3769   H HD3  . PRO A 1 241 ? 7.782   2.600   33.511  1.00 70.52 ? 241 PRO A HD3  1  
ATOM 3770   N N    . GLY A 1 242 ? 2.639   2.644   31.819  1.00 1.44  ? 242 GLY A N    1  
ATOM 3771   C CA   . GLY A 1 242 ? 1.512   3.037   30.976  1.00 42.50 ? 242 GLY A CA   1  
ATOM 3772   C C    . GLY A 1 242 ? 0.301   2.137   31.202  1.00 34.35 ? 242 GLY A C    1  
ATOM 3773   O O    . GLY A 1 242 ? 0.168   1.583   32.301  1.00 73.52 ? 242 GLY A O    1  
ATOM 3774   H H    . GLY A 1 242 ? 2.532   1.882   32.427  1.00 43.10 ? 242 GLY A H    1  
ATOM 3775   H HA2  . GLY A 1 242 ? 1.237   4.063   31.194  1.00 12.25 ? 242 GLY A HA2  1  
ATOM 3776   H HA3  . GLY A 1 242 ? 1.813   2.968   29.938  1.00 54.30 ? 242 GLY A HA3  1  
ATOM 3777   N N    . PRO A 1 243 ? -0.608  1.969   30.174  1.00 70.45 ? 243 PRO A N    1  
ATOM 3778   C CA   . PRO A 1 243 ? -1.825  1.105   30.268  1.00 53.52 ? 243 PRO A CA   1  
ATOM 3779   C C    . PRO A 1 243 ? -1.557  -0.324  30.792  1.00 32.43 ? 243 PRO A C    1  
ATOM 3780   O O    . PRO A 1 243 ? -2.286  -0.825  31.650  1.00 3.32  ? 243 PRO A O    1  
ATOM 3781   C CB   . PRO A 1 243 ? -2.336  1.062   28.804  1.00 30.30 ? 243 PRO A CB   1  
ATOM 3782   C CG   . PRO A 1 243 ? -1.891  2.360   28.216  1.00 60.44 ? 243 PRO A CG   1  
ATOM 3783   C CD   . PRO A 1 243 ? -0.540  2.647   28.844  1.00 61.05 ? 243 PRO A CD   1  
ATOM 3784   H HA   . PRO A 1 243 ? -2.577  1.576   30.897  1.00 3.32  ? 243 PRO A HA   1  
ATOM 3785   H HB2  . PRO A 1 243 ? -1.893  0.219   28.266  1.00 3.41  ? 243 PRO A HB2  1  
ATOM 3786   H HB3  . PRO A 1 243 ? -3.415  0.988   28.779  1.00 13.23 ? 243 PRO A HB3  1  
ATOM 3787   H HG2  . PRO A 1 243 ? -1.803  2.267   27.135  1.00 12.42 ? 243 PRO A HG2  1  
ATOM 3788   H HG3  . PRO A 1 243 ? -2.594  3.148   28.466  1.00 5.43  ? 243 PRO A HG3  1  
ATOM 3789   H HD2  . PRO A 1 243 ? 0.258   2.227   28.240  1.00 72.50 ? 243 PRO A HD2  1  
ATOM 3790   H HD3  . PRO A 1 243 ? -0.392  3.714   28.962  1.00 21.32 ? 243 PRO A HD3  1  
ATOM 3791   N N    . ALA A 1 244 ? -0.478  -0.947  30.290  1.00 12.15 ? 244 ALA A N    1  
ATOM 3792   C CA   . ALA A 1 244 ? -0.119  -2.349  30.610  1.00 63.23 ? 244 ALA A CA   1  
ATOM 3793   C C    . ALA A 1 244 ? 0.707   -2.463  31.917  1.00 64.00 ? 244 ALA A C    1  
ATOM 3794   O O    . ALA A 1 244 ? 1.371   -3.477  32.144  1.00 70.11 ? 244 ALA A O    1  
ATOM 3795   C CB   . ALA A 1 244 ? 0.649   -2.954  29.415  1.00 20.13 ? 244 ALA A CB   1  
ATOM 3796   H H    . ALA A 1 244 ? 0.102   -0.446  29.677  1.00 4.25  ? 244 ALA A H    1  
ATOM 3797   H HA   . ALA A 1 244 ? -1.038  -2.918  30.735  1.00 40.11 ? 244 ALA A HA   1  
ATOM 3798   H HB1  . ALA A 1 244 ? 1.572   -2.413  29.260  1.00 42.34 ? 244 ALA A HB1  1  
ATOM 3799   H HB2  . ALA A 1 244 ? 0.042   -2.889  28.522  1.00 33.44 ? 244 ALA A HB2  1  
ATOM 3800   H HB3  . ALA A 1 244 ? 0.877   -3.997  29.613  1.00 13.24 ? 244 ALA A HB3  1  
ATOM 3801   N N    . GLY A 1 245 ? 0.622   -1.447  32.798  1.00 3.22  ? 245 GLY A N    1  
ATOM 3802   C CA   . GLY A 1 245 ? 1.502   -1.356  33.970  1.00 13.14 ? 245 GLY A CA   1  
ATOM 3803   C C    . GLY A 1 245 ? 2.839   -0.775  33.548  1.00 35.14 ? 245 GLY A C    1  
ATOM 3804   O O    . GLY A 1 245 ? 3.111   0.396   33.786  1.00 62.24 ? 245 GLY A O    1  
ATOM 3805   H H    . GLY A 1 245 ? -0.039  -0.746  32.647  1.00 62.01 ? 245 GLY A H    1  
ATOM 3806   H HA2  . GLY A 1 245 ? 1.039   -0.716  34.712  1.00 54.43 ? 245 GLY A HA2  1  
ATOM 3807   H HA3  . GLY A 1 245 ? 1.654   -2.339  34.400  1.00 43.33 ? 245 GLY A HA3  1  
ATOM 3808   N N    . ARG A 1 246 ? 3.666   -1.625  32.912  1.00 31.22 ? 246 ARG A N    1  
ATOM 3809   C CA   . ARG A 1 246 ? 4.838   -1.205  32.114  1.00 34.42 ? 246 ARG A CA   1  
ATOM 3810   C C    . ARG A 1 246 ? 4.725   -1.828  30.716  1.00 32.34 ? 246 ARG A C    1  
ATOM 3811   O O    . ARG A 1 246 ? 3.987   -2.806  30.515  1.00 75.41 ? 246 ARG A O    1  
ATOM 3812   C CB   . ARG A 1 246 ? 6.194   -1.601  32.765  1.00 2.41  ? 246 ARG A CB   1  
ATOM 3813   C CG   . ARG A 1 246 ? 6.569   -0.797  34.029  1.00 70.55 ? 246 ARG A CG   1  
ATOM 3814   C CD   . ARG A 1 246 ? 7.998   -1.106  34.509  1.00 1.05  ? 246 ARG A CD   1  
ATOM 3815   N NE   . ARG A 1 246 ? 9.016   -0.714  33.508  1.00 41.30 ? 246 ARG A NE   1  
ATOM 3816   C CZ   . ARG A 1 246 ? 10.347  -0.845  33.661  1.00 70.41 ? 246 ARG A CZ   1  
ATOM 3817   N NH1  . ARG A 1 246 ? 10.863  -1.368  34.771  1.00 54.32 ? 246 ARG A NH1  1  
ATOM 3818   N NH2  . ARG A 1 246 ? 11.156  -0.433  32.698  1.00 22.01 ? 246 ARG A NH2  1  
ATOM 3819   H H    . ARG A 1 246 ? 3.473   -2.586  32.969  1.00 25.41 ? 246 ARG A H    1  
ATOM 3820   H HA   . ARG A 1 246 ? 4.801   -0.122  32.000  1.00 30.14 ? 246 ARG A HA   1  
ATOM 3821   H HB2  . ARG A 1 246 ? 6.157   -2.651  33.034  1.00 75.35 ? 246 ARG A HB2  1  
ATOM 3822   H HB3  . ARG A 1 246 ? 6.988   -1.461  32.034  1.00 43.15 ? 246 ARG A HB3  1  
ATOM 3823   H HG2  . ARG A 1 246 ? 6.497   0.263   33.806  1.00 11.34 ? 246 ARG A HG2  1  
ATOM 3824   H HG3  . ARG A 1 246 ? 5.867   -1.041  34.821  1.00 74.13 ? 246 ARG A HG3  1  
ATOM 3825   H HD2  . ARG A 1 246 ? 8.184   -0.563  35.427  1.00 0.14  ? 246 ARG A HD2  1  
ATOM 3826   H HD3  . ARG A 1 246 ? 8.086   -2.171  34.702  1.00 3.55  ? 246 ARG A HD3  1  
ATOM 3827   H HE   . ARG A 1 246 ? 8.684   -0.336  32.664  1.00 42.43 ? 246 ARG A HE   1  
ATOM 3828   H HH11 . ARG A 1 246 ? 10.262  -1.674  35.516  1.00 32.05 ? 246 ARG A HH11 1  
ATOM 3829   H HH12 . ARG A 1 246 ? 11.855  -1.459  34.869  1.00 35.12 ? 246 ARG A HH12 1  
ATOM 3830   H HH21 . ARG A 1 246 ? 10.779  -0.029  31.861  1.00 1.51  ? 246 ARG A HH21 1  
ATOM 3831   H HH22 . ARG A 1 246 ? 12.148  -0.527  32.800  1.00 3.22  ? 246 ARG A HH22 1  
ATOM 3832   N N    . GLY A 1 247 ? 5.459   -1.248  29.760  1.00 2.41  ? 247 GLY A N    1  
ATOM 3833   C CA   . GLY A 1 247 ? 5.450   -1.717  28.382  1.00 12.43 ? 247 GLY A CA   1  
ATOM 3834   C C    . GLY A 1 247 ? 6.534   -2.736  28.080  1.00 23.13 ? 247 GLY A C    1  
ATOM 3835   O O    . GLY A 1 247 ? 7.462   -2.977  28.882  1.00 42.24 ? 247 GLY A O    1  
ATOM 3836   H H    . GLY A 1 247 ? 6.020   -0.475  29.992  1.00 70.31 ? 247 GLY A H    1  
ATOM 3837   H HA2  . GLY A 1 247 ? 4.484   -2.158  28.152  1.00 13.01 ? 247 GLY A HA2  1  
ATOM 3838   H HA3  . GLY A 1 247 ? 5.592   -0.862  27.734  1.00 32.42 ? 247 GLY A HA3  1  
ATOM 3839   N N    . ASP A 1 248 ? 6.434   -3.295  26.878  1.00 55.13 ? 248 ASP A N    1  
ATOM 3840   C CA   . ASP A 1 248 ? 7.331   -4.343  26.383  1.00 72.55 ? 248 ASP A CA   1  
ATOM 3841   C C    . ASP A 1 248 ? 8.376   -3.742  25.431  1.00 71.25 ? 248 ASP A C    1  
ATOM 3842   O O    . ASP A 1 248 ? 8.534   -2.524  25.323  1.00 75.44 ? 248 ASP A O    1  
ATOM 3843   C CB   . ASP A 1 248 ? 6.495   -5.433  25.639  1.00 41.04 ? 248 ASP A CB   1  
ATOM 3844   C CG   . ASP A 1 248 ? 5.220   -5.866  26.385  1.00 32.13 ? 248 ASP A CG   1  
ATOM 3845   O OD1  . ASP A 1 248 ? 4.127   -5.901  25.766  1.00 22.22 ? 248 ASP A OD1  1  
ATOM 3846   O OD2  . ASP A 1 248 ? 5.297   -6.167  27.593  1.00 1.21  ? 248 ASP A OD2  1  
ATOM 3847   H H    . ASP A 1 248 ? 5.722   -2.984  26.287  1.00 64.21 ? 248 ASP A H    1  
ATOM 3848   H HA   . ASP A 1 248 ? 7.848   -4.805  27.226  1.00 74.54 ? 248 ASP A HA   1  
ATOM 3849   H HB2  . ASP A 1 248 ? 6.210   -5.055  24.662  1.00 22.23 ? 248 ASP A HB2  1  
ATOM 3850   H HB3  . ASP A 1 248 ? 7.116   -6.311  25.499  1.00 54.22 ? 248 ASP A HB3  1  
ATOM 3851   N N    . LEU A 1 249 ? 9.114   -4.633  24.785  1.00 64.21 ? 249 LEU A N    1  
ATOM 3852   C CA   . LEU A 1 249 ? 9.934   -4.329  23.609  1.00 44.41 ? 249 LEU A CA   1  
ATOM 3853   C C    . LEU A 1 249 ? 9.444   -5.226  22.479  1.00 70.31 ? 249 LEU A C    1  
ATOM 3854   O O    . LEU A 1 249 ? 9.009   -6.330  22.743  1.00 33.24 ? 249 LEU A O    1  
ATOM 3855   C CB   . LEU A 1 249 ? 11.433  -4.586  23.915  1.00 62.34 ? 249 LEU A CB   1  
ATOM 3856   C CG   . LEU A 1 249 ? 12.423  -4.458  22.716  1.00 64.10 ? 249 LEU A CG   1  
ATOM 3857   C CD1  . LEU A 1 249 ? 12.237  -3.119  21.982  1.00 1.42  ? 249 LEU A CD1  1  
ATOM 3858   C CD2  . LEU A 1 249 ? 13.886  -4.638  23.183  1.00 13.12 ? 249 LEU A CD2  1  
ATOM 3859   H H    . LEU A 1 249 ? 9.114   -5.553  25.112  1.00 72.03 ? 249 LEU A H    1  
ATOM 3860   H HA   . LEU A 1 249 ? 9.786   -3.285  23.331  1.00 73.32 ? 249 LEU A HA   1  
ATOM 3861   H HB2  . LEU A 1 249 ? 11.738  -3.882  24.681  1.00 52.34 ? 249 LEU A HB2  1  
ATOM 3862   H HB3  . LEU A 1 249 ? 11.528  -5.586  24.325  1.00 32.44 ? 249 LEU A HB3  1  
ATOM 3863   H HG   . LEU A 1 249 ? 12.206  -5.246  22.004  1.00 34.22 ? 249 LEU A HG   1  
ATOM 3864   H HD11 . LEU A 1 249 ? 12.969  -3.029  21.192  1.00 4.34  ? 249 LEU A HD11 1  
ATOM 3865   H HD12 . LEU A 1 249 ? 12.355  -2.298  22.682  1.00 1.33  ? 249 LEU A HD12 1  
ATOM 3866   H HD13 . LEU A 1 249 ? 11.245  -3.076  21.552  1.00 61.40 ? 249 LEU A HD13 1  
ATOM 3867   H HD21 . LEU A 1 249 ? 14.151  -3.855  23.885  1.00 61.34 ? 249 LEU A HD21 1  
ATOM 3868   H HD22 . LEU A 1 249 ? 14.549  -4.591  22.330  1.00 70.24 ? 249 LEU A HD22 1  
ATOM 3869   H HD23 . LEU A 1 249 ? 14.000  -5.602  23.663  1.00 70.21 ? 249 LEU A HD23 1  
ATOM 3870   N N    . TYR A 1 250 ? 9.452   -4.734  21.240  1.00 13.13 ? 250 TYR A N    1  
ATOM 3871   C CA   . TYR A 1 250 ? 9.133   -5.553  20.067  1.00 52.01 ? 250 TYR A CA   1  
ATOM 3872   C C    . TYR A 1 250 ? 10.300  -5.459  19.077  1.00 42.33 ? 250 TYR A C    1  
ATOM 3873   O O    . TYR A 1 250 ? 10.512  -4.422  18.443  1.00 30.32 ? 250 TYR A O    1  
ATOM 3874   C CB   . TYR A 1 250 ? 7.789   -5.094  19.445  1.00 33.24 ? 250 TYR A CB   1  
ATOM 3875   C CG   . TYR A 1 250 ? 6.577   -5.377  20.356  1.00 12.20 ? 250 TYR A CG   1  
ATOM 3876   C CD1  . TYR A 1 250 ? 6.204   -4.482  21.362  1.00 12.34 ? 250 TYR A CD1  1  
ATOM 3877   C CD2  . TYR A 1 250 ? 5.830   -6.552  20.229  1.00 11.15 ? 250 TYR A CD2  1  
ATOM 3878   C CE1  . TYR A 1 250 ? 5.139   -4.749  22.197  1.00 23.11 ? 250 TYR A CE1  1  
ATOM 3879   C CE2  . TYR A 1 250 ? 4.761   -6.815  21.062  1.00 52.51 ? 250 TYR A CE2  1  
ATOM 3880   C CZ   . TYR A 1 250 ? 4.423   -5.912  22.042  1.00 41.52 ? 250 TYR A CZ   1  
ATOM 3881   O OH   . TYR A 1 250 ? 3.358   -6.175  22.869  1.00 11.42 ? 250 TYR A OH   1  
ATOM 3882   H H    . TYR A 1 250 ? 9.669   -3.791  21.105  1.00 71.30 ? 250 TYR A H    1  
ATOM 3883   H HA   . TYR A 1 250 ? 9.034   -6.596  20.383  1.00 1.02  ? 250 TYR A HA   1  
ATOM 3884   H HB2  . TYR A 1 250 ? 7.829   -4.027  19.252  1.00 63.21 ? 250 TYR A HB2  1  
ATOM 3885   H HB3  . TYR A 1 250 ? 7.633   -5.611  18.506  1.00 45.41 ? 250 TYR A HB3  1  
ATOM 3886   H HD1  . TYR A 1 250 ? 6.766   -3.561  21.485  1.00 22.03 ? 250 TYR A HD1  1  
ATOM 3887   H HD2  . TYR A 1 250 ? 6.095   -7.265  19.460  1.00 23.43 ? 250 TYR A HD2  1  
ATOM 3888   H HE1  . TYR A 1 250 ? 4.870   -4.040  22.969  1.00 43.53 ? 250 TYR A HE1  1  
ATOM 3889   H HE2  . TYR A 1 250 ? 4.196   -7.729  20.940  1.00 33.35 ? 250 TYR A HE2  1  
ATOM 3890   H HH   . TYR A 1 250 ? 2.896   -5.353  23.064  1.00 52.05 ? 250 TYR A HH   1  
ATOM 3891   N N    . LEU A 1 251 ? 11.078  -6.552  18.998  1.00 43.24 ? 251 LEU A N    1  
ATOM 3892   C CA   . LEU A 1 251 ? 12.259  -6.641  18.115  1.00 2.32  ? 251 LEU A CA   1  
ATOM 3893   C C    . LEU A 1 251 ? 11.866  -7.196  16.735  1.00 43.22 ? 251 LEU A C    1  
ATOM 3894   O O    . LEU A 1 251 ? 11.397  -8.330  16.641  1.00 21.42 ? 251 LEU A O    1  
ATOM 3895   C CB   . LEU A 1 251 ? 13.337  -7.546  18.776  1.00 41.11 ? 251 LEU A CB   1  
ATOM 3896   C CG   . LEU A 1 251 ? 14.032  -6.966  20.049  1.00 33.20 ? 251 LEU A CG   1  
ATOM 3897   C CD1  . LEU A 1 251 ? 14.860  -8.037  20.786  1.00 72.24 ? 251 LEU A CD1  1  
ATOM 3898   C CD2  . LEU A 1 251 ? 14.922  -5.756  19.688  1.00 52.32 ? 251 LEU A CD2  1  
ATOM 3899   H H    . LEU A 1 251 ? 10.860  -7.326  19.575  1.00 4.44  ? 251 LEU A H    1  
ATOM 3900   H HA   . LEU A 1 251 ? 12.672  -5.642  17.993  1.00 74.33 ? 251 LEU A HA   1  
ATOM 3901   H HB2  . LEU A 1 251 ? 12.867  -8.488  19.043  1.00 30.43 ? 251 LEU A HB2  1  
ATOM 3902   H HB3  . LEU A 1 251 ? 14.106  -7.756  18.039  1.00 60.14 ? 251 LEU A HB3  1  
ATOM 3903   H HG   . LEU A 1 251 ? 13.269  -6.617  20.736  1.00 74.54 ? 251 LEU A HG   1  
ATOM 3904   H HD11 . LEU A 1 251 ? 15.276  -7.612  21.693  1.00 23.14 ? 251 LEU A HD11 1  
ATOM 3905   H HD12 . LEU A 1 251 ? 15.666  -8.382  20.154  1.00 23.03 ? 251 LEU A HD12 1  
ATOM 3906   H HD13 . LEU A 1 251 ? 14.226  -8.873  21.048  1.00 10.45 ? 251 LEU A HD13 1  
ATOM 3907   H HD21 . LEU A 1 251 ? 15.711  -6.061  19.012  1.00 20.03 ? 251 LEU A HD21 1  
ATOM 3908   H HD22 . LEU A 1 251 ? 15.360  -5.343  20.587  1.00 34.51 ? 251 LEU A HD22 1  
ATOM 3909   H HD23 . LEU A 1 251 ? 14.319  -4.995  19.211  1.00 22.25 ? 251 LEU A HD23 1  
ATOM 3910   N N    . GLU A 1 252 ? 12.089  -6.398  15.671  1.00 31.42 ? 252 GLU A N    1  
ATOM 3911   C CA   . GLU A 1 252 ? 11.815  -6.822  14.289  1.00 33.01 ? 252 GLU A CA   1  
ATOM 3912   C C    . GLU A 1 252 ? 12.939  -7.761  13.821  1.00 51.12 ? 252 GLU A C    1  
ATOM 3913   O O    . GLU A 1 252 ? 14.055  -7.322  13.527  1.00 75.41 ? 252 GLU A O    1  
ATOM 3914   C CB   . GLU A 1 252 ? 11.692  -5.596  13.340  1.00 51.22 ? 252 GLU A CB   1  
ATOM 3915   C CG   . GLU A 1 252 ? 11.477  -5.943  11.846  1.00 62.25 ? 252 GLU A CG   1  
ATOM 3916   C CD   . GLU A 1 252 ? 10.159  -6.700  11.564  1.00 60.44 ? 252 GLU A CD   1  
ATOM 3917   O OE1  . GLU A 1 252 ? 9.152   -6.048  11.215  1.00 64.31 ? 252 GLU A OE1  1  
ATOM 3918   O OE2  . GLU A 1 252 ? 10.116  -7.951  11.703  1.00 43.33 ? 252 GLU A OE2  1  
ATOM 3919   H H    . GLU A 1 252 ? 12.443  -5.500  15.822  1.00 41.32 ? 252 GLU A H    1  
ATOM 3920   H HA   . GLU A 1 252 ? 10.867  -7.361  14.284  1.00 12.43 ? 252 GLU A HA   1  
ATOM 3921   H HB2  . GLU A 1 252 ? 10.857  -4.986  13.670  1.00 64.10 ? 252 GLU A HB2  1  
ATOM 3922   H HB3  . GLU A 1 252 ? 12.596  -5.002  13.422  1.00 21.32 ? 252 GLU A HB3  1  
ATOM 3923   H HG2  . GLU A 1 252 ? 11.482  -5.019  11.275  1.00 42.24 ? 252 GLU A HG2  1  
ATOM 3924   H HG3  . GLU A 1 252 ? 12.310  -6.555  11.512  1.00 52.23 ? 252 GLU A HG3  1  
ATOM 3925   N N    . VAL A 1 253 ? 12.622  -9.058  13.790  1.00 22.14 ? 253 VAL A N    1  
ATOM 3926   C CA   . VAL A 1 253 ? 13.591  -10.115 13.501  1.00 14.12 ? 253 VAL A CA   1  
ATOM 3927   C C    . VAL A 1 253 ? 13.978  -10.137 12.009  1.00 23.24 ? 253 VAL A C    1  
ATOM 3928   O O    . VAL A 1 253 ? 13.111  -10.236 11.128  1.00 11.12 ? 253 VAL A O    1  
ATOM 3929   C CB   . VAL A 1 253 ? 13.033  -11.527 13.905  1.00 2.21  ? 253 VAL A CB   1  
ATOM 3930   C CG1  . VAL A 1 253 ? 14.109  -12.624 13.721  1.00 12.14 ? 253 VAL A CG1  1  
ATOM 3931   C CG2  . VAL A 1 253 ? 12.475  -11.520 15.349  1.00 24.43 ? 253 VAL A CG2  1  
ATOM 3932   H H    . VAL A 1 253 ? 11.696  -9.315  13.975  1.00 2.14  ? 253 VAL A H    1  
ATOM 3933   H HA   . VAL A 1 253 ? 14.481  -9.921  14.100  1.00 71.34 ? 253 VAL A HA   1  
ATOM 3934   H HB   . VAL A 1 253 ? 12.205  -11.763 13.236  1.00 42.22 ? 253 VAL A HB   1  
ATOM 3935   H HG11 . VAL A 1 253 ? 14.963  -12.417 14.357  1.00 22.15 ? 253 VAL A HG11 1  
ATOM 3936   H HG12 . VAL A 1 253 ? 14.433  -12.649 12.690  1.00 22.14 ? 253 VAL A HG12 1  
ATOM 3937   H HG13 . VAL A 1 253 ? 13.694  -13.591 13.982  1.00 65.13 ? 253 VAL A HG13 1  
ATOM 3938   H HG21 . VAL A 1 253 ? 12.062  -12.492 15.587  1.00 70.13 ? 253 VAL A HG21 1  
ATOM 3939   H HG22 . VAL A 1 253 ? 11.693  -10.775 15.434  1.00 24.23 ? 253 VAL A HG22 1  
ATOM 3940   H HG23 . VAL A 1 253 ? 13.266  -11.284 16.052  1.00 21.13 ? 253 VAL A HG23 1  
ATOM 3941   N N    . ARG A 1 254 ? 15.290  -10.019 11.750  1.00 42.35 ? 254 ARG A N    1  
ATOM 3942   C CA   . ARG A 1 254 ? 15.906  -10.297 10.447  1.00 53.31 ? 254 ARG A CA   1  
ATOM 3943   C C    . ARG A 1 254 ? 17.015  -11.325 10.676  1.00 61.04 ? 254 ARG A C    1  
ATOM 3944   O O    . ARG A 1 254 ? 18.088  -10.996 11.198  1.00 53.42 ? 254 ARG A O    1  
ATOM 3945   C CB   . ARG A 1 254 ? 16.453  -8.995  9.790   1.00 34.23 ? 254 ARG A CB   1  
ATOM 3946   C CG   . ARG A 1 254 ? 15.346  -8.002  9.371   1.00 23.11 ? 254 ARG A CG   1  
ATOM 3947   C CD   . ARG A 1 254 ? 14.434  -8.554  8.246   1.00 61.45 ? 254 ARG A CD   1  
ATOM 3948   N NE   . ARG A 1 254 ? 15.020  -8.406  6.898   1.00 40.25 ? 254 ARG A NE   1  
ATOM 3949   C CZ   . ARG A 1 254 ? 14.317  -8.375  5.752   1.00 73.14 ? 254 ARG A CZ   1  
ATOM 3950   N NH1  . ARG A 1 254 ? 12.990  -8.494  5.759   1.00 5.51  ? 254 ARG A NH1  1  
ATOM 3951   N NH2  . ARG A 1 254 ? 14.942  -8.163  4.605   1.00 24.42 ? 254 ARG A NH2  1  
ATOM 3952   H H    . ARG A 1 254 ? 15.878  -9.729  12.479  1.00 41.32 ? 254 ARG A H    1  
ATOM 3953   H HA   . ARG A 1 254 ? 15.154  -10.739 9.789   1.00 1.01  ? 254 ARG A HA   1  
ATOM 3954   H HB2  . ARG A 1 254 ? 17.104  -8.494  10.499  1.00 53.25 ? 254 ARG A HB2  1  
ATOM 3955   H HB3  . ARG A 1 254 ? 17.033  -9.252  8.908   1.00 34.04 ? 254 ARG A HB3  1  
ATOM 3956   H HG2  . ARG A 1 254 ? 14.735  -7.776  10.238  1.00 4.31  ? 254 ARG A HG2  1  
ATOM 3957   H HG3  . ARG A 1 254 ? 15.813  -7.086  9.023   1.00 1.25  ? 254 ARG A HG3  1  
ATOM 3958   H HD2  . ARG A 1 254 ? 14.241  -9.604  8.426   1.00 51.12 ? 254 ARG A HD2  1  
ATOM 3959   H HD3  . ARG A 1 254 ? 13.488  -8.018  8.277   1.00 50.31 ? 254 ARG A HD3  1  
ATOM 3960   H HE   . ARG A 1 254 ? 15.996  -8.307  6.848   1.00 0.20  ? 254 ARG A HE   1  
ATOM 3961   H HH11 . ARG A 1 254 ? 12.497  -8.607  6.626   1.00 15.34 ? 254 ARG A HH11 1  
ATOM 3962   H HH12 . ARG A 1 254 ? 12.475  -8.463  4.892   1.00 4.25  ? 254 ARG A HH12 1  
ATOM 3963   H HH21 . ARG A 1 254 ? 15.938  -8.024  4.591   1.00 11.13 ? 254 ARG A HH21 1  
ATOM 3964   H HH22 . ARG A 1 254 ? 14.418  -8.135  3.748   1.00 44.45 ? 254 ARG A HH22 1  
ATOM 3965   N N    . ILE A 1 255 ? 16.714  -12.589 10.361  1.00 40.33 ? 255 ILE A N    1  
ATOM 3966   C CA   . ILE A 1 255 ? 17.672  -13.680 10.517  1.00 41.02 ? 255 ILE A CA   1  
ATOM 3967   C C    . ILE A 1 255 ? 18.725  -13.618 9.397   1.00 61.32 ? 255 ILE A C    1  
ATOM 3968   O O    . ILE A 1 255 ? 18.392  -13.361 8.236   1.00 55.13 ? 255 ILE A O    1  
ATOM 3969   C CB   . ILE A 1 255 ? 16.976  -15.085 10.526  1.00 54.42 ? 255 ILE A CB   1  
ATOM 3970   C CG1  . ILE A 1 255 ? 15.886  -15.172 11.638  1.00 72.21 ? 255 ILE A CG1  1  
ATOM 3971   C CG2  . ILE A 1 255 ? 18.003  -16.226 10.689  1.00 71.33 ? 255 ILE A CG2  1  
ATOM 3972   C CD1  . ILE A 1 255 ? 15.116  -16.481 11.650  1.00 74.34 ? 255 ILE A CD1  1  
ATOM 3973   H H    . ILE A 1 255 ? 15.824  -12.789 10.012  1.00 53.21 ? 255 ILE A H    1  
ATOM 3974   H HA   . ILE A 1 255 ? 18.167  -13.546 11.477  1.00 61.21 ? 255 ILE A HA   1  
ATOM 3975   H HB   . ILE A 1 255 ? 16.497  -15.215 9.563   1.00 32.51 ? 255 ILE A HB   1  
ATOM 3976   H HG12 . ILE A 1 255 ? 16.352  -15.063 12.610  1.00 0.00  ? 255 ILE A HG12 1  
ATOM 3977   H HG13 . ILE A 1 255 ? 15.167  -14.369 11.502  1.00 33.31 ? 255 ILE A HG13 1  
ATOM 3978   H HG21 . ILE A 1 255 ? 17.500  -17.186 10.666  1.00 71.32 ? 255 ILE A HG21 1  
ATOM 3979   H HG22 . ILE A 1 255 ? 18.525  -16.122 11.634  1.00 2.12  ? 255 ILE A HG22 1  
ATOM 3980   H HG23 . ILE A 1 255 ? 18.724  -16.188 9.882   1.00 11.20 ? 255 ILE A HG23 1  
ATOM 3981   H HD11 . ILE A 1 255 ? 15.791  -17.298 11.860  1.00 4.02  ? 255 ILE A HD11 1  
ATOM 3982   H HD12 . ILE A 1 255 ? 14.644  -16.636 10.690  1.00 44.13 ? 255 ILE A HD12 1  
ATOM 3983   H HD13 . ILE A 1 255 ? 14.359  -16.437 12.418  1.00 71.21 ? 255 ILE A HD13 1  
ATOM 3984   N N    . THR A 1 256 ? 19.990  -13.828 9.767   1.00 3.54  ? 256 THR A N    1  
ATOM 3985   C CA   . THR A 1 256 ? 21.116  -13.946 8.826   1.00 20.11 ? 256 THR A CA   1  
ATOM 3986   C C    . THR A 1 256 ? 21.754  -15.337 8.993   1.00 22.02 ? 256 THR A C    1  
ATOM 3987   O O    . THR A 1 256 ? 21.420  -16.073 9.924   1.00 1.55  ? 256 THR A O    1  
ATOM 3988   C CB   . THR A 1 256 ? 22.176  -12.822 9.089   1.00 73.43 ? 256 THR A CB   1  
ATOM 3989   O OG1  . THR A 1 256 ? 22.569  -12.841 10.476  1.00 21.23 ? 256 THR A OG1  1  
ATOM 3990   C CG2  . THR A 1 256 ? 21.637  -11.415 8.724   1.00 13.45 ? 256 THR A CG2  1  
ATOM 3991   H H    . THR A 1 256 ? 20.183  -13.920 10.727  1.00 23.34 ? 256 THR A H    1  
ATOM 3992   H HA   . THR A 1 256 ? 20.746  -13.847 7.807   1.00 71.30 ? 256 THR A HA   1  
ATOM 3993   H HB   . THR A 1 256 ? 23.055  -13.018 8.481   1.00 32.22 ? 256 THR A HB   1  
ATOM 3994   H HG1  . THR A 1 256 ? 21.986  -12.265 10.981  1.00 41.41 ? 256 THR A HG1  1  
ATOM 3995   H HG21 . THR A 1 256 ? 22.397  -10.671 8.925   1.00 74.52 ? 256 THR A HG21 1  
ATOM 3996   H HG22 . THR A 1 256 ? 20.759  -11.192 9.318   1.00 43.15 ? 256 THR A HG22 1  
ATOM 3997   H HG23 . THR A 1 256 ? 21.375  -11.383 7.674   1.00 41.54 ? 256 THR A HG23 1  
ATOM 3998   N N    . ILE A 1 257 ? 22.653  -15.705 8.073   1.00 42.31 ? 257 ILE A N    1  
ATOM 3999   C CA   . ILE A 1 257 ? 23.436  -16.963 8.143   1.00 73.23 ? 257 ILE A CA   1  
ATOM 4000   C C    . ILE A 1 257 ? 24.928  -16.638 7.818   1.00 60.43 ? 257 ILE A C    1  
ATOM 4001   O O    . ILE A 1 257 ? 25.182  -15.661 7.102   1.00 73.40 ? 257 ILE A O    1  
ATOM 4002   C CB   . ILE A 1 257 ? 22.797  -18.096 7.214   1.00 14.25 ? 257 ILE A CB   1  
ATOM 4003   C CG1  . ILE A 1 257 ? 22.562  -17.615 5.747   1.00 45.24 ? 257 ILE A CG1  1  
ATOM 4004   C CG2  . ILE A 1 257 ? 21.482  -18.655 7.823   1.00 52.13 ? 257 ILE A CG2  1  
ATOM 4005   C CD1  . ILE A 1 257 ? 23.787  -17.663 4.856   1.00 2.03  ? 257 ILE A CD1  1  
ATOM 4006   H H    . ILE A 1 257 ? 22.811  -15.109 7.318   1.00 12.44 ? 257 ILE A H    1  
ATOM 4007   H HA   . ILE A 1 257 ? 23.405  -17.318 9.173   1.00 54.43 ? 257 ILE A HA   1  
ATOM 4008   H HB   . ILE A 1 257 ? 23.496  -18.928 7.194   1.00 1.24  ? 257 ILE A HB   1  
ATOM 4009   H HG12 . ILE A 1 257 ? 21.814  -18.238 5.274   1.00 31.41 ? 257 ILE A HG12 1  
ATOM 4010   H HG13 . ILE A 1 257 ? 22.205  -16.593 5.760   1.00 35.34 ? 257 ILE A HG13 1  
ATOM 4011   H HG21 . ILE A 1 257 ? 21.087  -19.448 7.196   1.00 73.00 ? 257 ILE A HG21 1  
ATOM 4012   H HG22 . ILE A 1 257 ? 20.746  -17.865 7.901   1.00 23.02 ? 257 ILE A HG22 1  
ATOM 4013   H HG23 . ILE A 1 257 ? 21.680  -19.053 8.811   1.00 22.32 ? 257 ILE A HG23 1  
ATOM 4014   H HD11 . ILE A 1 257 ? 24.157  -18.678 4.800   1.00 54.13 ? 257 ILE A HD11 1  
ATOM 4015   H HD12 . ILE A 1 257 ? 24.560  -17.020 5.258   1.00 33.51 ? 257 ILE A HD12 1  
ATOM 4016   H HD13 . ILE A 1 257 ? 23.523  -17.324 3.866   1.00 14.13 ? 257 ILE A HD13 1  
ATOM 4017   N N    . PRO A 1 258 ? 25.933  -17.482 8.261   1.00 72.13 ? 258 PRO A N    1  
ATOM 4018   C CA   . PRO A 1 258 ? 27.385  -17.080 8.345   1.00 45.51 ? 258 PRO A CA   1  
ATOM 4019   C C    . PRO A 1 258 ? 28.046  -16.625 7.018   1.00 74.45 ? 258 PRO A C    1  
ATOM 4020   O O    . PRO A 1 258 ? 29.129  -16.043 7.057   1.00 12.13 ? 258 PRO A O    1  
ATOM 4021   C CB   . PRO A 1 258 ? 28.075  -18.362 8.892   1.00 55.03 ? 258 PRO A CB   1  
ATOM 4022   C CG   . PRO A 1 258 ? 27.144  -19.476 8.528   1.00 32.44 ? 258 PRO A CG   1  
ATOM 4023   C CD   . PRO A 1 258 ? 25.758  -18.903 8.666   1.00 21.02 ? 258 PRO A CD   1  
ATOM 4024   H HA   . PRO A 1 258 ? 27.507  -16.283 9.073   1.00 31.21 ? 258 PRO A HA   1  
ATOM 4025   H HB2  . PRO A 1 258 ? 29.059  -18.503 8.437   1.00 73.12 ? 258 PRO A HB2  1  
ATOM 4026   H HB3  . PRO A 1 258 ? 28.179  -18.302 9.968   1.00 4.44  ? 258 PRO A HB3  1  
ATOM 4027   H HG2  . PRO A 1 258 ? 27.326  -19.796 7.503   1.00 23.42 ? 258 PRO A HG2  1  
ATOM 4028   H HG3  . PRO A 1 258 ? 27.270  -20.312 9.205   1.00 3.40  ? 258 PRO A HG3  1  
ATOM 4029   H HD2  . PRO A 1 258 ? 25.070  -19.417 8.004   1.00 45.50 ? 258 PRO A HD2  1  
ATOM 4030   H HD3  . PRO A 1 258 ? 25.409  -18.969 9.691   1.00 3.25  ? 258 PRO A HD3  1  
ATOM 4031   N N    . GLU A 1 259 ? 27.361  -16.869 5.885   1.00 34.05 ? 259 GLU A N    1  
ATOM 4032   C CA   . GLU A 1 259 ? 27.878  -16.664 4.506   1.00 60.41 ? 259 GLU A CA   1  
ATOM 4033   C C    . GLU A 1 259 ? 29.166  -17.482 4.223   1.00 63.24 ? 259 GLU A C    1  
ATOM 4034   O O    . GLU A 1 259 ? 29.146  -18.417 3.432   1.00 34.10 ? 259 GLU A O    1  
ATOM 4035   C CB   . GLU A 1 259 ? 28.082  -15.163 4.177   1.00 22.40 ? 259 GLU A CB   1  
ATOM 4036   C CG   . GLU A 1 259 ? 28.274  -14.874 2.669   1.00 23.14 ? 259 GLU A CG   1  
ATOM 4037   C CD   . GLU A 1 259 ? 28.371  -13.377 2.340   1.00 22.25 ? 259 GLU A CD   1  
ATOM 4038   O OE1  . GLU A 1 259 ? 29.229  -12.703 2.938   1.00 52.31 ? 259 GLU A OE1  1  
ATOM 4039   O OE2  . GLU A 1 259 ? 27.592  -12.875 1.490   1.00 31.15 ? 259 GLU A OE2  1  
ATOM 4040   H H    . GLU A 1 259 ? 26.431  -17.156 5.982   1.00 50.52 ? 259 GLU A H    1  
ATOM 4041   H HA   . GLU A 1 259 ? 27.099  -17.042 3.848   1.00 51.33 ? 259 GLU A HA   1  
ATOM 4042   H HB2  . GLU A 1 259 ? 27.211  -14.613 4.523   1.00 73.22 ? 259 GLU A HB2  1  
ATOM 4043   H HB3  . GLU A 1 259 ? 28.953  -14.798 4.712   1.00 42.33 ? 259 GLU A HB3  1  
ATOM 4044   H HG2  . GLU A 1 259 ? 29.185  -15.355 2.336   1.00 75.12 ? 259 GLU A HG2  1  
ATOM 4045   H HG3  . GLU A 1 259 ? 27.433  -15.304 2.132   1.00 31.01 ? 259 GLU A HG3  1  
ATOM 4046   N N    . ARG A 1 260 ? 30.287  -17.099 4.844   1.00 75.12 ? 260 ARG A N    1  
ATOM 4047   C CA   . ARG A 1 260 ? 31.533  -17.879 4.778   1.00 12.40 ? 260 ARG A CA   1  
ATOM 4048   C C    . ARG A 1 260 ? 31.395  -19.136 5.663   1.00 14.03 ? 260 ARG A C    1  
ATOM 4049   O O    . ARG A 1 260 ? 30.960  -19.048 6.820   1.00 20.01 ? 260 ARG A O    1  
ATOM 4050   C CB   . ARG A 1 260 ? 32.740  -17.009 5.213   1.00 0.33  ? 260 ARG A CB   1  
ATOM 4051   C CG   . ARG A 1 260 ? 32.611  -16.367 6.617   1.00 32.51 ? 260 ARG A CG   1  
ATOM 4052   C CD   . ARG A 1 260 ? 33.741  -15.370 6.911   1.00 22.42 ? 260 ARG A CD   1  
ATOM 4053   N NE   . ARG A 1 260 ? 33.779  -14.291 5.905   1.00 30.33 ? 260 ARG A NE   1  
ATOM 4054   C CZ   . ARG A 1 260 ? 34.700  -13.316 5.836   1.00 0.05  ? 260 ARG A CZ   1  
ATOM 4055   N NH1  . ARG A 1 260 ? 35.696  -13.244 6.719   1.00 15.55 ? 260 ARG A NH1  1  
ATOM 4056   N NH2  . ARG A 1 260 ? 34.614  -12.421 4.863   1.00 25.12 ? 260 ARG A NH2  1  
ATOM 4057   H H    . ARG A 1 260 ? 30.271  -16.275 5.371   1.00 13.33 ? 260 ARG A H    1  
ATOM 4058   H HA   . ARG A 1 260 ? 31.678  -18.188 3.739   1.00 54.33 ? 260 ARG A HA   1  
ATOM 4059   H HB2  . ARG A 1 260 ? 33.633  -17.627 5.202   1.00 74.21 ? 260 ARG A HB2  1  
ATOM 4060   H HB3  . ARG A 1 260 ? 32.869  -16.213 4.486   1.00 35.44 ? 260 ARG A HB3  1  
ATOM 4061   H HG2  . ARG A 1 260 ? 31.660  -15.847 6.682   1.00 33.43 ? 260 ARG A HG2  1  
ATOM 4062   H HG3  . ARG A 1 260 ? 32.630  -17.155 7.366   1.00 72.15 ? 260 ARG A HG3  1  
ATOM 4063   H HD2  . ARG A 1 260 ? 33.580  -14.937 7.893   1.00 42.35 ? 260 ARG A HD2  1  
ATOM 4064   H HD3  . ARG A 1 260 ? 34.687  -15.898 6.904   1.00 44.01 ? 260 ARG A HD3  1  
ATOM 4065   H HE   . ARG A 1 260 ? 33.062  -14.294 5.231   1.00 4.02  ? 260 ARG A HE   1  
ATOM 4066   H HH11 . ARG A 1 260 ? 35.770  -13.924 7.456   1.00 35.21 ? 260 ARG A HH11 1  
ATOM 4067   H HH12 . ARG A 1 260 ? 36.375  -12.509 6.655   1.00 34.33 ? 260 ARG A HH12 1  
ATOM 4068   H HH21 . ARG A 1 260 ? 33.868  -12.482 4.191   1.00 21.33 ? 260 ARG A HH21 1  
ATOM 4069   H HH22 . ARG A 1 260 ? 35.290  -11.684 4.790   1.00 61.42 ? 260 ARG A HH22 1  
ATOM 4070   N N    . LEU A 1 261 ? 31.747  -20.305 5.101   1.00 21.21 ? 261 LEU A N    1  
ATOM 4071   C CA   . LEU A 1 261 ? 31.649  -21.596 5.806   1.00 1.33  ? 261 LEU A CA   1  
ATOM 4072   C C    . LEU A 1 261 ? 32.866  -22.478 5.535   1.00 55.32 ? 261 LEU A C    1  
ATOM 4073   O O    . LEU A 1 261 ? 33.440  -22.477 4.440   1.00 5.10  ? 261 LEU A O    1  
ATOM 4074   C CB   . LEU A 1 261 ? 30.331  -22.335 5.430   1.00 34.42 ? 261 LEU A CB   1  
ATOM 4075   C CG   . LEU A 1 261 ? 29.077  -21.890 6.243   1.00 15.45 ? 261 LEU A CG   1  
ATOM 4076   C CD1  . LEU A 1 261 ? 27.805  -22.546 5.708   1.00 40.23 ? 261 LEU A CD1  1  
ATOM 4077   C CD2  . LEU A 1 261 ? 29.266  -22.202 7.750   1.00 13.15 ? 261 LEU A CD2  1  
ATOM 4078   H H    . LEU A 1 261 ? 32.073  -20.302 4.178   1.00 24.12 ? 261 LEU A H    1  
ATOM 4079   H HA   . LEU A 1 261 ? 31.624  -21.384 6.873   1.00 4.14  ? 261 LEU A HA   1  
ATOM 4080   H HB2  . LEU A 1 261 ? 30.133  -22.168 4.373   1.00 14.24 ? 261 LEU A HB2  1  
ATOM 4081   H HB3  . LEU A 1 261 ? 30.461  -23.404 5.580   1.00 72.32 ? 261 LEU A HB3  1  
ATOM 4082   H HG   . LEU A 1 261 ? 28.955  -20.818 6.142   1.00 33.35 ? 261 LEU A HG   1  
ATOM 4083   H HD11 . LEU A 1 261 ? 27.666  -22.283 4.666   1.00 32.45 ? 261 LEU A HD11 1  
ATOM 4084   H HD12 . LEU A 1 261 ? 26.949  -22.198 6.273   1.00 52.15 ? 261 LEU A HD12 1  
ATOM 4085   H HD13 . LEU A 1 261 ? 27.875  -23.624 5.797   1.00 31.32 ? 261 LEU A HD13 1  
ATOM 4086   H HD21 . LEU A 1 261 ? 28.377  -21.914 8.300   1.00 12.02 ? 261 LEU A HD21 1  
ATOM 4087   H HD22 . LEU A 1 261 ? 30.110  -21.648 8.135   1.00 61.14 ? 261 LEU A HD22 1  
ATOM 4088   H HD23 . LEU A 1 261 ? 29.441  -23.262 7.888   1.00 23.50 ? 261 LEU A HD23 1  
ATOM 4089   N N    . THR A 1 262 ? 33.248  -23.213 6.575   1.00 44.34 ? 262 THR A N    1  
ATOM 4090   C CA   . THR A 1 262 ? 34.290  -24.234 6.533   1.00 23.10 ? 262 THR A CA   1  
ATOM 4091   C C    . THR A 1 262 ? 33.623  -25.631 6.346   1.00 30.40 ? 262 THR A C    1  
ATOM 4092   O O    . THR A 1 262 ? 32.487  -25.816 6.811   1.00 1.31  ? 262 THR A O    1  
ATOM 4093   C CB   . THR A 1 262 ? 35.122  -24.152 7.849   1.00 32.15 ? 262 THR A CB   1  
ATOM 4094   O OG1  . THR A 1 262 ? 34.242  -24.146 8.984   1.00 44.14 ? 262 THR A OG1  1  
ATOM 4095   C CG2  . THR A 1 262 ? 35.991  -22.880 7.895   1.00 13.42 ? 262 THR A CG2  1  
ATOM 4096   H H    . THR A 1 262 ? 32.806  -23.057 7.435   1.00 40.21 ? 262 THR A H    1  
ATOM 4097   H HA   . THR A 1 262 ? 34.949  -24.029 5.688   1.00 21.53 ? 262 THR A HA   1  
ATOM 4098   H HB   . THR A 1 262 ? 35.772  -25.018 7.913   1.00 44.40 ? 262 THR A HB   1  
ATOM 4099   H HG1  . THR A 1 262 ? 33.849  -25.020 9.097   1.00 54.35 ? 262 THR A HG1  1  
ATOM 4100   H HG21 . THR A 1 262 ? 36.537  -22.847 8.831   1.00 44.55 ? 262 THR A HG21 1  
ATOM 4101   H HG22 . THR A 1 262 ? 35.364  -22.003 7.824   1.00 62.00 ? 262 THR A HG22 1  
ATOM 4102   H HG23 . THR A 1 262 ? 36.692  -22.883 7.067   1.00 74.31 ? 262 THR A HG23 1  
ATOM 4103   N N    . PRO A 1 263 ? 34.319  -26.610 5.653   1.00 15.30 ? 263 PRO A N    1  
ATOM 4104   C CA   . PRO A 1 263 ? 33.738  -27.911 5.179   1.00 15.13 ? 263 PRO A CA   1  
ATOM 4105   C C    . PRO A 1 263 ? 32.752  -28.633 6.139   1.00 52.10 ? 263 PRO A C    1  
ATOM 4106   O O    . PRO A 1 263 ? 31.679  -29.070 5.703   1.00 31.02 ? 263 PRO A O    1  
ATOM 4107   C CB   . PRO A 1 263 ? 35.005  -28.767 4.943   1.00 41.22 ? 263 PRO A CB   1  
ATOM 4108   C CG   . PRO A 1 263 ? 36.035  -27.791 4.479   1.00 74.33 ? 263 PRO A CG   1  
ATOM 4109   C CD   . PRO A 1 263 ? 35.756  -26.508 5.243   1.00 14.11 ? 263 PRO A CD   1  
ATOM 4110   H HA   . PRO A 1 263 ? 33.235  -27.763 4.229   1.00 13.22 ? 263 PRO A HA   1  
ATOM 4111   H HB2  . PRO A 1 263 ? 35.317  -29.248 5.872   1.00 53.24 ? 263 PRO A HB2  1  
ATOM 4112   H HB3  . PRO A 1 263 ? 34.825  -29.516 4.182   1.00 1.40  ? 263 PRO A HB3  1  
ATOM 4113   H HG2  . PRO A 1 263 ? 37.030  -28.167 4.712   1.00 2.23  ? 263 PRO A HG2  1  
ATOM 4114   H HG3  . PRO A 1 263 ? 35.943  -27.620 3.413   1.00 22.13 ? 263 PRO A HG3  1  
ATOM 4115   H HD2  . PRO A 1 263 ? 36.394  -26.439 6.116   1.00 13.44 ? 263 PRO A HD2  1  
ATOM 4116   H HD3  . PRO A 1 263 ? 35.909  -25.645 4.606   1.00 21.40 ? 263 PRO A HD3  1  
ATOM 4117   N N    . GLU A 1 264 ? 33.124  -28.762 7.428   1.00 22.54 ? 264 GLU A N    1  
ATOM 4118   C CA   . GLU A 1 264 ? 32.322  -29.518 8.424   1.00 71.44 ? 264 GLU A CA   1  
ATOM 4119   C C    . GLU A 1 264 ? 30.992  -28.814 8.723   1.00 11.42 ? 264 GLU A C    1  
ATOM 4120   O O    . GLU A 1 264 ? 29.938  -29.449 8.689   1.00 2.21  ? 264 GLU A O    1  
ATOM 4121   C CB   . GLU A 1 264 ? 33.126  -29.745 9.731   1.00 61.41 ? 264 GLU A CB   1  
ATOM 4122   C CG   . GLU A 1 264 ? 32.347  -30.465 10.853  1.00 45.21 ? 264 GLU A CG   1  
ATOM 4123   C CD   . GLU A 1 264 ? 33.202  -30.757 12.098  1.00 52.01 ? 264 GLU A CD   1  
ATOM 4124   O OE1  . GLU A 1 264 ? 33.931  -31.777 12.096  1.00 41.24 ? 264 GLU A OE1  1  
ATOM 4125   O OE2  . GLU A 1 264 ? 33.175  -29.966 13.067  1.00 1.31  ? 264 GLU A OE2  1  
ATOM 4126   H H    . GLU A 1 264 ? 33.952  -28.333 7.718   1.00 64.11 ? 264 GLU A H    1  
ATOM 4127   H HA   . GLU A 1 264 ? 32.100  -30.489 7.986   1.00 13.20 ? 264 GLU A HA   1  
ATOM 4128   H HB2  . GLU A 1 264 ? 34.000  -30.340 9.494   1.00 64.31 ? 264 GLU A HB2  1  
ATOM 4129   H HB3  . GLU A 1 264 ? 33.459  -28.783 10.110  1.00 42.10 ? 264 GLU A HB3  1  
ATOM 4130   H HG2  . GLU A 1 264 ? 31.504  -29.842 11.141  1.00 60.41 ? 264 GLU A HG2  1  
ATOM 4131   H HG3  . GLU A 1 264 ? 31.968  -31.402 10.461  1.00 11.43 ? 264 GLU A HG3  1  
ATOM 4132   N N    . GLU A 1 265 ? 31.053  -27.504 9.007   1.00 31.30 ? 265 GLU A N    1  
ATOM 4133   C CA   . GLU A 1 265 ? 29.846  -26.686 9.259   1.00 3.13  ? 265 GLU A CA   1  
ATOM 4134   C C    . GLU A 1 265 ? 28.918  -26.741 8.047   1.00 52.13 ? 265 GLU A C    1  
ATOM 4135   O O    . GLU A 1 265 ? 27.720  -26.944 8.195   1.00 64.20 ? 265 GLU A O    1  
ATOM 4136   C CB   . GLU A 1 265 ? 30.219  -25.210 9.593   1.00 1.12  ? 265 GLU A CB   1  
ATOM 4137   C CG   . GLU A 1 265 ? 30.643  -24.943 11.055  1.00 34.32 ? 265 GLU A CG   1  
ATOM 4138   C CD   . GLU A 1 265 ? 31.798  -25.834 11.536  1.00 4.01  ? 265 GLU A CD   1  
ATOM 4139   O OE1  . GLU A 1 265 ? 31.636  -26.572 12.533  1.00 54.14 ? 265 GLU A OE1  1  
ATOM 4140   O OE2  . GLU A 1 265 ? 32.880  -25.799 10.910  1.00 2.34  ? 265 GLU A OE2  1  
ATOM 4141   H H    . GLU A 1 265 ? 31.927  -27.074 9.042   1.00 64.01 ? 265 GLU A H    1  
ATOM 4142   H HA   . GLU A 1 265 ? 29.327  -27.119 10.109  1.00 35.01 ? 265 GLU A HA   1  
ATOM 4143   H HB2  . GLU A 1 265 ? 31.037  -24.907 8.950   1.00 3.10  ? 265 GLU A HB2  1  
ATOM 4144   H HB3  . GLU A 1 265 ? 29.366  -24.569 9.377   1.00 12.10 ? 265 GLU A HB3  1  
ATOM 4145   H HG2  . GLU A 1 265 ? 30.958  -23.905 11.134  1.00 73.22 ? 265 GLU A HG2  1  
ATOM 4146   H HG3  . GLU A 1 265 ? 29.779  -25.087 11.701  1.00 23.41 ? 265 GLU A HG3  1  
ATOM 4147   N N    . GLU A 1 266 ? 29.507  -26.603 6.853   1.00 43.44 ? 266 GLU A N    1  
ATOM 4148   C CA   . GLU A 1 266 ? 28.766  -26.664 5.585   1.00 73.45 ? 266 GLU A CA   1  
ATOM 4149   C C    . GLU A 1 266 ? 28.111  -28.053 5.383   1.00 31.34 ? 266 GLU A C    1  
ATOM 4150   O O    . GLU A 1 266 ? 27.026  -28.160 4.809   1.00 52.24 ? 266 GLU A O    1  
ATOM 4151   C CB   . GLU A 1 266 ? 29.719  -26.322 4.411   1.00 63.11 ? 266 GLU A CB   1  
ATOM 4152   C CG   . GLU A 1 266 ? 29.062  -26.269 3.017   1.00 63.13 ? 266 GLU A CG   1  
ATOM 4153   C CD   . GLU A 1 266 ? 27.896  -25.272 2.920   1.00 65.34 ? 266 GLU A CD   1  
ATOM 4154   O OE1  . GLU A 1 266 ? 28.157  -24.077 2.811   1.00 4.14  ? 266 GLU A OE1  1  
ATOM 4155   O OE2  . GLU A 1 266 ? 26.714  -25.690 2.946   1.00 65.32 ? 266 GLU A OE2  1  
ATOM 4156   H H    . GLU A 1 266 ? 30.478  -26.449 6.823   1.00 65.24 ? 266 GLU A H    1  
ATOM 4157   H HA   . GLU A 1 266 ? 27.983  -25.917 5.631   1.00 62.11 ? 266 GLU A HA   1  
ATOM 4158   H HB2  . GLU A 1 266 ? 30.169  -25.359 4.606   1.00 33.53 ? 266 GLU A HB2  1  
ATOM 4159   H HB3  . GLU A 1 266 ? 30.509  -27.066 4.379   1.00 44.23 ? 266 GLU A HB3  1  
ATOM 4160   H HG2  . GLU A 1 266 ? 29.820  -25.990 2.294   1.00 64.44 ? 266 GLU A HG2  1  
ATOM 4161   H HG3  . GLU A 1 266 ? 28.699  -27.262 2.769   1.00 22.01 ? 266 GLU A HG3  1  
ATOM 4162   N N    . ALA A 1 267 ? 28.784  -29.107 5.870   1.00 32.53 ? 267 ALA A N    1  
ATOM 4163   C CA   . ALA A 1 267 ? 28.260  -30.483 5.818   1.00 64.12 ? 267 ALA A CA   1  
ATOM 4164   C C    . ALA A 1 267 ? 27.013  -30.629 6.718   1.00 21.32 ? 267 ALA A C    1  
ATOM 4165   O O    . ALA A 1 267 ? 26.031  -31.269 6.324   1.00 41.23 ? 267 ALA A O    1  
ATOM 4166   C CB   . ALA A 1 267 ? 29.359  -31.487 6.214   1.00 61.33 ? 267 ALA A CB   1  
ATOM 4167   H H    . ALA A 1 267 ? 29.660  -28.953 6.280   1.00 22.20 ? 267 ALA A H    1  
ATOM 4168   H HA   . ALA A 1 267 ? 27.975  -30.690 4.788   1.00 21.20 ? 267 ALA A HA   1  
ATOM 4169   H HB1  . ALA A 1 267 ? 28.984  -32.501 6.119   1.00 52.23 ? 267 ALA A HB1  1  
ATOM 4170   H HB2  . ALA A 1 267 ? 29.658  -31.314 7.238   1.00 63.03 ? 267 ALA A HB2  1  
ATOM 4171   H HB3  . ALA A 1 267 ? 30.218  -31.360 5.568   1.00 63.11 ? 267 ALA A HB3  1  
ATOM 4172   N N    . LEU A 1 268 ? 27.067  -30.018 7.923   1.00 73.14 ? 268 LEU A N    1  
ATOM 4173   C CA   . LEU A 1 268 ? 25.932  -30.007 8.878   1.00 50.21 ? 268 LEU A CA   1  
ATOM 4174   C C    . LEU A 1 268 ? 24.741  -29.212 8.301   1.00 21.50 ? 268 LEU A C    1  
ATOM 4175   O O    . LEU A 1 268 ? 23.607  -29.691 8.327   1.00 2.52  ? 268 LEU A O    1  
ATOM 4176   C CB   . LEU A 1 268 ? 26.361  -29.425 10.269  1.00 61.44 ? 268 LEU A CB   1  
ATOM 4177   C CG   . LEU A 1 268 ? 26.985  -30.431 11.301  1.00 5.53  ? 268 LEU A CG   1  
ATOM 4178   C CD1  . LEU A 1 268 ? 28.268  -31.119 10.772  1.00 4.11  ? 268 LEU A CD1  1  
ATOM 4179   C CD2  . LEU A 1 268 ? 27.245  -29.724 12.660  1.00 15.44 ? 268 LEU A CD2  1  
ATOM 4180   H H    . LEU A 1 268 ? 27.895  -29.552 8.174   1.00 5.40  ? 268 LEU A H    1  
ATOM 4181   H HA   . LEU A 1 268 ? 25.616  -31.035 9.015   1.00 1.51  ? 268 LEU A HA   1  
ATOM 4182   H HB2  . LEU A 1 268 ? 27.080  -28.632 10.095  1.00 33.44 ? 268 LEU A HB2  1  
ATOM 4183   H HB3  . LEU A 1 268 ? 25.488  -28.976 10.739  1.00 32.42 ? 268 LEU A HB3  1  
ATOM 4184   H HG   . LEU A 1 268 ? 26.263  -31.217 11.486  1.00 45.43 ? 268 LEU A HG   1  
ATOM 4185   H HD11 . LEU A 1 268 ? 28.639  -31.814 11.513  1.00 31.00 ? 268 LEU A HD11 1  
ATOM 4186   H HD12 . LEU A 1 268 ? 29.028  -30.377 10.565  1.00 1.45  ? 268 LEU A HD12 1  
ATOM 4187   H HD13 . LEU A 1 268 ? 28.043  -31.662 9.863   1.00 1.10  ? 268 LEU A HD13 1  
ATOM 4188   H HD21 . LEU A 1 268 ? 26.310  -29.347 13.059  1.00 4.14  ? 268 LEU A HD21 1  
ATOM 4189   H HD22 . LEU A 1 268 ? 27.932  -28.898 12.525  1.00 52.25 ? 268 LEU A HD22 1  
ATOM 4190   H HD23 . LEU A 1 268 ? 27.666  -30.429 13.365  1.00 24.24 ? 268 LEU A HD23 1  
ATOM 4191   N N    . TRP A 1 269 ? 25.031  -28.010 7.778   1.00 75.00 ? 269 TRP A N    1  
ATOM 4192   C CA   . TRP A 1 269 ? 24.028  -27.111 7.172   1.00 13.11 ? 269 TRP A CA   1  
ATOM 4193   C C    . TRP A 1 269 ? 23.296  -27.784 5.990   1.00 33.44 ? 269 TRP A C    1  
ATOM 4194   O O    . TRP A 1 269 ? 22.068  -27.664 5.865   1.00 63.45 ? 269 TRP A O    1  
ATOM 4195   C CB   . TRP A 1 269 ? 24.702  -25.798 6.692   1.00 0.33  ? 269 TRP A CB   1  
ATOM 4196   C CG   . TRP A 1 269 ? 24.939  -24.735 7.754   1.00 43.00 ? 269 TRP A CG   1  
ATOM 4197   C CD1  . TRP A 1 269 ? 26.133  -24.343 8.293   1.00 13.23 ? 269 TRP A CD1  1  
ATOM 4198   C CD2  . TRP A 1 269 ? 23.945  -23.885 8.351   1.00 12.41 ? 269 TRP A CD2  1  
ATOM 4199   N NE1  . TRP A 1 269 ? 25.945  -23.309 9.174   1.00 24.52 ? 269 TRP A NE1  1  
ATOM 4200   C CE2  . TRP A 1 269 ? 24.612  -23.013 9.230   1.00 32.20 ? 269 TRP A CE2  1  
ATOM 4201   C CE3  . TRP A 1 269 ? 22.556  -23.785 8.229   1.00 32.10 ? 269 TRP A CE3  1  
ATOM 4202   C CZ2  . TRP A 1 269 ? 23.942  -22.052 9.978   1.00 4.42  ? 269 TRP A CZ2  1  
ATOM 4203   C CZ3  . TRP A 1 269 ? 21.891  -22.827 8.967   1.00 14.34 ? 269 TRP A CZ3  1  
ATOM 4204   C CH2  . TRP A 1 269 ? 22.584  -21.969 9.832   1.00 5.25  ? 269 TRP A CH2  1  
ATOM 4205   H H    . TRP A 1 269 ? 25.960  -27.718 7.789   1.00 40.33 ? 269 TRP A H    1  
ATOM 4206   H HA   . TRP A 1 269 ? 23.296  -26.870 7.937   1.00 21.30 ? 269 TRP A HA   1  
ATOM 4207   H HB2  . TRP A 1 269 ? 25.661  -26.040 6.253   1.00 22.13 ? 269 TRP A HB2  1  
ATOM 4208   H HB3  . TRP A 1 269 ? 24.089  -25.342 5.919   1.00 54.54 ? 269 TRP A HB3  1  
ATOM 4209   H HD1  . TRP A 1 269 ? 27.086  -24.786 8.047   1.00 41.01 ? 269 TRP A HD1  1  
ATOM 4210   H HE1  . TRP A 1 269 ? 26.651  -22.861 9.683   1.00 12.13 ? 269 TRP A HE1  1  
ATOM 4211   H HE3  . TRP A 1 269 ? 22.005  -24.439 7.564   1.00 12.40 ? 269 TRP A HE3  1  
ATOM 4212   H HZ2  . TRP A 1 269 ? 24.465  -21.383 10.650  1.00 2.33  ? 269 TRP A HZ2  1  
ATOM 4213   H HZ3  . TRP A 1 269 ? 20.817  -22.733 8.884   1.00 74.33 ? 269 TRP A HZ3  1  
ATOM 4214   H HH2  . TRP A 1 269 ? 22.021  -21.235 10.397  1.00 42.23 ? 269 TRP A HH2  1  
ATOM 4215   N N    . LYS A 1 270 ? 24.063  -28.471 5.124   1.00 44.41 ? 270 LYS A N    1  
ATOM 4216   C CA   . LYS A 1 270 ? 23.497  -29.194 3.975   1.00 10.34 ? 270 LYS A CA   1  
ATOM 4217   C C    . LYS A 1 270 ? 22.652  -30.391 4.427   1.00 24.10 ? 270 LYS A C    1  
ATOM 4218   O O    . LYS A 1 270 ? 21.578  -30.593 3.896   1.00 31.31 ? 270 LYS A O    1  
ATOM 4219   C CB   . LYS A 1 270 ? 24.588  -29.639 2.957   1.00 34.54 ? 270 LYS A CB   1  
ATOM 4220   C CG   . LYS A 1 270 ? 25.136  -28.486 2.076   1.00 45.02 ? 270 LYS A CG   1  
ATOM 4221   C CD   . LYS A 1 270 ? 25.779  -28.983 0.760   1.00 50.35 ? 270 LYS A CD   1  
ATOM 4222   C CE   . LYS A 1 270 ? 26.059  -27.843 -0.234  1.00 62.43 ? 270 LYS A CE   1  
ATOM 4223   N NZ   . LYS A 1 270 ? 26.958  -26.800 0.314   1.00 53.11 ? 270 LYS A NZ   1  
ATOM 4224   H H    . LYS A 1 270 ? 25.031  -28.491 5.266   1.00 1.41  ? 270 LYS A H    1  
ATOM 4225   H HA   . LYS A 1 270 ? 22.829  -28.498 3.466   1.00 52.52 ? 270 LYS A HA   1  
ATOM 4226   H HB2  . LYS A 1 270 ? 25.414  -30.082 3.502   1.00 32.32 ? 270 LYS A HB2  1  
ATOM 4227   H HB3  . LYS A 1 270 ? 24.166  -30.396 2.299   1.00 72.13 ? 270 LYS A HB3  1  
ATOM 4228   H HG2  . LYS A 1 270 ? 24.319  -27.818 1.825   1.00 12.34 ? 270 LYS A HG2  1  
ATOM 4229   H HG3  . LYS A 1 270 ? 25.880  -27.929 2.642   1.00 72.33 ? 270 LYS A HG3  1  
ATOM 4230   H HD2  . LYS A 1 270 ? 26.714  -29.484 0.987   1.00 4.14  ? 270 LYS A HD2  1  
ATOM 4231   H HD3  . LYS A 1 270 ? 25.107  -29.694 0.287   1.00 64.42 ? 270 LYS A HD3  1  
ATOM 4232   H HE2  . LYS A 1 270 ? 26.523  -28.259 -1.116  1.00 73.12 ? 270 LYS A HE2  1  
ATOM 4233   H HE3  . LYS A 1 270 ? 25.120  -27.383 -0.514  1.00 23.51 ? 270 LYS A HE3  1  
ATOM 4234   H HZ1  . LYS A 1 270 ? 27.162  -26.088 -0.417  1.00 52.43 ? 270 LYS A HZ1  1  
ATOM 4235   H HZ2  . LYS A 1 270 ? 27.853  -27.223 0.625   1.00 15.32 ? 270 LYS A HZ2  1  
ATOM 4236   H HZ3  . LYS A 1 270 ? 26.509  -26.329 1.130   1.00 5.11  ? 270 LYS A HZ3  1  
ATOM 4237   N N    . LYS A 1 271 ? 23.131  -31.159 5.418   1.00 52.11 ? 271 LYS A N    1  
ATOM 4238   C CA   . LYS A 1 271 ? 22.388  -32.335 5.936   1.00 44.43 ? 271 LYS A CA   1  
ATOM 4239   C C    . LYS A 1 271 ? 21.043  -31.927 6.565   1.00 12.14 ? 271 LYS A C    1  
ATOM 4240   O O    . LYS A 1 271 ? 20.046  -32.652 6.427   1.00 70.22 ? 271 LYS A O    1  
ATOM 4241   C CB   . LYS A 1 271 ? 23.271  -33.148 6.926   1.00 1.23  ? 271 LYS A CB   1  
ATOM 4242   C CG   . LYS A 1 271 ? 24.297  -34.062 6.221   1.00 13.01 ? 271 LYS A CG   1  
ATOM 4243   C CD   . LYS A 1 271 ? 23.610  -35.171 5.380   1.00 3.34  ? 271 LYS A CD   1  
ATOM 4244   C CE   . LYS A 1 271 ? 24.574  -35.871 4.412   1.00 24.34 ? 271 LYS A CE   1  
ATOM 4245   N NZ   . LYS A 1 271 ? 25.109  -34.936 3.388   1.00 10.12 ? 271 LYS A NZ   1  
ATOM 4246   H H    . LYS A 1 271 ? 23.994  -30.926 5.823   1.00 33.21 ? 271 LYS A H    1  
ATOM 4247   H HA   . LYS A 1 271 ? 22.165  -32.970 5.079   1.00 63.20 ? 271 LYS A HA   1  
ATOM 4248   H HB2  . LYS A 1 271 ? 23.814  -32.453 7.560   1.00 1.05  ? 271 LYS A HB2  1  
ATOM 4249   H HB3  . LYS A 1 271 ? 22.640  -33.768 7.552   1.00 14.24 ? 271 LYS A HB3  1  
ATOM 4250   H HG2  . LYS A 1 271 ? 24.918  -33.455 5.569   1.00 51.15 ? 271 LYS A HG2  1  
ATOM 4251   H HG3  . LYS A 1 271 ? 24.926  -34.529 6.973   1.00 15.13 ? 271 LYS A HG3  1  
ATOM 4252   H HD2  . LYS A 1 271 ? 23.199  -35.913 6.054   1.00 25.24 ? 271 LYS A HD2  1  
ATOM 4253   H HD3  . LYS A 1 271 ? 22.801  -34.732 4.805   1.00 50.24 ? 271 LYS A HD3  1  
ATOM 4254   H HE2  . LYS A 1 271 ? 25.403  -36.285 4.971   1.00 41.43 ? 271 LYS A HE2  1  
ATOM 4255   H HE3  . LYS A 1 271 ? 24.048  -36.673 3.909   1.00 0.52  ? 271 LYS A HE3  1  
ATOM 4256   H HZ1  . LYS A 1 271 ? 25.706  -35.453 2.713   1.00 11.43 ? 271 LYS A HZ1  1  
ATOM 4257   H HZ2  . LYS A 1 271 ? 25.680  -34.196 3.840   1.00 22.10 ? 271 LYS A HZ2  1  
ATOM 4258   H HZ3  . LYS A 1 271 ? 24.324  -34.489 2.870   1.00 42.52 ? 271 LYS A HZ3  1  
ATOM 4259   N N    . LEU A 1 272 ? 21.032  -30.755 7.220   1.00 63.40 ? 272 LEU A N    1  
ATOM 4260   C CA   . LEU A 1 272 ? 19.794  -30.105 7.684   1.00 15.12 ? 272 LEU A CA   1  
ATOM 4261   C C    . LEU A 1 272 ? 18.893  -29.810 6.486   1.00 10.43 ? 272 LEU A C    1  
ATOM 4262   O O    . LEU A 1 272 ? 17.746  -30.208 6.458   1.00 1.04  ? 272 LEU A O    1  
ATOM 4263   C CB   . LEU A 1 272 ? 20.120  -28.787 8.444   1.00 31.32 ? 272 LEU A CB   1  
ATOM 4264   C CG   . LEU A 1 272 ? 20.815  -28.977 9.819   1.00 33.34 ? 272 LEU A CG   1  
ATOM 4265   C CD1  . LEU A 1 272 ? 21.208  -27.625 10.445  1.00 34.54 ? 272 LEU A CD1  1  
ATOM 4266   C CD2  . LEU A 1 272 ? 19.914  -29.794 10.762  1.00 61.43 ? 272 LEU A CD2  1  
ATOM 4267   H H    . LEU A 1 272 ? 21.883  -30.306 7.387   1.00 42.12 ? 272 LEU A H    1  
ATOM 4268   H HA   . LEU A 1 272 ? 19.280  -30.788 8.353   1.00 20.13 ? 272 LEU A HA   1  
ATOM 4269   H HB2  . LEU A 1 272 ? 20.765  -28.179 7.813   1.00 1.44  ? 272 LEU A HB2  1  
ATOM 4270   H HB3  . LEU A 1 272 ? 19.195  -28.239 8.606   1.00 23.11 ? 272 LEU A HB3  1  
ATOM 4271   H HG   . LEU A 1 272 ? 21.729  -29.541 9.673   1.00 2.24  ? 272 LEU A HG   1  
ATOM 4272   H HD11 . LEU A 1 272 ? 21.879  -27.098 9.779   1.00 71.54 ? 272 LEU A HD11 1  
ATOM 4273   H HD12 . LEU A 1 272 ? 21.711  -27.792 11.389  1.00 44.31 ? 272 LEU A HD12 1  
ATOM 4274   H HD13 . LEU A 1 272 ? 20.324  -27.021 10.614  1.00 51.01 ? 272 LEU A HD13 1  
ATOM 4275   H HD21 . LEU A 1 272 ? 19.745  -30.778 10.343  1.00 14.31 ? 272 LEU A HD21 1  
ATOM 4276   H HD22 . LEU A 1 272 ? 18.960  -29.294 10.890  1.00 20.30 ? 272 LEU A HD22 1  
ATOM 4277   H HD23 . LEU A 1 272 ? 20.390  -29.901 11.726  1.00 23.43 ? 272 LEU A HD23 1  
ATOM 4278   N N    . ALA A 1 273 ? 19.487  -29.166 5.478   1.00 22.11 ? 273 ALA A N    1  
ATOM 4279   C CA   . ALA A 1 273 ? 18.792  -28.679 4.275   1.00 45.05 ? 273 ALA A CA   1  
ATOM 4280   C C    . ALA A 1 273 ? 18.220  -29.798 3.398   1.00 61.35 ? 273 ALA A C    1  
ATOM 4281   O O    . ALA A 1 273 ? 17.230  -29.590 2.701   1.00 33.21 ? 273 ALA A O    1  
ATOM 4282   C CB   . ALA A 1 273 ? 19.758  -27.830 3.463   1.00 64.51 ? 273 ALA A CB   1  
ATOM 4283   H H    . ALA A 1 273 ? 20.453  -29.015 5.544   1.00 72.23 ? 273 ALA A H    1  
ATOM 4284   H HA   . ALA A 1 273 ? 17.979  -28.033 4.601   1.00 33.23 ? 273 ALA A HA   1  
ATOM 4285   H HB1  . ALA A 1 273 ? 19.243  -27.393 2.613   1.00 24.03 ? 273 ALA A HB1  1  
ATOM 4286   H HB2  . ALA A 1 273 ? 20.579  -28.439 3.108   1.00 43.24 ? 273 ALA A HB2  1  
ATOM 4287   H HB3  . ALA A 1 273 ? 20.152  -27.035 4.084   1.00 13.42 ? 273 ALA A HB3  1  
ATOM 4288   N N    . GLU A 1 274 ? 18.873  -30.954 3.419   1.00 13.31 ? 274 GLU A N    1  
ATOM 4289   C CA   . GLU A 1 274 ? 18.472  -32.116 2.628   1.00 1.43  ? 274 GLU A CA   1  
ATOM 4290   C C    . GLU A 1 274 ? 17.339  -32.852 3.348   1.00 54.12 ? 274 GLU A C    1  
ATOM 4291   O O    . GLU A 1 274 ? 16.292  -33.138 2.751   1.00 41.04 ? 274 GLU A O    1  
ATOM 4292   C CB   . GLU A 1 274 ? 19.690  -33.045 2.387   1.00 74.35 ? 274 GLU A CB   1  
ATOM 4293   C CG   . GLU A 1 274 ? 20.823  -32.422 1.547   1.00 14.12 ? 274 GLU A CG   1  
ATOM 4294   C CD   . GLU A 1 274 ? 21.917  -33.428 1.160   1.00 0.44  ? 274 GLU A CD   1  
ATOM 4295   O OE1  . GLU A 1 274 ? 22.957  -33.509 1.861   1.00 33.20 ? 274 GLU A OE1  1  
ATOM 4296   O OE2  . GLU A 1 274 ? 21.729  -34.145 0.148   1.00 65.13 ? 274 GLU A OE2  1  
ATOM 4297   H H    . GLU A 1 274 ? 19.644  -31.037 4.012   1.00 42.25 ? 274 GLU A H    1  
ATOM 4298   H HA   . GLU A 1 274 ? 18.102  -31.764 1.664   1.00 43.20 ? 274 GLU A HA   1  
ATOM 4299   H HB2  . GLU A 1 274 ? 20.102  -33.335 3.348   1.00 2.32  ? 274 GLU A HB2  1  
ATOM 4300   H HB3  . GLU A 1 274 ? 19.346  -33.936 1.877   1.00 64.14 ? 274 GLU A HB3  1  
ATOM 4301   H HG2  . GLU A 1 274 ? 20.397  -32.005 0.641   1.00 14.35 ? 274 GLU A HG2  1  
ATOM 4302   H HG3  . GLU A 1 274 ? 21.270  -31.613 2.114   1.00 51.30 ? 274 GLU A HG3  1  
ATOM 4303   N N    . ALA A 1 275 ? 17.550  -33.111 4.654   1.00 64.22 ? 275 ALA A N    1  
ATOM 4304   C CA   . ALA A 1 275 ? 16.541  -33.757 5.521   1.00 45.11 ? 275 ALA A CA   1  
ATOM 4305   C C    . ALA A 1 275 ? 15.320  -32.832 5.742   1.00 42.34 ? 275 ALA A C    1  
ATOM 4306   O O    . ALA A 1 275 ? 14.250  -33.287 6.146   1.00 71.44 ? 275 ALA A O    1  
ATOM 4307   C CB   . ALA A 1 275 ? 17.179  -34.163 6.859   1.00 13.44 ? 275 ALA A CB   1  
ATOM 4308   H H    . ALA A 1 275 ? 18.407  -32.841 5.056   1.00 22.24 ? 275 ALA A H    1  
ATOM 4309   H HA   . ALA A 1 275 ? 16.203  -34.664 5.021   1.00 41.42 ? 275 ALA A HA   1  
ATOM 4310   H HB1  . ALA A 1 275 ? 16.453  -34.684 7.472   1.00 14.43 ? 275 ALA A HB1  1  
ATOM 4311   H HB2  . ALA A 1 275 ? 17.520  -33.279 7.385   1.00 72.24 ? 275 ALA A HB2  1  
ATOM 4312   H HB3  . ALA A 1 275 ? 18.024  -34.813 6.675   1.00 31.40 ? 275 ALA A HB3  1  
ATOM 4313   N N    . TYR A 1 276 ? 15.521  -31.534 5.484   1.00 40.32 ? 276 TYR A N    1  
ATOM 4314   C CA   . TYR A 1 276 ? 14.453  -30.532 5.461   1.00 51.31 ? 276 TYR A CA   1  
ATOM 4315   C C    . TYR A 1 276 ? 13.696  -30.663 4.132   1.00 1.55  ? 276 TYR A C    1  
ATOM 4316   O O    . TYR A 1 276 ? 12.647  -31.289 4.086   1.00 3.51  ? 276 TYR A O    1  
ATOM 4317   C CB   . TYR A 1 276 ? 15.067  -29.111 5.632   1.00 22.10 ? 276 TYR A CB   1  
ATOM 4318   C CG   . TYR A 1 276 ? 14.079  -27.976 5.951   1.00 4.42  ? 276 TYR A CG   1  
ATOM 4319   C CD1  . TYR A 1 276 ? 13.267  -27.409 4.962   1.00 75.02 ? 276 TYR A CD1  1  
ATOM 4320   C CD2  . TYR A 1 276 ? 13.985  -27.461 7.243   1.00 54.11 ? 276 TYR A CD2  1  
ATOM 4321   C CE1  . TYR A 1 276 ? 12.402  -26.375 5.255   1.00 52.34 ? 276 TYR A CE1  1  
ATOM 4322   C CE2  . TYR A 1 276 ? 13.123  -26.432 7.535   1.00 45.43 ? 276 TYR A CE2  1  
ATOM 4323   C CZ   . TYR A 1 276 ? 12.334  -25.890 6.542   1.00 51.13 ? 276 TYR A CZ   1  
ATOM 4324   O OH   . TYR A 1 276 ? 11.482  -24.848 6.841   1.00 41.30 ? 276 TYR A OH   1  
ATOM 4325   H H    . TYR A 1 276 ? 16.436  -31.238 5.316   1.00 4.11  ? 276 TYR A H    1  
ATOM 4326   H HA   . TYR A 1 276 ? 13.775  -30.732 6.286   1.00 41.33 ? 276 TYR A HA   1  
ATOM 4327   H HB2  . TYR A 1 276 ? 15.792  -29.152 6.439   1.00 25.42 ? 276 TYR A HB2  1  
ATOM 4328   H HB3  . TYR A 1 276 ? 15.599  -28.844 4.723   1.00 30.14 ? 276 TYR A HB3  1  
ATOM 4329   H HD1  . TYR A 1 276 ? 13.321  -27.795 3.950   1.00 54.44 ? 276 TYR A HD1  1  
ATOM 4330   H HD2  . TYR A 1 276 ? 14.604  -27.886 8.029   1.00 64.11 ? 276 TYR A HD2  1  
ATOM 4331   H HE1  . TYR A 1 276 ? 11.785  -25.951 4.477   1.00 52.24 ? 276 TYR A HE1  1  
ATOM 4332   H HE2  . TYR A 1 276 ? 13.074  -26.050 8.540   1.00 53.34 ? 276 TYR A HE2  1  
ATOM 4333   H HH   . TYR A 1 276 ? 10.630  -24.999 6.432   1.00 53.23 ? 276 TYR A HH   1  
ATOM 4334   N N    . TYR A 1 277 ? 14.322  -30.143 3.050   1.00 70.12 ? 277 TYR A N    1  
ATOM 4335   C CA   . TYR A 1 277 ? 13.710  -30.000 1.713   1.00 23.33 ? 277 TYR A CA   1  
ATOM 4336   C C    . TYR A 1 277 ? 13.056  -31.314 1.247   1.00 31.11 ? 277 TYR A C    1  
ATOM 4337   O O    . TYR A 1 277 ? 11.828  -31.380 1.101   1.00 21.30 ? 277 TYR A O    1  
ATOM 4338   C CB   . TYR A 1 277 ? 14.793  -29.526 0.705   1.00 43.11 ? 277 TYR A CB   1  
ATOM 4339   C CG   . TYR A 1 277 ? 14.304  -29.301 -0.746  1.00 34.12 ? 277 TYR A CG   1  
ATOM 4340   C CD1  . TYR A 1 277 ? 13.654  -28.120 -1.109  1.00 23.51 ? 277 TYR A CD1  1  
ATOM 4341   C CD2  . TYR A 1 277 ? 14.501  -30.266 -1.743  1.00 23.11 ? 277 TYR A CD2  1  
ATOM 4342   C CE1  . TYR A 1 277 ? 13.220  -27.910 -2.404  1.00 65.10 ? 277 TYR A CE1  1  
ATOM 4343   C CE2  . TYR A 1 277 ? 14.064  -30.056 -3.039  1.00 13.42 ? 277 TYR A CE2  1  
ATOM 4344   C CZ   . TYR A 1 277 ? 13.429  -28.877 -3.362  1.00 31.12 ? 277 TYR A CZ   1  
ATOM 4345   O OH   . TYR A 1 277 ? 12.993  -28.660 -4.647  1.00 13.15 ? 277 TYR A OH   1  
ATOM 4346   H H    . TYR A 1 277 ? 15.246  -29.856 3.159   1.00 54.25 ? 277 TYR A H    1  
ATOM 4347   H HA   . TYR A 1 277 ? 12.945  -29.231 1.792   1.00 21.22 ? 277 TYR A HA   1  
ATOM 4348   H HB2  . TYR A 1 277 ? 15.211  -28.592 1.065   1.00 13.53 ? 277 TYR A HB2  1  
ATOM 4349   H HB3  . TYR A 1 277 ? 15.588  -30.264 0.685   1.00 72.14 ? 277 TYR A HB3  1  
ATOM 4350   H HD1  . TYR A 1 277 ? 13.490  -27.354 -0.354  1.00 70.43 ? 277 TYR A HD1  1  
ATOM 4351   H HD2  . TYR A 1 277 ? 14.997  -31.195 -1.487  1.00 11.24 ? 277 TYR A HD2  1  
ATOM 4352   H HE1  . TYR A 1 277 ? 12.723  -26.983 -2.657  1.00 33.14 ? 277 TYR A HE1  1  
ATOM 4353   H HE2  . TYR A 1 277 ? 14.226  -30.812 -3.791  1.00 42.31 ? 277 TYR A HE2  1  
ATOM 4354   H HH   . TYR A 1 277 ? 12.299  -29.289 -4.864  1.00 11.24 ? 277 TYR A HH   1  
ATOM 4355   N N    . ALA A 1 278 ? 13.882  -32.374 1.128   1.00 0.14  ? 278 ALA A N    1  
ATOM 4356   C CA   . ALA A 1 278 ? 13.443  -33.674 0.582   1.00 3.34  ? 278 ALA A CA   1  
ATOM 4357   C C    . ALA A 1 278 ? 12.331  -34.305 1.435   1.00 54.53 ? 278 ALA A C    1  
ATOM 4358   O O    . ALA A 1 278 ? 11.464  -35.013 0.914   1.00 75.41 ? 278 ALA A O    1  
ATOM 4359   C CB   . ALA A 1 278 ? 14.633  -34.630 0.447   1.00 53.32 ? 278 ALA A CB   1  
ATOM 4360   H H    . ALA A 1 278 ? 14.817  -32.281 1.436   1.00 5.23  ? 278 ALA A H    1  
ATOM 4361   H HA   . ALA A 1 278 ? 13.050  -33.492 -0.419  1.00 34.05 ? 278 ALA A HA   1  
ATOM 4362   H HB1  . ALA A 1 278 ? 14.309  -35.557 -0.014  1.00 33.45 ? 278 ALA A HB1  1  
ATOM 4363   H HB2  . ALA A 1 278 ? 15.047  -34.841 1.422   1.00 44.41 ? 278 ALA A HB2  1  
ATOM 4364   H HB3  . ALA A 1 278 ? 15.399  -34.175 -0.171  1.00 2.43  ? 278 ALA A HB3  1  
ATOM 4365   N N    . ARG A 1 279 ? 12.325  -33.993 2.747   1.00 1.31  ? 279 ARG A N    1  
ATOM 4366   C CA   . ARG A 1 279 ? 11.391  -34.606 3.702   1.00 20.15 ? 279 ARG A CA   1  
ATOM 4367   C C    . ARG A 1 279 ? 10.491  -33.519 4.309   1.00 33.11 ? 279 ARG A C    1  
ATOM 4368   O O    . ARG A 1 279 ? 10.076  -33.615 5.467   1.00 33.54 ? 279 ARG A O    1  
ATOM 4369   C CB   . ARG A 1 279 ? 12.178  -35.399 4.787   1.00 44.20 ? 279 ARG A CB   1  
ATOM 4370   C CG   . ARG A 1 279 ? 13.085  -36.553 4.255   1.00 55.44 ? 279 ARG A CG   1  
ATOM 4371   C CD   . ARG A 1 279 ? 12.310  -37.800 3.737   1.00 60.13 ? 279 ARG A CD   1  
ATOM 4372   N NE   . ARG A 1 279 ? 11.506  -37.539 2.512   1.00 64.34 ? 279 ARG A NE   1  
ATOM 4373   C CZ   . ARG A 1 279 ? 11.721  -38.081 1.299   1.00 74.13 ? 279 ARG A CZ   1  
ATOM 4374   N NH1  . ARG A 1 279 ? 12.722  -38.916 1.107   1.00 23.12 ? 279 ARG A NH1  1  
ATOM 4375   N NH2  . ARG A 1 279 ? 10.937  -37.756 0.278   1.00 70.52 ? 279 ARG A NH2  1  
ATOM 4376   H H    . ARG A 1 279 ? 12.924  -33.271 3.071   1.00 44.35 ? 279 ARG A H    1  
ATOM 4377   H HA   . ARG A 1 279 ? 10.751  -35.302 3.165   1.00 24.21 ? 279 ARG A HA   1  
ATOM 4378   H HB2  . ARG A 1 279 ? 12.806  -34.705 5.332   1.00 11.21 ? 279 ARG A HB2  1  
ATOM 4379   H HB3  . ARG A 1 279 ? 11.465  -35.829 5.486   1.00 75.15 ? 279 ARG A HB3  1  
ATOM 4380   H HG2  . ARG A 1 279 ? 13.689  -36.167 3.443   1.00 12.15 ? 279 ARG A HG2  1  
ATOM 4381   H HG3  . ARG A 1 279 ? 13.749  -36.863 5.059   1.00 50.42 ? 279 ARG A HG3  1  
ATOM 4382   H HD2  . ARG A 1 279 ? 13.023  -38.593 3.538   1.00 41.30 ? 279 ARG A HD2  1  
ATOM 4383   H HD3  . ARG A 1 279 ? 11.639  -38.134 4.525   1.00 14.32 ? 279 ARG A HD3  1  
ATOM 4384   H HE   . ARG A 1 279 ? 10.748  -36.925 2.609   1.00 12.23 ? 279 ARG A HE   1  
ATOM 4385   H HH11 . ARG A 1 279 ? 13.329  -39.164 1.866   1.00 4.11  ? 279 ARG A HH11 1  
ATOM 4386   H HH12 . ARG A 1 279 ? 12.885  -39.318 0.205   1.00 64.22 ? 279 ARG A HH12 1  
ATOM 4387   H HH21 . ARG A 1 279 ? 10.178  -37.114 0.416   1.00 30.12 ? 279 ARG A HH21 1  
ATOM 4388   H HH22 . ARG A 1 279 ? 11.088  -38.153 -0.631  1.00 4.30  ? 279 ARG A HH22 1  
ATOM 4389   N N    . ALA A 1 280 ? 10.190  -32.480 3.501   1.00 72.21 ? 280 ALA A N    1  
ATOM 4390   C CA   . ALA A 1 280 ? 9.204   -31.453 3.855   1.00 52.24 ? 280 ALA A CA   1  
ATOM 4391   C C    . ALA A 1 280 ? 7.787   -32.035 3.651   1.00 32.53 ? 280 ALA A C    1  
ATOM 4392   O O    . ALA A 1 280 ? 7.198   -32.554 4.626   1.00 43.03 ? 280 ALA A O    1  
ATOM 4393   C CB   . ALA A 1 280 ? 9.443   -30.162 3.034   1.00 44.42 ? 280 ALA A CB   1  
ATOM 4394   O OXT  . ALA A 1 280 ? 7.285   -32.025 2.511   1.00 37.66 ? 280 ALA A OXT  1  
ATOM 4395   H H    . ALA A 1 280 ? 10.663  -32.396 2.640   1.00 72.50 ? 280 ALA A H    1  
ATOM 4396   H HA   . ALA A 1 280 ? 9.338   -31.202 4.910   1.00 71.11 ? 280 ALA A HA   1  
ATOM 4397   H HB1  . ALA A 1 280 ? 8.742   -29.394 3.339   1.00 33.13 ? 280 ALA A HB1  1  
ATOM 4398   H HB2  . ALA A 1 280 ? 9.310   -30.367 1.979   1.00 14.12 ? 280 ALA A HB2  1  
ATOM 4399   H HB3  . ALA A 1 280 ? 10.452  -29.809 3.202   1.00 12.22 ? 280 ALA A HB3  1  
ATOM 4400   N N    . MET B 2 1   ? 27.350  9.567   17.455  1.00 71.44 ? 1   MET B N    1  
ATOM 4401   C CA   . MET B 2 1   ? 27.740  10.770  18.229  1.00 2.23  ? 1   MET B CA   1  
ATOM 4402   C C    . MET B 2 1   ? 26.729  11.017  19.357  1.00 61.00 ? 1   MET B C    1  
ATOM 4403   O O    . MET B 2 1   ? 25.751  10.276  19.494  1.00 3.24  ? 1   MET B O    1  
ATOM 4404   C CB   . MET B 2 1   ? 27.857  12.008  17.295  1.00 62.21 ? 1   MET B CB   1  
ATOM 4405   C CG   . MET B 2 1   ? 28.970  11.906  16.244  1.00 34.32 ? 1   MET B CG   1  
ATOM 4406   S SD   . MET B 2 1   ? 29.162  13.413  15.252  1.00 51.41 ? 1   MET B SD   1  
ATOM 4407   C CE   . MET B 2 1   ? 27.543  13.592  14.494  1.00 14.31 ? 1   MET B CE   1  
ATOM 4408   H H1   . MET B 2 1   ? 26.437  9.726   16.981  1.00 37.66 ? 1   MET B H1   1  
ATOM 4409   H H2   . MET B 2 1   ? 27.255  8.754   18.094  1.00 37.66 ? 1   MET B H2   1  
ATOM 4410   H H3   . MET B 2 1   ? 28.063  9.344   16.732  1.00 37.66 ? 1   MET B H3   1  
ATOM 4411   H HA   . MET B 2 1   ? 28.709  10.571  18.679  1.00 13.50 ? 1   MET B HA   1  
ATOM 4412   H HB2  . MET B 2 1   ? 26.915  12.150  16.779  1.00 65.12 ? 1   MET B HB2  1  
ATOM 4413   H HB3  . MET B 2 1   ? 28.051  12.888  17.903  1.00 31.04 ? 1   MET B HB3  1  
ATOM 4414   H HG2  . MET B 2 1   ? 29.908  11.715  16.746  1.00 31.51 ? 1   MET B HG2  1  
ATOM 4415   H HG3  . MET B 2 1   ? 28.750  11.082  15.577  1.00 74.12 ? 1   MET B HG3  1  
ATOM 4416   H HE1  . MET B 2 1   ? 27.543  14.462  13.854  1.00 41.20 ? 1   MET B HE1  1  
ATOM 4417   H HE2  . MET B 2 1   ? 26.793  13.715  15.264  1.00 45.13 ? 1   MET B HE2  1  
ATOM 4418   H HE3  . MET B 2 1   ? 27.316  12.714  13.907  1.00 13.03 ? 1   MET B HE3  1  
ATOM 4419   N N    . LYS B 2 2   ? 26.977  12.066  20.162  1.00 53.20 ? 2   LYS B N    1  
ATOM 4420   C CA   . LYS B 2 2   ? 26.189  12.368  21.368  1.00 12.13 ? 2   LYS B CA   1  
ATOM 4421   C C    . LYS B 2 2   ? 25.247  13.551  21.079  1.00 30.32 ? 2   LYS B C    1  
ATOM 4422   O O    . LYS B 2 2   ? 25.618  14.711  21.311  1.00 50.15 ? 2   LYS B O    1  
ATOM 4423   C CB   . LYS B 2 2   ? 27.158  12.705  22.542  1.00 54.10 ? 2   LYS B CB   1  
ATOM 4424   C CG   . LYS B 2 2   ? 28.348  11.727  22.697  1.00 13.34 ? 2   LYS B CG   1  
ATOM 4425   C CD   . LYS B 2 2   ? 29.350  12.179  23.784  1.00 53.31 ? 2   LYS B CD   1  
ATOM 4426   C CE   . LYS B 2 2   ? 28.752  12.140  25.195  1.00 51.24 ? 2   LYS B CE   1  
ATOM 4427   N NZ   . LYS B 2 2   ? 28.394  10.759  25.603  1.00 0.32  ? 2   LYS B NZ   1  
ATOM 4428   H H    . LYS B 2 2   ? 27.720  12.666  19.935  1.00 61.33 ? 2   LYS B H    1  
ATOM 4429   H HA   . LYS B 2 2   ? 25.594  11.496  21.636  1.00 62.45 ? 2   LYS B HA   1  
ATOM 4430   H HB2  . LYS B 2 2   ? 27.564  13.699  22.384  1.00 35.33 ? 2   LYS B HB2  1  
ATOM 4431   H HB3  . LYS B 2 2   ? 26.593  12.706  23.470  1.00 31.11 ? 2   LYS B HB3  1  
ATOM 4432   H HG2  . LYS B 2 2   ? 27.969  10.743  22.954  1.00 11.53 ? 2   LYS B HG2  1  
ATOM 4433   H HG3  . LYS B 2 2   ? 28.869  11.664  21.748  1.00 34.14 ? 2   LYS B HG3  1  
ATOM 4434   H HD2  . LYS B 2 2   ? 30.219  11.528  23.753  1.00 4.52  ? 2   LYS B HD2  1  
ATOM 4435   H HD3  . LYS B 2 2   ? 29.669  13.195  23.566  1.00 52.20 ? 2   LYS B HD3  1  
ATOM 4436   H HE2  . LYS B 2 2   ? 29.476  12.533  25.898  1.00 25.14 ? 2   LYS B HE2  1  
ATOM 4437   H HE3  . LYS B 2 2   ? 27.862  12.755  25.220  1.00 21.24 ? 2   LYS B HE3  1  
ATOM 4438   H HZ1  . LYS B 2 2   ? 29.203  10.121  25.459  1.00 54.45 ? 2   LYS B HZ1  1  
ATOM 4439   H HZ2  . LYS B 2 2   ? 27.589  10.410  25.044  1.00 1.02  ? 2   LYS B HZ2  1  
ATOM 4440   H HZ3  . LYS B 2 2   ? 28.132  10.736  26.612  1.00 21.24 ? 2   LYS B HZ3  1  
ATOM 4441   N N    . GLN B 2 3   ? 24.062  13.257  20.502  1.00 23.12 ? 3   GLN B N    1  
ATOM 4442   C CA   . GLN B 2 3   ? 23.050  14.286  20.191  1.00 51.55 ? 3   GLN B CA   1  
ATOM 4443   C C    . GLN B 2 3   ? 22.479  14.860  21.507  1.00 54.24 ? 3   GLN B C    1  
ATOM 4444   O O    . GLN B 2 3   ? 22.821  15.989  21.869  1.00 42.43 ? 3   GLN B O    1  
ATOM 4445   C CB   . GLN B 2 3   ? 21.917  13.728  19.280  1.00 74.04 ? 3   GLN B CB   1  
ATOM 4446   C CG   . GLN B 2 3   ? 22.343  13.387  17.826  1.00 44.42 ? 3   GLN B CG   1  
ATOM 4447   C CD   . GLN B 2 3   ? 23.261  12.160  17.679  1.00 30.35 ? 3   GLN B CD   1  
ATOM 4448   O OE1  . GLN B 2 3   ? 23.178  11.207  18.459  1.00 53.40 ? 3   GLN B OE1  1  
ATOM 4449   N NE2  . GLN B 2 3   ? 24.139  12.184  16.680  1.00 25.44 ? 3   GLN B NE2  1  
ATOM 4450   H H    . GLN B 2 3   ? 23.864  12.321  20.280  1.00 13.42 ? 3   GLN B H    1  
ATOM 4451   H HA   . GLN B 2 3   ? 23.558  15.089  19.654  1.00 2.51  ? 3   GLN B HA   1  
ATOM 4452   H HB2  . GLN B 2 3   ? 21.521  12.831  19.739  1.00 14.21 ? 3   GLN B HB2  1  
ATOM 4453   H HB3  . GLN B 2 3   ? 21.119  14.465  19.231  1.00 33.25 ? 3   GLN B HB3  1  
ATOM 4454   H HG2  . GLN B 2 3   ? 21.453  13.199  17.244  1.00 5.50  ? 3   GLN B HG2  1  
ATOM 4455   H HG3  . GLN B 2 3   ? 22.852  14.253  17.409  1.00 44.33 ? 3   GLN B HG3  1  
ATOM 4456   H HE21 . GLN B 2 3   ? 24.157  12.975  16.101  1.00 31.11 ? 3   GLN B HE21 1  
ATOM 4457   H HE22 . GLN B 2 3   ? 24.726  11.408  16.554  1.00 21.01 ? 3   GLN B HE22 1  
ATOM 4458   N N    . SER B 2 4   ? 21.648  14.049  22.216  1.00 1.04  ? 4   SER B N    1  
ATOM 4459   C CA   . SER B 2 4   ? 21.059  14.376  23.546  1.00 52.14 ? 4   SER B CA   1  
ATOM 4460   C C    . SER B 2 4   ? 20.078  15.588  23.489  1.00 2.55  ? 4   SER B C    1  
ATOM 4461   O O    . SER B 2 4   ? 18.879  15.439  23.748  1.00 3.44  ? 4   SER B O    1  
ATOM 4462   C CB   . SER B 2 4   ? 22.169  14.594  24.613  1.00 34.41 ? 4   SER B CB   1  
ATOM 4463   O OG   . SER B 2 4   ? 23.038  13.475  24.685  1.00 43.14 ? 4   SER B OG   1  
ATOM 4464   H H    . SER B 2 4   ? 21.428  13.178  21.831  1.00 3.54  ? 4   SER B H    1  
ATOM 4465   H HA   . SER B 2 4   ? 20.481  13.503  23.841  1.00 33.55 ? 4   SER B HA   1  
ATOM 4466   H HB2  . SER B 2 4   ? 22.753  15.464  24.351  1.00 4.52  ? 4   SER B HB2  1  
ATOM 4467   H HB3  . SER B 2 4   ? 21.718  14.745  25.588  1.00 41.24 ? 4   SER B HB3  1  
ATOM 4468   H HG   . SER B 2 4   ? 22.554  12.716  25.031  1.00 1.15  ? 4   SER B HG   1  
ATOM 4469   N N    . THR B 2 5   ? 20.597  16.783  23.188  1.00 70.11 ? 5   THR B N    1  
ATOM 4470   C CA   . THR B 2 5   ? 19.795  18.003  23.037  1.00 4.22  ? 5   THR B CA   1  
ATOM 4471   C C    . THR B 2 5   ? 19.005  17.996  21.698  1.00 32.11 ? 5   THR B C    1  
ATOM 4472   O O    . THR B 2 5   ? 19.433  17.353  20.729  1.00 41.21 ? 5   THR B O    1  
ATOM 4473   C CB   . THR B 2 5   ? 20.718  19.252  23.114  1.00 23.03 ? 5   THR B CB   1  
ATOM 4474   O OG1  . THR B 2 5   ? 21.680  19.075  24.172  1.00 10.13 ? 5   THR B OG1  1  
ATOM 4475   C CG2  . THR B 2 5   ? 19.908  20.515  23.394  1.00 10.31 ? 5   THR B CG2  1  
ATOM 4476   H H    . THR B 2 5   ? 21.563  16.856  23.085  1.00 21.43 ? 5   THR B H    1  
ATOM 4477   H HA   . THR B 2 5   ? 19.093  18.042  23.867  1.00 23.42 ? 5   THR B HA   1  
ATOM 4478   H HB   . THR B 2 5   ? 21.249  19.370  22.173  1.00 54.20 ? 5   THR B HB   1  
ATOM 4479   H HG1  . THR B 2 5   ? 22.512  19.492  23.919  1.00 1.43  ? 5   THR B HG1  1  
ATOM 4480   H HG21 . THR B 2 5   ? 20.566  21.370  23.441  1.00 34.25 ? 5   THR B HG21 1  
ATOM 4481   H HG22 . THR B 2 5   ? 19.386  20.410  24.339  1.00 43.34 ? 5   THR B HG22 1  
ATOM 4482   H HG23 . THR B 2 5   ? 19.182  20.666  22.604  1.00 74.34 ? 5   THR B HG23 1  
ATOM 4483   N N    . ILE B 2 6   ? 17.852  18.719  21.655  1.00 5.54  ? 6   ILE B N    1  
ATOM 4484   C CA   . ILE B 2 6   ? 16.880  18.631  20.538  1.00 10.24 ? 6   ILE B CA   1  
ATOM 4485   C C    . ILE B 2 6   ? 16.378  20.028  20.083  1.00 21.34 ? 6   ILE B C    1  
ATOM 4486   O O    . ILE B 2 6   ? 16.753  21.058  20.654  1.00 25.22 ? 6   ILE B O    1  
ATOM 4487   C CB   . ILE B 2 6   ? 15.637  17.762  20.957  1.00 42.22 ? 6   ILE B CB   1  
ATOM 4488   C CG1  . ILE B 2 6   ? 14.826  18.456  22.103  1.00 21.40 ? 6   ILE B CG1  1  
ATOM 4489   C CG2  . ILE B 2 6   ? 16.059  16.328  21.372  1.00 1.45  ? 6   ILE B CG2  1  
ATOM 4490   C CD1  . ILE B 2 6   ? 13.502  17.790  22.439  1.00 64.44 ? 6   ILE B CD1  1  
ATOM 4491   H H    . ILE B 2 6   ? 17.656  19.345  22.389  1.00 10.13 ? 6   ILE B H    1  
ATOM 4492   H HA   . ILE B 2 6   ? 17.362  18.148  19.689  1.00 63.32 ? 6   ILE B HA   1  
ATOM 4493   H HB   . ILE B 2 6   ? 14.991  17.670  20.086  1.00 1.24  ? 6   ILE B HB   1  
ATOM 4494   H HG12 . ILE B 2 6   ? 15.420  18.464  23.005  1.00 43.43 ? 6   ILE B HG12 1  
ATOM 4495   H HG13 . ILE B 2 6   ? 14.611  19.480  21.821  1.00 52.51 ? 6   ILE B HG13 1  
ATOM 4496   H HG21 . ILE B 2 6   ? 15.185  15.756  21.664  1.00 22.52 ? 6   ILE B HG21 1  
ATOM 4497   H HG22 . ILE B 2 6   ? 16.746  16.373  22.206  1.00 53.11 ? 6   ILE B HG22 1  
ATOM 4498   H HG23 . ILE B 2 6   ? 16.543  15.832  20.539  1.00 65.34 ? 6   ILE B HG23 1  
ATOM 4499   H HD11 . ILE B 2 6   ? 13.020  18.338  23.238  1.00 2.21  ? 6   ILE B HD11 1  
ATOM 4500   H HD12 . ILE B 2 6   ? 13.676  16.774  22.760  1.00 34.04 ? 6   ILE B HD12 1  
ATOM 4501   H HD13 . ILE B 2 6   ? 12.860  17.789  21.569  1.00 34.41 ? 6   ILE B HD13 1  
ATOM 4502   N N    . ALA B 2 7   ? 15.485  20.020  19.068  1.00 42.11 ? 7   ALA B N    1  
ATOM 4503   C CA   . ALA B 2 7   ? 14.854  21.234  18.504  1.00 14.43 ? 7   ALA B CA   1  
ATOM 4504   C C    . ALA B 2 7   ? 13.313  21.033  18.425  1.00 65.11 ? 7   ALA B C    1  
ATOM 4505   O O    . ALA B 2 7   ? 12.764  20.202  19.160  1.00 72.01 ? 7   ALA B O    1  
ATOM 4506   C CB   . ALA B 2 7   ? 15.470  21.534  17.120  1.00 21.33 ? 7   ALA B CB   1  
ATOM 4507   H H    . ALA B 2 7   ? 15.227  19.154  18.686  1.00 2.22  ? 7   ALA B H    1  
ATOM 4508   H HA   . ALA B 2 7   ? 15.060  22.075  19.164  1.00 72.22 ? 7   ALA B HA   1  
ATOM 4509   H HB1  . ALA B 2 7   ? 15.279  20.708  16.448  1.00 32.41 ? 7   ALA B HB1  1  
ATOM 4510   H HB2  . ALA B 2 7   ? 16.538  21.674  17.216  1.00 44.04 ? 7   ALA B HB2  1  
ATOM 4511   H HB3  . ALA B 2 7   ? 15.030  22.438  16.712  1.00 1.03  ? 7   ALA B HB3  1  
ATOM 4512   N N    . LEU B 2 8   ? 12.620  21.807  17.551  1.00 53.32 ? 8   LEU B N    1  
ATOM 4513   C CA   . LEU B 2 8   ? 11.150  21.714  17.352  1.00 73.15 ? 8   LEU B CA   1  
ATOM 4514   C C    . LEU B 2 8   ? 10.812  21.888  15.852  1.00 14.33 ? 8   LEU B C    1  
ATOM 4515   O O    . LEU B 2 8   ? 11.537  22.583  15.132  1.00 45.43 ? 8   LEU B O    1  
ATOM 4516   C CB   . LEU B 2 8   ? 10.443  22.803  18.196  1.00 75.22 ? 8   LEU B CB   1  
ATOM 4517   C CG   . LEU B 2 8   ? 8.889   22.807  18.205  1.00 23.01 ? 8   LEU B CG   1  
ATOM 4518   C CD1  . LEU B 2 8   ? 8.331   21.548  18.881  1.00 50.12 ? 8   LEU B CD1  1  
ATOM 4519   C CD2  . LEU B 2 8   ? 8.352   24.081  18.880  1.00 53.12 ? 8   LEU B CD2  1  
ATOM 4520   H H    . LEU B 2 8   ? 13.111  22.471  17.019  1.00 14.54 ? 8   LEU B H    1  
ATOM 4521   H HA   . LEU B 2 8   ? 10.816  20.732  17.676  1.00 71.25 ? 8   LEU B HA   1  
ATOM 4522   H HB2  . LEU B 2 8   ? 10.774  22.698  19.220  1.00 15.44 ? 8   LEU B HB2  1  
ATOM 4523   H HB3  . LEU B 2 8   ? 10.773  23.766  17.835  1.00 1.22  ? 8   LEU B HB3  1  
ATOM 4524   H HG   . LEU B 2 8   ? 8.535   22.803  17.180  1.00 10.41 ? 8   LEU B HG   1  
ATOM 4525   H HD11 . LEU B 2 8   ? 7.248   21.573  18.862  1.00 31.41 ? 8   LEU B HD11 1  
ATOM 4526   H HD12 . LEU B 2 8   ? 8.668   21.499  19.910  1.00 2.20  ? 8   LEU B HD12 1  
ATOM 4527   H HD13 . LEU B 2 8   ? 8.672   20.670  18.354  1.00 54.02 ? 8   LEU B HD13 1  
ATOM 4528   H HD21 . LEU B 2 8   ? 7.272   24.085  18.843  1.00 55.41 ? 8   LEU B HD21 1  
ATOM 4529   H HD22 . LEU B 2 8   ? 8.725   24.952  18.359  1.00 25.30 ? 8   LEU B HD22 1  
ATOM 4530   H HD23 . LEU B 2 8   ? 8.677   24.119  19.915  1.00 41.33 ? 8   LEU B HD23 1  
ATOM 4531   N N    . ALA B 2 9   ? 9.716   21.247  15.392  1.00 62.11 ? 9   ALA B N    1  
ATOM 4532   C CA   . ALA B 2 9   ? 9.279   21.322  13.983  1.00 62.40 ? 9   ALA B CA   1  
ATOM 4533   C C    . ALA B 2 9   ? 8.495   22.621  13.695  1.00 61.01 ? 9   ALA B C    1  
ATOM 4534   O O    . ALA B 2 9   ? 8.788   23.320  12.721  1.00 1.51  ? 9   ALA B O    1  
ATOM 4535   C CB   . ALA B 2 9   ? 8.430   20.087  13.632  1.00 25.34 ? 9   ALA B CB   1  
ATOM 4536   H H    . ALA B 2 9   ? 9.197   20.689  16.019  1.00 11.21 ? 9   ALA B H    1  
ATOM 4537   H HA   . ALA B 2 9   ? 10.169  21.304  13.352  1.00 31.23 ? 9   ALA B HA   1  
ATOM 4538   H HB1  . ALA B 2 9   ? 9.003   19.191  13.825  1.00 50.23 ? 9   ALA B HB1  1  
ATOM 4539   H HB2  . ALA B 2 9   ? 8.155   20.113  12.585  1.00 73.12 ? 9   ALA B HB2  1  
ATOM 4540   H HB3  . ALA B 2 9   ? 7.530   20.073  14.238  1.00 1.41  ? 9   ALA B HB3  1  
ATOM 4541   N N    . LEU B 2 10  ? 7.471   22.891  14.543  1.00 21.21 ? 10  LEU B N    1  
ATOM 4542   C CA   . LEU B 2 10  ? 6.505   24.029  14.403  1.00 64.10 ? 10  LEU B CA   1  
ATOM 4543   C C    . LEU B 2 10  ? 5.451   23.820  13.288  1.00 41.34 ? 10  LEU B C    1  
ATOM 4544   O O    . LEU B 2 10  ? 4.375   24.424  13.350  1.00 24.03 ? 10  LEU B O    1  
ATOM 4545   C CB   . LEU B 2 10  ? 7.206   25.425  14.255  1.00 74.10 ? 10  LEU B CB   1  
ATOM 4546   C CG   . LEU B 2 10  ? 7.704   26.077  15.580  1.00 13.33 ? 10  LEU B CG   1  
ATOM 4547   C CD1  . LEU B 2 10  ? 8.460   27.396  15.319  1.00 33.14 ? 10  LEU B CD1  1  
ATOM 4548   C CD2  . LEU B 2 10  ? 6.522   26.302  16.553  1.00 40.04 ? 10  LEU B CD2  1  
ATOM 4549   H H    . LEU B 2 10  ? 7.360   22.300  15.310  1.00 12.14 ? 10  LEU B H    1  
ATOM 4550   H HA   . LEU B 2 10  ? 5.955   24.041  15.337  1.00 4.31  ? 10  LEU B HA   1  
ATOM 4551   H HB2  . LEU B 2 10  ? 8.054   25.302  13.590  1.00 24.44 ? 10  LEU B HB2  1  
ATOM 4552   H HB3  . LEU B 2 10  ? 6.512   26.117  13.781  1.00 13.42 ? 10  LEU B HB3  1  
ATOM 4553   H HG   . LEU B 2 10  ? 8.400   25.400  16.062  1.00 54.14 ? 10  LEU B HG   1  
ATOM 4554   H HD11 . LEU B 2 10  ? 7.801   28.116  14.849  1.00 5.21  ? 10  LEU B HD11 1  
ATOM 4555   H HD12 . LEU B 2 10  ? 9.305   27.209  14.672  1.00 4.31  ? 10  LEU B HD12 1  
ATOM 4556   H HD13 . LEU B 2 10  ? 8.819   27.797  16.259  1.00 51.21 ? 10  LEU B HD13 1  
ATOM 4557   H HD21 . LEU B 2 10  ? 6.052   25.354  16.780  1.00 15.12 ? 10  LEU B HD21 1  
ATOM 4558   H HD22 . LEU B 2 10  ? 5.792   26.963  16.103  1.00 54.43 ? 10  LEU B HD22 1  
ATOM 4559   H HD23 . LEU B 2 10  ? 6.882   26.744  17.474  1.00 73.34 ? 10  LEU B HD23 1  
ATOM 4560   N N    . LEU B 2 11  ? 5.762   22.951  12.304  1.00 45.35 ? 11  LEU B N    1  
ATOM 4561   C CA   . LEU B 2 11  ? 4.951   22.747  11.080  1.00 24.24 ? 11  LEU B CA   1  
ATOM 4562   C C    . LEU B 2 11  ? 4.675   24.094  10.332  1.00 34.44 ? 11  LEU B C    1  
ATOM 4563   O O    . LEU B 2 11  ? 3.512   24.476  10.155  1.00 34.23 ? 11  LEU B O    1  
ATOM 4564   C CB   . LEU B 2 11  ? 3.625   21.975  11.411  1.00 4.33  ? 11  LEU B CB   1  
ATOM 4565   C CG   . LEU B 2 11  ? 3.797   20.574  12.085  1.00 43.34 ? 11  LEU B CG   1  
ATOM 4566   C CD1  . LEU B 2 11  ? 2.434   19.945  12.475  1.00 34.12 ? 11  LEU B CD1  1  
ATOM 4567   C CD2  . LEU B 2 11  ? 4.621   19.621  11.185  1.00 43.54 ? 11  LEU B CD2  1  
ATOM 4568   H H    . LEU B 2 11  ? 6.571   22.420  12.400  1.00 63.54 ? 11  LEU B H    1  
ATOM 4569   H HA   . LEU B 2 11  ? 5.547   22.126  10.418  1.00 11.14 ? 11  LEU B HA   1  
ATOM 4570   H HB2  . LEU B 2 11  ? 3.033   22.601  12.074  1.00 70.32 ? 11  LEU B HB2  1  
ATOM 4571   H HB3  . LEU B 2 11  ? 3.069   21.844  10.489  1.00 42.13 ? 11  LEU B HB3  1  
ATOM 4572   H HG   . LEU B 2 11  ? 4.355   20.710  13.004  1.00 34.53 ? 11  LEU B HG   1  
ATOM 4573   H HD11 . LEU B 2 11  ? 1.830   19.778  11.591  1.00 23.23 ? 11  LEU B HD11 1  
ATOM 4574   H HD12 . LEU B 2 11  ? 1.906   20.607  13.148  1.00 72.11 ? 11  LEU B HD12 1  
ATOM 4575   H HD13 . LEU B 2 11  ? 2.603   19.000  12.978  1.00 33.52 ? 11  LEU B HD13 1  
ATOM 4576   H HD21 . LEU B 2 11  ? 4.110   19.463  10.243  1.00 22.34 ? 11  LEU B HD21 1  
ATOM 4577   H HD22 . LEU B 2 11  ? 4.754   18.671  11.684  1.00 33.53 ? 11  LEU B HD22 1  
ATOM 4578   H HD23 . LEU B 2 11  ? 5.596   20.054  10.993  1.00 63.24 ? 11  LEU B HD23 1  
ATOM 4579   N N    . PRO B 2 12  ? 5.750   24.859  9.909   1.00 52.11 ? 12  PRO B N    1  
ATOM 4580   C CA   . PRO B 2 12  ? 5.588   26.111  9.130   1.00 55.33 ? 12  PRO B CA   1  
ATOM 4581   C C    . PRO B 2 12  ? 5.370   25.830  7.631   1.00 22.33 ? 12  PRO B C    1  
ATOM 4582   O O    . PRO B 2 12  ? 4.758   26.627  6.918   1.00 34.20 ? 12  PRO B O    1  
ATOM 4583   C CB   . PRO B 2 12  ? 6.933   26.874  9.378   1.00 13.24 ? 12  PRO B CB   1  
ATOM 4584   C CG   . PRO B 2 12  ? 7.738   25.999  10.307  1.00 61.33 ? 12  PRO B CG   1  
ATOM 4585   C CD   . PRO B 2 12  ? 7.192   24.601  10.143  1.00 12.40 ? 12  PRO B CD   1  
ATOM 4586   H HA   . PRO B 2 12  ? 4.755   26.698  9.506   1.00 24.44 ? 12  PRO B HA   1  
ATOM 4587   H HB2  . PRO B 2 12  ? 7.467   27.033  8.439   1.00 61.53 ? 12  PRO B HB2  1  
ATOM 4588   H HB3  . PRO B 2 12  ? 6.738   27.830  9.846   1.00 1.53  ? 12  PRO B HB3  1  
ATOM 4589   H HG2  . PRO B 2 12  ? 8.787   26.035  10.035  1.00 1.04  ? 12  PRO B HG2  1  
ATOM 4590   H HG3  . PRO B 2 12  ? 7.610   26.326  11.336  1.00 71.41 ? 12  PRO B HG3  1  
ATOM 4591   H HD2  . PRO B 2 12  ? 7.640   24.105  9.285   1.00 20.14 ? 12  PRO B HD2  1  
ATOM 4592   H HD3  . PRO B 2 12  ? 7.347   24.016  11.039  1.00 43.31 ? 12  PRO B HD3  1  
ATOM 4593   N N    . LEU B 2 13  ? 5.884   24.673  7.191   1.00 74.03 ? 13  LEU B N    1  
ATOM 4594   C CA   . LEU B 2 13  ? 5.903   24.254  5.793   1.00 75.01 ? 13  LEU B CA   1  
ATOM 4595   C C    . LEU B 2 13  ? 6.091   22.728  5.750   1.00 22.22 ? 13  LEU B C    1  
ATOM 4596   O O    . LEU B 2 13  ? 6.363   22.099  6.785   1.00 35.11 ? 13  LEU B O    1  
ATOM 4597   C CB   . LEU B 2 13  ? 7.056   24.968  5.004   1.00 30.12 ? 13  LEU B CB   1  
ATOM 4598   C CG   . LEU B 2 13  ? 8.527   24.469  5.265   1.00 34.41 ? 13  LEU B CG   1  
ATOM 4599   C CD1  . LEU B 2 13  ? 9.516   25.080  4.252   1.00 5.41  ? 13  LEU B CD1  1  
ATOM 4600   C CD2  . LEU B 2 13  ? 8.997   24.744  6.715   1.00 72.24 ? 13  LEU B CD2  1  
ATOM 4601   H H    . LEU B 2 13  ? 6.260   24.056  7.849   1.00 20.24 ? 13  LEU B H    1  
ATOM 4602   H HA   . LEU B 2 13  ? 4.942   24.503  5.347   1.00 21.33 ? 13  LEU B HA   1  
ATOM 4603   H HB2  . LEU B 2 13  ? 6.845   24.855  3.946   1.00 75.11 ? 13  LEU B HB2  1  
ATOM 4604   H HB3  . LEU B 2 13  ? 7.011   26.027  5.236   1.00 42.05 ? 13  LEU B HB3  1  
ATOM 4605   H HG   . LEU B 2 13  ? 8.550   23.395  5.117   1.00 15.42 ? 13  LEU B HG   1  
ATOM 4606   H HD11 . LEU B 2 13  ? 10.511  24.700  4.439   1.00 72.02 ? 13  LEU B HD11 1  
ATOM 4607   H HD12 . LEU B 2 13  ? 9.521   26.159  4.345   1.00 65.14 ? 13  LEU B HD12 1  
ATOM 4608   H HD13 . LEU B 2 13  ? 9.218   24.810  3.248   1.00 2.22  ? 13  LEU B HD13 1  
ATOM 4609   H HD21 . LEU B 2 13  ? 8.337   24.247  7.413   1.00 24.34 ? 13  LEU B HD21 1  
ATOM 4610   H HD22 . LEU B 2 13  ? 8.986   25.810  6.912   1.00 24.44 ? 13  LEU B HD22 1  
ATOM 4611   H HD23 . LEU B 2 13  ? 10.002  24.366  6.851   1.00 22.32 ? 13  LEU B HD23 1  
ATOM 4612   N N    . LEU B 2 14  ? 5.953   22.147  4.554   1.00 13.01 ? 14  LEU B N    1  
ATOM 4613   C CA   . LEU B 2 14  ? 6.252   20.725  4.312   1.00 64.54 ? 14  LEU B CA   1  
ATOM 4614   C C    . LEU B 2 14  ? 7.599   20.633  3.567   1.00 1.14  ? 14  LEU B C    1  
ATOM 4615   O O    . LEU B 2 14  ? 7.731   21.175  2.460   1.00 52.13 ? 14  LEU B O    1  
ATOM 4616   C CB   . LEU B 2 14  ? 5.109   20.062  3.489   1.00 33.21 ? 14  LEU B CB   1  
ATOM 4617   C CG   . LEU B 2 14  ? 5.256   18.529  3.222   1.00 41.30 ? 14  LEU B CG   1  
ATOM 4618   C CD1  . LEU B 2 14  ? 5.304   17.723  4.543   1.00 51.04 ? 14  LEU B CD1  1  
ATOM 4619   C CD2  . LEU B 2 14  ? 4.127   18.015  2.295   1.00 43.11 ? 14  LEU B CD2  1  
ATOM 4620   H H    . LEU B 2 14  ? 5.652   22.695  3.799   1.00 3.12  ? 14  LEU B H    1  
ATOM 4621   H HA   . LEU B 2 14  ? 6.339   20.216  5.273   1.00 31.34 ? 14  LEU B HA   1  
ATOM 4622   H HB2  . LEU B 2 14  ? 4.174   20.226  4.017   1.00 50.31 ? 14  LEU B HB2  1  
ATOM 4623   H HB3  . LEU B 2 14  ? 5.043   20.571  2.531   1.00 32.05 ? 14  LEU B HB3  1  
ATOM 4624   H HG   . LEU B 2 14  ? 6.198   18.361  2.711   1.00 52.23 ? 14  LEU B HG   1  
ATOM 4625   H HD11 . LEU B 2 14  ? 5.397   16.667  4.324   1.00 61.51 ? 14  LEU B HD11 1  
ATOM 4626   H HD12 . LEU B 2 14  ? 4.400   17.891  5.115   1.00 52.32 ? 14  LEU B HD12 1  
ATOM 4627   H HD13 . LEU B 2 14  ? 6.159   18.035  5.130   1.00 20.31 ? 14  LEU B HD13 1  
ATOM 4628   H HD21 . LEU B 2 14  ? 3.161   18.174  2.764   1.00 60.22 ? 14  LEU B HD21 1  
ATOM 4629   H HD22 . LEU B 2 14  ? 4.261   16.959  2.107   1.00 2.23  ? 14  LEU B HD22 1  
ATOM 4630   H HD23 . LEU B 2 14  ? 4.158   18.546  1.353   1.00 21.13 ? 14  LEU B HD23 1  
ATOM 4631   N N    . PHE B 2 15  ? 8.598   19.982  4.198   1.00 21.51 ? 15  PHE B N    1  
ATOM 4632   C CA   . PHE B 2 15  ? 9.938   19.798  3.614   1.00 14.01 ? 15  PHE B CA   1  
ATOM 4633   C C    . PHE B 2 15  ? 9.845   18.911  2.362   1.00 45.51 ? 15  PHE B C    1  
ATOM 4634   O O    . PHE B 2 15  ? 9.445   17.749  2.446   1.00 31.30 ? 15  PHE B O    1  
ATOM 4635   C CB   . PHE B 2 15  ? 10.907  19.181  4.664   1.00 42.24 ? 15  PHE B CB   1  
ATOM 4636   C CG   . PHE B 2 15  ? 12.357  18.995  4.171   1.00 60.01 ? 15  PHE B CG   1  
ATOM 4637   C CD1  . PHE B 2 15  ? 13.215  20.090  4.050   1.00 13.34 ? 15  PHE B CD1  1  
ATOM 4638   C CD2  . PHE B 2 15  ? 12.847  17.734  3.814   1.00 43.04 ? 15  PHE B CD2  1  
ATOM 4639   C CE1  . PHE B 2 15  ? 14.515  19.930  3.604   1.00 53.12 ? 15  PHE B CE1  1  
ATOM 4640   C CE2  . PHE B 2 15  ? 14.149  17.576  3.371   1.00 54.23 ? 15  PHE B CE2  1  
ATOM 4641   C CZ   . PHE B 2 15  ? 14.980  18.675  3.258   1.00 22.43 ? 15  PHE B CZ   1  
ATOM 4642   H H    . PHE B 2 15  ? 8.423   19.608  5.083   1.00 23.13 ? 15  PHE B H    1  
ATOM 4643   H HA   . PHE B 2 15  ? 10.312  20.781  3.329   1.00 74.01 ? 15  PHE B HA   1  
ATOM 4644   H HB2  . PHE B 2 15  ? 10.932  19.828  5.535   1.00 51.13 ? 15  PHE B HB2  1  
ATOM 4645   H HB3  . PHE B 2 15  ? 10.521  18.214  4.971   1.00 60.22 ? 15  PHE B HB3  1  
ATOM 4646   H HD1  . PHE B 2 15  ? 12.857  21.078  4.321   1.00 43.10 ? 15  PHE B HD1  1  
ATOM 4647   H HD2  . PHE B 2 15  ? 12.198  16.868  3.898   1.00 70.42 ? 15  PHE B HD2  1  
ATOM 4648   H HE1  . PHE B 2 15  ? 15.165  20.790  3.519   1.00 70.33 ? 15  PHE B HE1  1  
ATOM 4649   H HE2  . PHE B 2 15  ? 14.512  16.594  3.104   1.00 43.23 ? 15  PHE B HE2  1  
ATOM 4650   H HZ   . PHE B 2 15  ? 15.997  18.552  2.908   1.00 42.05 ? 15  PHE B HZ   1  
ATOM 4651   N N    . THR B 2 16  ? 10.169  19.494  1.208   1.00 24.43 ? 16  THR B N    1  
ATOM 4652   C CA   . THR B 2 16  ? 10.204  18.786  -0.077  1.00 51.11 ? 16  THR B CA   1  
ATOM 4653   C C    . THR B 2 16  ? 11.551  18.035  -0.236  1.00 34.43 ? 16  THR B C    1  
ATOM 4654   O O    . THR B 2 16  ? 12.588  18.546  0.214   1.00 35.33 ? 16  THR B O    1  
ATOM 4655   C CB   . THR B 2 16  ? 10.006  19.798  -1.250  1.00 33.51 ? 16  THR B CB   1  
ATOM 4656   O OG1  . THR B 2 16  ? 10.993  20.847  -1.167  1.00 1.34  ? 16  THR B OG1  1  
ATOM 4657   C CG2  . THR B 2 16  ? 8.592   20.421  -1.239  1.00 12.22 ? 16  THR B CG2  1  
ATOM 4658   H H    . THR B 2 16  ? 10.393  20.444  1.220   1.00 25.44 ? 16  THR B H    1  
ATOM 4659   H HA   . THR B 2 16  ? 9.389   18.068  -0.096  1.00 55.34 ? 16  THR B HA   1  
ATOM 4660   H HB   . THR B 2 16  ? 10.140  19.270  -2.191  1.00 25.21 ? 16  THR B HB   1  
ATOM 4661   H HG1  . THR B 2 16  ? 11.514  20.741  -0.359  1.00 25.24 ? 16  THR B HG1  1  
ATOM 4662   H HG21 . THR B 2 16  ? 7.849   19.642  -1.352  1.00 4.11  ? 16  THR B HG21 1  
ATOM 4663   H HG22 . THR B 2 16  ? 8.495   21.125  -2.055  1.00 71.11 ? 16  THR B HG22 1  
ATOM 4664   H HG23 . THR B 2 16  ? 8.426   20.938  -0.302  1.00 61.34 ? 16  THR B HG23 1  
ATOM 4665   N N    . PRO B 2 17  ? 11.560  16.806  -0.858  1.00 13.41 ? 17  PRO B N    1  
ATOM 4666   C CA   . PRO B 2 17  ? 12.809  16.027  -1.089  1.00 30.34 ? 17  PRO B CA   1  
ATOM 4667   C C    . PRO B 2 17  ? 13.657  16.567  -2.272  1.00 41.25 ? 17  PRO B C    1  
ATOM 4668   O O    . PRO B 2 17  ? 13.199  17.424  -3.040  1.00 2.45  ? 17  PRO B O    1  
ATOM 4669   C CB   . PRO B 2 17  ? 12.265  14.606  -1.380  1.00 2.44  ? 17  PRO B CB   1  
ATOM 4670   C CG   . PRO B 2 17  ? 10.936  14.834  -2.030  1.00 31.51 ? 17  PRO B CG   1  
ATOM 4671   C CD   . PRO B 2 17  ? 10.357  16.066  -1.356  1.00 62.42 ? 17  PRO B CD   1  
ATOM 4672   H HA   . PRO B 2 17  ? 13.427  16.001  -0.195  1.00 10.02 ? 17  PRO B HA   1  
ATOM 4673   H HB2  . PRO B 2 17  ? 12.940  14.062  -2.036  1.00 50.51 ? 17  PRO B HB2  1  
ATOM 4674   H HB3  . PRO B 2 17  ? 12.136  14.059  -0.452  1.00 71.22 ? 17  PRO B HB3  1  
ATOM 4675   H HG2  . PRO B 2 17  ? 11.068  15.004  -3.099  1.00 64.25 ? 17  PRO B HG2  1  
ATOM 4676   H HG3  . PRO B 2 17  ? 10.288  13.981  -1.869  1.00 31.22 ? 17  PRO B HG3  1  
ATOM 4677   H HD2  . PRO B 2 17  ? 9.800   16.666  -2.069  1.00 12.11 ? 17  PRO B HD2  1  
ATOM 4678   H HD3  . PRO B 2 17  ? 9.716   15.782  -0.530  1.00 3.11  ? 17  PRO B HD3  1  
ATOM 4679   N N    . VAL B 2 18  ? 14.901  16.057  -2.389  1.00 21.12 ? 18  VAL B N    1  
ATOM 4680   C CA   . VAL B 2 18  ? 15.852  16.434  -3.462  1.00 44.32 ? 18  VAL B CA   1  
ATOM 4681   C C    . VAL B 2 18  ? 15.971  15.292  -4.502  1.00 11.10 ? 18  VAL B C    1  
ATOM 4682   O O    . VAL B 2 18  ? 16.060  14.108  -4.135  1.00 61.41 ? 18  VAL B O    1  
ATOM 4683   C CB   . VAL B 2 18  ? 17.268  16.811  -2.860  1.00 13.44 ? 18  VAL B CB   1  
ATOM 4684   C CG1  . VAL B 2 18  ? 17.859  15.668  -1.997  1.00 23.10 ? 18  VAL B CG1  1  
ATOM 4685   C CG2  . VAL B 2 18  ? 18.266  17.259  -3.963  1.00 43.12 ? 18  VAL B CG2  1  
ATOM 4686   H H    . VAL B 2 18  ? 15.194  15.391  -1.729  1.00 12.40 ? 18  VAL B H    1  
ATOM 4687   H HA   . VAL B 2 18  ? 15.456  17.319  -3.965  1.00 45.13 ? 18  VAL B HA   1  
ATOM 4688   H HB   . VAL B 2 18  ? 17.114  17.661  -2.198  1.00 63.30 ? 18  VAL B HB   1  
ATOM 4689   H HG11 . VAL B 2 18  ? 17.175  15.426  -1.194  1.00 4.52  ? 18  VAL B HG11 1  
ATOM 4690   H HG12 . VAL B 2 18  ? 18.805  15.979  -1.571  1.00 34.43 ? 18  VAL B HG12 1  
ATOM 4691   H HG13 . VAL B 2 18  ? 18.018  14.786  -2.608  1.00 43.11 ? 18  VAL B HG13 1  
ATOM 4692   H HG21 . VAL B 2 18  ? 17.864  18.110  -4.498  1.00 12.22 ? 18  VAL B HG21 1  
ATOM 4693   H HG22 . VAL B 2 18  ? 18.434  16.448  -4.663  1.00 23.04 ? 18  VAL B HG22 1  
ATOM 4694   H HG23 . VAL B 2 18  ? 19.210  17.538  -3.511  1.00 43.32 ? 18  VAL B HG23 1  
ATOM 4695   N N    . THR B 2 19  ? 15.953  15.665  -5.798  1.00 64.00 ? 19  THR B N    1  
ATOM 4696   C CA   . THR B 2 19  ? 16.020  14.722  -6.933  1.00 2.42  ? 19  THR B CA   1  
ATOM 4697   C C    . THR B 2 19  ? 17.390  14.014  -7.018  1.00 32.24 ? 19  THR B C    1  
ATOM 4698   O O    . THR B 2 19  ? 18.428  14.614  -6.728  1.00 42.24 ? 19  THR B O    1  
ATOM 4699   C CB   . THR B 2 19  ? 15.738  15.474  -8.273  1.00 61.33 ? 19  THR B CB   1  
ATOM 4700   O OG1  . THR B 2 19  ? 16.587  16.636  -8.360  1.00 71.22 ? 19  THR B OG1  1  
ATOM 4701   C CG2  . THR B 2 19  ? 14.262  15.898  -8.399  1.00 23.32 ? 19  THR B CG2  1  
ATOM 4702   H H    . THR B 2 19  ? 15.891  16.623  -6.002  1.00 34.53 ? 19  THR B H    1  
ATOM 4703   H HA   . THR B 2 19  ? 15.243  13.972  -6.792  1.00 1.23  ? 19  THR B HA   1  
ATOM 4704   H HB   . THR B 2 19  ? 15.976  14.812  -9.104  1.00 22.25 ? 19  THR B HB   1  
ATOM 4705   H HG1  . THR B 2 19  ? 16.264  17.219  -9.050  1.00 21.05 ? 19  THR B HG1  1  
ATOM 4706   H HG21 . THR B 2 19  ? 13.627  15.022  -8.370  1.00 31.52 ? 19  THR B HG21 1  
ATOM 4707   H HG22 . THR B 2 19  ? 14.113  16.415  -9.335  1.00 13.42 ? 19  THR B HG22 1  
ATOM 4708   H HG23 . THR B 2 19  ? 14.000  16.559  -7.581  1.00 61.14 ? 19  THR B HG23 1  
ATOM 4709   N N    . LYS B 2 20  ? 17.366  12.731  -7.429  1.00 32.53 ? 20  LYS B N    1  
ATOM 4710   C CA   . LYS B 2 20  ? 18.565  11.873  -7.568  1.00 33.13 ? 20  LYS B CA   1  
ATOM 4711   C C    . LYS B 2 20  ? 18.661  11.333  -9.006  1.00 32.43 ? 20  LYS B C    1  
ATOM 4712   O O    . LYS B 2 20  ? 17.774  11.586  -9.828  1.00 1.44  ? 20  LYS B O    1  
ATOM 4713   C CB   . LYS B 2 20  ? 18.483  10.698  -6.552  1.00 30.41 ? 20  LYS B CB   1  
ATOM 4714   C CG   . LYS B 2 20  ? 18.439  11.139  -5.075  1.00 62.14 ? 20  LYS B CG   1  
ATOM 4715   C CD   . LYS B 2 20  ? 18.129  9.979   -4.103  1.00 62.34 ? 20  LYS B CD   1  
ATOM 4716   C CE   . LYS B 2 20  ? 18.138  10.439  -2.635  1.00 22.21 ? 20  LYS B CE   1  
ATOM 4717   N NZ   . LYS B 2 20  ? 17.263  11.624  -2.410  1.00 1.41  ? 20  LYS B NZ   1  
ATOM 4718   H H    . LYS B 2 20  ? 16.498  12.338  -7.659  1.00 31.14 ? 20  LYS B H    1  
ATOM 4719   H HA   . LYS B 2 20  ? 19.450  12.468  -7.362  1.00 74.33 ? 20  LYS B HA   1  
ATOM 4720   H HB2  . LYS B 2 20  ? 17.589  10.118  -6.762  1.00 63.04 ? 20  LYS B HB2  1  
ATOM 4721   H HB3  . LYS B 2 20  ? 19.349  10.057  -6.689  1.00 55.34 ? 20  LYS B HB3  1  
ATOM 4722   H HG2  . LYS B 2 20  ? 19.398  11.571  -4.812  1.00 11.25 ? 20  LYS B HG2  1  
ATOM 4723   H HG3  . LYS B 2 20  ? 17.670  11.902  -4.965  1.00 33.11 ? 20  LYS B HG3  1  
ATOM 4724   H HD2  . LYS B 2 20  ? 17.150  9.575   -4.336  1.00 33.44 ? 20  LYS B HD2  1  
ATOM 4725   H HD3  . LYS B 2 20  ? 18.874  9.200   -4.233  1.00 50.14 ? 20  LYS B HD3  1  
ATOM 4726   H HE2  . LYS B 2 20  ? 17.792  9.626   -2.010  1.00 13.15 ? 20  LYS B HE2  1  
ATOM 4727   H HE3  . LYS B 2 20  ? 19.152  10.694  -2.351  1.00 73.02 ? 20  LYS B HE3  1  
ATOM 4728   H HZ1  . LYS B 2 20  ? 17.314  11.921  -1.413  1.00 2.10  ? 20  LYS B HZ1  1  
ATOM 4729   H HZ2  . LYS B 2 20  ? 16.277  11.395  -2.643  1.00 62.22 ? 20  LYS B HZ2  1  
ATOM 4730   H HZ3  . LYS B 2 20  ? 17.571  12.416  -3.008  1.00 73.13 ? 20  LYS B HZ3  1  
ATOM 4731   N N    . ALA B 2 21  ? 19.748  10.592  -9.299  1.00 43.10 ? 21  ALA B N    1  
ATOM 4732   C CA   . ALA B 2 21  ? 19.942  9.930   -10.605 1.00 61.44 ? 21  ALA B CA   1  
ATOM 4733   C C    . ALA B 2 21  ? 18.879  8.826   -10.802 1.00 13.33 ? 21  ALA B C    1  
ATOM 4734   O O    . ALA B 2 21  ? 18.901  7.802   -10.108 1.00 75.34 ? 21  ALA B O    1  
ATOM 4735   C CB   . ALA B 2 21  ? 21.370  9.368   -10.708 1.00 53.14 ? 21  ALA B CB   1  
ATOM 4736   H H    . ALA B 2 21  ? 20.438  10.481  -8.612  1.00 22.05 ? 21  ALA B H    1  
ATOM 4737   H HA   . ALA B 2 21  ? 19.823  10.686  -11.381 1.00 72.25 ? 21  ALA B HA   1  
ATOM 4738   H HB1  . ALA B 2 21  ? 22.085  10.173  -10.596 1.00 1.32  ? 21  ALA B HB1  1  
ATOM 4739   H HB2  . ALA B 2 21  ? 21.511  8.899   -11.672 1.00 71.32 ? 21  ALA B HB2  1  
ATOM 4740   H HB3  . ALA B 2 21  ? 21.531  8.636   -9.927  1.00 71.21 ? 21  ALA B HB3  1  
ATOM 4741   N N    . ARG B 2 22  ? 17.940  9.069   -11.732 1.00 21.32 ? 22  ARG B N    1  
ATOM 4742   C CA   . ARG B 2 22  ? 16.744  8.226   -11.932 1.00 33.21 ? 22  ARG B CA   1  
ATOM 4743   C C    . ARG B 2 22  ? 16.171  8.447   -13.354 1.00 61.40 ? 22  ARG B C    1  
ATOM 4744   O O    . ARG B 2 22  ? 16.386  9.509   -13.952 1.00 31.02 ? 22  ARG B O    1  
ATOM 4745   C CB   . ARG B 2 22  ? 15.679  8.576   -10.848 1.00 33.32 ? 22  ARG B CB   1  
ATOM 4746   C CG   . ARG B 2 22  ? 14.300  7.899   -11.036 1.00 5.24  ? 22  ARG B CG   1  
ATOM 4747   C CD   . ARG B 2 22  ? 13.240  8.415   -10.052 1.00 61.03 ? 22  ARG B CD   1  
ATOM 4748   N NE   . ARG B 2 22  ? 11.869  8.168   -10.538 1.00 60.54 ? 22  ARG B NE   1  
ATOM 4749   C CZ   . ARG B 2 22  ? 10.775  8.821   -10.111 1.00 54.53 ? 22  ARG B CZ   1  
ATOM 4750   N NH1  . ARG B 2 22  ? 10.860  9.764   -9.177  1.00 63.44 ? 22  ARG B NH1  1  
ATOM 4751   N NH2  . ARG B 2 22  ? 9.593   8.548   -10.641 1.00 73.31 ? 22  ARG B NH2  1  
ATOM 4752   H H    . ARG B 2 22  ? 18.057  9.849   -12.320 1.00 63.22 ? 22  ARG B H    1  
ATOM 4753   H HA   . ARG B 2 22  ? 17.038  7.187   -11.828 1.00 24.44 ? 22  ARG B HA   1  
ATOM 4754   H HB2  . ARG B 2 22  ? 16.065  8.287   -9.874  1.00 73.21 ? 22  ARG B HB2  1  
ATOM 4755   H HB3  . ARG B 2 22  ? 15.529  9.653   -10.845 1.00 32.01 ? 22  ARG B HB3  1  
ATOM 4756   H HG2  . ARG B 2 22  ? 13.960  8.094   -12.046 1.00 21.13 ? 22  ARG B HG2  1  
ATOM 4757   H HG3  . ARG B 2 22  ? 14.417  6.827   -10.906 1.00 20.32 ? 22  ARG B HG3  1  
ATOM 4758   H HD2  . ARG B 2 22  ? 13.369  7.916   -9.098  1.00 41.42 ? 22  ARG B HD2  1  
ATOM 4759   H HD3  . ARG B 2 22  ? 13.374  9.483   -9.915  1.00 2.35  ? 22  ARG B HD3  1  
ATOM 4760   H HE   . ARG B 2 22  ? 11.762  7.469   -11.221 1.00 51.44 ? 22  ARG B HE   1  
ATOM 4761   H HH11 . ARG B 2 22  ? 11.743  10.006  -8.777  1.00 65.24 ? 22  ARG B HH11 1  
ATOM 4762   H HH12 . ARG B 2 22  ? 10.028  10.243  -8.869  1.00 1.22  ? 22  ARG B HH12 1  
ATOM 4763   H HH21 . ARG B 2 22  ? 9.508   7.859   -11.360 1.00 55.33 ? 22  ARG B HH21 1  
ATOM 4764   H HH22 . ARG B 2 22  ? 8.776   9.039   -10.318 1.00 64.15 ? 22  ARG B HH22 1  
ATOM 4765   N N    . THR B 2 23  ? 15.469  7.416   -13.876 1.00 11.21 ? 23  THR B N    1  
ATOM 4766   C CA   . THR B 2 23  ? 14.748  7.455   -15.166 1.00 72.45 ? 23  THR B CA   1  
ATOM 4767   C C    . THR B 2 23  ? 15.715  7.483   -16.376 1.00 44.22 ? 23  THR B C    1  
ATOM 4768   O O    . THR B 2 23  ? 16.069  8.558   -16.877 1.00 3.21  ? 23  THR B O    1  
ATOM 4769   C CB   . THR B 2 23  ? 13.676  8.612   -15.225 1.00 51.13 ? 23  THR B CB   1  
ATOM 4770   O OG1  . THR B 2 23  ? 12.729  8.431   -14.157 1.00 72.02 ? 23  THR B OG1  1  
ATOM 4771   C CG2  . THR B 2 23  ? 12.904  8.659   -16.559 1.00 43.01 ? 23  THR B CG2  1  
ATOM 4772   H H    . THR B 2 23  ? 15.435  6.579   -13.360 1.00 72.54 ? 23  THR B H    1  
ATOM 4773   H HA   . THR B 2 23  ? 14.199  6.519   -15.220 1.00 55.13 ? 23  THR B HA   1  
ATOM 4774   H HB   . THR B 2 23  ? 14.182  9.559   -15.078 1.00 31.11 ? 23  THR B HB   1  
ATOM 4775   H HG1  . THR B 2 23  ? 12.136  7.705   -14.386 1.00 51.20 ? 23  THR B HG1  1  
ATOM 4776   H HG21 . THR B 2 23  ? 13.595  8.828   -17.374 1.00 12.53 ? 23  THR B HG21 1  
ATOM 4777   H HG22 . THR B 2 23  ? 12.177  9.459   -16.535 1.00 72.43 ? 23  THR B HG22 1  
ATOM 4778   H HG23 . THR B 2 23  ? 12.392  7.717   -16.716 1.00 11.41 ? 23  THR B HG23 1  
ATOM 4779   N N    . PRO B 2 24  ? 16.214  6.278   -16.825 1.00 74.55 ? 24  PRO B N    1  
ATOM 4780   C CA   . PRO B 2 24  ? 16.909  6.116   -18.121 1.00 63.12 ? 24  PRO B CA   1  
ATOM 4781   C C    . PRO B 2 24  ? 15.916  5.744   -19.252 1.00 32.41 ? 24  PRO B C    1  
ATOM 4782   O O    . PRO B 2 24  ? 16.257  5.010   -20.185 1.00 43.13 ? 24  PRO B O    1  
ATOM 4783   C CB   . PRO B 2 24  ? 17.897  4.972   -17.800 1.00 14.52 ? 24  PRO B CB   1  
ATOM 4784   C CG   . PRO B 2 24  ? 17.147  4.083   -16.853 1.00 51.45 ? 24  PRO B CG   1  
ATOM 4785   C CD   . PRO B 2 24  ? 16.201  4.989   -16.073 1.00 61.45 ? 24  PRO B CD   1  
ATOM 4786   H HA   . PRO B 2 24  ? 17.452  7.010   -18.404 1.00 50.12 ? 24  PRO B HA   1  
ATOM 4787   H HB2  . PRO B 2 24  ? 18.175  4.440   -18.709 1.00 23.03 ? 24  PRO B HB2  1  
ATOM 4788   H HB3  . PRO B 2 24  ? 18.785  5.366   -17.319 1.00 11.31 ? 24  PRO B HB3  1  
ATOM 4789   H HG2  . PRO B 2 24  ? 16.586  3.336   -17.415 1.00 12.23 ? 24  PRO B HG2  1  
ATOM 4790   H HG3  . PRO B 2 24  ? 17.836  3.590   -16.177 1.00 41.54 ? 24  PRO B HG3  1  
ATOM 4791   H HD2  . PRO B 2 24  ? 15.200  4.572   -16.049 1.00 43.25 ? 24  PRO B HD2  1  
ATOM 4792   H HD3  . PRO B 2 24  ? 16.560  5.137   -15.060 1.00 65.31 ? 24  PRO B HD3  1  
ATOM 4793   N N    . GLU B 2 25  ? 14.686  6.276   -19.147 1.00 0.03  ? 25  GLU B N    1  
ATOM 4794   C CA   . GLU B 2 25  ? 13.607  6.046   -20.116 1.00 15.11 ? 25  GLU B CA   1  
ATOM 4795   C C    . GLU B 2 25  ? 13.741  7.021   -21.296 1.00 4.24  ? 25  GLU B C    1  
ATOM 4796   O O    . GLU B 2 25  ? 13.030  8.033   -21.383 1.00 55.21 ? 25  GLU B O    1  
ATOM 4797   C CB   . GLU B 2 25  ? 12.230  6.185   -19.415 1.00 74.53 ? 25  GLU B CB   1  
ATOM 4798   C CG   . GLU B 2 25  ? 11.976  5.172   -18.281 1.00 4.34  ? 25  GLU B CG   1  
ATOM 4799   C CD   . GLU B 2 25  ? 10.776  5.544   -17.391 1.00 61.21 ? 25  GLU B CD   1  
ATOM 4800   O OE1  . GLU B 2 25  ? 10.967  5.754   -16.173 1.00 33.31 ? 25  GLU B OE1  1  
ATOM 4801   O OE2  . GLU B 2 25  ? 9.641   5.642   -17.908 1.00 74.25 ? 25  GLU B OE2  1  
ATOM 4802   H H    . GLU B 2 25  ? 14.498  6.861   -18.389 1.00 54.34 ? 25  GLU B H    1  
ATOM 4803   H HA   . GLU B 2 25  ? 13.704  5.031   -20.498 1.00 41.02 ? 25  GLU B HA   1  
ATOM 4804   H HB2  . GLU B 2 25  ? 12.153  7.188   -19.002 1.00 11.03 ? 25  GLU B HB2  1  
ATOM 4805   H HB3  . GLU B 2 25  ? 11.449  6.062   -20.159 1.00 23.12 ? 25  GLU B HB3  1  
ATOM 4806   H HG2  . GLU B 2 25  ? 11.786  4.198   -18.719 1.00 73.04 ? 25  GLU B HG2  1  
ATOM 4807   H HG3  . GLU B 2 25  ? 12.872  5.108   -17.666 1.00 64.12 ? 25  GLU B HG3  1  
ATOM 4808   N N    . MET B 2 26  ? 14.717  6.723   -22.163 1.00 3.32  ? 26  MET B N    1  
ATOM 4809   C CA   . MET B 2 26  ? 14.952  7.459   -23.414 1.00 53.54 ? 26  MET B CA   1  
ATOM 4810   C C    . MET B 2 26  ? 15.877  6.612   -24.331 1.00 75.13 ? 26  MET B C    1  
ATOM 4811   O O    . MET B 2 26  ? 15.564  6.455   -25.517 1.00 63.10 ? 26  MET B O    1  
ATOM 4812   C CB   . MET B 2 26  ? 15.502  8.899   -23.176 1.00 40.32 ? 26  MET B CB   1  
ATOM 4813   C CG   . MET B 2 26  ? 15.554  9.815   -24.420 1.00 73.25 ? 26  MET B CG   1  
ATOM 4814   S SD   . MET B 2 26  ? 13.982  10.643  -24.816 1.00 44.33 ? 26  MET B SD   1  
ATOM 4815   C CE   . MET B 2 26  ? 12.932  9.348   -25.475 1.00 42.03 ? 26  MET B CE   1  
ATOM 4816   H H    . MET B 2 26  ? 15.296  5.956   -21.957 1.00 52.43 ? 26  MET B H    1  
ATOM 4817   H HA   . MET B 2 26  ? 13.987  7.534   -23.908 1.00 34.32 ? 26  MET B HA   1  
ATOM 4818   H HB2  . MET B 2 26  ? 14.872  9.384   -22.442 1.00 31.32 ? 26  MET B HB2  1  
ATOM 4819   H HB3  . MET B 2 26  ? 16.504  8.822   -22.765 1.00 33.34 ? 26  MET B HB3  1  
ATOM 4820   H HG2  . MET B 2 26  ? 16.294  10.589  -24.246 1.00 73.34 ? 26  MET B HG2  1  
ATOM 4821   H HG3  . MET B 2 26  ? 15.862  9.232   -25.278 1.00 40.52 ? 26  MET B HG3  1  
ATOM 4822   H HE1  . MET B 2 26  ? 12.000  9.780   -25.814 1.00 53.24 ? 26  MET B HE1  1  
ATOM 4823   H HE2  . MET B 2 26  ? 12.724  8.619   -24.704 1.00 2.33  ? 26  MET B HE2  1  
ATOM 4824   H HE3  . MET B 2 26  ? 13.424  8.863   -26.306 1.00 24.33 ? 26  MET B HE3  1  
ATOM 4825   N N    . PRO B 2 27  ? 17.040  6.047   -23.827 1.00 51.45 ? 27  PRO B N    1  
ATOM 4826   C CA   . PRO B 2 27  ? 17.694  4.916   -24.487 1.00 71.10 ? 27  PRO B CA   1  
ATOM 4827   C C    . PRO B 2 27  ? 17.050  3.613   -23.989 1.00 64.41 ? 27  PRO B C    1  
ATOM 4828   O O    . PRO B 2 27  ? 17.377  3.132   -22.887 1.00 14.32 ? 27  PRO B O    1  
ATOM 4829   C CB   . PRO B 2 27  ? 19.193  5.044   -24.074 1.00 22.03 ? 27  PRO B CB   1  
ATOM 4830   C CG   . PRO B 2 27  ? 19.261  6.176   -23.074 1.00 5.11  ? 27  PRO B CG   1  
ATOM 4831   C CD   . PRO B 2 27  ? 17.836  6.460   -22.646 1.00 54.15 ? 27  PRO B CD   1  
ATOM 4832   H HA   . PRO B 2 27  ? 17.599  4.980   -25.572 1.00 44.14 ? 27  PRO B HA   1  
ATOM 4833   H HB2  . PRO B 2 27  ? 19.553  4.111   -23.636 1.00 10.34 ? 27  PRO B HB2  1  
ATOM 4834   H HB3  . PRO B 2 27  ? 19.799  5.284   -24.942 1.00 34.40 ? 27  PRO B HB3  1  
ATOM 4835   H HG2  . PRO B 2 27  ? 19.865  5.886   -22.217 1.00 73.04 ? 27  PRO B HG2  1  
ATOM 4836   H HG3  . PRO B 2 27  ? 19.686  7.061   -23.537 1.00 32.32 ? 27  PRO B HG3  1  
ATOM 4837   H HD2  . PRO B 2 27  ? 17.564  5.871   -21.774 1.00 44.13 ? 27  PRO B HD2  1  
ATOM 4838   H HD3  . PRO B 2 27  ? 17.702  7.513   -22.436 1.00 14.01 ? 27  PRO B HD3  1  
ATOM 4839   N N    . VAL B 2 28  ? 16.079  3.097   -24.765 1.00 71.21 ? 28  VAL B N    1  
ATOM 4840   C CA   . VAL B 2 28  ? 15.338  1.879   -24.406 1.00 44.42 ? 28  VAL B CA   1  
ATOM 4841   C C    . VAL B 2 28  ? 16.300  0.681   -24.239 1.00 33.24 ? 28  VAL B C    1  
ATOM 4842   O O    . VAL B 2 28  ? 17.083  0.372   -25.137 1.00 50.44 ? 28  VAL B O    1  
ATOM 4843   C CB   . VAL B 2 28  ? 14.209  1.526   -25.456 1.00 65.31 ? 28  VAL B CB   1  
ATOM 4844   C CG1  . VAL B 2 28  ? 14.770  1.335   -26.892 1.00 44.30 ? 28  VAL B CG1  1  
ATOM 4845   C CG2  . VAL B 2 28  ? 13.408  0.280   -24.998 1.00 73.51 ? 28  VAL B CG2  1  
ATOM 4846   H H    . VAL B 2 28  ? 15.857  3.553   -25.604 1.00 65.13 ? 28  VAL B H    1  
ATOM 4847   H HA   . VAL B 2 28  ? 14.850  2.074   -23.452 1.00 31.22 ? 28  VAL B HA   1  
ATOM 4848   H HB   . VAL B 2 28  ? 13.517  2.369   -25.489 1.00 44.43 ? 28  VAL B HB   1  
ATOM 4849   H HG11 . VAL B 2 28  ? 15.266  2.243   -27.215 1.00 75.25 ? 28  VAL B HG11 1  
ATOM 4850   H HG12 . VAL B 2 28  ? 13.962  1.114   -27.579 1.00 24.22 ? 28  VAL B HG12 1  
ATOM 4851   H HG13 . VAL B 2 28  ? 15.482  0.518   -26.906 1.00 72.15 ? 28  VAL B HG13 1  
ATOM 4852   H HG21 . VAL B 2 28  ? 12.976  0.462   -24.022 1.00 41.13 ? 28  VAL B HG21 1  
ATOM 4853   H HG22 . VAL B 2 28  ? 14.063  -0.582  -24.941 1.00 65.41 ? 28  VAL B HG22 1  
ATOM 4854   H HG23 . VAL B 2 28  ? 12.612  0.075   -25.703 1.00 60.05 ? 28  VAL B HG23 1  
ATOM 4855   N N    . LEU B 2 29  ? 16.266  0.066   -23.049 1.00 41.42 ? 29  LEU B N    1  
ATOM 4856   C CA   . LEU B 2 29  ? 16.990  -1.177  -22.762 1.00 34.34 ? 29  LEU B CA   1  
ATOM 4857   C C    . LEU B 2 29  ? 15.940  -2.299  -22.755 1.00 15.02 ? 29  LEU B C    1  
ATOM 4858   O O    . LEU B 2 29  ? 15.012  -2.285  -21.935 1.00 62.20 ? 29  LEU B O    1  
ATOM 4859   C CB   . LEU B 2 29  ? 17.758  -1.035  -21.407 1.00 40.52 ? 29  LEU B CB   1  
ATOM 4860   C CG   . LEU B 2 29  ? 18.959  -2.020  -21.125 1.00 1.44  ? 29  LEU B CG   1  
ATOM 4861   C CD1  . LEU B 2 29  ? 18.495  -3.451  -20.764 1.00 22.10 ? 29  LEU B CD1  1  
ATOM 4862   C CD2  . LEU B 2 29  ? 19.957  -2.050  -22.312 1.00 22.40 ? 29  LEU B CD2  1  
ATOM 4863   H H    . LEU B 2 29  ? 15.727  0.466   -22.334 1.00 11.34 ? 29  LEU B H    1  
ATOM 4864   H HA   . LEU B 2 29  ? 17.708  -1.357  -23.569 1.00 2.21  ? 29  LEU B HA   1  
ATOM 4865   H HB2  . LEU B 2 29  ? 18.157  -0.021  -21.359 1.00 2.33  ? 29  LEU B HB2  1  
ATOM 4866   H HB3  . LEU B 2 29  ? 17.041  -1.134  -20.600 1.00 54.23 ? 29  LEU B HB3  1  
ATOM 4867   H HG   . LEU B 2 29  ? 19.505  -1.647  -20.266 1.00 51.13 ? 29  LEU B HG   1  
ATOM 4868   H HD11 . LEU B 2 29  ? 17.850  -3.419  -19.893 1.00 33.11 ? 29  LEU B HD11 1  
ATOM 4869   H HD12 . LEU B 2 29  ? 19.354  -4.067  -20.540 1.00 73.15 ? 29  LEU B HD12 1  
ATOM 4870   H HD13 . LEU B 2 29  ? 17.950  -3.888  -21.595 1.00 73.34 ? 29  LEU B HD13 1  
ATOM 4871   H HD21 . LEU B 2 29  ? 20.791  -2.696  -22.071 1.00 72.10 ? 29  LEU B HD21 1  
ATOM 4872   H HD22 . LEU B 2 29  ? 20.328  -1.052  -22.504 1.00 34.42 ? 29  LEU B HD22 1  
ATOM 4873   H HD23 . LEU B 2 29  ? 19.463  -2.423  -23.202 1.00 63.15 ? 29  LEU B HD23 1  
ATOM 4874   N N    . GLU B 2 30  ? 16.077  -3.232  -23.713 1.00 70.24 ? 30  GLU B N    1  
ATOM 4875   C CA   . GLU B 2 30  ? 15.081  -4.294  -23.984 1.00 2.24  ? 30  GLU B CA   1  
ATOM 4876   C C    . GLU B 2 30  ? 14.928  -5.269  -22.795 1.00 3.13  ? 30  GLU B C    1  
ATOM 4877   O O    . GLU B 2 30  ? 13.844  -5.828  -22.590 1.00 41.41 ? 30  GLU B O    1  
ATOM 4878   C CB   . GLU B 2 30  ? 15.502  -5.076  -25.247 1.00 62.44 ? 30  GLU B CB   1  
ATOM 4879   C CG   . GLU B 2 30  ? 15.680  -4.227  -26.520 1.00 61.35 ? 30  GLU B CG   1  
ATOM 4880   C CD   . GLU B 2 30  ? 16.131  -5.077  -27.719 1.00 64.41 ? 30  GLU B CD   1  
ATOM 4881   O OE1  . GLU B 2 30  ? 15.287  -5.796  -28.293 1.00 45.21 ? 30  GLU B OE1  1  
ATOM 4882   O OE2  . GLU B 2 30  ? 17.338  -5.076  -28.060 1.00 1.31  ? 30  GLU B OE2  1  
ATOM 4883   H H    . GLU B 2 30  ? 16.887  -3.209  -24.267 1.00 53.32 ? 30  GLU B H    1  
ATOM 4884   H HA   . GLU B 2 30  ? 14.123  -3.816  -24.167 1.00 1.43  ? 30  GLU B HA   1  
ATOM 4885   H HB2  . GLU B 2 30  ? 16.446  -5.573  -25.045 1.00 65.44 ? 30  GLU B HB2  1  
ATOM 4886   H HB3  . GLU B 2 30  ? 14.750  -5.836  -25.449 1.00 5.42  ? 30  GLU B HB3  1  
ATOM 4887   H HG2  . GLU B 2 30  ? 14.736  -3.745  -26.760 1.00 53.33 ? 30  GLU B HG2  1  
ATOM 4888   H HG3  . GLU B 2 30  ? 16.424  -3.461  -26.325 1.00 71.25 ? 30  GLU B HG3  1  
ATOM 4889   N N    . ASN B 2 31  ? 16.052  -5.493  -22.069 1.00 33.21 ? 31  ASN B N    1  
ATOM 4890   C CA   . ASN B 2 31  ? 16.115  -6.316  -20.828 1.00 13.25 ? 31  ASN B CA   1  
ATOM 4891   C C    . ASN B 2 31  ? 15.926  -7.836  -21.125 1.00 74.34 ? 31  ASN B C    1  
ATOM 4892   O O    . ASN B 2 31  ? 15.755  -8.650  -20.207 1.00 61.11 ? 31  ASN B O    1  
ATOM 4893   C CB   . ASN B 2 31  ? 15.092  -5.785  -19.762 1.00 63.32 ? 31  ASN B CB   1  
ATOM 4894   C CG   . ASN B 2 31  ? 15.316  -6.318  -18.339 1.00 21.41 ? 31  ASN B CG   1  
ATOM 4895   O OD1  . ASN B 2 31  ? 16.457  -6.538  -17.913 1.00 21.12 ? 31  ASN B OD1  1  
ATOM 4896   N ND2  . ASN B 2 31  ? 14.238  -6.561  -17.613 1.00 52.42 ? 31  ASN B ND2  1  
ATOM 4897   H H    . ASN B 2 31  ? 16.886  -5.091  -22.387 1.00 62.14 ? 31  ASN B H    1  
ATOM 4898   H HA   . ASN B 2 31  ? 17.114  -6.189  -20.433 1.00 11.32 ? 31  ASN B HA   1  
ATOM 4899   H HB2  . ASN B 2 31  ? 15.168  -4.706  -19.720 1.00 12.11 ? 31  ASN B HB2  1  
ATOM 4900   H HB3  . ASN B 2 31  ? 14.089  -6.046  -20.085 1.00 72.31 ? 31  ASN B HB3  1  
ATOM 4901   H HD21 . ASN B 2 31  ? 13.357  -6.394  -18.015 1.00 41.24 ? 31  ASN B HD21 1  
ATOM 4902   H HD22 . ASN B 2 31  ? 14.360  -6.908  -16.708 1.00 53.21 ? 31  ASN B HD22 1  
ATOM 4903   N N    . ARG B 2 32  ? 16.030  -8.209  -22.420 1.00 40.53 ? 32  ARG B N    1  
ATOM 4904   C CA   . ARG B 2 32  ? 15.871  -9.613  -22.887 1.00 44.32 ? 32  ARG B CA   1  
ATOM 4905   C C    . ARG B 2 32  ? 17.189  -10.420 -22.805 1.00 15.21 ? 32  ARG B C    1  
ATOM 4906   O O    . ARG B 2 32  ? 17.216  -11.606 -23.152 1.00 64.02 ? 32  ARG B O    1  
ATOM 4907   C CB   . ARG B 2 32  ? 15.236  -9.654  -24.320 1.00 24.55 ? 32  ARG B CB   1  
ATOM 4908   C CG   . ARG B 2 32  ? 15.855  -8.684  -25.368 1.00 33.50 ? 32  ARG B CG   1  
ATOM 4909   C CD   . ARG B 2 32  ? 17.250  -9.089  -25.870 1.00 72.22 ? 32  ARG B CD   1  
ATOM 4910   N NE   . ARG B 2 32  ? 17.863  -8.039  -26.705 1.00 50.41 ? 32  ARG B NE   1  
ATOM 4911   C CZ   . ARG B 2 32  ? 19.176  -7.922  -26.956 1.00 51.12 ? 32  ARG B CZ   1  
ATOM 4912   N NH1  . ARG B 2 32  ? 20.055  -8.787  -26.449 1.00 51.03 ? 32  ARG B NH1  1  
ATOM 4913   N NH2  . ARG B 2 32  ? 19.598  -6.926  -27.709 1.00 0.45  ? 32  ARG B NH2  1  
ATOM 4914   H H    . ARG B 2 32  ? 16.229  -7.517  -23.080 1.00 64.32 ? 32  ARG B H    1  
ATOM 4915   H HA   . ARG B 2 32  ? 15.172  -10.094 -22.206 1.00 60.32 ? 32  ARG B HA   1  
ATOM 4916   H HB2  . ARG B 2 32  ? 15.302  -10.663 -24.709 1.00 21.21 ? 32  ARG B HB2  1  
ATOM 4917   H HB3  . ARG B 2 32  ? 14.181  -9.404  -24.227 1.00 1.15  ? 32  ARG B HB3  1  
ATOM 4918   H HG2  . ARG B 2 32  ? 15.191  -8.624  -26.222 1.00 65.30 ? 32  ARG B HG2  1  
ATOM 4919   H HG3  . ARG B 2 32  ? 15.923  -7.702  -24.915 1.00 54.54 ? 32  ARG B HG3  1  
ATOM 4920   H HD2  . ARG B 2 32  ? 17.891  -9.276  -25.016 1.00 72.05 ? 32  ARG B HD2  1  
ATOM 4921   H HD3  . ARG B 2 32  ? 17.167  -9.996  -26.457 1.00 2.24  ? 32  ARG B HD3  1  
ATOM 4922   H HE   . ARG B 2 32  ? 17.253  -7.376  -27.103 1.00 24.31 ? 32  ARG B HE   1  
ATOM 4923   H HH11 . ARG B 2 32  ? 19.742  -9.543  -25.868 1.00 62.03 ? 32  ARG B HH11 1  
ATOM 4924   H HH12 . ARG B 2 32  ? 21.037  -8.687  -26.647 1.00 22.41 ? 32  ARG B HH12 1  
ATOM 4925   H HH21 . ARG B 2 32  ? 18.943  -6.262  -28.086 1.00 2.12  ? 32  ARG B HH21 1  
ATOM 4926   H HH22 . ARG B 2 32  ? 20.576  -6.824  -27.907 1.00 2.32  ? 32  ARG B HH22 1  
ATOM 4927   N N    . ALA B 2 33  ? 18.274  -9.763  -22.364 1.00 63.13 ? 33  ALA B N    1  
ATOM 4928   C CA   . ALA B 2 33  ? 19.565  -10.425 -22.114 1.00 5.22  ? 33  ALA B CA   1  
ATOM 4929   C C    . ALA B 2 33  ? 19.446  -11.380 -20.903 1.00 73.31 ? 33  ALA B C    1  
ATOM 4930   O O    . ALA B 2 33  ? 19.106  -10.924 -19.806 1.00 72.33 ? 33  ALA B O    1  
ATOM 4931   C CB   . ALA B 2 33  ? 20.660  -9.368  -21.885 1.00 33.12 ? 33  ALA B CB   1  
ATOM 4932   H H    . ALA B 2 33  ? 18.201  -8.804  -22.200 1.00 55.32 ? 33  ALA B H    1  
ATOM 4933   H HA   . ALA B 2 33  ? 19.828  -10.997 -23.000 1.00 50.45 ? 33  ALA B HA   1  
ATOM 4934   H HB1  . ALA B 2 33  ? 20.423  -8.775  -21.009 1.00 4.54  ? 33  ALA B HB1  1  
ATOM 4935   H HB2  . ALA B 2 33  ? 20.723  -8.714  -22.746 1.00 62.52 ? 33  ALA B HB2  1  
ATOM 4936   H HB3  . ALA B 2 33  ? 21.618  -9.854  -21.741 1.00 62.43 ? 33  ALA B HB3  1  
ATOM 4937   N N    . ALA B 2 34  ? 19.674  -12.699 -21.135 1.00 22.53 ? 34  ALA B N    1  
ATOM 4938   C CA   . ALA B 2 34  ? 19.621  -13.761 -20.090 1.00 53.12 ? 34  ALA B CA   1  
ATOM 4939   C C    . ALA B 2 34  ? 18.229  -13.837 -19.400 1.00 34.43 ? 34  ALA B C    1  
ATOM 4940   O O    . ALA B 2 34  ? 18.113  -14.256 -18.241 1.00 10.43 ? 34  ALA B O    1  
ATOM 4941   C CB   . ALA B 2 34  ? 20.767  -13.571 -19.067 1.00 53.33 ? 34  ALA B CB   1  
ATOM 4942   H H    . ALA B 2 34  ? 19.883  -12.976 -22.052 1.00 44.34 ? 34  ALA B H    1  
ATOM 4943   H HA   . ALA B 2 34  ? 19.785  -14.705 -20.598 1.00 1.32  ? 34  ALA B HA   1  
ATOM 4944   H HB1  . ALA B 2 34  ? 20.776  -14.402 -18.373 1.00 53.20 ? 34  ALA B HB1  1  
ATOM 4945   H HB2  . ALA B 2 34  ? 20.623  -12.649 -18.521 1.00 4.14  ? 34  ALA B HB2  1  
ATOM 4946   H HB3  . ALA B 2 34  ? 21.715  -13.534 -19.588 1.00 51.51 ? 34  ALA B HB3  1  
ATOM 4947   N N    . GLN B 2 35  ? 17.179  -13.472 -20.163 1.00 54.11 ? 35  GLN B N    1  
ATOM 4948   C CA   . GLN B 2 35  ? 15.798  -13.351 -19.662 1.00 15.23 ? 35  GLN B CA   1  
ATOM 4949   C C    . GLN B 2 35  ? 15.104  -14.724 -19.518 1.00 24.14 ? 35  GLN B C    1  
ATOM 4950   O O    . GLN B 2 35  ? 14.261  -14.903 -18.635 1.00 13.44 ? 35  GLN B O    1  
ATOM 4951   C CB   . GLN B 2 35  ? 14.989  -12.415 -20.599 1.00 12.12 ? 35  GLN B CB   1  
ATOM 4952   C CG   . GLN B 2 35  ? 13.550  -12.087 -20.145 1.00 52.13 ? 35  GLN B CG   1  
ATOM 4953   C CD   . GLN B 2 35  ? 12.831  -11.151 -21.122 1.00 72.33 ? 35  GLN B CD   1  
ATOM 4954   O OE1  . GLN B 2 35  ? 12.851  -9.930  -20.974 1.00 73.13 ? 35  GLN B OE1  1  
ATOM 4955   N NE2  . GLN B 2 35  ? 12.241  -11.719 -22.162 1.00 5.02  ? 35  GLN B NE2  1  
ATOM 4956   H H    . GLN B 2 35  ? 17.347  -13.280 -21.113 1.00 71.24 ? 35  GLN B H    1  
ATOM 4957   H HA   . GLN B 2 35  ? 15.846  -12.889 -18.679 1.00 50.21 ? 35  GLN B HA   1  
ATOM 4958   H HB2  . GLN B 2 35  ? 15.532  -11.480 -20.694 1.00 20.03 ? 35  GLN B HB2  1  
ATOM 4959   H HB3  . GLN B 2 35  ? 14.938  -12.876 -21.584 1.00 13.44 ? 35  GLN B HB3  1  
ATOM 4960   H HG2  . GLN B 2 35  ? 12.988  -13.011 -20.065 1.00 41.33 ? 35  GLN B HG2  1  
ATOM 4961   H HG3  . GLN B 2 35  ? 13.588  -11.614 -19.168 1.00 25.10 ? 35  GLN B HG3  1  
ATOM 4962   H HE21 . GLN B 2 35  ? 12.294  -12.693 -22.253 1.00 53.44 ? 35  GLN B HE21 1  
ATOM 4963   H HE22 . GLN B 2 35  ? 11.780  -11.142 -22.799 1.00 41.12 ? 35  GLN B HE22 1  
ATOM 4964   N N    . GLY B 2 36  ? 15.471  -15.690 -20.373 1.00 34.52 ? 36  GLY B N    1  
ATOM 4965   C CA   . GLY B 2 36  ? 14.778  -16.982 -20.421 1.00 74.33 ? 36  GLY B CA   1  
ATOM 4966   C C    . GLY B 2 36  ? 13.358  -16.841 -20.976 1.00 51.42 ? 36  GLY B C    1  
ATOM 4967   O O    . GLY B 2 36  ? 13.137  -17.063 -22.173 1.00 12.54 ? 36  GLY B O    1  
ATOM 4968   H H    . GLY B 2 36  ? 16.233  -15.525 -20.965 1.00 31.44 ? 36  GLY B H    1  
ATOM 4969   H HA2  . GLY B 2 36  ? 15.344  -17.650 -21.052 1.00 11.13 ? 36  GLY B HA2  1  
ATOM 4970   H HA3  . GLY B 2 36  ? 14.730  -17.406 -19.424 1.00 44.23 ? 36  GLY B HA3  1  
ATOM 4971   N N    . ASP B 2 37  ? 12.415  -16.462 -20.073 1.00 24.21 ? 37  ASP B N    1  
ATOM 4972   C CA   . ASP B 2 37  ? 11.022  -16.065 -20.395 1.00 61.34 ? 37  ASP B CA   1  
ATOM 4973   C C    . ASP B 2 37  ? 10.244  -17.200 -21.087 1.00 61.44 ? 37  ASP B C    1  
ATOM 4974   O O    . ASP B 2 37  ? 9.521   -17.953 -20.433 1.00 1.22  ? 37  ASP B O    1  
ATOM 4975   C CB   . ASP B 2 37  ? 11.025  -14.751 -21.232 1.00 10.51 ? 37  ASP B CB   1  
ATOM 4976   C CG   . ASP B 2 37  ? 9.628   -14.208 -21.572 1.00 11.50 ? 37  ASP B CG   1  
ATOM 4977   O OD1  . ASP B 2 37  ? 9.170   -14.369 -22.732 1.00 40.23 ? 37  ASP B OD1  1  
ATOM 4978   O OD2  . ASP B 2 37  ? 8.973   -13.627 -20.679 1.00 2.22  ? 37  ASP B OD2  1  
ATOM 4979   H H    . ASP B 2 37  ? 12.680  -16.446 -19.125 1.00 42.12 ? 37  ASP B H    1  
ATOM 4980   H HA   . ASP B 2 37  ? 10.538  -15.861 -19.448 1.00 24.25 ? 37  ASP B HA   1  
ATOM 4981   H HB2  . ASP B 2 37  ? 11.560  -13.988 -20.677 1.00 43.40 ? 37  ASP B HB2  1  
ATOM 4982   H HB3  . ASP B 2 37  ? 11.566  -14.937 -22.156 1.00 43.34 ? 37  ASP B HB3  1  
ATOM 4983   N N    . ILE B 2 38  ? 10.417  -17.322 -22.417 1.00 35.21 ? 38  ILE B N    1  
ATOM 4984   C CA   . ILE B 2 38  ? 9.859   -18.426 -23.209 1.00 75.44 ? 38  ILE B CA   1  
ATOM 4985   C C    . ILE B 2 38  ? 10.956  -19.505 -23.388 1.00 10.01 ? 38  ILE B C    1  
ATOM 4986   O O    . ILE B 2 38  ? 11.735  -19.505 -24.350 1.00 44.14 ? 38  ILE B O    1  
ATOM 4987   C CB   . ILE B 2 38  ? 9.253   -17.923 -24.588 1.00 71.54 ? 38  ILE B CB   1  
ATOM 4988   C CG1  . ILE B 2 38  ? 8.789   -19.127 -25.493 1.00 52.12 ? 38  ILE B CG1  1  
ATOM 4989   C CG2  . ILE B 2 38  ? 10.230  -16.981 -25.339 1.00 54.32 ? 38  ILE B CG2  1  
ATOM 4990   C CD1  . ILE B 2 38  ? 8.161   -18.730 -26.824 1.00 10.35 ? 38  ILE B CD1  1  
ATOM 4991   H H    . ILE B 2 38  ? 10.955  -16.644 -22.880 1.00 2.24  ? 38  ILE B H    1  
ATOM 4992   H HA   . ILE B 2 38  ? 9.040   -18.866 -22.633 1.00 23.34 ? 38  ILE B HA   1  
ATOM 4993   H HB   . ILE B 2 38  ? 8.378   -17.326 -24.340 1.00 63.44 ? 38  ILE B HB   1  
ATOM 4994   H HG12 . ILE B 2 38  ? 9.641   -19.754 -25.720 1.00 3.41  ? 38  ILE B HG12 1  
ATOM 4995   H HG13 . ILE B 2 38  ? 8.059   -19.717 -24.951 1.00 62.14 ? 38  ILE B HG13 1  
ATOM 4996   H HG21 . ILE B 2 38  ? 9.762   -16.614 -26.244 1.00 33.33 ? 38  ILE B HG21 1  
ATOM 4997   H HG22 . ILE B 2 38  ? 11.132  -17.520 -25.600 1.00 55.13 ? 38  ILE B HG22 1  
ATOM 4998   H HG23 . ILE B 2 38  ? 10.489  -16.140 -24.708 1.00 44.40 ? 38  ILE B HG23 1  
ATOM 4999   H HD11 . ILE B 2 38  ? 7.310   -18.085 -26.650 1.00 1.23  ? 38  ILE B HD11 1  
ATOM 5000   H HD12 . ILE B 2 38  ? 7.836   -19.617 -27.346 1.00 15.41 ? 38  ILE B HD12 1  
ATOM 5001   H HD13 . ILE B 2 38  ? 8.891   -18.208 -27.429 1.00 45.23 ? 38  ILE B HD13 1  
ATOM 5002   N N    . THR B 2 39  ? 11.053  -20.381 -22.381 1.00 61.11 ? 39  THR B N    1  
ATOM 5003   C CA   . THR B 2 39  ? 11.997  -21.514 -22.368 1.00 41.23 ? 39  THR B CA   1  
ATOM 5004   C C    . THR B 2 39  ? 11.206  -22.832 -22.501 1.00 64.25 ? 39  THR B C    1  
ATOM 5005   O O    . THR B 2 39  ? 11.597  -23.738 -23.249 1.00 61.12 ? 39  THR B O    1  
ATOM 5006   C CB   . THR B 2 39  ? 12.848  -21.490 -21.048 1.00 20.25 ? 39  THR B CB   1  
ATOM 5007   O OG1  . THR B 2 39  ? 13.489  -20.206 -20.913 1.00 44.02 ? 39  THR B OG1  1  
ATOM 5008   C CG2  . THR B 2 39  ? 13.919  -22.605 -21.014 1.00 0.52  ? 39  THR B CG2  1  
ATOM 5009   H H    . THR B 2 39  ? 10.461  -20.261 -21.608 1.00 72.15 ? 39  THR B H    1  
ATOM 5010   H HA   . THR B 2 39  ? 12.674  -21.420 -23.218 1.00 2.31  ? 39  THR B HA   1  
ATOM 5011   H HB   . THR B 2 39  ? 12.180  -21.626 -20.202 1.00 60.03 ? 39  THR B HB   1  
ATOM 5012   H HG1  . THR B 2 39  ? 13.110  -19.587 -21.551 1.00 72.34 ? 39  THR B HG1  1  
ATOM 5013   H HG21 . THR B 2 39  ? 14.478  -22.551 -20.089 1.00 73.32 ? 39  THR B HG21 1  
ATOM 5014   H HG22 . THR B 2 39  ? 14.601  -22.487 -21.848 1.00 24.12 ? 39  THR B HG22 1  
ATOM 5015   H HG23 . THR B 2 39  ? 13.439  -23.573 -21.084 1.00 63.14 ? 39  THR B HG23 1  
ATOM 5016   N N    . ALA B 2 40  ? 10.085  -22.916 -21.761 1.00 62.41 ? 40  ALA B N    1  
ATOM 5017   C CA   . ALA B 2 40  ? 9.118   -24.019 -21.883 1.00 4.22  ? 40  ALA B CA   1  
ATOM 5018   C C    . ALA B 2 40  ? 8.341   -23.876 -23.215 1.00 10.34 ? 40  ALA B C    1  
ATOM 5019   O O    . ALA B 2 40  ? 7.688   -22.842 -23.418 1.00 60.31 ? 40  ALA B O    1  
ATOM 5020   C CB   . ALA B 2 40  ? 8.160   -24.018 -20.679 1.00 64.00 ? 40  ALA B CB   1  
ATOM 5021   H H    . ALA B 2 40  ? 9.901   -22.210 -21.117 1.00 35.31 ? 40  ALA B H    1  
ATOM 5022   H HA   . ALA B 2 40  ? 9.670   -24.955 -21.878 1.00 13.33 ? 40  ALA B HA   1  
ATOM 5023   H HB1  . ALA B 2 40  ? 7.469   -24.847 -20.760 1.00 73.24 ? 40  ALA B HB1  1  
ATOM 5024   H HB2  . ALA B 2 40  ? 7.604   -23.090 -20.654 1.00 22.52 ? 40  ALA B HB2  1  
ATOM 5025   H HB3  . ALA B 2 40  ? 8.728   -24.117 -19.762 1.00 43.12 ? 40  ALA B HB3  1  
ATOM 5026   N N    . PRO B 2 41  ? 8.431   -24.885 -24.154 1.00 71.22 ? 41  PRO B N    1  
ATOM 5027   C CA   . PRO B 2 41  ? 7.774   -24.815 -25.489 1.00 61.04 ? 41  PRO B CA   1  
ATOM 5028   C C    . PRO B 2 41  ? 6.232   -24.820 -25.389 1.00 11.53 ? 41  PRO B C    1  
ATOM 5029   O O    . PRO B 2 41  ? 5.598   -25.887 -25.388 1.00 22.22 ? 41  PRO B O    1  
ATOM 5030   C CB   . PRO B 2 41  ? 8.315   -26.075 -26.233 1.00 72.44 ? 41  PRO B CB   1  
ATOM 5031   C CG   . PRO B 2 41  ? 9.508   -26.514 -25.441 1.00 53.34 ? 41  PRO B CG   1  
ATOM 5032   C CD   . PRO B 2 41  ? 9.188   -26.159 -24.008 1.00 24.33 ? 41  PRO B CD   1  
ATOM 5033   H HA   . PRO B 2 41  ? 8.087   -23.920 -26.022 1.00 41.25 ? 41  PRO B HA   1  
ATOM 5034   H HB2  . PRO B 2 41  ? 7.557   -26.861 -26.259 1.00 2.13  ? 41  PRO B HB2  1  
ATOM 5035   H HB3  . PRO B 2 41  ? 8.608   -25.822 -27.244 1.00 12.23 ? 41  PRO B HB3  1  
ATOM 5036   H HG2  . PRO B 2 41  ? 9.657   -27.585 -25.548 1.00 54.42 ? 41  PRO B HG2  1  
ATOM 5037   H HG3  . PRO B 2 41  ? 10.394  -25.978 -25.766 1.00 54.54 ? 41  PRO B HG3  1  
ATOM 5038   H HD2  . PRO B 2 41  ? 8.573   -26.925 -23.543 1.00 61.10 ? 41  PRO B HD2  1  
ATOM 5039   H HD3  . PRO B 2 41  ? 10.099  -26.011 -23.439 1.00 14.41 ? 41  PRO B HD3  1  
ATOM 5040   N N    . GLY B 2 42  ? 5.655   -23.611 -25.269 1.00 45.24 ? 42  GLY B N    1  
ATOM 5041   C CA   . GLY B 2 42  ? 4.213   -23.434 -25.095 1.00 3.32  ? 42  GLY B CA   1  
ATOM 5042   C C    . GLY B 2 42  ? 3.773   -23.771 -23.677 1.00 44.35 ? 42  GLY B C    1  
ATOM 5043   O O    . GLY B 2 42  ? 3.587   -22.875 -22.840 1.00 41.53 ? 42  GLY B O    1  
ATOM 5044   H H    . GLY B 2 42  ? 6.232   -22.818 -25.285 1.00 14.10 ? 42  GLY B H    1  
ATOM 5045   H HA2  . GLY B 2 42  ? 3.961   -22.402 -25.307 1.00 61.22 ? 42  GLY B HA2  1  
ATOM 5046   H HA3  . GLY B 2 42  ? 3.682   -24.069 -25.794 1.00 24.12 ? 42  GLY B HA3  1  
ATOM 5047   N N    . GLY B 2 43  ? 3.621   -25.081 -23.407 1.00 21.53 ? 43  GLY B N    1  
ATOM 5048   C CA   . GLY B 2 43  ? 3.229   -25.569 -22.086 1.00 42.15 ? 43  GLY B CA   1  
ATOM 5049   C C    . GLY B 2 43  ? 1.718   -25.538 -21.890 1.00 22.12 ? 43  GLY B C    1  
ATOM 5050   O O    . GLY B 2 43  ? 1.075   -26.597 -21.798 1.00 21.24 ? 43  GLY B O    1  
ATOM 5051   H H    . GLY B 2 43  ? 3.783   -25.731 -24.128 1.00 64.32 ? 43  GLY B H    1  
ATOM 5052   H HA2  . GLY B 2 43  ? 3.586   -26.584 -21.974 1.00 53.24 ? 43  GLY B HA2  1  
ATOM 5053   H HA3  . GLY B 2 43  ? 3.694   -24.957 -21.322 1.00 23.02 ? 43  GLY B HA3  1  
ATOM 5054   N N    . ALA B 2 44  ? 1.162   -24.297 -21.856 1.00 63.20 ? 44  ALA B N    1  
ATOM 5055   C CA   . ALA B 2 44  ? -0.270  -24.023 -21.613 1.00 4.44  ? 44  ALA B CA   1  
ATOM 5056   C C    . ALA B 2 44  ? -0.726  -24.598 -20.256 1.00 41.31 ? 44  ALA B C    1  
ATOM 5057   O O    . ALA B 2 44  ? 0.101   -24.928 -19.389 1.00 24.43 ? 44  ALA B O    1  
ATOM 5058   C CB   . ALA B 2 44  ? -1.132  -24.542 -22.790 1.00 31.15 ? 44  ALA B CB   1  
ATOM 5059   H H    . ALA B 2 44  ? 1.754   -23.532 -22.002 1.00 21.43 ? 44  ALA B H    1  
ATOM 5060   H HA   . ALA B 2 44  ? -0.381  -22.946 -21.569 1.00 4.01  ? 44  ALA B HA   1  
ATOM 5061   H HB1  . ALA B 2 44  ? -1.050  -25.619 -22.848 1.00 62.32 ? 44  ALA B HB1  1  
ATOM 5062   H HB2  . ALA B 2 44  ? -0.783  -24.110 -23.718 1.00 32.31 ? 44  ALA B HB2  1  
ATOM 5063   H HB3  . ALA B 2 44  ? -2.171  -24.269 -22.637 1.00 0.42  ? 44  ALA B HB3  1  
ATOM 5064   N N    . ARG B 2 45  ? -2.040  -24.616 -20.023 1.00 42.33 ? 45  ARG B N    1  
ATOM 5065   C CA   . ARG B 2 45  ? -2.642  -25.330 -18.885 1.00 74.21 ? 45  ARG B CA   1  
ATOM 5066   C C    . ARG B 2 45  ? -3.010  -26.735 -19.367 1.00 1.44  ? 45  ARG B C    1  
ATOM 5067   O O    . ARG B 2 45  ? -3.643  -26.881 -20.419 1.00 72.33 ? 45  ARG B O    1  
ATOM 5068   C CB   . ARG B 2 45  ? -3.896  -24.567 -18.357 1.00 41.44 ? 45  ARG B CB   1  
ATOM 5069   C CG   . ARG B 2 45  ? -3.641  -23.322 -17.448 1.00 21.22 ? 45  ARG B CG   1  
ATOM 5070   C CD   . ARG B 2 45  ? -2.767  -22.200 -18.068 1.00 22.35 ? 45  ARG B CD   1  
ATOM 5071   N NE   . ARG B 2 45  ? -1.320  -22.506 -18.023 1.00 34.53 ? 45  ARG B NE   1  
ATOM 5072   C CZ   . ARG B 2 45  ? -0.333  -21.644 -17.720 1.00 45.11 ? 45  ARG B CZ   1  
ATOM 5073   N NH1  . ARG B 2 45  ? -0.588  -20.379 -17.402 1.00 32.10 ? 45  ARG B NH1  1  
ATOM 5074   N NH2  . ARG B 2 45  ? 0.919   -22.079 -17.735 1.00 63.31 ? 45  ARG B NH2  1  
ATOM 5075   H H    . ARG B 2 45  ? -2.636  -24.146 -20.644 1.00 21.42 ? 45  ARG B H    1  
ATOM 5076   H HA   . ARG B 2 45  ? -1.903  -25.402 -18.085 1.00 54.13 ? 45  ARG B HA   1  
ATOM 5077   H HB2  . ARG B 2 45  ? -4.479  -24.237 -19.207 1.00 11.03 ? 45  ARG B HB2  1  
ATOM 5078   H HB3  . ARG B 2 45  ? -4.506  -25.265 -17.788 1.00 72.15 ? 45  ARG B HB3  1  
ATOM 5079   H HG2  . ARG B 2 45  ? -4.603  -22.891 -17.189 1.00 54.21 ? 45  ARG B HG2  1  
ATOM 5080   H HG3  . ARG B 2 45  ? -3.168  -23.665 -16.531 1.00 11.41 ? 45  ARG B HG3  1  
ATOM 5081   H HD2  . ARG B 2 45  ? -3.054  -22.064 -19.103 1.00 50.01 ? 45  ARG B HD2  1  
ATOM 5082   H HD3  . ARG B 2 45  ? -2.948  -21.277 -17.530 1.00 41.45 ? 45  ARG B HD3  1  
ATOM 5083   H HE   . ARG B 2 45  ? -1.070  -23.426 -18.218 1.00 71.32 ? 45  ARG B HE   1  
ATOM 5084   H HH11 . ARG B 2 45  ? -1.538  -20.038 -17.377 1.00 61.00 ? 45  ARG B HH11 1  
ATOM 5085   H HH12 . ARG B 2 45  ? 0.161   -19.756 -17.175 1.00 71.34 ? 45  ARG B HH12 1  
ATOM 5086   H HH21 . ARG B 2 45  ? 1.119   -23.032 -17.973 1.00 43.50 ? 45  ARG B HH21 1  
ATOM 5087   H HH22 . ARG B 2 45  ? 1.672   -21.453 -17.513 1.00 73.34 ? 45  ARG B HH22 1  
ATOM 5088   N N    . ARG B 2 46  ? -2.588  -27.773 -18.633 1.00 2.44  ? 46  ARG B N    1  
ATOM 5089   C CA   . ARG B 2 46  ? -2.922  -29.159 -18.990 1.00 54.35 ? 46  ARG B CA   1  
ATOM 5090   C C    . ARG B 2 46  ? -4.292  -29.484 -18.367 1.00 51.42 ? 46  ARG B C    1  
ATOM 5091   O O    . ARG B 2 46  ? -4.380  -30.040 -17.265 1.00 12.45 ? 46  ARG B O    1  
ATOM 5092   C CB   . ARG B 2 46  ? -1.779  -30.140 -18.540 1.00 64.12 ? 46  ARG B CB   1  
ATOM 5093   C CG   . ARG B 2 46  ? -1.697  -31.484 -19.325 1.00 35.32 ? 46  ARG B CG   1  
ATOM 5094   C CD   . ARG B 2 46  ? -2.853  -32.457 -19.033 1.00 75.02 ? 46  ARG B CD   1  
ATOM 5095   N NE   . ARG B 2 46  ? -2.917  -32.813 -17.607 1.00 31.23 ? 46  ARG B NE   1  
ATOM 5096   C CZ   . ARG B 2 46  ? -3.842  -33.597 -17.035 1.00 12.23 ? 46  ARG B CZ   1  
ATOM 5097   N NH1  . ARG B 2 46  ? -4.824  -34.142 -17.754 1.00 71.41 ? 46  ARG B NH1  1  
ATOM 5098   N NH2  . ARG B 2 46  ? -3.767  -33.825 -15.731 1.00 64.21 ? 46  ARG B NH2  1  
ATOM 5099   H H    . ARG B 2 46  ? -2.051  -27.606 -17.833 1.00 3.43  ? 46  ARG B H    1  
ATOM 5100   H HA   . ARG B 2 46  ? -3.019  -29.217 -20.078 1.00 21.21 ? 46  ARG B HA   1  
ATOM 5101   H HB2  . ARG B 2 46  ? -0.828  -29.633 -18.673 1.00 61.13 ? 46  ARG B HB2  1  
ATOM 5102   H HB3  . ARG B 2 46  ? -1.896  -30.366 -17.485 1.00 3.21  ? 46  ARG B HB3  1  
ATOM 5103   H HG2  . ARG B 2 46  ? -1.698  -31.264 -20.386 1.00 51.13 ? 46  ARG B HG2  1  
ATOM 5104   H HG3  . ARG B 2 46  ? -0.762  -31.972 -19.074 1.00 72.01 ? 46  ARG B HG3  1  
ATOM 5105   H HD2  . ARG B 2 46  ? -3.789  -31.994 -19.325 1.00 32.32 ? 46  ARG B HD2  1  
ATOM 5106   H HD3  . ARG B 2 46  ? -2.705  -33.360 -19.614 1.00 45.54 ? 46  ARG B HD3  1  
ATOM 5107   H HE   . ARG B 2 46  ? -2.216  -32.437 -17.033 1.00 4.02  ? 46  ARG B HE   1  
ATOM 5108   H HH11 . ARG B 2 46  ? -4.888  -33.968 -18.743 1.00 73.52 ? 46  ARG B HH11 1  
ATOM 5109   H HH12 . ARG B 2 46  ? -5.509  -34.724 -17.314 1.00 32.12 ? 46  ARG B HH12 1  
ATOM 5110   H HH21 . ARG B 2 46  ? -3.021  -33.416 -15.194 1.00 12.33 ? 46  ARG B HH21 1  
ATOM 5111   H HH22 . ARG B 2 46  ? -4.442  -34.411 -15.277 1.00 42.45 ? 46  ARG B HH22 1  
ATOM 5112   N N    . LEU B 2 47  ? -5.357  -29.043 -19.059 1.00 45.31 ? 47  LEU B N    1  
ATOM 5113   C CA   . LEU B 2 47  ? -6.741  -29.336 -18.687 1.00 53.22 ? 47  LEU B CA   1  
ATOM 5114   C C    . LEU B 2 47  ? -7.426  -29.997 -19.890 1.00 50.31 ? 47  LEU B C    1  
ATOM 5115   O O    . LEU B 2 47  ? -7.770  -29.316 -20.868 1.00 24.24 ? 47  LEU B O    1  
ATOM 5116   C CB   . LEU B 2 47  ? -7.481  -28.033 -18.239 1.00 24.33 ? 47  LEU B CB   1  
ATOM 5117   C CG   . LEU B 2 47  ? -8.852  -28.214 -17.483 1.00 41.22 ? 47  LEU B CG   1  
ATOM 5118   C CD1  . LEU B 2 47  ? -10.012 -28.664 -18.415 1.00 3.33  ? 47  LEU B CD1  1  
ATOM 5119   C CD2  . LEU B 2 47  ? -8.706  -29.186 -16.287 1.00 33.24 ? 47  LEU B CD2  1  
ATOM 5120   H H    . LEU B 2 47  ? -5.203  -28.488 -19.855 1.00 72.13 ? 47  LEU B H    1  
ATOM 5121   H HA   . LEU B 2 47  ? -6.736  -30.043 -17.851 1.00 42.11 ? 47  LEU B HA   1  
ATOM 5122   H HB2  . LEU B 2 47  ? -6.810  -27.483 -17.586 1.00 24.40 ? 47  LEU B HB2  1  
ATOM 5123   H HB3  . LEU B 2 47  ? -7.656  -27.423 -19.120 1.00 63.22 ? 47  LEU B HB3  1  
ATOM 5124   H HG   . LEU B 2 47  ? -9.139  -27.249 -17.074 1.00 54.34 ? 47  LEU B HG   1  
ATOM 5125   H HD11 . LEU B 2 47  ? -10.934 -28.714 -17.854 1.00 53.10 ? 47  LEU B HD11 1  
ATOM 5126   H HD12 . LEU B 2 47  ? -9.796  -29.641 -18.831 1.00 70.21 ? 47  LEU B HD12 1  
ATOM 5127   H HD13 . LEU B 2 47  ? -10.127 -27.953 -19.224 1.00 61.11 ? 47  LEU B HD13 1  
ATOM 5128   H HD21 . LEU B 2 47  ? -9.637  -29.226 -15.735 1.00 40.23 ? 47  LEU B HD21 1  
ATOM 5129   H HD22 . LEU B 2 47  ? -7.923  -28.843 -15.626 1.00 52.24 ? 47  LEU B HD22 1  
ATOM 5130   H HD23 . LEU B 2 47  ? -8.461  -30.178 -16.644 1.00 33.25 ? 47  LEU B HD23 1  
ATOM 5131   N N    . THR B 2 48  ? -7.546  -31.324 -19.805 1.00 21.10 ? 48  THR B N    1  
ATOM 5132   C CA   . THR B 2 48  ? -8.355  -32.158 -20.708 1.00 45.35 ? 48  THR B CA   1  
ATOM 5133   C C    . THR B 2 48  ? -8.221  -33.627 -20.253 1.00 51.22 ? 48  THR B C    1  
ATOM 5134   O O    . THR B 2 48  ? -7.406  -33.931 -19.362 1.00 21.11 ? 48  THR B O    1  
ATOM 5135   C CB   . THR B 2 48  ? -7.981  -32.008 -22.235 1.00 3.32  ? 48  THR B CB   1  
ATOM 5136   O OG1  . THR B 2 48  ? -8.998  -32.621 -23.047 1.00 30.42 ? 48  THR B OG1  1  
ATOM 5137   C CG2  . THR B 2 48  ? -6.607  -32.617 -22.589 1.00 14.20 ? 48  THR B CG2  1  
ATOM 5138   H H    . THR B 2 48  ? -7.059  -31.779 -19.084 1.00 23.11 ? 48  THR B H    1  
ATOM 5139   H HA   . THR B 2 48  ? -9.394  -31.858 -20.577 1.00 54.21 ? 48  THR B HA   1  
ATOM 5140   H HB   . THR B 2 48  ? -7.955  -30.949 -22.470 1.00 73.12 ? 48  THR B HB   1  
ATOM 5141   H HG1  . THR B 2 48  ? -9.743  -32.014 -23.127 1.00 4.24  ? 48  THR B HG1  1  
ATOM 5142   H HG21 . THR B 2 48  ? -6.615  -33.681 -22.381 1.00 14.40 ? 48  THR B HG21 1  
ATOM 5143   H HG22 . THR B 2 48  ? -5.834  -32.146 -22.001 1.00 25.22 ? 48  THR B HG22 1  
ATOM 5144   H HG23 . THR B 2 48  ? -6.401  -32.461 -23.641 1.00 41.03 ? 48  THR B HG23 1  
ATOM 5145   N N    . GLY B 2 49  ? -9.023  -34.528 -20.849 1.00 30.23 ? 49  GLY B N    1  
ATOM 5146   C CA   . GLY B 2 49  ? -8.972  -35.955 -20.519 1.00 74.15 ? 49  GLY B CA   1  
ATOM 5147   C C    . GLY B 2 49  ? -10.342 -36.601 -20.595 1.00 44.23 ? 49  GLY B C    1  
ATOM 5148   O O    . GLY B 2 49  ? -11.365 -35.909 -20.482 1.00 42.20 ? 49  GLY B O    1  
ATOM 5149   H H    . GLY B 2 49  ? -9.661  -34.220 -21.527 1.00 0.14  ? 49  GLY B H    1  
ATOM 5150   H HA2  . GLY B 2 49  ? -8.310  -36.449 -21.220 1.00 3.15  ? 49  GLY B HA2  1  
ATOM 5151   H HA3  . GLY B 2 49  ? -8.578  -36.090 -19.517 1.00 51.43 ? 49  GLY B HA3  1  
ATOM 5152   N N    . ASP B 2 50  ? -10.362 -37.941 -20.768 1.00 51.52 ? 50  ASP B N    1  
ATOM 5153   C CA   . ASP B 2 50  ? -11.602 -38.746 -20.858 1.00 32.04 ? 50  ASP B CA   1  
ATOM 5154   C C    . ASP B 2 50  ? -12.139 -39.072 -19.442 1.00 50.10 ? 50  ASP B C    1  
ATOM 5155   O O    . ASP B 2 50  ? -12.397 -40.241 -19.118 1.00 64.20 ? 50  ASP B O    1  
ATOM 5156   C CB   . ASP B 2 50  ? -11.341 -40.057 -21.669 1.00 4.51  ? 50  ASP B CB   1  
ATOM 5157   C CG   . ASP B 2 50  ? -10.968 -39.805 -23.139 1.00 55.55 ? 50  ASP B CG   1  
ATOM 5158   O OD1  . ASP B 2 50  ? -9.758  -39.830 -23.482 1.00 63.13 ? 50  ASP B OD1  1  
ATOM 5159   O OD2  . ASP B 2 50  ? -11.883 -39.558 -23.961 1.00 63.15 ? 50  ASP B OD2  1  
ATOM 5160   H H    . ASP B 2 50  ? -9.507  -38.409 -20.839 1.00 24.43 ? 50  ASP B H    1  
ATOM 5161   H HA   . ASP B 2 50  ? -12.354 -38.155 -21.379 1.00 60.21 ? 50  ASP B HA   1  
ATOM 5162   H HB2  . ASP B 2 50  ? -10.536 -40.613 -21.195 1.00 41.34 ? 50  ASP B HB2  1  
ATOM 5163   H HB3  . ASP B 2 50  ? -12.235 -40.672 -21.647 1.00 33.22 ? 50  ASP B HB3  1  
ATOM 5164   N N    . GLN B 2 51  ? -12.341 -38.002 -18.634 1.00 21.35 ? 51  GLN B N    1  
ATOM 5165   C CA   . GLN B 2 51  ? -12.724 -38.058 -17.205 1.00 3.11  ? 51  GLN B CA   1  
ATOM 5166   C C    . GLN B 2 51  ? -11.594 -38.663 -16.339 1.00 64.22 ? 51  GLN B C    1  
ATOM 5167   O O    . GLN B 2 51  ? -11.067 -39.745 -16.639 1.00 34.51 ? 51  GLN B O    1  
ATOM 5168   C CB   . GLN B 2 51  ? -14.071 -38.811 -16.979 1.00 24.23 ? 51  GLN B CB   1  
ATOM 5169   C CG   . GLN B 2 51  ? -14.591 -38.758 -15.527 1.00 21.00 ? 51  GLN B CG   1  
ATOM 5170   C CD   . GLN B 2 51  ? -15.010 -37.354 -15.060 1.00 43.31 ? 51  GLN B CD   1  
ATOM 5171   O OE1  . GLN B 2 51  ? -14.818 -36.990 -13.900 1.00 75.30 ? 51  GLN B OE1  1  
ATOM 5172   N NE2  . GLN B 2 51  ? -15.638 -36.580 -15.940 1.00 44.14 ? 51  GLN B NE2  1  
ATOM 5173   H H    . GLN B 2 51  ? -12.238 -37.115 -19.029 1.00 63.14 ? 51  GLN B H    1  
ATOM 5174   H HA   . GLN B 2 51  ? -12.857 -37.024 -16.900 1.00 60.43 ? 51  GLN B HA   1  
ATOM 5175   H HB2  . GLN B 2 51  ? -14.823 -38.371 -17.623 1.00 22.44 ? 51  GLN B HB2  1  
ATOM 5176   H HB3  . GLN B 2 51  ? -13.945 -39.851 -17.260 1.00 3.22  ? 51  GLN B HB3  1  
ATOM 5177   H HG2  . GLN B 2 51  ? -15.457 -39.408 -15.449 1.00 42.12 ? 51  GLN B HG2  1  
ATOM 5178   H HG3  . GLN B 2 51  ? -13.818 -39.133 -14.864 1.00 3.13  ? 51  GLN B HG3  1  
ATOM 5179   H HE21 . GLN B 2 51  ? -15.809 -36.930 -16.840 1.00 62.13 ? 51  GLN B HE21 1  
ATOM 5180   H HE22 . GLN B 2 51  ? -15.900 -35.684 -15.653 1.00 2.01  ? 51  GLN B HE22 1  
ATOM 5181   N N    . THR B 2 52  ? -11.228 -37.955 -15.261 1.00 1.21  ? 52  THR B N    1  
ATOM 5182   C CA   . THR B 2 52  ? -10.162 -38.377 -14.343 1.00 1.41  ? 52  THR B CA   1  
ATOM 5183   C C    . THR B 2 52  ? -10.502 -37.909 -12.922 1.00 0.24  ? 52  THR B C    1  
ATOM 5184   O O    . THR B 2 52  ? -10.386 -36.713 -12.622 1.00 34.21 ? 52  THR B O    1  
ATOM 5185   C CB   . THR B 2 52  ? -8.772  -37.815 -14.796 1.00 71.20 ? 52  THR B CB   1  
ATOM 5186   O OG1  . THR B 2 52  ? -8.458  -38.306 -16.117 1.00 73.31 ? 52  THR B OG1  1  
ATOM 5187   C CG2  . THR B 2 52  ? -7.632  -38.196 -13.829 1.00 11.12 ? 52  THR B CG2  1  
ATOM 5188   H H    . THR B 2 52  ? -11.699 -37.116 -15.067 1.00 52.11 ? 52  THR B H    1  
ATOM 5189   H HA   . THR B 2 52  ? -10.108 -39.467 -14.353 1.00 62.51 ? 52  THR B HA   1  
ATOM 5190   H HB   . THR B 2 52  ? -8.838  -36.728 -14.846 1.00 50.22 ? 52  THR B HB   1  
ATOM 5191   H HG1  . THR B 2 52  ? -8.979  -39.100 -16.301 1.00 63.04 ? 52  THR B HG1  1  
ATOM 5192   H HG21 . THR B 2 52  ? -6.692  -37.803 -14.199 1.00 71.34 ? 52  THR B HG21 1  
ATOM 5193   H HG22 . THR B 2 52  ? -7.559  -39.273 -13.753 1.00 1.20  ? 52  THR B HG22 1  
ATOM 5194   H HG23 . THR B 2 52  ? -7.827  -37.780 -12.849 1.00 13.30 ? 52  THR B HG23 1  
ATOM 5195   N N    . ALA B 2 53  ? -10.973 -38.864 -12.092 1.00 53.22 ? 53  ALA B N    1  
ATOM 5196   C CA   . ALA B 2 53  ? -11.320 -38.654 -10.670 1.00 54.32 ? 53  ALA B CA   1  
ATOM 5197   C C    . ALA B 2 53  ? -12.493 -37.661 -10.472 1.00 73.24 ? 53  ALA B C    1  
ATOM 5198   O O    . ALA B 2 53  ? -12.974 -37.029 -11.423 1.00 61.22 ? 53  ALA B O    1  
ATOM 5199   C CB   . ALA B 2 53  ? -10.085 -38.239 -9.844  1.00 11.12 ? 53  ALA B CB   1  
ATOM 5200   H H    . ALA B 2 53  ? -11.097 -39.763 -12.463 1.00 1.22  ? 53  ALA B H    1  
ATOM 5201   H HA   . ALA B 2 53  ? -11.644 -39.621 -10.299 1.00 54.33 ? 53  ALA B HA   1  
ATOM 5202   H HB1  . ALA B 2 53  ? -9.736  -37.266 -10.167 1.00 42.11 ? 53  ALA B HB1  1  
ATOM 5203   H HB2  . ALA B 2 53  ? -9.296  -38.965 -9.983  1.00 2.31  ? 53  ALA B HB2  1  
ATOM 5204   H HB3  . ALA B 2 53  ? -10.348 -38.195 -8.795  1.00 33.04 ? 53  ALA B HB3  1  
ATOM 5205   N N    . ALA B 2 54  ? -12.990 -37.611 -9.220  1.00 1.35  ? 54  ALA B N    1  
ATOM 5206   C CA   . ALA B 2 54  ? -14.059 -36.690 -8.761  1.00 21.15 ? 54  ALA B CA   1  
ATOM 5207   C C    . ALA B 2 54  ? -15.466 -37.056 -9.287  1.00 24.22 ? 54  ALA B C    1  
ATOM 5208   O O    . ALA B 2 54  ? -16.446 -36.579 -8.740  1.00 75.51 ? 54  ALA B O    1  
ATOM 5209   C CB   . ALA B 2 54  ? -13.723 -35.210 -9.053  1.00 21.24 ? 54  ALA B CB   1  
ATOM 5210   H H    . ALA B 2 54  ? -12.619 -38.235 -8.565  1.00 22.11 ? 54  ALA B H    1  
ATOM 5211   H HA   . ALA B 2 54  ? -14.087 -36.795 -7.683  1.00 50.41 ? 54  ALA B HA   1  
ATOM 5212   H HB1  . ALA B 2 54  ? -12.743 -34.974 -8.656  1.00 72.14 ? 54  ALA B HB1  1  
ATOM 5213   H HB2  . ALA B 2 54  ? -14.457 -34.562 -8.589  1.00 11.03 ? 54  ALA B HB2  1  
ATOM 5214   H HB3  . ALA B 2 54  ? -13.723 -35.040 -10.123 1.00 43.44 ? 54  ALA B HB3  1  
ATOM 5215   N N    . LEU B 2 55  ? -15.568 -37.896 -10.332 1.00 70.45 ? 55  LEU B N    1  
ATOM 5216   C CA   . LEU B 2 55  ? -16.860 -38.371 -10.860 1.00 21.20 ? 55  LEU B CA   1  
ATOM 5217   C C    . LEU B 2 55  ? -17.596 -39.194 -9.776  1.00 63.22 ? 55  LEU B C    1  
ATOM 5218   O O    . LEU B 2 55  ? -16.986 -40.082 -9.164  1.00 41.41 ? 55  LEU B O    1  
ATOM 5219   C CB   . LEU B 2 55  ? -16.632 -39.210 -12.145 1.00 61.14 ? 55  LEU B CB   1  
ATOM 5220   C CG   . LEU B 2 55  ? -17.915 -39.675 -12.907 1.00 72.35 ? 55  LEU B CG   1  
ATOM 5221   C CD1  . LEU B 2 55  ? -18.790 -38.473 -13.351 1.00 5.40  ? 55  LEU B CD1  1  
ATOM 5222   C CD2  . LEU B 2 55  ? -17.545 -40.568 -14.115 1.00 22.34 ? 55  LEU B CD2  1  
ATOM 5223   H H    . LEU B 2 55  ? -14.755 -38.200 -10.767 1.00 52.30 ? 55  LEU B H    1  
ATOM 5224   H HA   . LEU B 2 55  ? -17.457 -37.498 -11.114 1.00 42.23 ? 55  LEU B HA   1  
ATOM 5225   H HB2  . LEU B 2 55  ? -16.031 -38.618 -12.827 1.00 45.12 ? 55  LEU B HB2  1  
ATOM 5226   H HB3  . LEU B 2 55  ? -16.058 -40.092 -11.877 1.00 71.41 ? 55  LEU B HB3  1  
ATOM 5227   H HG   . LEU B 2 55  ? -18.515 -40.274 -12.233 1.00 22.11 ? 55  LEU B HG   1  
ATOM 5228   H HD11 . LEU B 2 55  ? -18.226 -37.823 -14.011 1.00 54.13 ? 55  LEU B HD11 1  
ATOM 5229   H HD12 . LEU B 2 55  ? -19.106 -37.911 -12.483 1.00 1.40  ? 55  LEU B HD12 1  
ATOM 5230   H HD13 . LEU B 2 55  ? -19.668 -38.835 -13.871 1.00 43.04 ? 55  LEU B HD13 1  
ATOM 5231   H HD21 . LEU B 2 55  ? -16.972 -41.420 -13.773 1.00 71.22 ? 55  LEU B HD21 1  
ATOM 5232   H HD22 . LEU B 2 55  ? -16.955 -40.005 -14.827 1.00 13.35 ? 55  LEU B HD22 1  
ATOM 5233   H HD23 . LEU B 2 55  ? -18.446 -40.921 -14.597 1.00 55.21 ? 55  LEU B HD23 1  
ATOM 5234   N N    . ARG B 2 56  ? -18.882 -38.832 -9.524  1.00 5.41  ? 56  ARG B N    1  
ATOM 5235   C CA   . ARG B 2 56  ? -19.755 -39.401 -8.455  1.00 43.01 ? 56  ARG B CA   1  
ATOM 5236   C C    . ARG B 2 56  ? -19.423 -38.817 -7.061  1.00 73.20 ? 56  ARG B C    1  
ATOM 5237   O O    . ARG B 2 56  ? -20.332 -38.467 -6.303  1.00 62.22 ? 56  ARG B O    1  
ATOM 5238   C CB   . ARG B 2 56  ? -19.741 -40.962 -8.401  1.00 21.30 ? 56  ARG B CB   1  
ATOM 5239   C CG   . ARG B 2 56  ? -20.281 -41.670 -9.663  1.00 3.22  ? 56  ARG B CG   1  
ATOM 5240   C CD   . ARG B 2 56  ? -21.758 -41.339 -9.945  1.00 63.21 ? 56  ARG B CD   1  
ATOM 5241   N NE   . ARG B 2 56  ? -22.633 -41.677 -8.804  1.00 32.44 ? 56  ARG B NE   1  
ATOM 5242   C CZ   . ARG B 2 56  ? -23.965 -41.500 -8.769  1.00 61.44 ? 56  ARG B CZ   1  
ATOM 5243   N NH1  . ARG B 2 56  ? -24.620 -40.984 -9.806  1.00 51.23 ? 56  ARG B NH1  1  
ATOM 5244   N NH2  . ARG B 2 56  ? -24.634 -41.841 -7.679  1.00 45.35 ? 56  ARG B NH2  1  
ATOM 5245   H H    . ARG B 2 56  ? -19.268 -38.131 -10.089 1.00 24.11 ? 56  ARG B H    1  
ATOM 5246   H HA   . ARG B 2 56  ? -20.761 -39.085 -8.704  1.00 73.11 ? 56  ARG B HA   1  
ATOM 5247   H HB2  . ARG B 2 56  ? -18.719 -41.292 -8.245  1.00 0.24  ? 56  ARG B HB2  1  
ATOM 5248   H HB3  . ARG B 2 56  ? -20.336 -41.290 -7.553  1.00 71.23 ? 56  ARG B HB3  1  
ATOM 5249   H HG2  . ARG B 2 56  ? -19.685 -41.363 -10.518 1.00 34.34 ? 56  ARG B HG2  1  
ATOM 5250   H HG3  . ARG B 2 56  ? -20.180 -42.742 -9.531  1.00 51.22 ? 56  ARG B HG3  1  
ATOM 5251   H HD2  . ARG B 2 56  ? -21.846 -40.279 -10.156 1.00 10.14 ? 56  ARG B HD2  1  
ATOM 5252   H HD3  . ARG B 2 56  ? -22.080 -41.901 -10.815 1.00 14.15 ? 56  ARG B HD3  1  
ATOM 5253   H HE   . ARG B 2 56  ? -22.197 -42.067 -8.010  1.00 74.21 ? 56  ARG B HE   1  
ATOM 5254   H HH11 . ARG B 2 56  ? -24.124 -40.719 -10.640 1.00 71.14 ? 56  ARG B HH11 1  
ATOM 5255   H HH12 . ARG B 2 56  ? -25.614 -40.858 -9.761  1.00 22.03 ? 56  ARG B HH12 1  
ATOM 5256   H HH21 . ARG B 2 56  ? -24.149 -42.230 -6.892  1.00 41.35 ? 56  ARG B HH21 1  
ATOM 5257   H HH22 . ARG B 2 56  ? -25.629 -41.715 -7.637  1.00 71.50 ? 56  ARG B HH22 1  
ATOM 5258   N N    . ASP B 2 57  ? -18.124 -38.739 -6.723  1.00 3.45  ? 57  ASP B N    1  
ATOM 5259   C CA   . ASP B 2 57  ? -17.650 -38.205 -5.428  1.00 75.31 ? 57  ASP B CA   1  
ATOM 5260   C C    . ASP B 2 57  ? -17.900 -36.679 -5.362  1.00 15.43 ? 57  ASP B C    1  
ATOM 5261   O O    . ASP B 2 57  ? -18.767 -36.216 -4.609  1.00 60.21 ? 57  ASP B O    1  
ATOM 5262   C CB   . ASP B 2 57  ? -16.137 -38.541 -5.252  1.00 15.12 ? 57  ASP B CB   1  
ATOM 5263   C CG   . ASP B 2 57  ? -15.578 -38.163 -3.869  1.00 71.43 ? 57  ASP B CG   1  
ATOM 5264   O OD1  . ASP B 2 57  ? -15.277 -36.972 -3.647  1.00 72.30 ? 57  ASP B OD1  1  
ATOM 5265   O OD2  . ASP B 2 57  ? -15.421 -39.058 -3.006  1.00 5.12  ? 57  ASP B OD2  1  
ATOM 5266   H H    . ASP B 2 57  ? -17.458 -39.057 -7.358  1.00 22.45 ? 57  ASP B H    1  
ATOM 5267   H HA   . ASP B 2 57  ? -18.216 -38.694 -4.638  1.00 54.20 ? 57  ASP B HA   1  
ATOM 5268   H HB2  . ASP B 2 57  ? -15.995 -39.605 -5.406  1.00 72.31 ? 57  ASP B HB2  1  
ATOM 5269   H HB3  . ASP B 2 57  ? -15.567 -38.009 -6.011  1.00 3.14  ? 57  ASP B HB3  1  
ATOM 5270   N N    . SER B 2 58  ? -17.094 -35.925 -6.142  1.00 61.13 ? 58  SER B N    1  
ATOM 5271   C CA   . SER B 2 58  ? -17.278 -34.481 -6.407  1.00 32.10 ? 58  SER B CA   1  
ATOM 5272   C C    . SER B 2 58  ? -17.089 -33.577 -5.153  1.00 23.34 ? 58  SER B C    1  
ATOM 5273   O O    . SER B 2 58  ? -17.260 -32.355 -5.254  1.00 42.00 ? 58  SER B O    1  
ATOM 5274   C CB   . SER B 2 58  ? -18.668 -34.253 -7.063  1.00 62.01 ? 58  SER B CB   1  
ATOM 5275   O OG   . SER B 2 58  ? -18.845 -35.054 -8.220  1.00 31.12 ? 58  SER B OG   1  
ATOM 5276   H H    . SER B 2 58  ? -16.334 -36.361 -6.566  1.00 50.51 ? 58  SER B H    1  
ATOM 5277   H HA   . SER B 2 58  ? -16.515 -34.205 -7.128  1.00 4.13  ? 58  SER B HA   1  
ATOM 5278   H HB2  . SER B 2 58  ? -19.447 -34.506 -6.355  1.00 53.30 ? 58  SER B HB2  1  
ATOM 5279   H HB3  . SER B 2 58  ? -18.771 -33.213 -7.346  1.00 35.11 ? 58  SER B HB3  1  
ATOM 5280   H HG   . SER B 2 58  ? -18.181 -35.745 -8.226  1.00 55.15 ? 58  SER B HG   1  
ATOM 5281   N N    . LEU B 2 59  ? -16.682 -34.187 -4.008  1.00 71.31 ? 59  LEU B N    1  
ATOM 5282   C CA   . LEU B 2 59  ? -16.633 -33.537 -2.681  1.00 22.22 ? 59  LEU B CA   1  
ATOM 5283   C C    . LEU B 2 59  ? -18.027 -33.008 -2.290  1.00 72.44 ? 59  LEU B C    1  
ATOM 5284   O O    . LEU B 2 59  ? -18.433 -31.918 -2.700  1.00 52.11 ? 59  LEU B O    1  
ATOM 5285   C CB   . LEU B 2 59  ? -15.554 -32.410 -2.595  1.00 12.21 ? 59  LEU B CB   1  
ATOM 5286   C CG   . LEU B 2 59  ? -15.441 -31.669 -1.213  1.00 51.54 ? 59  LEU B CG   1  
ATOM 5287   C CD1  . LEU B 2 59  ? -15.066 -32.639 -0.067  1.00 31.22 ? 59  LEU B CD1  1  
ATOM 5288   C CD2  . LEU B 2 59  ? -14.452 -30.480 -1.285  1.00 11.42 ? 59  LEU B CD2  1  
ATOM 5289   H H    . LEU B 2 59  ? -16.404 -35.125 -4.064  1.00 22.34 ? 59  LEU B H    1  
ATOM 5290   H HA   . LEU B 2 59  ? -16.362 -34.317 -1.974  1.00 64.50 ? 59  LEU B HA   1  
ATOM 5291   H HB2  . LEU B 2 59  ? -14.589 -32.846 -2.833  1.00 53.41 ? 59  LEU B HB2  1  
ATOM 5292   H HB3  . LEU B 2 59  ? -15.784 -31.673 -3.358  1.00 43.10 ? 59  LEU B HB3  1  
ATOM 5293   H HG   . LEU B 2 59  ? -16.417 -31.260 -0.972  1.00 24.01 ? 59  LEU B HG   1  
ATOM 5294   H HD11 . LEU B 2 59  ? -15.822 -33.408 0.022   1.00 2.52  ? 59  LEU B HD11 1  
ATOM 5295   H HD12 . LEU B 2 59  ? -15.009 -32.096 0.868   1.00 53.52 ? 59  LEU B HD12 1  
ATOM 5296   H HD13 . LEU B 2 59  ? -14.107 -33.101 -0.270  1.00 71.31 ? 59  LEU B HD13 1  
ATOM 5297   H HD21 . LEU B 2 59  ? -14.419 -29.980 -0.325  1.00 33.51 ? 59  LEU B HD21 1  
ATOM 5298   H HD22 . LEU B 2 59  ? -14.782 -29.774 -2.034  1.00 72.12 ? 59  LEU B HD22 1  
ATOM 5299   H HD23 . LEU B 2 59  ? -13.460 -30.833 -1.538  1.00 64.43 ? 59  LEU B HD23 1  
ATOM 5300   N N    . SER B 2 60  ? -18.767 -33.809 -1.530  1.00 21.33 ? 60  SER B N    1  
ATOM 5301   C CA   . SER B 2 60  ? -20.087 -33.428 -1.024  1.00 63.10 ? 60  SER B CA   1  
ATOM 5302   C C    . SER B 2 60  ? -19.931 -32.483 0.187   1.00 24.21 ? 60  SER B C    1  
ATOM 5303   O O    . SER B 2 60  ? -19.751 -32.945 1.317   1.00 22.35 ? 60  SER B O    1  
ATOM 5304   C CB   . SER B 2 60  ? -20.885 -34.697 -0.647  1.00 0.12  ? 60  SER B CB   1  
ATOM 5305   O OG   . SER B 2 60  ? -21.004 -35.579 -1.757  1.00 63.51 ? 60  SER B OG   1  
ATOM 5306   H H    . SER B 2 60  ? -18.415 -34.690 -1.303  1.00 71.05 ? 60  SER B H    1  
ATOM 5307   H HA   . SER B 2 60  ? -20.620 -32.906 -1.816  1.00 71.31 ? 60  SER B HA   1  
ATOM 5308   H HB2  . SER B 2 60  ? -20.376 -35.222 0.152   1.00 0.25  ? 60  SER B HB2  1  
ATOM 5309   H HB3  . SER B 2 60  ? -21.878 -34.420 -0.318  1.00 11.32 ? 60  SER B HB3  1  
ATOM 5310   H HG   . SER B 2 60  ? -20.388 -35.312 -2.448  1.00 54.34 ? 60  SER B HG   1  
ATOM 5311   N N    . ASP B 2 61  ? -19.898 -31.162 -0.080  1.00 40.33 ? 61  ASP B N    1  
ATOM 5312   C CA   . ASP B 2 61  ? -19.925 -30.125 0.969   1.00 70.20 ? 61  ASP B CA   1  
ATOM 5313   C C    . ASP B 2 61  ? -21.220 -29.308 0.859   1.00 1.31  ? 61  ASP B C    1  
ATOM 5314   O O    . ASP B 2 61  ? -21.759 -29.143 -0.247  1.00 71.45 ? 61  ASP B O    1  
ATOM 5315   C CB   . ASP B 2 61  ? -18.669 -29.210 0.890   1.00 2.30  ? 61  ASP B CB   1  
ATOM 5316   C CG   . ASP B 2 61  ? -18.576 -28.367 -0.395  1.00 23.23 ? 61  ASP B CG   1  
ATOM 5317   O OD1  . ASP B 2 61  ? -18.911 -27.160 -0.360  1.00 2.04  ? 61  ASP B OD1  1  
ATOM 5318   O OD2  . ASP B 2 61  ? -18.180 -28.913 -1.452  1.00 32.43 ? 61  ASP B OD2  1  
ATOM 5319   H H    . ASP B 2 61  ? -19.843 -30.876 -1.016  1.00 31.21 ? 61  ASP B H    1  
ATOM 5320   H HA   . ASP B 2 61  ? -19.920 -30.628 1.938   1.00 14.02 ? 61  ASP B HA   1  
ATOM 5321   H HB2  . ASP B 2 61  ? -18.663 -28.542 1.748   1.00 13.44 ? 61  ASP B HB2  1  
ATOM 5322   H HB3  . ASP B 2 61  ? -17.783 -29.837 0.952   1.00 41.00 ? 61  ASP B HB3  1  
ATOM 5323   N N    . LYS B 2 62  ? -21.703 -28.821 2.029   1.00 54.00 ? 62  LYS B N    1  
ATOM 5324   C CA   . LYS B 2 62  ? -22.960 -28.050 2.194   1.00 4.11  ? 62  LYS B CA   1  
ATOM 5325   C C    . LYS B 2 62  ? -24.215 -28.966 2.098   1.00 14.13 ? 62  LYS B C    1  
ATOM 5326   O O    . LYS B 2 62  ? -24.232 -29.910 1.295   1.00 71.54 ? 62  LYS B O    1  
ATOM 5327   C CB   . LYS B 2 62  ? -23.051 -26.832 1.215   1.00 72.30 ? 62  LYS B CB   1  
ATOM 5328   C CG   . LYS B 2 62  ? -21.912 -25.766 1.338   1.00 0.15  ? 62  LYS B CG   1  
ATOM 5329   C CD   . LYS B 2 62  ? -22.066 -24.789 2.540   1.00 31.31 ? 62  LYS B CD   1  
ATOM 5330   C CE   . LYS B 2 62  ? -21.726 -25.399 3.913   1.00 4.13  ? 62  LYS B CE   1  
ATOM 5331   N NZ   . LYS B 2 62  ? -21.891 -24.415 5.016   1.00 43.24 ? 62  LYS B NZ   1  
ATOM 5332   H H    . LYS B 2 62  ? -21.183 -28.999 2.839   1.00 14.12 ? 62  LYS B H    1  
ATOM 5333   H HA   . LYS B 2 62  ? -22.926 -27.663 3.204   1.00 41.10 ? 62  LYS B HA   1  
ATOM 5334   H HB2  . LYS B 2 62  ? -23.041 -27.210 0.198   1.00 2.32  ? 62  LYS B HB2  1  
ATOM 5335   H HB3  . LYS B 2 62  ? -23.998 -26.329 1.377   1.00 22.43 ? 62  LYS B HB3  1  
ATOM 5336   H HG2  . LYS B 2 62  ? -20.963 -26.278 1.425   1.00 60.02 ? 62  LYS B HG2  1  
ATOM 5337   H HG3  . LYS B 2 62  ? -21.902 -25.179 0.423   1.00 62.25 ? 62  LYS B HG3  1  
ATOM 5338   H HD2  . LYS B 2 62  ? -21.409 -23.940 2.379   1.00 42.44 ? 62  LYS B HD2  1  
ATOM 5339   H HD3  . LYS B 2 62  ? -23.089 -24.432 2.563   1.00 5.04  ? 62  LYS B HD3  1  
ATOM 5340   H HE2  . LYS B 2 62  ? -22.387 -26.236 4.100   1.00 32.35 ? 62  LYS B HE2  1  
ATOM 5341   H HE3  . LYS B 2 62  ? -20.702 -25.752 3.906   1.00 52.14 ? 62  LYS B HE3  1  
ATOM 5342   H HZ1  . LYS B 2 62  ? -22.882 -24.103 5.070   1.00 72.42 ? 62  LYS B HZ1  1  
ATOM 5343   H HZ2  . LYS B 2 62  ? -21.288 -23.585 4.849   1.00 34.11 ? 62  LYS B HZ2  1  
ATOM 5344   H HZ3  . LYS B 2 62  ? -21.625 -24.845 5.923   1.00 62.43 ? 62  LYS B HZ3  1  
ATOM 5345   N N    . PRO B 2 63  ? -25.278 -28.713 2.945   1.00 63.15 ? 63  PRO B N    1  
ATOM 5346   C CA   . PRO B 2 63  ? -26.508 -29.554 2.987   1.00 15.21 ? 63  PRO B CA   1  
ATOM 5347   C C    . PRO B 2 63  ? -27.347 -29.401 1.699   1.00 63.14 ? 63  PRO B C    1  
ATOM 5348   O O    . PRO B 2 63  ? -28.182 -28.484 1.590   1.00 0.22  ? 63  PRO B O    1  
ATOM 5349   C CB   . PRO B 2 63  ? -27.248 -29.028 4.244   1.00 24.10 ? 63  PRO B CB   1  
ATOM 5350   C CG   . PRO B 2 63  ? -26.803 -27.605 4.374   1.00 10.24 ? 63  PRO B CG   1  
ATOM 5351   C CD   . PRO B 2 63  ? -25.361 -27.585 3.920   1.00 72.24 ? 63  PRO B CD   1  
ATOM 5352   H HA   . PRO B 2 63  ? -26.259 -30.607 3.126   1.00 5.35  ? 63  PRO B HA   1  
ATOM 5353   H HB2  . PRO B 2 63  ? -28.327 -29.092 4.112   1.00 64.31 ? 63  PRO B HB2  1  
ATOM 5354   H HB3  . PRO B 2 63  ? -26.952 -29.594 5.120   1.00 62.41 ? 63  PRO B HB3  1  
ATOM 5355   H HG2  . PRO B 2 63  ? -27.415 -26.966 3.737   1.00 11.02 ? 63  PRO B HG2  1  
ATOM 5356   H HG3  . PRO B 2 63  ? -26.877 -27.280 5.405   1.00 71.22 ? 63  PRO B HG3  1  
ATOM 5357   H HD2  . PRO B 2 63  ? -25.127 -26.642 3.437   1.00 44.13 ? 63  PRO B HD2  1  
ATOM 5358   H HD3  . PRO B 2 63  ? -24.692 -27.751 4.756   1.00 23.30 ? 63  PRO B HD3  1  
ATOM 5359   N N    . ALA B 2 64  ? -27.048 -30.283 0.722   1.00 22.52 ? 64  ALA B N    1  
ATOM 5360   C CA   . ALA B 2 64  ? -27.572 -30.247 -0.665  1.00 42.11 ? 64  ALA B CA   1  
ATOM 5361   C C    . ALA B 2 64  ? -26.870 -29.157 -1.510  1.00 33.22 ? 64  ALA B C    1  
ATOM 5362   O O    . ALA B 2 64  ? -26.417 -29.440 -2.621  1.00 72.04 ? 64  ALA B O    1  
ATOM 5363   C CB   . ALA B 2 64  ? -29.116 -30.106 -0.741  1.00 63.01 ? 64  ALA B CB   1  
ATOM 5364   H H    . ALA B 2 64  ? -26.421 -31.003 0.945   1.00 32.15 ? 64  ALA B H    1  
ATOM 5365   H HA   . ALA B 2 64  ? -27.319 -31.213 -1.098  1.00 1.24  ? 64  ALA B HA   1  
ATOM 5366   H HB1  . ALA B 2 64  ? -29.447 -30.199 -1.770  1.00 3.52  ? 64  ALA B HB1  1  
ATOM 5367   H HB2  . ALA B 2 64  ? -29.416 -29.139 -0.356  1.00 3.01  ? 64  ALA B HB2  1  
ATOM 5368   H HB3  . ALA B 2 64  ? -29.579 -30.881 -0.147  1.00 14.44 ? 64  ALA B HB3  1  
ATOM 5369   N N    . LYS B 2 65  ? -26.771 -27.923 -0.946  1.00 52.11 ? 65  LYS B N    1  
ATOM 5370   C CA   . LYS B 2 65  ? -26.241 -26.713 -1.616  1.00 14.15 ? 65  LYS B CA   1  
ATOM 5371   C C    . LYS B 2 65  ? -27.253 -26.232 -2.669  1.00 33.35 ? 65  LYS B C    1  
ATOM 5372   O O    . LYS B 2 65  ? -27.956 -25.243 -2.439  1.00 62.31 ? 65  LYS B O    1  
ATOM 5373   C CB   . LYS B 2 65  ? -24.811 -26.924 -2.224  1.00 23.03 ? 65  LYS B CB   1  
ATOM 5374   C CG   . LYS B 2 65  ? -24.248 -25.725 -3.031  1.00 65.32 ? 65  LYS B CG   1  
ATOM 5375   C CD   . LYS B 2 65  ? -22.783 -25.942 -3.482  1.00 12.00 ? 65  LYS B CD   1  
ATOM 5376   C CE   . LYS B 2 65  ? -21.819 -26.033 -2.284  1.00 52.32 ? 65  LYS B CE   1  
ATOM 5377   N NZ   . LYS B 2 65  ? -20.437 -26.407 -2.677  1.00 12.54 ? 65  LYS B NZ   1  
ATOM 5378   H H    . LYS B 2 65  ? -27.092 -27.823 -0.038  1.00 72.13 ? 65  LYS B H    1  
ATOM 5379   H HA   . LYS B 2 65  ? -26.176 -25.948 -0.841  1.00 31.32 ? 65  LYS B HA   1  
ATOM 5380   H HB2  . LYS B 2 65  ? -24.128 -27.146 -1.417  1.00 35.53 ? 65  LYS B HB2  1  
ATOM 5381   H HB3  . LYS B 2 65  ? -24.845 -27.786 -2.886  1.00 73.42 ? 65  LYS B HB3  1  
ATOM 5382   H HG2  . LYS B 2 65  ? -24.865 -25.588 -3.915  1.00 34.10 ? 65  LYS B HG2  1  
ATOM 5383   H HG3  . LYS B 2 65  ? -24.306 -24.826 -2.422  1.00 63.01 ? 65  LYS B HG3  1  
ATOM 5384   H HD2  . LYS B 2 65  ? -22.719 -26.858 -4.064  1.00 42.35 ? 65  LYS B HD2  1  
ATOM 5385   H HD3  . LYS B 2 65  ? -22.486 -25.107 -4.109  1.00 43.35 ? 65  LYS B HD3  1  
ATOM 5386   H HE2  . LYS B 2 65  ? -21.784 -25.069 -1.790  1.00 4.10  ? 65  LYS B HE2  1  
ATOM 5387   H HE3  . LYS B 2 65  ? -22.187 -26.772 -1.580  1.00 73.24 ? 65  LYS B HE3  1  
ATOM 5388   H HZ1  . LYS B 2 65  ? -20.063 -25.733 -3.376  1.00 42.54 ? 65  LYS B HZ1  1  
ATOM 5389   H HZ2  . LYS B 2 65  ? -20.426 -27.354 -3.087  1.00 24.23 ? 65  LYS B HZ2  1  
ATOM 5390   H HZ3  . LYS B 2 65  ? -19.818 -26.405 -1.835  1.00 35.21 ? 65  LYS B HZ3  1  
ATOM 5391   N N    . ASN B 2 66  ? -27.340 -26.982 -3.793  1.00 54.23 ? 66  ASN B N    1  
ATOM 5392   C CA   . ASN B 2 66  ? -28.252 -26.697 -4.911  1.00 23.51 ? 66  ASN B CA   1  
ATOM 5393   C C    . ASN B 2 66  ? -28.056 -25.240 -5.419  1.00 4.33  ? 66  ASN B C    1  
ATOM 5394   O O    . ASN B 2 66  ? -27.058 -24.958 -6.094  1.00 72.41 ? 66  ASN B O    1  
ATOM 5395   C CB   . ASN B 2 66  ? -29.726 -27.012 -4.495  1.00 20.13 ? 66  ASN B CB   1  
ATOM 5396   C CG   . ASN B 2 66  ? -30.770 -26.774 -5.590  1.00 52.34 ? 66  ASN B CG   1  
ATOM 5397   O OD1  . ASN B 2 66  ? -30.519 -26.993 -6.767  1.00 11.24 ? 66  ASN B OD1  1  
ATOM 5398   N ND2  . ASN B 2 66  ? -31.936 -26.282 -5.205  1.00 15.22 ? 66  ASN B ND2  1  
ATOM 5399   H H    . ASN B 2 66  ? -26.772 -27.769 -3.860  1.00 3.04  ? 66  ASN B H    1  
ATOM 5400   H HA   . ASN B 2 66  ? -27.973 -27.368 -5.718  1.00 31.32 ? 66  ASN B HA   1  
ATOM 5401   H HB2  . ASN B 2 66  ? -29.795 -28.046 -4.201  1.00 40.34 ? 66  ASN B HB2  1  
ATOM 5402   H HB3  . ASN B 2 66  ? -29.976 -26.391 -3.640  1.00 22.30 ? 66  ASN B HB3  1  
ATOM 5403   H HD21 . ASN B 2 66  ? -32.071 -26.096 -4.247  1.00 32.35 ? 66  ASN B HD21 1  
ATOM 5404   H HD22 . ASN B 2 66  ? -32.609 -26.108 -5.886  1.00 64.51 ? 66  ASN B HD22 1  
ATOM 5405   N N    . ILE B 2 67  ? -28.964 -24.307 -5.042  1.00 52.43 ? 67  ILE B N    1  
ATOM 5406   C CA   . ILE B 2 67  ? -28.849 -22.895 -5.421  1.00 63.40 ? 67  ILE B CA   1  
ATOM 5407   C C    . ILE B 2 67  ? -28.051 -22.174 -4.316  1.00 3.23  ? 67  ILE B C    1  
ATOM 5408   O O    . ILE B 2 67  ? -28.604 -21.799 -3.271  1.00 72.03 ? 67  ILE B O    1  
ATOM 5409   C CB   . ILE B 2 67  ? -30.256 -22.205 -5.639  1.00 41.02 ? 67  ILE B CB   1  
ATOM 5410   C CG1  . ILE B 2 67  ? -31.221 -23.114 -6.468  1.00 35.42 ? 67  ILE B CG1  1  
ATOM 5411   C CG2  . ILE B 2 67  ? -30.095 -20.823 -6.322  1.00 11.41 ? 67  ILE B CG2  1  
ATOM 5412   C CD1  . ILE B 2 67  ? -30.725 -23.505 -7.860  1.00 21.41 ? 67  ILE B CD1  1  
ATOM 5413   H H    . ILE B 2 67  ? -29.724 -24.575 -4.488  1.00 62.34 ? 67  ILE B H    1  
ATOM 5414   H HA   . ILE B 2 67  ? -28.288 -22.841 -6.359  1.00 60.24 ? 67  ILE B HA   1  
ATOM 5415   H HB   . ILE B 2 67  ? -30.700 -22.036 -4.656  1.00 74.04 ? 67  ILE B HB   1  
ATOM 5416   H HG12 . ILE B 2 67  ? -31.395 -24.031 -5.921  1.00 41.23 ? 67  ILE B HG12 1  
ATOM 5417   H HG13 . ILE B 2 67  ? -32.168 -22.601 -6.589  1.00 44.13 ? 67  ILE B HG13 1  
ATOM 5418   H HG21 . ILE B 2 67  ? -31.068 -20.364 -6.452  1.00 30.33 ? 67  ILE B HG21 1  
ATOM 5419   H HG22 . ILE B 2 67  ? -29.625 -20.942 -7.289  1.00 43.12 ? 67  ILE B HG22 1  
ATOM 5420   H HG23 . ILE B 2 67  ? -29.480 -20.178 -5.705  1.00 61.44 ? 67  ILE B HG23 1  
ATOM 5421   H HD11 . ILE B 2 67  ? -30.539 -22.614 -8.444  1.00 71.23 ? 67  ILE B HD11 1  
ATOM 5422   H HD12 . ILE B 2 67  ? -31.477 -24.104 -8.355  1.00 63.43 ? 67  ILE B HD12 1  
ATOM 5423   H HD13 . ILE B 2 67  ? -29.811 -24.078 -7.777  1.00 42.24 ? 67  ILE B HD13 1  
ATOM 5424   N N    . ILE B 2 68  ? -26.733 -22.053 -4.548  1.00 20.13 ? 68  ILE B N    1  
ATOM 5425   C CA   . ILE B 2 68  ? -25.771 -21.476 -3.584  1.00 13.23 ? 68  ILE B CA   1  
ATOM 5426   C C    . ILE B 2 68  ? -26.119 -20.001 -3.227  1.00 72.34 ? 68  ILE B C    1  
ATOM 5427   O O    . ILE B 2 68  ? -26.133 -19.135 -4.106  1.00 2.40  ? 68  ILE B O    1  
ATOM 5428   C CB   . ILE B 2 68  ? -24.286 -21.600 -4.132  1.00 72.43 ? 68  ILE B CB   1  
ATOM 5429   C CG1  . ILE B 2 68  ? -23.240 -20.952 -3.157  1.00 22.13 ? 68  ILE B CG1  1  
ATOM 5430   C CG2  . ILE B 2 68  ? -24.142 -21.025 -5.569  1.00 31.14 ? 68  ILE B CG2  1  
ATOM 5431   C CD1  . ILE B 2 68  ? -23.123 -21.617 -1.791  1.00 73.40 ? 68  ILE B CD1  1  
ATOM 5432   H H    . ILE B 2 68  ? -26.390 -22.373 -5.407  1.00 72.03 ? 68  ILE B H    1  
ATOM 5433   H HA   . ILE B 2 68  ? -25.833 -22.078 -2.677  1.00 31.34 ? 68  ILE B HA   1  
ATOM 5434   H HB   . ILE B 2 68  ? -24.067 -22.664 -4.205  1.00 63.33 ? 68  ILE B HB   1  
ATOM 5435   H HG12 . ILE B 2 68  ? -22.262 -20.994 -3.612  1.00 2.34  ? 68  ILE B HG12 1  
ATOM 5436   H HG13 . ILE B 2 68  ? -23.502 -19.912 -2.993  1.00 42.21 ? 68  ILE B HG13 1  
ATOM 5437   H HG21 . ILE B 2 68  ? -24.381 -19.968 -5.571  1.00 22.05 ? 68  ILE B HG21 1  
ATOM 5438   H HG22 . ILE B 2 68  ? -24.818 -21.542 -6.239  1.00 31.11 ? 68  ILE B HG22 1  
ATOM 5439   H HG23 . ILE B 2 68  ? -23.127 -21.162 -5.917  1.00 52.22 ? 68  ILE B HG23 1  
ATOM 5440   H HD11 . ILE B 2 68  ? -24.071 -21.561 -1.274  1.00 53.13 ? 68  ILE B HD11 1  
ATOM 5441   H HD12 . ILE B 2 68  ? -22.370 -21.105 -1.211  1.00 61.01 ? 68  ILE B HD12 1  
ATOM 5442   H HD13 . ILE B 2 68  ? -22.837 -22.652 -1.913  1.00 25.52 ? 68  ILE B HD13 1  
ATOM 5443   N N    . LEU B 2 69  ? -26.430 -19.776 -1.925  1.00 15.45 ? 69  LEU B N    1  
ATOM 5444   C CA   . LEU B 2 69  ? -26.735 -18.455 -1.319  1.00 25.43 ? 69  LEU B CA   1  
ATOM 5445   C C    . LEU B 2 69  ? -28.119 -17.920 -1.754  1.00 61.23 ? 69  LEU B C    1  
ATOM 5446   O O    . LEU B 2 69  ? -29.023 -17.763 -0.918  1.00 60.43 ? 69  LEU B O    1  
ATOM 5447   C CB   . LEU B 2 69  ? -25.606 -17.408 -1.579  1.00 2.34  ? 69  LEU B CB   1  
ATOM 5448   C CG   . LEU B 2 69  ? -25.805 -15.995 -0.931  1.00 32.21 ? 69  LEU B CG   1  
ATOM 5449   C CD1  . LEU B 2 69  ? -25.864 -16.066 0.620   1.00 11.44 ? 69  LEU B CD1  1  
ATOM 5450   C CD2  . LEU B 2 69  ? -24.711 -15.010 -1.404  1.00 73.12 ? 69  LEU B CD2  1  
ATOM 5451   H H    . LEU B 2 69  ? -26.462 -20.555 -1.334  1.00 44.15 ? 69  LEU B H    1  
ATOM 5452   H HA   . LEU B 2 69  ? -26.780 -18.630 -0.250  1.00 33.42 ? 69  LEU B HA   1  
ATOM 5453   H HB2  . LEU B 2 69  ? -24.675 -17.824 -1.214  1.00 45.21 ? 69  LEU B HB2  1  
ATOM 5454   H HB3  . LEU B 2 69  ? -25.512 -17.278 -2.655  1.00 43.50 ? 69  LEU B HB3  1  
ATOM 5455   H HG   . LEU B 2 69  ? -26.757 -15.600 -1.265  1.00 32.02 ? 69  LEU B HG   1  
ATOM 5456   H HD11 . LEU B 2 69  ? -26.007 -15.074 1.027   1.00 43.23 ? 69  LEU B HD11 1  
ATOM 5457   H HD12 . LEU B 2 69  ? -24.944 -16.483 1.010   1.00 74.34 ? 69  LEU B HD12 1  
ATOM 5458   H HD13 . LEU B 2 69  ? -26.694 -16.693 0.923   1.00 70.25 ? 69  LEU B HD13 1  
ATOM 5459   H HD21 . LEU B 2 69  ? -24.887 -14.035 -0.970  1.00 63.10 ? 69  LEU B HD21 1  
ATOM 5460   H HD22 . LEU B 2 69  ? -24.741 -14.926 -2.482  1.00 10.14 ? 69  LEU B HD22 1  
ATOM 5461   H HD23 . LEU B 2 69  ? -23.734 -15.367 -1.100  1.00 71.33 ? 69  LEU B HD23 1  
ATOM 5462   N N    . LEU B 2 70  ? -28.294 -17.669 -3.061  1.00 13.34 ? 70  LEU B N    1  
ATOM 5463   C CA   . LEU B 2 70  ? -29.512 -17.056 -3.626  1.00 10.12 ? 70  LEU B CA   1  
ATOM 5464   C C    . LEU B 2 70  ? -30.609 -18.127 -3.879  1.00 41.12 ? 70  LEU B C    1  
ATOM 5465   O O    . LEU B 2 70  ? -31.214 -18.164 -4.959  1.00 44.44 ? 70  LEU B O    1  
ATOM 5466   C CB   . LEU B 2 70  ? -29.142 -16.261 -4.936  1.00 30.14 ? 70  LEU B CB   1  
ATOM 5467   C CG   . LEU B 2 70  ? -29.820 -14.854 -5.141  1.00 31.41 ? 70  LEU B CG   1  
ATOM 5468   C CD1  . LEU B 2 70  ? -29.353 -14.204 -6.466  1.00 24.22 ? 70  LEU B CD1  1  
ATOM 5469   C CD2  . LEU B 2 70  ? -31.370 -14.917 -5.061  1.00 31.11 ? 70  LEU B CD2  1  
ATOM 5470   H H    . LEU B 2 70  ? -27.577 -17.896 -3.672  1.00 65.22 ? 70  LEU B H    1  
ATOM 5471   H HA   . LEU B 2 70  ? -29.897 -16.356 -2.898  1.00 44.23 ? 70  LEU B HA   1  
ATOM 5472   H HB2  . LEU B 2 70  ? -28.068 -16.106 -4.940  1.00 14.42 ? 70  LEU B HB2  1  
ATOM 5473   H HB3  . LEU B 2 70  ? -29.384 -16.879 -5.795  1.00 15.04 ? 70  LEU B HB3  1  
ATOM 5474   H HG   . LEU B 2 70  ? -29.486 -14.202 -4.341  1.00 1.34  ? 70  LEU B HG   1  
ATOM 5475   H HD11 . LEU B 2 70  ? -28.275 -14.089 -6.453  1.00 2.34  ? 70  LEU B HD11 1  
ATOM 5476   H HD12 . LEU B 2 70  ? -29.807 -13.230 -6.575  1.00 41.02 ? 70  LEU B HD12 1  
ATOM 5477   H HD13 . LEU B 2 70  ? -29.636 -14.828 -7.304  1.00 32.44 ? 70  LEU B HD13 1  
ATOM 5478   H HD21 . LEU B 2 70  ? -31.668 -15.267 -4.080  1.00 51.23 ? 70  LEU B HD21 1  
ATOM 5479   H HD22 . LEU B 2 70  ? -31.753 -15.596 -5.812  1.00 62.44 ? 70  LEU B HD22 1  
ATOM 5480   H HD23 . LEU B 2 70  ? -31.783 -13.932 -5.223  1.00 23.41 ? 70  LEU B HD23 1  
ATOM 5481   N N    . ILE B 2 71  ? -30.860 -18.993 -2.866  1.00 0.22  ? 71  ILE B N    1  
ATOM 5482   C CA   . ILE B 2 71  ? -31.976 -19.960 -2.891  1.00 63.21 ? 71  ILE B CA   1  
ATOM 5483   C C    . ILE B 2 71  ? -33.321 -19.207 -2.977  1.00 51.20 ? 71  ILE B C    1  
ATOM 5484   O O    . ILE B 2 71  ? -34.199 -19.568 -3.771  1.00 31.23 ? 71  ILE B O    1  
ATOM 5485   C CB   . ILE B 2 71  ? -31.950 -20.938 -1.639  1.00 64.31 ? 71  ILE B CB   1  
ATOM 5486   C CG1  . ILE B 2 71  ? -33.197 -21.898 -1.639  1.00 1.43  ? 71  ILE B CG1  1  
ATOM 5487   C CG2  . ILE B 2 71  ? -31.845 -20.157 -0.296  1.00 74.32 ? 71  ILE B CG2  1  
ATOM 5488   C CD1  . ILE B 2 71  ? -33.245 -22.903 -0.495  1.00 50.53 ? 71  ILE B CD1  1  
ATOM 5489   H H    . ILE B 2 71  ? -30.279 -18.971 -2.081  1.00 1.41  ? 71  ILE B H    1  
ATOM 5490   H HA   . ILE B 2 71  ? -31.859 -20.561 -3.791  1.00 41.13 ? 71  ILE B HA   1  
ATOM 5491   H HB   . ILE B 2 71  ? -31.050 -21.545 -1.728  1.00 31.23 ? 71  ILE B HB   1  
ATOM 5492   H HG12 . ILE B 2 71  ? -34.099 -21.305 -1.575  1.00 65.32 ? 71  ILE B HG12 1  
ATOM 5493   H HG13 . ILE B 2 71  ? -33.216 -22.457 -2.568  1.00 42.21 ? 71  ILE B HG13 1  
ATOM 5494   H HG21 . ILE B 2 71  ? -30.962 -19.532 -0.306  1.00 75.50 ? 71  ILE B HG21 1  
ATOM 5495   H HG22 . ILE B 2 71  ? -31.776 -20.851 0.531   1.00 23.12 ? 71  ILE B HG22 1  
ATOM 5496   H HG23 . ILE B 2 71  ? -32.723 -19.534 -0.165  1.00 61.25 ? 71  ILE B HG23 1  
ATOM 5497   H HD11 . ILE B 2 71  ? -33.305 -22.377 0.447   1.00 14.20 ? 71  ILE B HD11 1  
ATOM 5498   H HD12 . ILE B 2 71  ? -32.355 -23.520 -0.509  1.00 44.24 ? 71  ILE B HD12 1  
ATOM 5499   H HD13 . ILE B 2 71  ? -34.116 -23.529 -0.609  1.00 30.30 ? 71  ILE B HD13 1  
ATOM 5500   N N    . GLY B 2 72  ? -33.444 -18.130 -2.172  1.00 62.21 ? 72  GLY B N    1  
ATOM 5501   C CA   . GLY B 2 72  ? -34.659 -17.320 -2.119  1.00 21.20 ? 72  GLY B CA   1  
ATOM 5502   C C    . GLY B 2 72  ? -35.770 -18.000 -1.323  1.00 25.52 ? 72  GLY B C    1  
ATOM 5503   O O    . GLY B 2 72  ? -36.149 -17.527 -0.257  1.00 62.10 ? 72  GLY B O    1  
ATOM 5504   H H    . GLY B 2 72  ? -32.683 -17.886 -1.607  1.00 35.43 ? 72  GLY B H    1  
ATOM 5505   H HA2  . GLY B 2 72  ? -34.418 -16.369 -1.663  1.00 32.44 ? 72  GLY B HA2  1  
ATOM 5506   H HA3  . GLY B 2 72  ? -35.010 -17.136 -3.129  1.00 71.15 ? 72  GLY B HA3  1  
ATOM 5507   N N    . ASP B 2 73  ? -36.274 -19.114 -1.894  1.00 20.14 ? 73  ASP B N    1  
ATOM 5508   C CA   . ASP B 2 73  ? -37.302 -20.012 -1.326  1.00 63.33 ? 73  ASP B CA   1  
ATOM 5509   C C    . ASP B 2 73  ? -38.713 -19.412 -1.505  1.00 5.52  ? 73  ASP B C    1  
ATOM 5510   O O    . ASP B 2 73  ? -39.561 -20.000 -2.184  1.00 63.44 ? 73  ASP B O    1  
ATOM 5511   C CB   . ASP B 2 73  ? -37.017 -20.395 0.162   1.00 43.40 ? 73  ASP B CB   1  
ATOM 5512   C CG   . ASP B 2 73  ? -37.871 -21.577 0.666   1.00 1.41  ? 73  ASP B CG   1  
ATOM 5513   O OD1  . ASP B 2 73  ? -39.073 -21.383 0.956   1.00 22.10 ? 73  ASP B OD1  1  
ATOM 5514   O OD2  . ASP B 2 73  ? -37.348 -22.714 0.761   1.00 35.33 ? 73  ASP B OD2  1  
ATOM 5515   H H    . ASP B 2 73  ? -35.936 -19.344 -2.777  1.00 70.32 ? 73  ASP B H    1  
ATOM 5516   H HA   . ASP B 2 73  ? -37.255 -20.920 -1.923  1.00 74.12 ? 73  ASP B HA   1  
ATOM 5517   H HB2  . ASP B 2 73  ? -35.964 -20.653 0.256   1.00 54.13 ? 73  ASP B HB2  1  
ATOM 5518   H HB3  . ASP B 2 73  ? -37.211 -19.535 0.793   1.00 21.21 ? 73  ASP B HB3  1  
ATOM 5519   N N    . GLY B 2 74  ? -38.957 -18.244 -0.888  1.00 53.52 ? 74  GLY B N    1  
ATOM 5520   C CA   . GLY B 2 74  ? -40.232 -17.527 -1.024  1.00 23.44 ? 74  GLY B CA   1  
ATOM 5521   C C    . GLY B 2 74  ? -41.074 -17.596 0.244   1.00 10.55 ? 74  GLY B C    1  
ATOM 5522   O O    . GLY B 2 74  ? -41.329 -16.578 0.885   1.00 64.42 ? 74  GLY B O    1  
ATOM 5523   H H    . GLY B 2 74  ? -38.257 -17.861 -0.322  1.00 61.02 ? 74  GLY B H    1  
ATOM 5524   H HA2  . GLY B 2 74  ? -40.016 -16.490 -1.246  1.00 72.45 ? 74  GLY B HA2  1  
ATOM 5525   H HA3  . GLY B 2 74  ? -40.807 -17.938 -1.850  1.00 45.33 ? 74  GLY B HA3  1  
ATOM 5526   N N    . MET B 2 75  ? -41.499 -18.812 0.616   1.00 61.22 ? 75  MET B N    1  
ATOM 5527   C CA   . MET B 2 75  ? -42.390 -19.033 1.789   1.00 74.01 ? 75  MET B CA   1  
ATOM 5528   C C    . MET B 2 75  ? -41.572 -19.189 3.092   1.00 12.42 ? 75  MET B C    1  
ATOM 5529   O O    . MET B 2 75  ? -42.080 -18.922 4.185   1.00 25.12 ? 75  MET B O    1  
ATOM 5530   C CB   . MET B 2 75  ? -43.307 -20.263 1.551   1.00 32.21 ? 75  MET B CB   1  
ATOM 5531   C CG   . MET B 2 75  ? -42.568 -21.592 1.351   1.00 1.25  ? 75  MET B CG   1  
ATOM 5532   S SD   . MET B 2 75  ? -43.665 -22.939 0.854   1.00 42.12 ? 75  MET B SD   1  
ATOM 5533   C CE   . MET B 2 75  ? -44.328 -22.307 -0.691  1.00 45.44 ? 75  MET B CE   1  
ATOM 5534   H H    . MET B 2 75  ? -41.202 -19.590 0.096   1.00 43.45 ? 75  MET B H    1  
ATOM 5535   H HA   . MET B 2 75  ? -43.021 -18.154 1.895   1.00 51.34 ? 75  MET B HA   1  
ATOM 5536   H HB2  . MET B 2 75  ? -43.976 -20.374 2.398   1.00 45.35 ? 75  MET B HB2  1  
ATOM 5537   H HB3  . MET B 2 75  ? -43.908 -20.077 0.668   1.00 70.44 ? 75  MET B HB3  1  
ATOM 5538   H HG2  . MET B 2 75  ? -41.813 -21.461 0.585   1.00 10.11 ? 75  MET B HG2  1  
ATOM 5539   H HG3  . MET B 2 75  ? -42.083 -21.866 2.279   1.00 44.22 ? 75  MET B HG3  1  
ATOM 5540   H HE1  . MET B 2 75  ? -44.851 -21.378 -0.509  1.00 62.12 ? 75  MET B HE1  1  
ATOM 5541   H HE2  . MET B 2 75  ? -45.012 -23.028 -1.110  1.00 51.13 ? 75  MET B HE2  1  
ATOM 5542   H HE3  . MET B 2 75  ? -43.520 -22.133 -1.387  1.00 45.41 ? 75  MET B HE3  1  
ATOM 5543   N N    . GLY B 2 76  ? -40.303 -19.614 2.947   1.00 71.13 ? 76  GLY B N    1  
ATOM 5544   C CA   . GLY B 2 76  ? -39.350 -19.714 4.062   1.00 51.20 ? 76  GLY B CA   1  
ATOM 5545   C C    . GLY B 2 76  ? -38.227 -18.681 3.936   1.00 52.51 ? 76  GLY B C    1  
ATOM 5546   O O    . GLY B 2 76  ? -37.210 -18.774 4.626   1.00 64.23 ? 76  GLY B O    1  
ATOM 5547   H H    . GLY B 2 76  ? -39.997 -19.859 2.050   1.00 42.34 ? 76  GLY B H    1  
ATOM 5548   H HA2  . GLY B 2 76  ? -39.864 -19.574 5.010   1.00 32.04 ? 76  GLY B HA2  1  
ATOM 5549   H HA3  . GLY B 2 76  ? -38.912 -20.703 4.050   1.00 71.52 ? 76  GLY B HA3  1  
ATOM 5550   N N    . ASP B 2 77  ? -38.439 -17.695 3.044   1.00 22.14 ? 77  ASP B N    1  
ATOM 5551   C CA   . ASP B 2 77  ? -37.472 -16.618 2.733   1.00 60.45 ? 77  ASP B CA   1  
ATOM 5552   C C    . ASP B 2 77  ? -37.179 -15.729 3.968   1.00 22.41 ? 77  ASP B C    1  
ATOM 5553   O O    . ASP B 2 77  ? -38.104 -15.342 4.685   1.00 73.03 ? 77  ASP B O    1  
ATOM 5554   C CB   . ASP B 2 77  ? -38.059 -15.771 1.568   1.00 71.43 ? 77  ASP B CB   1  
ATOM 5555   C CG   . ASP B 2 77  ? -37.299 -14.474 1.256   1.00 71.33 ? 77  ASP B CG   1  
ATOM 5556   O OD1  . ASP B 2 77  ? -37.912 -13.387 1.346   1.00 63.53 ? 77  ASP B OD1  1  
ATOM 5557   O OD2  . ASP B 2 77  ? -36.079 -14.533 0.973   1.00 72.43 ? 77  ASP B OD2  1  
ATOM 5558   H H    . ASP B 2 77  ? -39.297 -17.688 2.570   1.00 64.45 ? 77  ASP B H    1  
ATOM 5559   H HA   . ASP B 2 77  ? -36.550 -17.087 2.399   1.00 24.13 ? 77  ASP B HA   1  
ATOM 5560   H HB2  . ASP B 2 77  ? -38.054 -16.377 0.671   1.00 55.24 ? 77  ASP B HB2  1  
ATOM 5561   H HB3  . ASP B 2 77  ? -39.096 -15.528 1.812   1.00 74.35 ? 77  ASP B HB3  1  
ATOM 5562   N N    . SER B 2 78  ? -35.890 -15.415 4.202   1.00 4.20  ? 78  SER B N    1  
ATOM 5563   C CA   . SER B 2 78  ? -35.454 -14.552 5.318   1.00 43.14 ? 78  SER B CA   1  
ATOM 5564   C C    . SER B 2 78  ? -33.996 -14.114 5.115   1.00 22.24 ? 78  SER B C    1  
ATOM 5565   O O    . SER B 2 78  ? -33.251 -14.767 4.379   1.00 51.10 ? 78  SER B O    1  
ATOM 5566   C CB   . SER B 2 78  ? -35.620 -15.284 6.676   1.00 3.22  ? 78  SER B CB   1  
ATOM 5567   O OG   . SER B 2 78  ? -35.352 -14.421 7.772   1.00 11.12 ? 78  SER B OG   1  
ATOM 5568   H H    . SER B 2 78  ? -35.203 -15.773 3.596   1.00 41.50 ? 78  SER B H    1  
ATOM 5569   H HA   . SER B 2 78  ? -36.083 -13.660 5.315   1.00 44.21 ? 78  SER B HA   1  
ATOM 5570   H HB2  . SER B 2 78  ? -36.639 -15.637 6.764   1.00 55.34 ? 78  SER B HB2  1  
ATOM 5571   H HB3  . SER B 2 78  ? -34.948 -16.133 6.721   1.00 20.03 ? 78  SER B HB3  1  
ATOM 5572   H HG   . SER B 2 78  ? -35.971 -13.683 7.749   1.00 21.32 ? 78  SER B HG   1  
ATOM 5573   N N    . GLU B 2 79  ? -33.628 -12.996 5.785   1.00 12.10 ? 79  GLU B N    1  
ATOM 5574   C CA   . GLU B 2 79  ? -32.266 -12.413 5.811   1.00 4.32  ? 79  GLU B CA   1  
ATOM 5575   C C    . GLU B 2 79  ? -31.855 -11.830 4.441   1.00 34.21 ? 79  GLU B C    1  
ATOM 5576   O O    . GLU B 2 79  ? -31.790 -10.607 4.281   1.00 24.12 ? 79  GLU B O    1  
ATOM 5577   C CB   . GLU B 2 79  ? -31.217 -13.434 6.340   1.00 34.23 ? 79  GLU B CB   1  
ATOM 5578   C CG   . GLU B 2 79  ? -31.440 -13.890 7.800   1.00 15.12 ? 79  GLU B CG   1  
ATOM 5579   C CD   . GLU B 2 79  ? -30.454 -14.974 8.262   1.00 61.21 ? 79  GLU B CD   1  
ATOM 5580   O OE1  . GLU B 2 79  ? -30.892 -16.009 8.815   1.00 74.44 ? 79  GLU B OE1  1  
ATOM 5581   O OE2  . GLU B 2 79  ? -29.227 -14.804 8.062   1.00 61.40 ? 79  GLU B OE2  1  
ATOM 5582   H H    . GLU B 2 79  ? -34.320 -12.538 6.304   1.00 74.33 ? 79  GLU B H    1  
ATOM 5583   H HA   . GLU B 2 79  ? -32.310 -11.588 6.515   1.00 4.04  ? 79  GLU B HA   1  
ATOM 5584   H HB2  . GLU B 2 79  ? -31.236 -14.312 5.703   1.00 61.12 ? 79  GLU B HB2  1  
ATOM 5585   H HB3  . GLU B 2 79  ? -30.231 -12.984 6.275   1.00 4.11  ? 79  GLU B HB3  1  
ATOM 5586   H HG2  . GLU B 2 79  ? -31.327 -13.032 8.455   1.00 73.45 ? 79  GLU B HG2  1  
ATOM 5587   H HG3  . GLU B 2 79  ? -32.455 -14.269 7.891   1.00 74.21 ? 79  GLU B HG3  1  
ATOM 5588   N N    . ILE B 2 80  ? -31.605 -12.720 3.466   1.00 72.52 ? 80  ILE B N    1  
ATOM 5589   C CA   . ILE B 2 80  ? -31.165 -12.370 2.095   1.00 42.25 ? 80  ILE B CA   1  
ATOM 5590   C C    . ILE B 2 80  ? -32.102 -11.335 1.402   1.00 14.32 ? 80  ILE B C    1  
ATOM 5591   O O    . ILE B 2 80  ? -31.668 -10.601 0.505   1.00 53.12 ? 80  ILE B O    1  
ATOM 5592   C CB   . ILE B 2 80  ? -31.041 -13.681 1.224   1.00 20.12 ? 80  ILE B CB   1  
ATOM 5593   C CG1  . ILE B 2 80  ? -30.407 -13.382 -0.181  1.00 13.33 ? 80  ILE B CG1  1  
ATOM 5594   C CG2  . ILE B 2 80  ? -32.416 -14.393 1.084   1.00 23.42 ? 80  ILE B CG2  1  
ATOM 5595   C CD1  . ILE B 2 80  ? -30.243 -14.596 -1.076  1.00 2.13  ? 80  ILE B CD1  1  
ATOM 5596   H H    . ILE B 2 80  ? -31.707 -13.669 3.681   1.00 25.24 ? 80  ILE B H    1  
ATOM 5597   H HA   . ILE B 2 80  ? -30.178 -11.931 2.182   1.00 61.34 ? 80  ILE B HA   1  
ATOM 5598   H HB   . ILE B 2 80  ? -30.380 -14.361 1.763   1.00 1.44  ? 80  ILE B HB   1  
ATOM 5599   H HG12 . ILE B 2 80  ? -31.035 -12.679 -0.713  1.00 42.31 ? 80  ILE B HG12 1  
ATOM 5600   H HG13 . ILE B 2 80  ? -29.428 -12.940 -0.045  1.00 10.41 ? 80  ILE B HG13 1  
ATOM 5601   H HG21 . ILE B 2 80  ? -32.815 -14.613 2.066   1.00 42.43 ? 80  ILE B HG21 1  
ATOM 5602   H HG22 . ILE B 2 80  ? -32.299 -15.320 0.537   1.00 12.03 ? 80  ILE B HG22 1  
ATOM 5603   H HG23 . ILE B 2 80  ? -33.109 -13.752 0.552   1.00 33.40 ? 80  ILE B HG23 1  
ATOM 5604   H HD11 . ILE B 2 80  ? -29.767 -14.301 -2.000  1.00 1.34  ? 80  ILE B HD11 1  
ATOM 5605   H HD12 . ILE B 2 80  ? -31.214 -15.017 -1.297  1.00 33.25 ? 80  ILE B HD12 1  
ATOM 5606   H HD13 . ILE B 2 80  ? -29.632 -15.341 -0.581  1.00 54.25 ? 80  ILE B HD13 1  
ATOM 5607   N N    . THR B 2 81  ? -33.367 -11.273 1.861   1.00 61.44 ? 81  THR B N    1  
ATOM 5608   C CA   . THR B 2 81  ? -34.379 -10.326 1.362   1.00 3.54  ? 81  THR B CA   1  
ATOM 5609   C C    . THR B 2 81  ? -33.886 -8.864  1.501   1.00 12.20 ? 81  THR B C    1  
ATOM 5610   O O    . THR B 2 81  ? -33.959 -8.072  0.559   1.00 35.23 ? 81  THR B O    1  
ATOM 5611   C CB   . THR B 2 81  ? -35.715 -10.496 2.170   1.00 71.34 ? 81  THR B CB   1  
ATOM 5612   O OG1  . THR B 2 81  ? -35.847 -11.856 2.627   1.00 10.43 ? 81  THR B OG1  1  
ATOM 5613   C CG2  . THR B 2 81  ? -36.952 -10.102 1.337   1.00 61.10 ? 81  THR B CG2  1  
ATOM 5614   H H    . THR B 2 81  ? -33.637 -11.900 2.567   1.00 74.52 ? 81  THR B H    1  
ATOM 5615   H HA   . THR B 2 81  ? -34.565 -10.552 0.316   1.00 42.34 ? 81  THR B HA   1  
ATOM 5616   H HB   . THR B 2 81  ? -35.678 -9.857  3.051   1.00 3.43  ? 81  THR B HB   1  
ATOM 5617   H HG1  . THR B 2 81  ? -35.965 -12.447 1.872   1.00 43.32 ? 81  THR B HG1  1  
ATOM 5618   H HG21 . THR B 2 81  ? -36.859 -9.073  1.017   1.00 20.52 ? 81  THR B HG21 1  
ATOM 5619   H HG22 . THR B 2 81  ? -37.845 -10.207 1.940   1.00 24.40 ? 81  THR B HG22 1  
ATOM 5620   H HG23 . THR B 2 81  ? -37.031 -10.744 0.469   1.00 3.10  ? 81  THR B HG23 1  
ATOM 5621   N N    . ALA B 2 82  ? -33.360 -8.553  2.701   1.00 55.34 ? 82  ALA B N    1  
ATOM 5622   C CA   . ALA B 2 82  ? -32.909 -7.194  3.078   1.00 23.42 ? 82  ALA B CA   1  
ATOM 5623   C C    . ALA B 2 82  ? -31.685 -6.732  2.264   1.00 61.11 ? 82  ALA B C    1  
ATOM 5624   O O    . ALA B 2 82  ? -31.446 -5.526  2.131   1.00 10.31 ? 82  ALA B O    1  
ATOM 5625   C CB   . ALA B 2 82  ? -32.611 -7.146  4.581   1.00 41.52 ? 82  ALA B CB   1  
ATOM 5626   H H    . ALA B 2 82  ? -33.258 -9.274  3.358   1.00 75.12 ? 82  ALA B H    1  
ATOM 5627   H HA   . ALA B 2 82  ? -33.729 -6.510  2.884   1.00 64.40 ? 82  ALA B HA   1  
ATOM 5628   H HB1  . ALA B 2 82  ? -33.490 -7.450  5.136   1.00 12.42 ? 82  ALA B HB1  1  
ATOM 5629   H HB2  . ALA B 2 82  ? -32.338 -6.141  4.873   1.00 34.41 ? 82  ALA B HB2  1  
ATOM 5630   H HB3  . ALA B 2 82  ? -31.794 -7.819  4.813   1.00 62.40 ? 82  ALA B HB3  1  
ATOM 5631   N N    . ALA B 2 83  ? -30.921 -7.704  1.734   1.00 35.42 ? 83  ALA B N    1  
ATOM 5632   C CA   . ALA B 2 83  ? -29.715 -7.439  0.926   1.00 71.35 ? 83  ALA B CA   1  
ATOM 5633   C C    . ALA B 2 83  ? -30.078 -6.765  -0.417  1.00 23.52 ? 83  ALA B C    1  
ATOM 5634   O O    . ALA B 2 83  ? -29.392 -5.831  -0.858  1.00 31.43 ? 83  ALA B O    1  
ATOM 5635   C CB   . ALA B 2 83  ? -28.938 -8.747  0.692   1.00 32.23 ? 83  ALA B CB   1  
ATOM 5636   H H    . ALA B 2 83  ? -31.186 -8.634  1.884   1.00 74.13 ? 83  ALA B H    1  
ATOM 5637   H HA   . ALA B 2 83  ? -29.076 -6.770  1.497   1.00 22.33 ? 83  ALA B HA   1  
ATOM 5638   H HB1  . ALA B 2 83  ? -28.035 -8.546  0.124   1.00 2.11  ? 83  ALA B HB1  1  
ATOM 5639   H HB2  . ALA B 2 83  ? -29.554 -9.446  0.143   1.00 22.41 ? 83  ALA B HB2  1  
ATOM 5640   H HB3  . ALA B 2 83  ? -28.670 -9.184  1.645   1.00 4.34  ? 83  ALA B HB3  1  
ATOM 5641   N N    . ARG B 2 84  ? -31.166 -7.247  -1.054  1.00 13.24 ? 84  ARG B N    1  
ATOM 5642   C CA   . ARG B 2 84  ? -31.644 -6.722  -2.350  1.00 22.44 ? 84  ARG B CA   1  
ATOM 5643   C C    . ARG B 2 84  ? -33.121 -7.114  -2.577  1.00 32.33 ? 84  ARG B C    1  
ATOM 5644   O O    . ARG B 2 84  ? -33.524 -8.232  -2.245  1.00 62.51 ? 84  ARG B O    1  
ATOM 5645   C CB   . ARG B 2 84  ? -30.739 -7.245  -3.504  1.00 44.21 ? 84  ARG B CB   1  
ATOM 5646   C CG   . ARG B 2 84  ? -31.095 -6.737  -4.923  1.00 21.13 ? 84  ARG B CG   1  
ATOM 5647   C CD   . ARG B 2 84  ? -31.159 -5.199  -5.030  1.00 21.23 ? 84  ARG B CD   1  
ATOM 5648   N NE   . ARG B 2 84  ? -29.925 -4.536  -4.560  1.00 55.25 ? 84  ARG B NE   1  
ATOM 5649   C CZ   . ARG B 2 84  ? -29.716 -3.206  -4.558  1.00 33.11 ? 84  ARG B CZ   1  
ATOM 5650   N NH1  . ARG B 2 84  ? -30.637 -2.365  -5.015  1.00 73.00 ? 84  ARG B NH1  1  
ATOM 5651   N NH2  . ARG B 2 84  ? -28.587 -2.722  -4.065  1.00 12.44 ? 84  ARG B NH2  1  
ATOM 5652   H H    . ARG B 2 84  ? -31.670 -7.979  -0.633  1.00 44.11 ? 84  ARG B H    1  
ATOM 5653   H HA   . ARG B 2 84  ? -31.577 -5.635  -2.312  1.00 33.14 ? 84  ARG B HA   1  
ATOM 5654   H HB2  . ARG B 2 84  ? -29.715 -6.958  -3.295  1.00 60.25 ? 84  ARG B HB2  1  
ATOM 5655   H HB3  . ARG B 2 84  ? -30.789 -8.329  -3.514  1.00 5.31  ? 84  ARG B HB3  1  
ATOM 5656   H HG2  . ARG B 2 84  ? -30.351 -7.101  -5.621  1.00 33.44 ? 84  ARG B HG2  1  
ATOM 5657   H HG3  . ARG B 2 84  ? -32.063 -7.145  -5.203  1.00 63.53 ? 84  ARG B HG3  1  
ATOM 5658   H HD2  . ARG B 2 84  ? -31.327 -4.930  -6.068  1.00 2.11  ? 84  ARG B HD2  1  
ATOM 5659   H HD3  . ARG B 2 84  ? -31.996 -4.846  -4.438  1.00 12.43 ? 84  ARG B HD3  1  
ATOM 5660   H HE   . ARG B 2 84  ? -29.207 -5.120  -4.227  1.00 15.51 ? 84  ARG B HE   1  
ATOM 5661   H HH11 . ARG B 2 84  ? -31.508 -2.708  -5.369  1.00 30.14 ? 84  ARG B HH11 1  
ATOM 5662   H HH12 . ARG B 2 84  ? -30.465 -1.375  -5.005  1.00 11.41 ? 84  ARG B HH12 1  
ATOM 5663   H HH21 . ARG B 2 84  ? -27.889 -3.342  -3.696  1.00 51.24 ? 84  ARG B HH21 1  
ATOM 5664   H HH22 . ARG B 2 84  ? -28.427 -1.731  -4.064  1.00 32.11 ? 84  ARG B HH22 1  
ATOM 5665   N N    . ASN B 2 85  ? -33.904 -6.161  -3.142  1.00 63.31 ? 85  ASN B N    1  
ATOM 5666   C CA   . ASN B 2 85  ? -35.336 -6.345  -3.486  1.00 32.34 ? 85  ASN B CA   1  
ATOM 5667   C C    . ASN B 2 85  ? -36.217 -6.501  -2.229  1.00 51.12 ? 85  ASN B C    1  
ATOM 5668   O O    . ASN B 2 85  ? -37.280 -7.137  -2.275  1.00 13.33 ? 85  ASN B O    1  
ATOM 5669   C CB   . ASN B 2 85  ? -35.535 -7.522  -4.502  1.00 72.23 ? 85  ASN B CB   1  
ATOM 5670   C CG   . ASN B 2 85  ? -35.003 -7.221  -5.910  1.00 22.32 ? 85  ASN B CG   1  
ATOM 5671   O OD1  . ASN B 2 85  ? -34.126 -6.383  -6.096  1.00 42.04 ? 85  ASN B OD1  1  
ATOM 5672   N ND2  . ASN B 2 85  ? -35.518 -7.920  -6.911  1.00 3.32  ? 85  ASN B ND2  1  
ATOM 5673   H H    . ASN B 2 85  ? -33.494 -5.295  -3.342  1.00 70.42 ? 85  ASN B H    1  
ATOM 5674   H HA   . ASN B 2 85  ? -35.649 -5.430  -3.972  1.00 53.32 ? 85  ASN B HA   1  
ATOM 5675   H HB2  . ASN B 2 85  ? -35.026 -8.401  -4.132  1.00 50.33 ? 85  ASN B HB2  1  
ATOM 5676   H HB3  . ASN B 2 85  ? -36.595 -7.742  -4.579  1.00 63.33 ? 85  ASN B HB3  1  
ATOM 5677   H HD21 . ASN B 2 85  ? -36.208 -8.589  -6.706  1.00 1.23  ? 85  ASN B HD21 1  
ATOM 5678   H HD22 . ASN B 2 85  ? -35.190 -7.745  -7.817  1.00 12.44 ? 85  ASN B HD22 1  
ATOM 5679   N N    . TYR B 2 86  ? -35.791 -5.856  -1.118  1.00 22.24 ? 86  TYR B N    1  
ATOM 5680   C CA   . TYR B 2 86  ? -36.603 -5.769  0.112   1.00 63.12 ? 86  TYR B CA   1  
ATOM 5681   C C    . TYR B 2 86  ? -37.704 -4.700  -0.080  1.00 40.11 ? 86  TYR B C    1  
ATOM 5682   O O    . TYR B 2 86  ? -37.571 -3.563  0.382   1.00 52.11 ? 86  TYR B O    1  
ATOM 5683   C CB   . TYR B 2 86  ? -35.712 -5.471  1.356   1.00 2.42  ? 86  TYR B CB   1  
ATOM 5684   C CG   . TYR B 2 86  ? -36.470 -5.519  2.700   1.00 10.04 ? 86  TYR B CG   1  
ATOM 5685   C CD1  . TYR B 2 86  ? -37.048 -6.710  3.150   1.00 42.34 ? 86  TYR B CD1  1  
ATOM 5686   C CD2  . TYR B 2 86  ? -36.612 -4.385  3.505   1.00 41.32 ? 86  TYR B CD2  1  
ATOM 5687   C CE1  . TYR B 2 86  ? -37.735 -6.765  4.341   1.00 44.23 ? 86  TYR B CE1  1  
ATOM 5688   C CE2  . TYR B 2 86  ? -37.301 -4.441  4.703   1.00 20.10 ? 86  TYR B CE2  1  
ATOM 5689   C CZ   . TYR B 2 86  ? -37.859 -5.630  5.115   1.00 12.40 ? 86  TYR B CZ   1  
ATOM 5690   O OH   . TYR B 2 86  ? -38.546 -5.691  6.307   1.00 44.44 ? 86  TYR B OH   1  
ATOM 5691   H H    . TYR B 2 86  ? -34.906 -5.433  -1.132  1.00 11.44 ? 86  TYR B H    1  
ATOM 5692   H HA   . TYR B 2 86  ? -37.084 -6.733  0.257   1.00 4.24  ? 86  TYR B HA   1  
ATOM 5693   H HB2  . TYR B 2 86  ? -34.915 -6.206  1.401   1.00 44.24 ? 86  TYR B HB2  1  
ATOM 5694   H HB3  . TYR B 2 86  ? -35.265 -4.488  1.247   1.00 74.21 ? 86  TYR B HB3  1  
ATOM 5695   H HD1  . TYR B 2 86  ? -36.954 -7.606  2.542   1.00 72.42 ? 86  TYR B HD1  1  
ATOM 5696   H HD2  . TYR B 2 86  ? -36.176 -3.450  3.178   1.00 60.14 ? 86  TYR B HD2  1  
ATOM 5697   H HE1  . TYR B 2 86  ? -38.173 -7.698  4.667   1.00 32.42 ? 86  TYR B HE1  1  
ATOM 5698   H HE2  . TYR B 2 86  ? -37.398 -3.551  5.306   1.00 34.51 ? 86  TYR B HE2  1  
ATOM 5699   H HH   . TYR B 2 86  ? -39.203 -4.994  6.334   1.00 64.10 ? 86  TYR B HH   1  
ATOM 5700   N N    . ALA B 2 87  ? -38.748 -5.112  -0.823  1.00 40.24 ? 87  ALA B N    1  
ATOM 5701   C CA   . ALA B 2 87  ? -39.949 -4.318  -1.190  1.00 35.34 ? 87  ALA B CA   1  
ATOM 5702   C C    . ALA B 2 87  ? -40.673 -5.019  -2.348  1.00 52.24 ? 87  ALA B C    1  
ATOM 5703   O O    . ALA B 2 87  ? -41.902 -5.004  -2.411  1.00 13.34 ? 87  ALA B O    1  
ATOM 5704   C CB   . ALA B 2 87  ? -39.625 -2.864  -1.617  1.00 4.41  ? 87  ALA B CB   1  
ATOM 5705   H H    . ALA B 2 87  ? -38.716 -6.040  -1.142  1.00 30.51 ? 87  ALA B H    1  
ATOM 5706   H HA   . ALA B 2 87  ? -40.605 -4.290  -0.325  1.00 2.12  ? 87  ALA B HA   1  
ATOM 5707   H HB1  . ALA B 2 87  ? -40.543 -2.341  -1.859  1.00 41.22 ? 87  ALA B HB1  1  
ATOM 5708   H HB2  . ALA B 2 87  ? -38.979 -2.873  -2.485  1.00 3.33  ? 87  ALA B HB2  1  
ATOM 5709   H HB3  . ALA B 2 87  ? -39.124 -2.353  -0.807  1.00 44.50 ? 87  ALA B HB3  1  
ATOM 5710   N N    . GLU B 2 88  ? -39.867 -5.643  -3.244  1.00 72.54 ? 88  GLU B N    1  
ATOM 5711   C CA   . GLU B 2 88  ? -40.305 -6.153  -4.562  1.00 0.42  ? 88  GLU B CA   1  
ATOM 5712   C C    . GLU B 2 88  ? -40.701 -4.938  -5.445  1.00 44.20 ? 88  GLU B C    1  
ATOM 5713   O O    . GLU B 2 88  ? -39.933 -4.522  -6.313  1.00 33.25 ? 88  GLU B O    1  
ATOM 5714   C CB   . GLU B 2 88  ? -41.468 -7.216  -4.453  1.00 32.32 ? 88  GLU B CB   1  
ATOM 5715   C CG   . GLU B 2 88  ? -41.660 -8.153  -5.679  1.00 74.14 ? 88  GLU B CG   1  
ATOM 5716   C CD   . GLU B 2 88  ? -41.959 -7.432  -7.014  1.00 50.00 ? 88  GLU B CD   1  
ATOM 5717   O OE1  . GLU B 2 88  ? -43.099 -6.969  -7.206  1.00 34.44 ? 88  GLU B OE1  1  
ATOM 5718   O OE2  . GLU B 2 88  ? -41.043 -7.312  -7.863  1.00 23.23 ? 88  GLU B OE2  1  
ATOM 5719   H H    . GLU B 2 88  ? -38.928 -5.760  -3.001  1.00 10.23 ? 88  GLU B H    1  
ATOM 5720   H HA   . GLU B 2 88  ? -39.432 -6.627  -5.003  1.00 53.43 ? 88  GLU B HA   1  
ATOM 5721   H HB2  . GLU B 2 88  ? -41.276 -7.842  -3.593  1.00 24.24 ? 88  GLU B HB2  1  
ATOM 5722   H HB3  . GLU B 2 88  ? -42.404 -6.689  -4.285  1.00 11.45 ? 88  GLU B HB3  1  
ATOM 5723   H HG2  . GLU B 2 88  ? -40.756 -8.743  -5.799  1.00 20.41 ? 88  GLU B HG2  1  
ATOM 5724   H HG3  . GLU B 2 88  ? -42.478 -8.836  -5.464  1.00 1.34  ? 88  GLU B HG3  1  
ATOM 5725   N N    . GLY B 2 89  ? -41.902 -4.389  -5.202  1.00 54.33 ? 89  GLY B N    1  
ATOM 5726   C CA   . GLY B 2 89  ? -42.388 -3.206  -5.899  1.00 33.45 ? 89  GLY B CA   1  
ATOM 5727   C C    . GLY B 2 89  ? -43.903 -3.207  -5.974  1.00 53.24 ? 89  GLY B C    1  
ATOM 5728   O O    . GLY B 2 89  ? -44.553 -2.282  -5.473  1.00 44.11 ? 89  GLY B O    1  
ATOM 5729   H H    . GLY B 2 89  ? -42.481 -4.809  -4.529  1.00 1.20  ? 89  GLY B H    1  
ATOM 5730   H HA2  . GLY B 2 89  ? -42.055 -2.323  -5.368  1.00 22.43 ? 89  GLY B HA2  1  
ATOM 5731   H HA3  . GLY B 2 89  ? -41.990 -3.179  -6.906  1.00 42.21 ? 89  GLY B HA3  1  
ATOM 5732   N N    . ALA B 2 90  ? -44.452 -4.269  -6.593  1.00 55.31 ? 90  ALA B N    1  
ATOM 5733   C CA   . ALA B 2 90  ? -45.898 -4.498  -6.730  1.00 24.23 ? 90  ALA B CA   1  
ATOM 5734   C C    . ALA B 2 90  ? -46.122 -5.848  -7.420  1.00 50.51 ? 90  ALA B C    1  
ATOM 5735   O O    . ALA B 2 90  ? -45.741 -6.003  -8.585  1.00 62.33 ? 90  ALA B O    1  
ATOM 5736   C CB   . ALA B 2 90  ? -46.607 -3.371  -7.523  1.00 0.03  ? 90  ALA B CB   1  
ATOM 5737   H H    . ALA B 2 90  ? -43.845 -4.949  -6.975  1.00 42.11 ? 90  ALA B H    1  
ATOM 5738   H HA   . ALA B 2 90  ? -46.318 -4.530  -5.727  1.00 4.14  ? 90  ALA B HA   1  
ATOM 5739   H HB1  . ALA B 2 90  ? -46.218 -3.332  -8.532  1.00 75.53 ? 90  ALA B HB1  1  
ATOM 5740   H HB2  . ALA B 2 90  ? -46.436 -2.418  -7.038  1.00 52.34 ? 90  ALA B HB2  1  
ATOM 5741   H HB3  . ALA B 2 90  ? -47.669 -3.567  -7.559  1.00 65.41 ? 90  ALA B HB3  1  
ATOM 5742   N N    . GLY B 2 91  ? -46.694 -6.825  -6.684  1.00 34.14 ? 91  GLY B N    1  
ATOM 5743   C CA   . GLY B 2 91  ? -47.070 -8.127  -7.252  1.00 54.41 ? 91  GLY B CA   1  
ATOM 5744   C C    . GLY B 2 91  ? -48.204 -7.976  -8.256  1.00 52.00 ? 91  GLY B C    1  
ATOM 5745   O O    . GLY B 2 91  ? -49.386 -8.095  -7.902  1.00 70.11 ? 91  GLY B O    1  
ATOM 5746   H H    . GLY B 2 91  ? -46.865 -6.654  -5.741  1.00 63.32 ? 91  GLY B H    1  
ATOM 5747   H HA2  . GLY B 2 91  ? -46.209 -8.574  -7.741  1.00 51.44 ? 91  GLY B HA2  1  
ATOM 5748   H HA3  . GLY B 2 91  ? -47.392 -8.779  -6.452  1.00 34.11 ? 91  GLY B HA3  1  
ATOM 5749   N N    . GLY B 2 92  ? -47.826 -7.700  -9.509  1.00 22.24 ? 92  GLY B N    1  
ATOM 5750   C CA   . GLY B 2 92  ? -48.763 -7.269  -10.543 1.00 11.22 ? 92  GLY B CA   1  
ATOM 5751   C C    . GLY B 2 92  ? -48.854 -5.747  -10.597 1.00 23.53 ? 92  GLY B C    1  
ATOM 5752   O O    . GLY B 2 92  ? -47.825 -5.077  -10.459 1.00 15.20 ? 92  GLY B O    1  
ATOM 5753   H H    . GLY B 2 92  ? -46.876 -7.779  -9.732  1.00 64.21 ? 92  GLY B H    1  
ATOM 5754   H HA2  . GLY B 2 92  ? -48.415 -7.633  -11.500 1.00 73.42 ? 92  GLY B HA2  1  
ATOM 5755   H HA3  . GLY B 2 92  ? -49.745 -7.685  -10.344 1.00 23.32 ? 92  GLY B HA3  1  
ATOM 5756   N N    . PHE B 2 93  ? -50.086 -5.214  -10.769 1.00 33.34 ? 93  PHE B N    1  
ATOM 5757   C CA   . PHE B 2 93  ? -50.388 -3.757  -10.792 1.00 30.42 ? 93  PHE B CA   1  
ATOM 5758   C C    . PHE B 2 93  ? -49.674 -3.044  -11.981 1.00 71.44 ? 93  PHE B C    1  
ATOM 5759   O O    . PHE B 2 93  ? -50.307 -2.715  -12.985 1.00 52.32 ? 93  PHE B O    1  
ATOM 5760   C CB   . PHE B 2 93  ? -50.032 -3.078  -9.430  1.00 21.40 ? 93  PHE B CB   1  
ATOM 5761   C CG   . PHE B 2 93  ? -50.734 -3.682  -8.205  1.00 70.43 ? 93  PHE B CG   1  
ATOM 5762   C CD1  . PHE B 2 93  ? -51.978 -3.216  -7.793  1.00 72.25 ? 93  PHE B CD1  1  
ATOM 5763   C CD2  . PHE B 2 93  ? -50.141 -4.712  -7.472  1.00 34.33 ? 93  PHE B CD2  1  
ATOM 5764   C CE1  . PHE B 2 93  ? -52.610 -3.755  -6.687  1.00 22.51 ? 93  PHE B CE1  1  
ATOM 5765   C CE2  . PHE B 2 93  ? -50.770 -5.251  -6.370  1.00 74.22 ? 93  PHE B CE2  1  
ATOM 5766   C CZ   . PHE B 2 93  ? -52.006 -4.773  -5.977  1.00 2.22  ? 93  PHE B CZ   1  
ATOM 5767   H H    . PHE B 2 93  ? -50.830 -5.833  -10.888 1.00 21.50 ? 93  PHE B H    1  
ATOM 5768   H HA   . PHE B 2 93  ? -51.459 -3.667  -10.946 1.00 3.01  ? 93  PHE B HA   1  
ATOM 5769   H HB2  . PHE B 2 93  ? -48.962 -3.157  -9.274  1.00 41.11 ? 93  PHE B HB2  1  
ATOM 5770   H HB3  . PHE B 2 93  ? -50.291 -2.024  -9.483  1.00 1.54  ? 93  PHE B HB3  1  
ATOM 5771   H HD1  . PHE B 2 93  ? -52.456 -2.415  -8.350  1.00 63.23 ? 93  PHE B HD1  1  
ATOM 5772   H HD2  . PHE B 2 93  ? -49.169 -5.092  -7.776  1.00 64.24 ? 93  PHE B HD2  1  
ATOM 5773   H HE1  . PHE B 2 93  ? -53.575 -3.377  -6.382  1.00 30.54 ? 93  PHE B HE1  1  
ATOM 5774   H HE2  . PHE B 2 93  ? -50.295 -6.047  -5.815  1.00 41.51 ? 93  PHE B HE2  1  
ATOM 5775   H HZ   . PHE B 2 93  ? -52.497 -5.194  -5.112  1.00 3.22  ? 93  PHE B HZ   1  
ATOM 5776   N N    . PHE B 2 94  ? -48.352 -2.823  -11.838 1.00 51.21 ? 94  PHE B N    1  
ATOM 5777   C CA   . PHE B 2 94  ? -47.485 -2.229  -12.877 1.00 40.54 ? 94  PHE B CA   1  
ATOM 5778   C C    . PHE B 2 94  ? -46.095 -2.901  -12.832 1.00 11.21 ? 94  PHE B C    1  
ATOM 5779   O O    . PHE B 2 94  ? -45.562 -3.316  -13.865 1.00 71.21 ? 94  PHE B O    1  
ATOM 5780   C CB   . PHE B 2 94  ? -47.366 -0.690  -12.671 1.00 31.30 ? 94  PHE B CB   1  
ATOM 5781   C CG   . PHE B 2 94  ? -46.425 0.025   -13.651 1.00 24.41 ? 94  PHE B CG   1  
ATOM 5782   C CD1  . PHE B 2 94  ? -46.833 0.315   -14.952 1.00 63.24 ? 94  PHE B CD1  1  
ATOM 5783   C CD2  . PHE B 2 94  ? -45.133 0.401   -13.266 1.00 62.43 ? 94  PHE B CD2  1  
ATOM 5784   C CE1  . PHE B 2 94  ? -45.982 0.953   -15.835 1.00 1.32  ? 94  PHE B CE1  1  
ATOM 5785   C CE2  . PHE B 2 94  ? -44.287 1.039   -14.150 1.00 14.44 ? 94  PHE B CE2  1  
ATOM 5786   C CZ   . PHE B 2 94  ? -44.711 1.314   -15.434 1.00 12.23 ? 94  PHE B CZ   1  
ATOM 5787   H H    . PHE B 2 94  ? -47.938 -3.084  -10.992 1.00 21.23 ? 94  PHE B H    1  
ATOM 5788   H HA   . PHE B 2 94  ? -47.936 -2.424  -13.846 1.00 21.41 ? 94  PHE B HA   1  
ATOM 5789   H HB2  . PHE B 2 94  ? -48.352 -0.248  -12.776 1.00 32.12 ? 94  PHE B HB2  1  
ATOM 5790   H HB3  . PHE B 2 94  ? -47.018 -0.497  -11.660 1.00 3.54  ? 94  PHE B HB3  1  
ATOM 5791   H HD1  . PHE B 2 94  ? -47.832 0.035   -15.273 1.00 32.23 ? 94  PHE B HD1  1  
ATOM 5792   H HD2  . PHE B 2 94  ? -44.796 0.184   -12.258 1.00 24.23 ? 94  PHE B HD2  1  
ATOM 5793   H HE1  . PHE B 2 94  ? -46.315 1.171   -16.842 1.00 72.14 ? 94  PHE B HE1  1  
ATOM 5794   H HE2  . PHE B 2 94  ? -43.293 1.321   -13.835 1.00 21.54 ? 94  PHE B HE2  1  
ATOM 5795   H HZ   . PHE B 2 94  ? -44.048 1.814   -16.127 1.00 20.55 ? 94  PHE B HZ   1  
ATOM 5796   N N    . LYS B 2 95  ? -45.524 -2.992  -11.614 1.00 53.43 ? 95  LYS B N    1  
ATOM 5797   C CA   . LYS B 2 95  ? -44.173 -3.546  -11.381 1.00 63.31 ? 95  LYS B CA   1  
ATOM 5798   C C    . LYS B 2 95  ? -44.093 -5.025  -11.807 1.00 74.14 ? 95  LYS B C    1  
ATOM 5799   O O    . LYS B 2 95  ? -43.150 -5.410  -12.502 1.00 25.11 ? 95  LYS B O    1  
ATOM 5800   C CB   . LYS B 2 95  ? -43.784 -3.387  -9.886  1.00 45.11 ? 95  LYS B CB   1  
ATOM 5801   C CG   . LYS B 2 95  ? -42.431 -4.009  -9.465  1.00 41.30 ? 95  LYS B CG   1  
ATOM 5802   C CD   . LYS B 2 95  ? -41.215 -3.386  -10.184 1.00 10.33 ? 95  LYS B CD   1  
ATOM 5803   C CE   . LYS B 2 95  ? -39.878 -3.849  -9.581  1.00 31.12 ? 95  LYS B CE   1  
ATOM 5804   N NZ   . LYS B 2 95  ? -39.770 -5.327  -9.513  1.00 31.13 ? 95  LYS B NZ   1  
ATOM 5805   H H    . LYS B 2 95  ? -46.036 -2.683  -10.844 1.00 72.23 ? 95  LYS B H    1  
ATOM 5806   H HA   . LYS B 2 95  ? -43.475 -2.968  -11.985 1.00 32.14 ? 95  LYS B HA   1  
ATOM 5807   H HB2  . LYS B 2 95  ? -43.752 -2.330  -9.651  1.00 1.45  ? 95  LYS B HB2  1  
ATOM 5808   H HB3  . LYS B 2 95  ? -44.563 -3.841  -9.279  1.00 11.53 ? 95  LYS B HB3  1  
ATOM 5809   H HG2  . LYS B 2 95  ? -42.310 -3.873  -8.397  1.00 5.23  ? 95  LYS B HG2  1  
ATOM 5810   H HG3  . LYS B 2 95  ? -42.458 -5.075  -9.677  1.00 10.12 ? 95  LYS B HG3  1  
ATOM 5811   H HD2  . LYS B 2 95  ? -41.244 -3.668  -11.230 1.00 4.25  ? 95  LYS B HD2  1  
ATOM 5812   H HD3  . LYS B 2 95  ? -41.276 -2.305  -10.108 1.00 14.40 ? 95  LYS B HD3  1  
ATOM 5813   H HE2  . LYS B 2 95  ? -39.067 -3.472  -10.191 1.00 74.44 ? 95  LYS B HE2  1  
ATOM 5814   H HE3  . LYS B 2 95  ? -39.786 -3.449  -8.581  1.00 53.24 ? 95  LYS B HE3  1  
ATOM 5815   H HZ1  . LYS B 2 95  ? -40.516 -5.717  -8.899  1.00 1.23  ? 95  LYS B HZ1  1  
ATOM 5816   H HZ2  . LYS B 2 95  ? -38.846 -5.599  -9.123  1.00 63.14 ? 95  LYS B HZ2  1  
ATOM 5817   H HZ3  . LYS B 2 95  ? -39.865 -5.742  -10.460 1.00 71.43 ? 95  LYS B HZ3  1  
ATOM 5818   N N    . GLY B 2 96  ? -45.085 -5.825  -11.377 1.00 72.31 ? 96  GLY B N    1  
ATOM 5819   C CA   . GLY B 2 96  ? -45.170 -7.242  -11.732 1.00 34.14 ? 96  GLY B CA   1  
ATOM 5820   C C    . GLY B 2 96  ? -45.411 -7.460  -13.219 1.00 31.02 ? 96  GLY B C    1  
ATOM 5821   O O    . GLY B 2 96  ? -46.547 -7.644  -13.661 1.00 34.33 ? 96  GLY B O    1  
ATOM 5822   H H    . GLY B 2 96  ? -45.771 -5.440  -10.791 1.00 63.05 ? 96  GLY B H    1  
ATOM 5823   H HA2  . GLY B 2 96  ? -44.247 -7.735  -11.444 1.00 75.21 ? 96  GLY B HA2  1  
ATOM 5824   H HA3  . GLY B 2 96  ? -45.983 -7.688  -11.177 1.00 45.45 ? 96  GLY B HA3  1  
ATOM 5825   N N    . ILE B 2 97  ? -44.319 -7.408  -13.986 1.00 60.15 ? 97  ILE B N    1  
ATOM 5826   C CA   . ILE B 2 97  ? -44.317 -7.666  -15.433 1.00 23.35 ? 97  ILE B CA   1  
ATOM 5827   C C    . ILE B 2 97  ? -44.199 -9.185  -15.688 1.00 35.42 ? 97  ILE B C    1  
ATOM 5828   O O    . ILE B 2 97  ? -44.528 -9.681  -16.769 1.00 11.25 ? 97  ILE B O    1  
ATOM 5829   C CB   . ILE B 2 97  ? -43.153 -6.875  -16.132 1.00 34.42 ? 97  ILE B CB   1  
ATOM 5830   C CG1  . ILE B 2 97  ? -41.757 -7.264  -15.526 1.00 3.41  ? 97  ILE B CG1  1  
ATOM 5831   C CG2  . ILE B 2 97  ? -43.401 -5.346  -16.018 1.00 35.42 ? 97  ILE B CG2  1  
ATOM 5832   C CD1  . ILE B 2 97  ? -40.561 -6.577  -16.169 1.00 72.22 ? 97  ILE B CD1  1  
ATOM 5833   H H    . ILE B 2 97  ? -43.468 -7.193  -13.554 1.00 73.00 ? 97  ILE B H    1  
ATOM 5834   H HA   . ILE B 2 97  ? -45.264 -7.318  -15.846 1.00 22.05 ? 97  ILE B HA   1  
ATOM 5835   H HB   . ILE B 2 97  ? -43.165 -7.132  -17.188 1.00 32.20 ? 97  ILE B HB   1  
ATOM 5836   H HG12 . ILE B 2 97  ? -41.744 -7.008  -14.473 1.00 33.51 ? 97  ILE B HG12 1  
ATOM 5837   H HG13 . ILE B 2 97  ? -41.612 -8.335  -15.621 1.00 22.03 ? 97  ILE B HG13 1  
ATOM 5838   H HG21 . ILE B 2 97  ? -42.601 -4.808  -16.510 1.00 13.41 ? 97  ILE B HG21 1  
ATOM 5839   H HG22 . ILE B 2 97  ? -43.436 -5.054  -14.975 1.00 71.35 ? 97  ILE B HG22 1  
ATOM 5840   H HG23 . ILE B 2 97  ? -44.343 -5.091  -16.489 1.00 31.22 ? 97  ILE B HG23 1  
ATOM 5841   H HD11 . ILE B 2 97  ? -40.658 -5.506  -16.063 1.00 71.43 ? 97  ILE B HD11 1  
ATOM 5842   H HD12 . ILE B 2 97  ? -40.512 -6.834  -17.218 1.00 52.04 ? 97  ILE B HD12 1  
ATOM 5843   H HD13 . ILE B 2 97  ? -39.656 -6.903  -15.677 1.00 4.43  ? 97  ILE B HD13 1  
ATOM 5844   N N    . ASP B 2 98  ? -43.696 -9.892  -14.664 1.00 63.01 ? 98  ASP B N    1  
ATOM 5845   C CA   . ASP B 2 98  ? -43.704 -11.361 -14.565 1.00 32.32 ? 98  ASP B CA   1  
ATOM 5846   C C    . ASP B 2 98  ? -44.030 -11.750 -13.115 1.00 24.13 ? 98  ASP B C    1  
ATOM 5847   O O    . ASP B 2 98  ? -44.092 -10.882 -12.228 1.00 31.20 ? 98  ASP B O    1  
ATOM 5848   C CB   . ASP B 2 98  ? -42.346 -11.969 -15.012 1.00 75.21 ? 98  ASP B CB   1  
ATOM 5849   C CG   . ASP B 2 98  ? -41.169 -11.571 -14.103 1.00 51.31 ? 98  ASP B CG   1  
ATOM 5850   O OD1  . ASP B 2 98  ? -40.712 -10.408 -14.182 1.00 1.01  ? 98  ASP B OD1  1  
ATOM 5851   O OD2  . ASP B 2 98  ? -40.698 -12.412 -13.307 1.00 22.43 ? 98  ASP B OD2  1  
ATOM 5852   H H    . ASP B 2 98  ? -43.296 -9.391  -13.922 1.00 63.41 ? 98  ASP B H    1  
ATOM 5853   H HA   . ASP B 2 98  ? -44.497 -11.742 -15.203 1.00 33.51 ? 98  ASP B HA   1  
ATOM 5854   H HB2  . ASP B 2 98  ? -42.431 -13.054 -15.028 1.00 20.52 ? 98  ASP B HB2  1  
ATOM 5855   H HB3  . ASP B 2 98  ? -42.127 -11.633 -16.021 1.00 63.31 ? 98  ASP B HB3  1  
ATOM 5856   N N    . ALA B 2 99  ? -44.231 -13.050 -12.873 1.00 1.10  ? 99  ALA B N    1  
ATOM 5857   C CA   . ALA B 2 99  ? -44.612 -13.561 -11.544 1.00 45.14 ? 99  ALA B CA   1  
ATOM 5858   C C    . ALA B 2 99  ? -43.929 -14.906 -11.266 1.00 61.12 ? 99  ALA B C    1  
ATOM 5859   O O    . ALA B 2 99  ? -43.461 -15.152 -10.146 1.00 42.54 ? 99  ALA B O    1  
ATOM 5860   C CB   . ALA B 2 99  ? -46.143 -13.678 -11.443 1.00 14.24 ? 99  ALA B CB   1  
ATOM 5861   H H    . ALA B 2 99  ? -44.122 -13.688 -13.608 1.00 33.01 ? 99  ALA B H    1  
ATOM 5862   H HA   . ALA B 2 99  ? -44.279 -12.844 -10.792 1.00 25.11 ? 99  ALA B HA   1  
ATOM 5863   H HB1  . ALA B 2 99  ? -46.596 -12.716 -11.645 1.00 15.44 ? 99  ALA B HB1  1  
ATOM 5864   H HB2  . ALA B 2 99  ? -46.426 -14.002 -10.448 1.00 32.11 ? 99  ALA B HB2  1  
ATOM 5865   H HB3  . ALA B 2 99  ? -46.504 -14.399 -12.167 1.00 51.50 ? 99  ALA B HB3  1  
ATOM 5866   N N    . LEU B 2 100 ? -43.861 -15.772 -12.298 1.00 63.31 ? 100 LEU B N    1  
ATOM 5867   C CA   . LEU B 2 100 ? -43.224 -17.105 -12.202 1.00 50.54 ? 100 LEU B CA   1  
ATOM 5868   C C    . LEU B 2 100 ? -42.131 -17.273 -13.293 1.00 32.15 ? 100 LEU B C    1  
ATOM 5869   O O    . LEU B 2 100 ? -42.404 -17.837 -14.360 1.00 74.20 ? 100 LEU B O    1  
ATOM 5870   C CB   . LEU B 2 100 ? -44.301 -18.237 -12.312 1.00 50.51 ? 100 LEU B CB   1  
ATOM 5871   C CG   . LEU B 2 100 ? -45.412 -18.255 -11.208 1.00 21.14 ? 100 LEU B CG   1  
ATOM 5872   C CD1  . LEU B 2 100 ? -46.464 -19.357 -11.478 1.00 4.53  ? 100 LEU B CD1  1  
ATOM 5873   C CD2  . LEU B 2 100 ? -44.796 -18.400 -9.794  1.00 64.01 ? 100 LEU B CD2  1  
ATOM 5874   H H    . LEU B 2 100 ? -44.259 -15.511 -13.149 1.00 23.44 ? 100 LEU B H    1  
ATOM 5875   H HA   . LEU B 2 100 ? -42.743 -17.182 -11.231 1.00 33.12 ? 100 LEU B HA   1  
ATOM 5876   H HB2  . LEU B 2 100 ? -44.789 -18.139 -13.279 1.00 2.22  ? 100 LEU B HB2  1  
ATOM 5877   H HB3  . LEU B 2 100 ? -43.789 -19.194 -12.292 1.00 25.02 ? 100 LEU B HB3  1  
ATOM 5878   H HG   . LEU B 2 100 ? -45.935 -17.306 -11.236 1.00 45.02 ? 100 LEU B HG   1  
ATOM 5879   H HD11 . LEU B 2 100 ? -46.918 -19.198 -12.448 1.00 70.23 ? 100 LEU B HD11 1  
ATOM 5880   H HD12 . LEU B 2 100 ? -47.236 -19.320 -10.721 1.00 45.34 ? 100 LEU B HD12 1  
ATOM 5881   H HD13 . LEU B 2 100 ? -45.993 -20.333 -11.458 1.00 55.24 ? 100 LEU B HD13 1  
ATOM 5882   H HD21 . LEU B 2 100 ? -44.136 -17.564 -9.597  1.00 12.31 ? 100 LEU B HD21 1  
ATOM 5883   H HD22 . LEU B 2 100 ? -44.234 -19.322 -9.726  1.00 62.13 ? 100 LEU B HD22 1  
ATOM 5884   H HD23 . LEU B 2 100 ? -45.584 -18.406 -9.052  1.00 24.21 ? 100 LEU B HD23 1  
ATOM 5885   N N    . PRO B 2 101 ? -40.883 -16.729 -13.074 1.00 12.35 ? 101 PRO B N    1  
ATOM 5886   C CA   . PRO B 2 101 ? -39.725 -17.017 -13.957 1.00 50.10 ? 101 PRO B CA   1  
ATOM 5887   C C    . PRO B 2 101 ? -38.980 -18.323 -13.571 1.00 72.21 ? 101 PRO B C    1  
ATOM 5888   O O    . PRO B 2 101 ? -38.080 -18.763 -14.287 1.00 70.54 ? 101 PRO B O    1  
ATOM 5889   C CB   . PRO B 2 101 ? -38.840 -15.772 -13.748 1.00 71.45 ? 101 PRO B CB   1  
ATOM 5890   C CG   . PRO B 2 101 ? -39.066 -15.386 -12.317 1.00 23.41 ? 101 PRO B CG   1  
ATOM 5891   C CD   . PRO B 2 101 ? -40.516 -15.741 -12.009 1.00 3.21  ? 101 PRO B CD   1  
ATOM 5892   H HA   . PRO B 2 101 ? -40.025 -17.078 -14.998 1.00 53.02 ? 101 PRO B HA   1  
ATOM 5893   H HB2  . PRO B 2 101 ? -37.794 -16.007 -13.938 1.00 33.43 ? 101 PRO B HB2  1  
ATOM 5894   H HB3  . PRO B 2 101 ? -39.162 -14.973 -14.405 1.00 63.31 ? 101 PRO B HB3  1  
ATOM 5895   H HG2  . PRO B 2 101 ? -38.390 -15.946 -11.673 1.00 41.02 ? 101 PRO B HG2  1  
ATOM 5896   H HG3  . PRO B 2 101 ? -38.906 -14.323 -12.186 1.00 53.44 ? 101 PRO B HG3  1  
ATOM 5897   H HD2  . PRO B 2 101 ? -40.600 -16.185 -11.023 1.00 22.11 ? 101 PRO B HD2  1  
ATOM 5898   H HD3  . PRO B 2 101 ? -41.149 -14.861 -12.073 1.00 74.43 ? 101 PRO B HD3  1  
ATOM 5899   N N    . LEU B 2 102 ? -39.354 -18.914 -12.418 1.00 73.12 ? 102 LEU B N    1  
ATOM 5900   C CA   . LEU B 2 102 ? -38.791 -20.190 -11.934 1.00 62.43 ? 102 LEU B CA   1  
ATOM 5901   C C    . LEU B 2 102 ? -39.420 -21.364 -12.706 1.00 3.31  ? 102 LEU B C    1  
ATOM 5902   O O    . LEU B 2 102 ? -38.709 -22.282 -13.126 1.00 61.31 ? 102 LEU B O    1  
ATOM 5903   C CB   . LEU B 2 102 ? -39.017 -20.371 -10.399 1.00 44.01 ? 102 LEU B CB   1  
ATOM 5904   C CG   . LEU B 2 102 ? -38.188 -19.453 -9.430  1.00 70.51 ? 102 LEU B CG   1  
ATOM 5905   C CD1  . LEU B 2 102 ? -36.666 -19.547 -9.714  1.00 2.11  ? 102 LEU B CD1  1  
ATOM 5906   C CD2  . LEU B 2 102 ? -38.682 -17.985 -9.440  1.00 34.21 ? 102 LEU B CD2  1  
ATOM 5907   H H    . LEU B 2 102 ? -40.041 -18.477 -11.878 1.00 51.42 ? 102 LEU B H    1  
ATOM 5908   H HA   . LEU B 2 102 ? -37.723 -20.175 -12.131 1.00 72.02 ? 102 LEU B HA   1  
ATOM 5909   H HB2  . LEU B 2 102 ? -40.073 -20.211 -10.194 1.00 51.12 ? 102 LEU B HB2  1  
ATOM 5910   H HB3  . LEU B 2 102 ? -38.792 -21.403 -10.145 1.00 54.12 ? 102 LEU B HB3  1  
ATOM 5911   H HG   . LEU B 2 102 ? -38.333 -19.825 -8.419  1.00 2.25  ? 102 LEU B HG   1  
ATOM 5912   H HD11 . LEU B 2 102 ? -36.341 -20.576 -9.617  1.00 31.42 ? 102 LEU B HD11 1  
ATOM 5913   H HD12 . LEU B 2 102 ? -36.122 -18.941 -9.001  1.00 1.25  ? 102 LEU B HD12 1  
ATOM 5914   H HD13 . LEU B 2 102 ? -36.453 -19.197 -10.715 1.00 42.13 ? 102 LEU B HD13 1  
ATOM 5915   H HD21 . LEU B 2 102 ? -38.583 -17.567 -10.435 1.00 61.05 ? 102 LEU B HD21 1  
ATOM 5916   H HD22 . LEU B 2 102 ? -38.096 -17.399 -8.747  1.00 70.43 ? 102 LEU B HD22 1  
ATOM 5917   H HD23 . LEU B 2 102 ? -39.722 -17.948 -9.139  1.00 13.41 ? 102 LEU B HD23 1  
ATOM 5918   N N    . THR B 2 103 ? -40.762 -21.306 -12.864 1.00 31.43 ? 103 THR B N    1  
ATOM 5919   C CA   . THR B 2 103 ? -41.564 -22.303 -13.602 1.00 3.41  ? 103 THR B CA   1  
ATOM 5920   C C    . THR B 2 103 ? -41.517 -23.676 -12.886 1.00 55.14 ? 103 THR B C    1  
ATOM 5921   O O    . THR B 2 103 ? -40.733 -24.572 -13.243 1.00 75.52 ? 103 THR B O    1  
ATOM 5922   C CB   . THR B 2 103 ? -41.130 -22.410 -15.110 1.00 44.32 ? 103 THR B CB   1  
ATOM 5923   O OG1  . THR B 2 103 ? -41.033 -21.088 -15.673 1.00 54.50 ? 103 THR B OG1  1  
ATOM 5924   C CG2  . THR B 2 103 ? -42.116 -23.241 -15.951 1.00 61.51 ? 103 THR B CG2  1  
ATOM 5925   H H    . THR B 2 103 ? -41.236 -20.556 -12.458 1.00 13.34 ? 103 THR B H    1  
ATOM 5926   H HA   . THR B 2 103 ? -42.592 -21.943 -13.581 1.00 72.42 ? 103 THR B HA   1  
ATOM 5927   H HB   . THR B 2 103 ? -40.148 -22.874 -15.157 1.00 54.24 ? 103 THR B HB   1  
ATOM 5928   H HG1  . THR B 2 103 ? -41.917 -20.745 -15.847 1.00 10.13 ? 103 THR B HG1  1  
ATOM 5929   H HG21 . THR B 2 103 ? -41.780 -23.276 -16.980 1.00 1.43  ? 103 THR B HG21 1  
ATOM 5930   H HG22 . THR B 2 103 ? -43.101 -22.792 -15.914 1.00 50.35 ? 103 THR B HG22 1  
ATOM 5931   H HG23 . THR B 2 103 ? -42.168 -24.249 -15.561 1.00 42.41 ? 103 THR B HG23 1  
ATOM 5932   N N    . GLY B 2 104 ? -42.324 -23.776 -11.809 1.00 3.14  ? 104 GLY B N    1  
ATOM 5933   C CA   . GLY B 2 104 ? -42.372 -24.959 -10.944 1.00 24.11 ? 104 GLY B CA   1  
ATOM 5934   C C    . GLY B 2 104 ? -41.078 -25.172 -10.164 1.00 51.35 ? 104 GLY B C    1  
ATOM 5935   O O    . GLY B 2 104 ? -40.815 -26.286 -9.708  1.00 12.22 ? 104 GLY B O    1  
ATOM 5936   H H    . GLY B 2 104 ? -42.898 -23.009 -11.589 1.00 21.41 ? 104 GLY B H    1  
ATOM 5937   H HA2  . GLY B 2 104 ? -43.184 -24.836 -10.242 1.00 43.02 ? 104 GLY B HA2  1  
ATOM 5938   H HA3  . GLY B 2 104 ? -42.570 -25.837 -11.549 1.00 35.12 ? 104 GLY B HA3  1  
ATOM 5939   N N    . GLN B 2 105 ? -40.299 -24.077 -9.991  1.00 4.43  ? 105 GLN B N    1  
ATOM 5940   C CA   . GLN B 2 105 ? -38.923 -24.107 -9.461  1.00 55.50 ? 105 GLN B CA   1  
ATOM 5941   C C    . GLN B 2 105 ? -38.043 -25.031 -10.343 1.00 73.30 ? 105 GLN B C    1  
ATOM 5942   O O    . GLN B 2 105 ? -37.809 -26.196 -10.005 1.00 44.03 ? 105 GLN B O    1  
ATOM 5943   C CB   . GLN B 2 105 ? -38.890 -24.499 -7.943  1.00 65.44 ? 105 GLN B CB   1  
ATOM 5944   C CG   . GLN B 2 105 ? -37.504 -24.399 -7.252  1.00 21.22 ? 105 GLN B CG   1  
ATOM 5945   C CD   . GLN B 2 105 ? -36.880 -22.988 -7.209  1.00 75.22 ? 105 GLN B CD   1  
ATOM 5946   O OE1  . GLN B 2 105 ? -35.663 -22.846 -7.245  1.00 44.41 ? 105 GLN B OE1  1  
ATOM 5947   N NE2  . GLN B 2 105 ? -37.689 -21.947 -7.086  1.00 23.53 ? 105 GLN B NE2  1  
ATOM 5948   H H    . GLN B 2 105 ? -40.674 -23.205 -10.234 1.00 63.54 ? 105 GLN B H    1  
ATOM 5949   H HA   . GLN B 2 105 ? -38.535 -23.093 -9.558  1.00 52.44 ? 105 GLN B HA   1  
ATOM 5950   H HB2  . GLN B 2 105 ? -39.576 -23.854 -7.407  1.00 71.55 ? 105 GLN B HB2  1  
ATOM 5951   H HB3  . GLN B 2 105 ? -39.239 -25.520 -7.848  1.00 23.21 ? 105 GLN B HB3  1  
ATOM 5952   H HG2  . GLN B 2 105 ? -37.607 -24.742 -6.232  1.00 42.23 ? 105 GLN B HG2  1  
ATOM 5953   H HG3  . GLN B 2 105 ? -36.819 -25.060 -7.772  1.00 25.53 ? 105 GLN B HG3  1  
ATOM 5954   H HE21 . GLN B 2 105 ? -38.653 -22.107 -7.027  1.00 55.54 ? 105 GLN B HE21 1  
ATOM 5955   H HE22 . GLN B 2 105 ? -37.288 -21.054 -7.057  1.00 50.30 ? 105 GLN B HE22 1  
ATOM 5956   N N    . TYR B 2 106 ? -37.663 -24.499 -11.521 1.00 73.25 ? 106 TYR B N    1  
ATOM 5957   C CA   . TYR B 2 106 ? -36.740 -25.129 -12.498 1.00 2.04  ? 106 TYR B CA   1  
ATOM 5958   C C    . TYR B 2 106 ? -37.284 -26.445 -13.115 1.00 44.13 ? 106 TYR B C    1  
ATOM 5959   O O    . TYR B 2 106 ? -37.313 -27.490 -12.456 1.00 11.31 ? 106 TYR B O    1  
ATOM 5960   C CB   . TYR B 2 106 ? -35.330 -25.363 -11.885 1.00 52.51 ? 106 TYR B CB   1  
ATOM 5961   C CG   . TYR B 2 106 ? -34.607 -24.072 -11.471 1.00 53.34 ? 106 TYR B CG   1  
ATOM 5962   C CD1  . TYR B 2 106 ? -34.175 -23.152 -12.429 1.00 61.42 ? 106 TYR B CD1  1  
ATOM 5963   C CD2  . TYR B 2 106 ? -34.339 -23.782 -10.134 1.00 74.44 ? 106 TYR B CD2  1  
ATOM 5964   C CE1  . TYR B 2 106 ? -33.503 -22.002 -12.066 1.00 5.10  ? 106 TYR B CE1  1  
ATOM 5965   C CE2  . TYR B 2 106 ? -33.675 -22.627 -9.771  1.00 41.45 ? 106 TYR B CE2  1  
ATOM 5966   C CZ   . TYR B 2 106 ? -33.256 -21.745 -10.739 1.00 24.24 ? 106 TYR B CZ   1  
ATOM 5967   O OH   . TYR B 2 106 ? -32.561 -20.611 -10.383 1.00 63.20 ? 106 TYR B OH   1  
ATOM 5968   H H    . TYR B 2 106 ? -38.034 -23.628 -11.755 1.00 61.24 ? 106 TYR B H    1  
ATOM 5969   H HA   . TYR B 2 106 ? -36.636 -24.410 -13.306 1.00 2.14  ? 106 TYR B HA   1  
ATOM 5970   H HB2  . TYR B 2 106 ? -35.429 -25.998 -11.011 1.00 15.11 ? 106 TYR B HB2  1  
ATOM 5971   H HB3  . TYR B 2 106 ? -34.704 -25.874 -12.611 1.00 43.44 ? 106 TYR B HB3  1  
ATOM 5972   H HD1  . TYR B 2 106 ? -34.365 -23.349 -13.478 1.00 52.43 ? 106 TYR B HD1  1  
ATOM 5973   H HD2  . TYR B 2 106 ? -34.669 -24.475 -9.367  1.00 21.11 ? 106 TYR B HD2  1  
ATOM 5974   H HE1  . TYR B 2 106 ? -33.178 -21.304 -12.826 1.00 20.11 ? 106 TYR B HE1  1  
ATOM 5975   H HE2  . TYR B 2 106 ? -33.481 -22.424 -8.727  1.00 0.23  ? 106 TYR B HE2  1  
ATOM 5976   H HH   . TYR B 2 106 ? -32.911 -19.854 -10.864 1.00 43.11 ? 106 TYR B HH   1  
ATOM 5977   N N    . THR B 2 107 ? -37.677 -26.378 -14.402 1.00 55.02 ? 107 THR B N    1  
ATOM 5978   C CA   . THR B 2 107 ? -38.050 -27.560 -15.203 1.00 33.22 ? 107 THR B CA   1  
ATOM 5979   C C    . THR B 2 107 ? -36.781 -28.313 -15.684 1.00 32.11 ? 107 THR B C    1  
ATOM 5980   O O    . THR B 2 107 ? -35.654 -27.973 -15.287 1.00 60.44 ? 107 THR B O    1  
ATOM 5981   C CB   . THR B 2 107 ? -38.921 -27.133 -16.433 1.00 1.14  ? 107 THR B CB   1  
ATOM 5982   O OG1  . THR B 2 107 ? -38.219 -26.147 -17.213 1.00 63.32 ? 107 THR B OG1  1  
ATOM 5983   C CG2  . THR B 2 107 ? -40.297 -26.575 -16.016 1.00 61.24 ? 107 THR B CG2  1  
ATOM 5984   H H    . THR B 2 107 ? -37.715 -25.498 -14.836 1.00 75.34 ? 107 THR B H    1  
ATOM 5985   H HA   . THR B 2 107 ? -38.637 -28.230 -14.579 1.00 50.45 ? 107 THR B HA   1  
ATOM 5986   H HB   . THR B 2 107 ? -39.085 -28.006 -17.058 1.00 42.30 ? 107 THR B HB   1  
ATOM 5987   H HG1  . THR B 2 107 ? -37.695 -26.588 -17.890 1.00 35.23 ? 107 THR B HG1  1  
ATOM 5988   H HG21 . THR B 2 107 ? -40.848 -27.329 -15.466 1.00 54.03 ? 107 THR B HG21 1  
ATOM 5989   H HG22 . THR B 2 107 ? -40.861 -26.300 -16.899 1.00 25.12 ? 107 THR B HG22 1  
ATOM 5990   H HG23 . THR B 2 107 ? -40.168 -25.699 -15.392 1.00 72.23 ? 107 THR B HG23 1  
ATOM 5991   N N    . HIS B 2 108 ? -36.960 -29.342 -16.539 1.00 33.50 ? 108 HIS B N    1  
ATOM 5992   C CA   . HIS B 2 108 ? -35.827 -30.103 -17.108 1.00 31.13 ? 108 HIS B CA   1  
ATOM 5993   C C    . HIS B 2 108 ? -35.197 -29.310 -18.292 1.00 64.32 ? 108 HIS B C    1  
ATOM 5994   O O    . HIS B 2 108 ? -35.519 -29.519 -19.465 1.00 23.53 ? 108 HIS B O    1  
ATOM 5995   C CB   . HIS B 2 108 ? -36.251 -31.566 -17.494 1.00 71.44 ? 108 HIS B CB   1  
ATOM 5996   C CG   . HIS B 2 108 ? -37.159 -31.725 -18.693 1.00 22.41 ? 108 HIS B CG   1  
ATOM 5997   N ND1  . HIS B 2 108 ? -36.714 -32.227 -19.900 1.00 55.53 ? 108 HIS B ND1  1  
ATOM 5998   C CD2  . HIS B 2 108 ? -38.458 -31.398 -18.886 1.00 31.42 ? 108 HIS B CD2  1  
ATOM 5999   C CE1  . HIS B 2 108 ? -37.700 -32.211 -20.775 1.00 35.20 ? 108 HIS B CE1  1  
ATOM 6000   N NE2  . HIS B 2 108 ? -38.766 -31.714 -20.185 1.00 61.24 ? 108 HIS B NE2  1  
ATOM 6001   H H    . HIS B 2 108 ? -37.870 -29.606 -16.776 1.00 53.34 ? 108 HIS B H    1  
ATOM 6002   H HA   . HIS B 2 108 ? -35.070 -30.178 -16.329 1.00 63.34 ? 108 HIS B HA   1  
ATOM 6003   H HB2  . HIS B 2 108 ? -35.358 -32.145 -17.690 1.00 5.31  ? 108 HIS B HB2  1  
ATOM 6004   H HB3  . HIS B 2 108 ? -36.760 -32.014 -16.645 1.00 61.21 ? 108 HIS B HB3  1  
ATOM 6005   H HD1  . HIS B 2 108 ? -35.808 -32.573 -20.077 1.00 73.44 ? 108 HIS B HD1  1  
ATOM 6006   H HD2  . HIS B 2 108 ? -39.133 -30.988 -18.145 1.00 13.51 ? 108 HIS B HD2  1  
ATOM 6007   H HE1  . HIS B 2 108 ? -37.643 -32.549 -21.796 1.00 13.54 ? 108 HIS B HE1  1  
ATOM 6008   H HE2  . HIS B 2 108 ? -39.610 -31.489 -20.643 1.00 37.66 ? 108 HIS B HE2  1  
ATOM 6009   N N    . TYR B 2 109 ? -34.347 -28.317 -17.954 1.00 24.01 ? 109 TYR B N    1  
ATOM 6010   C CA   . TYR B 2 109 ? -33.613 -27.519 -18.962 1.00 12.12 ? 109 TYR B CA   1  
ATOM 6011   C C    . TYR B 2 109 ? -32.472 -28.358 -19.563 1.00 23.25 ? 109 TYR B C    1  
ATOM 6012   O O    . TYR B 2 109 ? -32.236 -28.344 -20.775 1.00 53.33 ? 109 TYR B O    1  
ATOM 6013   C CB   . TYR B 2 109 ? -33.059 -26.210 -18.333 1.00 3.21  ? 109 TYR B CB   1  
ATOM 6014   C CG   . TYR B 2 109 ? -32.386 -25.255 -19.348 1.00 45.42 ? 109 TYR B CG   1  
ATOM 6015   C CD1  . TYR B 2 109 ? -33.155 -24.469 -20.215 1.00 0.44  ? 109 TYR B CD1  1  
ATOM 6016   C CD2  . TYR B 2 109 ? -30.991 -25.149 -19.443 1.00 22.15 ? 109 TYR B CD2  1  
ATOM 6017   C CE1  . TYR B 2 109 ? -32.561 -23.618 -21.128 1.00 22.41 ? 109 TYR B CE1  1  
ATOM 6018   C CE2  . TYR B 2 109 ? -30.399 -24.297 -20.357 1.00 35.43 ? 109 TYR B CE2  1  
ATOM 6019   C CZ   . TYR B 2 109 ? -31.187 -23.535 -21.194 1.00 14.13 ? 109 TYR B CZ   1  
ATOM 6020   O OH   . TYR B 2 109 ? -30.596 -22.681 -22.098 1.00 32.20 ? 109 TYR B OH   1  
ATOM 6021   H H    . TYR B 2 109 ? -34.218 -28.112 -17.007 1.00 24.35 ? 109 TYR B H    1  
ATOM 6022   H HA   . TYR B 2 109 ? -34.315 -27.258 -19.750 1.00 74.10 ? 109 TYR B HA   1  
ATOM 6023   H HB2  . TYR B 2 109 ? -33.878 -25.676 -17.864 1.00 1.44  ? 109 TYR B HB2  1  
ATOM 6024   H HB3  . TYR B 2 109 ? -32.334 -26.463 -17.562 1.00 64.40 ? 109 TYR B HB3  1  
ATOM 6025   H HD1  . TYR B 2 109 ? -34.238 -24.531 -20.164 1.00 4.34  ? 109 TYR B HD1  1  
ATOM 6026   H HD2  . TYR B 2 109 ? -30.373 -25.750 -18.789 1.00 41.21 ? 109 TYR B HD2  1  
ATOM 6027   H HE1  . TYR B 2 109 ? -33.178 -23.021 -21.784 1.00 2.14  ? 109 TYR B HE1  1  
ATOM 6028   H HE2  . TYR B 2 109 ? -29.323 -24.229 -20.411 1.00 24.41 ? 109 TYR B HE2  1  
ATOM 6029   H HH   . TYR B 2 109 ? -29.919 -23.156 -22.588 1.00 23.15 ? 109 TYR B HH   1  
ATOM 6030   N N    . ALA B 2 110 ? -31.787 -29.093 -18.674 1.00 62.14 ? 110 ALA B N    1  
ATOM 6031   C CA   . ALA B 2 110 ? -30.645 -29.959 -19.006 1.00 20.21 ? 110 ALA B CA   1  
ATOM 6032   C C    . ALA B 2 110 ? -30.315 -30.817 -17.778 1.00 14.33 ? 110 ALA B C    1  
ATOM 6033   O O    . ALA B 2 110 ? -30.137 -32.035 -17.878 1.00 61.43 ? 110 ALA B O    1  
ATOM 6034   C CB   . ALA B 2 110 ? -29.420 -29.124 -19.432 1.00 71.24 ? 110 ALA B CB   1  
ATOM 6035   H H    . ALA B 2 110 ? -32.079 -29.064 -17.741 1.00 34.11 ? 110 ALA B H    1  
ATOM 6036   H HA   . ALA B 2 110 ? -30.935 -30.605 -19.830 1.00 73.33 ? 110 ALA B HA   1  
ATOM 6037   H HB1  . ALA B 2 110 ? -28.595 -29.777 -19.691 1.00 75.22 ? 110 ALA B HB1  1  
ATOM 6038   H HB2  . ALA B 2 110 ? -29.124 -28.474 -18.621 1.00 62.00 ? 110 ALA B HB2  1  
ATOM 6039   H HB3  . ALA B 2 110 ? -29.682 -28.520 -20.292 1.00 64.40 ? 110 ALA B HB3  1  
ATOM 6040   N N    . LEU B 2 111 ? -30.263 -30.130 -16.627 1.00 52.20 ? 111 LEU B N    1  
ATOM 6041   C CA   . LEU B 2 111 ? -29.989 -30.709 -15.299 1.00 23.30 ? 111 LEU B CA   1  
ATOM 6042   C C    . LEU B 2 111 ? -30.259 -29.590 -14.275 1.00 14.13 ? 111 LEU B C    1  
ATOM 6043   O O    . LEU B 2 111 ? -31.021 -29.770 -13.316 1.00 1.02  ? 111 LEU B O    1  
ATOM 6044   C CB   . LEU B 2 111 ? -28.512 -31.241 -15.214 1.00 64.15 ? 111 LEU B CB   1  
ATOM 6045   C CG   . LEU B 2 111 ? -28.156 -32.252 -14.056 1.00 2.12  ? 111 LEU B CG   1  
ATOM 6046   C CD1  . LEU B 2 111 ? -26.788 -32.922 -14.320 1.00 52.02 ? 111 LEU B CD1  1  
ATOM 6047   C CD2  . LEU B 2 111 ? -28.164 -31.594 -12.652 1.00 23.44 ? 111 LEU B CD2  1  
ATOM 6048   H H    . LEU B 2 111 ? -30.424 -29.168 -16.673 1.00 63.20 ? 111 LEU B H    1  
ATOM 6049   H HA   . LEU B 2 111 ? -30.688 -31.525 -15.134 1.00 32.42 ? 111 LEU B HA   1  
ATOM 6050   H HB2  . LEU B 2 111 ? -28.299 -31.737 -16.157 1.00 65.24 ? 111 LEU B HB2  1  
ATOM 6051   H HB3  . LEU B 2 111 ? -27.848 -30.388 -15.138 1.00 70.25 ? 111 LEU B HB3  1  
ATOM 6052   H HG   . LEU B 2 111 ? -28.900 -33.041 -14.052 1.00 32.14 ? 111 LEU B HG   1  
ATOM 6053   H HD11 . LEU B 2 111 ? -26.007 -32.172 -14.352 1.00 35.43 ? 111 LEU B HD11 1  
ATOM 6054   H HD12 . LEU B 2 111 ? -26.817 -33.445 -15.268 1.00 23.41 ? 111 LEU B HD12 1  
ATOM 6055   H HD13 . LEU B 2 111 ? -26.574 -33.633 -13.535 1.00 32.32 ? 111 LEU B HD13 1  
ATOM 6056   H HD21 . LEU B 2 111 ? -29.150 -31.204 -12.440 1.00 62.22 ? 111 LEU B HD21 1  
ATOM 6057   H HD22 . LEU B 2 111 ? -27.446 -30.784 -12.617 1.00 24.45 ? 111 LEU B HD22 1  
ATOM 6058   H HD23 . LEU B 2 111 ? -27.909 -32.332 -11.903 1.00 15.14 ? 111 LEU B HD23 1  
ATOM 6059   N N    . ASN B 2 112 ? -29.619 -28.428 -14.543 1.00 11.24 ? 112 ASN B N    1  
ATOM 6060   C CA   . ASN B 2 112 ? -29.707 -27.201 -13.724 1.00 31.24 ? 112 ASN B CA   1  
ATOM 6061   C C    . ASN B 2 112 ? -29.074 -27.463 -12.328 1.00 42.11 ? 112 ASN B C    1  
ATOM 6062   O O    . ASN B 2 112 ? -27.965 -28.006 -12.269 1.00 73.20 ? 112 ASN B O    1  
ATOM 6063   C CB   . ASN B 2 112 ? -31.178 -26.663 -13.660 1.00 51.21 ? 112 ASN B CB   1  
ATOM 6064   C CG   . ASN B 2 112 ? -31.258 -25.163 -13.309 1.00 5.32  ? 112 ASN B CG   1  
ATOM 6065   O OD1  . ASN B 2 112 ? -31.243 -24.771 -12.137 1.00 72.33 ? 112 ASN B OD1  1  
ATOM 6066   N ND2  . ASN B 2 112 ? -31.359 -24.313 -14.318 1.00 71.34 ? 112 ASN B ND2  1  
ATOM 6067   H H    . ASN B 2 112 ? -29.039 -28.403 -15.327 1.00 32.42 ? 112 ASN B H    1  
ATOM 6068   H HA   . ASN B 2 112 ? -29.091 -26.462 -14.226 1.00 30.51 ? 112 ASN B HA   1  
ATOM 6069   H HB2  . ASN B 2 112 ? -31.650 -26.816 -14.622 1.00 2.33  ? 112 ASN B HB2  1  
ATOM 6070   H HB3  . ASN B 2 112 ? -31.732 -27.223 -12.912 1.00 34.34 ? 112 ASN B HB3  1  
ATOM 6071   H HD21 . ASN B 2 112 ? -31.381 -24.670 -15.235 1.00 62.45 ? 112 ASN B HD21 1  
ATOM 6072   H HD22 . ASN B 2 112 ? -31.417 -23.364 -14.113 1.00 24.34 ? 112 ASN B HD22 1  
ATOM 6073   N N    . LYS B 2 113 ? -29.756 -27.048 -11.230 1.00 42.53 ? 113 LYS B N    1  
ATOM 6074   C CA   . LYS B 2 113 ? -29.350 -27.301 -9.830  1.00 74.43 ? 113 LYS B CA   1  
ATOM 6075   C C    . LYS B 2 113 ? -28.092 -26.518 -9.400  1.00 12.33 ? 113 LYS B C    1  
ATOM 6076   O O    . LYS B 2 113 ? -27.733 -26.582 -8.237  1.00 4.42  ? 113 LYS B O    1  
ATOM 6077   C CB   . LYS B 2 113 ? -29.175 -28.835 -9.556  1.00 5.23  ? 113 LYS B CB   1  
ATOM 6078   C CG   . LYS B 2 113 ? -30.419 -29.736 -9.849  1.00 13.31 ? 113 LYS B CG   1  
ATOM 6079   C CD   . LYS B 2 113 ? -31.582 -29.591 -8.820  1.00 2.41  ? 113 LYS B CD   1  
ATOM 6080   C CE   . LYS B 2 113 ? -32.491 -28.365 -9.050  1.00 1.50  ? 113 LYS B CE   1  
ATOM 6081   N NZ   . LYS B 2 113 ? -33.419 -28.163 -7.913  1.00 75.13 ? 113 LYS B NZ   1  
ATOM 6082   H H    . LYS B 2 113 ? -30.570 -26.540 -11.360 1.00 73.15 ? 113 LYS B H    1  
ATOM 6083   H HA   . LYS B 2 113 ? -30.167 -26.946 -9.209  1.00 54.00 ? 113 LYS B HA   1  
ATOM 6084   H HB2  . LYS B 2 113 ? -28.355 -29.197 -10.169 1.00 72.11 ? 113 LYS B HB2  1  
ATOM 6085   H HB3  . LYS B 2 113 ? -28.900 -28.973 -8.514  1.00 14.32 ? 113 LYS B HB3  1  
ATOM 6086   H HG2  . LYS B 2 113 ? -30.796 -29.496 -10.836 1.00 15.40 ? 113 LYS B HG2  1  
ATOM 6087   H HG3  . LYS B 2 113 ? -30.090 -30.772 -9.852  1.00 15.50 ? 113 LYS B HG3  1  
ATOM 6088   H HD2  . LYS B 2 113 ? -32.200 -30.482 -8.868  1.00 62.54 ? 113 LYS B HD2  1  
ATOM 6089   H HD3  . LYS B 2 113 ? -31.153 -29.524 -7.826  1.00 53.12 ? 113 LYS B HD3  1  
ATOM 6090   H HE2  . LYS B 2 113 ? -31.877 -27.480 -9.156  1.00 13.05 ? 113 LYS B HE2  1  
ATOM 6091   H HE3  . LYS B 2 113 ? -33.068 -28.510 -9.955  1.00 3.43  ? 113 LYS B HE3  1  
ATOM 6092   H HZ1  . LYS B 2 113 ? -34.078 -28.965 -7.844  1.00 73.20 ? 113 LYS B HZ1  1  
ATOM 6093   H HZ2  . LYS B 2 113 ? -33.967 -27.289 -8.048  1.00 20.10 ? 113 LYS B HZ2  1  
ATOM 6094   H HZ3  . LYS B 2 113 ? -32.886 -28.088 -7.021  1.00 70.33 ? 113 LYS B HZ3  1  
ATOM 6095   N N    . LYS B 2 114 ? -27.464 -25.759 -10.330 1.00 74.01 ? 114 LYS B N    1  
ATOM 6096   C CA   . LYS B 2 114 ? -26.165 -25.067 -10.116 1.00 12.52 ? 114 LYS B CA   1  
ATOM 6097   C C    . LYS B 2 114 ? -25.101 -26.048 -9.566  1.00 21.12 ? 114 LYS B C    1  
ATOM 6098   O O    . LYS B 2 114 ? -24.469 -26.762 -10.346 1.00 40.04 ? 114 LYS B O    1  
ATOM 6099   C CB   . LYS B 2 114 ? -26.298 -23.779 -9.225  1.00 71.32 ? 114 LYS B CB   1  
ATOM 6100   C CG   . LYS B 2 114 ? -26.851 -22.526 -9.943  1.00 53.22 ? 114 LYS B CG   1  
ATOM 6101   C CD   . LYS B 2 114 ? -28.290 -22.715 -10.469 1.00 50.22 ? 114 LYS B CD   1  
ATOM 6102   C CE   . LYS B 2 114 ? -28.797 -21.508 -11.266 1.00 21.44 ? 114 LYS B CE   1  
ATOM 6103   N NZ   . LYS B 2 114 ? -30.169 -21.731 -11.788 1.00 41.42 ? 114 LYS B NZ   1  
ATOM 6104   H H    . LYS B 2 114 ? -27.896 -25.656 -11.202 1.00 12.22 ? 114 LYS B H    1  
ATOM 6105   H HA   . LYS B 2 114 ? -25.833 -24.757 -11.107 1.00 71.44 ? 114 LYS B HA   1  
ATOM 6106   H HB2  . LYS B 2 114 ? -26.947 -24.006 -8.387  1.00 42.11 ? 114 LYS B HB2  1  
ATOM 6107   H HB3  . LYS B 2 114 ? -25.318 -23.529 -8.832  1.00 22.52 ? 114 LYS B HB3  1  
ATOM 6108   H HG2  . LYS B 2 114 ? -26.839 -21.693 -9.247  1.00 53.05 ? 114 LYS B HG2  1  
ATOM 6109   H HG3  . LYS B 2 114 ? -26.200 -22.291 -10.781 1.00 41.54 ? 114 LYS B HG3  1  
ATOM 6110   H HD2  . LYS B 2 114 ? -28.316 -23.592 -11.107 1.00 62.51 ? 114 LYS B HD2  1  
ATOM 6111   H HD3  . LYS B 2 114 ? -28.947 -22.881 -9.621  1.00 44.11 ? 114 LYS B HD3  1  
ATOM 6112   H HE2  . LYS B 2 114 ? -28.808 -20.639 -10.620 1.00 32.35 ? 114 LYS B HE2  1  
ATOM 6113   H HE3  . LYS B 2 114 ? -28.128 -21.324 -12.099 1.00 74.21 ? 114 LYS B HE3  1  
ATOM 6114   H HZ1  . LYS B 2 114 ? -30.858 -21.661 -11.011 1.00 53.15 ? 114 LYS B HZ1  1  
ATOM 6115   H HZ2  . LYS B 2 114 ? -30.244 -22.673 -12.219 1.00 45.40 ? 114 LYS B HZ2  1  
ATOM 6116   H HZ3  . LYS B 2 114 ? -30.404 -21.010 -12.506 1.00 44.12 ? 114 LYS B HZ3  1  
ATOM 6117   N N    . THR B 2 115 ? -24.991 -26.119 -8.215  1.00 63.54 ? 115 THR B N    1  
ATOM 6118   C CA   . THR B 2 115 ? -24.053 -26.991 -7.479  1.00 52.35 ? 115 THR B CA   1  
ATOM 6119   C C    . THR B 2 115 ? -22.561 -26.730 -7.859  1.00 14.32 ? 115 THR B C    1  
ATOM 6120   O O    . THR B 2 115 ? -21.829 -26.100 -7.092  1.00 53.33 ? 115 THR B O    1  
ATOM 6121   C CB   . THR B 2 115 ? -24.445 -28.503 -7.636  1.00 32.14 ? 115 THR B CB   1  
ATOM 6122   O OG1  . THR B 2 115 ? -25.852 -28.651 -7.394  1.00 73.23 ? 115 THR B OG1  1  
ATOM 6123   C CG2  . THR B 2 115 ? -23.687 -29.406 -6.655  1.00 31.34 ? 115 THR B CG2  1  
ATOM 6124   H H    . THR B 2 115 ? -25.603 -25.573 -7.681  1.00 3.23  ? 115 THR B H    1  
ATOM 6125   H HA   . THR B 2 115 ? -24.170 -26.735 -6.428  1.00 55.22 ? 115 THR B HA   1  
ATOM 6126   H HB   . THR B 2 115 ? -24.229 -28.821 -8.655  1.00 50.42 ? 115 THR B HB   1  
ATOM 6127   H HG1  . THR B 2 115 ? -26.335 -28.087 -8.002  1.00 22.30 ? 115 THR B HG1  1  
ATOM 6128   H HG21 . THR B 2 115 ? -22.620 -29.331 -6.840  1.00 1.02  ? 115 THR B HG21 1  
ATOM 6129   H HG22 . THR B 2 115 ? -23.992 -30.431 -6.793  1.00 54.14 ? 115 THR B HG22 1  
ATOM 6130   H HG23 . THR B 2 115 ? -23.896 -29.105 -5.633  1.00 1.24  ? 115 THR B HG23 1  
ATOM 6131   N N    . GLY B 2 116 ? -22.131 -27.190 -9.058  1.00 14.41 ? 116 GLY B N    1  
ATOM 6132   C CA   . GLY B 2 116 ? -20.740 -27.044 -9.515  1.00 51.51 ? 116 GLY B CA   1  
ATOM 6133   C C    . GLY B 2 116 ? -19.869 -28.196 -9.037  1.00 21.52 ? 116 GLY B C    1  
ATOM 6134   O O    . GLY B 2 116 ? -18.772 -27.991 -8.509  1.00 55.33 ? 116 GLY B O    1  
ATOM 6135   H H    . GLY B 2 116 ? -22.773 -27.638 -9.642  1.00 10.00 ? 116 GLY B H    1  
ATOM 6136   H HA2  . GLY B 2 116 ? -20.731 -27.025 -10.600 1.00 1.11  ? 116 GLY B HA2  1  
ATOM 6137   H HA3  . GLY B 2 116 ? -20.331 -26.109 -9.151  1.00 22.20 ? 116 GLY B HA3  1  
ATOM 6138   N N    . LYS B 2 117 ? -20.386 -29.426 -9.223  1.00 70.25 ? 117 LYS B N    1  
ATOM 6139   C CA   . LYS B 2 117 ? -19.766 -30.672 -8.711  1.00 41.42 ? 117 LYS B CA   1  
ATOM 6140   C C    . LYS B 2 117 ? -19.391 -31.680 -9.853  1.00 50.22 ? 117 LYS B C    1  
ATOM 6141   O O    . LYS B 2 117 ? -18.236 -32.126 -9.873  1.00 14.22 ? 117 LYS B O    1  
ATOM 6142   C CB   . LYS B 2 117 ? -20.682 -31.337 -7.620  1.00 63.03 ? 117 LYS B CB   1  
ATOM 6143   C CG   . LYS B 2 117 ? -20.239 -31.100 -6.151  1.00 42.12 ? 117 LYS B CG   1  
ATOM 6144   C CD   . LYS B 2 117 ? -20.171 -29.612 -5.748  1.00 31.31 ? 117 LYS B CD   1  
ATOM 6145   C CE   . LYS B 2 117 ? -19.590 -29.406 -4.344  1.00 25.13 ? 117 LYS B CE   1  
ATOM 6146   N NZ   . LYS B 2 117 ? -18.144 -29.751 -4.261  1.00 65.23 ? 117 LYS B NZ   1  
ATOM 6147   H H    . LYS B 2 117 ? -21.220 -29.502 -9.729  1.00 33.01 ? 117 LYS B H    1  
ATOM 6148   H HA   . LYS B 2 117 ? -18.833 -30.384 -8.229  1.00 52.25 ? 117 LYS B HA   1  
ATOM 6149   H HB2  . LYS B 2 117 ? -21.696 -30.959 -7.735  1.00 75.04 ? 117 LYS B HB2  1  
ATOM 6150   H HB3  . LYS B 2 117 ? -20.713 -32.409 -7.786  1.00 31.32 ? 117 LYS B HB3  1  
ATOM 6151   H HG2  . LYS B 2 117 ? -20.942 -31.600 -5.495  1.00 2.32  ? 117 LYS B HG2  1  
ATOM 6152   H HG3  . LYS B 2 117 ? -19.259 -31.543 -6.016  1.00 34.33 ? 117 LYS B HG3  1  
ATOM 6153   H HD2  . LYS B 2 117 ? -19.547 -29.082 -6.461  1.00 50.22 ? 117 LYS B HD2  1  
ATOM 6154   H HD3  . LYS B 2 117 ? -21.172 -29.193 -5.781  1.00 75.35 ? 117 LYS B HD3  1  
ATOM 6155   H HE2  . LYS B 2 117 ? -19.707 -28.368 -4.059  1.00 71.51 ? 117 LYS B HE2  1  
ATOM 6156   H HE3  . LYS B 2 117 ? -20.134 -30.024 -3.638  1.00 12.33 ? 117 LYS B HE3  1  
ATOM 6157   H HZ1  . LYS B 2 117 ? -17.597 -29.195 -4.946  1.00 33.23 ? 117 LYS B HZ1  1  
ATOM 6158   H HZ2  . LYS B 2 117 ? -18.005 -30.764 -4.464  1.00 14.11 ? 117 LYS B HZ2  1  
ATOM 6159   H HZ3  . LYS B 2 117 ? -17.784 -29.554 -3.299  1.00 63.41 ? 117 LYS B HZ3  1  
ATOM 6160   N N    . PRO B 2 118 ? -20.320 -32.073 -10.810 1.00 54.43 ? 118 PRO B N    1  
ATOM 6161   C CA   . PRO B 2 118 ? -19.995 -33.083 -11.859 1.00 24.21 ? 118 PRO B CA   1  
ATOM 6162   C C    . PRO B 2 118 ? -18.845 -32.640 -12.795 1.00 14.21 ? 118 PRO B C    1  
ATOM 6163   O O    . PRO B 2 118 ? -19.029 -31.724 -13.614 1.00 24.54 ? 118 PRO B O    1  
ATOM 6164   C CB   . PRO B 2 118 ? -21.334 -33.256 -12.643 1.00 0.12  ? 118 PRO B CB   1  
ATOM 6165   C CG   . PRO B 2 118 ? -22.391 -32.720 -11.730 1.00 24.21 ? 118 PRO B CG   1  
ATOM 6166   C CD   . PRO B 2 118 ? -21.725 -31.596 -10.970 1.00 60.53 ? 118 PRO B CD   1  
ATOM 6167   H HA   . PRO B 2 118 ? -19.730 -34.033 -11.397 1.00 60.42 ? 118 PRO B HA   1  
ATOM 6168   H HB2  . PRO B 2 118 ? -21.309 -32.694 -13.582 1.00 33.41 ? 118 PRO B HB2  1  
ATOM 6169   H HB3  . PRO B 2 118 ? -21.521 -34.305 -12.856 1.00 13.53 ? 118 PRO B HB3  1  
ATOM 6170   H HG2  . PRO B 2 118 ? -23.237 -32.348 -12.303 1.00 5.24  ? 118 PRO B HG2  1  
ATOM 6171   H HG3  . PRO B 2 118 ? -22.716 -33.489 -11.040 1.00 14.24 ? 118 PRO B HG3  1  
ATOM 6172   H HD2  . PRO B 2 118 ? -21.751 -30.670 -11.542 1.00 63.21 ? 118 PRO B HD2  1  
ATOM 6173   H HD3  . PRO B 2 118 ? -22.200 -31.447 -10.007 1.00 54.34 ? 118 PRO B HD3  1  
ATOM 6174   N N    . ASP B 2 119 ? -17.661 -33.263 -12.596 1.00 15.15 ? 119 ASP B N    1  
ATOM 6175   C CA   . ASP B 2 119 ? -16.454 -33.108 -13.455 1.00 75.33 ? 119 ASP B CA   1  
ATOM 6176   C C    . ASP B 2 119 ? -15.708 -31.767 -13.214 1.00 51.41 ? 119 ASP B C    1  
ATOM 6177   O O    . ASP B 2 119 ? -16.258 -30.828 -12.633 1.00 43.33 ? 119 ASP B O    1  
ATOM 6178   C CB   . ASP B 2 119 ? -16.807 -33.300 -14.970 1.00 10.14 ? 119 ASP B CB   1  
ATOM 6179   C CG   . ASP B 2 119 ? -15.615 -33.076 -15.908 1.00 1.43  ? 119 ASP B CG   1  
ATOM 6180   O OD1  . ASP B 2 119 ? -15.606 -32.081 -16.668 1.00 72.33 ? 119 ASP B OD1  1  
ATOM 6181   O OD2  . ASP B 2 119 ? -14.648 -33.869 -15.838 1.00 70.21 ? 119 ASP B OD2  1  
ATOM 6182   H H    . ASP B 2 119 ? -17.584 -33.848 -11.813 1.00 22.23 ? 119 ASP B H    1  
ATOM 6183   H HA   . ASP B 2 119 ? -15.781 -33.910 -13.167 1.00 62.24 ? 119 ASP B HA   1  
ATOM 6184   H HB2  . ASP B 2 119 ? -17.170 -34.315 -15.121 1.00 41.42 ? 119 ASP B HB2  1  
ATOM 6185   H HB3  . ASP B 2 119 ? -17.601 -32.612 -15.237 1.00 11.34 ? 119 ASP B HB3  1  
ATOM 6186   N N    . TYR B 2 120 ? -14.426 -31.721 -13.653 1.00 15.45 ? 120 TYR B N    1  
ATOM 6187   C CA   . TYR B 2 120 ? -13.571 -30.523 -13.598 1.00 60.43 ? 120 TYR B CA   1  
ATOM 6188   C C    . TYR B 2 120 ? -12.493 -30.541 -14.718 1.00 60.52 ? 120 TYR B C    1  
ATOM 6189   O O    . TYR B 2 120 ? -11.744 -29.567 -14.854 1.00 70.10 ? 120 TYR B O    1  
ATOM 6190   C CB   . TYR B 2 120 ? -12.905 -30.391 -12.189 1.00 13.41 ? 120 TYR B CB   1  
ATOM 6191   C CG   . TYR B 2 120 ? -11.916 -31.526 -11.814 1.00 32.23 ? 120 TYR B CG   1  
ATOM 6192   C CD1  . TYR B 2 120 ? -12.319 -32.866 -11.813 1.00 12.10 ? 120 TYR B CD1  1  
ATOM 6193   C CD2  . TYR B 2 120 ? -10.589 -31.253 -11.468 1.00 55.01 ? 120 TYR B CD2  1  
ATOM 6194   C CE1  . TYR B 2 120 ? -11.447 -33.878 -11.483 1.00 4.21  ? 120 TYR B CE1  1  
ATOM 6195   C CE2  . TYR B 2 120 ? -9.712  -32.268 -11.135 1.00 22.32 ? 120 TYR B CE2  1  
ATOM 6196   C CZ   . TYR B 2 120 ? -10.146 -33.579 -11.147 1.00 43.02 ? 120 TYR B CZ   1  
ATOM 6197   O OH   . TYR B 2 120 ? -9.273  -34.591 -10.812 1.00 61.44 ? 120 TYR B OH   1  
ATOM 6198   H H    . TYR B 2 120 ? -14.042 -32.541 -14.035 1.00 51.44 ? 120 TYR B H    1  
ATOM 6199   H HA   . TYR B 2 120 ? -14.208 -29.657 -13.764 1.00 42.00 ? 120 TYR B HA   1  
ATOM 6200   H HB2  . TYR B 2 120 ? -12.374 -29.445 -12.143 1.00 44.31 ? 120 TYR B HB2  1  
ATOM 6201   H HB3  . TYR B 2 120 ? -13.686 -30.376 -11.435 1.00 33.22 ? 120 TYR B HB3  1  
ATOM 6202   H HD1  . TYR B 2 120 ? -13.345 -33.105 -12.081 1.00 31.32 ? 120 TYR B HD1  1  
ATOM 6203   H HD2  . TYR B 2 120 ? -10.247 -30.222 -11.461 1.00 34.30 ? 120 TYR B HD2  1  
ATOM 6204   H HE1  . TYR B 2 120 ? -11.788 -34.902 -11.489 1.00 25.54 ? 120 TYR B HE1  1  
ATOM 6205   H HE2  . TYR B 2 120 ? -8.692  -32.031 -10.868 1.00 35.45 ? 120 TYR B HE2  1  
ATOM 6206   H HH   . TYR B 2 120 ? -9.430  -35.352 -11.377 1.00 44.31 ? 120 TYR B HH   1  
ATOM 6207   N N    . VAL B 2 121 ? -12.433 -31.634 -15.535 1.00 31.24 ? 121 VAL B N    1  
ATOM 6208   C CA   . VAL B 2 121 ? -11.323 -31.863 -16.513 1.00 74.32 ? 121 VAL B CA   1  
ATOM 6209   C C    . VAL B 2 121 ? -11.818 -32.125 -17.954 1.00 53.13 ? 121 VAL B C    1  
ATOM 6210   O O    . VAL B 2 121 ? -11.114 -31.805 -18.916 1.00 21.41 ? 121 VAL B O    1  
ATOM 6211   C CB   . VAL B 2 121 ? -10.386 -33.064 -16.076 1.00 33.34 ? 121 VAL B CB   1  
ATOM 6212   C CG1  . VAL B 2 121 ? -9.546  -32.707 -14.828 1.00 0.10  ? 121 VAL B CG1  1  
ATOM 6213   C CG2  . VAL B 2 121 ? -11.201 -34.365 -15.851 1.00 22.01 ? 121 VAL B CG2  1  
ATOM 6214   H H    . VAL B 2 121 ? -13.157 -32.288 -15.492 1.00 20.20 ? 121 VAL B H    1  
ATOM 6215   H HA   . VAL B 2 121 ? -10.711 -30.963 -16.537 1.00 61.45 ? 121 VAL B HA   1  
ATOM 6216   H HB   . VAL B 2 121 ? -9.681  -33.252 -16.888 1.00 23.50 ? 121 VAL B HB   1  
ATOM 6217   H HG11 . VAL B 2 121 ? -8.935  -31.836 -15.035 1.00 20.33 ? 121 VAL B HG11 1  
ATOM 6218   H HG12 . VAL B 2 121 ? -8.897  -33.535 -14.568 1.00 63.24 ? 121 VAL B HG12 1  
ATOM 6219   H HG13 . VAL B 2 121 ? -10.200 -32.494 -13.992 1.00 51.24 ? 121 VAL B HG13 1  
ATOM 6220   H HG21 . VAL B 2 121 ? -11.719 -34.634 -16.764 1.00 61.32 ? 121 VAL B HG21 1  
ATOM 6221   H HG22 . VAL B 2 121 ? -11.928 -34.213 -15.062 1.00 4.14  ? 121 VAL B HG22 1  
ATOM 6222   H HG23 . VAL B 2 121 ? -10.536 -35.172 -15.572 1.00 72.12 ? 121 VAL B HG23 1  
ATOM 6223   N N    . THR B 2 122 ? -12.997 -32.736 -18.096 1.00 42.32 ? 122 THR B N    1  
ATOM 6224   C CA   . THR B 2 122 ? -13.536 -33.154 -19.404 1.00 51.10 ? 122 THR B CA   1  
ATOM 6225   C C    . THR B 2 122 ? -14.106 -31.932 -20.165 1.00 75.24 ? 122 THR B C    1  
ATOM 6226   O O    . THR B 2 122 ? -15.274 -31.553 -19.987 1.00 33.03 ? 122 THR B O    1  
ATOM 6227   C CB   . THR B 2 122 ? -14.626 -34.268 -19.208 1.00 23.12 ? 122 THR B CB   1  
ATOM 6228   O OG1  . THR B 2 122 ? -14.067 -35.349 -18.448 1.00 71.10 ? 122 THR B OG1  1  
ATOM 6229   C CG2  . THR B 2 122 ? -15.187 -34.822 -20.530 1.00 25.05 ? 122 THR B CG2  1  
ATOM 6230   H H    . THR B 2 122 ? -13.532 -32.900 -17.303 1.00 31.21 ? 122 THR B H    1  
ATOM 6231   H HA   . THR B 2 122 ? -12.717 -33.580 -19.981 1.00 60.44 ? 122 THR B HA   1  
ATOM 6232   H HB   . THR B 2 122 ? -15.448 -33.844 -18.633 1.00 53.23 ? 122 THR B HB   1  
ATOM 6233   H HG1  . THR B 2 122 ? -14.028 -35.093 -17.518 1.00 54.40 ? 122 THR B HG1  1  
ATOM 6234   H HG21 . THR B 2 122 ? -15.937 -35.573 -20.316 1.00 44.22 ? 122 THR B HG21 1  
ATOM 6235   H HG22 . THR B 2 122 ? -14.393 -35.270 -21.108 1.00 74.43 ? 122 THR B HG22 1  
ATOM 6236   H HG23 . THR B 2 122 ? -15.638 -34.022 -21.101 1.00 75.25 ? 122 THR B HG23 1  
ATOM 6237   N N    . ASP B 2 123 ? -13.246 -31.290 -20.981 1.00 41.11 ? 123 ASP B N    1  
ATOM 6238   C CA   . ASP B 2 123 ? -13.622 -30.105 -21.780 1.00 64.30 ? 123 ASP B CA   1  
ATOM 6239   C C    . ASP B 2 123 ? -12.708 -29.997 -23.023 1.00 30.21 ? 123 ASP B C    1  
ATOM 6240   O O    . ASP B 2 123 ? -11.636 -30.616 -23.065 1.00 23.30 ? 123 ASP B O    1  
ATOM 6241   C CB   . ASP B 2 123 ? -13.544 -28.822 -20.900 1.00 4.44  ? 123 ASP B CB   1  
ATOM 6242   C CG   . ASP B 2 123 ? -14.270 -27.620 -21.528 1.00 31.10 ? 123 ASP B CG   1  
ATOM 6243   O OD1  . ASP B 2 123 ? -13.646 -26.878 -22.303 1.00 40.12 ? 123 ASP B OD1  1  
ATOM 6244   O OD2  . ASP B 2 123 ? -15.488 -27.459 -21.296 1.00 5.14  ? 123 ASP B OD2  1  
ATOM 6245   H H    . ASP B 2 123 ? -12.319 -31.615 -21.035 1.00 70.53 ? 123 ASP B H    1  
ATOM 6246   H HA   . ASP B 2 123 ? -14.644 -30.243 -22.118 1.00 11.23 ? 123 ASP B HA   1  
ATOM 6247   H HB2  . ASP B 2 123 ? -13.995 -29.035 -19.935 1.00 23.04 ? 123 ASP B HB2  1  
ATOM 6248   H HB3  . ASP B 2 123 ? -12.502 -28.560 -20.740 1.00 32.14 ? 123 ASP B HB3  1  
ATOM 6249   N N    . SER B 2 124 ? -13.137 -29.214 -24.038 1.00 15.34 ? 124 SER B N    1  
ATOM 6250   C CA   . SER B 2 124 ? -12.410 -29.072 -25.323 1.00 13.04 ? 124 SER B CA   1  
ATOM 6251   C C    . SER B 2 124 ? -11.600 -27.751 -25.389 1.00 11.01 ? 124 SER B C    1  
ATOM 6252   O O    . SER B 2 124 ? -11.129 -27.366 -26.472 1.00 12.12 ? 124 SER B O    1  
ATOM 6253   C CB   . SER B 2 124 ? -13.420 -29.152 -26.489 1.00 43.31 ? 124 SER B CB   1  
ATOM 6254   O OG   . SER B 2 124 ? -14.140 -30.372 -26.453 1.00 41.25 ? 124 SER B OG   1  
ATOM 6255   H H    . SER B 2 124 ? -13.960 -28.691 -23.913 1.00 61.03 ? 124 SER B H    1  
ATOM 6256   H HA   . SER B 2 124 ? -11.715 -29.905 -25.416 1.00 1.43  ? 124 SER B HA   1  
ATOM 6257   H HB2  . SER B 2 124 ? -14.126 -28.337 -26.415 1.00 21.10 ? 124 SER B HB2  1  
ATOM 6258   H HB3  . SER B 2 124 ? -12.895 -29.089 -27.435 1.00 10.24 ? 124 SER B HB3  1  
ATOM 6259   H HG   . SER B 2 124 ? -14.514 -30.488 -25.574 1.00 10.52 ? 124 SER B HG   1  
ATOM 6260   N N    . ALA B 2 125 ? -11.442 -27.076 -24.232 1.00 53.21 ? 125 ALA B N    1  
ATOM 6261   C CA   . ALA B 2 125 ? -10.664 -25.831 -24.117 1.00 34.20 ? 125 ALA B CA   1  
ATOM 6262   C C    . ALA B 2 125 ? -9.180  -26.094 -24.393 1.00 73.02 ? 125 ALA B C    1  
ATOM 6263   O O    . ALA B 2 125 ? -8.586  -27.022 -23.821 1.00 70.21 ? 125 ALA B O    1  
ATOM 6264   C CB   . ALA B 2 125 ? -10.847 -25.191 -22.726 1.00 62.13 ? 125 ALA B CB   1  
ATOM 6265   H H    . ALA B 2 125 ? -11.868 -27.430 -23.424 1.00 74.53 ? 125 ALA B H    1  
ATOM 6266   H HA   . ALA B 2 125 ? -11.048 -25.133 -24.858 1.00 61.30 ? 125 ALA B HA   1  
ATOM 6267   H HB1  . ALA B 2 125 ? -10.309 -24.252 -22.676 1.00 53.05 ? 125 ALA B HB1  1  
ATOM 6268   H HB2  . ALA B 2 125 ? -10.475 -25.858 -21.959 1.00 44.05 ? 125 ALA B HB2  1  
ATOM 6269   H HB3  . ALA B 2 125 ? -11.900 -25.004 -22.550 1.00 73.15 ? 125 ALA B HB3  1  
ATOM 6270   N N    . ALA B 2 126 ? -8.592  -25.266 -25.278 1.00 74.13 ? 126 ALA B N    1  
ATOM 6271   C CA   . ALA B 2 126 ? -7.156  -25.321 -25.603 1.00 32.44 ? 126 ALA B CA   1  
ATOM 6272   C C    . ALA B 2 126 ? -6.304  -24.955 -24.371 1.00 42.03 ? 126 ALA B C    1  
ATOM 6273   O O    . ALA B 2 126 ? -5.123  -25.308 -24.297 1.00 42.24 ? 126 ALA B O    1  
ATOM 6274   C CB   . ALA B 2 126 ? -6.845  -24.397 -26.795 1.00 22.10 ? 126 ALA B CB   1  
ATOM 6275   H H    . ALA B 2 126 ? -9.149  -24.593 -25.727 1.00 21.13 ? 126 ALA B H    1  
ATOM 6276   H HA   . ALA B 2 126 ? -6.921  -26.342 -25.895 1.00 14.52 ? 126 ALA B HA   1  
ATOM 6277   H HB1  . ALA B 2 126 ? -5.800  -24.488 -27.068 1.00 20.33 ? 126 ALA B HB1  1  
ATOM 6278   H HB2  . ALA B 2 126 ? -7.056  -23.369 -26.529 1.00 44.13 ? 126 ALA B HB2  1  
ATOM 6279   H HB3  . ALA B 2 126 ? -7.458  -24.678 -27.640 1.00 2.41  ? 126 ALA B HB3  1  
ATOM 6280   N N    . SER B 2 127 ? -6.935  -24.217 -23.430 1.00 32.24 ? 127 SER B N    1  
ATOM 6281   C CA   . SER B 2 127 ? -6.388  -23.905 -22.103 1.00 4.04  ? 127 SER B CA   1  
ATOM 6282   C C    . SER B 2 127 ? -5.166  -22.962 -22.190 1.00 31.11 ? 127 SER B C    1  
ATOM 6283   O O    . SER B 2 127 ? -4.312  -22.929 -21.290 1.00 23.22 ? 127 SER B O    1  
ATOM 6284   C CB   . SER B 2 127 ? -6.083  -25.218 -21.336 1.00 62.24 ? 127 SER B CB   1  
ATOM 6285   O OG   . SER B 2 127 ? -7.260  -25.999 -21.161 1.00 70.01 ? 127 SER B OG   1  
ATOM 6286   H H    . SER B 2 127 ? -7.819  -23.857 -23.649 1.00 12.22 ? 127 SER B H    1  
ATOM 6287   H HA   . SER B 2 127 ? -7.165  -23.374 -21.571 1.00 13.13 ? 127 SER B HA   1  
ATOM 6288   H HB2  . SER B 2 127 ? -5.359  -25.802 -21.886 1.00 22.41 ? 127 SER B HB2  1  
ATOM 6289   H HB3  . SER B 2 127 ? -5.681  -24.982 -20.359 1.00 32.21 ? 127 SER B HB3  1  
ATOM 6290   H HG   . SER B 2 127 ? -7.432  -26.515 -21.959 1.00 3.44  ? 127 SER B HG   1  
ATOM 6291   N N    . ALA B 2 128 ? -5.121  -22.167 -23.275 1.00 63.25 ? 128 ALA B N    1  
ATOM 6292   C CA   . ALA B 2 128 ? -4.080  -21.144 -23.494 1.00 20.34 ? 128 ALA B CA   1  
ATOM 6293   C C    . ALA B 2 128 ? -4.638  -19.733 -23.234 1.00 51.22 ? 128 ALA B C    1  
ATOM 6294   O O    . ALA B 2 128 ? -3.882  -18.809 -22.907 1.00 70.14 ? 128 ALA B O    1  
ATOM 6295   C CB   . ALA B 2 128 ? -3.530  -21.259 -24.922 1.00 72.01 ? 128 ALA B CB   1  
ATOM 6296   H H    . ALA B 2 128 ? -5.818  -22.276 -23.958 1.00 0.14  ? 128 ALA B H    1  
ATOM 6297   H HA   . ALA B 2 128 ? -3.260  -21.327 -22.801 1.00 20.51 ? 128 ALA B HA   1  
ATOM 6298   H HB1  . ALA B 2 128 ? -2.743  -20.531 -25.075 1.00 13.42 ? 128 ALA B HB1  1  
ATOM 6299   H HB2  . ALA B 2 128 ? -4.325  -21.083 -25.635 1.00 74.33 ? 128 ALA B HB2  1  
ATOM 6300   H HB3  . ALA B 2 128 ? -3.129  -22.253 -25.078 1.00 20.42 ? 128 ALA B HB3  1  
ATOM 6301   N N    . THR B 2 129 ? -5.966  -19.572 -23.394 1.00 2.23  ? 129 THR B N    1  
ATOM 6302   C CA   . THR B 2 129 ? -6.650  -18.293 -23.149 1.00 13.41 ? 129 THR B CA   1  
ATOM 6303   C C    . THR B 2 129 ? -6.826  -18.050 -21.633 1.00 2.42  ? 129 THR B C    1  
ATOM 6304   O O    . THR B 2 129 ? -7.822  -18.475 -21.027 1.00 22.53 ? 129 THR B O    1  
ATOM 6305   C CB   . THR B 2 129 ? -8.038  -18.235 -23.883 1.00 3.03  ? 129 THR B CB   1  
ATOM 6306   O OG1  . THR B 2 129 ? -8.842  -19.373 -23.519 1.00 54.34 ? 129 THR B OG1  1  
ATOM 6307   C CG2  . THR B 2 129 ? -7.878  -18.199 -25.414 1.00 40.11 ? 129 THR B CG2  1  
ATOM 6308   H H    . THR B 2 129 ? -6.500  -20.338 -23.686 1.00 51.23 ? 129 THR B H    1  
ATOM 6309   H HA   . THR B 2 129 ? -6.024  -17.495 -23.555 1.00 13.40 ? 129 THR B HA   1  
ATOM 6310   H HB   . THR B 2 129 ? -8.559  -17.332 -23.571 1.00 74.41 ? 129 THR B HB   1  
ATOM 6311   H HG1  . THR B 2 129 ? -9.252  -19.213 -22.661 1.00 12.40 ? 129 THR B HG1  1  
ATOM 6312   H HG21 . THR B 2 129 ? -8.853  -18.146 -25.882 1.00 14.12 ? 129 THR B HG21 1  
ATOM 6313   H HG22 . THR B 2 129 ? -7.373  -19.096 -25.748 1.00 42.03 ? 129 THR B HG22 1  
ATOM 6314   H HG23 . THR B 2 129 ? -7.297  -17.334 -25.702 1.00 65.01 ? 129 THR B HG23 1  
ATOM 6315   N N    . ALA B 2 130 ? -5.820  -17.404 -21.014 1.00 31.25 ? 130 ALA B N    1  
ATOM 6316   C CA   . ALA B 2 130 ? -5.879  -17.002 -19.599 1.00 44.22 ? 130 ALA B CA   1  
ATOM 6317   C C    . ALA B 2 130 ? -6.579  -15.630 -19.482 1.00 11.23 ? 130 ALA B C    1  
ATOM 6318   O O    . ALA B 2 130 ? -5.935  -14.617 -19.198 1.00 33.53 ? 130 ALA B O    1  
ATOM 6319   C CB   . ALA B 2 130 ? -4.460  -16.999 -18.986 1.00 31.52 ? 130 ALA B CB   1  
ATOM 6320   H H    . ALA B 2 130 ? -5.009  -17.199 -21.528 1.00 54.01 ? 130 ALA B H    1  
ATOM 6321   H HA   . ALA B 2 130 ? -6.476  -17.735 -19.054 1.00 21.02 ? 130 ALA B HA   1  
ATOM 6322   H HB1  . ALA B 2 130 ? -4.515  -16.733 -17.938 1.00 23.11 ? 130 ALA B HB1  1  
ATOM 6323   H HB2  . ALA B 2 130 ? -3.837  -16.280 -19.502 1.00 53.12 ? 130 ALA B HB2  1  
ATOM 6324   H HB3  . ALA B 2 130 ? -4.018  -17.984 -19.083 1.00 61.42 ? 130 ALA B HB3  1  
ATOM 6325   N N    . TRP B 2 131 ? -7.908  -15.635 -19.756 1.00 71.21 ? 131 TRP B N    1  
ATOM 6326   C CA   . TRP B 2 131 ? -8.783  -14.435 -19.773 1.00 11.31 ? 131 TRP B CA   1  
ATOM 6327   C C    . TRP B 2 131 ? -8.384  -13.477 -20.931 1.00 65.43 ? 131 TRP B C    1  
ATOM 6328   O O    . TRP B 2 131 ? -9.055  -13.433 -21.965 1.00 51.04 ? 131 TRP B O    1  
ATOM 6329   C CB   . TRP B 2 131 ? -8.796  -13.723 -18.381 1.00 54.44 ? 131 TRP B CB   1  
ATOM 6330   C CG   . TRP B 2 131 ? -9.710  -12.514 -18.268 1.00 45.40 ? 131 TRP B CG   1  
ATOM 6331   C CD1  . TRP B 2 131 ? -9.373  -11.194 -18.443 1.00 32.10 ? 131 TRP B CD1  1  
ATOM 6332   C CD2  . TRP B 2 131 ? -11.108 -12.518 -17.944 1.00 64.42 ? 131 TRP B CD2  1  
ATOM 6333   N NE1  . TRP B 2 131 ? -10.463 -10.395 -18.240 1.00 61.32 ? 131 TRP B NE1  1  
ATOM 6334   C CE2  . TRP B 2 131 ? -11.540 -11.180 -17.932 1.00 65.33 ? 131 TRP B CE2  1  
ATOM 6335   C CE3  . TRP B 2 131 ? -12.033 -13.525 -17.658 1.00 73.51 ? 131 TRP B CE3  1  
ATOM 6336   C CZ2  . TRP B 2 131 ? -12.856 -10.823 -17.647 1.00 44.32 ? 131 TRP B CZ2  1  
ATOM 6337   C CZ3  . TRP B 2 131 ? -13.340 -13.171 -17.376 1.00 15.23 ? 131 TRP B CZ3  1  
ATOM 6338   C CH2  . TRP B 2 131 ? -13.742 -11.828 -17.374 1.00 24.24 ? 131 TRP B CH2  1  
ATOM 6339   H H    . TRP B 2 131 ? -8.322  -16.499 -19.967 1.00 43.33 ? 131 TRP B H    1  
ATOM 6340   H HA   . TRP B 2 131 ? -9.786  -14.799 -19.974 1.00 13.21 ? 131 TRP B HA   1  
ATOM 6341   H HB2  . TRP B 2 131 ? -9.108  -14.438 -17.631 1.00 14.10 ? 131 TRP B HB2  1  
ATOM 6342   H HB3  . TRP B 2 131 ? -7.785  -13.404 -18.144 1.00 12.12 ? 131 TRP B HB3  1  
ATOM 6343   H HD1  . TRP B 2 131 ? -8.380  -10.847 -18.702 1.00 31.12 ? 131 TRP B HD1  1  
ATOM 6344   H HE1  . TRP B 2 131 ? -10.470 -9.420  -18.302 1.00 11.45 ? 131 TRP B HE1  1  
ATOM 6345   H HE3  . TRP B 2 131 ? -11.740 -14.566 -17.657 1.00 24.15 ? 131 TRP B HE3  1  
ATOM 6346   H HZ2  . TRP B 2 131 ? -13.180 -9.791  -17.643 1.00 63.24 ? 131 TRP B HZ2  1  
ATOM 6347   H HZ3  . TRP B 2 131 ? -14.071 -13.938 -17.154 1.00 21.21 ? 131 TRP B HZ3  1  
ATOM 6348   H HH2  . TRP B 2 131 ? -14.776 -11.595 -17.147 1.00 54.12 ? 131 TRP B HH2  1  
ATOM 6349   N N    . SER B 2 132 ? -7.276  -12.737 -20.740 1.00 2.42  ? 132 SER B N    1  
ATOM 6350   C CA   . SER B 2 132 ? -6.708  -11.822 -21.749 1.00 1.00  ? 132 SER B CA   1  
ATOM 6351   C C    . SER B 2 132 ? -5.252  -11.486 -21.370 1.00 51.40 ? 132 SER B C    1  
ATOM 6352   O O    . SER B 2 132 ? -4.834  -11.699 -20.225 1.00 3.33  ? 132 SER B O    1  
ATOM 6353   C CB   . SER B 2 132 ? -7.559  -10.535 -21.869 1.00 5.44  ? 132 SER B CB   1  
ATOM 6354   O OG   . SER B 2 132 ? -7.066  -9.661  -22.871 1.00 34.54 ? 132 SER B OG   1  
ATOM 6355   H H    . SER B 2 132 ? -6.808  -12.818 -19.885 1.00 4.20  ? 132 SER B H    1  
ATOM 6356   H HA   . SER B 2 132 ? -6.702  -12.338 -22.704 1.00 74.11 ? 132 SER B HA   1  
ATOM 6357   H HB2  . SER B 2 132 ? -8.577  -10.804 -22.126 1.00 23.11 ? 132 SER B HB2  1  
ATOM 6358   H HB3  . SER B 2 132 ? -7.563  -10.008 -20.923 1.00 23.41 ? 132 SER B HB3  1  
ATOM 6359   H HG   . SER B 2 132 ? -7.730  -9.560  -23.572 1.00 41.30 ? 132 SER B HG   1  
ATOM 6360   N N    . THR B 2 133 ? -4.479  -10.983 -22.346 1.00 62.25 ? 133 THR B N    1  
ATOM 6361   C CA   . THR B 2 133 ? -3.077  -10.581 -22.144 1.00 25.15 ? 133 THR B CA   1  
ATOM 6362   C C    . THR B 2 133 ? -2.711  -9.497  -23.180 1.00 52.43 ? 133 THR B C    1  
ATOM 6363   O O    . THR B 2 133 ? -3.147  -9.567  -24.340 1.00 40.41 ? 133 THR B O    1  
ATOM 6364   C CB   . THR B 2 133 ? -2.086  -11.808 -22.270 1.00 42.04 ? 133 THR B CB   1  
ATOM 6365   O OG1  . THR B 2 133 ? -2.451  -12.848 -21.340 1.00 22.02 ? 133 THR B OG1  1  
ATOM 6366   C CG2  . THR B 2 133 ? -0.615  -11.416 -22.013 1.00 40.42 ? 133 THR B CG2  1  
ATOM 6367   H H    . THR B 2 133 ? -4.867  -10.871 -23.241 1.00 22.34 ? 133 THR B H    1  
ATOM 6368   H HA   . THR B 2 133 ? -2.986  -10.157 -21.144 1.00 41.44 ? 133 THR B HA   1  
ATOM 6369   H HB   . THR B 2 133 ? -2.167  -12.209 -23.277 1.00 15.11 ? 133 THR B HB   1  
ATOM 6370   H HG1  . THR B 2 133 ? -2.856  -12.453 -20.561 1.00 73.24 ? 133 THR B HG1  1  
ATOM 6371   H HG21 . THR B 2 133 ? 0.018   -12.287 -22.119 1.00 31.44 ? 133 THR B HG21 1  
ATOM 6372   H HG22 . THR B 2 133 ? -0.509  -11.019 -21.011 1.00 20.20 ? 133 THR B HG22 1  
ATOM 6373   H HG23 . THR B 2 133 ? -0.305  -10.663 -22.727 1.00 74.52 ? 133 THR B HG23 1  
ATOM 6374   N N    . GLY B 2 134 ? -1.925  -8.497  -22.748 1.00 21.42 ? 134 GLY B N    1  
ATOM 6375   C CA   . GLY B 2 134 ? -1.451  -7.440  -23.637 1.00 51.55 ? 134 GLY B CA   1  
ATOM 6376   C C    . GLY B 2 134 ? -0.080  -6.935  -23.219 1.00 55.15 ? 134 GLY B C    1  
ATOM 6377   O O    . GLY B 2 134 ? 0.172   -6.739  -22.025 1.00 3.24  ? 134 GLY B O    1  
ATOM 6378   H H    . GLY B 2 134 ? -1.661  -8.477  -21.803 1.00 32.22 ? 134 GLY B H    1  
ATOM 6379   H HA2  . GLY B 2 134 ? -1.403  -7.813  -24.659 1.00 33.24 ? 134 GLY B HA2  1  
ATOM 6380   H HA3  . GLY B 2 134 ? -2.150  -6.616  -23.601 1.00 32.15 ? 134 GLY B HA3  1  
ATOM 6381   N N    . VAL B 2 135 ? 0.818   -6.755  -24.199 1.00 22.33 ? 135 VAL B N    1  
ATOM 6382   C CA   . VAL B 2 135 ? 2.155   -6.178  -23.979 1.00 63.54 ? 135 VAL B CA   1  
ATOM 6383   C C    . VAL B 2 135 ? 2.102   -4.646  -24.164 1.00 55.02 ? 135 VAL B C    1  
ATOM 6384   O O    . VAL B 2 135 ? 1.041   -4.089  -24.488 1.00 53.10 ? 135 VAL B O    1  
ATOM 6385   C CB   . VAL B 2 135 ? 3.215   -6.834  -24.948 1.00 24.52 ? 135 VAL B CB   1  
ATOM 6386   C CG1  . VAL B 2 135 ? 3.232   -8.374  -24.785 1.00 73.24 ? 135 VAL B CG1  1  
ATOM 6387   C CG2  . VAL B 2 135 ? 2.996   -6.440  -26.434 1.00 40.21 ? 135 VAL B CG2  1  
ATOM 6388   H H    . VAL B 2 135 ? 0.572   -7.020  -25.107 1.00 51.13 ? 135 VAL B H    1  
ATOM 6389   H HA   . VAL B 2 135 ? 2.457   -6.389  -22.951 1.00 50.25 ? 135 VAL B HA   1  
ATOM 6390   H HB   . VAL B 2 135 ? 4.196   -6.469  -24.649 1.00 22.10 ? 135 VAL B HB   1  
ATOM 6391   H HG11 . VAL B 2 135 ? 3.973   -8.805  -25.447 1.00 22.30 ? 135 VAL B HG11 1  
ATOM 6392   H HG12 . VAL B 2 135 ? 2.259   -8.781  -25.026 1.00 21.00 ? 135 VAL B HG12 1  
ATOM 6393   H HG13 . VAL B 2 135 ? 3.481   -8.631  -23.761 1.00 33.10 ? 135 VAL B HG13 1  
ATOM 6394   H HG21 . VAL B 2 135 ? 2.021   -6.775  -26.765 1.00 45.45 ? 135 VAL B HG21 1  
ATOM 6395   H HG22 . VAL B 2 135 ? 3.759   -6.897  -27.051 1.00 63.31 ? 135 VAL B HG22 1  
ATOM 6396   H HG23 . VAL B 2 135 ? 3.058   -5.364  -26.541 1.00 22.31 ? 135 VAL B HG23 1  
ATOM 6397   N N    . LYS B 2 136 ? 3.243   -3.951  -23.962 1.00 15.23 ? 136 LYS B N    1  
ATOM 6398   C CA   . LYS B 2 136 ? 3.339   -2.499  -24.257 1.00 52.43 ? 136 LYS B CA   1  
ATOM 6399   C C    . LYS B 2 136 ? 3.774   -2.288  -25.738 1.00 20.00 ? 136 LYS B C    1  
ATOM 6400   O O    . LYS B 2 136 ? 4.663   -1.499  -26.029 1.00 44.11 ? 136 LYS B O    1  
ATOM 6401   C CB   . LYS B 2 136 ? 4.286   -1.770  -23.234 1.00 25.03 ? 136 LYS B CB   1  
ATOM 6402   C CG   . LYS B 2 136 ? 5.784   -2.164  -23.287 1.00 40.25 ? 136 LYS B CG   1  
ATOM 6403   C CD   . LYS B 2 136 ? 6.677   -1.300  -22.353 1.00 1.40  ? 136 LYS B CD   1  
ATOM 6404   C CE   . LYS B 2 136 ? 8.181   -1.461  -22.646 1.00 52.41 ? 136 LYS B CE   1  
ATOM 6405   N NZ   . LYS B 2 136 ? 8.540   -0.994  -24.019 1.00 21.54 ? 136 LYS B NZ   1  
ATOM 6406   H H    . LYS B 2 136 ? 4.026   -4.416  -23.606 1.00 2.14  ? 136 LYS B H    1  
ATOM 6407   H HA   . LYS B 2 136 ? 2.339   -2.075  -24.150 1.00 34.14 ? 136 LYS B HA   1  
ATOM 6408   H HB2  . LYS B 2 136 ? 4.217   -0.701  -23.408 1.00 54.44 ? 136 LYS B HB2  1  
ATOM 6409   H HB3  . LYS B 2 136 ? 3.920   -1.972  -22.232 1.00 44.34 ? 136 LYS B HB3  1  
ATOM 6410   H HG2  . LYS B 2 136 ? 5.879   -3.204  -23.001 1.00 74.24 ? 136 LYS B HG2  1  
ATOM 6411   H HG3  . LYS B 2 136 ? 6.129   -2.046  -24.309 1.00 31.40 ? 136 LYS B HG3  1  
ATOM 6412   H HD2  . LYS B 2 136 ? 6.415   -0.255  -22.476 1.00 23.33 ? 136 LYS B HD2  1  
ATOM 6413   H HD3  . LYS B 2 136 ? 6.488   -1.590  -21.322 1.00 24.42 ? 136 LYS B HD3  1  
ATOM 6414   H HE2  . LYS B 2 136 ? 8.743   -0.879  -21.927 1.00 1.45  ? 136 LYS B HE2  1  
ATOM 6415   H HE3  . LYS B 2 136 ? 8.454   -2.505  -22.547 1.00 2.14  ? 136 LYS B HE3  1  
ATOM 6416   H HZ1  . LYS B 2 136 ? 8.308   0.017   -24.125 1.00 25.41 ? 136 LYS B HZ1  1  
ATOM 6417   H HZ2  . LYS B 2 136 ? 8.009   -1.528  -24.736 1.00 65.53 ? 136 LYS B HZ2  1  
ATOM 6418   H HZ3  . LYS B 2 136 ? 9.559   -1.125  -24.189 1.00 63.32 ? 136 LYS B HZ3  1  
ATOM 6419   N N    . THR B 2 137 ? 3.099   -3.015  -26.658 1.00 75.31 ? 137 THR B N    1  
ATOM 6420   C CA   . THR B 2 137 ? 3.325   -2.969  -28.123 1.00 61.34 ? 137 THR B CA   1  
ATOM 6421   C C    . THR B 2 137 ? 4.795   -3.290  -28.524 1.00 51.12 ? 137 THR B C    1  
ATOM 6422   O O    . THR B 2 137 ? 5.128   -4.438  -28.832 1.00 62.23 ? 137 THR B O    1  
ATOM 6423   C CB   . THR B 2 137 ? 2.870   -1.600  -28.744 1.00 74.44 ? 137 THR B CB   1  
ATOM 6424   O OG1  . THR B 2 137 ? 1.500   -1.337  -28.400 1.00 21.33 ? 137 THR B OG1  1  
ATOM 6425   C CG2  . THR B 2 137 ? 3.034   -1.581  -30.276 1.00 73.45 ? 137 THR B CG2  1  
ATOM 6426   H H    . THR B 2 137 ? 2.401   -3.611  -26.336 1.00 4.42  ? 137 THR B H    1  
ATOM 6427   H HA   . THR B 2 137 ? 2.694   -3.744  -28.547 1.00 52.52 ? 137 THR B HA   1  
ATOM 6428   H HB   . THR B 2 137 ? 3.486   -0.813  -28.320 1.00 1.34  ? 137 THR B HB   1  
ATOM 6429   H HG1  . THR B 2 137 ? 1.472   -0.687  -27.692 1.00 70.21 ? 137 THR B HG1  1  
ATOM 6430   H HG21 . THR B 2 137 ? 2.437   -2.366  -30.722 1.00 24.11 ? 137 THR B HG21 1  
ATOM 6431   H HG22 . THR B 2 137 ? 4.076   -1.732  -30.537 1.00 24.54 ? 137 THR B HG22 1  
ATOM 6432   H HG23 . THR B 2 137 ? 2.707   -0.628  -30.665 1.00 63.34 ? 137 THR B HG23 1  
ATOM 6433   N N    . TYR B 2 138 ? 5.664   -2.264  -28.470 1.00 65.44 ? 138 TYR B N    1  
ATOM 6434   C CA   . TYR B 2 138 ? 7.028   -2.305  -29.025 1.00 24.25 ? 138 TYR B CA   1  
ATOM 6435   C C    . TYR B 2 138 ? 8.010   -1.701  -27.993 1.00 63.41 ? 138 TYR B C    1  
ATOM 6436   O O    . TYR B 2 138 ? 7.578   -1.264  -26.913 1.00 24.43 ? 138 TYR B O    1  
ATOM 6437   C CB   . TYR B 2 138 ? 7.025   -1.527  -30.369 1.00 23.03 ? 138 TYR B CB   1  
ATOM 6438   C CG   . TYR B 2 138 ? 8.293   -1.672  -31.226 1.00 12.35 ? 138 TYR B CG   1  
ATOM 6439   C CD1  . TYR B 2 138 ? 8.729   -2.930  -31.652 1.00 75.21 ? 138 TYR B CD1  1  
ATOM 6440   C CD2  . TYR B 2 138 ? 9.031   -0.557  -31.629 1.00 35.51 ? 138 TYR B CD2  1  
ATOM 6441   C CE1  . TYR B 2 138 ? 9.857   -3.064  -32.439 1.00 1.43  ? 138 TYR B CE1  1  
ATOM 6442   C CE2  . TYR B 2 138 ? 10.155  -0.691  -32.415 1.00 63.21 ? 138 TYR B CE2  1  
ATOM 6443   C CZ   . TYR B 2 138 ? 10.565  -1.940  -32.820 1.00 75.52 ? 138 TYR B CZ   1  
ATOM 6444   O OH   . TYR B 2 138 ? 11.693  -2.062  -33.605 1.00 72.41 ? 138 TYR B OH   1  
ATOM 6445   H H    . TYR B 2 138 ? 5.380   -1.442  -28.016 1.00 3.44  ? 138 TYR B H    1  
ATOM 6446   H HA   . TYR B 2 138 ? 7.304   -3.341  -29.205 1.00 22.25 ? 138 TYR B HA   1  
ATOM 6447   H HB2  . TYR B 2 138 ? 6.190   -1.878  -30.969 1.00 40.12 ? 138 TYR B HB2  1  
ATOM 6448   H HB3  . TYR B 2 138 ? 6.870   -0.474  -30.160 1.00 42.12 ? 138 TYR B HB3  1  
ATOM 6449   H HD1  . TYR B 2 138 ? 8.172   -3.812  -31.354 1.00 62.21 ? 138 TYR B HD1  1  
ATOM 6450   H HD2  . TYR B 2 138 ? 8.713   0.426   -31.309 1.00 22.20 ? 138 TYR B HD2  1  
ATOM 6451   H HE1  . TYR B 2 138 ? 10.177  -4.046  -32.759 1.00 52.21 ? 138 TYR B HE1  1  
ATOM 6452   H HE2  . TYR B 2 138 ? 10.709  0.188   -32.710 1.00 54.21 ? 138 TYR B HE2  1  
ATOM 6453   H HH   . TYR B 2 138 ? 11.533  -2.711  -34.299 1.00 43.52 ? 138 TYR B HH   1  
ATOM 6454   N N    . ASN B 2 139 ? 9.332   -1.749  -28.262 1.00 23.42 ? 139 ASN B N    1  
ATOM 6455   C CA   . ASN B 2 139 ? 10.330  -1.189  -27.327 1.00 50.44 ? 139 ASN B CA   1  
ATOM 6456   C C    . ASN B 2 139 ? 10.398  0.351   -27.460 1.00 31.24 ? 139 ASN B C    1  
ATOM 6457   O O    . ASN B 2 139 ? 10.463  1.044   -26.450 1.00 73.24 ? 139 ASN B O    1  
ATOM 6458   C CB   . ASN B 2 139 ? 11.725  -1.862  -27.496 1.00 61.42 ? 139 ASN B CB   1  
ATOM 6459   C CG   . ASN B 2 139 ? 12.432  -1.588  -28.827 1.00 5.32  ? 139 ASN B CG   1  
ATOM 6460   O OD1  . ASN B 2 139 ? 11.795  -1.405  -29.856 1.00 30.12 ? 139 ASN B OD1  1  
ATOM 6461   N ND2  . ASN B 2 139 ? 13.757  -1.550  -28.805 1.00 40.21 ? 139 ASN B ND2  1  
ATOM 6462   H H    . ASN B 2 139 ? 9.642   -2.163  -29.098 1.00 30.01 ? 139 ASN B H    1  
ATOM 6463   H HA   . ASN B 2 139 ? 9.972   -1.414  -26.320 1.00 52.02 ? 139 ASN B HA   1  
ATOM 6464   H HB2  . ASN B 2 139 ? 12.370  -1.522  -26.695 1.00 33.11 ? 139 ASN B HB2  1  
ATOM 6465   H HB3  . ASN B 2 139 ? 11.601  -2.934  -27.400 1.00 33.22 ? 139 ASN B HB3  1  
ATOM 6466   H HD21 . ASN B 2 139 ? 14.211  -1.691  -27.948 1.00 21.44 ? 139 ASN B HD21 1  
ATOM 6467   H HD22 . ASN B 2 139 ? 14.232  -1.383  -29.648 1.00 63.41 ? 139 ASN B HD22 1  
ATOM 6468   N N    . GLY B 2 140 ? 10.357  0.858   -28.711 1.00 14.14 ? 140 GLY B N    1  
ATOM 6469   C CA   . GLY B 2 140 ? 10.240  2.302   -28.992 1.00 23.34 ? 140 GLY B CA   1  
ATOM 6470   C C    . GLY B 2 140 ? 11.349  3.170   -28.396 1.00 2.32  ? 140 GLY B C    1  
ATOM 6471   O O    . GLY B 2 140 ? 12.518  2.805   -28.487 1.00 65.04 ? 140 GLY B O    1  
ATOM 6472   H H    . GLY B 2 140 ? 10.402  0.235   -29.465 1.00 12.15 ? 140 GLY B H    1  
ATOM 6473   H HA2  . GLY B 2 140 ? 10.250  2.434   -30.061 1.00 13.30 ? 140 GLY B HA2  1  
ATOM 6474   H HA3  . GLY B 2 140 ? 9.289   2.642   -28.620 1.00 75.54 ? 140 GLY B HA3  1  
ATOM 6475   N N    . ALA B 2 141 ? 10.974  4.328   -27.807 1.00 45.44 ? 141 ALA B N    1  
ATOM 6476   C CA   . ALA B 2 141 ? 11.926  5.292   -27.198 1.00 34.13 ? 141 ALA B CA   1  
ATOM 6477   C C    . ALA B 2 141 ? 11.797  5.314   -25.662 1.00 23.11 ? 141 ALA B C    1  
ATOM 6478   O O    . ALA B 2 141 ? 12.803  5.424   -24.948 1.00 75.34 ? 141 ALA B O    1  
ATOM 6479   C CB   . ALA B 2 141 ? 11.673  6.696   -27.783 1.00 13.12 ? 141 ALA B CB   1  
ATOM 6480   H H    . ALA B 2 141 ? 10.013  4.559   -27.798 1.00 65.21 ? 141 ALA B H    1  
ATOM 6481   H HA   . ALA B 2 141 ? 12.941  4.996   -27.458 1.00 71.11 ? 141 ALA B HA   1  
ATOM 6482   H HB1  . ALA B 2 141 ? 10.673  7.030   -27.527 1.00 51.53 ? 141 ALA B HB1  1  
ATOM 6483   H HB2  . ALA B 2 141 ? 11.769  6.659   -28.859 1.00 33.34 ? 141 ALA B HB2  1  
ATOM 6484   H HB3  . ALA B 2 141 ? 12.395  7.400   -27.388 1.00 50.43 ? 141 ALA B HB3  1  
ATOM 6485   N N    . LEU B 2 142 ? 10.535  5.208   -25.193 1.00 23.43 ? 142 LEU B N    1  
ATOM 6486   C CA   . LEU B 2 142 ? 10.122  5.273   -23.765 1.00 62.02 ? 142 LEU B CA   1  
ATOM 6487   C C    . LEU B 2 142 ? 10.188  6.717   -23.219 1.00 31.23 ? 142 LEU B C    1  
ATOM 6488   O O    . LEU B 2 142 ? 10.686  7.632   -23.886 1.00 4.11  ? 142 LEU B O    1  
ATOM 6489   C CB   . LEU B 2 142 ? 10.917  4.301   -22.829 1.00 41.22 ? 142 LEU B CB   1  
ATOM 6490   C CG   . LEU B 2 142 ? 10.978  2.801   -23.261 1.00 32.35 ? 142 LEU B CG   1  
ATOM 6491   C CD1  . LEU B 2 142 ? 11.578  1.923   -22.141 1.00 41.23 ? 142 LEU B CD1  1  
ATOM 6492   C CD2  . LEU B 2 142 ? 9.598   2.271   -23.717 1.00 70.15 ? 142 LEU B CD2  1  
ATOM 6493   H H    . LEU B 2 142 ? 9.824   5.105   -25.855 1.00 72.21 ? 142 LEU B H    1  
ATOM 6494   H HA   . LEU B 2 142 ? 9.080   4.973   -23.753 1.00 2.35  ? 142 LEU B HA   1  
ATOM 6495   H HB2  . LEU B 2 142 ? 11.937  4.670   -22.751 1.00 14.33 ? 142 LEU B HB2  1  
ATOM 6496   H HB3  . LEU B 2 142 ? 10.468  4.352   -21.841 1.00 14.43 ? 142 LEU B HB3  1  
ATOM 6497   H HG   . LEU B 2 142 ? 11.645  2.724   -24.111 1.00 62.42 ? 142 LEU B HG   1  
ATOM 6498   H HD11 . LEU B 2 142 ? 12.574  2.274   -21.897 1.00 2.15  ? 142 LEU B HD11 1  
ATOM 6499   H HD12 . LEU B 2 142 ? 11.639  0.898   -22.476 1.00 74.24 ? 142 LEU B HD12 1  
ATOM 6500   H HD13 . LEU B 2 142 ? 10.953  1.974   -21.257 1.00 4.13  ? 142 LEU B HD13 1  
ATOM 6501   H HD21 . LEU B 2 142 ? 9.239   2.858   -24.553 1.00 50.43 ? 142 LEU B HD21 1  
ATOM 6502   H HD22 . LEU B 2 142 ? 8.890   2.339   -22.905 1.00 14.33 ? 142 LEU B HD22 1  
ATOM 6503   H HD23 . LEU B 2 142 ? 9.688   1.237   -24.027 1.00 42.34 ? 142 LEU B HD23 1  
ATOM 6504   N N    . GLY B 2 143 ? 9.665   6.898   -21.992 1.00 10.51 ? 143 GLY B N    1  
ATOM 6505   C CA   . GLY B 2 143 ? 9.677   8.195   -21.310 1.00 51.11 ? 143 GLY B CA   1  
ATOM 6506   C C    . GLY B 2 143 ? 8.557   9.126   -21.751 1.00 33.14 ? 143 GLY B C    1  
ATOM 6507   O O    . GLY B 2 143 ? 7.637   8.701   -22.464 1.00 61.25 ? 143 GLY B O    1  
ATOM 6508   H H    . GLY B 2 143 ? 9.257   6.134   -21.544 1.00 53.41 ? 143 GLY B H    1  
ATOM 6509   H HA2  . GLY B 2 143 ? 9.569   8.015   -20.252 1.00 21.11 ? 143 GLY B HA2  1  
ATOM 6510   H HA3  . GLY B 2 143 ? 10.631  8.685   -21.479 1.00 51.11 ? 143 GLY B HA3  1  
ATOM 6511   N N    . VAL B 2 144 ? 8.630   10.399  -21.268 1.00 43.41 ? 144 VAL B N    1  
ATOM 6512   C CA   . VAL B 2 144 ? 7.643   11.488  -21.528 1.00 75.31 ? 144 VAL B CA   1  
ATOM 6513   C C    . VAL B 2 144 ? 6.331   11.304  -20.702 1.00 44.12 ? 144 VAL B C    1  
ATOM 6514   O O    . VAL B 2 144 ? 5.728   12.298  -20.262 1.00 73.15 ? 144 VAL B O    1  
ATOM 6515   C CB   . VAL B 2 144 ? 7.331   11.714  -23.073 1.00 13.55 ? 144 VAL B CB   1  
ATOM 6516   C CG1  . VAL B 2 144 ? 6.382   12.918  -23.297 1.00 71.11 ? 144 VAL B CG1  1  
ATOM 6517   C CG2  . VAL B 2 144 ? 8.642   11.891  -23.889 1.00 1.01  ? 144 VAL B CG2  1  
ATOM 6518   H H    . VAL B 2 144 ? 9.394   10.620  -20.699 1.00 43.21 ? 144 VAL B H    1  
ATOM 6519   H HA   . VAL B 2 144 ? 8.118   12.398  -21.165 1.00 4.34  ? 144 VAL B HA   1  
ATOM 6520   H HB   . VAL B 2 144 ? 6.827   10.822  -23.443 1.00 63.34 ? 144 VAL B HB   1  
ATOM 6521   H HG11 . VAL B 2 144 ? 5.448   12.746  -22.775 1.00 60.13 ? 144 VAL B HG11 1  
ATOM 6522   H HG12 . VAL B 2 144 ? 6.178   13.037  -24.352 1.00 42.11 ? 144 VAL B HG12 1  
ATOM 6523   H HG13 . VAL B 2 144 ? 6.840   13.823  -22.917 1.00 12.41 ? 144 VAL B HG13 1  
ATOM 6524   H HG21 . VAL B 2 144 ? 8.409   12.015  -24.939 1.00 43.21 ? 144 VAL B HG21 1  
ATOM 6525   H HG22 . VAL B 2 144 ? 9.268   11.016  -23.767 1.00 72.45 ? 144 VAL B HG22 1  
ATOM 6526   H HG23 . VAL B 2 144 ? 9.180   12.763  -23.537 1.00 12.52 ? 144 VAL B HG23 1  
ATOM 6527   N N    . ASP B 2 145 ? 5.914   10.040  -20.472 1.00 4.34  ? 145 ASP B N    1  
ATOM 6528   C CA   . ASP B 2 145 ? 4.719   9.701   -19.680 1.00 21.30 ? 145 ASP B CA   1  
ATOM 6529   C C    . ASP B 2 145 ? 4.849   10.213  -18.219 1.00 64.30 ? 145 ASP B C    1  
ATOM 6530   O O    . ASP B 2 145 ? 5.671   9.726   -17.436 1.00 25.43 ? 145 ASP B O    1  
ATOM 6531   C CB   . ASP B 2 145 ? 4.446   8.160   -19.722 1.00 51.30 ? 145 ASP B CB   1  
ATOM 6532   C CG   . ASP B 2 145 ? 5.531   7.283   -19.052 1.00 24.14 ? 145 ASP B CG   1  
ATOM 6533   O OD1  . ASP B 2 145 ? 5.228   6.591   -18.050 1.00 63.24 ? 145 ASP B OD1  1  
ATOM 6534   O OD2  . ASP B 2 145 ? 6.707   7.306   -19.498 1.00 34.24 ? 145 ASP B OD2  1  
ATOM 6535   H H    . ASP B 2 145 ? 6.421   9.302   -20.864 1.00 75.32 ? 145 ASP B H    1  
ATOM 6536   H HA   . ASP B 2 145 ? 3.879   10.203  -20.149 1.00 32.52 ? 145 ASP B HA   1  
ATOM 6537   H HB2  . ASP B 2 145 ? 3.491   7.966   -19.239 1.00 71.12 ? 145 ASP B HB2  1  
ATOM 6538   H HB3  . ASP B 2 145 ? 4.358   7.852   -20.762 1.00 4.45  ? 145 ASP B HB3  1  
ATOM 6539   N N    . ILE B 2 146 ? 4.101   11.287  -17.913 1.00 34.44 ? 146 ILE B N    1  
ATOM 6540   C CA   . ILE B 2 146 ? 3.956   11.847  -16.546 1.00 70.25 ? 146 ILE B CA   1  
ATOM 6541   C C    . ILE B 2 146 ? 2.447   11.981  -16.247 1.00 3.25  ? 146 ILE B C    1  
ATOM 6542   O O    . ILE B 2 146 ? 1.881   11.180  -15.495 1.00 53.31 ? 146 ILE B O    1  
ATOM 6543   C CB   . ILE B 2 146 ? 4.678   13.254  -16.399 1.00 53.25 ? 146 ILE B CB   1  
ATOM 6544   C CG1  . ILE B 2 146 ? 6.217   13.128  -16.651 1.00 24.21 ? 146 ILE B CG1  1  
ATOM 6545   C CG2  . ILE B 2 146 ? 4.390   13.919  -15.021 1.00 72.52 ? 146 ILE B CG2  1  
ATOM 6546   C CD1  . ILE B 2 146 ? 6.982   14.447  -16.627 1.00 3.05  ? 146 ILE B CD1  1  
ATOM 6547   H H    . ILE B 2 146 ? 3.632   11.736  -18.646 1.00 12.14 ? 146 ILE B H    1  
ATOM 6548   H HA   . ILE B 2 146 ? 4.395   11.149  -15.827 1.00 24.10 ? 146 ILE B HA   1  
ATOM 6549   H HB   . ILE B 2 146 ? 4.256   13.904  -17.161 1.00 14.35 ? 146 ILE B HB   1  
ATOM 6550   H HG12 . ILE B 2 146 ? 6.652   12.490  -15.892 1.00 12.33 ? 146 ILE B HG12 1  
ATOM 6551   H HG13 . ILE B 2 146 ? 6.379   12.671  -17.621 1.00 23.14 ? 146 ILE B HG13 1  
ATOM 6552   H HG21 . ILE B 2 146 ? 4.869   14.887  -14.974 1.00 11.14 ? 146 ILE B HG21 1  
ATOM 6553   H HG22 . ILE B 2 146 ? 4.772   13.295  -14.219 1.00 45.42 ? 146 ILE B HG22 1  
ATOM 6554   H HG23 . ILE B 2 146 ? 3.323   14.044  -14.891 1.00 52.31 ? 146 ILE B HG23 1  
ATOM 6555   H HD11 . ILE B 2 146 ? 8.024   14.261  -16.839 1.00 13.33 ? 146 ILE B HD11 1  
ATOM 6556   H HD12 . ILE B 2 146 ? 6.892   14.900  -15.650 1.00 55.14 ? 146 ILE B HD12 1  
ATOM 6557   H HD13 . ILE B 2 146 ? 6.578   15.120  -17.374 1.00 53.35 ? 146 ILE B HD13 1  
ATOM 6558   N N    . HIS B 2 147 ? 1.821   12.998  -16.888 1.00 63.41 ? 147 HIS B N    1  
ATOM 6559   C CA   . HIS B 2 147 ? 0.369   13.248  -16.880 1.00 13.31 ? 147 HIS B CA   1  
ATOM 6560   C C    . HIS B 2 147 ? -0.188  13.791  -15.536 1.00 23.10 ? 147 HIS B C    1  
ATOM 6561   O O    . HIS B 2 147 ? -0.819  14.846  -15.533 1.00 33.31 ? 147 HIS B O    1  
ATOM 6562   C CB   . HIS B 2 147 ? -0.428  11.998  -17.325 1.00 31.04 ? 147 HIS B CB   1  
ATOM 6563   C CG   . HIS B 2 147 ? -1.915  12.128  -17.145 1.00 72.43 ? 147 HIS B CG   1  
ATOM 6564   N ND1  . HIS B 2 147 ? -2.562  11.677  -16.021 1.00 35.54 ? 147 HIS B ND1  1  
ATOM 6565   C CD2  . HIS B 2 147 ? -2.858  12.731  -17.908 1.00 44.14 ? 147 HIS B CD2  1  
ATOM 6566   C CE1  . HIS B 2 147 ? -3.824  11.990  -16.099 1.00 2.23  ? 147 HIS B CE1  1  
ATOM 6567   N NE2  . HIS B 2 147 ? -4.039  12.619  -17.236 1.00 25.21 ? 147 HIS B NE2  1  
ATOM 6568   H H    . HIS B 2 147 ? 2.379   13.619  -17.404 1.00 53.45 ? 147 HIS B H    1  
ATOM 6569   H HA   . HIS B 2 147 ? 0.212   14.018  -17.634 1.00 11.22 ? 147 HIS B HA   1  
ATOM 6570   H HB2  . HIS B 2 147 ? -0.233  11.806  -18.373 1.00 44.30 ? 147 HIS B HB2  1  
ATOM 6571   H HB3  . HIS B 2 147 ? -0.095  11.141  -16.749 1.00 41.24 ? 147 HIS B HB3  1  
ATOM 6572   H HD1  . HIS B 2 147 ? -2.147  11.204  -15.262 1.00 15.20 ? 147 HIS B HD1  1  
ATOM 6573   H HD2  . HIS B 2 147 ? -2.704  13.217  -18.867 1.00 61.05 ? 147 HIS B HD2  1  
ATOM 6574   H HE1  . HIS B 2 147 ? -4.577  11.765  -15.356 1.00 40.34 ? 147 HIS B HE1  1  
ATOM 6575   H HE2  . HIS B 2 147 ? -4.922  12.820  -17.601 1.00 37.66 ? 147 HIS B HE2  1  
ATOM 6576   N N    . GLU B 2 148 ? 0.047   13.049  -14.433 1.00 73.05 ? 148 GLU B N    1  
ATOM 6577   C CA   . GLU B 2 148 ? -0.783  13.085  -13.206 1.00 64.42 ? 148 GLU B CA   1  
ATOM 6578   C C    . GLU B 2 148 ? -1.151  14.486  -12.693 1.00 63.40 ? 148 GLU B C    1  
ATOM 6579   O O    . GLU B 2 148 ? -0.336  15.402  -12.695 1.00 43.10 ? 148 GLU B O    1  
ATOM 6580   C CB   . GLU B 2 148 ? -0.138  12.222  -12.083 1.00 41.32 ? 148 GLU B CB   1  
ATOM 6581   C CG   . GLU B 2 148 ? -0.603  10.755  -12.097 1.00 34.05 ? 148 GLU B CG   1  
ATOM 6582   C CD   . GLU B 2 148 ? -2.116  10.625  -11.830 1.00 63.13 ? 148 GLU B CD   1  
ATOM 6583   O OE1  . GLU B 2 148 ? -2.914  10.679  -12.797 1.00 14.23 ? 148 GLU B OE1  1  
ATOM 6584   O OE2  . GLU B 2 148 ? -2.515  10.516  -10.653 1.00 24.13 ? 148 GLU B OE2  1  
ATOM 6585   H H    . GLU B 2 148 ? 0.828   12.468  -14.426 1.00 12.20 ? 148 GLU B H    1  
ATOM 6586   H HA   . GLU B 2 148 ? -1.712  12.604  -13.493 1.00 75.05 ? 148 GLU B HA   1  
ATOM 6587   H HB2  . GLU B 2 148 ? 0.940   12.243  -12.196 1.00 74.10 ? 148 GLU B HB2  1  
ATOM 6588   H HB3  . GLU B 2 148 ? -0.386  12.641  -11.115 1.00 14.40 ? 148 GLU B HB3  1  
ATOM 6589   H HG2  . GLU B 2 148 ? -0.373  10.328  -13.067 1.00 44.05 ? 148 GLU B HG2  1  
ATOM 6590   H HG3  . GLU B 2 148 ? -0.059  10.204  -11.336 1.00 12.34 ? 148 GLU B HG3  1  
ATOM 6591   N N    . LYS B 2 149 ? -2.421  14.601  -12.259 1.00 13.32 ? 149 LYS B N    1  
ATOM 6592   C CA   . LYS B 2 149 ? -3.047  15.861  -11.850 1.00 21.33 ? 149 LYS B CA   1  
ATOM 6593   C C    . LYS B 2 149 ? -3.577  15.731  -10.408 1.00 72.23 ? 149 LYS B C    1  
ATOM 6594   O O    . LYS B 2 149 ? -2.818  15.959  -9.470  1.00 32.51 ? 149 LYS B O    1  
ATOM 6595   C CB   . LYS B 2 149 ? -4.173  16.233  -12.856 1.00 10.44 ? 149 LYS B CB   1  
ATOM 6596   C CG   . LYS B 2 149 ? -3.707  16.409  -14.328 1.00 1.02  ? 149 LYS B CG   1  
ATOM 6597   C CD   . LYS B 2 149 ? -4.878  16.297  -15.321 1.00 14.14 ? 149 LYS B CD   1  
ATOM 6598   C CE   . LYS B 2 149 ? -5.562  14.923  -15.238 1.00 54.45 ? 149 LYS B CE   1  
ATOM 6599   N NZ   . LYS B 2 149 ? -6.740  14.828  -16.117 1.00 31.21 ? 149 LYS B NZ   1  
ATOM 6600   H H    . LYS B 2 149 ? -2.957  13.783  -12.200 1.00 22.02 ? 149 LYS B H    1  
ATOM 6601   H HA   . LYS B 2 149 ? -2.291  16.643  -11.859 1.00 11.42 ? 149 LYS B HA   1  
ATOM 6602   H HB2  . LYS B 2 149 ? -4.927  15.451  -12.823 1.00 64.33 ? 149 LYS B HB2  1  
ATOM 6603   H HB3  . LYS B 2 149 ? -4.633  17.159  -12.533 1.00 32.54 ? 149 LYS B HB3  1  
ATOM 6604   H HG2  . LYS B 2 149 ? -3.249  17.389  -14.439 1.00 24.41 ? 149 LYS B HG2  1  
ATOM 6605   H HG3  . LYS B 2 149 ? -2.972  15.647  -14.562 1.00 0.44  ? 149 LYS B HG3  1  
ATOM 6606   H HD2  . LYS B 2 149 ? -5.609  17.068  -15.097 1.00 62.22 ? 149 LYS B HD2  1  
ATOM 6607   H HD3  . LYS B 2 149 ? -4.502  16.444  -16.327 1.00 73.40 ? 149 LYS B HD3  1  
ATOM 6608   H HE2  . LYS B 2 149 ? -4.853  14.163  -15.531 1.00 1.11  ? 149 LYS B HE2  1  
ATOM 6609   H HE3  . LYS B 2 149 ? -5.876  14.738  -14.216 1.00 4.42  ? 149 LYS B HE3  1  
ATOM 6610   H HZ1  . LYS B 2 149 ? -6.468  14.997  -17.106 1.00 31.23 ? 149 LYS B HZ1  1  
ATOM 6611   H HZ2  . LYS B 2 149 ? -7.453  15.535  -15.840 1.00 74.13 ? 149 LYS B HZ2  1  
ATOM 6612   H HZ3  . LYS B 2 149 ? -7.167  13.879  -16.049 1.00 42.34 ? 149 LYS B HZ3  1  
ATOM 6613   N N    . ASP B 2 150 ? -4.874  15.356  -10.261 1.00 11.12 ? 150 ASP B N    1  
ATOM 6614   C CA   . ASP B 2 150 ? -5.526  15.032  -8.975  1.00 12.24 ? 150 ASP B CA   1  
ATOM 6615   C C    . ASP B 2 150 ? -7.013  14.696  -9.274  1.00 74.11 ? 150 ASP B C    1  
ATOM 6616   O O    . ASP B 2 150 ? -7.268  13.823  -10.114 1.00 2.53  ? 150 ASP B O    1  
ATOM 6617   C CB   . ASP B 2 150 ? -5.350  16.155  -7.891  1.00 41.44 ? 150 ASP B CB   1  
ATOM 6618   C CG   . ASP B 2 150 ? -5.912  15.755  -6.515  1.00 11.30 ? 150 ASP B CG   1  
ATOM 6619   O OD1  . ASP B 2 150 ? -5.449  14.750  -5.937  1.00 13.12 ? 150 ASP B OD1  1  
ATOM 6620   O OD2  . ASP B 2 150 ? -6.868  16.398  -6.034  1.00 3.35  ? 150 ASP B OD2  1  
ATOM 6621   H H    . ASP B 2 150 ? -5.425  15.288  -11.067 1.00 12.13 ? 150 ASP B H    1  
ATOM 6622   H HA   . ASP B 2 150 ? -5.054  14.122  -8.612  1.00 55.31 ? 150 ASP B HA   1  
ATOM 6623   H HB2  . ASP B 2 150 ? -4.293  16.374  -7.773  1.00 50.53 ? 150 ASP B HB2  1  
ATOM 6624   H HB3  . ASP B 2 150 ? -5.851  17.058  -8.235  1.00 71.44 ? 150 ASP B HB3  1  
ATOM 6625   N N    . HIS B 2 151 ? -7.979  15.401  -8.634  1.00 74.41 ? 151 HIS B N    1  
ATOM 6626   C CA   . HIS B 2 151 ? -9.416  15.151  -8.764  1.00 62.12 ? 151 HIS B CA   1  
ATOM 6627   C C    . HIS B 2 151 ? -10.191 16.216  -7.953  1.00 43.32 ? 151 HIS B C    1  
ATOM 6628   O O    . HIS B 2 151 ? -10.059 16.271  -6.725  1.00 4.54  ? 151 HIS B O    1  
ATOM 6629   C CB   . HIS B 2 151 ? -9.806  13.714  -8.293  1.00 14.03 ? 151 HIS B CB   1  
ATOM 6630   C CG   . HIS B 2 151 ? -9.558  13.382  -6.832  1.00 74.43 ? 151 HIS B CG   1  
ATOM 6631   N ND1  . HIS B 2 151 ? -8.347  13.558  -6.201  1.00 42.13 ? 151 HIS B ND1  1  
ATOM 6632   C CD2  . HIS B 2 151 ? -10.380 12.842  -5.897  1.00 62.22 ? 151 HIS B CD2  1  
ATOM 6633   C CE1  . HIS B 2 151 ? -8.440  13.164  -4.945  1.00 11.41 ? 151 HIS B CE1  1  
ATOM 6634   N NE2  . HIS B 2 151 ? -9.666  12.720  -4.734  1.00 44.44 ? 151 HIS B NE2  1  
ATOM 6635   H H    . HIS B 2 151 ? -7.714  16.133  -8.053  1.00 40.34 ? 151 HIS B H    1  
ATOM 6636   H HA   . HIS B 2 151 ? -9.670  15.254  -9.814  1.00 21.50 ? 151 HIS B HA   1  
ATOM 6637   H HB2  . HIS B 2 151 ? -10.860 13.570  -8.482  1.00 34.42 ? 151 HIS B HB2  1  
ATOM 6638   H HB3  . HIS B 2 151 ? -9.250  13.001  -8.891  1.00 4.22  ? 151 HIS B HB3  1  
ATOM 6639   H HD1  . HIS B 2 151 ? -7.542  13.954  -6.599  1.00 50.33 ? 151 HIS B HD1  1  
ATOM 6640   H HD2  . HIS B 2 151 ? -11.413 12.557  -6.046  1.00 61.23 ? 151 HIS B HD2  1  
ATOM 6641   H HE1  . HIS B 2 151 ? -7.641  13.176  -4.219  1.00 12.32 ? 151 HIS B HE1  1  
ATOM 6642   H HE2  . HIS B 2 151 ? -10.069 12.644  -3.847  1.00 37.66 ? 151 HIS B HE2  1  
ATOM 6643   N N    . PRO B 2 152 ? -10.975 17.114  -8.621  1.00 42.51 ? 152 PRO B N    1  
ATOM 6644   C CA   . PRO B 2 152 ? -11.918 18.012  -7.919  1.00 1.41  ? 152 PRO B CA   1  
ATOM 6645   C C    . PRO B 2 152 ? -13.198 17.250  -7.503  1.00 31.35 ? 152 PRO B C    1  
ATOM 6646   O O    . PRO B 2 152 ? -13.956 17.700  -6.640  1.00 14.44 ? 152 PRO B O    1  
ATOM 6647   C CB   . PRO B 2 152 ? -12.220 19.087  -8.993  1.00 40.40 ? 152 PRO B CB   1  
ATOM 6648   C CG   . PRO B 2 152 ? -12.121 18.345  -10.290 1.00 4.23  ? 152 PRO B CG   1  
ATOM 6649   C CD   . PRO B 2 152 ? -10.993 17.351  -10.094 1.00 34.12 ? 152 PRO B CD   1  
ATOM 6650   H HA   . PRO B 2 152 ? -11.462 18.471  -7.047  1.00 34.20 ? 152 PRO B HA   1  
ATOM 6651   H HB2  . PRO B 2 152 ? -13.213 19.508  -8.850  1.00 13.33 ? 152 PRO B HB2  1  
ATOM 6652   H HB3  . PRO B 2 152 ? -11.477 19.876  -8.956  1.00 21.40 ? 152 PRO B HB3  1  
ATOM 6653   H HG2  . PRO B 2 152 ? -13.058 17.827  -10.490 1.00 33.23 ? 152 PRO B HG2  1  
ATOM 6654   H HG3  . PRO B 2 152 ? -11.886 19.021  -11.100 1.00 42.03 ? 152 PRO B HG3  1  
ATOM 6655   H HD2  . PRO B 2 152 ? -11.199 16.431  -10.629 1.00 21.21 ? 152 PRO B HD2  1  
ATOM 6656   H HD3  . PRO B 2 152 ? -10.045 17.767  -10.423 1.00 64.13 ? 152 PRO B HD3  1  
ATOM 6657   N N    . THR B 2 153 ? -13.410 16.083  -8.145  1.00 34.14 ? 153 THR B N    1  
ATOM 6658   C CA   . THR B 2 153 ? -14.589 15.240  -7.960  1.00 53.45 ? 153 THR B CA   1  
ATOM 6659   C C    . THR B 2 153 ? -14.177 13.938  -7.243  1.00 55.42 ? 153 THR B C    1  
ATOM 6660   O O    . THR B 2 153 ? -13.189 13.295  -7.628  1.00 74.20 ? 153 THR B O    1  
ATOM 6661   C CB   . THR B 2 153 ? -15.237 14.928  -9.352  1.00 73.33 ? 153 THR B CB   1  
ATOM 6662   O OG1  . THR B 2 153 ? -15.410 16.162  -10.081 1.00 53.53 ? 153 THR B OG1  1  
ATOM 6663   C CG2  . THR B 2 153 ? -16.600 14.217  -9.214  1.00 55.43 ? 153 THR B CG2  1  
ATOM 6664   H H    . THR B 2 153 ? -12.727 15.774  -8.773  1.00 1.32  ? 153 THR B H    1  
ATOM 6665   H HA   . THR B 2 153 ? -15.318 15.780  -7.350  1.00 41.52 ? 153 THR B HA   1  
ATOM 6666   H HB   . THR B 2 153 ? -14.562 14.288  -9.919  1.00 64.24 ? 153 THR B HB   1  
ATOM 6667   H HG1  . THR B 2 153 ? -15.112 16.901  -9.536  1.00 40.42 ? 153 THR B HG1  1  
ATOM 6668   H HG21 . THR B 2 153 ? -16.476 13.293  -8.662  1.00 73.05 ? 153 THR B HG21 1  
ATOM 6669   H HG22 . THR B 2 153 ? -17.001 13.992  -10.195 1.00 42.44 ? 153 THR B HG22 1  
ATOM 6670   H HG23 . THR B 2 153 ? -17.292 14.857  -8.685  1.00 12.12 ? 153 THR B HG23 1  
ATOM 6671   N N    . ILE B 2 154 ? -14.931 13.583  -6.198  1.00 52.13 ? 154 ILE B N    1  
ATOM 6672   C CA   . ILE B 2 154 ? -14.714 12.374  -5.386  1.00 53.21 ? 154 ILE B CA   1  
ATOM 6673   C C    . ILE B 2 154 ? -16.098 11.799  -5.000  1.00 22.33 ? 154 ILE B C    1  
ATOM 6674   O O    . ILE B 2 154 ? -17.104 12.514  -5.093  1.00 74.25 ? 154 ILE B O    1  
ATOM 6675   C CB   . ILE B 2 154 ? -13.837 12.731  -4.112  1.00 41.54 ? 154 ILE B CB   1  
ATOM 6676   C CG1  . ILE B 2 154 ? -13.361 11.449  -3.347  1.00 13.44 ? 154 ILE B CG1  1  
ATOM 6677   C CG2  . ILE B 2 154 ? -14.591 13.703  -3.166  1.00 3.22  ? 154 ILE B CG2  1  
ATOM 6678   C CD1  . ILE B 2 154 ? -12.430 11.706  -2.169  1.00 51.13 ? 154 ILE B CD1  1  
ATOM 6679   H H    . ILE B 2 154 ? -15.682 14.168  -5.948  1.00 2.20  ? 154 ILE B H    1  
ATOM 6680   H HA   . ILE B 2 154 ? -14.183 11.637  -5.988  1.00 2.03  ? 154 ILE B HA   1  
ATOM 6681   H HB   . ILE B 2 154 ? -12.955 13.259  -4.474  1.00 11.13 ? 154 ILE B HB   1  
ATOM 6682   H HG12 . ILE B 2 154 ? -14.223 10.923  -2.962  1.00 62.20 ? 154 ILE B HG12 1  
ATOM 6683   H HG13 . ILE B 2 154 ? -12.838 10.797  -4.037  1.00 51.44 ? 154 ILE B HG13 1  
ATOM 6684   H HG21 . ILE B 2 154 ? -13.957 13.970  -2.329  1.00 40.33 ? 154 ILE B HG21 1  
ATOM 6685   H HG22 . ILE B 2 154 ? -15.491 13.230  -2.793  1.00 3.05  ? 154 ILE B HG22 1  
ATOM 6686   H HG23 . ILE B 2 154 ? -14.860 14.603  -3.706  1.00 61.44 ? 154 ILE B HG23 1  
ATOM 6687   H HD11 . ILE B 2 154 ? -11.540 12.220  -2.508  1.00 25.11 ? 154 ILE B HD11 1  
ATOM 6688   H HD12 . ILE B 2 154 ? -12.149 10.762  -1.725  1.00 42.40 ? 154 ILE B HD12 1  
ATOM 6689   H HD13 . ILE B 2 154 ? -12.938 12.309  -1.431  1.00 22.53 ? 154 ILE B HD13 1  
ATOM 6690   N N    . LEU B 2 155 ? -16.133 10.506  -4.610  1.00 61.54 ? 155 LEU B N    1  
ATOM 6691   C CA   . LEU B 2 155 ? -17.356 9.788   -4.143  1.00 3.23  ? 155 LEU B CA   1  
ATOM 6692   C C    . LEU B 2 155 ? -18.365 9.524   -5.287  1.00 30.23 ? 155 LEU B C    1  
ATOM 6693   O O    . LEU B 2 155 ? -18.174 9.986   -6.416  1.00 44.12 ? 155 LEU B O    1  
ATOM 6694   C CB   . LEU B 2 155 ? -18.049 10.548  -2.968  1.00 50.34 ? 155 LEU B CB   1  
ATOM 6695   C CG   . LEU B 2 155 ? -17.161 10.857  -1.720  1.00 23.01 ? 155 LEU B CG   1  
ATOM 6696   C CD1  . LEU B 2 155 ? -17.904 11.764  -0.716  1.00 72.10 ? 155 LEU B CD1  1  
ATOM 6697   C CD2  . LEU B 2 155 ? -16.656 9.558   -1.049  1.00 11.01 ? 155 LEU B CD2  1  
ATOM 6698   H H    . LEU B 2 155 ? -15.302 10.005  -4.638  1.00 42.22 ? 155 LEU B H    1  
ATOM 6699   H HA   . LEU B 2 155 ? -17.018 8.825   -3.775  1.00 20.45 ? 155 LEU B HA   1  
ATOM 6700   H HB2  . LEU B 2 155 ? -18.422 11.491  -3.359  1.00 32.34 ? 155 LEU B HB2  1  
ATOM 6701   H HB3  . LEU B 2 155 ? -18.902 9.960   -2.643  1.00 21.10 ? 155 LEU B HB3  1  
ATOM 6702   H HG   . LEU B 2 155 ? -16.288 11.406  -2.055  1.00 30.22 ? 155 LEU B HG   1  
ATOM 6703   H HD11 . LEU B 2 155 ? -17.253 11.991  0.119   1.00 64.41 ? 155 LEU B HD11 1  
ATOM 6704   H HD12 . LEU B 2 155 ? -18.793 11.267  -0.351  1.00 42.10 ? 155 LEU B HD12 1  
ATOM 6705   H HD13 . LEU B 2 155 ? -18.185 12.688  -1.203  1.00 43.24 ? 155 LEU B HD13 1  
ATOM 6706   H HD21 . LEU B 2 155 ? -16.057 8.995   -1.756  1.00 43.01 ? 155 LEU B HD21 1  
ATOM 6707   H HD22 . LEU B 2 155 ? -17.493 8.953   -0.729  1.00 73.12 ? 155 LEU B HD22 1  
ATOM 6708   H HD23 . LEU B 2 155 ? -16.043 9.805   -0.192  1.00 34.14 ? 155 LEU B HD23 1  
ATOM 6709   N N    . GLU B 2 156 ? -19.421 8.748   -4.967  1.00 72.23 ? 156 GLU B N    1  
ATOM 6710   C CA   . GLU B 2 156 ? -20.582 8.502   -5.848  1.00 12.24 ? 156 GLU B CA   1  
ATOM 6711   C C    . GLU B 2 156 ? -21.655 7.715   -5.047  1.00 35.03 ? 156 GLU B C    1  
ATOM 6712   O O    . GLU B 2 156 ? -21.717 7.854   -3.814  1.00 3.43  ? 156 GLU B O    1  
ATOM 6713   C CB   . GLU B 2 156 ? -20.173 7.730   -7.146  1.00 30.21 ? 156 GLU B CB   1  
ATOM 6714   C CG   . GLU B 2 156 ? -19.623 6.288   -6.928  1.00 33.11 ? 156 GLU B CG   1  
ATOM 6715   C CD   . GLU B 2 156 ? -20.112 5.301   -7.998  1.00 15.22 ? 156 GLU B CD   1  
ATOM 6716   O OE1  . GLU B 2 156 ? -19.658 5.402   -9.167  1.00 22.51 ? 156 GLU B OE1  1  
ATOM 6717   O OE2  . GLU B 2 156 ? -20.970 4.438   -7.685  1.00 25.03 ? 156 GLU B OE2  1  
ATOM 6718   H H    . GLU B 2 156 ? -19.425 8.312   -4.087  1.00 3.04  ? 156 GLU B H    1  
ATOM 6719   H HA   . GLU B 2 156 ? -21.004 9.469   -6.118  1.00 12.43 ? 156 GLU B HA   1  
ATOM 6720   H HB2  . GLU B 2 156 ? -21.043 7.679   -7.794  1.00 44.12 ? 156 GLU B HB2  1  
ATOM 6721   H HB3  . GLU B 2 156 ? -19.412 8.311   -7.658  1.00 41.23 ? 156 GLU B HB3  1  
ATOM 6722   H HG2  . GLU B 2 156 ? -18.537 6.319   -6.958  1.00 10.45 ? 156 GLU B HG2  1  
ATOM 6723   H HG3  . GLU B 2 156 ? -19.929 5.933   -5.946  1.00 63.34 ? 156 GLU B HG3  1  
ATOM 6724   N N    . MET B 2 157 ? -22.522 6.938   -5.760  1.00 23.33 ? 157 MET B N    1  
ATOM 6725   C CA   . MET B 2 157 ? -23.503 6.018   -5.142  1.00 45.42 ? 157 MET B CA   1  
ATOM 6726   C C    . MET B 2 157 ? -22.811 5.063   -4.134  1.00 42.01 ? 157 MET B C    1  
ATOM 6727   O O    . MET B 2 157 ? -22.916 5.278   -2.918  1.00 41.21 ? 157 MET B O    1  
ATOM 6728   C CB   . MET B 2 157 ? -24.261 5.201   -6.235  1.00 21.25 ? 157 MET B CB   1  
ATOM 6729   C CG   . MET B 2 157 ? -25.022 6.049   -7.263  1.00 53.54 ? 157 MET B CG   1  
ATOM 6730   S SD   . MET B 2 157 ? -25.947 5.044   -8.450  1.00 41.24 ? 157 MET B SD   1  
ATOM 6731   C CE   . MET B 2 157 ? -26.726 6.288   -9.485  1.00 22.02 ? 157 MET B CE   1  
ATOM 6732   H H    . MET B 2 157 ? -22.502 6.997   -6.737  1.00 23.11 ? 157 MET B H    1  
ATOM 6733   H HA   . MET B 2 157 ? -24.224 6.630   -4.606  1.00 43.32 ? 157 MET B HA   1  
ATOM 6734   H HB2  . MET B 2 157 ? -23.546 4.587   -6.773  1.00 15.42 ? 157 MET B HB2  1  
ATOM 6735   H HB3  . MET B 2 157 ? -24.975 4.546   -5.748  1.00 61.13 ? 157 MET B HB3  1  
ATOM 6736   H HG2  . MET B 2 157 ? -25.720 6.691   -6.739  1.00 1.12  ? 157 MET B HG2  1  
ATOM 6737   H HG3  . MET B 2 157 ? -24.314 6.663   -7.806  1.00 31.34 ? 157 MET B HG3  1  
ATOM 6738   H HE1  . MET B 2 157 ? -27.311 5.805   -10.253 1.00 32.02 ? 157 MET B HE1  1  
ATOM 6739   H HE2  . MET B 2 157 ? -25.965 6.901   -9.947  1.00 54.05 ? 157 MET B HE2  1  
ATOM 6740   H HE3  . MET B 2 157 ? -27.369 6.911   -8.878  1.00 13.04 ? 157 MET B HE3  1  
ATOM 6741   N N    . ALA B 2 158 ? -22.077 4.053   -4.663  1.00 2.51  ? 158 ALA B N    1  
ATOM 6742   C CA   . ALA B 2 158 ? -21.337 3.039   -3.864  1.00 20.35 ? 158 ALA B CA   1  
ATOM 6743   C C    . ALA B 2 158 ? -20.796 1.957   -4.808  1.00 23.11 ? 158 ALA B C    1  
ATOM 6744   O O    . ALA B 2 158 ? -19.589 1.880   -5.058  1.00 34.04 ? 158 ALA B O    1  
ATOM 6745   C CB   . ALA B 2 158 ? -22.212 2.373   -2.762  1.00 22.12 ? 158 ALA B CB   1  
ATOM 6746   H H    . ALA B 2 158 ? -22.009 4.001   -5.645  1.00 43.50 ? 158 ALA B H    1  
ATOM 6747   H HA   . ALA B 2 158 ? -20.502 3.545   -3.384  1.00 13.32 ? 158 ALA B HA   1  
ATOM 6748   H HB1  . ALA B 2 158 ? -22.596 3.134   -2.093  1.00 23.25 ? 158 ALA B HB1  1  
ATOM 6749   H HB2  . ALA B 2 158 ? -21.616 1.673   -2.193  1.00 43.31 ? 158 ALA B HB2  1  
ATOM 6750   H HB3  . ALA B 2 158 ? -23.041 1.848   -3.220  1.00 65.11 ? 158 ALA B HB3  1  
ATOM 6751   N N    . LYS B 2 159 ? -21.747 1.142   -5.330  1.00 55.45 ? 159 LYS B N    1  
ATOM 6752   C CA   . LYS B 2 159 ? -21.494 -0.032  -6.192  1.00 10.12 ? 159 LYS B CA   1  
ATOM 6753   C C    . LYS B 2 159 ? -20.364 -0.939  -5.648  1.00 51.21 ? 159 LYS B C    1  
ATOM 6754   O O    . LYS B 2 159 ? -19.263 -1.000  -6.214  1.00 25.02 ? 159 LYS B O    1  
ATOM 6755   C CB   . LYS B 2 159 ? -21.236 0.381   -7.672  1.00 22.23 ? 159 LYS B CB   1  
ATOM 6756   C CG   . LYS B 2 159 ? -22.420 1.085   -8.371  1.00 21.14 ? 159 LYS B CG   1  
ATOM 6757   C CD   . LYS B 2 159 ? -22.239 1.161   -9.908  1.00 44.03 ? 159 LYS B CD   1  
ATOM 6758   C CE   . LYS B 2 159 ? -21.045 2.027   -10.350 1.00 42.12 ? 159 LYS B CE   1  
ATOM 6759   N NZ   . LYS B 2 159 ? -21.346 3.472   -10.331 1.00 1.14  ? 159 LYS B NZ   1  
ATOM 6760   H H    . LYS B 2 159 ? -22.677 1.349   -5.118  1.00 63.13 ? 159 LYS B H    1  
ATOM 6761   H HA   . LYS B 2 159 ? -22.410 -0.618  -6.170  1.00 72.45 ? 159 LYS B HA   1  
ATOM 6762   H HB2  . LYS B 2 159 ? -20.381 1.050   -7.699  1.00 73.24 ? 159 LYS B HB2  1  
ATOM 6763   H HB3  . LYS B 2 159 ? -20.987 -0.510  -8.243  1.00 21.14 ? 159 LYS B HB3  1  
ATOM 6764   H HG2  . LYS B 2 159 ? -23.331 0.536   -8.156  1.00 60.22 ? 159 LYS B HG2  1  
ATOM 6765   H HG3  . LYS B 2 159 ? -22.512 2.091   -7.973  1.00 1.54  ? 159 LYS B HG3  1  
ATOM 6766   H HD2  . LYS B 2 159 ? -22.092 0.156   -10.289 1.00 62.02 ? 159 LYS B HD2  1  
ATOM 6767   H HD3  . LYS B 2 159 ? -23.146 1.568   -10.345 1.00 35.03 ? 159 LYS B HD3  1  
ATOM 6768   H HE2  . LYS B 2 159 ? -20.206 1.841   -9.695  1.00 62.53 ? 159 LYS B HE2  1  
ATOM 6769   H HE3  . LYS B 2 159 ? -20.768 1.748   -11.360 1.00 13.40 ? 159 LYS B HE3  1  
ATOM 6770   H HZ1  . LYS B 2 159 ? -20.479 4.020   -10.499 1.00 34.45 ? 159 LYS B HZ1  1  
ATOM 6771   H HZ2  . LYS B 2 159 ? -21.739 3.748   -9.408  1.00 4.31  ? 159 LYS B HZ2  1  
ATOM 6772   H HZ3  . LYS B 2 159 ? -22.037 3.700   -11.077 1.00 63.51 ? 159 LYS B HZ3  1  
ATOM 6773   N N    . ALA B 2 160 ? -20.640 -1.613  -4.519  1.00 52.20 ? 160 ALA B N    1  
ATOM 6774   C CA   . ALA B 2 160 ? -19.725 -2.611  -3.932  1.00 70.22 ? 160 ALA B CA   1  
ATOM 6775   C C    . ALA B 2 160 ? -19.988 -3.994  -4.571  1.00 64.43 ? 160 ALA B C    1  
ATOM 6776   O O    . ALA B 2 160 ? -20.330 -4.960  -3.882  1.00 62.13 ? 160 ALA B O    1  
ATOM 6777   C CB   . ALA B 2 160 ? -19.895 -2.626  -2.399  1.00 4.43  ? 160 ALA B CB   1  
ATOM 6778   H H    . ALA B 2 160 ? -21.489 -1.434  -4.061  1.00 70.54 ? 160 ALA B H    1  
ATOM 6779   H HA   . ALA B 2 160 ? -18.700 -2.315  -4.154  1.00 1.32  ? 160 ALA B HA   1  
ATOM 6780   H HB1  . ALA B 2 160 ? -19.685 -1.642  -1.999  1.00 60.15 ? 160 ALA B HB1  1  
ATOM 6781   H HB2  . ALA B 2 160 ? -19.212 -3.342  -1.959  1.00 74.34 ? 160 ALA B HB2  1  
ATOM 6782   H HB3  . ALA B 2 160 ? -20.911 -2.899  -2.148  1.00 70.24 ? 160 ALA B HB3  1  
ATOM 6783   N N    . ALA B 2 161 ? -19.828 -4.056  -5.910  1.00 22.34 ? 161 ALA B N    1  
ATOM 6784   C CA   . ALA B 2 161 ? -20.158 -5.245  -6.723  1.00 34.52 ? 161 ALA B CA   1  
ATOM 6785   C C    . ALA B 2 161 ? -19.173 -6.399  -6.451  1.00 45.33 ? 161 ALA B C    1  
ATOM 6786   O O    . ALA B 2 161 ? -17.958 -6.240  -6.626  1.00 71.10 ? 161 ALA B O    1  
ATOM 6787   C CB   . ALA B 2 161 ? -20.173 -4.869  -8.218  1.00 54.43 ? 161 ALA B CB   1  
ATOM 6788   H H    . ALA B 2 161 ? -19.473 -3.266  -6.367  1.00 12.51 ? 161 ALA B H    1  
ATOM 6789   H HA   . ALA B 2 161 ? -21.164 -5.561  -6.449  1.00 14.13 ? 161 ALA B HA   1  
ATOM 6790   H HB1  . ALA B 2 161 ? -19.189 -4.536  -8.526  1.00 60.21 ? 161 ALA B HB1  1  
ATOM 6791   H HB2  . ALA B 2 161 ? -20.887 -4.071  -8.385  1.00 34.43 ? 161 ALA B HB2  1  
ATOM 6792   H HB3  . ALA B 2 161 ? -20.457 -5.728  -8.809  1.00 50.10 ? 161 ALA B HB3  1  
ATOM 6793   N N    . GLY B 2 162 ? -19.714 -7.552  -6.012  1.00 73.40 ? 162 GLY B N    1  
ATOM 6794   C CA   . GLY B 2 162 ? -18.904 -8.718  -5.662  1.00 70.34 ? 162 GLY B CA   1  
ATOM 6795   C C    . GLY B 2 162 ? -18.371 -8.627  -4.239  1.00 73.31 ? 162 GLY B C    1  
ATOM 6796   O O    . GLY B 2 162 ? -18.824 -9.365  -3.354  1.00 65.02 ? 162 GLY B O    1  
ATOM 6797   H H    . GLY B 2 162 ? -20.690 -7.605  -5.915  1.00 12.51 ? 162 GLY B H    1  
ATOM 6798   H HA2  . GLY B 2 162 ? -19.516 -9.605  -5.756  1.00 62.54 ? 162 GLY B HA2  1  
ATOM 6799   H HA3  . GLY B 2 162 ? -18.069 -8.805  -6.348  1.00 54.21 ? 162 GLY B HA3  1  
ATOM 6800   N N    . LEU B 2 163 ? -17.364 -7.740  -4.047  1.00 65.02 ? 163 LEU B N    1  
ATOM 6801   C CA   . LEU B 2 163 ? -16.754 -7.403  -2.725  1.00 31.40 ? 163 LEU B CA   1  
ATOM 6802   C C    . LEU B 2 163 ? -16.062 -8.638  -2.055  1.00 33.01 ? 163 LEU B C    1  
ATOM 6803   O O    . LEU B 2 163 ? -15.584 -8.563  -0.927  1.00 24.51 ? 163 LEU B O    1  
ATOM 6804   C CB   . LEU B 2 163 ? -17.833 -6.742  -1.791  1.00 41.13 ? 163 LEU B CB   1  
ATOM 6805   C CG   . LEU B 2 163 ? -17.329 -6.062  -0.467  1.00 63.12 ? 163 LEU B CG   1  
ATOM 6806   C CD1  . LEU B 2 163 ? -16.374 -4.877  -0.755  1.00 61.14 ? 163 LEU B CD1  1  
ATOM 6807   C CD2  . LEU B 2 163 ? -18.519 -5.622  0.421   1.00 3.40  ? 163 LEU B CD2  1  
ATOM 6808   H H    . LEU B 2 163 ? -17.012 -7.284  -4.837  1.00 72.52 ? 163 LEU B H    1  
ATOM 6809   H HA   . LEU B 2 163 ? -15.983 -6.670  -2.928  1.00 55.33 ? 163 LEU B HA   1  
ATOM 6810   H HB2  . LEU B 2 163 ? -18.363 -5.994  -2.371  1.00 44.13 ? 163 LEU B HB2  1  
ATOM 6811   H HB3  . LEU B 2 163 ? -18.548 -7.514  -1.520  1.00 0.41  ? 163 LEU B HB3  1  
ATOM 6812   H HG   . LEU B 2 163 ? -16.760 -6.793  0.094   1.00 44.41 ? 163 LEU B HG   1  
ATOM 6813   H HD11 . LEU B 2 163 ? -15.513 -5.228  -1.309  1.00 34.11 ? 163 LEU B HD11 1  
ATOM 6814   H HD12 . LEU B 2 163 ? -16.037 -4.444  0.178   1.00 75.25 ? 163 LEU B HD12 1  
ATOM 6815   H HD13 . LEU B 2 163 ? -16.889 -4.119  -1.334  1.00 13.34 ? 163 LEU B HD13 1  
ATOM 6816   H HD21 . LEU B 2 163 ? -19.132 -6.482  0.657   1.00 44.21 ? 163 LEU B HD21 1  
ATOM 6817   H HD22 . LEU B 2 163 ? -19.121 -4.889  -0.102  1.00 15.44 ? 163 LEU B HD22 1  
ATOM 6818   H HD23 . LEU B 2 163 ? -18.149 -5.190  1.341   1.00 5.20  ? 163 LEU B HD23 1  
ATOM 6819   N N    . ALA B 2 164 ? -15.958 -9.743  -2.811  1.00 42.31 ? 164 ALA B N    1  
ATOM 6820   C CA   . ALA B 2 164 ? -15.447 -11.044 -2.337  1.00 74.11 ? 164 ALA B CA   1  
ATOM 6821   C C    . ALA B 2 164 ? -15.271 -11.950 -3.561  1.00 74.22 ? 164 ALA B C    1  
ATOM 6822   O O    . ALA B 2 164 ? -14.249 -12.628 -3.726  1.00 73.52 ? 164 ALA B O    1  
ATOM 6823   C CB   . ALA B 2 164 ? -16.417 -11.678 -1.319  1.00 75.34 ? 164 ALA B CB   1  
ATOM 6824   H H    . ALA B 2 164 ? -16.222 -9.678  -3.753  1.00 5.35  ? 164 ALA B H    1  
ATOM 6825   H HA   . ALA B 2 164 ? -14.483 -10.885 -1.862  1.00 4.43  ? 164 ALA B HA   1  
ATOM 6826   H HB1  . ALA B 2 164 ? -16.029 -12.633 -0.989  1.00 13.21 ? 164 ALA B HB1  1  
ATOM 6827   H HB2  . ALA B 2 164 ? -17.385 -11.824 -1.779  1.00 2.41  ? 164 ALA B HB2  1  
ATOM 6828   H HB3  . ALA B 2 164 ? -16.525 -11.021 -0.466  1.00 63.42 ? 164 ALA B HB3  1  
ATOM 6829   N N    . THR B 2 165 ? -16.313 -11.946 -4.405  1.00 5.11  ? 165 THR B N    1  
ATOM 6830   C CA   . THR B 2 165 ? -16.293 -12.549 -5.743  1.00 64.15 ? 165 THR B CA   1  
ATOM 6831   C C    . THR B 2 165 ? -16.161 -11.431 -6.803  1.00 22.11 ? 165 THR B C    1  
ATOM 6832   O O    . THR B 2 165 ? -15.989 -10.250 -6.456  1.00 4.00  ? 165 THR B O    1  
ATOM 6833   C CB   . THR B 2 165 ? -17.593 -13.384 -5.988  1.00 33.20 ? 165 THR B CB   1  
ATOM 6834   O OG1  . THR B 2 165 ? -18.750 -12.553 -5.779  1.00 61.11 ? 165 THR B OG1  1  
ATOM 6835   C CG2  . THR B 2 165 ? -17.667 -14.610 -5.066  1.00 44.02 ? 165 THR B CG2  1  
ATOM 6836   H H    . THR B 2 165 ? -17.142 -11.506 -4.116  1.00 43.32 ? 165 THR B H    1  
ATOM 6837   H HA   . THR B 2 165 ? -15.432 -13.213 -5.824  1.00 70.01 ? 165 THR B HA   1  
ATOM 6838   H HB   . THR B 2 165 ? -17.598 -13.727 -7.018  1.00 0.14  ? 165 THR B HB   1  
ATOM 6839   H HG1  . THR B 2 165 ? -19.296 -12.930 -5.078  1.00 1.52  ? 165 THR B HG1  1  
ATOM 6840   H HG21 . THR B 2 165 ? -17.651 -14.288 -4.030  1.00 33.12 ? 165 THR B HG21 1  
ATOM 6841   H HG22 . THR B 2 165 ? -16.823 -15.257 -5.250  1.00 73.14 ? 165 THR B HG22 1  
ATOM 6842   H HG23 . THR B 2 165 ? -18.584 -15.155 -5.256  1.00 62.23 ? 165 THR B HG23 1  
ATOM 6843   N N    . GLY B 2 166 ? -16.242 -11.812 -8.089  1.00 71.15 ? 166 GLY B N    1  
ATOM 6844   C CA   . GLY B 2 166 ? -16.120 -10.875 -9.209  1.00 33.43 ? 166 GLY B CA   1  
ATOM 6845   C C    . GLY B 2 166 ? -14.858 -11.144 -10.013 1.00 11.31 ? 166 GLY B C    1  
ATOM 6846   O O    . GLY B 2 166 ? -14.541 -12.305 -10.287 1.00 23.13 ? 166 GLY B O    1  
ATOM 6847   H H    . GLY B 2 166 ? -16.377 -12.763 -8.287  1.00 74.53 ? 166 GLY B H    1  
ATOM 6848   H HA2  . GLY B 2 166 ? -16.979 -11.004 -9.857  1.00 71.53 ? 166 GLY B HA2  1  
ATOM 6849   H HA3  . GLY B 2 166 ? -16.111 -9.850  -8.846  1.00 43.51 ? 166 GLY B HA3  1  
ATOM 6850   N N    . ASN B 2 167 ? -14.127 -10.081 -10.381 1.00 43.14 ? 167 ASN B N    1  
ATOM 6851   C CA   . ASN B 2 167 ? -12.841 -10.198 -11.104 1.00 11.45 ? 167 ASN B CA   1  
ATOM 6852   C C    . ASN B 2 167 ? -11.716 -10.463 -10.077 1.00 52.51 ? 167 ASN B C    1  
ATOM 6853   O O    . ASN B 2 167 ? -10.880 -9.594  -9.788  1.00 3.22  ? 167 ASN B O    1  
ATOM 6854   C CB   . ASN B 2 167 ? -12.586 -8.910  -11.956 1.00 72.31 ? 167 ASN B CB   1  
ATOM 6855   C CG   . ASN B 2 167 ? -11.359 -8.967  -12.892 1.00 50.22 ? 167 ASN B CG   1  
ATOM 6856   O OD1  . ASN B 2 167 ? -10.701 -7.953  -13.128 1.00 62.13 ? 167 ASN B OD1  1  
ATOM 6857   N ND2  . ASN B 2 167 ? -11.077 -10.128 -13.478 1.00 22.22 ? 167 ASN B ND2  1  
ATOM 6858   H H    . ASN B 2 167 ? -14.450 -9.188  -10.143 1.00 73.21 ? 167 ASN B H    1  
ATOM 6859   H HA   . ASN B 2 167 ? -12.904 -11.054 -11.776 1.00 74.33 ? 167 ASN B HA   1  
ATOM 6860   H HB2  . ASN B 2 167 ? -13.454 -8.728  -12.573 1.00 22.05 ? 167 ASN B HB2  1  
ATOM 6861   H HB3  . ASN B 2 167 ? -12.462 -8.068  -11.283 1.00 21.12 ? 167 ASN B HB3  1  
ATOM 6862   H HD21 . ASN B 2 167 ? -11.654 -10.896 -13.302 1.00 73.44 ? 167 ASN B HD21 1  
ATOM 6863   H HD22 . ASN B 2 167 ? -10.279 -10.173 -14.046 1.00 52.01 ? 167 ASN B HD22 1  
ATOM 6864   N N    . VAL B 2 168 ? -11.762 -11.671 -9.471  1.00 72.25 ? 168 VAL B N    1  
ATOM 6865   C CA   . VAL B 2 168 ? -10.819 -12.082 -8.415  1.00 43.21 ? 168 VAL B CA   1  
ATOM 6866   C C    . VAL B 2 168 ? -9.827  -13.145 -8.956  1.00 21.12 ? 168 VAL B C    1  
ATOM 6867   O O    . VAL B 2 168 ? -8.625  -12.879 -9.037  1.00 51.14 ? 168 VAL B O    1  
ATOM 6868   C CB   . VAL B 2 168 ? -11.580 -12.563 -7.098  1.00 74.13 ? 168 VAL B CB   1  
ATOM 6869   C CG1  . VAL B 2 168 ? -12.287 -11.372 -6.406  1.00 11.22 ? 168 VAL B CG1  1  
ATOM 6870   C CG2  . VAL B 2 168 ? -12.607 -13.699 -7.374  1.00 34.41 ? 168 VAL B CG2  1  
ATOM 6871   H H    . VAL B 2 168 ? -12.449 -12.309 -9.757  1.00 74.41 ? 168 VAL B H    1  
ATOM 6872   H HA   . VAL B 2 168 ? -10.233 -11.200 -8.140  1.00 65.31 ? 168 VAL B HA   1  
ATOM 6873   H HB   . VAL B 2 168 ? -10.832 -12.945 -6.406  1.00 21.02 ? 168 VAL B HB   1  
ATOM 6874   H HG11 . VAL B 2 168 ? -13.038 -10.956 -7.067  1.00 51.30 ? 168 VAL B HG11 1  
ATOM 6875   H HG12 . VAL B 2 168 ? -11.561 -10.605 -6.166  1.00 61.35 ? 168 VAL B HG12 1  
ATOM 6876   H HG13 . VAL B 2 168 ? -12.760 -11.709 -5.492  1.00 75.53 ? 168 VAL B HG13 1  
ATOM 6877   H HG21 . VAL B 2 168 ? -12.099 -14.549 -7.810  1.00 62.04 ? 168 VAL B HG21 1  
ATOM 6878   H HG22 . VAL B 2 168 ? -13.368 -13.350 -8.060  1.00 31.34 ? 168 VAL B HG22 1  
ATOM 6879   H HG23 . VAL B 2 168 ? -13.074 -14.004 -6.445  1.00 65.31 ? 168 VAL B HG23 1  
ATOM 6880   N N    . SER B 2 169 ? -10.359 -14.320 -9.364  1.00 32.24 ? 169 SER B N    1  
ATOM 6881   C CA   . SER B 2 169 ? -9.605  -15.445 -9.966  1.00 22.22 ? 169 SER B CA   1  
ATOM 6882   C C    . SER B 2 169 ? -8.326  -15.888 -9.187  1.00 51.31 ? 169 SER B C    1  
ATOM 6883   O O    . SER B 2 169 ? -8.057  -15.418 -8.072  1.00 54.35 ? 169 SER B O    1  
ATOM 6884   C CB   . SER B 2 169 ? -9.293  -15.119 -11.434 1.00 32.34 ? 169 SER B CB   1  
ATOM 6885   O OG   . SER B 2 169 ? -10.476 -14.791 -12.146 1.00 24.55 ? 169 SER B OG   1  
ATOM 6886   H H    . SER B 2 169 ? -11.318 -14.431 -9.284  1.00 65.53 ? 169 SER B H    1  
ATOM 6887   H HA   . SER B 2 169 ? -10.281 -16.288 -9.957  1.00 3.43  ? 169 SER B HA   1  
ATOM 6888   H HB2  . SER B 2 169 ? -8.615  -14.280 -11.486 1.00 64.45 ? 169 SER B HB2  1  
ATOM 6889   H HB3  . SER B 2 169 ? -8.835  -15.979 -11.912 1.00 44.41 ? 169 SER B HB3  1  
ATOM 6890   H HG   . SER B 2 169 ? -10.336 -13.965 -12.627 1.00 1.12  ? 169 SER B HG   1  
ATOM 6891   N N    . THR B 2 170 ? -7.594  -16.870 -9.758  1.00 41.42 ? 170 THR B N    1  
ATOM 6892   C CA   . THR B 2 170 ? -6.313  -17.359 -9.214  1.00 54.24 ? 170 THR B CA   1  
ATOM 6893   C C    . THR B 2 170 ? -5.440  -17.855 -10.379 1.00 61.13 ? 170 THR B C    1  
ATOM 6894   O O    . THR B 2 170 ? -5.659  -18.970 -10.879 1.00 63.10 ? 170 THR B O    1  
ATOM 6895   C CB   . THR B 2 170 ? -6.522  -18.513 -8.161  1.00 4.10  ? 170 THR B CB   1  
ATOM 6896   O OG1  . THR B 2 170 ? -7.411  -18.072 -7.127  1.00 41.23 ? 170 THR B OG1  1  
ATOM 6897   C CG2  . THR B 2 170 ? -5.188  -18.968 -7.515  1.00 24.30 ? 170 THR B CG2  1  
ATOM 6898   H H    . THR B 2 170 ? -7.932  -17.286 -10.579 1.00 55.31 ? 170 THR B H    1  
ATOM 6899   H HA   . THR B 2 170 ? -5.813  -16.528 -8.717  1.00 12.11 ? 170 THR B HA   1  
ATOM 6900   H HB   . THR B 2 170 ? -6.981  -19.369 -8.662  1.00 53.32 ? 170 THR B HB   1  
ATOM 6901   H HG1  . THR B 2 170 ? -7.207  -17.154 -6.887  1.00 54.51 ? 170 THR B HG1  1  
ATOM 6902   H HG21 . THR B 2 170 ? -5.379  -19.747 -6.785  1.00 73.13 ? 170 THR B HG21 1  
ATOM 6903   H HG22 . THR B 2 170 ? -4.715  -18.131 -7.019  1.00 12.52 ? 170 THR B HG22 1  
ATOM 6904   H HG23 . THR B 2 170 ? -4.525  -19.356 -8.277  1.00 53.54 ? 170 THR B HG23 1  
ATOM 6905   N N    . ALA B 2 171 ? -4.500  -16.992 -10.822 1.00 2.11  ? 171 ALA B N    1  
ATOM 6906   C CA   . ALA B 2 171 ? -3.566  -17.245 -11.949 1.00 53.32 ? 171 ALA B CA   1  
ATOM 6907   C C    . ALA B 2 171 ? -4.301  -17.191 -13.307 1.00 21.11 ? 171 ALA B C    1  
ATOM 6908   O O    . ALA B 2 171 ? -4.004  -16.338 -14.154 1.00 14.30 ? 171 ALA B O    1  
ATOM 6909   C CB   . ALA B 2 171 ? -2.758  -18.549 -11.761 1.00 44.22 ? 171 ALA B CB   1  
ATOM 6910   H H    . ALA B 2 171 ? -4.435  -16.127 -10.370 1.00 14.44 ? 171 ALA B H    1  
ATOM 6911   H HA   . ALA B 2 171 ? -2.857  -16.422 -11.929 1.00 31.14 ? 171 ALA B HA   1  
ATOM 6912   H HB1  . ALA B 2 171 ? -2.005  -18.626 -12.533 1.00 55.14 ? 171 ALA B HB1  1  
ATOM 6913   H HB2  . ALA B 2 171 ? -3.419  -19.404 -11.819 1.00 43.23 ? 171 ALA B HB2  1  
ATOM 6914   H HB3  . ALA B 2 171 ? -2.275  -18.539 -10.791 1.00 73.41 ? 171 ALA B HB3  1  
ATOM 6915   N N    . GLU B 2 172 ? -5.233  -18.138 -13.522 1.00 44.02 ? 172 GLU B N    1  
ATOM 6916   C CA   . GLU B 2 172 ? -6.203  -18.110 -14.638 1.00 25.13 ? 172 GLU B CA   1  
ATOM 6917   C C    . GLU B 2 172 ? -7.586  -17.724 -14.091 1.00 73.22 ? 172 GLU B C    1  
ATOM 6918   O O    . GLU B 2 172 ? -7.778  -17.646 -12.872 1.00 12.45 ? 172 GLU B O    1  
ATOM 6919   C CB   . GLU B 2 172 ? -6.278  -19.487 -15.366 1.00 61.33 ? 172 GLU B CB   1  
ATOM 6920   C CG   . GLU B 2 172 ? -5.010  -19.890 -16.151 1.00 24.10 ? 172 GLU B CG   1  
ATOM 6921   C CD   . GLU B 2 172 ? -3.751  -20.111 -15.288 1.00 53.10 ? 172 GLU B CD   1  
ATOM 6922   O OE1  . GLU B 2 172 ? -2.681  -19.531 -15.590 1.00 62.05 ? 172 GLU B OE1  1  
ATOM 6923   O OE2  . GLU B 2 172 ? -3.816  -20.880 -14.311 1.00 64.33 ? 172 GLU B OE2  1  
ATOM 6924   H H    . GLU B 2 172 ? -5.271  -18.891 -12.901 1.00 51.21 ? 172 GLU B H    1  
ATOM 6925   H HA   . GLU B 2 172 ? -5.887  -17.351 -15.348 1.00 73.13 ? 172 GLU B HA   1  
ATOM 6926   H HB2  . GLU B 2 172 ? -6.484  -20.261 -14.633 1.00 21.03 ? 172 GLU B HB2  1  
ATOM 6927   H HB3  . GLU B 2 172 ? -7.109  -19.460 -16.070 1.00 53.42 ? 172 GLU B HB3  1  
ATOM 6928   H HG2  . GLU B 2 172 ? -5.218  -20.816 -16.679 1.00 75.25 ? 172 GLU B HG2  1  
ATOM 6929   H HG3  . GLU B 2 172 ? -4.807  -19.117 -16.884 1.00 13.53 ? 172 GLU B HG3  1  
ATOM 6930   N N    . LEU B 2 173 ? -8.537  -17.470 -15.010 1.00 74.23 ? 173 LEU B N    1  
ATOM 6931   C CA   . LEU B 2 173 ? -9.926  -17.114 -14.667 1.00 33.02 ? 173 LEU B CA   1  
ATOM 6932   C C    . LEU B 2 173 ? -10.599 -18.205 -13.782 1.00 72.24 ? 173 LEU B C    1  
ATOM 6933   O O    . LEU B 2 173 ? -10.497 -19.395 -14.057 1.00 33.32 ? 173 LEU B O    1  
ATOM 6934   C CB   . LEU B 2 173 ? -10.783 -16.725 -15.944 1.00 24.04 ? 173 LEU B CB   1  
ATOM 6935   C CG   . LEU B 2 173 ? -10.911 -17.700 -17.203 1.00 71.45 ? 173 LEU B CG   1  
ATOM 6936   C CD1  . LEU B 2 173 ? -9.561  -17.984 -17.902 1.00 3.11  ? 173 LEU B CD1  1  
ATOM 6937   C CD2  . LEU B 2 173 ? -11.659 -19.015 -16.877 1.00 41.23 ? 173 LEU B CD2  1  
ATOM 6938   H H    . LEU B 2 173 ? -8.288  -17.511 -15.946 1.00 20.22 ? 173 LEU B H    1  
ATOM 6939   H HA   . LEU B 2 173 ? -9.849  -16.216 -14.051 1.00 60.11 ? 173 LEU B HA   1  
ATOM 6940   H HB2  . LEU B 2 173 ? -11.788 -16.512 -15.602 1.00 11.00 ? 173 LEU B HB2  1  
ATOM 6941   H HB3  . LEU B 2 173 ? -10.376 -15.784 -16.311 1.00 71.41 ? 173 LEU B HB3  1  
ATOM 6942   H HG   . LEU B 2 173 ? -11.517 -17.185 -17.943 1.00 74.44 ? 173 LEU B HG   1  
ATOM 6943   H HD11 . LEU B 2 173 ? -9.117  -17.049 -18.225 1.00 53.11 ? 173 LEU B HD11 1  
ATOM 6944   H HD12 . LEU B 2 173 ? -9.715  -18.613 -18.770 1.00 63.15 ? 173 LEU B HD12 1  
ATOM 6945   H HD13 . LEU B 2 173 ? -8.888  -18.481 -17.215 1.00 72.52 ? 173 LEU B HD13 1  
ATOM 6946   H HD21 . LEU B 2 173 ? -11.101 -19.583 -16.143 1.00 3.21  ? 173 LEU B HD21 1  
ATOM 6947   H HD22 . LEU B 2 173 ? -11.770 -19.608 -17.774 1.00 51.13 ? 173 LEU B HD22 1  
ATOM 6948   H HD23 . LEU B 2 173 ? -12.641 -18.787 -16.483 1.00 35.13 ? 173 LEU B HD23 1  
ATOM 6949   N N    . GLN B 2 174 ? -11.231 -17.770 -12.676 1.00 21.51 ? 174 GLN B N    1  
ATOM 6950   C CA   . GLN B 2 174 ? -11.897 -18.661 -11.692 1.00 52.10 ? 174 GLN B CA   1  
ATOM 6951   C C    . GLN B 2 174 ? -13.307 -18.153 -11.367 1.00 53.31 ? 174 GLN B C    1  
ATOM 6952   O O    . GLN B 2 174 ? -14.178 -18.948 -10.986 1.00 34.42 ? 174 GLN B O    1  
ATOM 6953   C CB   . GLN B 2 174 ? -11.048 -18.789 -10.389 1.00 72.32 ? 174 GLN B CB   1  
ATOM 6954   C CG   . GLN B 2 174 ? -9.928  -19.849 -10.444 1.00 74.45 ? 174 GLN B CG   1  
ATOM 6955   C CD   . GLN B 2 174 ? -10.459 -21.293 -10.483 1.00 61.21 ? 174 GLN B CD   1  
ATOM 6956   O OE1  . GLN B 2 174 ? -9.862  -22.174 -11.088 1.00 74.21 ? 174 GLN B OE1  1  
ATOM 6957   N NE2  . GLN B 2 174 ? -11.585 -21.552 -9.821  1.00 54.33 ? 174 GLN B NE2  1  
ATOM 6958   H H    . GLN B 2 174 ? -11.247 -16.805 -12.510 1.00 71.13 ? 174 GLN B H    1  
ATOM 6959   H HA   . GLN B 2 174 ? -11.997 -19.646 -12.142 1.00 4.44  ? 174 GLN B HA   1  
ATOM 6960   H HB2  . GLN B 2 174 ? -10.592 -17.834 -10.182 1.00 72.01 ? 174 GLN B HB2  1  
ATOM 6961   H HB3  . GLN B 2 174 ? -11.701 -19.040 -9.554  1.00 73.11 ? 174 GLN B HB3  1  
ATOM 6962   H HG2  . GLN B 2 174 ? -9.325  -19.674 -11.328 1.00 50.42 ? 174 GLN B HG2  1  
ATOM 6963   H HG3  . GLN B 2 174 ? -9.302  -19.740 -9.564  1.00 42.40 ? 174 GLN B HG3  1  
ATOM 6964   H HE21 . GLN B 2 174 ? -12.030 -20.818 -9.342  1.00 51.24 ? 174 GLN B HE21 1  
ATOM 6965   H HE22 . GLN B 2 174 ? -11.915 -22.465 -9.821  1.00 11.44 ? 174 GLN B HE22 1  
ATOM 6966   N N    . ASP B 2 175 ? -13.519 -16.834 -11.510 1.00 50.21 ? 175 ASP B N    1  
ATOM 6967   C CA   . ASP B 2 175 ? -14.853 -16.225 -11.358 1.00 63.23 ? 175 ASP B CA   1  
ATOM 6968   C C    . ASP B 2 175 ? -14.938 -14.927 -12.166 1.00 43.10 ? 175 ASP B C    1  
ATOM 6969   O O    . ASP B 2 175 ? -13.923 -14.235 -12.367 1.00 4.54  ? 175 ASP B O    1  
ATOM 6970   C CB   . ASP B 2 175 ? -15.193 -15.957 -9.859  1.00 13.44 ? 175 ASP B CB   1  
ATOM 6971   C CG   . ASP B 2 175 ? -16.651 -15.492 -9.642  1.00 74.10 ? 175 ASP B CG   1  
ATOM 6972   O OD1  . ASP B 2 175 ? -16.904 -14.270 -9.601  1.00 54.53 ? 175 ASP B OD1  1  
ATOM 6973   O OD2  . ASP B 2 175 ? -17.561 -16.349 -9.579  1.00 4.21  ? 175 ASP B OD2  1  
ATOM 6974   H H    . ASP B 2 175 ? -12.760 -16.256 -11.731 1.00 22.21 ? 175 ASP B H    1  
ATOM 6975   H HA   . ASP B 2 175 ? -15.578 -16.924 -11.763 1.00 35.12 ? 175 ASP B HA   1  
ATOM 6976   H HB2  . ASP B 2 175 ? -15.036 -16.874 -9.299  1.00 22.32 ? 175 ASP B HB2  1  
ATOM 6977   H HB3  . ASP B 2 175 ? -14.518 -15.198 -9.471  1.00 35.43 ? 175 ASP B HB3  1  
ATOM 6978   N N    . ALA B 2 176 ? -16.154 -14.624 -12.638 1.00 23.02 ? 176 ALA B N    1  
ATOM 6979   C CA   . ALA B 2 176 ? -16.488 -13.361 -13.292 1.00 32.14 ? 176 ALA B CA   1  
ATOM 6980   C C    . ALA B 2 176 ? -17.954 -13.018 -12.988 1.00 30.22 ? 176 ALA B C    1  
ATOM 6981   O O    . ALA B 2 176 ? -18.861 -13.321 -13.779 1.00 31.05 ? 176 ALA B O    1  
ATOM 6982   C CB   . ALA B 2 176 ? -16.217 -13.433 -14.807 1.00 74.11 ? 176 ALA B CB   1  
ATOM 6983   H H    . ALA B 2 176 ? -16.864 -15.291 -12.538 1.00 71.21 ? 176 ALA B H    1  
ATOM 6984   H HA   . ALA B 2 176 ? -15.858 -12.579 -12.867 1.00 3.44  ? 176 ALA B HA   1  
ATOM 6985   H HB1  . ALA B 2 176 ? -16.834 -14.203 -15.252 1.00 72.04 ? 176 ALA B HB1  1  
ATOM 6986   H HB2  . ALA B 2 176 ? -15.175 -13.668 -14.979 1.00 73.21 ? 176 ALA B HB2  1  
ATOM 6987   H HB3  . ALA B 2 176 ? -16.449 -12.481 -15.267 1.00 62.51 ? 176 ALA B HB3  1  
ATOM 6988   N N    . THR B 2 177 ? -18.190 -12.447 -11.790 1.00 61.15 ? 177 THR B N    1  
ATOM 6989   C CA   . THR B 2 177 ? -19.529 -11.973 -11.377 1.00 0.32  ? 177 THR B CA   1  
ATOM 6990   C C    . THR B 2 177 ? -19.494 -10.495 -10.815 1.00 25.51 ? 177 THR B C    1  
ATOM 6991   O O    . THR B 2 177 ? -20.056 -10.232 -9.749  1.00 12.34 ? 177 THR B O    1  
ATOM 6992   C CB   . THR B 2 177 ? -20.128 -12.968 -10.302 1.00 64.31 ? 177 THR B CB   1  
ATOM 6993   O OG1  . THR B 2 177 ? -19.812 -14.330 -10.649 1.00 33.11 ? 177 THR B OG1  1  
ATOM 6994   C CG2  . THR B 2 177 ? -21.664 -12.850 -10.166 1.00 34.52 ? 177 THR B CG2  1  
ATOM 6995   H H    . THR B 2 177 ? -17.446 -12.363 -11.151 1.00 74.15 ? 177 THR B H    1  
ATOM 6996   H HA   . THR B 2 177 ? -20.181 -11.983 -12.247 1.00 12.32 ? 177 THR B HA   1  
ATOM 6997   H HB   . THR B 2 177 ? -19.679 -12.754 -9.339  1.00 64.02 ? 177 THR B HB   1  
ATOM 6998   H HG1  . THR B 2 177 ? -18.984 -14.581 -10.224 1.00 24.52 ? 177 THR B HG1  1  
ATOM 6999   H HG21 . THR B 2 177 ? -22.136 -13.088 -11.112 1.00 44.34 ? 177 THR B HG21 1  
ATOM 7000   H HG22 . THR B 2 177 ? -21.928 -11.843 -9.880  1.00 64.14 ? 177 THR B HG22 1  
ATOM 7001   H HG23 . THR B 2 177 ? -22.014 -13.538 -9.407  1.00 21.03 ? 177 THR B HG23 1  
ATOM 7002   N N    . PRO B 2 178 ? -18.823 -9.480  -11.494 1.00 1.12  ? 178 PRO B N    1  
ATOM 7003   C CA   . PRO B 2 178 ? -18.977 -8.056  -11.137 1.00 2.00  ? 178 PRO B CA   1  
ATOM 7004   C C    . PRO B 2 178 ? -19.983 -7.368  -12.091 1.00 13.24 ? 178 PRO B C    1  
ATOM 7005   O O    . PRO B 2 178 ? -20.898 -8.024  -12.602 1.00 41.24 ? 178 PRO B O    1  
ATOM 7006   C CB   . PRO B 2 178 ? -17.529 -7.541  -11.318 1.00 74.53 ? 178 PRO B CB   1  
ATOM 7007   C CG   . PRO B 2 178 ? -16.922 -8.400  -12.407 1.00 2.55  ? 178 PRO B CG   1  
ATOM 7008   C CD   . PRO B 2 178 ? -17.857 -9.587  -12.622 1.00 33.10 ? 178 PRO B CD   1  
ATOM 7009   H HA   . PRO B 2 178 ? -19.298 -7.919  -10.111 1.00 64.51 ? 178 PRO B HA   1  
ATOM 7010   H HB2  . PRO B 2 178 ? -17.538 -6.488  -11.603 1.00 43.31 ? 178 PRO B HB2  1  
ATOM 7011   H HB3  . PRO B 2 178 ? -16.978 -7.662  -10.395 1.00 54.43 ? 178 PRO B HB3  1  
ATOM 7012   H HG2  . PRO B 2 178 ? -16.833 -7.821  -13.323 1.00 62.11 ? 178 PRO B HG2  1  
ATOM 7013   H HG3  . PRO B 2 178 ? -15.941 -8.750  -12.102 1.00 70.13 ? 178 PRO B HG3  1  
ATOM 7014   H HD2  . PRO B 2 178 ? -18.374 -9.509  -13.573 1.00 23.22 ? 178 PRO B HD2  1  
ATOM 7015   H HD3  . PRO B 2 178 ? -17.310 -10.522 -12.575 1.00 25.41 ? 178 PRO B HD3  1  
ATOM 7016   N N    . ALA B 2 179 ? -19.835 -6.042  -12.303 1.00 42.10 ? 179 ALA B N    1  
ATOM 7017   C CA   . ALA B 2 179 ? -20.555 -5.332  -13.384 1.00 61.34 ? 179 ALA B CA   1  
ATOM 7018   C C    . ALA B 2 179 ? -20.084 -5.867  -14.756 1.00 12.01 ? 179 ALA B C    1  
ATOM 7019   O O    . ALA B 2 179 ? -20.901 -6.173  -15.634 1.00 51.33 ? 179 ALA B O    1  
ATOM 7020   C CB   . ALA B 2 179 ? -20.328 -3.816  -13.275 1.00 61.34 ? 179 ALA B CB   1  
ATOM 7021   H H    . ALA B 2 179 ? -19.245 -5.528  -11.712 1.00 64.44 ? 179 ALA B H    1  
ATOM 7022   H HA   . ALA B 2 179 ? -21.619 -5.530  -13.265 1.00 60.03 ? 179 ALA B HA   1  
ATOM 7023   H HB1  . ALA B 2 179 ? -19.273 -3.591  -13.382 1.00 74.35 ? 179 ALA B HB1  1  
ATOM 7024   H HB2  . ALA B 2 179 ? -20.668 -3.466  -12.309 1.00 31.41 ? 179 ALA B HB2  1  
ATOM 7025   H HB3  . ALA B 2 179 ? -20.882 -3.303  -14.052 1.00 0.13  ? 179 ALA B HB3  1  
ATOM 7026   N N    . ALA B 2 180 ? -18.748 -5.962  -14.890 1.00 62.11 ? 180 ALA B N    1  
ATOM 7027   C CA   . ALA B 2 180 ? -18.064 -6.625  -16.014 1.00 50.13 ? 180 ALA B CA   1  
ATOM 7028   C C    . ALA B 2 180 ? -16.561 -6.678  -15.706 1.00 55.13 ? 180 ALA B C    1  
ATOM 7029   O O    . ALA B 2 180 ? -15.947 -7.752  -15.700 1.00 74.40 ? 180 ALA B O    1  
ATOM 7030   C CB   . ALA B 2 180 ? -18.327 -5.922  -17.352 1.00 32.50 ? 180 ALA B CB   1  
ATOM 7031   H H    . ALA B 2 180 ? -18.194 -5.564  -14.189 1.00 73.32 ? 180 ALA B H    1  
ATOM 7032   H HA   . ALA B 2 180 ? -18.446 -7.644  -16.076 1.00 75.32 ? 180 ALA B HA   1  
ATOM 7033   H HB1  . ALA B 2 180 ? -17.958 -4.906  -17.311 1.00 3.34  ? 180 ALA B HB1  1  
ATOM 7034   H HB2  . ALA B 2 180 ? -19.391 -5.906  -17.554 1.00 65.15 ? 180 ALA B HB2  1  
ATOM 7035   H HB3  . ALA B 2 180 ? -17.823 -6.452  -18.151 1.00 62.04 ? 180 ALA B HB3  1  
ATOM 7036   N N    . LEU B 2 181 ? -15.982 -5.488  -15.450 1.00 60.42 ? 181 LEU B N    1  
ATOM 7037   C CA   . LEU B 2 181 ? -14.618 -5.339  -14.913 1.00 31.05 ? 181 LEU B CA   1  
ATOM 7038   C C    . LEU B 2 181 ? -14.742 -4.925  -13.436 1.00 23.11 ? 181 LEU B C    1  
ATOM 7039   O O    . LEU B 2 181 ? -14.806 -5.782  -12.549 1.00 62.04 ? 181 LEU B O    1  
ATOM 7040   C CB   . LEU B 2 181 ? -13.814 -4.290  -15.747 1.00 11.35 ? 181 LEU B CB   1  
ATOM 7041   C CG   . LEU B 2 181 ? -12.326 -4.033  -15.319 1.00 53.22 ? 181 LEU B CG   1  
ATOM 7042   C CD1  . LEU B 2 181 ? -11.461 -5.313  -15.427 1.00 34.31 ? 181 LEU B CD1  1  
ATOM 7043   C CD2  . LEU B 2 181 ? -11.712 -2.863  -16.132 1.00 4.14  ? 181 LEU B CD2  1  
ATOM 7044   H H    . LEU B 2 181 ? -16.497 -4.671  -15.627 1.00 54.53 ? 181 LEU B H    1  
ATOM 7045   H HA   . LEU B 2 181 ? -14.110 -6.304  -14.967 1.00 3.22  ? 181 LEU B HA   1  
ATOM 7046   H HB2  . LEU B 2 181 ? -13.817 -4.608  -16.781 1.00 21.42 ? 181 LEU B HB2  1  
ATOM 7047   H HB3  . LEU B 2 181 ? -14.348 -3.343  -15.691 1.00 14.40 ? 181 LEU B HB3  1  
ATOM 7048   H HG   . LEU B 2 181 ? -12.323 -3.734  -14.274 1.00 15.42 ? 181 LEU B HG   1  
ATOM 7049   H HD11 . LEU B 2 181 ? -11.456 -5.672  -16.449 1.00 74.44 ? 181 LEU B HD11 1  
ATOM 7050   H HD12 . LEU B 2 181 ? -11.866 -6.082  -14.782 1.00 3.44  ? 181 LEU B HD12 1  
ATOM 7051   H HD13 . LEU B 2 181 ? -10.447 -5.096  -15.118 1.00 4.11  ? 181 LEU B HD13 1  
ATOM 7052   H HD21 . LEU B 2 181 ? -10.696 -2.686  -15.807 1.00 3.45  ? 181 LEU B HD21 1  
ATOM 7053   H HD22 . LEU B 2 181 ? -12.294 -1.966  -15.974 1.00 4.55  ? 181 LEU B HD22 1  
ATOM 7054   H HD23 . LEU B 2 181 ? -11.713 -3.108  -17.188 1.00 44.12 ? 181 LEU B HD23 1  
ATOM 7055   N N    . VAL B 2 182 ? -14.802 -3.605  -13.188 1.00 14.13 ? 182 VAL B N    1  
ATOM 7056   C CA   . VAL B 2 182 ? -15.117 -3.014  -11.884 1.00 50.25 ? 182 VAL B CA   1  
ATOM 7057   C C    . VAL B 2 182 ? -16.239 -1.974  -12.077 1.00 24.33 ? 182 VAL B C    1  
ATOM 7058   O O    . VAL B 2 182 ? -16.777 -1.843  -13.194 1.00 32.41 ? 182 VAL B O    1  
ATOM 7059   C CB   . VAL B 2 182 ? -13.843 -2.323  -11.292 1.00 71.31 ? 182 VAL B CB   1  
ATOM 7060   C CG1  . VAL B 2 182 ? -12.734 -3.364  -10.980 1.00 35.24 ? 182 VAL B CG1  1  
ATOM 7061   C CG2  . VAL B 2 182 ? -13.334 -1.212  -12.262 1.00 11.21 ? 182 VAL B CG2  1  
ATOM 7062   H H    . VAL B 2 182 ? -14.579 -2.982  -13.909 1.00 62.52 ? 182 VAL B H    1  
ATOM 7063   H HA   . VAL B 2 182 ? -15.458 -3.787  -11.198 1.00 43.45 ? 182 VAL B HA   1  
ATOM 7064   H HB   . VAL B 2 182 ? -14.122 -1.848  -10.356 1.00 72.25 ? 182 VAL B HB   1  
ATOM 7065   H HG11 . VAL B 2 182 ? -12.447 -3.880  -11.890 1.00 30.02 ? 182 VAL B HG11 1  
ATOM 7066   H HG12 . VAL B 2 182 ? -13.100 -4.090  -10.265 1.00 72.43 ? 182 VAL B HG12 1  
ATOM 7067   H HG13 . VAL B 2 182 ? -11.868 -2.865  -10.565 1.00 65.00 ? 182 VAL B HG13 1  
ATOM 7068   H HG21 . VAL B 2 182 ? -13.094 -1.644  -13.228 1.00 40.23 ? 182 VAL B HG21 1  
ATOM 7069   H HG22 . VAL B 2 182 ? -12.449 -0.747  -11.855 1.00 22.32 ? 182 VAL B HG22 1  
ATOM 7070   H HG23 . VAL B 2 182 ? -14.099 -0.456  -12.393 1.00 0.20  ? 182 VAL B HG23 1  
ATOM 7071   N N    . ALA B 2 183 ? -16.572 -1.212  -11.007 1.00 64.40 ? 183 ALA B N    1  
ATOM 7072   C CA   . ALA B 2 183 ? -17.638 -0.197  -11.070 1.00 15.50 ? 183 ALA B CA   1  
ATOM 7073   C C    . ALA B 2 183 ? -17.698 0.675   -9.793  1.00 13.12 ? 183 ALA B C    1  
ATOM 7074   O O    . ALA B 2 183 ? -18.256 0.218   -8.799  1.00 62.35 ? 183 ALA B O    1  
ATOM 7075   C CB   . ALA B 2 183 ? -19.008 -0.870  -11.330 1.00 65.24 ? 183 ALA B CB   1  
ATOM 7076   H H    . ALA B 2 183 ? -16.077 -1.323  -10.169 1.00 45.25 ? 183 ALA B H    1  
ATOM 7077   H HA   . ALA B 2 183 ? -17.423 0.447   -11.920 1.00 40.35 ? 183 ALA B HA   1  
ATOM 7078   H HB1  . ALA B 2 183 ? -19.767 -0.111  -11.456 1.00 63.24 ? 183 ALA B HB1  1  
ATOM 7079   H HB2  . ALA B 2 183 ? -19.270 -1.504  -10.496 1.00 40.12 ? 183 ALA B HB2  1  
ATOM 7080   H HB3  . ALA B 2 183 ? -18.957 -1.476  -12.231 1.00 3.41  ? 183 ALA B HB3  1  
ATOM 7081   N N    . HIS B 2 184 ? -17.044 1.876   -9.825  1.00 21.24 ? 184 HIS B N    1  
ATOM 7082   C CA   . HIS B 2 184 ? -17.303 3.044   -8.898  1.00 54.13 ? 184 HIS B CA   1  
ATOM 7083   C C    . HIS B 2 184 ? -16.165 4.091   -8.937  1.00 32.11 ? 184 HIS B C    1  
ATOM 7084   O O    . HIS B 2 184 ? -15.044 3.780   -9.330  1.00 31.41 ? 184 HIS B O    1  
ATOM 7085   C CB   . HIS B 2 184 ? -17.594 2.676   -7.394  1.00 14.45 ? 184 HIS B CB   1  
ATOM 7086   C CG   . HIS B 2 184 ? -16.551 1.829   -6.698  1.00 74.15 ? 184 HIS B CG   1  
ATOM 7087   N ND1  . HIS B 2 184 ? -16.729 0.486   -6.459  1.00 60.45 ? 184 HIS B ND1  1  
ATOM 7088   C CD2  . HIS B 2 184 ? -15.341 2.138   -6.168  1.00 64.21 ? 184 HIS B CD2  1  
ATOM 7089   C CE1  . HIS B 2 184 ? -15.676 0.007   -5.831  1.00 22.14 ? 184 HIS B CE1  1  
ATOM 7090   N NE2  . HIS B 2 184 ? -14.819 0.986   -5.643  1.00 62.35 ? 184 HIS B NE2  1  
ATOM 7091   H H    . HIS B 2 184 ? -16.342 1.990   -10.500 1.00 75.32 ? 184 HIS B H    1  
ATOM 7092   H HA   . HIS B 2 184 ? -18.191 3.536   -9.300  1.00 61.12 ? 184 HIS B HA   1  
ATOM 7093   H HB2  . HIS B 2 184 ? -17.703 3.586   -6.825  1.00 43.45 ? 184 HIS B HB2  1  
ATOM 7094   H HB3  . HIS B 2 184 ? -18.541 2.139   -7.353  1.00 53.32 ? 184 HIS B HB3  1  
ATOM 7095   H HD1  . HIS B 2 184 ? -17.519 -0.035  -6.714  1.00 60.22 ? 184 HIS B HD1  1  
ATOM 7096   H HD2  . HIS B 2 184 ? -14.869 3.118   -6.170  1.00 63.02 ? 184 HIS B HD2  1  
ATOM 7097   H HE1  . HIS B 2 184 ? -15.544 -1.016  -5.514  1.00 21.35 ? 184 HIS B HE1  1  
ATOM 7098   H HE2  . HIS B 2 184 ? -13.966 0.910   -5.159  1.00 37.66 ? 184 HIS B HE2  1  
ATOM 7099   N N    . VAL B 2 185 ? -16.495 5.337   -8.503  1.00 70.12 ? 185 VAL B N    1  
ATOM 7100   C CA   . VAL B 2 185 ? -15.520 6.440   -8.250  1.00 14.51 ? 185 VAL B CA   1  
ATOM 7101   C C    . VAL B 2 185 ? -14.802 6.192   -6.888  1.00 5.11  ? 185 VAL B C    1  
ATOM 7102   O O    . VAL B 2 185 ? -15.184 5.266   -6.168  1.00 71.33 ? 185 VAL B O    1  
ATOM 7103   C CB   . VAL B 2 185 ? -16.275 7.837   -8.230  1.00 40.01 ? 185 VAL B CB   1  
ATOM 7104   C CG1  . VAL B 2 185 ? -15.329 9.061   -8.115  1.00 5.35  ? 185 VAL B CG1  1  
ATOM 7105   C CG2  . VAL B 2 185 ? -17.183 7.996   -9.464  1.00 70.14 ? 185 VAL B CG2  1  
ATOM 7106   H H    . VAL B 2 185 ? -17.440 5.529   -8.340  1.00 4.42  ? 185 VAL B H    1  
ATOM 7107   H HA   . VAL B 2 185 ? -14.783 6.447   -9.052  1.00 50.03 ? 185 VAL B HA   1  
ATOM 7108   H HB   . VAL B 2 185 ? -16.919 7.843   -7.352  1.00 14.03 ? 185 VAL B HB   1  
ATOM 7109   H HG11 . VAL B 2 185 ? -15.909 9.975   -8.078  1.00 54.44 ? 185 VAL B HG11 1  
ATOM 7110   H HG12 . VAL B 2 185 ? -14.665 9.094   -8.972  1.00 64.25 ? 185 VAL B HG12 1  
ATOM 7111   H HG13 . VAL B 2 185 ? -14.737 8.980   -7.213  1.00 74.01 ? 185 VAL B HG13 1  
ATOM 7112   H HG21 . VAL B 2 185 ? -17.736 8.924   -9.397  1.00 61.32 ? 185 VAL B HG21 1  
ATOM 7113   H HG22 . VAL B 2 185 ? -17.882 7.169   -9.511  1.00 34.43 ? 185 VAL B HG22 1  
ATOM 7114   H HG23 . VAL B 2 185 ? -16.581 8.005   -10.364 1.00 13.22 ? 185 VAL B HG23 1  
ATOM 7115   N N    . THR B 2 186 ? -13.751 6.994   -6.551  1.00 31.10 ? 186 THR B N    1  
ATOM 7116   C CA   . THR B 2 186 ? -13.115 6.990   -5.208  1.00 12.45 ? 186 THR B CA   1  
ATOM 7117   C C    . THR B 2 186 ? -14.169 7.269   -4.103  1.00 42.23 ? 186 THR B C    1  
ATOM 7118   O O    . THR B 2 186 ? -14.392 8.413   -3.723  1.00 12.23 ? 186 THR B O    1  
ATOM 7119   C CB   . THR B 2 186 ? -11.920 8.022   -5.124  1.00 43.35 ? 186 THR B CB   1  
ATOM 7120   O OG1  . THR B 2 186 ? -12.315 9.300   -5.666  1.00 51.31 ? 186 THR B OG1  1  
ATOM 7121   C CG2  . THR B 2 186 ? -10.668 7.521   -5.865  1.00 5.41  ? 186 THR B CG2  1  
ATOM 7122   H H    . THR B 2 186 ? -13.395 7.604   -7.227  1.00 60.24 ? 186 THR B H    1  
ATOM 7123   H HA   . THR B 2 186 ? -12.705 5.995   -5.045  1.00 35.11 ? 186 THR B HA   1  
ATOM 7124   H HB   . THR B 2 186 ? -11.656 8.165   -4.076  1.00 1.11  ? 186 THR B HB   1  
ATOM 7125   H HG1  . THR B 2 186 ? -13.266 9.402   -5.589  1.00 33.00 ? 186 THR B HG1  1  
ATOM 7126   H HG21 . THR B 2 186 ? -10.903 7.355   -6.907  1.00 3.30  ? 186 THR B HG21 1  
ATOM 7127   H HG22 . THR B 2 186 ? -10.328 6.595   -5.421  1.00 33.20 ? 186 THR B HG22 1  
ATOM 7128   H HG23 . THR B 2 186 ? -9.877  8.260   -5.792  1.00 52.40 ? 186 THR B HG23 1  
ATOM 7129   N N    . SER B 2 187 ? -14.827 6.193   -3.634  1.00 20.33 ? 187 SER B N    1  
ATOM 7130   C CA   . SER B 2 187 ? -16.006 6.269   -2.737  1.00 21.45 ? 187 SER B CA   1  
ATOM 7131   C C    . SER B 2 187 ? -15.674 5.738   -1.324  1.00 43.23 ? 187 SER B C    1  
ATOM 7132   O O    . SER B 2 187 ? -16.574 5.528   -0.503  1.00 23.55 ? 187 SER B O    1  
ATOM 7133   C CB   . SER B 2 187 ? -17.192 5.487   -3.380  1.00 40.42 ? 187 SER B CB   1  
ATOM 7134   O OG   . SER B 2 187 ? -18.433 5.739   -2.722  1.00 62.14 ? 187 SER B OG   1  
ATOM 7135   H H    . SER B 2 187 ? -14.500 5.304   -3.898  1.00 12.24 ? 187 SER B H    1  
ATOM 7136   H HA   . SER B 2 187 ? -16.296 7.312   -2.642  1.00 13.05 ? 187 SER B HA   1  
ATOM 7137   H HB2  . SER B 2 187 ? -17.298 5.781   -4.414  1.00 3.31  ? 187 SER B HB2  1  
ATOM 7138   H HB3  . SER B 2 187 ? -16.991 4.421   -3.339  1.00 53.00 ? 187 SER B HB3  1  
ATOM 7139   H HG   . SER B 2 187 ? -18.280 5.895   -1.787  1.00 42.44 ? 187 SER B HG   1  
ATOM 7140   N N    . ARG B 2 188 ? -14.378 5.553   -1.046  1.00 2.23  ? 188 ARG B N    1  
ATOM 7141   C CA   . ARG B 2 188 ? -13.885 5.096   0.262   1.00 14.44 ? 188 ARG B CA   1  
ATOM 7142   C C    . ARG B 2 188 ? -12.729 5.999   0.715   1.00 11.31 ? 188 ARG B C    1  
ATOM 7143   O O    . ARG B 2 188 ? -12.773 6.550   1.821   1.00 71.25 ? 188 ARG B O    1  
ATOM 7144   C CB   . ARG B 2 188 ? -13.420 3.614   0.194   1.00 61.14 ? 188 ARG B CB   1  
ATOM 7145   C CG   . ARG B 2 188 ? -13.009 2.978   1.548   1.00 4.31  ? 188 ARG B CG   1  
ATOM 7146   C CD   . ARG B 2 188 ? -14.207 2.477   2.392   1.00 24.00 ? 188 ARG B CD   1  
ATOM 7147   N NE   . ARG B 2 188 ? -15.179 3.539   2.735   1.00 35.44 ? 188 ARG B NE   1  
ATOM 7148   C CZ   . ARG B 2 188 ? -16.466 3.327   3.074   1.00 24.24 ? 188 ARG B CZ   1  
ATOM 7149   N NH1  . ARG B 2 188 ? -16.963 2.092   3.137   1.00 64.44 ? 188 ARG B NH1  1  
ATOM 7150   N NH2  . ARG B 2 188 ? -17.257 4.360   3.328   1.00 71.52 ? 188 ARG B NH2  1  
ATOM 7151   H H    . ARG B 2 188 ? -13.723 5.738   -1.748  1.00 64.25 ? 188 ARG B H    1  
ATOM 7152   H HA   . ARG B 2 188 ? -14.696 5.180   0.984   1.00 44.51 ? 188 ARG B HA   1  
ATOM 7153   H HB2  . ARG B 2 188 ? -14.223 3.022   -0.229  1.00 71.23 ? 188 ARG B HB2  1  
ATOM 7154   H HB3  . ARG B 2 188 ? -12.568 3.553   -0.481  1.00 55.32 ? 188 ARG B HB3  1  
ATOM 7155   H HG2  . ARG B 2 188 ? -12.360 2.132   1.348   1.00 31.43 ? 188 ARG B HG2  1  
ATOM 7156   H HG3  . ARG B 2 188 ? -12.454 3.709   2.127   1.00 44.35 ? 188 ARG B HG3  1  
ATOM 7157   H HD2  . ARG B 2 188 ? -14.717 1.698   1.837   1.00 35.14 ? 188 ARG B HD2  1  
ATOM 7158   H HD3  . ARG B 2 188 ? -13.820 2.054   3.313   1.00 53.42 ? 188 ARG B HD3  1  
ATOM 7159   H HE   . ARG B 2 188 ? -14.849 4.466   2.720   1.00 12.45 ? 188 ARG B HE   1  
ATOM 7160   H HH11 . ARG B 2 188 ? -16.383 1.298   2.930   1.00 60.43 ? 188 ARG B HH11 1  
ATOM 7161   H HH12 . ARG B 2 188 ? -17.925 1.948   3.390   1.00 13.42 ? 188 ARG B HH12 1  
ATOM 7162   H HH21 . ARG B 2 188 ? -16.901 5.295   3.267   1.00 3.43  ? 188 ARG B HH21 1  
ATOM 7163   H HH22 . ARG B 2 188 ? -18.220 4.207   3.579   1.00 72.32 ? 188 ARG B HH22 1  
ATOM 7164   N N    . LYS B 2 189 ? -11.689 6.130   -0.148  1.00 33.04 ? 189 LYS B N    1  
ATOM 7165   C CA   . LYS B 2 189 ? -10.492 6.960   0.124   1.00 72.52 ? 189 LYS B CA   1  
ATOM 7166   C C    . LYS B 2 189 ? -9.599  7.095   -1.136  1.00 24.35 ? 189 LYS B C    1  
ATOM 7167   O O    . LYS B 2 189 ? -9.851  6.451   -2.161  1.00 64.03 ? 189 LYS B O    1  
ATOM 7168   C CB   . LYS B 2 189 ? -9.683  6.391   1.345   1.00 0.21  ? 189 LYS B CB   1  
ATOM 7169   C CG   . LYS B 2 189 ? -9.321  4.866   1.306   1.00 54.11 ? 189 LYS B CG   1  
ATOM 7170   C CD   . LYS B 2 189 ? -8.088  4.522   0.423   1.00 5.10  ? 189 LYS B CD   1  
ATOM 7171   C CE   . LYS B 2 189 ? -6.794  5.165   0.936   1.00 4.24  ? 189 LYS B CE   1  
ATOM 7172   N NZ   . LYS B 2 189 ? -6.408  4.663   2.280   1.00 33.00 ? 189 LYS B NZ   1  
ATOM 7173   H H    . LYS B 2 189 ? -11.726 5.649   -1.001  1.00 13.34 ? 189 LYS B H    1  
ATOM 7174   H HA   . LYS B 2 189 ? -10.849 7.958   0.377   1.00 2.41  ? 189 LYS B HA   1  
ATOM 7175   H HB2  . LYS B 2 189 ? -8.763  6.954   1.441   1.00 42.22 ? 189 LYS B HB2  1  
ATOM 7176   H HB3  . LYS B 2 189 ? -10.271 6.570   2.241   1.00 34.04 ? 189 LYS B HB3  1  
ATOM 7177   H HG2  . LYS B 2 189 ? -9.121  4.533   2.321   1.00 72.11 ? 189 LYS B HG2  1  
ATOM 7178   H HG3  . LYS B 2 189 ? -10.180 4.317   0.931   1.00 42.43 ? 189 LYS B HG3  1  
ATOM 7179   H HD2  . LYS B 2 189 ? -7.953  3.445   0.397   1.00 20.30 ? 189 LYS B HD2  1  
ATOM 7180   H HD3  . LYS B 2 189 ? -8.271  4.875   -0.586  1.00 35.20 ? 189 LYS B HD3  1  
ATOM 7181   H HE2  . LYS B 2 189 ? -5.989  4.948   0.244   1.00 1.31  ? 189 LYS B HE2  1  
ATOM 7182   H HE3  . LYS B 2 189 ? -6.929  6.237   0.993   1.00 72.33 ? 189 LYS B HE3  1  
ATOM 7183   H HZ1  . LYS B 2 189 ? -6.295  3.626   2.260   1.00 41.53 ? 189 LYS B HZ1  1  
ATOM 7184   H HZ2  . LYS B 2 189 ? -7.137  4.905   2.981   1.00 15.20 ? 189 LYS B HZ2  1  
ATOM 7185   H HZ3  . LYS B 2 189 ? -5.509  5.094   2.578   1.00 15.21 ? 189 LYS B HZ3  1  
ATOM 7186   N N    . CYS B 2 190 ? -8.540  7.937   -1.032  1.00 34.02 ? 190 CYS B N    1  
ATOM 7187   C CA   . CYS B 2 190 ? -7.527  8.119   -2.095  1.00 70.33 ? 190 CYS B CA   1  
ATOM 7188   C C    . CYS B 2 190 ? -6.255  8.753   -1.492  1.00 62.04 ? 190 CYS B C    1  
ATOM 7189   O O    . CYS B 2 190 ? -6.331  9.827   -0.871  1.00 70.31 ? 190 CYS B O    1  
ATOM 7190   C CB   . CYS B 2 190 ? -8.070  9.000   -3.246  1.00 22.40 ? 190 CYS B CB   1  
ATOM 7191   S SG   . CYS B 2 190 ? -6.931  9.176   -4.643  1.00 64.42 ? 190 CYS B SG   1  
ATOM 7192   H H    . CYS B 2 190 ? -8.434  8.456   -0.201  1.00 62.22 ? 190 CYS B H    1  
ATOM 7193   H HA   . CYS B 2 190 ? -7.275  7.135   -2.490  1.00 43.53 ? 190 CYS B HA   1  
ATOM 7194   H HB2  . CYS B 2 190 ? -8.982  8.564   -3.627  1.00 55.54 ? 190 CYS B HB2  1  
ATOM 7195   H HB3  . CYS B 2 190 ? -8.284  9.992   -2.872  1.00 13.23 ? 190 CYS B HB3  1  
ATOM 7196   H HG   . CYS B 2 190 ? -6.775  7.978   -5.194  1.00 13.43 ? 190 CYS B HG   1  
ATOM 7197   N N    . TYR B 2 191 ? -5.096  8.078   -1.674  1.00 20.50 ? 191 TYR B N    1  
ATOM 7198   C CA   . TYR B 2 191 ? -3.804  8.512   -1.094  1.00 10.51 ? 191 TYR B CA   1  
ATOM 7199   C C    . TYR B 2 191 ? -3.361  9.865   -1.673  1.00 64.11 ? 191 TYR B C    1  
ATOM 7200   O O    . TYR B 2 191 ? -3.349  10.872  -0.970  1.00 61.41 ? 191 TYR B O    1  
ATOM 7201   C CB   . TYR B 2 191 ? -2.697  7.453   -1.341  1.00 40.34 ? 191 TYR B CB   1  
ATOM 7202   C CG   . TYR B 2 191 ? -3.023  6.059   -0.794  1.00 34.03 ? 191 TYR B CG   1  
ATOM 7203   C CD1  . TYR B 2 191 ? -2.995  5.804   0.576   1.00 74.04 ? 191 TYR B CD1  1  
ATOM 7204   C CD2  . TYR B 2 191 ? -3.352  4.999   -1.643  1.00 64.21 ? 191 TYR B CD2  1  
ATOM 7205   C CE1  . TYR B 2 191 ? -3.283  4.550   1.071   1.00 64.51 ? 191 TYR B CE1  1  
ATOM 7206   C CE2  . TYR B 2 191 ? -3.638  3.744   -1.142  1.00 63.31 ? 191 TYR B CE2  1  
ATOM 7207   C CZ   . TYR B 2 191 ? -3.601  3.525   0.214   1.00 52.50 ? 191 TYR B CZ   1  
ATOM 7208   O OH   . TYR B 2 191 ? -3.897  2.279   0.723   1.00 53.55 ? 191 TYR B OH   1  
ATOM 7209   H H    . TYR B 2 191 ? -5.110  7.268   -2.219  1.00 62.40 ? 191 TYR B H    1  
ATOM 7210   H HA   . TYR B 2 191 ? -3.945  8.622   -0.023  1.00 21.44 ? 191 TYR B HA   1  
ATOM 7211   H HB2  . TYR B 2 191 ? -2.518  7.368   -2.409  1.00 63.31 ? 191 TYR B HB2  1  
ATOM 7212   H HB3  . TYR B 2 191 ? -1.777  7.787   -0.868  1.00 2.30  ? 191 TYR B HB3  1  
ATOM 7213   H HD1  . TYR B 2 191 ? -2.745  6.605   1.261   1.00 50.23 ? 191 TYR B HD1  1  
ATOM 7214   H HD2  . TYR B 2 191 ? -3.383  5.169   -2.712  1.00 70.33 ? 191 TYR B HD2  1  
ATOM 7215   H HE1  . TYR B 2 191 ? -3.258  4.377   2.138   1.00 31.41 ? 191 TYR B HE1  1  
ATOM 7216   H HE2  . TYR B 2 191 ? -3.886  2.937   -1.820  1.00 31.30 ? 191 TYR B HE2  1  
ATOM 7217   H HH   . TYR B 2 191 ? -3.358  1.609   0.280   1.00 12.43 ? 191 TYR B HH   1  
ATOM 7218   N N    . GLY B 2 192 ? -3.021  9.864   -2.963  1.00 32.10 ? 192 GLY B N    1  
ATOM 7219   C CA   . GLY B 2 192 ? -2.534  11.053  -3.646  1.00 62.41 ? 192 GLY B CA   1  
ATOM 7220   C C    . GLY B 2 192 ? -2.218  10.759  -5.107  1.00 2.02  ? 192 GLY B C    1  
ATOM 7221   O O    . GLY B 2 192 ? -1.989  9.593   -5.451  1.00 64.22 ? 192 GLY B O    1  
ATOM 7222   H H    . GLY B 2 192 ? -3.105  9.032   -3.469  1.00 35.34 ? 192 GLY B H    1  
ATOM 7223   H HA2  . GLY B 2 192 ? -3.291  11.824  -3.593  1.00 55.50 ? 192 GLY B HA2  1  
ATOM 7224   H HA3  . GLY B 2 192 ? -1.635  11.405  -3.155  1.00 54.21 ? 192 GLY B HA3  1  
ATOM 7225   N N    . PRO B 2 193 ? -2.203  11.794  -5.999  1.00 44.34 ? 193 PRO B N    1  
ATOM 7226   C CA   . PRO B 2 193 ? -1.962  11.595  -7.443  1.00 64.32 ? 193 PRO B CA   1  
ATOM 7227   C C    . PRO B 2 193 ? -0.481  11.244  -7.753  1.00 3.13  ? 193 PRO B C    1  
ATOM 7228   O O    . PRO B 2 193 ? -0.154  10.079  -8.018  1.00 53.42 ? 193 PRO B O    1  
ATOM 7229   C CB   . PRO B 2 193 ? -2.403  12.949  -8.057  1.00 34.44 ? 193 PRO B CB   1  
ATOM 7230   C CG   . PRO B 2 193 ? -2.210  13.963  -6.965  1.00 52.15 ? 193 PRO B CG   1  
ATOM 7231   C CD   . PRO B 2 193 ? -2.438  13.229  -5.660  1.00 53.31 ? 193 PRO B CD   1  
ATOM 7232   H HA   . PRO B 2 193 ? -2.597  10.802  -7.835  1.00 45.44 ? 193 PRO B HA   1  
ATOM 7233   H HB2  . PRO B 2 193 ? -1.796  13.189  -8.929  1.00 21.31 ? 193 PRO B HB2  1  
ATOM 7234   H HB3  . PRO B 2 193 ? -3.449  12.905  -8.343  1.00 4.51  ? 193 PRO B HB3  1  
ATOM 7235   H HG2  . PRO B 2 193 ? -1.196  14.364  -7.004  1.00 73.22 ? 193 PRO B HG2  1  
ATOM 7236   H HG3  . PRO B 2 193 ? -2.927  14.770  -7.070  1.00 20.34 ? 193 PRO B HG3  1  
ATOM 7237   H HD2  . PRO B 2 193 ? -1.738  13.568  -4.905  1.00 72.03 ? 193 PRO B HD2  1  
ATOM 7238   H HD3  . PRO B 2 193 ? -3.455  13.376  -5.316  1.00 51.12 ? 193 PRO B HD3  1  
ATOM 7239   N N    . SER B 2 194 ? 0.409   12.250  -7.642  1.00 2.31  ? 194 SER B N    1  
ATOM 7240   C CA   . SER B 2 194 ? 1.844   12.110  -7.911  1.00 12.45 ? 194 SER B CA   1  
ATOM 7241   C C    . SER B 2 194 ? 2.591   11.495  -6.711  1.00 22.20 ? 194 SER B C    1  
ATOM 7242   O O    . SER B 2 194 ? 3.792   11.233  -6.787  1.00 24.51 ? 194 SER B O    1  
ATOM 7243   C CB   . SER B 2 194 ? 2.426   13.487  -8.275  1.00 20.32 ? 194 SER B CB   1  
ATOM 7244   O OG   . SER B 2 194 ? 1.704   14.085  -9.345  1.00 23.52 ? 194 SER B OG   1  
ATOM 7245   H H    . SER B 2 194 ? 0.087   13.126  -7.373  1.00 53.35 ? 194 SER B H    1  
ATOM 7246   H HA   . SER B 2 194 ? 1.965   11.451  -8.762  1.00 45.22 ? 194 SER B HA   1  
ATOM 7247   H HB2  . SER B 2 194 ? 2.370   14.145  -7.416  1.00 63.44 ? 194 SER B HB2  1  
ATOM 7248   H HB3  . SER B 2 194 ? 3.460   13.377  -8.576  1.00 44.34 ? 194 SER B HB3  1  
ATOM 7249   H HG   . SER B 2 194 ? 1.716   15.042  -9.246  1.00 52.00 ? 194 SER B HG   1  
ATOM 7250   N N    . ALA B 2 195 ? 1.865   11.281  -5.601  1.00 44.12 ? 195 ALA B N    1  
ATOM 7251   C CA   . ALA B 2 195 ? 2.399   10.592  -4.419  1.00 61.00 ? 195 ALA B CA   1  
ATOM 7252   C C    . ALA B 2 195 ? 2.667   9.113   -4.741  1.00 20.30 ? 195 ALA B C    1  
ATOM 7253   O O    . ALA B 2 195 ? 3.780   8.607   -4.541  1.00 25.31 ? 195 ALA B O    1  
ATOM 7254   C CB   . ALA B 2 195 ? 1.413   10.721  -3.251  1.00 74.32 ? 195 ALA B CB   1  
ATOM 7255   H H    . ALA B 2 195 ? 0.937   11.594  -5.585  1.00 2.10  ? 195 ALA B H    1  
ATOM 7256   H HA   . ALA B 2 195 ? 3.332   11.078  -4.134  1.00 20.34 ? 195 ALA B HA   1  
ATOM 7257   H HB1  . ALA B 2 195 ? 1.818   10.229  -2.376  1.00 71.20 ? 195 ALA B HB1  1  
ATOM 7258   H HB2  . ALA B 2 195 ? 0.467   10.263  -3.512  1.00 51.25 ? 195 ALA B HB2  1  
ATOM 7259   H HB3  . ALA B 2 195 ? 1.250   11.768  -3.024  1.00 3.21  ? 195 ALA B HB3  1  
ATOM 7260   N N    . THR B 2 196 ? 1.628   8.441   -5.259  1.00 73.32 ? 196 THR B N    1  
ATOM 7261   C CA   . THR B 2 196 ? 1.668   7.007   -5.585  1.00 52.41 ? 196 THR B CA   1  
ATOM 7262   C C    . THR B 2 196 ? 2.061   6.771   -7.054  1.00 63.34 ? 196 THR B C    1  
ATOM 7263   O O    . THR B 2 196 ? 2.546   5.685   -7.403  1.00 1.12  ? 196 THR B O    1  
ATOM 7264   C CB   . THR B 2 196 ? 0.284   6.354   -5.313  1.00 52.33 ? 196 THR B CB   1  
ATOM 7265   O OG1  . THR B 2 196 ? -0.719  7.001   -6.111  1.00 61.13 ? 196 THR B OG1  1  
ATOM 7266   C CG2  . THR B 2 196 ? -0.115  6.445   -3.830  1.00 2.43  ? 196 THR B CG2  1  
ATOM 7267   H H    . THR B 2 196 ? 0.795   8.929   -5.430  1.00 34.24 ? 196 THR B H    1  
ATOM 7268   H HA   . THR B 2 196 ? 2.404   6.524   -4.944  1.00 43.23 ? 196 THR B HA   1  
ATOM 7269   H HB   . THR B 2 196 ? 0.326   5.302   -5.592  1.00 53.04 ? 196 THR B HB   1  
ATOM 7270   H HG1  . THR B 2 196 ? -1.583  6.653   -5.875  1.00 32.43 ? 196 THR B HG1  1  
ATOM 7271   H HG21 . THR B 2 196 ? 0.623   5.944   -3.217  1.00 34.31 ? 196 THR B HG21 1  
ATOM 7272   H HG22 . THR B 2 196 ? -1.078  5.970   -3.684  1.00 5.34  ? 196 THR B HG22 1  
ATOM 7273   H HG23 . THR B 2 196 ? -0.183  7.484   -3.533  1.00 24.54 ? 196 THR B HG23 1  
ATOM 7274   N N    . SER B 2 197 ? 1.832   7.782   -7.915  1.00 45.21 ? 197 SER B N    1  
ATOM 7275   C CA   . SER B 2 197 ? 2.143   7.703   -9.354  1.00 75.11 ? 197 SER B CA   1  
ATOM 7276   C C    . SER B 2 197 ? 2.566   9.073   -9.883  1.00 5.44  ? 197 SER B C    1  
ATOM 7277   O O    . SER B 2 197 ? 1.723   9.899   -10.203 1.00 74.22 ? 197 SER B O    1  
ATOM 7278   C CB   . SER B 2 197 ? 0.919   7.190   -10.147 1.00 11.44 ? 197 SER B CB   1  
ATOM 7279   O OG   . SER B 2 197 ? 0.465   5.961   -9.632  1.00 24.12 ? 197 SER B OG   1  
ATOM 7280   H H    . SER B 2 197 ? 1.434   8.609   -7.572  1.00 32.41 ? 197 SER B H    1  
ATOM 7281   H HA   . SER B 2 197 ? 2.968   7.007   -9.491  1.00 33.33 ? 197 SER B HA   1  
ATOM 7282   H HB2  . SER B 2 197 ? 0.111   7.910   -10.075 1.00 32.15 ? 197 SER B HB2  1  
ATOM 7283   H HB3  . SER B 2 197 ? 1.185   7.054   -11.190 1.00 4.02  ? 197 SER B HB3  1  
ATOM 7284   H HG   . SER B 2 197 ? 0.118   6.105   -8.742  1.00 4.11  ? 197 SER B HG   1  
ATOM 7285   N N    . GLU B 2 198 ? 3.880   9.314   -9.954  1.00 51.12 ? 198 GLU B N    1  
ATOM 7286   C CA   . GLU B 2 198 ? 4.439   10.523  -10.605 1.00 4.33  ? 198 GLU B CA   1  
ATOM 7287   C C    . GLU B 2 198 ? 4.259   10.451  -12.139 1.00 43.23 ? 198 GLU B C    1  
ATOM 7288   O O    . GLU B 2 198 ? 4.377   11.457  -12.844 1.00 41.43 ? 198 GLU B O    1  
ATOM 7289   C CB   . GLU B 2 198 ? 5.940   10.647  -10.251 1.00 24.35 ? 198 GLU B CB   1  
ATOM 7290   C CG   . GLU B 2 198 ? 6.222   10.741  -8.743  1.00 31.31 ? 198 GLU B CG   1  
ATOM 7291   C CD   . GLU B 2 198 ? 7.706   10.591  -8.385  1.00 10.14 ? 198 GLU B CD   1  
ATOM 7292   O OE1  . GLU B 2 198 ? 8.436   11.602  -8.353  1.00 43.23 ? 198 GLU B OE1  1  
ATOM 7293   O OE2  . GLU B 2 198 ? 8.158   9.446   -8.153  1.00 32.43 ? 198 GLU B OE2  1  
ATOM 7294   H H    . GLU B 2 198 ? 4.498   8.667   -9.558  1.00 33.23 ? 198 GLU B H    1  
ATOM 7295   H HA   . GLU B 2 198 ? 3.905   11.393  -10.224 1.00 2.00  ? 198 GLU B HA   1  
ATOM 7296   H HB2  . GLU B 2 198 ? 6.461   9.777   -10.642 1.00 65.14 ? 198 GLU B HB2  1  
ATOM 7297   H HB3  . GLU B 2 198 ? 6.343   11.535  -10.731 1.00 52.03 ? 198 GLU B HB3  1  
ATOM 7298   H HG2  . GLU B 2 198 ? 5.865   11.701  -8.382  1.00 12.53 ? 198 GLU B HG2  1  
ATOM 7299   H HG3  . GLU B 2 198 ? 5.661   9.956   -8.243  1.00 23.22 ? 198 GLU B HG3  1  
ATOM 7300   N N    . LYS B 2 199 ? 3.975   9.228   -12.623 1.00 74.40 ? 199 LYS B N    1  
ATOM 7301   C CA   . LYS B 2 199 ? 3.888   8.896   -14.042 1.00 24.52 ? 199 LYS B CA   1  
ATOM 7302   C C    . LYS B 2 199 ? 2.895   7.733   -14.234 1.00 24.24 ? 199 LYS B C    1  
ATOM 7303   O O    . LYS B 2 199 ? 3.257   6.557   -14.101 1.00 31.01 ? 199 LYS B O    1  
ATOM 7304   C CB   . LYS B 2 199 ? 5.319   8.570   -14.586 1.00 42.15 ? 199 LYS B CB   1  
ATOM 7305   C CG   . LYS B 2 199 ? 6.196   7.697   -13.649 1.00 60.20 ? 199 LYS B CG   1  
ATOM 7306   C CD   . LYS B 2 199 ? 7.689   7.626   -14.063 1.00 1.03  ? 199 LYS B CD   1  
ATOM 7307   C CE   . LYS B 2 199 ? 7.962   6.771   -15.311 1.00 61.41 ? 199 LYS B CE   1  
ATOM 7308   N NZ   . LYS B 2 199 ? 7.537   7.399   -16.587 1.00 52.14 ? 199 LYS B NZ   1  
ATOM 7309   H H    . LYS B 2 199 ? 3.814   8.511   -11.983 1.00 43.22 ? 199 LYS B H    1  
ATOM 7310   H HA   . LYS B 2 199 ? 3.500   9.764   -14.570 1.00 64.43 ? 199 LYS B HA   1  
ATOM 7311   H HB2  . LYS B 2 199 ? 5.229   8.061   -15.539 1.00 55.24 ? 199 LYS B HB2  1  
ATOM 7312   H HB3  . LYS B 2 199 ? 5.837   9.509   -14.752 1.00 35.22 ? 199 LYS B HB3  1  
ATOM 7313   H HG2  . LYS B 2 199 ? 6.146   8.114   -12.649 1.00 24.53 ? 199 LYS B HG2  1  
ATOM 7314   H HG3  . LYS B 2 199 ? 5.789   6.693   -13.627 1.00 2.23  ? 199 LYS B HG3  1  
ATOM 7315   H HD2  . LYS B 2 199 ? 8.051   8.629   -14.248 1.00 13.45 ? 199 LYS B HD2  1  
ATOM 7316   H HD3  . LYS B 2 199 ? 8.251   7.206   -13.231 1.00 13.45 ? 199 LYS B HD3  1  
ATOM 7317   H HE2  . LYS B 2 199 ? 9.022   6.585   -15.374 1.00 75.14 ? 199 LYS B HE2  1  
ATOM 7318   H HE3  . LYS B 2 199 ? 7.447   5.825   -15.205 1.00 42.51 ? 199 LYS B HE3  1  
ATOM 7319   H HZ1  . LYS B 2 199 ? 6.497   7.439   -16.649 1.00 60.22 ? 199 LYS B HZ1  1  
ATOM 7320   H HZ2  . LYS B 2 199 ? 7.893   6.838   -17.392 1.00 54.30 ? 199 LYS B HZ2  1  
ATOM 7321   H HZ3  . LYS B 2 199 ? 7.918   8.361   -16.661 1.00 63.33 ? 199 LYS B HZ3  1  
ATOM 7322   N N    . CYS B 2 200 ? 1.613   8.081   -14.477 1.00 73.31 ? 200 CYS B N    1  
ATOM 7323   C CA   . CYS B 2 200 ? 0.549   7.090   -14.728 1.00 51.34 ? 200 CYS B CA   1  
ATOM 7324   C C    . CYS B 2 200 ? 0.389   6.877   -16.249 1.00 53.32 ? 200 CYS B C    1  
ATOM 7325   O O    . CYS B 2 200 ? 0.002   7.820   -16.954 1.00 42.41 ? 200 CYS B O    1  
ATOM 7326   C CB   . CYS B 2 200 ? -0.794  7.551   -14.118 1.00 22.42 ? 200 CYS B CB   1  
ATOM 7327   S SG   . CYS B 2 200 ? -1.532  8.999   -14.912 1.00 32.21 ? 200 CYS B SG   1  
ATOM 7328   H H    . CYS B 2 200 ? 1.378   9.035   -14.494 1.00 15.10 ? 200 CYS B H    1  
ATOM 7329   H HA   . CYS B 2 200 ? 0.837   6.151   -14.259 1.00 31.10 ? 200 CYS B HA   1  
ATOM 7330   H HB2  . CYS B 2 200 ? -1.516  6.745   -14.189 1.00 71.02 ? 200 CYS B HB2  1  
ATOM 7331   H HB3  . CYS B 2 200 ? -0.651  7.790   -13.070 1.00 41.03 ? 200 CYS B HB3  1  
ATOM 7332   H HG   . CYS B 2 200 ? -2.728  9.176   -14.365 1.00 64.24 ? 200 CYS B HG   1  
ATOM 7333   N N    . PRO B 2 201 ? 0.726   5.668   -16.797 1.00 34.21 ? 201 PRO B N    1  
ATOM 7334   C CA   . PRO B 2 201 ? 0.482   5.347   -18.225 1.00 12.52 ? 201 PRO B CA   1  
ATOM 7335   C C    . PRO B 2 201 ? -0.996  4.991   -18.488 1.00 23.13 ? 201 PRO B C    1  
ATOM 7336   O O    . PRO B 2 201 ? -1.750  4.676   -17.551 1.00 31.14 ? 201 PRO B O    1  
ATOM 7337   C CB   . PRO B 2 201 ? 1.407   4.141   -18.461 1.00 61.14 ? 201 PRO B CB   1  
ATOM 7338   C CG   . PRO B 2 201 ? 1.451   3.438   -17.140 1.00 71.34 ? 201 PRO B CG   1  
ATOM 7339   C CD   . PRO B 2 201 ? 1.400   4.534   -16.093 1.00 1.35  ? 201 PRO B CD   1  
ATOM 7340   H HA   . PRO B 2 201 ? 0.772   6.172   -18.872 1.00 13.11 ? 201 PRO B HA   1  
ATOM 7341   H HB2  . PRO B 2 201 ? 1.007   3.495   -19.241 1.00 0.32  ? 201 PRO B HB2  1  
ATOM 7342   H HB3  . PRO B 2 201 ? 2.400   4.477   -18.736 1.00 4.13  ? 201 PRO B HB3  1  
ATOM 7343   H HG2  . PRO B 2 201 ? 0.595   2.769   -17.046 1.00 24.22 ? 201 PRO B HG2  1  
ATOM 7344   H HG3  . PRO B 2 201 ? 2.372   2.875   -17.047 1.00 71.00 ? 201 PRO B HG3  1  
ATOM 7345   H HD2  . PRO B 2 201 ? 0.824   4.220   -15.232 1.00 74.02 ? 201 PRO B HD2  1  
ATOM 7346   H HD3  . PRO B 2 201 ? 2.401   4.819   -15.788 1.00 12.41 ? 201 PRO B HD3  1  
ATOM 7347   N N    . GLY B 2 202 ? -1.399  5.038   -19.764 1.00 5.31  ? 202 GLY B N    1  
ATOM 7348   C CA   . GLY B 2 202 ? -2.779  4.743   -20.146 1.00 63.04 ? 202 GLY B CA   1  
ATOM 7349   C C    . GLY B 2 202 ? -2.932  4.506   -21.631 1.00 25.21 ? 202 GLY B C    1  
ATOM 7350   O O    . GLY B 2 202 ? -3.723  3.651   -22.056 1.00 22.11 ? 202 GLY B O    1  
ATOM 7351   H H    . GLY B 2 202 ? -0.743  5.274   -20.460 1.00 32.40 ? 202 GLY B H    1  
ATOM 7352   H HA2  . GLY B 2 202 ? -3.121  3.861   -19.610 1.00 73.41 ? 202 GLY B HA2  1  
ATOM 7353   H HA3  . GLY B 2 202 ? -3.402  5.581   -19.864 1.00 70.11 ? 202 GLY B HA3  1  
ATOM 7354   N N    . ASN B 2 203 ? -2.182  5.278   -22.428 1.00 21.11 ? 203 ASN B N    1  
ATOM 7355   C CA   . ASN B 2 203 ? -2.119  5.103   -23.886 1.00 3.33  ? 203 ASN B CA   1  
ATOM 7356   C C    . ASN B 2 203 ? -1.176  3.929   -24.199 1.00 71.33 ? 203 ASN B C    1  
ATOM 7357   O O    . ASN B 2 203 ? -0.013  4.135   -24.503 1.00 41.04 ? 203 ASN B O    1  
ATOM 7358   C CB   . ASN B 2 203 ? -1.646  6.426   -24.561 1.00 11.13 ? 203 ASN B CB   1  
ATOM 7359   C CG   . ASN B 2 203 ? -1.549  6.363   -26.094 1.00 61.43 ? 203 ASN B CG   1  
ATOM 7360   O OD1  . ASN B 2 203 ? -2.317  5.661   -26.760 1.00 12.43 ? 203 ASN B OD1  1  
ATOM 7361   N ND2  . ASN B 2 203 ? -0.596  7.100   -26.660 1.00 52.24 ? 203 ASN B ND2  1  
ATOM 7362   H H    . ASN B 2 203 ? -1.639  5.985   -22.020 1.00 15.21 ? 203 ASN B H    1  
ATOM 7363   H HA   . ASN B 2 203 ? -3.118  4.859   -24.248 1.00 42.22 ? 203 ASN B HA   1  
ATOM 7364   H HB2  . ASN B 2 203 ? -2.344  7.213   -24.313 1.00 34.41 ? 203 ASN B HB2  1  
ATOM 7365   H HB3  . ASN B 2 203 ? -0.672  6.689   -24.161 1.00 62.25 ? 203 ASN B HB3  1  
ATOM 7366   H HD21 . ASN B 2 203 ? -0.016  7.634   -26.077 1.00 4.21  ? 203 ASN B HD21 1  
ATOM 7367   H HD22 . ASN B 2 203 ? -0.512  7.073   -27.634 1.00 65.44 ? 203 ASN B HD22 1  
ATOM 7368   N N    . ALA B 2 204 ? -1.689  2.695   -24.027 1.00 2.35  ? 204 ALA B N    1  
ATOM 7369   C CA   . ALA B 2 204 ? -0.950  1.451   -24.312 1.00 24.21 ? 204 ALA B CA   1  
ATOM 7370   C C    . ALA B 2 204 ? -1.929  0.262   -24.269 1.00 74.01 ? 204 ALA B C    1  
ATOM 7371   O O    . ALA B 2 204 ? -2.076  -0.411  -23.247 1.00 4.43  ? 204 ALA B O    1  
ATOM 7372   C CB   . ALA B 2 204 ? 0.235   1.248   -23.327 1.00 44.51 ? 204 ALA B CB   1  
ATOM 7373   H H    . ALA B 2 204 ? -2.607  2.619   -23.688 1.00 12.13 ? 204 ALA B H    1  
ATOM 7374   H HA   . ALA B 2 204 ? -0.543  1.529   -25.318 1.00 23.01 ? 204 ALA B HA   1  
ATOM 7375   H HB1  . ALA B 2 204 ? -0.139  1.179   -22.313 1.00 52.03 ? 204 ALA B HB1  1  
ATOM 7376   H HB2  . ALA B 2 204 ? 0.914   2.087   -23.398 1.00 45.23 ? 204 ALA B HB2  1  
ATOM 7377   H HB3  . ALA B 2 204 ? 0.769   0.338   -23.576 1.00 12.43 ? 204 ALA B HB3  1  
ATOM 7378   N N    . LEU B 2 205 ? -2.645  0.041   -25.386 1.00 14.33 ? 205 LEU B N    1  
ATOM 7379   C CA   . LEU B 2 205 ? -3.656  -1.032  -25.501 1.00 31.10 ? 205 LEU B CA   1  
ATOM 7380   C C    . LEU B 2 205 ? -3.221  -2.079  -26.555 1.00 10.23 ? 205 LEU B C    1  
ATOM 7381   O O    . LEU B 2 205 ? -4.047  -2.851  -27.056 1.00 23.51 ? 205 LEU B O    1  
ATOM 7382   C CB   . LEU B 2 205 ? -5.080  -0.440  -25.787 1.00 51.03 ? 205 LEU B CB   1  
ATOM 7383   C CG   . LEU B 2 205 ? -5.271  0.468   -27.054 1.00 20.40 ? 205 LEU B CG   1  
ATOM 7384   C CD1  . LEU B 2 205 ? -6.774  0.623   -27.402 1.00 21.23 ? 205 LEU B CD1  1  
ATOM 7385   C CD2  . LEU B 2 205 ? -4.620  1.868   -26.883 1.00 24.10 ? 205 LEU B CD2  1  
ATOM 7386   H H    . LEU B 2 205 ? -2.481  0.611   -26.170 1.00 72.30 ? 205 LEU B H    1  
ATOM 7387   H HA   . LEU B 2 205 ? -3.698  -1.553  -24.544 1.00 1.14  ? 205 LEU B HA   1  
ATOM 7388   H HB2  . LEU B 2 205 ? -5.769  -1.276  -25.868 1.00 71.43 ? 205 LEU B HB2  1  
ATOM 7389   H HB3  . LEU B 2 205 ? -5.373  0.137   -24.917 1.00 21.12 ? 205 LEU B HB3  1  
ATOM 7390   H HG   . LEU B 2 205 ? -4.795  -0.014  -27.898 1.00 43.34 ? 205 LEU B HG   1  
ATOM 7391   H HD11 . LEU B 2 205 ? -6.880  1.214   -28.302 1.00 54.25 ? 205 LEU B HD11 1  
ATOM 7392   H HD12 . LEU B 2 205 ? -7.296  1.110   -26.589 1.00 72.44 ? 205 LEU B HD12 1  
ATOM 7393   H HD13 . LEU B 2 205 ? -7.208  -0.354  -27.571 1.00 4.03  ? 205 LEU B HD13 1  
ATOM 7394   H HD21 . LEU B 2 205 ? -5.085  2.399   -26.060 1.00 41.35 ? 205 LEU B HD21 1  
ATOM 7395   H HD22 . LEU B 2 205 ? -4.748  2.438   -27.793 1.00 34.13 ? 205 LEU B HD22 1  
ATOM 7396   H HD23 . LEU B 2 205 ? -3.563  1.754   -26.687 1.00 11.23 ? 205 LEU B HD23 1  
ATOM 7397   N N    . GLU B 2 206 ? -1.895  -2.110  -26.823 1.00 45.42 ? 206 GLU B N    1  
ATOM 7398   C CA   . GLU B 2 206 ? -1.214  -3.114  -27.675 1.00 62.32 ? 206 GLU B CA   1  
ATOM 7399   C C    . GLU B 2 206 ? -1.817  -3.196  -29.108 1.00 22.24 ? 206 GLU B C    1  
ATOM 7400   O O    . GLU B 2 206 ? -1.469  -2.390  -29.972 1.00 2.52  ? 206 GLU B O    1  
ATOM 7401   C CB   . GLU B 2 206 ? -1.192  -4.515  -26.981 1.00 0.12  ? 206 GLU B CB   1  
ATOM 7402   C CG   . GLU B 2 206 ? -0.477  -5.647  -27.773 1.00 44.52 ? 206 GLU B CG   1  
ATOM 7403   C CD   . GLU B 2 206 ? -0.946  -7.065  -27.383 1.00 41.43 ? 206 GLU B CD   1  
ATOM 7404   O OE1  . GLU B 2 206 ? -0.137  -7.871  -26.883 1.00 13.12 ? 206 GLU B OE1  1  
ATOM 7405   O OE2  . GLU B 2 206 ? -2.151  -7.368  -27.579 1.00 54.24 ? 206 GLU B OE2  1  
ATOM 7406   H H    . GLU B 2 206 ? -1.343  -1.406  -26.430 1.00 4.35  ? 206 GLU B H    1  
ATOM 7407   H HA   . GLU B 2 206 ? -0.187  -2.774  -27.774 1.00 61.24 ? 206 GLU B HA   1  
ATOM 7408   H HB2  . GLU B 2 206 ? -0.701  -4.415  -26.018 1.00 52.23 ? 206 GLU B HB2  1  
ATOM 7409   H HB3  . GLU B 2 206 ? -2.216  -4.817  -26.806 1.00 25.53 ? 206 GLU B HB3  1  
ATOM 7410   H HG2  . GLU B 2 206 ? -0.669  -5.509  -28.833 1.00 70.30 ? 206 GLU B HG2  1  
ATOM 7411   H HG3  . GLU B 2 206 ? 0.592   -5.565  -27.601 1.00 34.13 ? 206 GLU B HG3  1  
ATOM 7412   N N    . LYS B 2 207 ? -2.767  -4.137  -29.320 1.00 12.52 ? 207 LYS B N    1  
ATOM 7413   C CA   . LYS B 2 207 ? -3.266  -4.500  -30.651 1.00 22.41 ? 207 LYS B CA   1  
ATOM 7414   C C    . LYS B 2 207 ? -4.342  -5.594  -30.516 1.00 42.42 ? 207 LYS B C    1  
ATOM 7415   O O    . LYS B 2 207 ? -5.517  -5.376  -30.836 1.00 12.40 ? 207 LYS B O    1  
ATOM 7416   C CB   . LYS B 2 207 ? -2.101  -5.002  -31.573 1.00 55.42 ? 207 LYS B CB   1  
ATOM 7417   C CG   . LYS B 2 207 ? -2.541  -5.438  -32.985 1.00 0.33  ? 207 LYS B CG   1  
ATOM 7418   C CD   . LYS B 2 207 ? -1.408  -6.091  -33.811 1.00 73.42 ? 207 LYS B CD   1  
ATOM 7419   C CE   . LYS B 2 207 ? -1.932  -6.753  -35.100 1.00 65.12 ? 207 LYS B CE   1  
ATOM 7420   N NZ   . LYS B 2 207 ? -2.884  -7.860  -34.808 1.00 74.32 ? 207 LYS B NZ   1  
ATOM 7421   H H    . LYS B 2 207 ? -3.161  -4.581  -28.544 1.00 73.25 ? 207 LYS B H    1  
ATOM 7422   H HA   . LYS B 2 207 ? -3.715  -3.614  -31.093 1.00 63.21 ? 207 LYS B HA   1  
ATOM 7423   H HB2  . LYS B 2 207 ? -1.376  -4.203  -31.675 1.00 54.54 ? 207 LYS B HB2  1  
ATOM 7424   H HB3  . LYS B 2 207 ? -1.618  -5.844  -31.088 1.00 73.32 ? 207 LYS B HB3  1  
ATOM 7425   H HG2  . LYS B 2 207 ? -3.350  -6.150  -32.883 1.00 52.42 ? 207 LYS B HG2  1  
ATOM 7426   H HG3  . LYS B 2 207 ? -2.910  -4.565  -33.518 1.00 34.31 ? 207 LYS B HG3  1  
ATOM 7427   H HD2  . LYS B 2 207 ? -0.684  -5.328  -34.079 1.00 43.42 ? 207 LYS B HD2  1  
ATOM 7428   H HD3  . LYS B 2 207 ? -0.916  -6.846  -33.205 1.00 52.43 ? 207 LYS B HD3  1  
ATOM 7429   H HE2  . LYS B 2 207 ? -2.436  -6.008  -35.705 1.00 5.15  ? 207 LYS B HE2  1  
ATOM 7430   H HE3  . LYS B 2 207 ? -1.092  -7.151  -35.656 1.00 70.55 ? 207 LYS B HE3  1  
ATOM 7431   H HZ1  . LYS B 2 207 ? -3.688  -7.507  -34.249 1.00 23.20 ? 207 LYS B HZ1  1  
ATOM 7432   H HZ2  . LYS B 2 207 ? -2.409  -8.607  -34.266 1.00 54.44 ? 207 LYS B HZ2  1  
ATOM 7433   H HZ3  . LYS B 2 207 ? -3.246  -8.269  -35.698 1.00 53.52 ? 207 LYS B HZ3  1  
ATOM 7434   N N    . GLY B 2 208 ? -3.917  -6.775  -30.020 1.00 3.23  ? 208 GLY B N    1  
ATOM 7435   C CA   . GLY B 2 208 ? -4.755  -7.981  -30.034 1.00 3.12  ? 208 GLY B CA   1  
ATOM 7436   C C    . GLY B 2 208 ? -4.829  -8.610  -31.430 1.00 5.12  ? 208 GLY B C    1  
ATOM 7437   O O    . GLY B 2 208 ? -4.447  -7.982  -32.422 1.00 71.52 ? 208 GLY B O    1  
ATOM 7438   H H    . GLY B 2 208 ? -3.014  -6.826  -29.637 1.00 32.42 ? 208 GLY B H    1  
ATOM 7439   H HA2  . GLY B 2 208 ? -4.331  -8.699  -29.345 1.00 41.21 ? 208 GLY B HA2  1  
ATOM 7440   H HA3  . GLY B 2 208 ? -5.760  -7.734  -29.707 1.00 54.42 ? 208 GLY B HA3  1  
ATOM 7441   N N    . GLY B 2 209 ? -5.296  -9.860  -31.514 1.00 14.33 ? 209 GLY B N    1  
ATOM 7442   C CA   . GLY B 2 209 ? -5.436  -10.552 -32.801 1.00 42.21 ? 209 GLY B CA   1  
ATOM 7443   C C    . GLY B 2 209 ? -5.465  -12.061 -32.656 1.00 4.25  ? 209 GLY B C    1  
ATOM 7444   O O    . GLY B 2 209 ? -5.307  -12.585 -31.544 1.00 40.55 ? 209 GLY B O    1  
ATOM 7445   H H    . GLY B 2 209 ? -5.541  -10.330 -30.689 1.00 63.34 ? 209 GLY B H    1  
ATOM 7446   H HA2  . GLY B 2 209 ? -6.359  -10.229 -33.261 1.00 23.51 ? 209 GLY B HA2  1  
ATOM 7447   H HA3  . GLY B 2 209 ? -4.608  -10.283 -33.452 1.00 50.54 ? 209 GLY B HA3  1  
ATOM 7448   N N    . LYS B 2 210 ? -5.712  -12.756 -33.795 1.00 52.24 ? 210 LYS B N    1  
ATOM 7449   C CA   . LYS B 2 210 ? -5.822  -14.246 -33.886 1.00 4.44  ? 210 LYS B CA   1  
ATOM 7450   C C    . LYS B 2 210 ? -7.045  -14.793 -33.105 1.00 3.41  ? 210 LYS B C    1  
ATOM 7451   O O    . LYS B 2 210 ? -7.229  -16.018 -33.007 1.00 23.41 ? 210 LYS B O    1  
ATOM 7452   C CB   . LYS B 2 210 ? -4.508  -14.945 -33.416 1.00 62.32 ? 210 LYS B CB   1  
ATOM 7453   C CG   . LYS B 2 210 ? -3.245  -14.535 -34.207 1.00 73.01 ? 210 LYS B CG   1  
ATOM 7454   C CD   . LYS B 2 210 ? -1.942  -15.081 -33.584 1.00 11.25 ? 210 LYS B CD   1  
ATOM 7455   C CE   . LYS B 2 210 ? -1.882  -16.617 -33.558 1.00 74.51 ? 210 LYS B CE   1  
ATOM 7456   N NZ   . LYS B 2 210 ? -0.667  -17.108 -32.858 1.00 60.12 ? 210 LYS B NZ   1  
ATOM 7457   H H    . LYS B 2 210 ? -5.828  -12.245 -34.624 1.00 20.54 ? 210 LYS B H    1  
ATOM 7458   H HA   . LYS B 2 210 ? -5.977  -14.474 -34.932 1.00 11.30 ? 210 LYS B HA   1  
ATOM 7459   H HB2  . LYS B 2 210 ? -4.346  -14.704 -32.367 1.00 72.24 ? 210 LYS B HB2  1  
ATOM 7460   H HB3  . LYS B 2 210 ? -4.634  -16.018 -33.506 1.00 3.23  ? 210 LYS B HB3  1  
ATOM 7461   H HG2  . LYS B 2 210 ? -3.332  -14.900 -35.225 1.00 3.42  ? 210 LYS B HG2  1  
ATOM 7462   H HG3  . LYS B 2 210 ? -3.191  -13.450 -34.230 1.00 13.31 ? 210 LYS B HG3  1  
ATOM 7463   H HD2  . LYS B 2 210 ? -1.102  -14.711 -34.160 1.00 73.20 ? 210 LYS B HD2  1  
ATOM 7464   H HD3  . LYS B 2 210 ? -1.858  -14.710 -32.567 1.00 2.54  ? 210 LYS B HD3  1  
ATOM 7465   H HE2  . LYS B 2 210 ? -2.752  -17.000 -33.043 1.00 25.31 ? 210 LYS B HE2  1  
ATOM 7466   H HE3  . LYS B 2 210 ? -1.874  -16.991 -34.575 1.00 52.25 ? 210 LYS B HE3  1  
ATOM 7467   H HZ1  . LYS B 2 210 ? 0.187   -16.699 -33.292 1.00 13.22 ? 210 LYS B HZ1  1  
ATOM 7468   H HZ2  . LYS B 2 210 ? -0.612  -18.142 -32.926 1.00 64.01 ? 210 LYS B HZ2  1  
ATOM 7469   H HZ3  . LYS B 2 210 ? -0.697  -16.839 -31.851 1.00 1.42  ? 210 LYS B HZ3  1  
ATOM 7470   N N    . GLY B 2 211 ? -7.882  -13.873 -32.586 1.00 24.34 ? 211 GLY B N    1  
ATOM 7471   C CA   . GLY B 2 211 ? -9.033  -14.219 -31.778 1.00 74.43 ? 211 GLY B CA   1  
ATOM 7472   C C    . GLY B 2 211 ? -10.224 -14.547 -32.650 1.00 12.30 ? 211 GLY B C    1  
ATOM 7473   O O    . GLY B 2 211 ? -10.295 -15.651 -33.184 1.00 13.10 ? 211 GLY B O    1  
ATOM 7474   H H    . GLY B 2 211 ? -7.715  -12.931 -32.775 1.00 25.24 ? 211 GLY B H    1  
ATOM 7475   H HA2  . GLY B 2 211 ? -8.799  -15.072 -31.149 1.00 30.22 ? 211 GLY B HA2  1  
ATOM 7476   H HA3  . GLY B 2 211 ? -9.275  -13.378 -31.142 1.00 55.44 ? 211 GLY B HA3  1  
ATOM 7477   N N    . SER B 2 212 ? -11.151 -13.571 -32.804 1.00 20.33 ? 212 SER B N    1  
ATOM 7478   C CA   . SER B 2 212 ? -12.426 -13.744 -33.550 1.00 3.24  ? 212 SER B CA   1  
ATOM 7479   C C    . SER B 2 212 ? -13.332 -14.845 -32.924 1.00 2.21  ? 212 SER B C    1  
ATOM 7480   O O    . SER B 2 212 ? -14.361 -15.213 -33.494 1.00 72.14 ? 212 SER B O    1  
ATOM 7481   C CB   . SER B 2 212 ? -12.136 -14.025 -35.053 1.00 74.04 ? 212 SER B CB   1  
ATOM 7482   O OG   . SER B 2 212 ? -11.298 -13.018 -35.603 1.00 62.22 ? 212 SER B OG   1  
ATOM 7483   H H    . SER B 2 212 ? -10.964 -12.694 -32.408 1.00 52.51 ? 212 SER B H    1  
ATOM 7484   H HA   . SER B 2 212 ? -12.958 -12.802 -33.476 1.00 30.11 ? 212 SER B HA   1  
ATOM 7485   H HB2  . SER B 2 212 ? -11.634 -14.979 -35.154 1.00 62.34 ? 212 SER B HB2  1  
ATOM 7486   H HB3  . SER B 2 212 ? -13.063 -14.045 -35.609 1.00 31.45 ? 212 SER B HB3  1  
ATOM 7487   H HG   . SER B 2 212 ? -10.498 -12.952 -35.072 1.00 0.21  ? 212 SER B HG   1  
ATOM 7488   N N    . ILE B 2 213 ? -12.952 -15.308 -31.723 1.00 22.33 ? 213 ILE B N    1  
ATOM 7489   C CA   . ILE B 2 213 ? -13.605 -16.402 -31.002 1.00 2.41  ? 213 ILE B CA   1  
ATOM 7490   C C    . ILE B 2 213 ? -13.189 -16.291 -29.519 1.00 32.12 ? 213 ILE B C    1  
ATOM 7491   O O    . ILE B 2 213 ? -11.996 -16.109 -29.212 1.00 22.11 ? 213 ILE B O    1  
ATOM 7492   C CB   . ILE B 2 213 ? -13.227 -17.824 -31.612 1.00 62.44 ? 213 ILE B CB   1  
ATOM 7493   C CG1  . ILE B 2 213 ? -14.034 -18.977 -30.936 1.00 11.23 ? 213 ILE B CG1  1  
ATOM 7494   C CG2  . ILE B 2 213 ? -11.707 -18.109 -31.552 1.00 64.40 ? 213 ILE B CG2  1  
ATOM 7495   C CD1  . ILE B 2 213 ? -15.536 -18.909 -31.152 1.00 10.25 ? 213 ILE B CD1  1  
ATOM 7496   H H    . ILE B 2 213 ? -12.194 -14.876 -31.286 1.00 11.04 ? 213 ILE B H    1  
ATOM 7497   H HA   . ILE B 2 213 ? -14.682 -16.260 -31.082 1.00 31.45 ? 213 ILE B HA   1  
ATOM 7498   H HB   . ILE B 2 213 ? -13.494 -17.797 -32.669 1.00 22.43 ? 213 ILE B HB   1  
ATOM 7499   H HG12 . ILE B 2 213 ? -13.702 -19.929 -31.331 1.00 40.31 ? 213 ILE B HG12 1  
ATOM 7500   H HG13 . ILE B 2 213 ? -13.856 -18.962 -29.868 1.00 23.34 ? 213 ILE B HG13 1  
ATOM 7501   H HG21 . ILE B 2 213 ? -11.375 -18.130 -30.522 1.00 70.12 ? 213 ILE B HG21 1  
ATOM 7502   H HG22 . ILE B 2 213 ? -11.172 -17.333 -32.082 1.00 54.33 ? 213 ILE B HG22 1  
ATOM 7503   H HG23 . ILE B 2 213 ? -11.493 -19.064 -32.016 1.00 22.41 ? 213 ILE B HG23 1  
ATOM 7504   H HD11 . ILE B 2 213 ? -15.759 -18.968 -32.207 1.00 61.34 ? 213 ILE B HD11 1  
ATOM 7505   H HD12 . ILE B 2 213 ? -15.924 -17.983 -30.751 1.00 21.35 ? 213 ILE B HD12 1  
ATOM 7506   H HD13 . ILE B 2 213 ? -16.006 -19.740 -30.643 1.00 44.44 ? 213 ILE B HD13 1  
ATOM 7507   N N    . THR B 2 214 ? -14.174 -16.351 -28.609 1.00 23.33 ? 214 THR B N    1  
ATOM 7508   C CA   . THR B 2 214 ? -13.945 -16.146 -27.162 1.00 34.15 ? 214 THR B CA   1  
ATOM 7509   C C    . THR B 2 214 ? -15.105 -16.757 -26.331 1.00 24.20 ? 214 THR B C    1  
ATOM 7510   O O    . THR B 2 214 ? -15.197 -16.528 -25.117 1.00 34.01 ? 214 THR B O    1  
ATOM 7511   C CB   . THR B 2 214 ? -13.772 -14.606 -26.847 1.00 44.10 ? 214 THR B CB   1  
ATOM 7512   O OG1  . THR B 2 214 ? -13.381 -14.400 -25.475 1.00 75.43 ? 214 THR B OG1  1  
ATOM 7513   C CG2  . THR B 2 214 ? -15.051 -13.789 -27.151 1.00 21.23 ? 214 THR B CG2  1  
ATOM 7514   H H    . THR B 2 214 ? -15.090 -16.523 -28.918 1.00 3.44  ? 214 THR B H    1  
ATOM 7515   H HA   . THR B 2 214 ? -13.024 -16.653 -26.891 1.00 51.43 ? 214 THR B HA   1  
ATOM 7516   H HB   . THR B 2 214 ? -12.974 -14.227 -27.478 1.00 62.43 ? 214 THR B HB   1  
ATOM 7517   H HG1  . THR B 2 214 ? -13.953 -14.907 -24.895 1.00 73.41 ? 214 THR B HG1  1  
ATOM 7518   H HG21 . THR B 2 214 ? -15.324 -13.909 -28.191 1.00 3.04  ? 214 THR B HG21 1  
ATOM 7519   H HG22 . THR B 2 214 ? -14.869 -12.741 -26.951 1.00 45.31 ? 214 THR B HG22 1  
ATOM 7520   H HG23 . THR B 2 214 ? -15.865 -14.133 -26.524 1.00 43.11 ? 214 THR B HG23 1  
ATOM 7521   N N    . GLU B 2 215 ? -15.960 -17.578 -26.988 1.00 4.44  ? 215 GLU B N    1  
ATOM 7522   C CA   . GLU B 2 215 ? -17.217 -18.089 -26.380 1.00 2.24  ? 215 GLU B CA   1  
ATOM 7523   C C    . GLU B 2 215 ? -16.904 -19.115 -25.276 1.00 22.34 ? 215 GLU B C    1  
ATOM 7524   O O    . GLU B 2 215 ? -17.679 -19.272 -24.328 1.00 21.22 ? 215 GLU B O    1  
ATOM 7525   C CB   . GLU B 2 215 ? -18.174 -18.732 -27.443 1.00 73.31 ? 215 GLU B CB   1  
ATOM 7526   C CG   . GLU B 2 215 ? -18.134 -18.135 -28.866 1.00 12.22 ? 215 GLU B CG   1  
ATOM 7527   C CD   . GLU B 2 215 ? -18.216 -16.603 -28.940 1.00 1.12  ? 215 GLU B CD   1  
ATOM 7528   O OE1  . GLU B 2 215 ? -17.166 -15.944 -29.164 1.00 63.41 ? 215 GLU B OE1  1  
ATOM 7529   O OE2  . GLU B 2 215 ? -19.325 -16.052 -28.788 1.00 72.43 ? 215 GLU B OE2  1  
ATOM 7530   H H    . GLU B 2 215 ? -15.734 -17.853 -27.898 1.00 61.43 ? 215 GLU B H    1  
ATOM 7531   H HA   . GLU B 2 215 ? -17.723 -17.241 -25.921 1.00 43.22 ? 215 GLU B HA   1  
ATOM 7532   H HB2  . GLU B 2 215 ? -17.941 -19.790 -27.536 1.00 20.03 ? 215 GLU B HB2  1  
ATOM 7533   H HB3  . GLU B 2 215 ? -19.196 -18.651 -27.076 1.00 51.44 ? 215 GLU B HB3  1  
ATOM 7534   H HG2  . GLU B 2 215 ? -17.212 -18.456 -29.332 1.00 3.13  ? 215 GLU B HG2  1  
ATOM 7535   H HG3  . GLU B 2 215 ? -18.962 -18.555 -29.431 1.00 60.31 ? 215 GLU B HG3  1  
ATOM 7536   N N    . GLN B 2 216 ? -15.765 -19.820 -25.431 1.00 33.01 ? 216 GLN B N    1  
ATOM 7537   C CA   . GLN B 2 216 ? -15.272 -20.774 -24.434 1.00 34.40 ? 216 GLN B CA   1  
ATOM 7538   C C    . GLN B 2 216 ? -14.544 -20.008 -23.306 1.00 3.51  ? 216 GLN B C    1  
ATOM 7539   O O    . GLN B 2 216 ? -13.326 -19.794 -23.366 1.00 4.45  ? 216 GLN B O    1  
ATOM 7540   C CB   . GLN B 2 216 ? -14.334 -21.829 -25.103 1.00 31.52 ? 216 GLN B CB   1  
ATOM 7541   C CG   . GLN B 2 216 ? -13.991 -23.051 -24.215 1.00 61.42 ? 216 GLN B CG   1  
ATOM 7542   C CD   . GLN B 2 216 ? -15.188 -23.979 -23.960 1.00 14.54 ? 216 GLN B CD   1  
ATOM 7543   O OE1  . GLN B 2 216 ? -16.063 -24.136 -24.811 1.00 34.14 ? 216 GLN B OE1  1  
ATOM 7544   N NE2  . GLN B 2 216 ? -15.238 -24.592 -22.796 1.00 44.42 ? 216 GLN B NE2  1  
ATOM 7545   H H    . GLN B 2 216 ? -15.239 -19.685 -26.246 1.00 44.22 ? 216 GLN B H    1  
ATOM 7546   H HA   . GLN B 2 216 ? -16.135 -21.293 -24.009 1.00 20.43 ? 216 GLN B HA   1  
ATOM 7547   H HB2  . GLN B 2 216 ? -14.812 -22.195 -26.005 1.00 53.24 ? 216 GLN B HB2  1  
ATOM 7548   H HB3  . GLN B 2 216 ? -13.405 -21.345 -25.385 1.00 53.22 ? 216 GLN B HB3  1  
ATOM 7549   H HG2  . GLN B 2 216 ? -13.214 -23.629 -24.700 1.00 44.24 ? 216 GLN B HG2  1  
ATOM 7550   H HG3  . GLN B 2 216 ? -13.619 -22.693 -23.261 1.00 11.04 ? 216 GLN B HG3  1  
ATOM 7551   H HE21 . GLN B 2 216 ? -14.514 -24.425 -22.158 1.00 45.44 ? 216 GLN B HE21 1  
ATOM 7552   H HE22 . GLN B 2 216 ? -15.976 -25.209 -22.623 1.00 14.43 ? 216 GLN B HE22 1  
ATOM 7553   N N    . LEU B 2 217 ? -15.327 -19.515 -22.328 1.00 71.31 ? 217 LEU B N    1  
ATOM 7554   C CA   . LEU B 2 217 ? -14.792 -18.888 -21.100 1.00 41.40 ? 217 LEU B CA   1  
ATOM 7555   C C    . LEU B 2 217 ? -14.336 -20.003 -20.136 1.00 71.31 ? 217 LEU B C    1  
ATOM 7556   O O    . LEU B 2 217 ? -13.352 -19.848 -19.413 1.00 55.01 ? 217 LEU B O    1  
ATOM 7557   C CB   . LEU B 2 217 ? -15.889 -17.960 -20.476 1.00 34.01 ? 217 LEU B CB   1  
ATOM 7558   C CG   . LEU B 2 217 ? -15.489 -16.979 -19.304 1.00 45.30 ? 217 LEU B CG   1  
ATOM 7559   C CD1  . LEU B 2 217 ? -15.393 -17.687 -17.930 1.00 75.40 ? 217 LEU B CD1  1  
ATOM 7560   C CD2  . LEU B 2 217 ? -14.186 -16.205 -19.628 1.00 74.10 ? 217 LEU B CD2  1  
ATOM 7561   H H    . LEU B 2 217 ? -16.302 -19.561 -22.440 1.00 1.55  ? 217 LEU B H    1  
ATOM 7562   H HA   . LEU B 2 217 ? -13.926 -18.287 -21.371 1.00 63.01 ? 217 LEU B HA   1  
ATOM 7563   H HB2  . LEU B 2 217 ? -16.293 -17.358 -21.282 1.00 23.54 ? 217 LEU B HB2  1  
ATOM 7564   H HB3  . LEU B 2 217 ? -16.697 -18.598 -20.118 1.00 12.05 ? 217 LEU B HB3  1  
ATOM 7565   H HG   . LEU B 2 217 ? -16.279 -16.236 -19.213 1.00 72.01 ? 217 LEU B HG   1  
ATOM 7566   H HD11 . LEU B 2 217 ? -14.604 -18.428 -17.954 1.00 2.34  ? 217 LEU B HD11 1  
ATOM 7567   H HD12 . LEU B 2 217 ? -16.332 -18.176 -17.706 1.00 54.23 ? 217 LEU B HD12 1  
ATOM 7568   H HD13 . LEU B 2 217 ? -15.180 -16.961 -17.158 1.00 31.31 ? 217 LEU B HD13 1  
ATOM 7569   H HD21 . LEU B 2 217 ? -13.358 -16.896 -19.724 1.00 25.32 ? 217 LEU B HD21 1  
ATOM 7570   H HD22 . LEU B 2 217 ? -13.972 -15.501 -18.835 1.00 20.33 ? 217 LEU B HD22 1  
ATOM 7571   H HD23 . LEU B 2 217 ? -14.304 -15.657 -20.557 1.00 74.51 ? 217 LEU B HD23 1  
ATOM 7572   N N    . LEU B 2 218 ? -15.061 -21.137 -20.174 1.00 52.22 ? 218 LEU B N    1  
ATOM 7573   C CA   . LEU B 2 218 ? -14.807 -22.296 -19.304 1.00 71.43 ? 218 LEU B CA   1  
ATOM 7574   C C    . LEU B 2 218 ? -13.461 -22.962 -19.681 1.00 62.11 ? 218 LEU B C    1  
ATOM 7575   O O    . LEU B 2 218 ? -13.395 -23.724 -20.647 1.00 71.30 ? 218 LEU B O    1  
ATOM 7576   C CB   . LEU B 2 218 ? -15.972 -23.343 -19.392 1.00 71.12 ? 218 LEU B CB   1  
ATOM 7577   C CG   . LEU B 2 218 ? -17.376 -22.924 -18.821 1.00 43.22 ? 218 LEU B CG   1  
ATOM 7578   C CD1  . LEU B 2 218 ? -18.040 -21.787 -19.634 1.00 24.34 ? 218 LEU B CD1  1  
ATOM 7579   C CD2  . LEU B 2 218 ? -18.319 -24.153 -18.715 1.00 34.23 ? 218 LEU B CD2  1  
ATOM 7580   H H    . LEU B 2 218 ? -15.789 -21.196 -20.825 1.00 62.21 ? 218 LEU B H    1  
ATOM 7581   H HA   . LEU B 2 218 ? -14.746 -21.932 -18.283 1.00 55.14 ? 218 LEU B HA   1  
ATOM 7582   H HB2  . LEU B 2 218 ? -16.102 -23.615 -20.435 1.00 4.04  ? 218 LEU B HB2  1  
ATOM 7583   H HB3  . LEU B 2 218 ? -15.651 -24.234 -18.858 1.00 52.41 ? 218 LEU B HB3  1  
ATOM 7584   H HG   . LEU B 2 218 ? -17.232 -22.546 -17.814 1.00 51.34 ? 218 LEU B HG   1  
ATOM 7585   H HD11 . LEU B 2 218 ? -17.389 -20.921 -19.644 1.00 71.14 ? 218 LEU B HD11 1  
ATOM 7586   H HD12 . LEU B 2 218 ? -18.979 -21.513 -19.178 1.00 71.14 ? 218 LEU B HD12 1  
ATOM 7587   H HD13 . LEU B 2 218 ? -18.218 -22.112 -20.654 1.00 52.12 ? 218 LEU B HD13 1  
ATOM 7588   H HD21 . LEU B 2 218 ? -19.271 -23.848 -18.297 1.00 34.31 ? 218 LEU B HD21 1  
ATOM 7589   H HD22 . LEU B 2 218 ? -17.877 -24.897 -18.066 1.00 51.54 ? 218 LEU B HD22 1  
ATOM 7590   H HD23 . LEU B 2 218 ? -18.481 -24.586 -19.695 1.00 61.12 ? 218 LEU B HD23 1  
ATOM 7591   N N    . ASN B 2 219 ? -12.386 -22.621 -18.943 1.00 12.21 ? 219 ASN B N    1  
ATOM 7592   C CA   . ASN B 2 219 ? -11.065 -23.264 -19.112 1.00 22.22 ? 219 ASN B CA   1  
ATOM 7593   C C    . ASN B 2 219 ? -11.082 -24.666 -18.488 1.00 3.14  ? 219 ASN B C    1  
ATOM 7594   O O    . ASN B 2 219 ? -10.588 -25.619 -19.093 1.00 71.24 ? 219 ASN B O    1  
ATOM 7595   C CB   . ASN B 2 219 ? -9.939  -22.368 -18.500 1.00 13.14 ? 219 ASN B CB   1  
ATOM 7596   C CG   . ASN B 2 219 ? -8.531  -23.004 -18.409 1.00 20.33 ? 219 ASN B CG   1  
ATOM 7597   O OD1  . ASN B 2 219 ? -7.725  -22.615 -17.563 1.00 54.51 ? 219 ASN B OD1  1  
ATOM 7598   N ND2  . ASN B 2 219 ? -8.216  -23.972 -19.255 1.00 60.15 ? 219 ASN B ND2  1  
ATOM 7599   H H    . ASN B 2 219 ? -12.480 -21.907 -18.275 1.00 1.21  ? 219 ASN B H    1  
ATOM 7600   H HA   . ASN B 2 219 ? -10.880 -23.367 -20.182 1.00 61.11 ? 219 ASN B HA   1  
ATOM 7601   H HB2  . ASN B 2 219 ? -9.848  -21.477 -19.099 1.00 31.33 ? 219 ASN B HB2  1  
ATOM 7602   H HB3  . ASN B 2 219 ? -10.241 -22.076 -17.498 1.00 53.42 ? 219 ASN B HB3  1  
ATOM 7603   H HD21 . ASN B 2 219 ? -8.881  -24.258 -19.917 1.00 15.33 ? 219 ASN B HD21 1  
ATOM 7604   H HD22 . ASN B 2 219 ? -7.337  -24.387 -19.168 1.00 24.03 ? 219 ASN B HD22 1  
ATOM 7605   N N    . ALA B 2 220 ? -11.668 -24.776 -17.283 1.00 33.41 ? 220 ALA B N    1  
ATOM 7606   C CA   . ALA B 2 220 ? -11.748 -26.046 -16.538 1.00 44.21 ? 220 ALA B CA   1  
ATOM 7607   C C    . ALA B 2 220 ? -13.203 -26.539 -16.417 1.00 41.32 ? 220 ALA B C    1  
ATOM 7608   O O    . ALA B 2 220 ? -13.587 -27.512 -17.082 1.00 61.10 ? 220 ALA B O    1  
ATOM 7609   C CB   . ALA B 2 220 ? -11.074 -25.908 -15.163 1.00 13.31 ? 220 ALA B CB   1  
ATOM 7610   H H    . ALA B 2 220 ? -12.068 -23.979 -16.889 1.00 32.12 ? 220 ALA B H    1  
ATOM 7611   H HA   . ALA B 2 220 ? -11.187 -26.794 -17.094 1.00 32.13 ? 220 ALA B HA   1  
ATOM 7612   H HB1  . ALA B 2 220 ? -10.052 -25.568 -15.286 1.00 74.30 ? 220 ALA B HB1  1  
ATOM 7613   H HB2  . ALA B 2 220 ? -11.069 -26.866 -14.655 1.00 60.11 ? 220 ALA B HB2  1  
ATOM 7614   H HB3  . ALA B 2 220 ? -11.615 -25.190 -14.563 1.00 24.24 ? 220 ALA B HB3  1  
ATOM 7615   N N    . ARG B 2 221 ? -14.018 -25.861 -15.574 1.00 13.52 ? 221 ARG B N    1  
ATOM 7616   C CA   . ARG B 2 221 ? -15.429 -26.244 -15.369 1.00 34.11 ? 221 ARG B CA   1  
ATOM 7617   C C    . ARG B 2 221 ? -16.266 -25.047 -14.887 1.00 31.43 ? 221 ARG B C    1  
ATOM 7618   O O    . ARG B 2 221 ? -16.923 -24.397 -15.703 1.00 2.02  ? 221 ARG B O    1  
ATOM 7619   C CB   . ARG B 2 221 ? -15.543 -27.430 -14.366 1.00 24.31 ? 221 ARG B CB   1  
ATOM 7620   C CG   . ARG B 2 221 ? -16.946 -28.086 -14.255 1.00 53.50 ? 221 ARG B CG   1  
ATOM 7621   C CD   . ARG B 2 221 ? -17.314 -28.977 -15.463 1.00 52.41 ? 221 ARG B CD   1  
ATOM 7622   N NE   . ARG B 2 221 ? -17.470 -28.211 -16.719 1.00 3.22  ? 221 ARG B NE   1  
ATOM 7623   C CZ   . ARG B 2 221 ? -16.849 -28.482 -17.886 1.00 22.23 ? 221 ARG B CZ   1  
ATOM 7624   N NH1  . ARG B 2 221 ? -16.020 -29.519 -17.997 1.00 73.55 ? 221 ARG B NH1  1  
ATOM 7625   N NH2  . ARG B 2 221 ? -17.057 -27.691 -18.926 1.00 41.24 ? 221 ARG B NH2  1  
ATOM 7626   H H    . ARG B 2 221 ? -13.658 -25.097 -15.082 1.00 12.30 ? 221 ARG B H    1  
ATOM 7627   H HA   . ARG B 2 221 ? -15.826 -26.566 -16.327 1.00 25.50 ? 221 ARG B HA   1  
ATOM 7628   H HB2  . ARG B 2 221 ? -14.838 -28.197 -14.660 1.00 4.11  ? 221 ARG B HB2  1  
ATOM 7629   H HB3  . ARG B 2 221 ? -15.261 -27.072 -13.381 1.00 2.21  ? 221 ARG B HB3  1  
ATOM 7630   H HG2  . ARG B 2 221 ? -16.964 -28.702 -13.362 1.00 62.21 ? 221 ARG B HG2  1  
ATOM 7631   H HG3  . ARG B 2 221 ? -17.692 -27.306 -14.152 1.00 53.33 ? 221 ARG B HG3  1  
ATOM 7632   H HD2  . ARG B 2 221 ? -16.547 -29.734 -15.586 1.00 10.05 ? 221 ARG B HD2  1  
ATOM 7633   H HD3  . ARG B 2 221 ? -18.258 -29.468 -15.245 1.00 14.23 ? 221 ARG B HD3  1  
ATOM 7634   H HE   . ARG B 2 221 ? -18.069 -27.436 -16.686 1.00 52.44 ? 221 ARG B HE   1  
ATOM 7635   H HH11 . ARG B 2 221 ? -15.844 -30.117 -17.203 1.00 54.52 ? 221 ARG B HH11 1  
ATOM 7636   H HH12 . ARG B 2 221 ? -15.567 -29.712 -18.866 1.00 24.42 ? 221 ARG B HH12 1  
ATOM 7637   H HH21 . ARG B 2 221 ? -17.668 -26.900 -18.848 1.00 61.51 ? 221 ARG B HH21 1  
ATOM 7638   H HH22 . ARG B 2 221 ? -16.604 -27.880 -19.804 1.00 52.35 ? 221 ARG B HH22 1  
ATOM 7639   N N    . ALA B 2 222 ? -16.219 -24.748 -13.566 1.00 42.52 ? 222 ALA B N    1  
ATOM 7640   C CA   . ALA B 2 222 ? -17.079 -23.715 -12.950 1.00 1.31  ? 222 ALA B CA   1  
ATOM 7641   C C    . ALA B 2 222 ? -16.641 -23.401 -11.504 1.00 34.41 ? 222 ALA B C    1  
ATOM 7642   O O    . ALA B 2 222 ? -16.280 -24.323 -10.768 1.00 22.22 ? 222 ALA B O    1  
ATOM 7643   C CB   . ALA B 2 222 ? -18.559 -24.159 -12.973 1.00 5.53  ? 222 ALA B CB   1  
ATOM 7644   H H    . ALA B 2 222 ? -15.588 -25.235 -12.992 1.00 52.04 ? 222 ALA B H    1  
ATOM 7645   H HA   . ALA B 2 222 ? -16.986 -22.815 -13.547 1.00 75.21 ? 222 ALA B HA   1  
ATOM 7646   H HB1  . ALA B 2 222 ? -18.869 -24.349 -13.996 1.00 64.42 ? 222 ALA B HB1  1  
ATOM 7647   H HB2  . ALA B 2 222 ? -19.179 -23.380 -12.557 1.00 74.24 ? 222 ALA B HB2  1  
ATOM 7648   H HB3  . ALA B 2 222 ? -18.681 -25.065 -12.391 1.00 51.40 ? 222 ALA B HB3  1  
ATOM 7649   N N    . ASP B 2 223 ? -16.660 -22.092 -11.146 1.00 23.44 ? 223 ASP B N    1  
ATOM 7650   C CA   . ASP B 2 223 ? -16.511 -21.557 -9.752  1.00 31.43 ? 223 ASP B CA   1  
ATOM 7651   C C    . ASP B 2 223 ? -15.280 -22.108 -8.983  1.00 15.12 ? 223 ASP B C    1  
ATOM 7652   O O    . ASP B 2 223 ? -14.242 -21.437 -8.913  1.00 2.11  ? 223 ASP B O    1  
ATOM 7653   C CB   . ASP B 2 223 ? -17.838 -21.736 -8.947  1.00 21.25 ? 223 ASP B CB   1  
ATOM 7654   C CG   . ASP B 2 223 ? -17.772 -21.177 -7.506  1.00 51.44 ? 223 ASP B CG   1  
ATOM 7655   O OD1  . ASP B 2 223 ? -17.649 -21.976 -6.541  1.00 61.02 ? 223 ASP B OD1  1  
ATOM 7656   O OD2  . ASP B 2 223 ? -17.811 -19.939 -7.334  1.00 45.24 ? 223 ASP B OD2  1  
ATOM 7657   H H    . ASP B 2 223 ? -16.775 -21.434 -11.864 1.00 72.13 ? 223 ASP B H    1  
ATOM 7658   H HA   . ASP B 2 223 ? -16.351 -20.492 -9.871  1.00 1.22  ? 223 ASP B HA   1  
ATOM 7659   H HB2  . ASP B 2 223 ? -18.636 -21.223 -9.472  1.00 5.14  ? 223 ASP B HB2  1  
ATOM 7660   H HB3  . ASP B 2 223 ? -18.083 -22.794 -8.903  1.00 54.05 ? 223 ASP B HB3  1  
ATOM 7661   N N    . VAL B 2 224 ? -15.416 -23.320 -8.399  1.00 72.12 ? 224 VAL B N    1  
ATOM 7662   C CA   . VAL B 2 224 ? -14.347 -23.976 -7.618  1.00 74.20 ? 224 VAL B CA   1  
ATOM 7663   C C    . VAL B 2 224 ? -13.102 -24.233 -8.496  1.00 45.33 ? 224 VAL B C    1  
ATOM 7664   O O    . VAL B 2 224 ? -11.963 -24.033 -8.057  1.00 42.24 ? 224 VAL B O    1  
ATOM 7665   C CB   . VAL B 2 224 ? -14.858 -25.328 -6.965  1.00 61.04 ? 224 VAL B CB   1  
ATOM 7666   C CG1  . VAL B 2 224 ? -15.371 -26.331 -8.034  1.00 1.23  ? 224 VAL B CG1  1  
ATOM 7667   C CG2  . VAL B 2 224 ? -13.772 -25.978 -6.061  1.00 54.24 ? 224 VAL B CG2  1  
ATOM 7668   H H    . VAL B 2 224 ? -16.273 -23.788 -8.496  1.00 44.53 ? 224 VAL B H    1  
ATOM 7669   H HA   . VAL B 2 224 ? -14.074 -23.296 -6.812  1.00 13.11 ? 224 VAL B HA   1  
ATOM 7670   H HB   . VAL B 2 224 ? -15.707 -25.076 -6.329  1.00 74.55 ? 224 VAL B HB   1  
ATOM 7671   H HG11 . VAL B 2 224 ? -14.564 -26.597 -8.706  1.00 43.12 ? 224 VAL B HG11 1  
ATOM 7672   H HG12 . VAL B 2 224 ? -16.171 -25.873 -8.606  1.00 75.32 ? 224 VAL B HG12 1  
ATOM 7673   H HG13 . VAL B 2 224 ? -15.746 -27.225 -7.555  1.00 13.31 ? 224 VAL B HG13 1  
ATOM 7674   H HG21 . VAL B 2 224 ? -13.479 -25.283 -5.284  1.00 74.13 ? 224 VAL B HG21 1  
ATOM 7675   H HG22 . VAL B 2 224 ? -12.900 -26.231 -6.653  1.00 33.23 ? 224 VAL B HG22 1  
ATOM 7676   H HG23 . VAL B 2 224 ? -14.163 -26.878 -5.603  1.00 63.22 ? 224 VAL B HG23 1  
ATOM 7677   N N    . THR B 2 225 ? -13.344 -24.638 -9.752  1.00 44.42 ? 225 THR B N    1  
ATOM 7678   C CA   . THR B 2 225 ? -12.300 -24.920 -10.741 1.00 52.25 ? 225 THR B CA   1  
ATOM 7679   C C    . THR B 2 225 ? -12.827 -24.493 -12.124 1.00 12.21 ? 225 THR B C    1  
ATOM 7680   O O    . THR B 2 225 ? -13.435 -25.285 -12.838 1.00 0.34  ? 225 THR B O    1  
ATOM 7681   C CB   . THR B 2 225 ? -11.895 -26.442 -10.719 1.00 23.32 ? 225 THR B CB   1  
ATOM 7682   O OG1  . THR B 2 225 ? -11.640 -26.860 -9.365  1.00 51.21 ? 225 THR B OG1  1  
ATOM 7683   C CG2  . THR B 2 225 ? -10.638 -26.735 -11.563 1.00 54.34 ? 225 THR B CG2  1  
ATOM 7684   H H    . THR B 2 225 ? -14.274 -24.754 -10.026 1.00 13.44 ? 225 THR B H    1  
ATOM 7685   H HA   . THR B 2 225 ? -11.420 -24.322 -10.500 1.00 73.55 ? 225 THR B HA   1  
ATOM 7686   H HB   . THR B 2 225 ? -12.723 -27.030 -11.106 1.00 51.33 ? 225 THR B HB   1  
ATOM 7687   H HG1  . THR B 2 225 ? -11.296 -26.117 -8.854  1.00 1.14  ? 225 THR B HG1  1  
ATOM 7688   H HG21 . THR B 2 225 ? -9.803  -26.157 -11.186 1.00 10.20 ? 225 THR B HG21 1  
ATOM 7689   H HG22 . THR B 2 225 ? -10.820 -26.470 -12.591 1.00 21.21 ? 225 THR B HG22 1  
ATOM 7690   H HG23 . THR B 2 225 ? -10.395 -27.792 -11.507 1.00 71.31 ? 225 THR B HG23 1  
ATOM 7691   N N    . LEU B 2 226 ? -12.673 -23.196 -12.444 1.00 41.32 ? 226 LEU B N    1  
ATOM 7692   C CA   . LEU B 2 226 ? -13.082 -22.618 -13.746 1.00 32.30 ? 226 LEU B CA   1  
ATOM 7693   C C    . LEU B 2 226 ? -11.843 -22.380 -14.637 1.00 4.02  ? 226 LEU B C    1  
ATOM 7694   O O    . LEU B 2 226 ? -11.968 -22.197 -15.852 1.00 2.42  ? 226 LEU B O    1  
ATOM 7695   C CB   . LEU B 2 226 ? -13.885 -21.303 -13.509 1.00 74.43 ? 226 LEU B CB   1  
ATOM 7696   C CG   . LEU B 2 226 ? -14.437 -20.554 -14.774 1.00 14.32 ? 226 LEU B CG   1  
ATOM 7697   C CD1  . LEU B 2 226 ? -15.421 -21.426 -15.582 1.00 72.03 ? 226 LEU B CD1  1  
ATOM 7698   C CD2  . LEU B 2 226 ? -15.085 -19.202 -14.385 1.00 74.41 ? 226 LEU B CD2  1  
ATOM 7699   H H    . LEU B 2 226 ? -12.266 -22.599 -11.785 1.00 53.11 ? 226 LEU B H    1  
ATOM 7700   H HA   . LEU B 2 226 ? -13.729 -23.335 -14.250 1.00 62.14 ? 226 LEU B HA   1  
ATOM 7701   H HB2  . LEU B 2 226 ? -14.727 -21.538 -12.868 1.00 5.11  ? 226 LEU B HB2  1  
ATOM 7702   H HB3  . LEU B 2 226 ? -13.242 -20.615 -12.970 1.00 35.21 ? 226 LEU B HB3  1  
ATOM 7703   H HG   . LEU B 2 226 ? -13.603 -20.335 -15.427 1.00 31.21 ? 226 LEU B HG   1  
ATOM 7704   H HD11 . LEU B 2 226 ? -15.757 -20.881 -16.455 1.00 33.25 ? 226 LEU B HD11 1  
ATOM 7705   H HD12 . LEU B 2 226 ? -16.275 -21.686 -14.971 1.00 5.20  ? 226 LEU B HD12 1  
ATOM 7706   H HD13 . LEU B 2 226 ? -14.924 -22.332 -15.905 1.00 44.42 ? 226 LEU B HD13 1  
ATOM 7707   H HD21 . LEU B 2 226 ? -14.348 -18.575 -13.899 1.00 63.05 ? 226 LEU B HD21 1  
ATOM 7708   H HD22 . LEU B 2 226 ? -15.914 -19.368 -13.708 1.00 43.43 ? 226 LEU B HD22 1  
ATOM 7709   H HD23 . LEU B 2 226 ? -15.442 -18.701 -15.274 1.00 43.22 ? 226 LEU B HD23 1  
ATOM 7710   N N    . GLY B 2 227 ? -10.645 -22.436 -14.022 1.00 24.54 ? 227 GLY B N    1  
ATOM 7711   C CA   . GLY B 2 227 ? -9.376  -22.249 -14.731 1.00 32.43 ? 227 GLY B CA   1  
ATOM 7712   C C    . GLY B 2 227 ? -8.226  -22.991 -14.072 1.00 51.31 ? 227 GLY B C    1  
ATOM 7713   O O    . GLY B 2 227 ? -8.418  -23.660 -13.045 1.00 44.42 ? 227 GLY B O    1  
ATOM 7714   H H    . GLY B 2 227 ? -10.619 -22.611 -13.060 1.00 71.24 ? 227 GLY B H    1  
ATOM 7715   H HA2  . GLY B 2 227 ? -9.476  -22.605 -15.750 1.00 53.04 ? 227 GLY B HA2  1  
ATOM 7716   H HA3  . GLY B 2 227 ? -9.142  -21.193 -14.752 1.00 25.43 ? 227 GLY B HA3  1  
ATOM 7717   N N    . GLY B 2 228 ? -7.029  -22.889 -14.680 1.00 52.15 ? 228 GLY B N    1  
ATOM 7718   C CA   . GLY B 2 228 ? -5.816  -23.532 -14.163 1.00 72.41 ? 228 GLY B CA   1  
ATOM 7719   C C    . GLY B 2 228 ? -5.763  -25.021 -14.475 1.00 20.12 ? 228 GLY B C    1  
ATOM 7720   O O    . GLY B 2 228 ? -4.982  -25.464 -15.329 1.00 52.20 ? 228 GLY B O    1  
ATOM 7721   H H    . GLY B 2 228 ? -6.971  -22.367 -15.509 1.00 42.03 ? 228 GLY B H    1  
ATOM 7722   H HA2  . GLY B 2 228 ? -4.956  -23.047 -14.610 1.00 41.32 ? 228 GLY B HA2  1  
ATOM 7723   H HA3  . GLY B 2 228 ? -5.762  -23.393 -13.089 1.00 14.41 ? 228 GLY B HA3  1  
ATOM 7724   N N    . GLY B 2 229 ? -6.604  -25.795 -13.767 1.00 30.04 ? 229 GLY B N    1  
ATOM 7725   C CA   . GLY B 2 229 ? -6.713  -27.232 -13.973 1.00 2.40  ? 229 GLY B CA   1  
ATOM 7726   C C    . GLY B 2 229 ? -5.561  -28.006 -13.345 1.00 34.13 ? 229 GLY B C    1  
ATOM 7727   O O    . GLY B 2 229 ? -5.721  -28.612 -12.279 1.00 70.24 ? 229 GLY B O    1  
ATOM 7728   H H    . GLY B 2 229 ? -7.164  -25.370 -13.080 1.00 54.31 ? 229 GLY B H    1  
ATOM 7729   H HA2  . GLY B 2 229 ? -7.645  -27.567 -13.537 1.00 50.52 ? 229 GLY B HA2  1  
ATOM 7730   H HA3  . GLY B 2 229 ? -6.742  -27.439 -15.038 1.00 71.04 ? 229 GLY B HA3  1  
ATOM 7731   N N    . ALA B 2 230 ? -4.391  -27.971 -14.011 1.00 70.23 ? 230 ALA B N    1  
ATOM 7732   C CA   . ALA B 2 230 ? -3.175  -28.662 -13.558 1.00 31.02 ? 230 ALA B CA   1  
ATOM 7733   C C    . ALA B 2 230 ? -1.925  -27.920 -14.074 1.00 11.10 ? 230 ALA B C    1  
ATOM 7734   O O    . ALA B 2 230 ? -1.695  -27.848 -15.292 1.00 65.02 ? 230 ALA B O    1  
ATOM 7735   C CB   . ALA B 2 230 ? -3.198  -30.124 -14.039 1.00 15.04 ? 230 ALA B CB   1  
ATOM 7736   H H    . ALA B 2 230 ? -4.348  -27.462 -14.849 1.00 70.12 ? 230 ALA B H    1  
ATOM 7737   H HA   . ALA B 2 230 ? -3.164  -28.662 -12.467 1.00 31.44 ? 230 ALA B HA   1  
ATOM 7738   H HB1  . ALA B 2 230 ? -4.085  -30.613 -13.660 1.00 53.04 ? 230 ALA B HB1  1  
ATOM 7739   H HB2  . ALA B 2 230 ? -2.322  -30.646 -13.677 1.00 45.33 ? 230 ALA B HB2  1  
ATOM 7740   H HB3  . ALA B 2 230 ? -3.211  -30.155 -15.122 1.00 22.15 ? 230 ALA B HB3  1  
ATOM 7741   N N    . LYS B 2 231 ? -1.145  -27.333 -13.135 1.00 51.42 ? 231 LYS B N    1  
ATOM 7742   C CA   . LYS B 2 231 ? 0.127   -26.636 -13.441 1.00 71.21 ? 231 LYS B CA   1  
ATOM 7743   C C    . LYS B 2 231 ? 1.196   -27.048 -12.405 1.00 44.53 ? 231 LYS B C    1  
ATOM 7744   O O    . LYS B 2 231 ? 1.373   -26.369 -11.382 1.00 1.01  ? 231 LYS B O    1  
ATOM 7745   C CB   . LYS B 2 231 ? -0.029  -25.080 -13.432 1.00 73.24 ? 231 LYS B CB   1  
ATOM 7746   C CG   . LYS B 2 231 ? -1.082  -24.492 -14.398 1.00 24.44 ? 231 LYS B CG   1  
ATOM 7747   C CD   . LYS B 2 231 ? -0.995  -22.949 -14.504 1.00 53.13 ? 231 LYS B CD   1  
ATOM 7748   C CE   . LYS B 2 231 ? -1.062  -22.225 -13.145 1.00 51.24 ? 231 LYS B CE   1  
ATOM 7749   N NZ   . LYS B 2 231 ? -1.014  -20.749 -13.318 1.00 22.05 ? 231 LYS B NZ   1  
ATOM 7750   H H    . LYS B 2 231 ? -1.433  -27.384 -12.198 1.00 61.24 ? 231 LYS B H    1  
ATOM 7751   H HA   . LYS B 2 231 ? 0.463   -26.953 -14.428 1.00 72.03 ? 231 LYS B HA   1  
ATOM 7752   H HB2  . LYS B 2 231 ? -0.295  -24.768 -12.426 1.00 71.33 ? 231 LYS B HB2  1  
ATOM 7753   H HB3  . LYS B 2 231 ? 0.934   -24.640 -13.676 1.00 51.31 ? 231 LYS B HB3  1  
ATOM 7754   H HG2  . LYS B 2 231 ? -0.928  -24.917 -15.384 1.00 2.35  ? 231 LYS B HG2  1  
ATOM 7755   H HG3  . LYS B 2 231 ? -2.073  -24.768 -14.049 1.00 52.54 ? 231 LYS B HG3  1  
ATOM 7756   H HD2  . LYS B 2 231 ? -0.063  -22.685 -14.988 1.00 23.23 ? 231 LYS B HD2  1  
ATOM 7757   H HD3  . LYS B 2 231 ? -1.818  -22.599 -15.124 1.00 34.22 ? 231 LYS B HD3  1  
ATOM 7758   H HE2  . LYS B 2 231 ? -1.987  -22.484 -12.649 1.00 54.22 ? 231 LYS B HE2  1  
ATOM 7759   H HE3  . LYS B 2 231 ? -0.224  -22.531 -12.532 1.00 31.54 ? 231 LYS B HE3  1  
ATOM 7760   H HZ1  . LYS B 2 231 ? -1.858  -20.425 -13.843 1.00 31.32 ? 231 LYS B HZ1  1  
ATOM 7761   H HZ2  . LYS B 2 231 ? -0.167  -20.476 -13.853 1.00 5.15  ? 231 LYS B HZ2  1  
ATOM 7762   H HZ3  . LYS B 2 231 ? -0.994  -20.276 -12.394 1.00 33.23 ? 231 LYS B HZ3  1  
ATOM 7763   N N    . THR B 2 232 ? 1.866   -28.183 -12.649 1.00 34.21 ? 232 THR B N    1  
ATOM 7764   C CA   . THR B 2 232 ? 2.940   -28.687 -11.769 1.00 14.42 ? 232 THR B CA   1  
ATOM 7765   C C    . THR B 2 232 ? 4.249   -27.886 -11.972 1.00 50.20 ? 232 THR B C    1  
ATOM 7766   O O    . THR B 2 232 ? 4.459   -27.293 -13.034 1.00 71.32 ? 232 THR B O    1  
ATOM 7767   C CB   . THR B 2 232 ? 3.180   -30.206 -12.038 1.00 74.24 ? 232 THR B CB   1  
ATOM 7768   O OG1  . THR B 2 232 ? 3.435   -30.416 -13.438 1.00 65.52 ? 232 THR B OG1  1  
ATOM 7769   C CG2  . THR B 2 232 ? 1.969   -31.058 -11.603 1.00 31.31 ? 232 THR B CG2  1  
ATOM 7770   H H    . THR B 2 232 ? 1.641   -28.704 -13.449 1.00 23.11 ? 232 THR B H    1  
ATOM 7771   H HA   . THR B 2 232 ? 2.616   -28.568 -10.736 1.00 60.13 ? 232 THR B HA   1  
ATOM 7772   H HB   . THR B 2 232 ? 4.050   -30.532 -11.472 1.00 42.35 ? 232 THR B HB   1  
ATOM 7773   H HG1  . THR B 2 232 ? 3.427   -31.360 -13.630 1.00 61.11 ? 232 THR B HG1  1  
ATOM 7774   H HG21 . THR B 2 232 ? 1.808   -30.949 -10.538 1.00 11.53 ? 232 THR B HG21 1  
ATOM 7775   H HG22 . THR B 2 232 ? 2.157   -32.099 -11.828 1.00 12.41 ? 232 THR B HG22 1  
ATOM 7776   H HG23 . THR B 2 232 ? 1.083   -30.733 -12.135 1.00 53.03 ? 232 THR B HG23 1  
ATOM 7777   N N    . PHE B 2 233 ? 5.119   -27.875 -10.945 1.00 12.52 ? 233 PHE B N    1  
ATOM 7778   C CA   . PHE B 2 233 ? 6.416   -27.165 -10.977 1.00 23.11 ? 233 PHE B CA   1  
ATOM 7779   C C    . PHE B 2 233 ? 7.519   -28.081 -10.408 1.00 4.55  ? 233 PHE B C    1  
ATOM 7780   O O    . PHE B 2 233 ? 7.381   -28.595 -9.299  1.00 70.41 ? 233 PHE B O    1  
ATOM 7781   C CB   . PHE B 2 233 ? 6.328   -25.817 -10.183 1.00 34.32 ? 233 PHE B CB   1  
ATOM 7782   C CG   . PHE B 2 233 ? 6.042   -25.968 -8.674  1.00 33.34 ? 233 PHE B CG   1  
ATOM 7783   C CD1  . PHE B 2 233 ? 4.756   -26.245 -8.213  1.00 0.01  ? 233 PHE B CD1  1  
ATOM 7784   C CD2  . PHE B 2 233 ? 7.070   -25.865 -7.730  1.00 45.33 ? 233 PHE B CD2  1  
ATOM 7785   C CE1  . PHE B 2 233 ? 4.505   -26.415 -6.867  1.00 10.15 ? 233 PHE B CE1  1  
ATOM 7786   C CE2  . PHE B 2 233 ? 6.815   -26.033 -6.383  1.00 62.04 ? 233 PHE B CE2  1  
ATOM 7787   C CZ   . PHE B 2 233 ? 5.532   -26.309 -5.951  1.00 30.32 ? 233 PHE B CZ   1  
ATOM 7788   H H    . PHE B 2 233 ? 4.885   -28.365 -10.133 1.00 22.02 ? 233 PHE B H    1  
ATOM 7789   H HA   . PHE B 2 233 ? 6.655   -26.945 -12.016 1.00 43.21 ? 233 PHE B HA   1  
ATOM 7790   H HB2  . PHE B 2 233 ? 7.266   -25.279 -10.299 1.00 52.20 ? 233 PHE B HB2  1  
ATOM 7791   H HB3  . PHE B 2 233 ? 5.538   -25.212 -10.613 1.00 42.14 ? 233 PHE B HB3  1  
ATOM 7792   H HD1  . PHE B 2 233 ? 3.943   -26.328 -8.928  1.00 4.23  ? 233 PHE B HD1  1  
ATOM 7793   H HD2  . PHE B 2 233 ? 8.080   -25.646 -8.065  1.00 62.11 ? 233 PHE B HD2  1  
ATOM 7794   H HE1  . PHE B 2 233 ? 3.501   -26.627 -6.530  1.00 5.32  ? 233 PHE B HE1  1  
ATOM 7795   H HE2  . PHE B 2 233 ? 7.621   -25.948 -5.668  1.00 40.13 ? 233 PHE B HE2  1  
ATOM 7796   H HZ   . PHE B 2 233 ? 5.333   -26.444 -4.896  1.00 71.44 ? 233 PHE B HZ   1  
ATOM 7797   N N    . ALA B 2 234 ? 8.586   -28.306 -11.185 1.00 24.54 ? 234 ALA B N    1  
ATOM 7798   C CA   . ALA B 2 234 ? 9.760   -29.094 -10.755 1.00 72.31 ? 234 ALA B CA   1  
ATOM 7799   C C    . ALA B 2 234 ? 10.850  -28.947 -11.822 1.00 60.30 ? 234 ALA B C    1  
ATOM 7800   O O    . ALA B 2 234 ? 10.795  -29.611 -12.864 1.00 65.32 ? 234 ALA B O    1  
ATOM 7801   C CB   . ALA B 2 234 ? 9.402   -30.586 -10.520 1.00 50.43 ? 234 ALA B CB   1  
ATOM 7802   H H    . ALA B 2 234 ? 8.587   -27.930 -12.088 1.00 22.23 ? 234 ALA B H    1  
ATOM 7803   H HA   . ALA B 2 234 ? 10.121  -28.675 -9.818  1.00 41.44 ? 234 ALA B HA   1  
ATOM 7804   H HB1  . ALA B 2 234 ? 8.628   -30.657 -9.765  1.00 21.33 ? 234 ALA B HB1  1  
ATOM 7805   H HB2  . ALA B 2 234 ? 10.276  -31.126 -10.182 1.00 60.44 ? 234 ALA B HB2  1  
ATOM 7806   H HB3  . ALA B 2 234 ? 9.043   -31.027 -11.441 1.00 1.14  ? 234 ALA B HB3  1  
ATOM 7807   N N    . GLU B 2 235 ? 11.816  -28.048 -11.580 1.00 13.05 ? 235 GLU B N    1  
ATOM 7808   C CA   . GLU B 2 235 ? 12.827  -27.685 -12.582 1.00 52.33 ? 235 GLU B CA   1  
ATOM 7809   C C    . GLU B 2 235 ? 14.099  -27.185 -11.861 1.00 40.20 ? 235 GLU B C    1  
ATOM 7810   O O    . GLU B 2 235 ? 14.011  -26.613 -10.777 1.00 42.53 ? 235 GLU B O    1  
ATOM 7811   C CB   . GLU B 2 235 ? 12.219  -26.605 -13.540 1.00 54.41 ? 235 GLU B CB   1  
ATOM 7812   C CG   . GLU B 2 235 ? 12.762  -26.579 -14.987 1.00 44.23 ? 235 GLU B CG   1  
ATOM 7813   C CD   . GLU B 2 235 ? 14.237  -26.172 -15.109 1.00 4.45  ? 235 GLU B CD   1  
ATOM 7814   O OE1  . GLU B 2 235 ? 14.557  -24.986 -14.880 1.00 22.24 ? 235 GLU B OE1  1  
ATOM 7815   O OE2  . GLU B 2 235 ? 15.086  -27.036 -15.433 1.00 41.50 ? 235 GLU B OE2  1  
ATOM 7816   H H    . GLU B 2 235 ? 11.852  -27.609 -10.700 1.00 45.10 ? 235 GLU B H    1  
ATOM 7817   H HA   . GLU B 2 235 ? 13.079  -28.575 -13.153 1.00 64.41 ? 235 GLU B HA   1  
ATOM 7818   H HB2  . GLU B 2 235 ? 11.149  -26.777 -13.607 1.00 63.24 ? 235 GLU B HB2  1  
ATOM 7819   H HB3  . GLU B 2 235 ? 12.370  -25.624 -13.104 1.00 33.40 ? 235 GLU B HB3  1  
ATOM 7820   H HG2  . GLU B 2 235 ? 12.630  -27.565 -15.419 1.00 2.21  ? 235 GLU B HG2  1  
ATOM 7821   H HG3  . GLU B 2 235 ? 12.161  -25.877 -15.559 1.00 54.12 ? 235 GLU B HG3  1  
ATOM 7822   N N    . THR B 2 236 ? 15.260  -27.426 -12.493 1.00 10.40 ? 236 THR B N    1  
ATOM 7823   C CA   . THR B 2 236 ? 16.607  -27.112 -11.970 1.00 73.34 ? 236 THR B CA   1  
ATOM 7824   C C    . THR B 2 236 ? 16.739  -25.651 -11.476 1.00 63.34 ? 236 THR B C    1  
ATOM 7825   O O    . THR B 2 236 ? 17.131  -25.402 -10.324 1.00 54.02 ? 236 THR B O    1  
ATOM 7826   C CB   . THR B 2 236 ? 17.657  -27.358 -13.108 1.00 11.55 ? 236 THR B CB   1  
ATOM 7827   O OG1  . THR B 2 236 ? 17.353  -28.593 -13.782 1.00 42.14 ? 236 THR B OG1  1  
ATOM 7828   C CG2  . THR B 2 236 ? 19.102  -27.409 -12.582 1.00 25.20 ? 236 THR B CG2  1  
ATOM 7829   H H    . THR B 2 236 ? 15.212  -27.845 -13.376 1.00 34.15 ? 236 THR B H    1  
ATOM 7830   H HA   . THR B 2 236 ? 16.817  -27.793 -11.153 1.00 24.35 ? 236 THR B HA   1  
ATOM 7831   H HB   . THR B 2 236 ? 17.577  -26.553 -13.831 1.00 53.42 ? 236 THR B HB   1  
ATOM 7832   H HG1  . THR B 2 236 ? 16.767  -28.406 -14.527 1.00 21.51 ? 236 THR B HG1  1  
ATOM 7833   H HG21 . THR B 2 236 ? 19.344  -26.481 -12.082 1.00 42.44 ? 236 THR B HG21 1  
ATOM 7834   H HG22 . THR B 2 236 ? 19.785  -27.553 -13.411 1.00 20.31 ? 236 THR B HG22 1  
ATOM 7835   H HG23 . THR B 2 236 ? 19.213  -28.231 -11.885 1.00 61.12 ? 236 THR B HG23 1  
ATOM 7836   N N    . ALA B 2 237 ? 16.401  -24.703 -12.364 1.00 24.12 ? 237 ALA B N    1  
ATOM 7837   C CA   . ALA B 2 237 ? 16.551  -23.267 -12.101 1.00 71.12 ? 237 ALA B CA   1  
ATOM 7838   C C    . ALA B 2 237 ? 15.679  -22.453 -13.073 1.00 24.12 ? 237 ALA B C    1  
ATOM 7839   O O    . ALA B 2 237 ? 16.146  -22.015 -14.133 1.00 12.22 ? 237 ALA B O    1  
ATOM 7840   C CB   . ALA B 2 237 ? 18.039  -22.845 -12.182 1.00 31.24 ? 237 ALA B CB   1  
ATOM 7841   H H    . ALA B 2 237 ? 16.020  -24.984 -13.228 1.00 63.22 ? 237 ALA B H    1  
ATOM 7842   H HA   . ALA B 2 237 ? 16.203  -23.079 -11.086 1.00 40.01 ? 237 ALA B HA   1  
ATOM 7843   H HB1  . ALA B 2 237 ? 18.618  -23.412 -11.462 1.00 40.00 ? 237 ALA B HB1  1  
ATOM 7844   H HB2  . ALA B 2 237 ? 18.132  -21.792 -11.957 1.00 24.33 ? 237 ALA B HB2  1  
ATOM 7845   H HB3  . ALA B 2 237 ? 18.421  -23.034 -13.177 1.00 73.03 ? 237 ALA B HB3  1  
ATOM 7846   N N    . THR B 2 238 ? 14.391  -22.306 -12.725 1.00 13.12 ? 238 THR B N    1  
ATOM 7847   C CA   . THR B 2 238 ? 13.437  -21.461 -13.480 1.00 71.31 ? 238 THR B CA   1  
ATOM 7848   C C    . THR B 2 238 ? 13.464  -19.997 -12.952 1.00 15.23 ? 238 THR B C    1  
ATOM 7849   O O    . THR B 2 238 ? 12.830  -19.105 -13.527 1.00 62.40 ? 238 THR B O    1  
ATOM 7850   C CB   . THR B 2 238 ? 11.992  -22.065 -13.370 1.00 22.11 ? 238 THR B CB   1  
ATOM 7851   O OG1  . THR B 2 238 ? 12.030  -23.461 -13.704 1.00 30.05 ? 238 THR B OG1  1  
ATOM 7852   C CG2  . THR B 2 238 ? 10.973  -21.367 -14.294 1.00 44.55 ? 238 THR B CG2  1  
ATOM 7853   H H    . THR B 2 238 ? 14.058  -22.793 -11.938 1.00 34.14 ? 238 THR B H    1  
ATOM 7854   H HA   . THR B 2 238 ? 13.730  -21.459 -14.529 1.00 33.33 ? 238 THR B HA   1  
ATOM 7855   H HB   . THR B 2 238 ? 11.651  -21.969 -12.341 1.00 24.52 ? 238 THR B HB   1  
ATOM 7856   H HG1  . THR B 2 238 ? 12.922  -23.701 -13.995 1.00 0.43  ? 238 THR B HG1  1  
ATOM 7857   H HG21 . THR B 2 238 ? 11.292  -21.451 -15.324 1.00 33.15 ? 238 THR B HG21 1  
ATOM 7858   H HG22 . THR B 2 238 ? 10.898  -20.320 -14.026 1.00 25.25 ? 238 THR B HG22 1  
ATOM 7859   H HG23 . THR B 2 238 ? 10.001  -21.831 -14.182 1.00 53.33 ? 238 THR B HG23 1  
ATOM 7860   N N    . ALA B 2 239 ? 14.229  -19.780 -11.856 1.00 61.14 ? 239 ALA B N    1  
ATOM 7861   C CA   . ALA B 2 239 ? 14.312  -18.491 -11.146 1.00 45.05 ? 239 ALA B CA   1  
ATOM 7862   C C    . ALA B 2 239 ? 14.716  -17.316 -12.072 1.00 74.42 ? 239 ALA B C    1  
ATOM 7863   O O    . ALA B 2 239 ? 13.861  -16.543 -12.516 1.00 11.02 ? 239 ALA B O    1  
ATOM 7864   C CB   . ALA B 2 239 ? 15.290  -18.612 -9.959  1.00 14.52 ? 239 ALA B CB   1  
ATOM 7865   H H    . ALA B 2 239 ? 14.755  -20.527 -11.513 1.00 54.23 ? 239 ALA B H    1  
ATOM 7866   H HA   . ALA B 2 239 ? 13.327  -18.280 -10.735 1.00 30.54 ? 239 ALA B HA   1  
ATOM 7867   H HB1  . ALA B 2 239 ? 14.994  -19.439 -9.326  1.00 54.23 ? 239 ALA B HB1  1  
ATOM 7868   H HB2  . ALA B 2 239 ? 15.281  -17.700 -9.374  1.00 25.21 ? 239 ALA B HB2  1  
ATOM 7869   H HB3  . ALA B 2 239 ? 16.293  -18.789 -10.326 1.00 45.32 ? 239 ALA B HB3  1  
ATOM 7870   N N    . GLY B 2 240 ? 16.016  -17.216 -12.375 1.00 0.22  ? 240 GLY B N    1  
ATOM 7871   C CA   . GLY B 2 240 ? 16.562  -16.073 -13.097 1.00 41.02 ? 240 GLY B CA   1  
ATOM 7872   C C    . GLY B 2 240 ? 18.025  -15.864 -12.741 1.00 71.23 ? 240 GLY B C    1  
ATOM 7873   O O    . GLY B 2 240 ? 18.864  -16.732 -13.021 1.00 40.12 ? 240 GLY B O    1  
ATOM 7874   H H    . GLY B 2 240 ? 16.619  -17.941 -12.116 1.00 50.52 ? 240 GLY B H    1  
ATOM 7875   H HA2  . GLY B 2 240 ? 16.476  -16.253 -14.162 1.00 35.14 ? 240 GLY B HA2  1  
ATOM 7876   H HA3  . GLY B 2 240 ? 16.000  -15.177 -12.842 1.00 42.53 ? 240 GLY B HA3  1  
ATOM 7877   N N    . GLU B 2 241 ? 18.325  -14.729 -12.082 1.00 13.42 ? 241 GLU B N    1  
ATOM 7878   C CA   . GLU B 2 241 ? 19.693  -14.363 -11.676 1.00 32.02 ? 241 GLU B CA   1  
ATOM 7879   C C    . GLU B 2 241 ? 19.650  -13.479 -10.416 1.00 60.43 ? 241 GLU B C    1  
ATOM 7880   O O    . GLU B 2 241 ? 18.799  -12.576 -10.311 1.00 50.21 ? 241 GLU B O    1  
ATOM 7881   C CB   . GLU B 2 241 ? 20.418  -13.629 -12.846 1.00 45.14 ? 241 GLU B CB   1  
ATOM 7882   C CG   . GLU B 2 241 ? 19.657  -12.399 -13.396 1.00 71.21 ? 241 GLU B CG   1  
ATOM 7883   C CD   . GLU B 2 241 ? 20.374  -11.691 -14.557 1.00 15.13 ? 241 GLU B CD   1  
ATOM 7884   O OE1  . GLU B 2 241 ? 21.241  -10.826 -14.286 1.00 64.01 ? 241 GLU B OE1  1  
ATOM 7885   O OE2  . GLU B 2 241 ? 20.058  -11.971 -15.734 1.00 52.42 ? 241 GLU B OE2  1  
ATOM 7886   H H    . GLU B 2 241 ? 17.597  -14.104 -11.866 1.00 41.33 ? 241 GLU B H    1  
ATOM 7887   H HA   . GLU B 2 241 ? 20.236  -15.280 -11.438 1.00 15.23 ? 241 GLU B HA   1  
ATOM 7888   H HB2  . GLU B 2 241 ? 21.395  -13.304 -12.505 1.00 42.41 ? 241 GLU B HB2  1  
ATOM 7889   H HB3  . GLU B 2 241 ? 20.557  -14.336 -13.658 1.00 54.01 ? 241 GLU B HB3  1  
ATOM 7890   H HG2  . GLU B 2 241 ? 18.676  -12.722 -13.735 1.00 31.24 ? 241 GLU B HG2  1  
ATOM 7891   H HG3  . GLU B 2 241 ? 19.517  -11.689 -12.586 1.00 71.23 ? 241 GLU B HG3  1  
ATOM 7892   N N    . TRP B 2 242 ? 20.549  -13.780 -9.450  1.00 55.45 ? 242 TRP B N    1  
ATOM 7893   C CA   . TRP B 2 242 ? 20.749  -12.969 -8.232  1.00 70.32 ? 242 TRP B CA   1  
ATOM 7894   C C    . TRP B 2 242 ? 21.961  -13.443 -7.414  1.00 31.34 ? 242 TRP B C    1  
ATOM 7895   O O    . TRP B 2 242 ? 22.162  -14.651 -7.223  1.00 32.20 ? 242 TRP B O    1  
ATOM 7896   C CB   . TRP B 2 242 ? 19.493  -12.936 -7.326  1.00 2.51  ? 242 TRP B CB   1  
ATOM 7897   C CG   . TRP B 2 242 ? 18.981  -14.268 -6.810  1.00 2.54  ? 242 TRP B CG   1  
ATOM 7898   C CD1  . TRP B 2 242 ? 18.531  -15.335 -7.546  1.00 64.40 ? 242 TRP B CD1  1  
ATOM 7899   C CD2  . TRP B 2 242 ? 18.794  -14.630 -5.435  1.00 10.32 ? 242 TRP B CD2  1  
ATOM 7900   N NE1  . TRP B 2 242 ? 18.060  -16.316 -6.716  1.00 12.40 ? 242 TRP B NE1  1  
ATOM 7901   C CE2  . TRP B 2 242 ? 18.208  -15.904 -5.420  1.00 2.34  ? 242 TRP B CE2  1  
ATOM 7902   C CE3  . TRP B 2 242 ? 19.066  -13.994 -4.223  1.00 23.23 ? 242 TRP B CE3  1  
ATOM 7903   C CZ2  . TRP B 2 242 ? 17.891  -16.559 -4.234  1.00 41.15 ? 242 TRP B CZ2  1  
ATOM 7904   C CZ3  . TRP B 2 242 ? 18.735  -14.634 -3.055  1.00 4.42  ? 242 TRP B CZ3  1  
ATOM 7905   C CH2  . TRP B 2 242 ? 18.147  -15.906 -3.063  1.00 0.52  ? 242 TRP B CH2  1  
ATOM 7906   H H    . TRP B 2 242 ? 21.098  -14.587 -9.559  1.00 14.35 ? 242 TRP B H    1  
ATOM 7907   H HA   . TRP B 2 242 ? 20.947  -11.953 -8.566  1.00 35.03 ? 242 TRP B HA   1  
ATOM 7908   H HB2  . TRP B 2 242 ? 19.701  -12.312 -6.465  1.00 4.51  ? 242 TRP B HB2  1  
ATOM 7909   H HB3  . TRP B 2 242 ? 18.687  -12.472 -7.883  1.00 21.03 ? 242 TRP B HB3  1  
ATOM 7910   H HD1  . TRP B 2 242 ? 18.535  -15.375 -8.623  1.00 13.10 ? 242 TRP B HD1  1  
ATOM 7911   H HE1  . TRP B 2 242 ? 17.677  -17.172 -7.001  1.00 50.11 ? 242 TRP B HE1  1  
ATOM 7912   H HE3  . TRP B 2 242 ? 19.519  -13.009 -4.191  1.00 14.00 ? 242 TRP B HE3  1  
ATOM 7913   H HZ2  . TRP B 2 242 ? 17.432  -17.538 -4.227  1.00 0.13  ? 242 TRP B HZ2  1  
ATOM 7914   H HZ3  . TRP B 2 242 ? 18.937  -14.157 -2.106  1.00 54.23 ? 242 TRP B HZ3  1  
ATOM 7915   H HH2  . TRP B 2 242 ? 17.918  -16.379 -2.116  1.00 41.11 ? 242 TRP B HH2  1  
ATOM 7916   N N    . GLN B 2 243 ? 22.728  -12.445 -6.916  1.00 5.20  ? 243 GLN B N    1  
ATOM 7917   C CA   . GLN B 2 243 ? 23.891  -12.613 -6.017  1.00 42.45 ? 243 GLN B CA   1  
ATOM 7918   C C    . GLN B 2 243 ? 25.028  -13.411 -6.694  1.00 23.23 ? 243 GLN B C    1  
ATOM 7919   O O    . GLN B 2 243 ? 26.037  -12.833 -7.099  1.00 54.31 ? 243 GLN B O    1  
ATOM 7920   C CB   . GLN B 2 243 ? 23.460  -13.241 -4.651  1.00 34.35 ? 243 GLN B CB   1  
ATOM 7921   C CG   . GLN B 2 243 ? 22.253  -12.541 -3.987  1.00 74.22 ? 243 GLN B CG   1  
ATOM 7922   C CD   . GLN B 2 243 ? 22.477  -11.063 -3.663  1.00 1.45  ? 243 GLN B CD   1  
ATOM 7923   O OE1  . GLN B 2 243 ? 23.578  -10.650 -3.320  1.00 55.02 ? 243 GLN B OE1  1  
ATOM 7924   N NE2  . GLN B 2 243 ? 21.431  -10.256 -3.801  1.00 11.02 ? 243 GLN B NE2  1  
ATOM 7925   H H    . GLN B 2 243 ? 22.498  -11.532 -7.180  1.00 14.43 ? 243 GLN B H    1  
ATOM 7926   H HA   . GLN B 2 243 ? 24.266  -11.612 -5.824  1.00 4.34  ? 243 GLN B HA   1  
ATOM 7927   H HB2  . GLN B 2 243 ? 23.200  -14.284 -4.810  1.00 55.45 ? 243 GLN B HB2  1  
ATOM 7928   H HB3  . GLN B 2 243 ? 24.298  -13.196 -3.964  1.00 51.13 ? 243 GLN B HB3  1  
ATOM 7929   H HG2  . GLN B 2 243 ? 21.400  -12.623 -4.654  1.00 12.42 ? 243 GLN B HG2  1  
ATOM 7930   H HG3  . GLN B 2 243 ? 22.021  -13.057 -3.063  1.00 14.53 ? 243 GLN B HG3  1  
ATOM 7931   H HE21 . GLN B 2 243 ? 20.581  -10.646 -4.107  1.00 13.42 ? 243 GLN B HE21 1  
ATOM 7932   H HE22 . GLN B 2 243 ? 21.554  -9.306  -3.602  1.00 43.42 ? 243 GLN B HE22 1  
ATOM 7933   N N    . GLY B 2 244 ? 24.852  -14.736 -6.816  1.00 32.21 ? 244 GLY B N    1  
ATOM 7934   C CA   . GLY B 2 244 ? 25.828  -15.590 -7.476  1.00 52.01 ? 244 GLY B CA   1  
ATOM 7935   C C    . GLY B 2 244 ? 25.415  -17.048 -7.464  1.00 44.34 ? 244 GLY B C    1  
ATOM 7936   O O    . GLY B 2 244 ? 26.130  -17.897 -6.913  1.00 63.11 ? 244 GLY B O    1  
ATOM 7937   H H    . GLY B 2 244 ? 24.036  -15.139 -6.455  1.00 64.40 ? 244 GLY B H    1  
ATOM 7938   H HA2  . GLY B 2 244 ? 25.936  -15.268 -8.504  1.00 71.54 ? 244 GLY B HA2  1  
ATOM 7939   H HA3  . GLY B 2 244 ? 26.783  -15.486 -6.976  1.00 13.53 ? 244 GLY B HA3  1  
ATOM 7940   N N    . LYS B 2 245 ? 24.238  -17.342 -8.051  1.00 65.13 ? 245 LYS B N    1  
ATOM 7941   C CA   . LYS B 2 245 ? 23.734  -18.716 -8.166  1.00 33.12 ? 245 LYS B CA   1  
ATOM 7942   C C    . LYS B 2 245 ? 24.588  -19.530 -9.157  1.00 3.13  ? 245 LYS B C    1  
ATOM 7943   O O    . LYS B 2 245 ? 24.410  -19.434 -10.373 1.00 33.33 ? 245 LYS B O    1  
ATOM 7944   C CB   . LYS B 2 245 ? 22.222  -18.747 -8.572  1.00 22.40 ? 245 LYS B CB   1  
ATOM 7945   C CG   . LYS B 2 245 ? 21.642  -20.174 -8.798  1.00 4.33  ? 245 LYS B CG   1  
ATOM 7946   C CD   . LYS B 2 245 ? 21.817  -21.088 -7.563  1.00 53.11 ? 245 LYS B CD   1  
ATOM 7947   C CE   . LYS B 2 245 ? 21.300  -22.523 -7.772  1.00 32.34 ? 245 LYS B CE   1  
ATOM 7948   N NZ   . LYS B 2 245 ? 21.366  -23.319 -6.516  1.00 75.34 ? 245 LYS B NZ   1  
ATOM 7949   H H    . LYS B 2 245 ? 23.695  -16.609 -8.413  1.00 74.14 ? 245 LYS B H    1  
ATOM 7950   H HA   . LYS B 2 245 ? 23.824  -19.171 -7.179  1.00 25.13 ? 245 LYS B HA   1  
ATOM 7951   H HB2  . LYS B 2 245 ? 21.642  -18.266 -7.791  1.00 31.32 ? 245 LYS B HB2  1  
ATOM 7952   H HB3  . LYS B 2 245 ? 22.095  -18.182 -9.488  1.00 64.35 ? 245 LYS B HB3  1  
ATOM 7953   H HG2  . LYS B 2 245 ? 20.584  -20.091 -9.026  1.00 10.24 ? 245 LYS B HG2  1  
ATOM 7954   H HG3  . LYS B 2 245 ? 22.151  -20.625 -9.644  1.00 5.32  ? 245 LYS B HG3  1  
ATOM 7955   H HD2  . LYS B 2 245 ? 22.872  -21.140 -7.314  1.00 2.23  ? 245 LYS B HD2  1  
ATOM 7956   H HD3  . LYS B 2 245 ? 21.285  -20.642 -6.729  1.00 12.31 ? 245 LYS B HD3  1  
ATOM 7957   H HE2  . LYS B 2 245 ? 20.272  -22.483 -8.102  1.00 42.20 ? 245 LYS B HE2  1  
ATOM 7958   H HE3  . LYS B 2 245 ? 21.901  -23.011 -8.528  1.00 33.24 ? 245 LYS B HE3  1  
ATOM 7959   H HZ1  . LYS B 2 245 ? 20.964  -24.266 -6.670  1.00 20.32 ? 245 LYS B HZ1  1  
ATOM 7960   H HZ2  . LYS B 2 245 ? 20.826  -22.849 -5.761  1.00 42.34 ? 245 LYS B HZ2  1  
ATOM 7961   H HZ3  . LYS B 2 245 ? 22.350  -23.423 -6.206  1.00 31.21 ? 245 LYS B HZ3  1  
ATOM 7962   N N    . THR B 2 246 ? 25.552  -20.281 -8.613  1.00 34.55 ? 246 THR B N    1  
ATOM 7963   C CA   . THR B 2 246 ? 26.222  -21.354 -9.346  1.00 71.02 ? 246 THR B CA   1  
ATOM 7964   C C    . THR B 2 246 ? 25.205  -22.492 -9.582  1.00 23.31 ? 246 THR B C    1  
ATOM 7965   O O    . THR B 2 246 ? 24.470  -22.866 -8.650  1.00 11.10 ? 246 THR B O    1  
ATOM 7966   C CB   . THR B 2 246 ? 27.489  -21.859 -8.574  1.00 63.51 ? 246 THR B CB   1  
ATOM 7967   O OG1  . THR B 2 246 ? 28.073  -22.981 -9.250  1.00 33.05 ? 246 THR B OG1  1  
ATOM 7968   C CG2  . THR B 2 246 ? 27.189  -22.237 -7.111  1.00 64.31 ? 246 THR B CG2  1  
ATOM 7969   H H    . THR B 2 246 ? 25.834  -20.090 -7.692  1.00 52.24 ? 246 THR B H    1  
ATOM 7970   H HA   . THR B 2 246 ? 26.541  -20.956 -10.308 1.00 43.11 ? 246 THR B HA   1  
ATOM 7971   H HB   . THR B 2 246 ? 28.219  -21.051 -8.570  1.00 35.31 ? 246 THR B HB   1  
ATOM 7972   H HG1  . THR B 2 246 ? 29.036  -22.925 -9.178  1.00 3.11  ? 246 THR B HG1  1  
ATOM 7973   H HG21 . THR B 2 246 ? 26.458  -23.038 -7.083  1.00 71.14 ? 246 THR B HG21 1  
ATOM 7974   H HG22 . THR B 2 246 ? 26.793  -21.379 -6.584  1.00 12.14 ? 246 THR B HG22 1  
ATOM 7975   H HG23 . THR B 2 246 ? 28.098  -22.564 -6.625  1.00 43.44 ? 246 THR B HG23 1  
ATOM 7976   N N    . LEU B 2 247 ? 25.129  -22.984 -10.837 1.00 53.40 ? 247 LEU B N    1  
ATOM 7977   C CA   . LEU B 2 247 ? 24.137  -23.995 -11.265 1.00 63.41 ? 247 LEU B CA   1  
ATOM 7978   C C    . LEU B 2 247 ? 24.338  -25.316 -10.483 1.00 32.24 ? 247 LEU B C    1  
ATOM 7979   O O    . LEU B 2 247 ? 25.117  -26.185 -10.887 1.00 15.04 ? 247 LEU B O    1  
ATOM 7980   C CB   . LEU B 2 247 ? 24.225  -24.222 -12.808 1.00 34.33 ? 247 LEU B CB   1  
ATOM 7981   C CG   . LEU B 2 247 ? 23.150  -25.171 -13.435 1.00 72.51 ? 247 LEU B CG   1  
ATOM 7982   C CD1  . LEU B 2 247 ? 21.714  -24.617 -13.255 1.00 70.35 ? 247 LEU B CD1  1  
ATOM 7983   C CD2  . LEU B 2 247 ? 23.456  -25.449 -14.930 1.00 11.52 ? 247 LEU B CD2  1  
ATOM 7984   H H    . LEU B 2 247 ? 25.766  -22.650 -11.503 1.00 15.14 ? 247 LEU B H    1  
ATOM 7985   H HA   . LEU B 2 247 ? 23.151  -23.600 -11.032 1.00 31.52 ? 247 LEU B HA   1  
ATOM 7986   H HB2  . LEU B 2 247 ? 24.146  -23.254 -13.296 1.00 61.14 ? 247 LEU B HB2  1  
ATOM 7987   H HB3  . LEU B 2 247 ? 25.207  -24.626 -13.032 1.00 21.11 ? 247 LEU B HB3  1  
ATOM 7988   H HG   . LEU B 2 247 ? 23.191  -26.123 -12.915 1.00 70.11 ? 247 LEU B HG   1  
ATOM 7989   H HD11 . LEU B 2 247 ? 21.493  -24.503 -12.200 1.00 55.21 ? 247 LEU B HD11 1  
ATOM 7990   H HD12 . LEU B 2 247 ? 21.002  -25.309 -13.685 1.00 60.43 ? 247 LEU B HD12 1  
ATOM 7991   H HD13 . LEU B 2 247 ? 21.618  -23.657 -13.748 1.00 30.01 ? 247 LEU B HD13 1  
ATOM 7992   H HD21 . LEU B 2 247 ? 24.449  -25.872 -15.027 1.00 51.15 ? 247 LEU B HD21 1  
ATOM 7993   H HD22 . LEU B 2 247 ? 23.403  -24.529 -15.498 1.00 11.11 ? 247 LEU B HD22 1  
ATOM 7994   H HD23 . LEU B 2 247 ? 22.736  -26.154 -15.323 1.00 42.12 ? 247 LEU B HD23 1  
ATOM 7995   N N    . ARG B 2 248 ? 23.673  -25.405 -9.315  1.00 34.40 ? 248 ARG B N    1  
ATOM 7996   C CA   . ARG B 2 248 ? 23.748  -26.554 -8.394  1.00 63.33 ? 248 ARG B CA   1  
ATOM 7997   C C    . ARG B 2 248 ? 22.353  -26.800 -7.805  1.00 3.30  ? 248 ARG B C    1  
ATOM 7998   O O    . ARG B 2 248 ? 21.783  -25.894 -7.199  1.00 24.55 ? 248 ARG B O    1  
ATOM 7999   C CB   . ARG B 2 248 ? 24.764  -26.281 -7.249  1.00 74.41 ? 248 ARG B CB   1  
ATOM 8000   C CG   . ARG B 2 248 ? 26.231  -26.092 -7.701  1.00 53.21 ? 248 ARG B CG   1  
ATOM 8001   C CD   . ARG B 2 248 ? 27.215  -25.982 -6.525  1.00 41.11 ? 248 ARG B CD   1  
ATOM 8002   N NE   . ARG B 2 248 ? 28.603  -25.764 -6.982  1.00 75.15 ? 248 ARG B NE   1  
ATOM 8003   C CZ   . ARG B 2 248 ? 29.691  -25.797 -6.195  1.00 72.10 ? 248 ARG B CZ   1  
ATOM 8004   N NH1  . ARG B 2 248 ? 29.587  -26.046 -4.891  1.00 64.32 ? 248 ARG B NH1  1  
ATOM 8005   N NH2  . ARG B 2 248 ? 30.882  -25.579 -6.729  1.00 32.23 ? 248 ARG B NH2  1  
ATOM 8006   H H    . ARG B 2 248 ? 23.103  -24.653 -9.056  1.00 41.23 ? 248 ARG B H    1  
ATOM 8007   H HA   . ARG B 2 248 ? 24.060  -27.432 -8.956  1.00 21.44 ? 248 ARG B HA   1  
ATOM 8008   H HB2  . ARG B 2 248 ? 24.459  -25.382 -6.722  1.00 20.10 ? 248 ARG B HB2  1  
ATOM 8009   H HB3  . ARG B 2 248 ? 24.731  -27.113 -6.552  1.00 33.44 ? 248 ARG B HB3  1  
ATOM 8010   H HG2  . ARG B 2 248 ? 26.518  -26.938 -8.315  1.00 13.41 ? 248 ARG B HG2  1  
ATOM 8011   H HG3  . ARG B 2 248 ? 26.292  -25.187 -8.297  1.00 1.54  ? 248 ARG B HG3  1  
ATOM 8012   H HD2  . ARG B 2 248 ? 26.923  -25.150 -5.893  1.00 35.20 ? 248 ARG B HD2  1  
ATOM 8013   H HD3  . ARG B 2 248 ? 27.173  -26.900 -5.949  1.00 13.41 ? 248 ARG B HD3  1  
ATOM 8014   H HE   . ARG B 2 248 ? 28.729  -25.580 -7.942  1.00 62.52 ? 248 ARG B HE   1  
ATOM 8015   H HH11 . ARG B 2 248 ? 28.687  -26.212 -4.479  1.00 24.54 ? 248 ARG B HH11 1  
ATOM 8016   H HH12 . ARG B 2 248 ? 30.407  -26.068 -4.312  1.00 54.20 ? 248 ARG B HH12 1  
ATOM 8017   H HH21 . ARG B 2 248 ? 30.965  -25.389 -7.709  1.00 1.41  ? 248 ARG B HH21 1  
ATOM 8018   H HH22 . ARG B 2 248 ? 31.706  -25.599 -6.157  1.00 50.04 ? 248 ARG B HH22 1  
ATOM 8019   N N    . GLU B 2 249 ? 21.804  -28.007 -8.006  1.00 21.03 ? 249 GLU B N    1  
ATOM 8020   C CA   . GLU B 2 249 ? 20.458  -28.358 -7.520  1.00 42.22 ? 249 GLU B CA   1  
ATOM 8021   C C    . GLU B 2 249 ? 20.489  -28.635 -6.000  1.00 51.04 ? 249 GLU B C    1  
ATOM 8022   O O    . GLU B 2 249 ? 19.758  -27.991 -5.236  1.00 61.42 ? 249 GLU B O    1  
ATOM 8023   C CB   . GLU B 2 249 ? 19.846  -29.557 -8.324  1.00 35.23 ? 249 GLU B CB   1  
ATOM 8024   C CG   . GLU B 2 249 ? 20.466  -30.970 -8.107  1.00 5.42  ? 249 GLU B CG   1  
ATOM 8025   C CD   . GLU B 2 249 ? 21.901  -31.162 -8.653  1.00 31.25 ? 249 GLU B CD   1  
ATOM 8026   O OE1  . GLU B 2 249 ? 22.059  -31.767 -9.737  1.00 45.54 ? 249 GLU B OE1  1  
ATOM 8027   O OE2  . GLU B 2 249 ? 22.877  -30.710 -7.997  1.00 71.33 ? 249 GLU B OE2  1  
ATOM 8028   H H    . GLU B 2 249 ? 22.316  -28.677 -8.504  1.00 22.14 ? 249 GLU B H    1  
ATOM 8029   H HA   . GLU B 2 249 ? 19.825  -27.488 -7.689  1.00 24.32 ? 249 GLU B HA   1  
ATOM 8030   H HB2  . GLU B 2 249 ? 18.793  -29.623 -8.073  1.00 40.13 ? 249 GLU B HB2  1  
ATOM 8031   H HB3  . GLU B 2 249 ? 19.922  -29.319 -9.376  1.00 61.02 ? 249 GLU B HB3  1  
ATOM 8032   H HG2  . GLU B 2 249 ? 20.478  -31.175 -7.043  1.00 12.43 ? 249 GLU B HG2  1  
ATOM 8033   H HG3  . GLU B 2 249 ? 19.812  -31.696 -8.585  1.00 51.52 ? 249 GLU B HG3  1  
ATOM 8034   N N    . GLN B 2 250 ? 21.372  -29.578 -5.583  1.00 33.44 ? 250 GLN B N    1  
ATOM 8035   C CA   . GLN B 2 250 ? 21.533  -30.041 -4.183  1.00 1.14  ? 250 GLN B CA   1  
ATOM 8036   C C    . GLN B 2 250 ? 20.190  -30.506 -3.538  1.00 42.03 ? 250 GLN B C    1  
ATOM 8037   O O    . GLN B 2 250 ? 19.178  -30.661 -4.228  1.00 63.05 ? 250 GLN B O    1  
ATOM 8038   C CB   . GLN B 2 250 ? 22.244  -28.938 -3.331  1.00 2.01  ? 250 GLN B CB   1  
ATOM 8039   C CG   . GLN B 2 250 ? 23.792  -29.027 -3.218  1.00 62.15 ? 250 GLN B CG   1  
ATOM 8040   C CD   . GLN B 2 250 ? 24.612  -28.681 -4.477  1.00 42.11 ? 250 GLN B CD   1  
ATOM 8041   O OE1  . GLN B 2 250 ? 25.663  -28.046 -4.373  1.00 65.40 ? 250 GLN B OE1  1  
ATOM 8042   N NE2  . GLN B 2 250 ? 24.242  -29.193 -5.644  1.00 31.03 ? 250 GLN B NE2  1  
ATOM 8043   H H    . GLN B 2 250 ? 21.945  -29.981 -6.259  1.00 2.01  ? 250 GLN B H    1  
ATOM 8044   H HA   . GLN B 2 250 ? 22.185  -30.904 -4.229  1.00 70.14 ? 250 GLN B HA   1  
ATOM 8045   H HB2  . GLN B 2 250 ? 21.999  -27.965 -3.744  1.00 44.11 ? 250 GLN B HB2  1  
ATOM 8046   H HB3  . GLN B 2 250 ? 21.845  -28.975 -2.323  1.00 5.43  ? 250 GLN B HB3  1  
ATOM 8047   H HG2  . GLN B 2 250 ? 24.107  -28.362 -2.423  1.00 65.03 ? 250 GLN B HG2  1  
ATOM 8048   H HG3  . GLN B 2 250 ? 24.045  -30.041 -2.928  1.00 50.44 ? 250 GLN B HG3  1  
ATOM 8049   H HE21 . GLN B 2 250 ? 23.468  -29.777 -5.670  1.00 60.31 ? 250 GLN B HE21 1  
ATOM 8050   H HE22 . GLN B 2 250 ? 24.768  -28.965 -6.437  1.00 53.12 ? 250 GLN B HE22 1  
ATOM 8051   N N    . ALA B 2 251 ? 20.241  -30.771 -2.213  1.00 22.51 ? 251 ALA B N    1  
ATOM 8052   C CA   . ALA B 2 251 ? 19.065  -31.090 -1.376  1.00 34.04 ? 251 ALA B CA   1  
ATOM 8053   C C    . ALA B 2 251 ? 18.335  -32.375 -1.846  1.00 41.22 ? 251 ALA B C    1  
ATOM 8054   O O    . ALA B 2 251 ? 17.261  -32.311 -2.464  1.00 3.40  ? 251 ALA B O    1  
ATOM 8055   C CB   . ALA B 2 251 ? 18.120  -29.873 -1.257  1.00 61.03 ? 251 ALA B CB   1  
ATOM 8056   H H    . ALA B 2 251 ? 21.118  -30.766 -1.781  1.00 32.51 ? 251 ALA B H    1  
ATOM 8057   H HA   . ALA B 2 251 ? 19.452  -31.285 -0.386  1.00 64.21 ? 251 ALA B HA   1  
ATOM 8058   H HB1  . ALA B 2 251 ? 17.330  -30.096 -0.552  1.00 22.44 ? 251 ALA B HB1  1  
ATOM 8059   H HB2  . ALA B 2 251 ? 17.688  -29.653 -2.223  1.00 50.32 ? 251 ALA B HB2  1  
ATOM 8060   H HB3  . ALA B 2 251 ? 18.675  -29.013 -0.908  1.00 45.44 ? 251 ALA B HB3  1  
ATOM 8061   N N    . GLN B 2 252 ? 18.954  -33.541 -1.559  1.00 35.33 ? 252 GLN B N    1  
ATOM 8062   C CA   . GLN B 2 252 ? 18.428  -34.865 -1.971  1.00 22.44 ? 252 GLN B CA   1  
ATOM 8063   C C    . GLN B 2 252 ? 18.142  -35.750 -0.743  1.00 54.41 ? 252 GLN B C    1  
ATOM 8064   O O    . GLN B 2 252 ? 17.155  -36.495 -0.730  1.00 64.05 ? 252 GLN B O    1  
ATOM 8065   C CB   . GLN B 2 252 ? 19.444  -35.572 -2.913  1.00 72.30 ? 252 GLN B CB   1  
ATOM 8066   C CG   . GLN B 2 252 ? 18.979  -36.947 -3.439  1.00 54.11 ? 252 GLN B CG   1  
ATOM 8067   C CD   . GLN B 2 252 ? 19.978  -37.614 -4.393  1.00 65.21 ? 252 GLN B CD   1  
ATOM 8068   O OE1  . GLN B 2 252 ? 20.861  -38.354 -3.965  1.00 61.10 ? 252 GLN B OE1  1  
ATOM 8069   N NE2  . GLN B 2 252 ? 19.831  -37.358 -5.684  1.00 30.04 ? 252 GLN B NE2  1  
ATOM 8070   H H    . GLN B 2 252 ? 19.797  -33.512 -1.048  1.00 72.31 ? 252 GLN B H    1  
ATOM 8071   H HA   . GLN B 2 252 ? 17.493  -34.714 -2.513  1.00 73.12 ? 252 GLN B HA   1  
ATOM 8072   H HB2  . GLN B 2 252 ? 19.629  -34.930 -3.768  1.00 44.23 ? 252 GLN B HB2  1  
ATOM 8073   H HB3  . GLN B 2 252 ? 20.379  -35.710 -2.378  1.00 13.15 ? 252 GLN B HB3  1  
ATOM 8074   H HG2  . GLN B 2 252 ? 18.823  -37.604 -2.592  1.00 32.14 ? 252 GLN B HG2  1  
ATOM 8075   H HG3  . GLN B 2 252 ? 18.035  -36.817 -3.958  1.00 30.42 ? 252 GLN B HG3  1  
ATOM 8076   H HE21 . GLN B 2 252 ? 19.097  -36.762 -5.951  1.00 21.21 ? 252 GLN B HE21 1  
ATOM 8077   H HE22 . GLN B 2 252 ? 20.455  -37.769 -6.318  1.00 24.50 ? 252 GLN B HE22 1  
ATOM 8078   N N    . ALA B 2 253 ? 19.066  -35.696 0.240   1.00 32.12 ? 253 ALA B N    1  
ATOM 8079   C CA   . ALA B 2 253 ? 19.015  -36.451 1.522   1.00 15.22 ? 253 ALA B CA   1  
ATOM 8080   C C    . ALA B 2 253 ? 19.473  -37.909 1.382   1.00 51.41 ? 253 ALA B C    1  
ATOM 8081   O O    . ALA B 2 253 ? 20.120  -38.430 2.294   1.00 44.13 ? 253 ALA B O    1  
ATOM 8082   C CB   . ALA B 2 253 ? 17.631  -36.372 2.213   1.00 20.10 ? 253 ALA B CB   1  
ATOM 8083   H H    . ALA B 2 253 ? 19.839  -35.117 0.097   1.00 12.21 ? 253 ALA B H    1  
ATOM 8084   H HA   . ALA B 2 253 ? 19.721  -35.951 2.179   1.00 24.34 ? 253 ALA B HA   1  
ATOM 8085   H HB1  . ALA B 2 253 ? 17.331  -35.336 2.304   1.00 41.10 ? 253 ALA B HB1  1  
ATOM 8086   H HB2  . ALA B 2 253 ? 17.682  -36.811 3.203   1.00 2.03  ? 253 ALA B HB2  1  
ATOM 8087   H HB3  . ALA B 2 253 ? 16.896  -36.907 1.625   1.00 45.20 ? 253 ALA B HB3  1  
ATOM 8088   N N    . ARG B 2 254 ? 19.145  -38.544 0.238   1.00 14.13 ? 254 ARG B N    1  
ATOM 8089   C CA   . ARG B 2 254 ? 19.351  -39.988 0.000   1.00 1.43  ? 254 ARG B CA   1  
ATOM 8090   C C    . ARG B 2 254 ? 20.800  -40.432 0.283   1.00 11.15 ? 254 ARG B C    1  
ATOM 8091   O O    . ARG B 2 254 ? 21.704  -40.234 -0.536  1.00 43.40 ? 254 ARG B O    1  
ATOM 8092   C CB   . ARG B 2 254 ? 18.929  -40.352 -1.444  1.00 53.41 ? 254 ARG B CB   1  
ATOM 8093   C CG   . ARG B 2 254 ? 17.457  -40.009 -1.737  1.00 12.13 ? 254 ARG B CG   1  
ATOM 8094   C CD   . ARG B 2 254 ? 16.977  -40.433 -3.130  1.00 72.51 ? 254 ARG B CD   1  
ATOM 8095   N NE   . ARG B 2 254 ? 15.544  -40.120 -3.303  1.00 34.55 ? 254 ARG B NE   1  
ATOM 8096   C CZ   . ARG B 2 254 ? 14.914  -39.938 -4.469  1.00 43.24 ? 254 ARG B CZ   1  
ATOM 8097   N NH1  . ARG B 2 254 ? 15.569  -40.035 -5.627  1.00 71.35 ? 254 ARG B NH1  1  
ATOM 8098   N NH2  . ARG B 2 254 ? 13.615  -39.644 -4.460  1.00 14.20 ? 254 ARG B NH2  1  
ATOM 8099   H H    . ARG B 2 254 ? 18.738  -38.026 -0.471  1.00 13.11 ? 254 ARG B H    1  
ATOM 8100   H HA   . ARG B 2 254 ? 18.690  -40.512 0.684   1.00 34.12 ? 254 ARG B HA   1  
ATOM 8101   H HB2  . ARG B 2 254 ? 19.560  -39.810 -2.142  1.00 52.33 ? 254 ARG B HB2  1  
ATOM 8102   H HB3  . ARG B 2 254 ? 19.070  -41.416 -1.595  1.00 1.22  ? 254 ARG B HB3  1  
ATOM 8103   H HG2  . ARG B 2 254 ? 16.839  -40.506 -1.002  1.00 45.55 ? 254 ARG B HG2  1  
ATOM 8104   H HG3  . ARG B 2 254 ? 17.325  -38.934 -1.633  1.00 11.20 ? 254 ARG B HG3  1  
ATOM 8105   H HD2  . ARG B 2 254 ? 17.558  -39.912 -3.884  1.00 4.35  ? 254 ARG B HD2  1  
ATOM 8106   H HD3  . ARG B 2 254 ? 17.117  -41.501 -3.239  1.00 1.20  ? 254 ARG B HD3  1  
ATOM 8107   H HE   . ARG B 2 254 ? 15.015  -40.049 -2.476  1.00 22.11 ? 254 ARG B HE   1  
ATOM 8108   H HH11 . ARG B 2 254 ? 16.551  -40.248 -5.636  1.00 50.30 ? 254 ARG B HH11 1  
ATOM 8109   H HH12 . ARG B 2 254 ? 15.086  -39.897 -6.495  1.00 41.23 ? 254 ARG B HH12 1  
ATOM 8110   H HH21 . ARG B 2 254 ? 13.124  -39.565 -3.589  1.00 32.01 ? 254 ARG B HH21 1  
ATOM 8111   H HH22 . ARG B 2 254 ? 13.118  -39.504 -5.323  1.00 21.04 ? 254 ARG B HH22 1  
ATOM 8112   N N    . GLY B 2 255 ? 20.986  -40.994 1.485   1.00 12.44 ? 255 GLY B N    1  
ATOM 8113   C CA   . GLY B 2 255 ? 22.274  -41.480 1.960   1.00 53.24 ? 255 GLY B CA   1  
ATOM 8114   C C    . GLY B 2 255 ? 22.107  -42.755 2.767   1.00 44.23 ? 255 GLY B C    1  
ATOM 8115   O O    . GLY B 2 255 ? 22.924  -43.676 2.659   1.00 54.22 ? 255 GLY B O    1  
ATOM 8116   H H    . GLY B 2 255 ? 20.206  -41.079 2.074   1.00 63.32 ? 255 GLY B H    1  
ATOM 8117   H HA2  . GLY B 2 255 ? 22.934  -41.671 1.120   1.00 13.33 ? 255 GLY B HA2  1  
ATOM 8118   H HA3  . GLY B 2 255 ? 22.723  -40.727 2.595   1.00 62.54 ? 255 GLY B HA3  1  
ATOM 8119   N N    . TYR B 2 256 ? 21.029  -42.809 3.584   1.00 11.30 ? 256 TYR B N    1  
ATOM 8120   C CA   . TYR B 2 256 ? 20.726  -43.968 4.444   1.00 52.52 ? 256 TYR B CA   1  
ATOM 8121   C C    . TYR B 2 256 ? 19.243  -43.949 4.879   1.00 51.54 ? 256 TYR B C    1  
ATOM 8122   O O    . TYR B 2 256 ? 18.509  -44.919 4.640   1.00 13.42 ? 256 TYR B O    1  
ATOM 8123   C CB   . TYR B 2 256 ? 21.665  -43.973 5.681   1.00 13.11 ? 256 TYR B CB   1  
ATOM 8124   C CG   . TYR B 2 256 ? 21.612  -45.252 6.538   1.00 33.22 ? 256 TYR B CG   1  
ATOM 8125   C CD1  . TYR B 2 256 ? 21.731  -46.512 5.948   1.00 10.15 ? 256 TYR B CD1  1  
ATOM 8126   C CD2  . TYR B 2 256 ? 21.470  -45.197 7.928   1.00 52.34 ? 256 TYR B CD2  1  
ATOM 8127   C CE1  . TYR B 2 256 ? 21.705  -47.661 6.711   1.00 5.12  ? 256 TYR B CE1  1  
ATOM 8128   C CE2  . TYR B 2 256 ? 21.443  -46.348 8.692   1.00 31.10 ? 256 TYR B CE2  1  
ATOM 8129   C CZ   . TYR B 2 256 ? 21.561  -47.575 8.081   1.00 13.35 ? 256 TYR B CZ   1  
ATOM 8130   O OH   . TYR B 2 256 ? 21.535  -48.723 8.843   1.00 41.24 ? 256 TYR B OH   1  
ATOM 8131   H H    . TYR B 2 256 ? 20.421  -42.039 3.606   1.00 45.33 ? 256 TYR B H    1  
ATOM 8132   H HA   . TYR B 2 256 ? 20.905  -44.867 3.858   1.00 71.20 ? 256 TYR B HA   1  
ATOM 8133   H HB2  . TYR B 2 256 ? 22.686  -43.857 5.340   1.00 52.21 ? 256 TYR B HB2  1  
ATOM 8134   H HB3  . TYR B 2 256 ? 21.417  -43.124 6.313   1.00 3.13  ? 256 TYR B HB3  1  
ATOM 8135   H HD1  . TYR B 2 256 ? 21.845  -46.583 4.870   1.00 21.14 ? 256 TYR B HD1  1  
ATOM 8136   H HD2  . TYR B 2 256 ? 21.377  -44.233 8.412   1.00 11.23 ? 256 TYR B HD2  1  
ATOM 8137   H HE1  . TYR B 2 256 ? 21.801  -48.622 6.229   1.00 53.43 ? 256 TYR B HE1  1  
ATOM 8138   H HE2  . TYR B 2 256 ? 21.331  -46.280 9.767   1.00 12.22 ? 256 TYR B HE2  1  
ATOM 8139   H HH   . TYR B 2 256 ? 22.248  -49.309 8.566   1.00 11.24 ? 256 TYR B HH   1  
ATOM 8140   N N    . GLN B 2 257 ? 18.833  -42.832 5.522   1.00 53.30 ? 257 GLN B N    1  
ATOM 8141   C CA   . GLN B 2 257 ? 17.453  -42.611 6.032   1.00 62.52 ? 257 GLN B CA   1  
ATOM 8142   C C    . GLN B 2 257 ? 16.982  -43.746 6.967   1.00 71.02 ? 257 GLN B C    1  
ATOM 8143   O O    . GLN B 2 257 ? 15.793  -44.100 6.987   1.00 53.30 ? 257 GLN B O    1  
ATOM 8144   C CB   . GLN B 2 257 ? 16.453  -42.350 4.853   1.00 23.25 ? 257 GLN B CB   1  
ATOM 8145   C CG   . GLN B 2 257 ? 16.389  -40.878 4.384   1.00 4.32  ? 257 GLN B CG   1  
ATOM 8146   C CD   . GLN B 2 257 ? 17.722  -40.327 3.866   1.00 55.54 ? 257 GLN B CD   1  
ATOM 8147   O OE1  . GLN B 2 257 ? 18.524  -41.049 3.267   1.00 74.31 ? 257 GLN B OE1  1  
ATOM 8148   N NE2  . GLN B 2 257 ? 17.987  -39.062 4.141   1.00 33.42 ? 257 GLN B NE2  1  
ATOM 8149   H H    . GLN B 2 257 ? 19.487  -42.120 5.651   1.00 55.12 ? 257 GLN B H    1  
ATOM 8150   H HA   . GLN B 2 257 ? 17.500  -41.712 6.640   1.00 13.55 ? 257 GLN B HA   1  
ATOM 8151   H HB2  . GLN B 2 257 ? 16.735  -42.970 4.004   1.00 40.14 ? 257 GLN B HB2  1  
ATOM 8152   H HB3  . GLN B 2 257 ? 15.455  -42.644 5.162   1.00 55.51 ? 257 GLN B HB3  1  
ATOM 8153   H HG2  . GLN B 2 257 ? 15.658  -40.800 3.588   1.00 63.52 ? 257 GLN B HG2  1  
ATOM 8154   H HG3  . GLN B 2 257 ? 16.060  -40.270 5.221   1.00 31.21 ? 257 GLN B HG3  1  
ATOM 8155   H HE21 . GLN B 2 257 ? 17.330  -38.554 4.657   1.00 60.40 ? 257 GLN B HE21 1  
ATOM 8156   H HE22 . GLN B 2 257 ? 18.831  -38.689 3.820   1.00 1.41  ? 257 GLN B HE22 1  
ATOM 8157   N N    . LEU B 2 258 ? 17.945  -44.264 7.766   1.00 4.23  ? 258 LEU B N    1  
ATOM 8158   C CA   . LEU B 2 258 ? 17.728  -45.327 8.771   1.00 33.20 ? 258 LEU B CA   1  
ATOM 8159   C C    . LEU B 2 258 ? 17.384  -46.671 8.087   1.00 75.13 ? 258 LEU B C    1  
ATOM 8160   O O    . LEU B 2 258 ? 18.220  -47.579 8.055   1.00 23.51 ? 258 LEU B O    1  
ATOM 8161   C CB   . LEU B 2 258 ? 16.671  -44.928 9.869   1.00 61.22 ? 258 LEU B CB   1  
ATOM 8162   C CG   . LEU B 2 258 ? 17.128  -43.882 10.952  1.00 52.22 ? 258 LEU B CG   1  
ATOM 8163   C CD1  . LEU B 2 258 ? 17.507  -42.506 10.347  1.00 44.31 ? 258 LEU B CD1  1  
ATOM 8164   C CD2  . LEU B 2 258 ? 16.050  -43.716 12.051  1.00 31.03 ? 258 LEU B CD2  1  
ATOM 8165   H H    . LEU B 2 258 ? 18.854  -43.922 7.656   1.00 51.35 ? 258 LEU B H    1  
ATOM 8166   H HA   . LEU B 2 258 ? 18.687  -45.459 9.266   1.00 32.22 ? 258 LEU B HA   1  
ATOM 8167   H HB2  . LEU B 2 258 ? 15.797  -44.532 9.363   1.00 72.24 ? 258 LEU B HB2  1  
ATOM 8168   H HB3  . LEU B 2 258 ? 16.371  -45.834 10.388  1.00 23.53 ? 258 LEU B HB3  1  
ATOM 8169   H HG   . LEU B 2 258 ? 18.018  -44.266 11.436  1.00 72.00 ? 258 LEU B HG   1  
ATOM 8170   H HD11 . LEU B 2 258 ? 17.818  -41.837 11.139  1.00 74.13 ? 258 LEU B HD11 1  
ATOM 8171   H HD12 . LEU B 2 258 ? 16.656  -42.079 9.832   1.00 65.01 ? 258 LEU B HD12 1  
ATOM 8172   H HD13 . LEU B 2 258 ? 18.324  -42.627 9.649   1.00 52.04 ? 258 LEU B HD13 1  
ATOM 8173   H HD21 . LEU B 2 258 ? 15.125  -43.355 11.616  1.00 22.11 ? 258 LEU B HD21 1  
ATOM 8174   H HD22 . LEU B 2 258 ? 16.395  -43.011 12.793  1.00 72.41 ? 258 LEU B HD22 1  
ATOM 8175   H HD23 . LEU B 2 258 ? 15.871  -44.670 12.533  1.00 31.40 ? 258 LEU B HD23 1  
ATOM 8176   N N    . VAL B 2 259 ? 16.158  -46.800 7.547   1.00 61.25 ? 259 VAL B N    1  
ATOM 8177   C CA   . VAL B 2 259 ? 15.706  -48.023 6.843   1.00 0.34  ? 259 VAL B CA   1  
ATOM 8178   C C    . VAL B 2 259 ? 15.584  -47.755 5.331   1.00 63.02 ? 259 VAL B C    1  
ATOM 8179   O O    . VAL B 2 259 ? 16.150  -48.488 4.511   1.00 53.42 ? 259 VAL B O    1  
ATOM 8180   C CB   . VAL B 2 259 ? 14.324  -48.539 7.394   1.00 54.41 ? 259 VAL B CB   1  
ATOM 8181   C CG1  . VAL B 2 259 ? 13.871  -49.846 6.690   1.00 20.34 ? 259 VAL B CG1  1  
ATOM 8182   C CG2  . VAL B 2 259 ? 14.370  -48.717 8.931   1.00 44.11 ? 259 VAL B CG2  1  
ATOM 8183   H H    . VAL B 2 259 ? 15.539  -46.047 7.613   1.00 63.31 ? 259 VAL B H    1  
ATOM 8184   H HA   . VAL B 2 259 ? 16.448  -48.806 6.999   1.00 1.23  ? 259 VAL B HA   1  
ATOM 8185   H HB   . VAL B 2 259 ? 13.578  -47.776 7.175   1.00 11.45 ? 259 VAL B HB   1  
ATOM 8186   H HG11 . VAL B 2 259 ? 12.911  -50.158 7.079   1.00 12.11 ? 259 VAL B HG11 1  
ATOM 8187   H HG12 . VAL B 2 259 ? 14.597  -50.633 6.859   1.00 31.34 ? 259 VAL B HG12 1  
ATOM 8188   H HG13 . VAL B 2 259 ? 13.780  -49.672 5.624   1.00 53.15 ? 259 VAL B HG13 1  
ATOM 8189   H HG21 . VAL B 2 259 ? 15.102  -49.473 9.196   1.00 32.45 ? 259 VAL B HG21 1  
ATOM 8190   H HG22 . VAL B 2 259 ? 13.398  -49.017 9.295   1.00 33.32 ? 259 VAL B HG22 1  
ATOM 8191   H HG23 . VAL B 2 259 ? 14.648  -47.779 9.396   1.00 22.25 ? 259 VAL B HG23 1  
ATOM 8192   N N    . SER B 2 260 ? 14.819  -46.708 4.973   1.00 21.53 ? 260 SER B N    1  
ATOM 8193   C CA   . SER B 2 260 ? 14.585  -46.325 3.567   1.00 32.32 ? 260 SER B CA   1  
ATOM 8194   C C    . SER B 2 260 ? 14.186  -44.846 3.470   1.00 25.41 ? 260 SER B C    1  
ATOM 8195   O O    . SER B 2 260 ? 13.811  -44.227 4.468   1.00 3.20  ? 260 SER B O    1  
ATOM 8196   C CB   . SER B 2 260 ? 13.502  -47.228 2.930   1.00 73.11 ? 260 SER B CB   1  
ATOM 8197   O OG   . SER B 2 260 ? 12.294  -47.202 3.674   1.00 30.13 ? 260 SER B OG   1  
ATOM 8198   H H    . SER B 2 260 ? 14.405  -46.167 5.675   1.00 45.30 ? 260 SER B H    1  
ATOM 8199   H HA   . SER B 2 260 ? 15.521  -46.460 3.025   1.00 13.52 ? 260 SER B HA   1  
ATOM 8200   H HB2  . SER B 2 260 ? 13.294  -46.895 1.922   1.00 52.13 ? 260 SER B HB2  1  
ATOM 8201   H HB3  . SER B 2 260 ? 13.865  -48.247 2.897   1.00 22.33 ? 260 SER B HB3  1  
ATOM 8202   H HG   . SER B 2 260 ? 12.503  -47.076 4.610   1.00 4.31  ? 260 SER B HG   1  
ATOM 8203   N N    . ASP B 2 261 ? 14.252  -44.303 2.248   1.00 2.13  ? 261 ASP B N    1  
ATOM 8204   C CA   . ASP B 2 261 ? 14.058  -42.865 1.988   1.00 44.31 ? 261 ASP B CA   1  
ATOM 8205   C C    . ASP B 2 261 ? 12.570  -42.515 1.779   1.00 34.11 ? 261 ASP B C    1  
ATOM 8206   O O    . ASP B 2 261 ? 12.097  -41.473 2.254   1.00 12.03 ? 261 ASP B O    1  
ATOM 8207   C CB   . ASP B 2 261 ? 14.912  -42.471 0.758   1.00 23.31 ? 261 ASP B CB   1  
ATOM 8208   C CG   . ASP B 2 261 ? 14.780  -41.000 0.348   1.00 52.21 ? 261 ASP B CG   1  
ATOM 8209   O OD1  . ASP B 2 261 ? 15.349  -40.125 1.040   1.00 13.24 ? 261 ASP B OD1  1  
ATOM 8210   O OD2  . ASP B 2 261 ? 14.100  -40.706 -0.671  1.00 24.33 ? 261 ASP B OD2  1  
ATOM 8211   H H    . ASP B 2 261 ? 14.441  -44.894 1.483   1.00 42.02 ? 261 ASP B H    1  
ATOM 8212   H HA   . ASP B 2 261 ? 14.424  -42.315 2.854   1.00 65.51 ? 261 ASP B HA   1  
ATOM 8213   H HB2  . ASP B 2 261 ? 15.956  -42.668 0.984   1.00 4.02  ? 261 ASP B HB2  1  
ATOM 8214   H HB3  . ASP B 2 261 ? 14.622  -43.099 -0.082  1.00 30.03 ? 261 ASP B HB3  1  
ATOM 8215   N N    . ALA B 2 262 ? 11.844  -43.402 1.079   1.00 14.55 ? 262 ALA B N    1  
ATOM 8216   C CA   . ALA B 2 262 ? 10.422  -43.201 0.747   1.00 20.01 ? 262 ALA B CA   1  
ATOM 8217   C C    . ALA B 2 262 ? 9.544   -43.403 2.000   1.00 12.23 ? 262 ALA B C    1  
ATOM 8218   O O    . ALA B 2 262 ? 9.117   -44.524 2.288   1.00 1.30  ? 262 ALA B O    1  
ATOM 8219   C CB   . ALA B 2 262 ? 9.999   -44.141 -0.401  1.00 43.43 ? 262 ALA B CB   1  
ATOM 8220   H H    . ALA B 2 262 ? 12.279  -44.224 0.784   1.00 62.23 ? 262 ALA B H    1  
ATOM 8221   H HA   . ALA B 2 262 ? 10.301  -42.174 0.398   1.00 75.22 ? 262 ALA B HA   1  
ATOM 8222   H HB1  . ALA B 2 262 ? 10.108  -45.173 -0.092  1.00 44.42 ? 262 ALA B HB1  1  
ATOM 8223   H HB2  . ALA B 2 262 ? 10.622  -43.960 -1.268  1.00 62.31 ? 262 ALA B HB2  1  
ATOM 8224   H HB3  . ALA B 2 262 ? 8.965   -43.956 -0.662  1.00 73.10 ? 262 ALA B HB3  1  
ATOM 8225   N N    . ALA B 2 263 ? 9.350   -42.295 2.758   1.00 34.12 ? 263 ALA B N    1  
ATOM 8226   C CA   . ALA B 2 263 ? 8.537   -42.238 3.999   1.00 70.44 ? 263 ALA B CA   1  
ATOM 8227   C C    . ALA B 2 263 ? 9.179   -43.060 5.152   1.00 43.45 ? 263 ALA B C    1  
ATOM 8228   O O    . ALA B 2 263 ? 9.731   -42.473 6.089   1.00 34.52 ? 263 ALA B O    1  
ATOM 8229   C CB   . ALA B 2 263 ? 7.066   -42.642 3.743   1.00 2.30  ? 263 ALA B CB   1  
ATOM 8230   H H    . ALA B 2 263 ? 9.795   -41.472 2.471   1.00 12.13 ? 263 ALA B H    1  
ATOM 8231   H HA   . ALA B 2 263 ? 8.532   -41.196 4.299   1.00 23.23 ? 263 ALA B HA   1  
ATOM 8232   H HB1  . ALA B 2 263 ? 7.013   -43.685 3.456   1.00 21.45 ? 263 ALA B HB1  1  
ATOM 8233   H HB2  . ALA B 2 263 ? 6.653   -42.034 2.947   1.00 64.23 ? 263 ALA B HB2  1  
ATOM 8234   H HB3  . ALA B 2 263 ? 6.486   -42.490 4.643   1.00 22.12 ? 263 ALA B HB3  1  
ATOM 8235   N N    . SER B 2 264 ? 9.084   -44.411 5.055   1.00 32.24 ? 264 SER B N    1  
ATOM 8236   C CA   . SER B 2 264 ? 9.700   -45.388 5.985   1.00 30.42 ? 264 SER B CA   1  
ATOM 8237   C C    . SER B 2 264 ? 9.024   -45.369 7.374   1.00 51.14 ? 264 SER B C    1  
ATOM 8238   O O    . SER B 2 264 ? 8.271   -46.283 7.717   1.00 25.04 ? 264 SER B O    1  
ATOM 8239   C CB   . SER B 2 264 ? 11.237  -45.177 6.100   1.00 23.24 ? 264 SER B CB   1  
ATOM 8240   O OG   . SER B 2 264 ? 11.858  -46.170 6.904   1.00 22.34 ? 264 SER B OG   1  
ATOM 8241   H H    . SER B 2 264 ? 8.570   -44.772 4.306   1.00 44.44 ? 264 SER B H    1  
ATOM 8242   H HA   . SER B 2 264 ? 9.526   -46.368 5.549   1.00 25.41 ? 264 SER B HA   1  
ATOM 8243   H HB2  . SER B 2 264 ? 11.678  -45.217 5.112   1.00 33.45 ? 264 SER B HB2  1  
ATOM 8244   H HB3  . SER B 2 264 ? 11.436  -44.203 6.534   1.00 13.12 ? 264 SER B HB3  1  
ATOM 8245   H HG   . SER B 2 264 ? 11.306  -46.960 6.917   1.00 32.03 ? 264 SER B HG   1  
ATOM 8246   N N    . LEU B 2 265 ? 9.292   -44.306 8.157   1.00 35.12 ? 265 LEU B N    1  
ATOM 8247   C CA   . LEU B 2 265 ? 8.779   -44.145 9.534   1.00 14.54 ? 265 LEU B CA   1  
ATOM 8248   C C    . LEU B 2 265 ? 7.238   -43.981 9.541   1.00 64.12 ? 265 LEU B C    1  
ATOM 8249   O O    . LEU B 2 265 ? 6.582   -44.251 10.553  1.00 53.43 ? 265 LEU B O    1  
ATOM 8250   C CB   . LEU B 2 265 ? 9.470   -42.938 10.251  1.00 62.42 ? 265 LEU B CB   1  
ATOM 8251   C CG   . LEU B 2 265 ? 11.007  -43.067 10.588  1.00 12.12 ? 265 LEU B CG   1  
ATOM 8252   C CD1  . LEU B 2 265 ? 11.313  -44.355 11.391  1.00 52.22 ? 265 LEU B CD1  1  
ATOM 8253   C CD2  . LEU B 2 265 ? 11.908  -42.959 9.327   1.00 14.13 ? 265 LEU B CD2  1  
ATOM 8254   H H    . LEU B 2 265 ? 9.853   -43.596 7.792   1.00 40.43 ? 265 LEU B H    1  
ATOM 8255   H HA   . LEU B 2 265 ? 9.026   -45.050 10.077  1.00 30.32 ? 265 LEU B HA   1  
ATOM 8256   H HB2  . LEU B 2 265 ? 9.335   -42.061 9.628   1.00 73.31 ? 265 LEU B HB2  1  
ATOM 8257   H HB3  . LEU B 2 265 ? 8.943   -42.758 11.185  1.00 51.35 ? 265 LEU B HB3  1  
ATOM 8258   H HG   . LEU B 2 265 ? 11.275  -42.232 11.234  1.00 33.22 ? 265 LEU B HG   1  
ATOM 8259   H HD11 . LEU B 2 265 ? 11.073  -45.228 10.796  1.00 61.22 ? 265 LEU B HD11 1  
ATOM 8260   H HD12 . LEU B 2 265 ? 10.721  -44.371 12.297  1.00 13.52 ? 265 LEU B HD12 1  
ATOM 8261   H HD13 . LEU B 2 265 ? 12.363  -44.383 11.658  1.00 65.14 ? 265 LEU B HD13 1  
ATOM 8262   H HD21 . LEU B 2 265 ? 11.682  -43.769 8.641   1.00 3.21  ? 265 LEU B HD21 1  
ATOM 8263   H HD22 . LEU B 2 265 ? 12.948  -43.018 9.616   1.00 31.45 ? 265 LEU B HD22 1  
ATOM 8264   H HD23 . LEU B 2 265 ? 11.734  -42.012 8.831   1.00 71.15 ? 265 LEU B HD23 1  
ATOM 8265   N N    . ASN B 2 266 ? 6.671   -43.558 8.395   1.00 41.11 ? 266 ASN B N    1  
ATOM 8266   C CA   . ASN B 2 266 ? 5.207   -43.474 8.183   1.00 53.52 ? 266 ASN B CA   1  
ATOM 8267   C C    . ASN B 2 266 ? 4.810   -44.342 6.971   1.00 15.01 ? 266 ASN B C    1  
ATOM 8268   O O    . ASN B 2 266 ? 5.570   -44.443 5.997   1.00 34.04 ? 266 ASN B O    1  
ATOM 8269   C CB   . ASN B 2 266 ? 4.765   -41.994 7.969   1.00 71.02 ? 266 ASN B CB   1  
ATOM 8270   C CG   . ASN B 2 266 ? 3.248   -41.808 7.754   1.00 23.33 ? 266 ASN B CG   1  
ATOM 8271   O OD1  . ASN B 2 266 ? 2.428   -42.613 8.207   1.00 44.14 ? 266 ASN B OD1  1  
ATOM 8272   N ND2  . ASN B 2 266 ? 2.867   -40.731 7.081   1.00 71.52 ? 266 ASN B ND2  1  
ATOM 8273   H H    . ASN B 2 266 ? 7.257   -43.307 7.656   1.00 30.24 ? 266 ASN B H    1  
ATOM 8274   H HA   . ASN B 2 266 ? 4.709   -43.866 9.068   1.00 30.12 ? 266 ASN B HA   1  
ATOM 8275   H HB2  . ASN B 2 266 ? 5.046   -41.416 8.839   1.00 20.24 ? 266 ASN B HB2  1  
ATOM 8276   H HB3  . ASN B 2 266 ? 5.285   -41.597 7.106   1.00 22.11 ? 266 ASN B HB3  1  
ATOM 8277   H HD21 . ASN B 2 266 ? 3.561   -40.116 6.756   1.00 64.23 ? 266 ASN B HD21 1  
ATOM 8278   H HD22 . ASN B 2 266 ? 1.908   -40.586 6.946   1.00 34.32 ? 266 ASN B HD22 1  
ATOM 8279   N N    . SER B 2 267 ? 3.623   -44.969 7.050   1.00 63.43 ? 267 SER B N    1  
ATOM 8280   C CA   . SER B 2 267 ? 3.061   -45.788 5.965   1.00 55.30 ? 267 SER B CA   1  
ATOM 8281   C C    . SER B 2 267 ? 2.089   -44.943 5.130   1.00 61.43 ? 267 SER B C    1  
ATOM 8282   O O    . SER B 2 267 ? 2.229   -44.845 3.903   1.00 22.21 ? 267 SER B O    1  
ATOM 8283   C CB   . SER B 2 267 ? 2.345   -47.028 6.544   1.00 73.13 ? 267 SER B CB   1  
ATOM 8284   O OG   . SER B 2 267 ? 1.886   -47.895 5.517   1.00 12.32 ? 267 SER B OG   1  
ATOM 8285   H H    . SER B 2 267 ? 3.097   -44.868 7.873   1.00 70.54 ? 267 SER B H    1  
ATOM 8286   H HA   . SER B 2 267 ? 3.876   -46.123 5.325   1.00 11.31 ? 267 SER B HA   1  
ATOM 8287   H HB2  . SER B 2 267 ? 3.034   -47.579 7.173   1.00 72.33 ? 267 SER B HB2  1  
ATOM 8288   H HB3  . SER B 2 267 ? 1.496   -46.717 7.143   1.00 1.50  ? 267 SER B HB3  1  
ATOM 8289   H HG   . SER B 2 267 ? 2.520   -48.610 5.400   1.00 42.13 ? 267 SER B HG   1  
ATOM 8290   N N    . VAL B 2 268 ? 1.116   -44.316 5.815   1.00 41.23 ? 268 VAL B N    1  
ATOM 8291   C CA   . VAL B 2 268 ? 0.059   -43.519 5.164   1.00 54.23 ? 268 VAL B CA   1  
ATOM 8292   C C    . VAL B 2 268 ? -0.650  -42.627 6.204   1.00 22.42 ? 268 VAL B C    1  
ATOM 8293   O O    . VAL B 2 268 ? -0.766  -43.002 7.381   1.00 74.44 ? 268 VAL B O    1  
ATOM 8294   C CB   . VAL B 2 268 ? -0.986  -44.448 4.407   1.00 62.34 ? 268 VAL B CB   1  
ATOM 8295   C CG1  . VAL B 2 268 ? -1.734  -45.413 5.372   1.00 5.12  ? 268 VAL B CG1  1  
ATOM 8296   C CG2  . VAL B 2 268 ? -1.978  -43.623 3.541   1.00 62.41 ? 268 VAL B CG2  1  
ATOM 8297   H H    . VAL B 2 268 ? 1.111   -44.380 6.795   1.00 35.45 ? 268 VAL B H    1  
ATOM 8298   H HA   . VAL B 2 268 ? 0.543   -42.875 4.425   1.00 24.04 ? 268 VAL B HA   1  
ATOM 8299   H HB   . VAL B 2 268 ? -0.410  -45.074 3.727   1.00 20.40 ? 268 VAL B HB   1  
ATOM 8300   H HG11 . VAL B 2 268 ? -1.020  -46.029 5.906   1.00 42.32 ? 268 VAL B HG11 1  
ATOM 8301   H HG12 . VAL B 2 268 ? -2.396  -46.057 4.805   1.00 10.31 ? 268 VAL B HG12 1  
ATOM 8302   H HG13 . VAL B 2 268 ? -2.320  -44.845 6.086   1.00 43.33 ? 268 VAL B HG13 1  
ATOM 8303   H HG21 . VAL B 2 268 ? -2.652  -44.292 3.018   1.00 12.24 ? 268 VAL B HG21 1  
ATOM 8304   H HG22 . VAL B 2 268 ? -1.432  -43.035 2.814   1.00 51.21 ? 268 VAL B HG22 1  
ATOM 8305   H HG23 . VAL B 2 268 ? -2.556  -42.959 4.173   1.00 43.03 ? 268 VAL B HG23 1  
ATOM 8306   N N    . THR B 2 269 ? -1.079  -41.431 5.766   1.00 23.43 ? 269 THR B N    1  
ATOM 8307   C CA   . THR B 2 269 ? -1.897  -40.510 6.563   1.00 61.10 ? 269 THR B CA   1  
ATOM 8308   C C    . THR B 2 269 ? -2.919  -39.846 5.622   1.00 74.31 ? 269 THR B C    1  
ATOM 8309   O O    . THR B 2 269 ? -2.572  -38.903 4.910   1.00 14.24 ? 269 THR B O    1  
ATOM 8310   C CB   . THR B 2 269 ? -1.015  -39.426 7.291   1.00 33.51 ? 269 THR B CB   1  
ATOM 8311   O OG1  . THR B 2 269 ? 0.019   -40.074 8.055   1.00 11.33 ? 269 THR B OG1  1  
ATOM 8312   C CG2  . THR B 2 269 ? -1.851  -38.529 8.236   1.00 41.14 ? 269 THR B CG2  1  
ATOM 8313   H H    . THR B 2 269 ? -0.839  -41.156 4.857   1.00 70.24 ? 269 THR B H    1  
ATOM 8314   H HA   . THR B 2 269 ? -2.434  -41.083 7.322   1.00 10.42 ? 269 THR B HA   1  
ATOM 8315   H HB   . THR B 2 269 ? -0.542  -38.798 6.539   1.00 11.23 ? 269 THR B HB   1  
ATOM 8316   H HG1  . THR B 2 269 ? -0.288  -40.945 8.342   1.00 70.12 ? 269 THR B HG1  1  
ATOM 8317   H HG21 . THR B 2 269 ? -2.592  -37.987 7.665   1.00 51.04 ? 269 THR B HG21 1  
ATOM 8318   H HG22 . THR B 2 269 ? -1.201  -37.819 8.739   1.00 43.33 ? 269 THR B HG22 1  
ATOM 8319   H HG23 . THR B 2 269 ? -2.347  -39.141 8.977   1.00 13.33 ? 269 THR B HG23 1  
ATOM 8320   N N    . GLU B 2 270 ? -4.150  -40.419 5.584   1.00 72.41 ? 270 GLU B N    1  
ATOM 8321   C CA   . GLU B 2 270 ? -5.310  -39.924 4.787   1.00 34.32 ? 270 GLU B CA   1  
ATOM 8322   C C    . GLU B 2 270 ? -4.974  -39.816 3.271   1.00 43.14 ? 270 GLU B C    1  
ATOM 8323   O O    . GLU B 2 270 ? -5.232  -40.736 2.496   1.00 25.32 ? 270 GLU B O    1  
ATOM 8324   C CB   . GLU B 2 270 ? -5.807  -38.565 5.353   1.00 61.14 ? 270 GLU B CB   1  
ATOM 8325   C CG   . GLU B 2 270 ? -6.079  -38.549 6.867   1.00 20.44 ? 270 GLU B CG   1  
ATOM 8326   C CD   . GLU B 2 270 ? -6.185  -37.124 7.425   1.00 54.44 ? 270 GLU B CD   1  
ATOM 8327   O OE1  . GLU B 2 270 ? -7.301  -36.675 7.756   1.00 25.31 ? 270 GLU B OE1  1  
ATOM 8328   O OE2  . GLU B 2 270 ? -5.137  -36.442 7.532   1.00 4.45  ? 270 GLU B OE2  1  
ATOM 8329   H H    . GLU B 2 270 ? -4.284  -41.227 6.122   1.00 3.41  ? 270 GLU B H    1  
ATOM 8330   H HA   . GLU B 2 270 ? -6.101  -40.655 4.900   1.00 33.04 ? 270 GLU B HA   1  
ATOM 8331   H HB2  . GLU B 2 270 ? -5.050  -37.813 5.140   1.00 13.23 ? 270 GLU B HB2  1  
ATOM 8332   H HB3  . GLU B 2 270 ? -6.720  -38.283 4.840   1.00 44.30 ? 270 GLU B HB3  1  
ATOM 8333   H HG2  . GLU B 2 270 ? -7.001  -39.085 7.063   1.00 3.13  ? 270 GLU B HG2  1  
ATOM 8334   H HG3  . GLU B 2 270 ? -5.265  -39.060 7.375   1.00 11.31 ? 270 GLU B HG3  1  
ATOM 8335   N N    . ALA B 2 271 ? -4.395  -38.671 2.884   1.00 43.32 ? 271 ALA B N    1  
ATOM 8336   C CA   . ALA B 2 271 ? -3.836  -38.424 1.554   1.00 75.22 ? 271 ALA B CA   1  
ATOM 8337   C C    . ALA B 2 271 ? -2.561  -37.600 1.759   1.00 40.40 ? 271 ALA B C    1  
ATOM 8338   O O    . ALA B 2 271 ? -1.468  -38.096 1.510   1.00 51.44 ? 271 ALA B O    1  
ATOM 8339   C CB   . ALA B 2 271 ? -4.846  -37.698 0.640   1.00 75.30 ? 271 ALA B CB   1  
ATOM 8340   H H    . ALA B 2 271 ? -4.317  -37.951 3.546   1.00 60.35 ? 271 ALA B H    1  
ATOM 8341   H HA   . ALA B 2 271 ? -3.575  -39.382 1.102   1.00 51.22 ? 271 ALA B HA   1  
ATOM 8342   H HB1  . ALA B 2 271 ? -4.395  -37.520 -0.331  1.00 74.32 ? 271 ALA B HB1  1  
ATOM 8343   H HB2  . ALA B 2 271 ? -5.124  -36.752 1.081   1.00 63.13 ? 271 ALA B HB2  1  
ATOM 8344   H HB3  . ALA B 2 271 ? -5.732  -38.307 0.517   1.00 73.04 ? 271 ALA B HB3  1  
ATOM 8345   N N    . ASN B 2 272 ? -2.750  -36.353 2.262   1.00 54.14 ? 272 ASN B N    1  
ATOM 8346   C CA   . ASN B 2 272 ? -1.678  -35.411 2.691   1.00 11.11 ? 272 ASN B CA   1  
ATOM 8347   C C    . ASN B 2 272 ? -0.697  -35.030 1.554   1.00 43.21 ? 272 ASN B C    1  
ATOM 8348   O O    . ASN B 2 272 ? -0.697  -33.882 1.105   1.00 50.30 ? 272 ASN B O    1  
ATOM 8349   C CB   . ASN B 2 272 ? -0.901  -35.940 3.943   1.00 23.55 ? 272 ASN B CB   1  
ATOM 8350   C CG   . ASN B 2 272 ? -1.687  -35.875 5.271   1.00 33.10 ? 272 ASN B CG   1  
ATOM 8351   O OD1  . ASN B 2 272 ? -1.105  -35.650 6.326   1.00 2.42  ? 272 ASN B OD1  1  
ATOM 8352   N ND2  . ASN B 2 272 ? -2.999  -36.093 5.240   1.00 33.32 ? 272 ASN B ND2  1  
ATOM 8353   H H    . ASN B 2 272 ? -3.676  -36.042 2.346   1.00 73.11 ? 272 ASN B H    1  
ATOM 8354   H HA   . ASN B 2 272 ? -2.198  -34.499 2.987   1.00 61.33 ? 272 ASN B HA   1  
ATOM 8355   H HB2  . ASN B 2 272 ? -0.626  -36.973 3.771   1.00 51.54 ? 272 ASN B HB2  1  
ATOM 8356   H HB3  . ASN B 2 272 ? 0.011   -35.359 4.065   1.00 4.13  ? 272 ASN B HB3  1  
ATOM 8357   H HD21 . ASN B 2 272 ? -3.421  -36.285 4.380   1.00 4.44  ? 272 ASN B HD21 1  
ATOM 8358   H HD22 . ASN B 2 272 ? -3.495  -36.059 6.085   1.00 32.32 ? 272 ASN B HD22 1  
ATOM 8359   N N    . GLN B 2 273 ? 0.143   -36.002 1.123   1.00 61.25 ? 273 GLN B N    1  
ATOM 8360   C CA   . GLN B 2 273 ? 1.215   -35.814 0.127   1.00 61.32 ? 273 GLN B CA   1  
ATOM 8361   C C    . GLN B 2 273 ? 2.282   -34.869 0.686   1.00 14.14 ? 273 GLN B C    1  
ATOM 8362   O O    . GLN B 2 273 ? 2.637   -33.854 0.079   1.00 41.25 ? 273 GLN B O    1  
ATOM 8363   C CB   . GLN B 2 273 ? 0.668   -35.354 -1.264  1.00 60.35 ? 273 GLN B CB   1  
ATOM 8364   C CG   . GLN B 2 273 ? -0.306  -36.352 -1.934  1.00 4.12  ? 273 GLN B CG   1  
ATOM 8365   C CD   . GLN B 2 273 ? 0.281   -37.758 -2.155  1.00 14.12 ? 273 GLN B CD   1  
ATOM 8366   O OE1  . GLN B 2 273 ? 1.487   -37.924 -2.339  1.00 60.10 ? 273 GLN B OE1  1  
ATOM 8367   N NE2  . GLN B 2 273 ? -0.571  -38.778 -2.148  1.00 55.10 ? 273 GLN B NE2  1  
ATOM 8368   H H    . GLN B 2 273 ? 0.041   -36.889 1.506   1.00 13.20 ? 273 GLN B H    1  
ATOM 8369   H HA   . GLN B 2 273 ? 1.685   -36.783 0.000   1.00 12.01 ? 273 GLN B HA   1  
ATOM 8370   H HB2  . GLN B 2 273 ? 0.147   -34.409 -1.138  1.00 44.51 ? 273 GLN B HB2  1  
ATOM 8371   H HB3  . GLN B 2 273 ? 1.506   -35.194 -1.935  1.00 60.44 ? 273 GLN B HB3  1  
ATOM 8372   H HG2  . GLN B 2 273 ? -1.185  -36.440 -1.308  1.00 63.01 ? 273 GLN B HG2  1  
ATOM 8373   H HG3  . GLN B 2 273 ? -0.604  -35.951 -2.899  1.00 15.30 ? 273 GLN B HG3  1  
ATOM 8374   H HE21 . GLN B 2 273 ? -1.524  -38.590 -2.011  1.00 73.43 ? 273 GLN B HE21 1  
ATOM 8375   H HE22 . GLN B 2 273 ? -0.209  -39.683 -2.264  1.00 11.50 ? 273 GLN B HE22 1  
ATOM 8376   N N    . GLN B 2 274 ? 2.729   -35.209 1.903   1.00 31.31 ? 274 GLN B N    1  
ATOM 8377   C CA   . GLN B 2 274 ? 3.844   -34.544 2.584   1.00 14.31 ? 274 GLN B CA   1  
ATOM 8378   C C    . GLN B 2 274 ? 5.070   -35.476 2.562   1.00 34.22 ? 274 GLN B C    1  
ATOM 8379   O O    . GLN B 2 274 ? 4.918   -36.700 2.439   1.00 54.44 ? 274 GLN B O    1  
ATOM 8380   C CB   . GLN B 2 274 ? 3.426   -34.173 4.029   1.00 71.44 ? 274 GLN B CB   1  
ATOM 8381   C CG   . GLN B 2 274 ? 2.184   -33.252 4.102   1.00 41.15 ? 274 GLN B CG   1  
ATOM 8382   C CD   . GLN B 2 274 ? 1.788   -32.852 5.529   1.00 54.13 ? 274 GLN B CD   1  
ATOM 8383   O OE1  . GLN B 2 274 ? 2.006   -33.601 6.482   1.00 13.22 ? 274 GLN B OE1  1  
ATOM 8384   N NE2  . GLN B 2 274 ? 1.208   -31.670 5.682   1.00 70.12 ? 274 GLN B NE2  1  
ATOM 8385   H H    . GLN B 2 274 ? 2.291   -35.955 2.362   1.00 42.53 ? 274 GLN B H    1  
ATOM 8386   H HA   . GLN B 2 274 ? 4.093   -33.633 2.039   1.00 61.50 ? 274 GLN B HA   1  
ATOM 8387   H HB2  . GLN B 2 274 ? 3.202   -35.086 4.571   1.00 11.14 ? 274 GLN B HB2  1  
ATOM 8388   H HB3  . GLN B 2 274 ? 4.254   -33.671 4.518   1.00 71.24 ? 274 GLN B HB3  1  
ATOM 8389   H HG2  . GLN B 2 274 ? 2.391   -32.349 3.536   1.00 3.51  ? 274 GLN B HG2  1  
ATOM 8390   H HG3  . GLN B 2 274 ? 1.345   -33.765 3.645   1.00 11.55 ? 274 GLN B HG3  1  
ATOM 8391   H HE21 . GLN B 2 274 ? 1.060   -31.117 4.883   1.00 62.12 ? 274 GLN B HE21 1  
ATOM 8392   H HE22 . GLN B 2 274 ? 0.946   -31.399 6.585   1.00 21.45 ? 274 GLN B HE22 1  
ATOM 8393   N N    . LYS B 2 275 ? 6.269   -34.879 2.706   1.00 40.03 ? 275 LYS B N    1  
ATOM 8394   C CA   . LYS B 2 275 ? 7.582   -35.542 2.473   1.00 23.33 ? 275 LYS B CA   1  
ATOM 8395   C C    . LYS B 2 275 ? 7.742   -36.056 0.988   1.00 24.11 ? 275 LYS B C    1  
ATOM 8396   O O    . LYS B 2 275 ? 8.273   -37.153 0.779   1.00 33.43 ? 275 LYS B O    1  
ATOM 8397   C CB   . LYS B 2 275 ? 7.848   -36.697 3.511   1.00 71.33 ? 275 LYS B CB   1  
ATOM 8398   C CG   . LYS B 2 275 ? 8.002   -36.277 5.000   1.00 53.34 ? 275 LYS B CG   1  
ATOM 8399   C CD   . LYS B 2 275 ? 6.687   -35.816 5.680   1.00 22.01 ? 275 LYS B CD   1  
ATOM 8400   C CE   . LYS B 2 275 ? 6.908   -35.249 7.095   1.00 51.03 ? 275 LYS B CE   1  
ATOM 8401   N NZ   . LYS B 2 275 ? 7.837   -34.081 7.099   1.00 12.34 ? 275 LYS B NZ   1  
ATOM 8402   H H    . LYS B 2 275 ? 6.285   -33.935 2.976   1.00 72.04 ? 275 LYS B H    1  
ATOM 8403   H HA   . LYS B 2 275 ? 8.335   -34.778 2.624   1.00 53.21 ? 275 LYS B HA   1  
ATOM 8404   H HB2  . LYS B 2 275 ? 7.032   -37.406 3.447   1.00 54.12 ? 275 LYS B HB2  1  
ATOM 8405   H HB3  . LYS B 2 275 ? 8.760   -37.211 3.217   1.00 22.11 ? 275 LYS B HB3  1  
ATOM 8406   H HG2  . LYS B 2 275 ? 8.387   -37.127 5.556   1.00 32.33 ? 275 LYS B HG2  1  
ATOM 8407   H HG3  . LYS B 2 275 ? 8.727   -35.473 5.056   1.00 40.51 ? 275 LYS B HG3  1  
ATOM 8408   H HD2  . LYS B 2 275 ? 6.226   -35.050 5.067   1.00 32.23 ? 275 LYS B HD2  1  
ATOM 8409   H HD3  . LYS B 2 275 ? 6.015   -36.666 5.745   1.00 31.21 ? 275 LYS B HD3  1  
ATOM 8410   H HE2  . LYS B 2 275 ? 5.955   -34.928 7.498   1.00 22.43 ? 275 LYS B HE2  1  
ATOM 8411   H HE3  . LYS B 2 275 ? 7.320   -36.022 7.730   1.00 2.21  ? 275 LYS B HE3  1  
ATOM 8412   H HZ1  . LYS B 2 275 ? 8.783   -34.376 6.781   1.00 72.14 ? 275 LYS B HZ1  1  
ATOM 8413   H HZ2  . LYS B 2 275 ? 7.918   -33.681 8.053   1.00 43.00 ? 275 LYS B HZ2  1  
ATOM 8414   H HZ3  . LYS B 2 275 ? 7.488   -33.344 6.448   1.00 33.11 ? 275 LYS B HZ3  1  
ATOM 8415   N N    . PRO B 2 276 ? 7.329   -35.261 -0.078  1.00 33.32 ? 276 PRO B N    1  
ATOM 8416   C CA   . PRO B 2 276 ? 7.391   -35.668 -1.499  1.00 44.23 ? 276 PRO B CA   1  
ATOM 8417   C C    . PRO B 2 276 ? 8.480   -34.885 -2.285  1.00 14.13 ? 276 PRO B C    1  
ATOM 8418   O O    . PRO B 2 276 ? 8.243   -34.435 -3.420  1.00 43.04 ? 276 PRO B O    1  
ATOM 8419   C CB   . PRO B 2 276 ? 5.964   -35.253 -1.926  1.00 2.54  ? 276 PRO B CB   1  
ATOM 8420   C CG   . PRO B 2 276 ? 5.676   -33.987 -1.137  1.00 62.35 ? 276 PRO B CG   1  
ATOM 8421   C CD   . PRO B 2 276 ? 6.734   -33.904 -0.044  1.00 22.25 ? 276 PRO B CD   1  
ATOM 8422   H HA   . PRO B 2 276 ? 7.531   -36.733 -1.628  1.00 20.55 ? 276 PRO B HA   1  
ATOM 8423   H HB2  . PRO B 2 276 ? 5.926   -35.070 -3.001  1.00 73.04 ? 276 PRO B HB2  1  
ATOM 8424   H HB3  . PRO B 2 276 ? 5.253   -36.029 -1.663  1.00 2.34  ? 276 PRO B HB3  1  
ATOM 8425   H HG2  . PRO B 2 276 ? 5.739   -33.119 -1.788  1.00 35.23 ? 276 PRO B HG2  1  
ATOM 8426   H HG3  . PRO B 2 276 ? 4.690   -34.043 -0.694  1.00 52.14 ? 276 PRO B HG3  1  
ATOM 8427   H HD2  . PRO B 2 276 ? 7.480   -33.148 -0.275  1.00 31.22 ? 276 PRO B HD2  1  
ATOM 8428   H HD3  . PRO B 2 276 ? 6.281   -33.699 0.916   1.00 53.41 ? 276 PRO B HD3  1  
ATOM 8429   N N    . LEU B 2 277 ? 9.653   -34.724 -1.629  1.00 5.22  ? 277 LEU B N    1  
ATOM 8430   C CA   . LEU B 2 277 ? 10.821  -33.917 -2.090  1.00 33.11 ? 277 LEU B CA   1  
ATOM 8431   C C    . LEU B 2 277 ? 10.653  -32.407 -1.791  1.00 63.32 ? 277 LEU B C    1  
ATOM 8432   O O    . LEU B 2 277 ? 11.647  -31.691 -1.730  1.00 54.43 ? 277 LEU B O    1  
ATOM 8433   C CB   . LEU B 2 277 ? 11.230  -34.168 -3.576  1.00 3.33  ? 277 LEU B CB   1  
ATOM 8434   C CG   . LEU B 2 277 ? 11.651  -35.638 -3.929  1.00 62.20 ? 277 LEU B CG   1  
ATOM 8435   C CD1  . LEU B 2 277 ? 11.949  -35.797 -5.437  1.00 10.21 ? 277 LEU B CD1  1  
ATOM 8436   C CD2  . LEU B 2 277 ? 12.855  -36.099 -3.062  1.00 12.10 ? 277 LEU B CD2  1  
ATOM 8437   H H    . LEU B 2 277 ? 9.741   -35.172 -0.766  1.00 1.21  ? 277 LEU B H    1  
ATOM 8438   H HA   . LEU B 2 277 ? 11.645  -34.256 -1.470  1.00 64.02 ? 277 LEU B HA   1  
ATOM 8439   H HB2  . LEU B 2 277 ? 10.391  -33.889 -4.207  1.00 55.34 ? 277 LEU B HB2  1  
ATOM 8440   H HB3  . LEU B 2 277 ? 12.063  -33.512 -3.815  1.00 3.21  ? 277 LEU B HB3  1  
ATOM 8441   H HG   . LEU B 2 277 ? 10.820  -36.295 -3.699  1.00 71.22 ? 277 LEU B HG   1  
ATOM 8442   H HD11 . LEU B 2 277 ? 12.204  -36.825 -5.652  1.00 3.10  ? 277 LEU B HD11 1  
ATOM 8443   H HD12 . LEU B 2 277 ? 12.775  -35.157 -5.721  1.00 12.13 ? 277 LEU B HD12 1  
ATOM 8444   H HD13 . LEU B 2 277 ? 11.072  -35.522 -6.011  1.00 23.20 ? 277 LEU B HD13 1  
ATOM 8445   H HD21 . LEU B 2 277 ? 12.591  -36.044 -2.013  1.00 24.44 ? 277 LEU B HD21 1  
ATOM 8446   H HD22 . LEU B 2 277 ? 13.707  -35.457 -3.246  1.00 74.52 ? 277 LEU B HD22 1  
ATOM 8447   H HD23 . LEU B 2 277 ? 13.116  -37.120 -3.306  1.00 61.54 ? 277 LEU B HD23 1  
ATOM 8448   N N    . LEU B 2 278 ? 9.397   -31.936 -1.648  1.00 51.55 ? 278 LEU B N    1  
ATOM 8449   C CA   . LEU B 2 278 ? 9.057   -30.584 -1.129  1.00 62.00 ? 278 LEU B CA   1  
ATOM 8450   C C    . LEU B 2 278 ? 7.531   -30.490 -0.958  1.00 2.32  ? 278 LEU B C    1  
ATOM 8451   O O    . LEU B 2 278 ? 6.776   -30.911 -1.851  1.00 15.54 ? 278 LEU B O    1  
ATOM 8452   C CB   . LEU B 2 278 ? 9.571   -29.405 -2.036  1.00 35.34 ? 278 LEU B CB   1  
ATOM 8453   C CG   . LEU B 2 278 ? 8.971   -29.283 -3.485  1.00 43.20 ? 278 LEU B CG   1  
ATOM 8454   C CD1  . LEU B 2 278 ? 9.239   -27.885 -4.082  1.00 52.04 ? 278 LEU B CD1  1  
ATOM 8455   C CD2  . LEU B 2 278 ? 9.503   -30.390 -4.431  1.00 25.11 ? 278 LEU B CD2  1  
ATOM 8456   H H    . LEU B 2 278 ? 8.661   -32.513 -1.913  1.00 65.13 ? 278 LEU B H    1  
ATOM 8457   H HA   . LEU B 2 278 ? 9.513   -30.493 -0.147  1.00 14.41 ? 278 LEU B HA   1  
ATOM 8458   H HB2  . LEU B 2 278 ? 9.369   -28.476 -1.514  1.00 5.44  ? 278 LEU B HB2  1  
ATOM 8459   H HB3  . LEU B 2 278 ? 10.646  -29.503 -2.127  1.00 72.20 ? 278 LEU B HB3  1  
ATOM 8460   H HG   . LEU B 2 278 ? 7.896   -29.399 -3.421  1.00 61.44 ? 278 LEU B HG   1  
ATOM 8461   H HD11 . LEU B 2 278 ? 8.785   -27.815 -5.060  1.00 42.05 ? 278 LEU B HD11 1  
ATOM 8462   H HD12 . LEU B 2 278 ? 10.306  -27.717 -4.168  1.00 62.23 ? 278 LEU B HD12 1  
ATOM 8463   H HD13 . LEU B 2 278 ? 8.810   -27.128 -3.439  1.00 54.21 ? 278 LEU B HD13 1  
ATOM 8464   H HD21 . LEU B 2 278 ? 9.252   -31.362 -4.027  1.00 14.41 ? 278 LEU B HD21 1  
ATOM 8465   H HD22 . LEU B 2 278 ? 10.577  -30.310 -4.531  1.00 23.35 ? 278 LEU B HD22 1  
ATOM 8466   H HD23 . LEU B 2 278 ? 9.044   -30.286 -5.406  1.00 31.11 ? 278 LEU B HD23 1  
ATOM 8467   N N    . GLY B 2 279 ? 7.079   -29.989 0.205   1.00 2.41  ? 279 GLY B N    1  
ATOM 8468   C CA   . GLY B 2 279 ? 5.649   -29.830 0.480   1.00 5.05  ? 279 GLY B CA   1  
ATOM 8469   C C    . GLY B 2 279 ? 5.362   -29.368 1.910   1.00 75.43 ? 279 GLY B C    1  
ATOM 8470   O O    . GLY B 2 279 ? 5.584   -28.190 2.236   1.00 33.42 ? 279 GLY B O    1  
ATOM 8471   H H    . GLY B 2 279 ? 7.730   -29.747 0.897   1.00 51.02 ? 279 GLY B H    1  
ATOM 8472   H HA2  . GLY B 2 279 ? 5.241   -29.103 -0.209  1.00 13.11 ? 279 GLY B HA2  1  
ATOM 8473   H HA3  . GLY B 2 279 ? 5.156   -30.781 0.312   1.00 74.11 ? 279 GLY B HA3  1  
ATOM 8474   N N    . LEU B 2 280 ? 4.905   -30.324 2.761   1.00 2.23  ? 280 LEU B N    1  
ATOM 8475   C CA   . LEU B 2 280 ? 4.369   -30.071 4.117   1.00 3.22  ? 280 LEU B CA   1  
ATOM 8476   C C    . LEU B 2 280 ? 3.187   -29.074 4.012   1.00 51.33 ? 280 LEU B C    1  
ATOM 8477   O O    . LEU B 2 280 ? 2.044   -29.481 3.778   1.00 43.32 ? 280 LEU B O    1  
ATOM 8478   C CB   . LEU B 2 280 ? 5.517   -29.610 5.094   1.00 4.21  ? 280 LEU B CB   1  
ATOM 8479   C CG   . LEU B 2 280 ? 5.307   -29.788 6.647   1.00 12.12 ? 280 LEU B CG   1  
ATOM 8480   C CD1  . LEU B 2 280 ? 4.303   -28.774 7.247   1.00 53.23 ? 280 LEU B CD1  1  
ATOM 8481   C CD2  . LEU B 2 280 ? 4.909   -31.246 6.999   1.00 43.32 ? 280 LEU B CD2  1  
ATOM 8482   H H    . LEU B 2 280 ? 4.962   -31.252 2.463   1.00 4.12  ? 280 LEU B H    1  
ATOM 8483   H HA   . LEU B 2 280 ? 3.975   -31.019 4.472   1.00 23.11 ? 280 LEU B HA   1  
ATOM 8484   H HB2  . LEU B 2 280 ? 6.411   -30.161 4.825   1.00 0.34  ? 280 LEU B HB2  1  
ATOM 8485   H HB3  . LEU B 2 280 ? 5.716   -28.560 4.901   1.00 71.22 ? 280 LEU B HB3  1  
ATOM 8486   H HG   . LEU B 2 280 ? 6.257   -29.597 7.133   1.00 14.42 ? 280 LEU B HG   1  
ATOM 8487   H HD11 . LEU B 2 280 ? 4.640   -27.764 7.044   1.00 74.31 ? 280 LEU B HD11 1  
ATOM 8488   H HD12 . LEU B 2 280 ? 4.240   -28.913 8.316   1.00 0.35  ? 280 LEU B HD12 1  
ATOM 8489   H HD13 . LEU B 2 280 ? 3.322   -28.917 6.809   1.00 62.11 ? 280 LEU B HD13 1  
ATOM 8490   H HD21 . LEU B 2 280 ? 4.839   -31.356 8.071   1.00 32.31 ? 280 LEU B HD21 1  
ATOM 8491   H HD22 . LEU B 2 280 ? 5.660   -31.931 6.623   1.00 14.04 ? 280 LEU B HD22 1  
ATOM 8492   H HD23 . LEU B 2 280 ? 3.953   -31.488 6.550   1.00 61.04 ? 280 LEU B HD23 1  
ATOM 8493   N N    . PHE B 2 281 ? 3.505   -27.778 4.120   1.00 41.45 ? 281 PHE B N    1  
ATOM 8494   C CA   . PHE B 2 281 ? 2.589   -26.659 3.870   1.00 4.33  ? 281 PHE B CA   1  
ATOM 8495   C C    . PHE B 2 281 ? 3.451   -25.504 3.347   1.00 53.42 ? 281 PHE B C    1  
ATOM 8496   O O    . PHE B 2 281 ? 3.303   -25.091 2.191   1.00 75.31 ? 281 PHE B O    1  
ATOM 8497   C CB   . PHE B 2 281 ? 1.793   -26.233 5.142   1.00 5.31  ? 281 PHE B CB   1  
ATOM 8498   C CG   . PHE B 2 281 ? 0.653   -27.190 5.528   1.00 54.32 ? 281 PHE B CG   1  
ATOM 8499   C CD1  . PHE B 2 281 ? -0.492  -27.289 4.731   1.00 60.22 ? 281 PHE B CD1  1  
ATOM 8500   C CD2  . PHE B 2 281 ? 0.728   -27.984 6.672   1.00 44.32 ? 281 PHE B CD2  1  
ATOM 8501   C CE1  . PHE B 2 281 ? -1.524  -28.148 5.072   1.00 53.00 ? 281 PHE B CE1  1  
ATOM 8502   C CE2  . PHE B 2 281 ? -0.304  -28.842 7.011   1.00 40.23 ? 281 PHE B CE2  1  
ATOM 8503   C CZ   . PHE B 2 281 ? -1.428  -28.924 6.210   1.00 23.25 ? 281 PHE B CZ   1  
ATOM 8504   H H    . PHE B 2 281 ? 4.427   -27.556 4.354   1.00 22.15 ? 281 PHE B H    1  
ATOM 8505   H HA   . PHE B 2 281 ? 1.892   -26.957 3.087   1.00 12.23 ? 281 PHE B HA   1  
ATOM 8506   H HB2  . PHE B 2 281 ? 2.482   -26.160 5.977   1.00 44.32 ? 281 PHE B HB2  1  
ATOM 8507   H HB3  . PHE B 2 281 ? 1.357   -25.253 4.974   1.00 53.03 ? 281 PHE B HB3  1  
ATOM 8508   H HD1  . PHE B 2 281 ? -0.572  -26.682 3.835   1.00 61.25 ? 281 PHE B HD1  1  
ATOM 8509   H HD2  . PHE B 2 281 ? 1.608   -27.924 7.301   1.00 63.45 ? 281 PHE B HD2  1  
ATOM 8510   H HE1  . PHE B 2 281 ? -2.403  -28.210 4.446   1.00 71.42 ? 281 PHE B HE1  1  
ATOM 8511   H HE2  . PHE B 2 281 ? -0.230  -29.448 7.903   1.00 60.13 ? 281 PHE B HE2  1  
ATOM 8512   H HZ   . PHE B 2 281 ? -2.237  -29.594 6.478   1.00 2.04  ? 281 PHE B HZ   1  
ATOM 8513   N N    . ALA B 2 282 ? 4.376   -25.027 4.221   1.00 34.31 ? 282 ALA B N    1  
ATOM 8514   C CA   . ALA B 2 282 ? 5.419   -24.032 3.884   1.00 11.22 ? 282 ALA B CA   1  
ATOM 8515   C C    . ALA B 2 282 ? 4.835   -22.731 3.272   1.00 65.41 ? 282 ALA B C    1  
ATOM 8516   O O    . ALA B 2 282 ? 3.635   -22.470 3.399   1.00 45.22 ? 282 ALA B O    1  
ATOM 8517   C CB   . ALA B 2 282 ? 6.487   -24.684 2.971   1.00 33.20 ? 282 ALA B CB   1  
ATOM 8518   H H    . ALA B 2 282 ? 4.351   -25.360 5.138   1.00 12.22 ? 282 ALA B H    1  
ATOM 8519   H HA   . ALA B 2 282 ? 5.904   -23.765 4.816   1.00 32.52 ? 282 ALA B HA   1  
ATOM 8520   H HB1  . ALA B 2 282 ? 7.296   -23.984 2.793   1.00 54.05 ? 282 ALA B HB1  1  
ATOM 8521   H HB2  . ALA B 2 282 ? 6.043   -24.962 2.024   1.00 5.20  ? 282 ALA B HB2  1  
ATOM 8522   H HB3  . ALA B 2 282 ? 6.883   -25.568 3.452   1.00 64.51 ? 282 ALA B HB3  1  
ATOM 8523   N N    . ASP B 2 283 ? 5.724   -21.910 2.672   1.00 32.21 ? 283 ASP B N    1  
ATOM 8524   C CA   . ASP B 2 283 ? 5.371   -20.680 1.929   1.00 23.43 ? 283 ASP B CA   1  
ATOM 8525   C C    . ASP B 2 283 ? 4.665   -19.650 2.820   1.00 65.35 ? 283 ASP B C    1  
ATOM 8526   O O    . ASP B 2 283 ? 3.429   -19.645 2.949   1.00 52.03 ? 283 ASP B O    1  
ATOM 8527   C CB   . ASP B 2 283 ? 4.525   -21.002 0.660   1.00 23.42 ? 283 ASP B CB   1  
ATOM 8528   C CG   . ASP B 2 283 ? 4.180   -19.764 -0.200  1.00 34.11 ? 283 ASP B CG   1  
ATOM 8529   O OD1  . ASP B 2 283 ? 5.103   -19.021 -0.591  1.00 72.33 ? 283 ASP B OD1  1  
ATOM 8530   O OD2  . ASP B 2 283 ? 2.997   -19.571 -0.560  1.00 44.32 ? 283 ASP B OD2  1  
ATOM 8531   H H    . ASP B 2 283 ? 6.674   -22.139 2.739   1.00 25.44 ? 283 ASP B H    1  
ATOM 8532   H HA   . ASP B 2 283 ? 6.312   -20.249 1.602   1.00 54.21 ? 283 ASP B HA   1  
ATOM 8533   H HB2  . ASP B 2 283 ? 5.076   -21.696 0.043   1.00 42.41 ? 283 ASP B HB2  1  
ATOM 8534   H HB3  . ASP B 2 283 ? 3.599   -21.482 0.974   1.00 70.13 ? 283 ASP B HB3  1  
ATOM 8535   N N    . GLY B 2 284 ? 5.467   -18.810 3.476   1.00 61.45 ? 284 GLY B N    1  
ATOM 8536   C CA   . GLY B 2 284 ? 4.946   -17.659 4.208   1.00 1.21  ? 284 GLY B CA   1  
ATOM 8537   C C    . GLY B 2 284 ? 4.510   -16.521 3.278   1.00 55.24 ? 284 GLY B C    1  
ATOM 8538   O O    . GLY B 2 284 ? 4.346   -16.726 2.066   1.00 51.32 ? 284 GLY B O    1  
ATOM 8539   H H    . GLY B 2 284 ? 6.429   -18.977 3.469   1.00 63.10 ? 284 GLY B H    1  
ATOM 8540   H HA2  . GLY B 2 284 ? 4.100   -17.967 4.811   1.00 43.30 ? 284 GLY B HA2  1  
ATOM 8541   H HA3  . GLY B 2 284 ? 5.726   -17.300 4.862   1.00 72.13 ? 284 GLY B HA3  1  
ATOM 8542   N N    . ASN B 2 285 ? 4.353   -15.318 3.864   1.00 53.12 ? 285 ASN B N    1  
ATOM 8543   C CA   . ASN B 2 285 ? 3.875   -14.096 3.174   1.00 22.42 ? 285 ASN B CA   1  
ATOM 8544   C C    . ASN B 2 285 ? 2.364   -14.226 2.815   1.00 64.15 ? 285 ASN B C    1  
ATOM 8545   O O    . ASN B 2 285 ? 1.531   -13.644 3.499   1.00 60.45 ? 285 ASN B O    1  
ATOM 8546   C CB   . ASN B 2 285 ? 4.731   -13.724 1.909   1.00 70.02 ? 285 ASN B CB   1  
ATOM 8547   C CG   . ASN B 2 285 ? 6.231   -13.634 2.199   1.00 31.10 ? 285 ASN B CG   1  
ATOM 8548   O OD1  . ASN B 2 285 ? 6.711   -12.654 2.756   1.00 34.00 ? 285 ASN B OD1  1  
ATOM 8549   N ND2  . ASN B 2 285 ? 6.988   -14.654 1.807   1.00 72.41 ? 285 ASN B ND2  1  
ATOM 8550   H H    . ASN B 2 285 ? 4.558   -15.255 4.813   1.00 73.03 ? 285 ASN B H    1  
ATOM 8551   H HA   . ASN B 2 285 ? 3.976   -13.284 3.895   1.00 71.10 ? 285 ASN B HA   1  
ATOM 8552   H HB2  . ASN B 2 285 ? 4.567   -14.474 1.138   1.00 64.03 ? 285 ASN B HB2  1  
ATOM 8553   H HB3  . ASN B 2 285 ? 4.402   -12.764 1.524   1.00 70.44 ? 285 ASN B HB3  1  
ATOM 8554   H HD21 . ASN B 2 285 ? 6.552   -15.412 1.359   1.00 71.21 ? 285 ASN B HD21 1  
ATOM 8555   H HD22 . ASN B 2 285 ? 7.953   -14.604 1.970   1.00 54.11 ? 285 ASN B HD22 1  
ATOM 8556   N N    . MET B 2 286 ? 2.069   -15.035 1.759   1.00 42.31 ? 286 MET B N    1  
ATOM 8557   C CA   . MET B 2 286 ? 0.722   -15.303 1.172   1.00 42.43 ? 286 MET B CA   1  
ATOM 8558   C C    . MET B 2 286 ? -0.208  -14.026 1.047   1.00 5.10  ? 286 MET B C    1  
ATOM 8559   O O    . MET B 2 286 ? -0.115  -13.384 -0.010  1.00 15.22 ? 286 MET B O    1  
ATOM 8560   C CB   . MET B 2 286 ? 0.035   -16.565 1.798   1.00 31.31 ? 286 MET B CB   1  
ATOM 8561   C CG   . MET B 2 286 ? 0.665   -17.920 1.435   1.00 51.52 ? 286 MET B CG   1  
ATOM 8562   S SD   . MET B 2 286 ? -0.308  -19.307 2.094   1.00 63.42 ? 286 MET B SD   1  
ATOM 8563   C CE   . MET B 2 286 ? 0.516   -20.752 1.408   1.00 64.10 ? 286 MET B CE   1  
ATOM 8564   H H    . MET B 2 286 ? 2.820   -15.485 1.340   1.00 14.34 ? 286 MET B H    1  
ATOM 8565   H HA   . MET B 2 286 ? 0.955   -15.583 0.143   1.00 71.51 ? 286 MET B HA   1  
ATOM 8566   H HB2  . MET B 2 286 ? 0.058   -16.463 2.879   1.00 54.32 ? 286 MET B HB2  1  
ATOM 8567   H HB3  . MET B 2 286 ? -1.005  -16.583 1.487   1.00 13.43 ? 286 MET B HB3  1  
ATOM 8568   H HG2  . MET B 2 286 ? 0.720   -18.012 0.359   1.00 62.31 ? 286 MET B HG2  1  
ATOM 8569   H HG3  . MET B 2 286 ? 1.660   -17.968 1.856   1.00 71.12 ? 286 MET B HG3  1  
ATOM 8570   H HE1  . MET B 2 286 ? 0.001   -21.643 1.736   1.00 3.14  ? 286 MET B HE1  1  
ATOM 8571   H HE2  . MET B 2 286 ? 1.539   -20.783 1.754   1.00 14.30 ? 286 MET B HE2  1  
ATOM 8572   H HE3  . MET B 2 286 ? 0.499   -20.702 0.329   1.00 74.22 ? 286 MET B HE3  1  
ATOM 8573   N N    . PRO B 2 287 ? -1.111  -13.575 2.050   1.00 53.11 ? 287 PRO B N    1  
ATOM 8574   C CA   . PRO B 2 287 ? -1.911  -12.340 1.843   1.00 44.33 ? 287 PRO B CA   1  
ATOM 8575   C C    . PRO B 2 287 ? -1.080  -11.052 2.019   1.00 64.42 ? 287 PRO B C    1  
ATOM 8576   O O    . PRO B 2 287 ? -1.400  -10.047 1.404   1.00 41.42 ? 287 PRO B O    1  
ATOM 8577   C CB   . PRO B 2 287 ? -3.031  -12.448 2.909   1.00 73.33 ? 287 PRO B CB   1  
ATOM 8578   C CG   . PRO B 2 287 ? -2.408  -13.195 4.042   1.00 61.54 ? 287 PRO B CG   1  
ATOM 8579   C CD   . PRO B 2 287 ? -1.475  -14.199 3.383   1.00 61.25 ? 287 PRO B CD   1  
ATOM 8580   H HA   . PRO B 2 287 ? -2.362  -12.336 0.851   1.00 74.24 ? 287 PRO B HA   1  
ATOM 8581   H HB2  . PRO B 2 287 ? -3.375  -11.459 3.224   1.00 4.21  ? 287 PRO B HB2  1  
ATOM 8582   H HB3  . PRO B 2 287 ? -3.867  -13.012 2.514   1.00 1.25  ? 287 PRO B HB3  1  
ATOM 8583   H HG2  . PRO B 2 287 ? -1.850  -12.507 4.680   1.00 2.40  ? 287 PRO B HG2  1  
ATOM 8584   H HG3  . PRO B 2 287 ? -3.163  -13.710 4.615   1.00 40.44 ? 287 PRO B HG3  1  
ATOM 8585   H HD2  . PRO B 2 287 ? -0.586  -14.356 3.986   1.00 1.43  ? 287 PRO B HD2  1  
ATOM 8586   H HD3  . PRO B 2 287 ? -1.977  -15.148 3.223   1.00 43.22 ? 287 PRO B HD3  1  
ATOM 8587   N N    . VAL B 2 288 ? -0.001  -11.122 2.837   1.00 51.22 ? 288 VAL B N    1  
ATOM 8588   C CA   . VAL B 2 288 ? 0.841   -9.961  3.234   1.00 52.24 ? 288 VAL B CA   1  
ATOM 8589   C C    . VAL B 2 288 ? -0.046  -8.792  3.774   1.00 74.32 ? 288 VAL B C    1  
ATOM 8590   O O    . VAL B 2 288 ? -0.382  -8.782  4.955   1.00 4.31  ? 288 VAL B O    1  
ATOM 8591   C CB   . VAL B 2 288 ? 1.816   -9.466  2.077   1.00 73.22 ? 288 VAL B CB   1  
ATOM 8592   C CG1  . VAL B 2 288 ? 2.752   -8.331  2.567   1.00 73.03 ? 288 VAL B CG1  1  
ATOM 8593   C CG2  . VAL B 2 288 ? 2.626   -10.640 1.472   1.00 64.24 ? 288 VAL B CG2  1  
ATOM 8594   H H    . VAL B 2 288 ? 0.241   -12.000 3.190   1.00 1.03  ? 288 VAL B H    1  
ATOM 8595   H HA   . VAL B 2 288 ? 1.465   -10.309 4.058   1.00 30.11 ? 288 VAL B HA   1  
ATOM 8596   H HB   . VAL B 2 288 ? 1.193   -9.056  1.280   1.00 43.35 ? 288 VAL B HB   1  
ATOM 8597   H HG11 . VAL B 2 288 ? 3.403   -8.015  1.762   1.00 72.24 ? 288 VAL B HG11 1  
ATOM 8598   H HG12 . VAL B 2 288 ? 3.355   -8.683  3.394   1.00 61.42 ? 288 VAL B HG12 1  
ATOM 8599   H HG13 . VAL B 2 288 ? 2.159   -7.485  2.896   1.00 21.13 ? 288 VAL B HG13 1  
ATOM 8600   H HG21 . VAL B 2 288 ? 3.259   -10.276 0.671   1.00 13.34 ? 288 VAL B HG21 1  
ATOM 8601   H HG22 . VAL B 2 288 ? 1.948   -11.386 1.074   1.00 71.14 ? 288 VAL B HG22 1  
ATOM 8602   H HG23 . VAL B 2 288 ? 3.243   -11.092 2.236   1.00 12.42 ? 288 VAL B HG23 1  
ATOM 8603   N N    . ARG B 2 289 ? -0.456  -7.868  2.858   1.00 35.25 ? 289 ARG B N    1  
ATOM 8604   C CA   . ARG B 2 289 ? -1.360  -6.719  3.114   1.00 25.12 ? 289 ARG B CA   1  
ATOM 8605   C C    . ARG B 2 289 ? -0.906  -5.857  4.321   1.00 20.40 ? 289 ARG B C    1  
ATOM 8606   O O    . ARG B 2 289 ? -1.223  -6.171  5.480   1.00 20.05 ? 289 ARG B O    1  
ATOM 8607   C CB   . ARG B 2 289 ? -2.844  -7.207  3.251   1.00 44.21 ? 289 ARG B CB   1  
ATOM 8608   C CG   . ARG B 2 289 ? -3.949  -6.140  2.953   1.00 54.22 ? 289 ARG B CG   1  
ATOM 8609   C CD   . ARG B 2 289 ? -4.132  -5.089  4.071   1.00 72.14 ? 289 ARG B CD   1  
ATOM 8610   N NE   . ARG B 2 289 ? -5.242  -4.155  3.793   1.00 24.40 ? 289 ARG B NE   1  
ATOM 8611   C CZ   . ARG B 2 289 ? -5.835  -3.365  4.707   1.00 33.33 ? 289 ARG B CZ   1  
ATOM 8612   N NH1  . ARG B 2 289 ? -5.437  -3.372  5.980   1.00 65.53 ? 289 ARG B NH1  1  
ATOM 8613   N NH2  . ARG B 2 289 ? -6.834  -2.575  4.338   1.00 35.31 ? 289 ARG B NH2  1  
ATOM 8614   H H    . ARG B 2 289 ? -0.139  -7.979  1.939   1.00 51.44 ? 289 ARG B H    1  
ATOM 8615   H HA   . ARG B 2 289 ? -1.304  -6.095  2.227   1.00 32.24 ? 289 ARG B HA   1  
ATOM 8616   H HB2  . ARG B 2 289 ? -2.994  -8.031  2.560   1.00 23.15 ? 289 ARG B HB2  1  
ATOM 8617   H HB3  . ARG B 2 289 ? -2.998  -7.584  4.257   1.00 32.10 ? 289 ARG B HB3  1  
ATOM 8618   H HG2  . ARG B 2 289 ? -3.687  -5.622  2.038   1.00 12.31 ? 289 ARG B HG2  1  
ATOM 8619   H HG3  . ARG B 2 289 ? -4.888  -6.656  2.805   1.00 31.41 ? 289 ARG B HG3  1  
ATOM 8620   H HD2  . ARG B 2 289 ? -4.328  -5.605  5.005   1.00 74.32 ? 289 ARG B HD2  1  
ATOM 8621   H HD3  . ARG B 2 289 ? -3.215  -4.520  4.165   1.00 51.32 ? 289 ARG B HD3  1  
ATOM 8622   H HE   . ARG B 2 289 ? -5.569  -4.125  2.866   1.00 10.45 ? 289 ARG B HE   1  
ATOM 8623   H HH11 . ARG B 2 289 ? -4.692  -3.973  6.271   1.00 2.31  ? 289 ARG B HH11 1  
ATOM 8624   H HH12 . ARG B 2 289 ? -5.890  -2.781  6.656   1.00 11.32 ? 289 ARG B HH12 1  
ATOM 8625   H HH21 . ARG B 2 289 ? -7.141  -2.564  3.381   1.00 4.44  ? 289 ARG B HH21 1  
ATOM 8626   H HH22 . ARG B 2 289 ? -7.285  -1.980  5.010   1.00 73.32 ? 289 ARG B HH22 1  
ATOM 8627   N N    . TRP B 2 290 ? -0.173  -4.778  4.034   1.00 71.43 ? 290 TRP B N    1  
ATOM 8628   C CA   . TRP B 2 290 ? 0.226   -3.782  5.046   1.00 13.13 ? 290 TRP B CA   1  
ATOM 8629   C C    . TRP B 2 290 ? -0.961  -2.843  5.379   1.00 23.31 ? 290 TRP B C    1  
ATOM 8630   O O    . TRP B 2 290 ? -1.709  -2.438  4.479   1.00 42.21 ? 290 TRP B O    1  
ATOM 8631   C CB   . TRP B 2 290 ? 1.471   -2.978  4.563   1.00 34.24 ? 290 TRP B CB   1  
ATOM 8632   C CG   . TRP B 2 290 ? 1.327   -2.286  3.221   1.00 34.05 ? 290 TRP B CG   1  
ATOM 8633   C CD1  . TRP B 2 290 ? 0.928   -0.997  2.991   1.00 64.14 ? 290 TRP B CD1  1  
ATOM 8634   C CD2  . TRP B 2 290 ? 1.598   -2.853  1.929   1.00 31.44 ? 290 TRP B CD2  1  
ATOM 8635   N NE1  . TRP B 2 290 ? 0.927   -0.736  1.648   1.00 23.21 ? 290 TRP B NE1  1  
ATOM 8636   C CE2  . TRP B 2 290 ? 1.332   -1.857  0.974   1.00 52.20 ? 290 TRP B CE2  1  
ATOM 8637   C CE3  . TRP B 2 290 ? 2.036   -4.109  1.491   1.00 43.12 ? 290 TRP B CE3  1  
ATOM 8638   C CZ2  . TRP B 2 290 ? 1.489   -2.074  -0.389  1.00 60.44 ? 290 TRP B CZ2  1  
ATOM 8639   C CZ3  . TRP B 2 290 ? 2.190   -4.324  0.137   1.00 32.10 ? 290 TRP B CZ3  1  
ATOM 8640   C CH2  . TRP B 2 290 ? 1.917   -3.312  -0.792  1.00 75.34 ? 290 TRP B CH2  1  
ATOM 8641   H H    . TRP B 2 290 ? 0.107   -4.643  3.110   1.00 10.03 ? 290 TRP B H    1  
ATOM 8642   H HA   . TRP B 2 290 ? 0.505   -4.326  5.947   1.00 72.21 ? 290 TRP B HA   1  
ATOM 8643   H HB2  . TRP B 2 290 ? 1.708   -2.218  5.299   1.00 61.34 ? 290 TRP B HB2  1  
ATOM 8644   H HB3  . TRP B 2 290 ? 2.315   -3.655  4.495   1.00 5.14  ? 290 TRP B HB3  1  
ATOM 8645   H HD1  . TRP B 2 290 ? 0.653   -0.299  3.768   1.00 65.23 ? 290 TRP B HD1  1  
ATOM 8646   H HE1  . TRP B 2 290 ? 0.674   0.118   1.237   1.00 73.24 ? 290 TRP B HE1  1  
ATOM 8647   H HE3  . TRP B 2 290 ? 2.249   -4.902  2.196   1.00 72.24 ? 290 TRP B HE3  1  
ATOM 8648   H HZ2  . TRP B 2 290 ? 1.277   -1.303  -1.118  1.00 23.34 ? 290 TRP B HZ2  1  
ATOM 8649   H HZ3  . TRP B 2 290 ? 2.527   -5.288  -0.219  1.00 73.53 ? 290 TRP B HZ3  1  
ATOM 8650   H HH2  . TRP B 2 290 ? 2.051   -3.524  -1.845  1.00 42.35 ? 290 TRP B HH2  1  
ATOM 8651   N N    . LEU B 2 291 ? -1.147  -2.543  6.678   1.00 1.44  ? 291 LEU B N    1  
ATOM 8652   C CA   . LEU B 2 291 ? -2.168  -1.577  7.144   1.00 5.24  ? 291 LEU B CA   1  
ATOM 8653   C C    . LEU B 2 291 ? -1.591  -0.145  7.178   1.00 33.12 ? 291 LEU B C    1  
ATOM 8654   O O    . LEU B 2 291 ? -2.339  0.837   7.237   1.00 52.01 ? 291 LEU B O    1  
ATOM 8655   C CB   . LEU B 2 291 ? -2.747  -2.026  8.535   1.00 11.34 ? 291 LEU B CB   1  
ATOM 8656   C CG   . LEU B 2 291 ? -1.727  -2.419  9.679   1.00 64.34 ? 291 LEU B CG   1  
ATOM 8657   C CD1  . LEU B 2 291 ? -0.998  -1.198  10.290  1.00 53.40 ? 291 LEU B CD1  1  
ATOM 8658   C CD2  . LEU B 2 291 ? -2.422  -3.253  10.787  1.00 60.32 ? 291 LEU B CD2  1  
ATOM 8659   H H    . LEU B 2 291 ? -0.571  -2.980  7.344   1.00 30.30 ? 291 LEU B H    1  
ATOM 8660   H HA   . LEU B 2 291 ? -2.983  -1.584  6.420   1.00 73.33 ? 291 LEU B HA   1  
ATOM 8661   H HB2  . LEU B 2 291 ? -3.381  -1.232  8.906   1.00 3.22  ? 291 LEU B HB2  1  
ATOM 8662   H HB3  . LEU B 2 291 ? -3.384  -2.888  8.347   1.00 71.51 ? 291 LEU B HB3  1  
ATOM 8663   H HG   . LEU B 2 291 ? -0.963  -3.050  9.241   1.00 73.52 ? 291 LEU B HG   1  
ATOM 8664   H HD11 . LEU B 2 291 ? -0.312  -1.530  11.061  1.00 21.10 ? 291 LEU B HD11 1  
ATOM 8665   H HD12 . LEU B 2 291 ? -1.717  -0.515  10.721  1.00 4.32  ? 291 LEU B HD12 1  
ATOM 8666   H HD13 . LEU B 2 291 ? -0.436  -0.687  9.519   1.00 41.42 ? 291 LEU B HD13 1  
ATOM 8667   H HD21 . LEU B 2 291 ? -1.695  -3.539  11.538  1.00 24.34 ? 291 LEU B HD21 1  
ATOM 8668   H HD22 . LEU B 2 291 ? -2.850  -4.150  10.357  1.00 42.52 ? 291 LEU B HD22 1  
ATOM 8669   H HD23 . LEU B 2 291 ? -3.207  -2.672  11.252  1.00 44.20 ? 291 LEU B HD23 1  
ATOM 8670   N N    . GLY B 2 292 ? -0.244  -0.058  7.164   1.00 1.45  ? 292 GLY B N    1  
ATOM 8671   C CA   . GLY B 2 292 ? 0.482   1.208   7.211   1.00 62.12 ? 292 GLY B CA   1  
ATOM 8672   C C    . GLY B 2 292 ? 0.822   1.709   5.807   1.00 44.00 ? 292 GLY B C    1  
ATOM 8673   O O    . GLY B 2 292 ? 1.780   1.215   5.199   1.00 10.31 ? 292 GLY B O    1  
ATOM 8674   H H    . GLY B 2 292 ? 0.270   -0.887  7.105   1.00 71.42 ? 292 GLY B H    1  
ATOM 8675   H HA2  . GLY B 2 292 ? -0.107  1.952   7.731   1.00 33.43 ? 292 GLY B HA2  1  
ATOM 8676   H HA3  . GLY B 2 292 ? 1.398   1.057   7.760   1.00 32.10 ? 292 GLY B HA3  1  
ATOM 8677   N N    . PRO B 2 293 ? 0.082   2.734   5.269   1.00 51.12 ? 293 PRO B N    1  
ATOM 8678   C CA   . PRO B 2 293 ? 0.213   3.186   3.857   1.00 22.00 ? 293 PRO B CA   1  
ATOM 8679   C C    . PRO B 2 293 ? 1.340   4.223   3.641   1.00 40.54 ? 293 PRO B C    1  
ATOM 8680   O O    . PRO B 2 293 ? 1.371   4.905   2.607   1.00 4.14  ? 293 PRO B O    1  
ATOM 8681   C CB   . PRO B 2 293 ? -1.173  3.811   3.623   1.00 4.55  ? 293 PRO B CB   1  
ATOM 8682   C CG   . PRO B 2 293 ? -1.511  4.465   4.927   1.00 2.10  ? 293 PRO B CG   1  
ATOM 8683   C CD   . PRO B 2 293 ? -0.946  3.552   5.995   1.00 41.44 ? 293 PRO B CD   1  
ATOM 8684   H HA   . PRO B 2 293 ? 0.357   2.354   3.179   1.00 61.00 ? 293 PRO B HA   1  
ATOM 8685   H HB2  . PRO B 2 293 ? -1.135  4.537   2.810   1.00 31.22 ? 293 PRO B HB2  1  
ATOM 8686   H HB3  . PRO B 2 293 ? -1.897  3.039   3.392   1.00 31.10 ? 293 PRO B HB3  1  
ATOM 8687   H HG2  . PRO B 2 293 ? -1.052  5.453   4.978   1.00 71.11 ? 293 PRO B HG2  1  
ATOM 8688   H HG3  . PRO B 2 293 ? -2.586  4.552   5.035   1.00 52.14 ? 293 PRO B HG3  1  
ATOM 8689   H HD2  . PRO B 2 293 ? -0.490  4.136   6.793   1.00 75.13 ? 293 PRO B HD2  1  
ATOM 8690   H HD3  . PRO B 2 293 ? -1.720  2.913   6.400   1.00 70.24 ? 293 PRO B HD3  1  
ATOM 8691   N N    . LYS B 2 294 ? 2.260   4.296   4.624   1.00 14.51 ? 294 LYS B N    1  
ATOM 8692   C CA   . LYS B 2 294 ? 3.354   5.279   4.700   1.00 31.04 ? 294 LYS B CA   1  
ATOM 8693   C C    . LYS B 2 294 ? 2.776   6.712   4.828   1.00 35.11 ? 294 LYS B C    1  
ATOM 8694   O O    . LYS B 2 294 ? 2.624   7.222   5.941   1.00 41.23 ? 294 LYS B O    1  
ATOM 8695   C CB   . LYS B 2 294 ? 4.365   5.157   3.505   1.00 21.53 ? 294 LYS B CB   1  
ATOM 8696   C CG   . LYS B 2 294 ? 4.908   3.727   3.181   1.00 1.04  ? 294 LYS B CG   1  
ATOM 8697   C CD   . LYS B 2 294 ? 5.796   3.081   4.296   1.00 5.44  ? 294 LYS B CD   1  
ATOM 8698   C CE   . LYS B 2 294 ? 4.994   2.352   5.400   1.00 20.04 ? 294 LYS B CE   1  
ATOM 8699   N NZ   . LYS B 2 294 ? 5.882   1.710   6.407   1.00 1.05  ? 294 LYS B NZ   1  
ATOM 8700   H H    . LYS B 2 294 ? 2.192   3.650   5.349   1.00 22.22 ? 294 LYS B H    1  
ATOM 8701   H HA   . LYS B 2 294 ? 3.890   5.058   5.620   1.00 51.45 ? 294 LYS B HA   1  
ATOM 8702   H HB2  . LYS B 2 294 ? 3.878   5.528   2.612   1.00 13.12 ? 294 LYS B HB2  1  
ATOM 8703   H HB3  . LYS B 2 294 ? 5.217   5.798   3.714   1.00 74.44 ? 294 LYS B HB3  1  
ATOM 8704   H HG2  . LYS B 2 294 ? 4.063   3.077   2.995   1.00 74.35 ? 294 LYS B HG2  1  
ATOM 8705   H HG3  . LYS B 2 294 ? 5.495   3.792   2.269   1.00 22.31 ? 294 LYS B HG3  1  
ATOM 8706   H HD2  . LYS B 2 294 ? 6.462   2.360   3.833   1.00 73.03 ? 294 LYS B HD2  1  
ATOM 8707   H HD3  . LYS B 2 294 ? 6.394   3.857   4.755   1.00 65.23 ? 294 LYS B HD3  1  
ATOM 8708   H HE2  . LYS B 2 294 ? 4.361   3.068   5.905   1.00 14.25 ? 294 LYS B HE2  1  
ATOM 8709   H HE3  . LYS B 2 294 ? 4.373   1.589   4.945   1.00 11.23 ? 294 LYS B HE3  1  
ATOM 8710   H HZ1  . LYS B 2 294 ? 6.446   0.959   5.959   1.00 4.50  ? 294 LYS B HZ1  1  
ATOM 8711   H HZ2  . LYS B 2 294 ? 5.311   1.292   7.170   1.00 45.44 ? 294 LYS B HZ2  1  
ATOM 8712   H HZ3  . LYS B 2 294 ? 6.527   2.415   6.817   1.00 23.43 ? 294 LYS B HZ3  1  
ATOM 8713   N N    . ALA B 2 295 ? 2.408   7.326   3.686   1.00 12.03 ? 295 ALA B N    1  
ATOM 8714   C CA   . ALA B 2 295 ? 1.845   8.689   3.636   1.00 3.53  ? 295 ALA B CA   1  
ATOM 8715   C C    . ALA B 2 295 ? 0.833   8.801   2.486   1.00 12.23 ? 295 ALA B C    1  
ATOM 8716   O O    . ALA B 2 295 ? 0.874   8.012   1.531   1.00 31.45 ? 295 ALA B O    1  
ATOM 8717   C CB   . ALA B 2 295 ? 2.959   9.741   3.475   1.00 34.32 ? 295 ALA B CB   1  
ATOM 8718   H H    . ALA B 2 295 ? 2.493   6.836   2.843   1.00 33.13 ? 295 ALA B H    1  
ATOM 8719   H HA   . ALA B 2 295 ? 1.326   8.883   4.572   1.00 71.35 ? 295 ALA B HA   1  
ATOM 8720   H HB1  . ALA B 2 295 ? 3.653   9.661   4.304   1.00 51.20 ? 295 ALA B HB1  1  
ATOM 8721   H HB2  . ALA B 2 295 ? 2.529   10.734  3.469   1.00 51.31 ? 295 ALA B HB2  1  
ATOM 8722   H HB3  . ALA B 2 295 ? 3.490   9.574   2.549   1.00 64.15 ? 295 ALA B HB3  1  
ATOM 8723   N N    . THR B 2 296 ? -0.076  9.784   2.595   1.00 65.42 ? 296 THR B N    1  
ATOM 8724   C CA   . THR B 2 296 ? -1.063  10.084  1.553   1.00 43.33 ? 296 THR B CA   1  
ATOM 8725   C C    . THR B 2 296 ? -0.470  11.098  0.554   1.00 52.22 ? 296 THR B C    1  
ATOM 8726   O O    . THR B 2 296 ? -0.360  10.796  -0.636  1.00 23.42 ? 296 THR B O    1  
ATOM 8727   C CB   . THR B 2 296 ? -2.390  10.625  2.184   1.00 15.00 ? 296 THR B CB   1  
ATOM 8728   O OG1  . THR B 2 296 ? -2.101  11.693  3.110   1.00 3.32  ? 296 THR B OG1  1  
ATOM 8729   C CG2  . THR B 2 296 ? -3.173  9.512   2.908   1.00 22.11 ? 296 THR B CG2  1  
ATOM 8730   H H    . THR B 2 296 ? -0.078  10.332  3.405   1.00 64.22 ? 296 THR B H    1  
ATOM 8731   H HA   . THR B 2 296 ? -1.294  9.160   1.020   1.00 24.21 ? 296 THR B HA   1  
ATOM 8732   H HB   . THR B 2 296 ? -3.017  11.021  1.390   1.00 1.21  ? 296 THR B HB   1  
ATOM 8733   H HG1  . THR B 2 296 ? -1.861  11.316  3.966   1.00 21.51 ? 296 THR B HG1  1  
ATOM 8734   H HG21 . THR B 2 296 ? -2.567  9.097   3.703   1.00 71.52 ? 296 THR B HG21 1  
ATOM 8735   H HG22 . THR B 2 296 ? -3.429  8.728   2.207   1.00 62.11 ? 296 THR B HG22 1  
ATOM 8736   H HG23 . THR B 2 296 ? -4.082  9.922   3.330   1.00 41.03 ? 296 THR B HG23 1  
ATOM 8737   N N    . TYR B 2 297 ? -0.080  12.289  1.078   1.00 33.21 ? 297 TYR B N    1  
ATOM 8738   C CA   . TYR B 2 297 ? 0.582   13.376  0.320   1.00 12.43 ? 297 TYR B CA   1  
ATOM 8739   C C    . TYR B 2 297 ? -0.308  13.885  -0.842  1.00 60.44 ? 297 TYR B C    1  
ATOM 8740   O O    . TYR B 2 297 ? -0.310  13.325  -1.949  1.00 5.34  ? 297 TYR B O    1  
ATOM 8741   C CB   . TYR B 2 297 ? 1.992   12.926  -0.174  1.00 62.03 ? 297 TYR B CB   1  
ATOM 8742   C CG   . TYR B 2 297 ? 2.835   14.022  -0.871  1.00 60.15 ? 297 TYR B CG   1  
ATOM 8743   C CD1  . TYR B 2 297 ? 3.548   14.966  -0.124  1.00 23.33 ? 297 TYR B CD1  1  
ATOM 8744   C CD2  . TYR B 2 297 ? 2.931   14.096  -2.268  1.00 21.44 ? 297 TYR B CD2  1  
ATOM 8745   C CE1  . TYR B 2 297 ? 4.319   15.934  -0.741  1.00 62.13 ? 297 TYR B CE1  1  
ATOM 8746   C CE2  . TYR B 2 297 ? 3.699   15.066  -2.882  1.00 4.42  ? 297 TYR B CE2  1  
ATOM 8747   C CZ   . TYR B 2 297 ? 4.390   15.979  -2.116  1.00 64.12 ? 297 TYR B CZ   1  
ATOM 8748   O OH   . TYR B 2 297 ? 5.166   16.939  -2.731  1.00 11.23 ? 297 TYR B OH   1  
ATOM 8749   H H    . TYR B 2 297 ? -0.251  12.441  2.027   1.00 70.40 ? 297 TYR B H    1  
ATOM 8750   H HA   . TYR B 2 297 ? 0.718   14.193  1.021   1.00 53.44 ? 297 TYR B HA   1  
ATOM 8751   H HB2  . TYR B 2 297 ? 2.557   12.570  0.680   1.00 62.55 ? 297 TYR B HB2  1  
ATOM 8752   H HB3  . TYR B 2 297 ? 1.871   12.099  -0.867  1.00 52.52 ? 297 TYR B HB3  1  
ATOM 8753   H HD1  . TYR B 2 297 ? 3.494   14.934  0.958   1.00 41.55 ? 297 TYR B HD1  1  
ATOM 8754   H HD2  . TYR B 2 297 ? 2.386   13.379  -2.873  1.00 75.44 ? 297 TYR B HD2  1  
ATOM 8755   H HE1  . TYR B 2 297 ? 4.862   16.653  -0.141  1.00 70.35 ? 297 TYR B HE1  1  
ATOM 8756   H HE2  . TYR B 2 297 ? 3.756   15.103  -3.961  1.00 22.24 ? 297 TYR B HE2  1  
ATOM 8757   H HH   . TYR B 2 297 ? 6.008   17.015  -2.271  1.00 52.10 ? 297 TYR B HH   1  
ATOM 8758   N N    . HIS B 2 298 ? -1.084  14.946  -0.572  1.00 71.50 ? 298 HIS B N    1  
ATOM 8759   C CA   . HIS B 2 298 ? -1.953  15.583  -1.580  1.00 62.13 ? 298 HIS B CA   1  
ATOM 8760   C C    . HIS B 2 298 ? -1.251  16.830  -2.134  1.00 43.41 ? 298 HIS B C    1  
ATOM 8761   O O    . HIS B 2 298 ? -1.613  17.974  -1.822  1.00 2.31  ? 298 HIS B O    1  
ATOM 8762   C CB   . HIS B 2 298 ? -3.345  15.906  -0.979  1.00 43.32 ? 298 HIS B CB   1  
ATOM 8763   C CG   . HIS B 2 298 ? -4.118  14.681  -0.567  1.00 33.25 ? 298 HIS B CG   1  
ATOM 8764   N ND1  . HIS B 2 298 ? -4.522  14.432  0.727   1.00 51.10 ? 298 HIS B ND1  1  
ATOM 8765   C CD2  . HIS B 2 298 ? -4.572  13.639  -1.301  1.00 33.10 ? 298 HIS B CD2  1  
ATOM 8766   C CE1  . HIS B 2 298 ? -5.183  13.292  0.767   1.00 55.11 ? 298 HIS B CE1  1  
ATOM 8767   N NE2  . HIS B 2 298 ? -5.232  12.789  -0.448  1.00 42.32 ? 298 HIS B NE2  1  
ATOM 8768   H H    . HIS B 2 298 ? -1.060  15.326  0.334   1.00 52.33 ? 298 HIS B H    1  
ATOM 8769   H HA   . HIS B 2 298 ? -2.087  14.881  -2.404  1.00 44.15 ? 298 HIS B HA   1  
ATOM 8770   H HB2  . HIS B 2 298 ? -3.220  16.536  -0.106  1.00 73.43 ? 298 HIS B HB2  1  
ATOM 8771   H HB3  . HIS B 2 298 ? -3.938  16.439  -1.713  1.00 62.13 ? 298 HIS B HB3  1  
ATOM 8772   H HD1  . HIS B 2 298 ? -4.359  15.016  1.500   1.00 61.22 ? 298 HIS B HD1  1  
ATOM 8773   H HD2  . HIS B 2 298 ? -4.445  13.502  -2.367  1.00 62.04 ? 298 HIS B HD2  1  
ATOM 8774   H HE1  . HIS B 2 298 ? -5.607  12.844  1.652   1.00 52.30 ? 298 HIS B HE1  1  
ATOM 8775   H HE2  . HIS B 2 298 ? -5.443  11.849  -0.648  1.00 37.66 ? 298 HIS B HE2  1  
ATOM 8776   N N    . GLY B 2 299 ? -0.201  16.570  -2.928  1.00 63.41 ? 299 GLY B N    1  
ATOM 8777   C CA   . GLY B 2 299 ? 0.610   17.615  -3.549  1.00 24.14 ? 299 GLY B CA   1  
ATOM 8778   C C    . GLY B 2 299 ? 0.984   17.267  -4.978  1.00 52.11 ? 299 GLY B C    1  
ATOM 8779   O O    . GLY B 2 299 ? 0.671   16.160  -5.452  1.00 31.53 ? 299 GLY B O    1  
ATOM 8780   H H    . GLY B 2 299 ? 0.025   15.632  -3.103  1.00 72.35 ? 299 GLY B H    1  
ATOM 8781   H HA2  . GLY B 2 299 ? 0.062   18.556  -3.551  1.00 22.14 ? 299 GLY B HA2  1  
ATOM 8782   H HA3  . GLY B 2 299 ? 1.517   17.740  -2.977  1.00 4.42  ? 299 GLY B HA3  1  
ATOM 8783   N N    . ASN B 2 300 ? 1.653   18.231  -5.655  1.00 65.15 ? 300 ASN B N    1  
ATOM 8784   C CA   . ASN B 2 300 ? 2.006   18.160  -7.098  1.00 24.44 ? 300 ASN B CA   1  
ATOM 8785   C C    . ASN B 2 300 ? 0.698   18.096  -7.937  1.00 63.15 ? 300 ASN B C    1  
ATOM 8786   O O    . ASN B 2 300 ? 0.637   17.503  -9.026  1.00 72.23 ? 300 ASN B O    1  
ATOM 8787   C CB   . ASN B 2 300 ? 2.987   16.971  -7.352  1.00 42.52 ? 300 ASN B CB   1  
ATOM 8788   C CG   . ASN B 2 300 ? 3.731   17.024  -8.703  1.00 52.53 ? 300 ASN B CG   1  
ATOM 8789   O OD1  . ASN B 2 300 ? 3.255   16.516  -9.707  1.00 34.31 ? 300 ASN B OD1  1  
ATOM 8790   N ND2  . ASN B 2 300 ? 4.915   17.622  -8.717  1.00 72.15 ? 300 ASN B ND2  1  
ATOM 8791   H H    . ASN B 2 300 ? 1.915   19.034  -5.159  1.00 32.52 ? 300 ASN B H    1  
ATOM 8792   H HA   . ASN B 2 300 ? 2.508   19.088  -7.341  1.00 50.33 ? 300 ASN B HA   1  
ATOM 8793   H HB2  . ASN B 2 300 ? 3.728   16.963  -6.561  1.00 13.41 ? 300 ASN B HB2  1  
ATOM 8794   H HB3  . ASN B 2 300 ? 2.432   16.040  -7.299  1.00 32.33 ? 300 ASN B HB3  1  
ATOM 8795   H HD21 . ASN B 2 300 ? 5.250   18.001  -7.873  1.00 71.54 ? 300 ASN B HD21 1  
ATOM 8796   H HD22 . ASN B 2 300 ? 5.417   17.639  -9.557  1.00 33.41 ? 300 ASN B HD22 1  
ATOM 8797   N N    . ILE B 2 301 ? -0.330  18.790  -7.382  1.00 72.24 ? 301 ILE B N    1  
ATOM 8798   C CA   . ILE B 2 301 ? -1.723  18.803  -7.882  1.00 55.25 ? 301 ILE B CA   1  
ATOM 8799   C C    . ILE B 2 301 ? -1.860  19.498  -9.256  1.00 21.03 ? 301 ILE B C    1  
ATOM 8800   O O    . ILE B 2 301 ? -1.009  20.306  -9.623  1.00 42.23 ? 301 ILE B O    1  
ATOM 8801   C CB   . ILE B 2 301 ? -2.719  19.427  -6.802  1.00 44.30 ? 301 ILE B CB   1  
ATOM 8802   C CG1  . ILE B 2 301 ? -2.151  20.724  -6.096  1.00 12.24 ? 301 ILE B CG1  1  
ATOM 8803   C CG2  . ILE B 2 301 ? -3.072  18.367  -5.723  1.00 1.12  ? 301 ILE B CG2  1  
ATOM 8804   C CD1  . ILE B 2 301 ? -1.928  21.953  -6.973  1.00 22.43 ? 301 ILE B CD1  1  
ATOM 8805   H H    . ILE B 2 301 ? -0.127  19.325  -6.588  1.00 12.41 ? 301 ILE B H    1  
ATOM 8806   H HA   . ILE B 2 301 ? -2.008  17.763  -8.023  1.00 72.55 ? 301 ILE B HA   1  
ATOM 8807   H HB   . ILE B 2 301 ? -3.647  19.683  -7.309  1.00 22.32 ? 301 ILE B HB   1  
ATOM 8808   H HG12 . ILE B 2 301 ? -2.837  21.028  -5.313  1.00 12.52 ? 301 ILE B HG12 1  
ATOM 8809   H HG13 . ILE B 2 301 ? -1.202  20.480  -5.638  1.00 4.44  ? 301 ILE B HG13 1  
ATOM 8810   H HG21 . ILE B 2 301 ? -2.172  18.056  -5.209  1.00 53.23 ? 301 ILE B HG21 1  
ATOM 8811   H HG22 . ILE B 2 301 ? -3.528  17.505  -6.193  1.00 72.33 ? 301 ILE B HG22 1  
ATOM 8812   H HG23 . ILE B 2 301 ? -3.770  18.786  -5.005  1.00 75.13 ? 301 ILE B HG23 1  
ATOM 8813   H HD11 . ILE B 2 301 ? -1.598  22.776  -6.354  1.00 23.00 ? 301 ILE B HD11 1  
ATOM 8814   H HD12 . ILE B 2 301 ? -2.850  22.226  -7.468  1.00 4.44  ? 301 ILE B HD12 1  
ATOM 8815   H HD13 . ILE B 2 301 ? -1.170  21.738  -7.712  1.00 11.21 ? 301 ILE B HD13 1  
ATOM 8816   N N    . ASP B 2 302 ? -2.983  19.189  -9.958  1.00 63.41 ? 302 ASP B N    1  
ATOM 8817   C CA   . ASP B 2 302 ? -3.248  19.526  -11.393 1.00 32.24 ? 302 ASP B CA   1  
ATOM 8818   C C    . ASP B 2 302 ? -1.971  19.493  -12.273 1.00 42.32 ? 302 ASP B C    1  
ATOM 8819   O O    . ASP B 2 302 ? -1.624  18.426  -12.792 1.00 25.11 ? 302 ASP B O    1  
ATOM 8820   C CB   . ASP B 2 302 ? -4.135  20.811  -11.610 1.00 4.21  ? 302 ASP B CB   1  
ATOM 8821   C CG   . ASP B 2 302 ? -3.636  22.099  -10.939 1.00 5.23  ? 302 ASP B CG   1  
ATOM 8822   O OD1  . ASP B 2 302 ? -3.031  22.959  -11.625 1.00 0.34  ? 302 ASP B OD1  1  
ATOM 8823   O OD2  . ASP B 2 302 ? -3.858  22.263  -9.721  1.00 54.42 ? 302 ASP B OD2  1  
ATOM 8824   H H    . ASP B 2 302 ? -3.680  18.700  -9.479  1.00 31.43 ? 302 ASP B H    1  
ATOM 8825   H HA   . ASP B 2 302 ? -3.855  18.686  -11.743 1.00 22.40 ? 302 ASP B HA   1  
ATOM 8826   H HB2  . ASP B 2 302 ? -4.220  20.998  -12.676 1.00 1.01  ? 302 ASP B HB2  1  
ATOM 8827   H HB3  . ASP B 2 302 ? -5.136  20.606  -11.235 1.00 74.32 ? 302 ASP B HB3  1  
ATOM 8828   N N    . LYS B 2 303 ? -1.239  20.624  -12.384 1.00 32.33 ? 303 LYS B N    1  
ATOM 8829   C CA   . LYS B 2 303 ? -0.005  20.705  -13.196 1.00 52.21 ? 303 LYS B CA   1  
ATOM 8830   C C    . LYS B 2 303 ? -0.305  20.251  -14.663 1.00 30.05 ? 303 LYS B C    1  
ATOM 8831   O O    . LYS B 2 303 ? 0.085   19.148  -15.085 1.00 52.13 ? 303 LYS B O    1  
ATOM 8832   C CB   . LYS B 2 303 ? 1.120   19.861  -12.506 1.00 73.45 ? 303 LYS B CB   1  
ATOM 8833   C CG   . LYS B 2 303 ? 2.458   19.736  -13.275 1.00 74.11 ? 303 LYS B CG   1  
ATOM 8834   C CD   . LYS B 2 303 ? 3.385   18.617  -12.718 1.00 51.33 ? 303 LYS B CD   1  
ATOM 8835   C CE   . LYS B 2 303 ? 2.807   17.182  -12.868 1.00 72.24 ? 303 LYS B CE   1  
ATOM 8836   N NZ   . LYS B 2 303 ? 1.683   16.901  -11.923 1.00 72.54 ? 303 LYS B NZ   1  
ATOM 8837   H H    . LYS B 2 303 ? -1.527  21.414  -11.899 1.00 61.42 ? 303 LYS B H    1  
ATOM 8838   H HA   . LYS B 2 303 ? 0.297   21.748  -13.215 1.00 32.42 ? 303 LYS B HA   1  
ATOM 8839   H HB2  . LYS B 2 303 ? 1.330   20.307  -11.540 1.00 24.40 ? 303 LYS B HB2  1  
ATOM 8840   H HB3  . LYS B 2 303 ? 0.733   18.860  -12.333 1.00 45.33 ? 303 LYS B HB3  1  
ATOM 8841   H HG2  . LYS B 2 303 ? 2.240   19.517  -14.315 1.00 11.21 ? 303 LYS B HG2  1  
ATOM 8842   H HG3  . LYS B 2 303 ? 2.982   20.687  -13.222 1.00 62.42 ? 303 LYS B HG3  1  
ATOM 8843   H HD2  . LYS B 2 303 ? 4.331   18.658  -13.246 1.00 32.15 ? 303 LYS B HD2  1  
ATOM 8844   H HD3  . LYS B 2 303 ? 3.571   18.805  -11.664 1.00 30.43 ? 303 LYS B HD3  1  
ATOM 8845   H HE2  . LYS B 2 303 ? 2.442   17.057  -13.879 1.00 34.30 ? 303 LYS B HE2  1  
ATOM 8846   H HE3  . LYS B 2 303 ? 3.599   16.462  -12.690 1.00 51.22 ? 303 LYS B HE3  1  
ATOM 8847   H HZ1  . LYS B 2 303 ? 0.834   17.425  -12.213 1.00 11.12 ? 303 LYS B HZ1  1  
ATOM 8848   H HZ2  . LYS B 2 303 ? 1.940   17.192  -10.958 1.00 4.13  ? 303 LYS B HZ2  1  
ATOM 8849   H HZ3  . LYS B 2 303 ? 1.461   15.884  -11.918 1.00 44.22 ? 303 LYS B HZ3  1  
ATOM 8850   N N    . PRO B 2 304 ? -1.063  21.080  -15.454 1.00 14.01 ? 304 PRO B N    1  
ATOM 8851   C CA   . PRO B 2 304 ? -1.448  20.744  -16.846 1.00 52.34 ? 304 PRO B CA   1  
ATOM 8852   C C    . PRO B 2 304 ? -0.331  21.107  -17.857 1.00 33.31 ? 304 PRO B C    1  
ATOM 8853   O O    . PRO B 2 304 ? -0.605  21.497  -19.001 1.00 3.32  ? 304 PRO B O    1  
ATOM 8854   C CB   . PRO B 2 304 ? -2.725  21.597  -17.034 1.00 75.12 ? 304 PRO B CB   1  
ATOM 8855   C CG   . PRO B 2 304 ? -2.462  22.841  -16.243 1.00 60.52 ? 304 PRO B CG   1  
ATOM 8856   C CD   . PRO B 2 304 ? -1.615  22.408  -15.055 1.00 51.43 ? 304 PRO B CD   1  
ATOM 8857   H HA   . PRO B 2 304 ? -1.692  19.694  -16.953 1.00 44.02 ? 304 PRO B HA   1  
ATOM 8858   H HB2  . PRO B 2 304 ? -2.887  21.822  -18.086 1.00 23.21 ? 304 PRO B HB2  1  
ATOM 8859   H HB3  . PRO B 2 304 ? -3.589  21.076  -16.633 1.00 44.12 ? 304 PRO B HB3  1  
ATOM 8860   H HG2  . PRO B 2 304 ? -1.924  23.560  -16.858 1.00 20.21 ? 304 PRO B HG2  1  
ATOM 8861   H HG3  . PRO B 2 304 ? -3.395  23.272  -15.901 1.00 43.12 ? 304 PRO B HG3  1  
ATOM 8862   H HD2  . PRO B 2 304 ? -0.816  23.117  -14.875 1.00 15.31 ? 304 PRO B HD2  1  
ATOM 8863   H HD3  . PRO B 2 304 ? -2.228  22.308  -14.166 1.00 72.11 ? 304 PRO B HD3  1  
ATOM 8864   N N    . ALA B 2 305 ? 0.929   20.929  -17.413 1.00 20.33 ? 305 ALA B N    1  
ATOM 8865   C CA   . ALA B 2 305 ? 2.142   21.243  -18.187 1.00 41.04 ? 305 ALA B CA   1  
ATOM 8866   C C    . ALA B 2 305 ? 2.404   20.209  -19.296 1.00 42.33 ? 305 ALA B C    1  
ATOM 8867   O O    . ALA B 2 305 ? 3.264   20.422  -20.159 1.00 40.00 ? 305 ALA B O    1  
ATOM 8868   C CB   . ALA B 2 305 ? 3.349   21.317  -17.237 1.00 1.22  ? 305 ALA B CB   1  
ATOM 8869   H H    . ALA B 2 305 ? 1.050   20.560  -16.522 1.00 15.24 ? 305 ALA B H    1  
ATOM 8870   H HA   . ALA B 2 305 ? 2.009   22.218  -18.640 1.00 32.14 ? 305 ALA B HA   1  
ATOM 8871   H HB1  . ALA B 2 305 ? 3.513   20.353  -16.773 1.00 72.13 ? 305 ALA B HB1  1  
ATOM 8872   H HB2  . ALA B 2 305 ? 3.159   22.054  -16.467 1.00 42.02 ? 305 ALA B HB2  1  
ATOM 8873   H HB3  . ALA B 2 305 ? 4.236   21.602  -17.790 1.00 0.22  ? 305 ALA B HB3  1  
ATOM 8874   N N    . VAL B 2 306 ? 1.675   19.084  -19.243 1.00 51.12 ? 306 VAL B N    1  
ATOM 8875   C CA   . VAL B 2 306 ? 1.790   18.003  -20.225 1.00 33.21 ? 306 VAL B CA   1  
ATOM 8876   C C    . VAL B 2 306 ? 1.165   18.459  -21.563 1.00 71.43 ? 306 VAL B C    1  
ATOM 8877   O O    . VAL B 2 306 ? -0.062  18.424  -21.745 1.00 23.44 ? 306 VAL B O    1  
ATOM 8878   C CB   . VAL B 2 306 ? 1.114   16.689  -19.681 1.00 50.12 ? 306 VAL B CB   1  
ATOM 8879   C CG1  . VAL B 2 306 ? 1.321   15.494  -20.642 1.00 72.33 ? 306 VAL B CG1  1  
ATOM 8880   C CG2  . VAL B 2 306 ? 1.631   16.366  -18.254 1.00 1.11  ? 306 VAL B CG2  1  
ATOM 8881   H H    . VAL B 2 306 ? 1.025   18.984  -18.521 1.00 55.13 ? 306 VAL B H    1  
ATOM 8882   H HA   . VAL B 2 306 ? 2.851   17.801  -20.378 1.00 61.33 ? 306 VAL B HA   1  
ATOM 8883   H HB   . VAL B 2 306 ? 0.043   16.871  -19.611 1.00 70.21 ? 306 VAL B HB   1  
ATOM 8884   H HG11 . VAL B 2 306 ? 0.822   14.617  -20.250 1.00 41.22 ? 306 VAL B HG11 1  
ATOM 8885   H HG12 . VAL B 2 306 ? 2.377   15.285  -20.752 1.00 62.02 ? 306 VAL B HG12 1  
ATOM 8886   H HG13 . VAL B 2 306 ? 0.904   15.733  -21.613 1.00 32.02 ? 306 VAL B HG13 1  
ATOM 8887   H HG21 . VAL B 2 306 ? 2.699   16.186  -18.276 1.00 52.23 ? 306 VAL B HG21 1  
ATOM 8888   H HG22 . VAL B 2 306 ? 1.131   15.488  -17.874 1.00 64.44 ? 306 VAL B HG22 1  
ATOM 8889   H HG23 . VAL B 2 306 ? 1.425   17.200  -17.595 1.00 14.51 ? 306 VAL B HG23 1  
ATOM 8890   N N    . THR B 2 307 ? 2.038   18.963  -22.452 1.00 74.13 ? 307 THR B N    1  
ATOM 8891   C CA   . THR B 2 307 ? 1.660   19.492  -23.768 1.00 51.25 ? 307 THR B CA   1  
ATOM 8892   C C    . THR B 2 307 ? 1.200   18.356  -24.699 1.00 22.35 ? 307 THR B C    1  
ATOM 8893   O O    . THR B 2 307 ? 0.053   18.354  -25.169 1.00 54.30 ? 307 THR B O    1  
ATOM 8894   C CB   . THR B 2 307 ? 2.860   20.275  -24.401 1.00 74.23 ? 307 THR B CB   1  
ATOM 8895   O OG1  . THR B 2 307 ? 4.051   19.469  -24.337 1.00 63.43 ? 307 THR B OG1  1  
ATOM 8896   C CG2  . THR B 2 307 ? 3.114   21.608  -23.675 1.00 45.12 ? 307 THR B CG2  1  
ATOM 8897   H H    . THR B 2 307 ? 2.988   18.985  -22.206 1.00 52.21 ? 307 THR B H    1  
ATOM 8898   H HA   . THR B 2 307 ? 0.838   20.187  -23.628 1.00 3.42  ? 307 THR B HA   1  
ATOM 8899   H HB   . THR B 2 307 ? 2.636   20.487  -25.445 1.00 71.14 ? 307 THR B HB   1  
ATOM 8900   H HG1  . THR B 2 307 ? 4.682   19.775  -24.997 1.00 1.14  ? 307 THR B HG1  1  
ATOM 8901   H HG21 . THR B 2 307 ? 3.326   21.422  -22.630 1.00 33.25 ? 307 THR B HG21 1  
ATOM 8902   H HG22 . THR B 2 307 ? 2.235   22.239  -23.754 1.00 62.52 ? 307 THR B HG22 1  
ATOM 8903   H HG23 . THR B 2 307 ? 3.956   22.115  -24.124 1.00 61.14 ? 307 THR B HG23 1  
ATOM 8904   N N    . CYS B 2 308 ? 2.100   17.385  -24.945 1.00 14.54 ? 308 CYS B N    1  
ATOM 8905   C CA   . CYS B 2 308 ? 1.801   16.211  -25.776 1.00 65.25 ? 308 CYS B CA   1  
ATOM 8906   C C    . CYS B 2 308 ? 1.047   15.154  -24.948 1.00 74.22 ? 308 CYS B C    1  
ATOM 8907   O O    . CYS B 2 308 ? 1.568   14.682  -23.935 1.00 15.11 ? 308 CYS B O    1  
ATOM 8908   C CB   . CYS B 2 308 ? 3.092   15.606  -26.353 1.00 34.44 ? 308 CYS B CB   1  
ATOM 8909   S SG   . CYS B 2 308 ? 2.809   14.179  -27.424 1.00 3.21  ? 308 CYS B SG   1  
ATOM 8910   H H    . CYS B 2 308 ? 2.991   17.462  -24.550 1.00 3.12  ? 308 CYS B H    1  
ATOM 8911   H HA   . CYS B 2 308 ? 1.169   16.534  -26.604 1.00 35.23 ? 308 CYS B HA   1  
ATOM 8912   H HB2  . CYS B 2 308 ? 3.611   16.355  -26.940 1.00 1.01  ? 308 CYS B HB2  1  
ATOM 8913   H HB3  . CYS B 2 308 ? 3.739   15.287  -25.545 1.00 53.40 ? 308 CYS B HB3  1  
ATOM 8914   H HG   . CYS B 2 308 ? 2.454   14.621  -28.618 1.00 33.01 ? 308 CYS B HG   1  
ATOM 8915   N N    . THR B 2 309 ? -0.181  14.828  -25.401 1.00 23.14 ? 309 THR B N    1  
ATOM 8916   C CA   . THR B 2 309 ? -1.077  13.805  -24.811 1.00 72.03 ? 309 THR B CA   1  
ATOM 8917   C C    . THR B 2 309 ? -2.462  13.732  -25.542 1.00 65.04 ? 309 THR B C    1  
ATOM 8918   O O    . THR B 2 309 ? -2.986  12.618  -25.672 1.00 72.20 ? 309 THR B O    1  
ATOM 8919   C CB   . THR B 2 309 ? -1.293  13.918  -23.238 1.00 23.22 ? 309 THR B CB   1  
ATOM 8920   O OG1  . THR B 2 309 ? -2.054  12.791  -22.756 1.00 11.15 ? 309 THR B OG1  1  
ATOM 8921   C CG2  . THR B 2 309 ? -1.973  15.230  -22.783 1.00 63.32 ? 309 THR B CG2  1  
ATOM 8922   H H    . THR B 2 309 ? -0.495  15.291  -26.197 1.00 24.25 ? 309 THR B H    1  
ATOM 8923   H HA   . THR B 2 309 ? -0.575  12.853  -24.994 1.00 3.32  ? 309 THR B HA   1  
ATOM 8924   H HB   . THR B 2 309 ? -0.308  13.872  -22.781 1.00 50.55 ? 309 THR B HB   1  
ATOM 8925   H HG1  . THR B 2 309 ? -2.315  12.236  -23.500 1.00 35.23 ? 309 THR B HG1  1  
ATOM 8926   H HG21 . THR B 2 309 ? -2.955  15.306  -23.221 1.00 40.44 ? 309 THR B HG21 1  
ATOM 8927   H HG22 . THR B 2 309 ? -1.373  16.082  -23.094 1.00 43.35 ? 309 THR B HG22 1  
ATOM 8928   H HG23 . THR B 2 309 ? -2.061  15.232  -21.707 1.00 43.34 ? 309 THR B HG23 1  
ATOM 8929   N N    . PRO B 2 310 ? -3.119  14.872  -26.044 1.00 44.51 ? 310 PRO B N    1  
ATOM 8930   C CA   . PRO B 2 310 ? -4.447  14.785  -26.698 1.00 33.52 ? 310 PRO B CA   1  
ATOM 8931   C C    . PRO B 2 310 ? -4.355  14.686  -28.241 1.00 52.14 ? 310 PRO B C    1  
ATOM 8932   O O    . PRO B 2 310 ? -5.330  14.973  -28.946 1.00 11.32 ? 310 PRO B O    1  
ATOM 8933   C CB   . PRO B 2 310 ? -5.094  16.111  -26.239 1.00 63.14 ? 310 PRO B CB   1  
ATOM 8934   C CG   . PRO B 2 310 ? -3.966  17.108  -26.229 1.00 40.13 ? 310 PRO B CG   1  
ATOM 8935   C CD   . PRO B 2 310 ? -2.680  16.306  -26.025 1.00 60.03 ? 310 PRO B CD   1  
ATOM 8936   H HA   . PRO B 2 310 ? -5.024  13.952  -26.326 1.00 64.44 ? 310 PRO B HA   1  
ATOM 8937   H HB2  . PRO B 2 310 ? -5.883  16.414  -26.934 1.00 15.31 ? 310 PRO B HB2  1  
ATOM 8938   H HB3  . PRO B 2 310 ? -5.508  16.005  -25.244 1.00 23.01 ? 310 PRO B HB3  1  
ATOM 8939   H HG2  . PRO B 2 310 ? -3.932  17.634  -27.181 1.00 4.20  ? 310 PRO B HG2  1  
ATOM 8940   H HG3  . PRO B 2 310 ? -4.097  17.813  -25.421 1.00 64.34 ? 310 PRO B HG3  1  
ATOM 8941   H HD2  . PRO B 2 310 ? -1.973  16.486  -26.828 1.00 43.33 ? 310 PRO B HD2  1  
ATOM 8942   H HD3  . PRO B 2 310 ? -2.218  16.549  -25.073 1.00 13.22 ? 310 PRO B HD3  1  
ATOM 8943   N N    . ASN B 2 311 ? -3.183  14.259  -28.741 1.00 4.02  ? 311 ASN B N    1  
ATOM 8944   C CA   . ASN B 2 311 ? -2.913  14.112  -30.183 1.00 13.13 ? 311 ASN B CA   1  
ATOM 8945   C C    . ASN B 2 311 ? -3.123  12.633  -30.606 1.00 32.21 ? 311 ASN B C    1  
ATOM 8946   O O    . ASN B 2 311 ? -2.316  11.770  -30.227 1.00 73.13 ? 311 ASN B O    1  
ATOM 8947   C CB   . ASN B 2 311 ? -1.460  14.561  -30.502 1.00 41.02 ? 311 ASN B CB   1  
ATOM 8948   C CG   . ASN B 2 311 ? -1.123  14.475  -31.993 1.00 64.35 ? 311 ASN B CG   1  
ATOM 8949   O OD1  . ASN B 2 311 ? -1.246  15.449  -32.736 1.00 72.00 ? 311 ASN B OD1  1  
ATOM 8950   N ND2  . ASN B 2 311 ? -0.729  13.299  -32.445 1.00 2.12  ? 311 ASN B ND2  1  
ATOM 8951   H H    . ASN B 2 311 ? -2.472  14.021  -28.113 1.00 32.44 ? 311 ASN B H    1  
ATOM 8952   H HA   . ASN B 2 311 ? -3.605  14.750  -30.731 1.00 51.54 ? 311 ASN B HA   1  
ATOM 8953   H HB2  . ASN B 2 311 ? -1.330  15.588  -30.182 1.00 5.14  ? 311 ASN B HB2  1  
ATOM 8954   H HB3  . ASN B 2 311 ? -0.762  13.936  -29.955 1.00 64.55 ? 311 ASN B HB3  1  
ATOM 8955   H HD21 . ASN B 2 311 ? -0.662  12.555  -31.808 1.00 32.31 ? 311 ASN B HD21 1  
ATOM 8956   H HD22 . ASN B 2 311 ? -0.532  13.215  -33.394 1.00 51.25 ? 311 ASN B HD22 1  
ATOM 8957   N N    . PRO B 2 312 ? -4.198  12.314  -31.396 1.00 52.21 ? 312 PRO B N    1  
ATOM 8958   C CA   . PRO B 2 312 ? -4.443  10.951  -31.903 1.00 70.14 ? 312 PRO B CA   1  
ATOM 8959   C C    . PRO B 2 312 ? -3.701  10.688  -33.246 1.00 55.44 ? 312 PRO B C    1  
ATOM 8960   O O    . PRO B 2 312 ? -4.293  10.808  -34.331 1.00 70.01 ? 312 PRO B O    1  
ATOM 8961   C CB   . PRO B 2 312 ? -5.985  10.942  -32.045 1.00 41.32 ? 312 PRO B CB   1  
ATOM 8962   C CG   . PRO B 2 312 ? -6.352  12.352  -32.422 1.00 5.24  ? 312 PRO B CG   1  
ATOM 8963   C CD   . PRO B 2 312 ? -5.271  13.253  -31.836 1.00 12.30 ? 312 PRO B CD   1  
ATOM 8964   H HA   . PRO B 2 312 ? -4.142  10.196  -31.180 1.00 62.14 ? 312 PRO B HA   1  
ATOM 8965   H HB2  . PRO B 2 312 ? -6.292  10.237  -32.814 1.00 23.21 ? 312 PRO B HB2  1  
ATOM 8966   H HB3  . PRO B 2 312 ? -6.448  10.679  -31.100 1.00 12.34 ? 312 PRO B HB3  1  
ATOM 8967   H HG2  . PRO B 2 312 ? -6.379  12.447  -33.507 1.00 10.23 ? 312 PRO B HG2  1  
ATOM 8968   H HG3  . PRO B 2 312 ? -7.319  12.610  -32.007 1.00 62.44 ? 312 PRO B HG3  1  
ATOM 8969   H HD2  . PRO B 2 312 ? -4.888  13.939  -32.583 1.00 53.54 ? 312 PRO B HD2  1  
ATOM 8970   H HD3  . PRO B 2 312 ? -5.657  13.809  -30.988 1.00 14.12 ? 312 PRO B HD3  1  
ATOM 8971   N N    . GLN B 2 313 ? -2.385  10.374  -33.135 1.00 12.13 ? 313 GLN B N    1  
ATOM 8972   C CA   . GLN B 2 313 ? -1.468  10.091  -34.278 1.00 54.01 ? 313 GLN B CA   1  
ATOM 8973   C C    . GLN B 2 313 ? -1.166  11.370  -35.091 1.00 51.01 ? 313 GLN B C    1  
ATOM 8974   O O    . GLN B 2 313 ? -2.069  12.170  -35.382 1.00 75.13 ? 313 GLN B O    1  
ATOM 8975   C CB   . GLN B 2 313 ? -2.019  8.944   -35.196 1.00 44.31 ? 313 GLN B CB   1  
ATOM 8976   C CG   . GLN B 2 313 ? -1.038  8.377   -36.264 1.00 31.31 ? 313 GLN B CG   1  
ATOM 8977   C CD   . GLN B 2 313 ? -0.813  9.248   -37.504 1.00 25.54 ? 313 GLN B CD   1  
ATOM 8978   O OE1  . GLN B 2 313 ? -1.703  9.974   -37.934 1.00 74.41 ? 313 GLN B OE1  1  
ATOM 8979   N NE2  . GLN B 2 313 ? 0.384   9.195   -38.065 1.00 15.22 ? 313 GLN B NE2  1  
ATOM 8980   H H    . GLN B 2 313 ? -2.010  10.330  -32.232 1.00 1.42  ? 313 GLN B H    1  
ATOM 8981   H HA   . GLN B 2 313 ? -0.538  9.751   -33.833 1.00 33.54 ? 313 GLN B HA   1  
ATOM 8982   H HB2  . GLN B 2 313 ? -2.322  8.121   -34.559 1.00 22.42 ? 313 GLN B HB2  1  
ATOM 8983   H HB3  . GLN B 2 313 ? -2.902  9.310   -35.712 1.00 65.43 ? 313 GLN B HB3  1  
ATOM 8984   H HG2  . GLN B 2 313 ? -0.079  8.216   -35.788 1.00 65.52 ? 313 GLN B HG2  1  
ATOM 8985   H HG3  . GLN B 2 313 ? -1.419  7.418   -36.596 1.00 32.41 ? 313 GLN B HG3  1  
ATOM 8986   H HE21 . GLN B 2 313 ? 1.057   8.608   -37.660 1.00 43.41 ? 313 GLN B HE21 1  
ATOM 8987   H HE22 . GLN B 2 313 ? 0.556   9.759   -38.846 1.00 4.21  ? 313 GLN B HE22 1  
ATOM 8988   N N    . ARG B 2 314 ? 0.110   11.527  -35.487 1.00 1.05  ? 314 ARG B N    1  
ATOM 8989   C CA   . ARG B 2 314 ? 0.576   12.669  -36.288 1.00 24.43 ? 314 ARG B CA   1  
ATOM 8990   C C    . ARG B 2 314 ? 1.818   12.274  -37.114 1.00 31.04 ? 314 ARG B C    1  
ATOM 8991   O O    . ARG B 2 314 ? 1.700   11.959  -38.299 1.00 70.34 ? 314 ARG B O    1  
ATOM 8992   C CB   . ARG B 2 314 ? 0.854   13.874  -35.357 1.00 1.22  ? 314 ARG B CB   1  
ATOM 8993   C CG   . ARG B 2 314 ? 1.387   15.133  -36.055 1.00 72.01 ? 314 ARG B CG   1  
ATOM 8994   C CD   . ARG B 2 314 ? 1.432   16.334  -35.110 1.00 1.23  ? 314 ARG B CD   1  
ATOM 8995   N NE   . ARG B 2 314 ? 2.251   16.067  -33.918 1.00 12.54 ? 314 ARG B NE   1  
ATOM 8996   C CZ   . ARG B 2 314 ? 2.617   16.981  -33.019 1.00 32.22 ? 314 ARG B CZ   1  
ATOM 8997   N NH1  . ARG B 2 314 ? 2.259   18.256  -33.153 1.00 23.41 ? 314 ARG B NH1  1  
ATOM 8998   N NH2  . ARG B 2 314 ? 3.330   16.598  -31.977 1.00 55.20 ? 314 ARG B NH2  1  
ATOM 8999   H H    . ARG B 2 314 ? 0.763   10.842  -35.234 1.00 25.41 ? 314 ARG B H    1  
ATOM 9000   H HA   . ARG B 2 314 ? -0.221  12.938  -36.981 1.00 73.24 ? 314 ARG B HA   1  
ATOM 9001   H HB2  . ARG B 2 314 ? -0.072  14.133  -34.852 1.00 3.13  ? 314 ARG B HB2  1  
ATOM 9002   H HB3  . ARG B 2 314 ? 1.577   13.572  -34.604 1.00 31.21 ? 314 ARG B HB3  1  
ATOM 9003   H HG2  . ARG B 2 314 ? 2.390   14.935  -36.420 1.00 74.53 ? 314 ARG B HG2  1  
ATOM 9004   H HG3  . ARG B 2 314 ? 0.747   15.367  -36.896 1.00 41.31 ? 314 ARG B HG3  1  
ATOM 9005   H HD2  . ARG B 2 314 ? 1.845   17.183  -35.647 1.00 12.32 ? 314 ARG B HD2  1  
ATOM 9006   H HD3  . ARG B 2 314 ? 0.421   16.572  -34.796 1.00 3.23  ? 314 ARG B HD3  1  
ATOM 9007   H HE   . ARG B 2 314 ? 2.557   15.138  -33.787 1.00 63.04 ? 314 ARG B HE   1  
ATOM 9008   H HH11 . ARG B 2 314 ? 1.699   18.546  -33.935 1.00 65.14 ? 314 ARG B HH11 1  
ATOM 9009   H HH12 . ARG B 2 314 ? 2.539   18.932  -32.469 1.00 50.14 ? 314 ARG B HH12 1  
ATOM 9010   H HH21 . ARG B 2 314 ? 3.590   15.629  -31.876 1.00 53.44 ? 314 ARG B HH21 1  
ATOM 9011   H HH22 . ARG B 2 314 ? 3.621   17.265  -31.290 1.00 25.30 ? 314 ARG B HH22 1  
ATOM 9012   N N    . ASN B 2 315 ? 2.993   12.247  -36.465 1.00 24.34 ? 315 ASN B N    1  
ATOM 9013   C CA   . ASN B 2 315 ? 4.289   11.979  -37.120 1.00 53.42 ? 315 ASN B CA   1  
ATOM 9014   C C    . ASN B 2 315 ? 4.834   10.625  -36.634 1.00 5.23  ? 315 ASN B C    1  
ATOM 9015   O O    . ASN B 2 315 ? 5.734   10.543  -35.790 1.00 72.12 ? 315 ASN B O    1  
ATOM 9016   C CB   . ASN B 2 315 ? 5.283   13.163  -36.884 1.00 43.51 ? 315 ASN B CB   1  
ATOM 9017   C CG   . ASN B 2 315 ? 5.314   13.677  -35.436 1.00 23.33 ? 315 ASN B CG   1  
ATOM 9018   O OD1  . ASN B 2 315 ? 4.572   14.588  -35.080 1.00 22.13 ? 315 ASN B OD1  1  
ATOM 9019   N ND2  . ASN B 2 315 ? 6.165   13.105  -34.602 1.00 0.44  ? 315 ASN B ND2  1  
ATOM 9020   H H    . ASN B 2 315 ? 2.992   12.396  -35.496 1.00 74.45 ? 315 ASN B H    1  
ATOM 9021   H HA   . ASN B 2 315 ? 4.113   11.894  -38.193 1.00 75.34 ? 315 ASN B HA   1  
ATOM 9022   H HB2  . ASN B 2 315 ? 6.285   12.851  -37.160 1.00 51.21 ? 315 ASN B HB2  1  
ATOM 9023   H HB3  . ASN B 2 315 ? 4.996   13.987  -37.525 1.00 14.43 ? 315 ASN B HB3  1  
ATOM 9024   H HD21 . ASN B 2 315 ? 6.738   12.385  -34.945 1.00 64.23 ? 315 ASN B HD21 1  
ATOM 9025   H HD22 . ASN B 2 315 ? 6.177   13.411  -33.673 1.00 65.41 ? 315 ASN B HD22 1  
ATOM 9026   N N    . ASP B 2 316 ? 4.224   9.557   -37.165 1.00 62.14 ? 316 ASP B N    1  
ATOM 9027   C CA   . ASP B 2 316 ? 4.477   8.161   -36.753 1.00 74.40 ? 316 ASP B CA   1  
ATOM 9028   C C    . ASP B 2 316 ? 5.186   7.376   -37.867 1.00 64.34 ? 316 ASP B C    1  
ATOM 9029   O O    . ASP B 2 316 ? 5.499   7.926   -38.937 1.00 5.33  ? 316 ASP B O    1  
ATOM 9030   C CB   . ASP B 2 316 ? 3.124   7.493   -36.397 1.00 74.31 ? 316 ASP B CB   1  
ATOM 9031   C CG   . ASP B 2 316 ? 2.495   8.076   -35.129 1.00 24.21 ? 316 ASP B CG   1  
ATOM 9032   O OD1  . ASP B 2 316 ? 2.023   9.235   -35.160 1.00 61.43 ? 316 ASP B OD1  1  
ATOM 9033   O OD2  . ASP B 2 316 ? 2.492   7.401   -34.096 1.00 4.44  ? 316 ASP B OD2  1  
ATOM 9034   H H    . ASP B 2 316 ? 3.561   9.709   -37.871 1.00 2.04  ? 316 ASP B H    1  
ATOM 9035   H HA   . ASP B 2 316 ? 5.115   8.162   -35.878 1.00 1.44  ? 316 ASP B HA   1  
ATOM 9036   H HB2  . ASP B 2 316 ? 2.432   7.642   -37.219 1.00 54.23 ? 316 ASP B HB2  1  
ATOM 9037   H HB3  . ASP B 2 316 ? 3.275   6.424   -36.262 1.00 33.53 ? 316 ASP B HB3  1  
ATOM 9038   N N    . SER B 2 317 ? 5.425   6.083   -37.601 1.00 75.41 ? 317 SER B N    1  
ATOM 9039   C CA   . SER B 2 317 ? 6.107   5.178   -38.538 1.00 3.44  ? 317 SER B CA   1  
ATOM 9040   C C    . SER B 2 317 ? 5.079   4.639   -39.552 1.00 22.15 ? 317 SER B C    1  
ATOM 9041   O O    . SER B 2 317 ? 5.116   4.995   -40.735 1.00 45.53 ? 317 SER B O    1  
ATOM 9042   C CB   . SER B 2 317 ? 6.780   4.024   -37.747 1.00 62.23 ? 317 SER B CB   1  
ATOM 9043   O OG   . SER B 2 317 ? 7.432   4.520   -36.592 1.00 51.32 ? 317 SER B OG   1  
ATOM 9044   H H    . SER B 2 317 ? 5.113   5.718   -36.741 1.00 11.14 ? 317 SER B H    1  
ATOM 9045   H HA   . SER B 2 317 ? 6.871   5.740   -39.067 1.00 71.32 ? 317 SER B HA   1  
ATOM 9046   H HB2  . SER B 2 317 ? 6.029   3.307   -37.425 1.00 12.31 ? 317 SER B HB2  1  
ATOM 9047   H HB3  . SER B 2 317 ? 7.508   3.523   -38.370 1.00 51.44 ? 317 SER B HB3  1  
ATOM 9048   H HG   . SER B 2 317 ? 6.775   4.613   -35.884 1.00 45.25 ? 317 SER B HG   1  
ATOM 9049   N N    . VAL B 2 318 ? 4.141   3.816   -39.036 1.00 0.42  ? 318 VAL B N    1  
ATOM 9050   C CA   . VAL B 2 318 ? 3.067   3.168   -39.814 1.00 72.42 ? 318 VAL B CA   1  
ATOM 9051   C C    . VAL B 2 318 ? 2.243   2.245   -38.871 1.00 73.13 ? 318 VAL B C    1  
ATOM 9052   O O    . VAL B 2 318 ? 2.845   1.541   -38.051 1.00 21.23 ? 318 VAL B O    1  
ATOM 9053   C CB   . VAL B 2 318 ? 3.638   2.323   -41.035 1.00 31.40 ? 318 VAL B CB   1  
ATOM 9054   C CG1  . VAL B 2 318 ? 4.484   1.108   -40.564 1.00 64.10 ? 318 VAL B CG1  1  
ATOM 9055   C CG2  . VAL B 2 318 ? 2.513   1.897   -42.005 1.00 51.51 ? 318 VAL B CG2  1  
ATOM 9056   H H    . VAL B 2 318 ? 4.165   3.648   -38.071 1.00 32.42 ? 318 VAL B H    1  
ATOM 9057   H HA   . VAL B 2 318 ? 2.424   3.957   -40.199 1.00 31.03 ? 318 VAL B HA   1  
ATOM 9058   H HB   . VAL B 2 318 ? 4.311   2.980   -41.589 1.00 1.44  ? 318 VAL B HB   1  
ATOM 9059   H HG11 . VAL B 2 318 ? 3.864   0.432   -39.987 1.00 22.33 ? 318 VAL B HG11 1  
ATOM 9060   H HG12 . VAL B 2 318 ? 5.302   1.455   -39.941 1.00 41.41 ? 318 VAL B HG12 1  
ATOM 9061   H HG13 . VAL B 2 318 ? 4.885   0.583   -41.417 1.00 1.43  ? 318 VAL B HG13 1  
ATOM 9062   H HG21 . VAL B 2 318 ? 2.938   1.388   -42.859 1.00 32.54 ? 318 VAL B HG21 1  
ATOM 9063   H HG22 . VAL B 2 318 ? 1.971   2.772   -42.346 1.00 34.21 ? 318 VAL B HG22 1  
ATOM 9064   H HG23 . VAL B 2 318 ? 1.827   1.230   -41.499 1.00 32.14 ? 318 VAL B HG23 1  
ATOM 9065   N N    . PRO B 2 319 ? 0.868   2.210   -38.956 1.00 62.53 ? 319 PRO B N    1  
ATOM 9066   C CA   . PRO B 2 319 ? 0.037   1.245   -38.172 1.00 24.11 ? 319 PRO B CA   1  
ATOM 9067   C C    . PRO B 2 319 ? 0.105   -0.223  -38.713 1.00 54.12 ? 319 PRO B C    1  
ATOM 9068   O O    . PRO B 2 319 ? -0.918  -0.907  -38.814 1.00 51.15 ? 319 PRO B O    1  
ATOM 9069   C CB   . PRO B 2 319 ? -1.383  1.861   -38.286 1.00 43.43 ? 319 PRO B CB   1  
ATOM 9070   C CG   . PRO B 2 319 ? -1.386  2.612   -39.580 1.00 65.10 ? 319 PRO B CG   1  
ATOM 9071   C CD   . PRO B 2 319 ? 0.021   3.151   -39.748 1.00 4.03  ? 319 PRO B CD   1  
ATOM 9072   H HA   . PRO B 2 319 ? 0.339   1.236   -37.129 1.00 4.01  ? 319 PRO B HA   1  
ATOM 9073   H HB2  . PRO B 2 319 ? -2.142  1.082   -38.281 1.00 43.01 ? 319 PRO B HB2  1  
ATOM 9074   H HB3  . PRO B 2 319 ? -1.560  2.546   -37.463 1.00 55.02 ? 319 PRO B HB3  1  
ATOM 9075   H HG2  . PRO B 2 319 ? -1.642  1.940   -40.398 1.00 51.53 ? 319 PRO B HG2  1  
ATOM 9076   H HG3  . PRO B 2 319 ? -2.095  3.431   -39.540 1.00 33.41 ? 319 PRO B HG3  1  
ATOM 9077   H HD2  . PRO B 2 319 ? 0.310   3.144   -40.794 1.00 1.12  ? 319 PRO B HD2  1  
ATOM 9078   H HD3  . PRO B 2 319 ? 0.094   4.157   -39.351 1.00 2.41  ? 319 PRO B HD3  1  
ATOM 9079   N N    . THR B 2 320 ? 1.328   -0.701  -39.028 1.00 42.33 ? 320 THR B N    1  
ATOM 9080   C CA   . THR B 2 320 ? 1.604   -2.085  -39.474 1.00 44.23 ? 320 THR B CA   1  
ATOM 9081   C C    . THR B 2 320 ? 2.985   -2.516  -38.892 1.00 41.54 ? 320 THR B C    1  
ATOM 9082   O O    . THR B 2 320 ? 3.706   -3.336  -39.465 1.00 53.31 ? 320 THR B O    1  
ATOM 9083   C CB   . THR B 2 320 ? 1.580   -2.175  -41.057 1.00 52.25 ? 320 THR B CB   1  
ATOM 9084   O OG1  . THR B 2 320 ? 0.417   -1.507  -41.560 1.00 3.32  ? 320 THR B OG1  1  
ATOM 9085   C CG2  . THR B 2 320 ? 1.550   -3.623  -41.590 1.00 23.15 ? 320 THR B CG2  1  
ATOM 9086   H H    . THR B 2 320 ? 2.086   -0.103  -38.953 1.00 73.24 ? 320 THR B H    1  
ATOM 9087   H HA   . THR B 2 320 ? 0.838   -2.746  -39.069 1.00 51.53 ? 320 THR B HA   1  
ATOM 9088   H HB   . THR B 2 320 ? 2.462   -1.675  -41.452 1.00 44.42 ? 320 THR B HB   1  
ATOM 9089   H HG1  . THR B 2 320 ? -0.351  -1.766  -41.035 1.00 54.33 ? 320 THR B HG1  1  
ATOM 9090   H HG21 . THR B 2 320 ? 0.662   -4.126  -41.227 1.00 11.30 ? 320 THR B HG21 1  
ATOM 9091   H HG22 . THR B 2 320 ? 2.424   -4.154  -41.246 1.00 21.10 ? 320 THR B HG22 1  
ATOM 9092   H HG23 . THR B 2 320 ? 1.544   -3.617  -42.675 1.00 72.11 ? 320 THR B HG23 1  
ATOM 9093   N N    . LEU B 2 321 ? 3.348   -1.939  -37.726 1.00 65.14 ? 321 LEU B N    1  
ATOM 9094   C CA   . LEU B 2 321 ? 4.592   -2.292  -37.014 1.00 50.11 ? 321 LEU B CA   1  
ATOM 9095   C C    . LEU B 2 321 ? 4.374   -3.553  -36.152 1.00 22.15 ? 321 LEU B C    1  
ATOM 9096   O O    . LEU B 2 321 ? 5.046   -4.571  -36.349 1.00 43.00 ? 321 LEU B O    1  
ATOM 9097   C CB   . LEU B 2 321 ? 5.062   -1.100  -36.141 1.00 61.25 ? 321 LEU B CB   1  
ATOM 9098   C CG   . LEU B 2 321 ? 6.366   -1.313  -35.298 1.00 14.41 ? 321 LEU B CG   1  
ATOM 9099   C CD1  . LEU B 2 321 ? 7.600   -1.568  -36.196 1.00 24.30 ? 321 LEU B CD1  1  
ATOM 9100   C CD2  . LEU B 2 321 ? 6.608   -0.124  -34.337 1.00 41.11 ? 321 LEU B CD2  1  
ATOM 9101   H H    . LEU B 2 321 ? 2.763   -1.255  -37.334 1.00 62.11 ? 321 LEU B H    1  
ATOM 9102   H HA   . LEU B 2 321 ? 5.357   -2.503  -37.755 1.00 45.34 ? 321 LEU B HA   1  
ATOM 9103   H HB2  . LEU B 2 321 ? 5.214   -0.248  -36.792 1.00 73.53 ? 321 LEU B HB2  1  
ATOM 9104   H HB3  . LEU B 2 321 ? 4.256   -0.854  -35.454 1.00 54.21 ? 321 LEU B HB3  1  
ATOM 9105   H HG   . LEU B 2 321 ? 6.235   -2.197  -34.688 1.00 74.43 ? 321 LEU B HG   1  
ATOM 9106   H HD11 . LEU B 2 321 ? 8.473   -1.737  -35.575 1.00 33.02 ? 321 LEU B HD11 1  
ATOM 9107   H HD12 . LEU B 2 321 ? 7.779   -0.714  -36.837 1.00 74.12 ? 321 LEU B HD12 1  
ATOM 9108   H HD13 . LEU B 2 321 ? 7.430   -2.443  -36.808 1.00 40.42 ? 321 LEU B HD13 1  
ATOM 9109   H HD21 . LEU B 2 321 ? 5.768   -0.026  -33.661 1.00 23.50 ? 321 LEU B HD21 1  
ATOM 9110   H HD22 . LEU B 2 321 ? 6.721   0.796   -34.899 1.00 12.11 ? 321 LEU B HD22 1  
ATOM 9111   H HD23 . LEU B 2 321 ? 7.505   -0.301  -33.759 1.00 2.12  ? 321 LEU B HD23 1  
ATOM 9112   N N    . ALA B 2 322 ? 3.417   -3.462  -35.205 1.00 33.04 ? 322 ALA B N    1  
ATOM 9113   C CA   . ALA B 2 322 ? 3.100   -4.545  -34.255 1.00 62.31 ? 322 ALA B CA   1  
ATOM 9114   C C    . ALA B 2 322 ? 2.568   -5.788  -35.001 1.00 64.54 ? 322 ALA B C    1  
ATOM 9115   O O    . ALA B 2 322 ? 1.423   -5.787  -35.474 1.00 2.43  ? 322 ALA B O    1  
ATOM 9116   C CB   . ALA B 2 322 ? 2.098   -4.047  -33.191 1.00 30.22 ? 322 ALA B CB   1  
ATOM 9117   H H    . ALA B 2 322 ? 2.908   -2.634  -35.146 1.00 13.11 ? 322 ALA B H    1  
ATOM 9118   H HA   . ALA B 2 322 ? 4.021   -4.812  -33.743 1.00 24.22 ? 322 ALA B HA   1  
ATOM 9119   H HB1  . ALA B 2 322 ? 1.163   -3.772  -33.661 1.00 64.54 ? 322 ALA B HB1  1  
ATOM 9120   H HB2  . ALA B 2 322 ? 2.507   -3.181  -32.683 1.00 54.52 ? 322 ALA B HB2  1  
ATOM 9121   H HB3  . ALA B 2 322 ? 1.917   -4.829  -32.465 1.00 14.10 ? 322 ALA B HB3  1  
ATOM 9122   N N    . GLN B 2 323 ? 3.467   -6.792  -35.198 1.00 4.10  ? 323 GLN B N    1  
ATOM 9123   C CA   . GLN B 2 323 ? 3.156   -8.105  -35.838 1.00 72.14 ? 323 GLN B CA   1  
ATOM 9124   C C    . GLN B 2 323 ? 2.916   -7.986  -37.381 1.00 63.04 ? 323 GLN B C    1  
ATOM 9125   O O    . GLN B 2 323 ? 2.949   -8.997  -38.095 1.00 41.23 ? 323 GLN B O    1  
ATOM 9126   C CB   . GLN B 2 323 ? 1.953   -8.803  -35.096 1.00 23.31 ? 323 GLN B CB   1  
ATOM 9127   C CG   . GLN B 2 323 ? 1.456   -10.142 -35.685 1.00 74.02 ? 323 GLN B CG   1  
ATOM 9128   C CD   . GLN B 2 323 ? 2.501   -11.263 -35.742 1.00 53.12 ? 323 GLN B CD   1  
ATOM 9129   O OE1  . GLN B 2 323 ? 3.387   -11.356 -34.893 1.00 3.53  ? 323 GLN B OE1  1  
ATOM 9130   N NE2  . GLN B 2 323 ? 2.409   -12.108 -36.764 1.00 3.03  ? 323 GLN B NE2  1  
ATOM 9131   H H    . GLN B 2 323 ? 4.388   -6.635  -34.907 1.00 1.24  ? 323 GLN B H    1  
ATOM 9132   H HA   . GLN B 2 323 ? 4.041   -8.718  -35.694 1.00 63.00 ? 323 GLN B HA   1  
ATOM 9133   H HB2  . GLN B 2 323 ? 2.244   -8.984  -34.067 1.00 73.52 ? 323 GLN B HB2  1  
ATOM 9134   H HB3  . GLN B 2 323 ? 1.114   -8.114  -35.086 1.00 11.01 ? 323 GLN B HB3  1  
ATOM 9135   H HG2  . GLN B 2 323 ? 0.635   -10.496 -35.080 1.00 11.15 ? 323 GLN B HG2  1  
ATOM 9136   H HG3  . GLN B 2 323 ? 1.089   -9.953  -36.691 1.00 13.31 ? 323 GLN B HG3  1  
ATOM 9137   H HE21 . GLN B 2 323 ? 1.689   -11.967 -37.417 1.00 43.01 ? 323 GLN B HE21 1  
ATOM 9138   H HE22 . GLN B 2 323 ? 3.072   -12.827 -36.832 1.00 63.51 ? 323 GLN B HE22 1  
ATOM 9139   N N    . MET B 2 324 ? 2.757   -6.737  -37.888 1.00 61.03 ? 324 MET B N    1  
ATOM 9140   C CA   . MET B 2 324 ? 2.320   -6.428  -39.272 1.00 23.41 ? 324 MET B CA   1  
ATOM 9141   C C    . MET B 2 324 ? 0.894   -6.956  -39.525 1.00 54.23 ? 324 MET B C    1  
ATOM 9142   O O    . MET B 2 324 ? -0.070  -6.185  -39.538 1.00 54.32 ? 324 MET B O    1  
ATOM 9143   C CB   . MET B 2 324 ? 3.325   -6.943  -40.350 1.00 1.13  ? 324 MET B CB   1  
ATOM 9144   C CG   . MET B 2 324 ? 4.701   -6.277  -40.301 1.00 21.13 ? 324 MET B CG   1  
ATOM 9145   S SD   . MET B 2 324 ? 5.892   -6.991  -41.463 1.00 71.32 ? 324 MET B SD   1  
ATOM 9146   C CE   . MET B 2 324 ? 5.159   -6.625  -43.061 1.00 54.12 ? 324 MET B CE   1  
ATOM 9147   H H    . MET B 2 324 ? 2.948   -5.983  -37.301 1.00 14.25 ? 324 MET B H    1  
ATOM 9148   H HA   . MET B 2 324 ? 2.282   -5.342  -39.339 1.00 24.21 ? 324 MET B HA   1  
ATOM 9149   H HB2  . MET B 2 324 ? 3.465   -8.008  -40.212 1.00 71.51 ? 324 MET B HB2  1  
ATOM 9150   H HB3  . MET B 2 324 ? 2.904   -6.777  -41.337 1.00 74.22 ? 324 MET B HB3  1  
ATOM 9151   H HG2  . MET B 2 324 ? 4.588   -5.223  -40.528 1.00 1.12  ? 324 MET B HG2  1  
ATOM 9152   H HG3  . MET B 2 324 ? 5.099   -6.378  -39.298 1.00 71.24 ? 324 MET B HG3  1  
ATOM 9153   H HE1  . MET B 2 324 ? 5.029   -5.558  -43.163 1.00 30.11 ? 324 MET B HE1  1  
ATOM 9154   H HE2  . MET B 2 324 ? 4.199   -7.114  -43.138 1.00 3.52  ? 324 MET B HE2  1  
ATOM 9155   H HE3  . MET B 2 324 ? 5.808   -6.984  -43.845 1.00 55.21 ? 324 MET B HE3  1  
ATOM 9156   N N    . THR B 2 325 ? 0.775   -8.281  -39.718 1.00 62.50 ? 325 THR B N    1  
ATOM 9157   C CA   . THR B 2 325 ? -0.511  -8.977  -39.853 1.00 1.11  ? 325 THR B CA   1  
ATOM 9158   C C    . THR B 2 325 ? -0.449  -10.278 -39.033 1.00 63.30 ? 325 THR B C    1  
ATOM 9159   O O    . THR B 2 325 ? 0.467   -11.086 -39.216 1.00 22.35 ? 325 THR B O    1  
ATOM 9160   C CB   . THR B 2 325 ? -0.832  -9.289  -41.356 1.00 52.12 ? 325 THR B CB   1  
ATOM 9161   O OG1  . THR B 2 325 ? -0.789  -8.073  -42.129 1.00 41.34 ? 325 THR B OG1  1  
ATOM 9162   C CG2  . THR B 2 325 ? -2.214  -9.955  -41.547 1.00 72.33 ? 325 THR B CG2  1  
ATOM 9163   H H    . THR B 2 325 ? 1.596   -8.818  -39.771 1.00 22.34 ? 325 THR B H    1  
ATOM 9164   H HA   . THR B 2 325 ? -1.296  -8.337  -39.451 1.00 4.12  ? 325 THR B HA   1  
ATOM 9165   H HB   . THR B 2 325 ? -0.070  -9.959  -41.740 1.00 60.31 ? 325 THR B HB   1  
ATOM 9166   H HG1  . THR B 2 325 ? -0.535  -7.332  -41.566 1.00 71.31 ? 325 THR B HG1  1  
ATOM 9167   H HG21 . THR B 2 325 ? -2.995  -9.292  -41.194 1.00 61.44 ? 325 THR B HG21 1  
ATOM 9168   H HG22 . THR B 2 325 ? -2.258  -10.880 -40.990 1.00 13.50 ? 325 THR B HG22 1  
ATOM 9169   H HG23 . THR B 2 325 ? -2.375  -10.169 -42.599 1.00 24.12 ? 325 THR B HG23 1  
ATOM 9170   N N    . ASP B 2 326 ? -1.399  -10.453 -38.105 1.00 51.01 ? 326 ASP B N    1  
ATOM 9171   C CA   . ASP B 2 326 ? -1.453  -11.638 -37.226 1.00 32.01 ? 326 ASP B CA   1  
ATOM 9172   C C    . ASP B 2 326 ? -1.978  -12.868 -37.996 1.00 52.35 ? 326 ASP B C    1  
ATOM 9173   O O    . ASP B 2 326 ? -1.492  -13.991 -37.798 1.00 24.01 ? 326 ASP B O    1  
ATOM 9174   C CB   . ASP B 2 326 ? -2.321  -11.336 -35.975 1.00 44.43 ? 326 ASP B CB   1  
ATOM 9175   C CG   . ASP B 2 326 ? -3.783  -10.998 -36.316 1.00 45.24 ? 326 ASP B CG   1  
ATOM 9176   O OD1  . ASP B 2 326 ? -4.619  -11.920 -36.358 1.00 72.01 ? 326 ASP B OD1  1  
ATOM 9177   O OD2  . ASP B 2 326 ? -4.080  -9.810  -36.589 1.00 31.20 ? 326 ASP B OD2  1  
ATOM 9178   H H    . ASP B 2 326 ? -2.089  -9.765  -38.007 1.00 70.12 ? 326 ASP B H    1  
ATOM 9179   H HA   . ASP B 2 326 ? -0.437  -11.847 -36.899 1.00 55.12 ? 326 ASP B HA   1  
ATOM 9180   H HB2  . ASP B 2 326 ? -2.301  -12.198 -35.313 1.00 2.42  ? 326 ASP B HB2  1  
ATOM 9181   H HB3  . ASP B 2 326 ? -1.885  -10.493 -35.445 1.00 0.45  ? 326 ASP B HB3  1  
ATOM 9182   N N    . LYS B 2 327 ? -2.958  -12.618 -38.883 1.00 24.25 ? 327 LYS B N    1  
ATOM 9183   C CA   . LYS B 2 327 ? -3.576  -13.636 -39.738 1.00 12.13 ? 327 LYS B CA   1  
ATOM 9184   C C    . LYS B 2 327 ? -4.283  -12.950 -40.913 1.00 21.14 ? 327 LYS B C    1  
ATOM 9185   O O    . LYS B 2 327 ? -3.824  -13.018 -42.056 1.00 43.40 ? 327 LYS B O    1  
ATOM 9186   C CB   . LYS B 2 327 ? -4.578  -14.509 -38.932 1.00 54.34 ? 327 LYS B CB   1  
ATOM 9187   C CG   . LYS B 2 327 ? -5.328  -15.568 -39.775 1.00 14.22 ? 327 LYS B CG   1  
ATOM 9188   C CD   . LYS B 2 327 ? -6.250  -16.466 -38.924 1.00 51.10 ? 327 LYS B CD   1  
ATOM 9189   C CE   . LYS B 2 327 ? -5.468  -17.297 -37.889 1.00 50.41 ? 327 LYS B CE   1  
ATOM 9190   N NZ   . LYS B 2 327 ? -4.512  -18.250 -38.523 1.00 24.32 ? 327 LYS B NZ   1  
ATOM 9191   H H    . LYS B 2 327 ? -3.284  -11.698 -38.955 1.00 71.20 ? 327 LYS B H    1  
ATOM 9192   H HA   . LYS B 2 327 ? -2.786  -14.275 -40.130 1.00 62.14 ? 327 LYS B HA   1  
ATOM 9193   H HB2  . LYS B 2 327 ? -4.029  -15.022 -38.148 1.00 51.20 ? 327 LYS B HB2  1  
ATOM 9194   H HB3  . LYS B 2 327 ? -5.312  -13.859 -38.466 1.00 44.23 ? 327 LYS B HB3  1  
ATOM 9195   H HG2  . LYS B 2 327 ? -5.930  -15.058 -40.519 1.00 4.11  ? 327 LYS B HG2  1  
ATOM 9196   H HG3  . LYS B 2 327 ? -4.597  -16.192 -40.281 1.00 42.02 ? 327 LYS B HG3  1  
ATOM 9197   H HD2  . LYS B 2 327 ? -6.968  -15.841 -38.401 1.00 44.45 ? 327 LYS B HD2  1  
ATOM 9198   H HD3  . LYS B 2 327 ? -6.786  -17.141 -39.584 1.00 23.43 ? 327 LYS B HD3  1  
ATOM 9199   H HE2  . LYS B 2 327 ? -4.911  -16.628 -37.248 1.00 1.41  ? 327 LYS B HE2  1  
ATOM 9200   H HE3  . LYS B 2 327 ? -6.168  -17.859 -37.286 1.00 75.41 ? 327 LYS B HE3  1  
ATOM 9201   H HZ1  . LYS B 2 327 ? -3.807  -17.733 -39.090 1.00 54.43 ? 327 LYS B HZ1  1  
ATOM 9202   H HZ2  . LYS B 2 327 ? -5.018  -18.909 -39.147 1.00 54.22 ? 327 LYS B HZ2  1  
ATOM 9203   H HZ3  . LYS B 2 327 ? -4.013  -18.795 -37.788 1.00 72.03 ? 327 LYS B HZ3  1  
ATOM 9204   N N    . ALA B 2 328 ? -5.387  -12.253 -40.605 1.00 72.03 ? 328 ALA B N    1  
ATOM 9205   C CA   . ALA B 2 328 ? -6.234  -11.582 -41.607 1.00 42.20 ? 328 ALA B CA   1  
ATOM 9206   C C    . ALA B 2 328 ? -7.262  -10.708 -40.874 1.00 61.25 ? 328 ALA B C    1  
ATOM 9207   O O    . ALA B 2 328 ? -7.159  -9.482  -40.903 1.00 0.10  ? 328 ALA B O    1  
ATOM 9208   C CB   . ALA B 2 328 ? -6.929  -12.613 -42.517 1.00 54.10 ? 328 ALA B CB   1  
ATOM 9209   H H    . ALA B 2 328 ? -5.642  -12.180 -39.659 1.00 14.10 ? 328 ALA B H    1  
ATOM 9210   H HA   . ALA B 2 328 ? -5.594  -10.950 -42.227 1.00 64.23 ? 328 ALA B HA   1  
ATOM 9211   H HB1  . ALA B 2 328 ? -7.525  -12.104 -43.264 1.00 14.05 ? 328 ALA B HB1  1  
ATOM 9212   H HB2  . ALA B 2 328 ? -7.565  -13.245 -41.917 1.00 54.11 ? 328 ALA B HB2  1  
ATOM 9213   H HB3  . ALA B 2 328 ? -6.182  -13.225 -43.009 1.00 14.41 ? 328 ALA B HB3  1  
ATOM 9214   N N    . ILE B 2 329 ? -8.227  -11.389 -40.202 1.00 43.11 ? 329 ILE B N    1  
ATOM 9215   C CA   . ILE B 2 329 ? -9.261  -10.793 -39.316 1.00 40.03 ? 329 ILE B CA   1  
ATOM 9216   C C    . ILE B 2 329 ? -10.255 -9.871  -40.092 1.00 41.35 ? 329 ILE B C    1  
ATOM 9217   O O    . ILE B 2 329 ? -11.459 -10.156 -40.130 1.00 70.01 ? 329 ILE B O    1  
ATOM 9218   C CB   . ILE B 2 329 ? -8.644  -10.033 -38.071 1.00 14.12 ? 329 ILE B CB   1  
ATOM 9219   C CG1  . ILE B 2 329 ? -7.580  -10.905 -37.319 1.00 51.42 ? 329 ILE B CG1  1  
ATOM 9220   C CG2  . ILE B 2 329 ? -9.758  -9.591  -37.097 1.00 5.21  ? 329 ILE B CG2  1  
ATOM 9221   C CD1  . ILE B 2 329 ? -8.100  -12.206 -36.714 1.00 73.50 ? 329 ILE B CD1  1  
ATOM 9222   H H    . ILE B 2 329 ? -8.247  -12.359 -40.315 1.00 64.21 ? 329 ILE B H    1  
ATOM 9223   H HA   . ILE B 2 329 ? -9.836  -11.634 -38.925 1.00 1.55  ? 329 ILE B HA   1  
ATOM 9224   H HB   . ILE B 2 329 ? -8.154  -9.133  -38.442 1.00 11.35 ? 329 ILE B HB   1  
ATOM 9225   H HG12 . ILE B 2 329 ? -6.786  -11.167 -38.008 1.00 64.13 ? 329 ILE B HG12 1  
ATOM 9226   H HG13 . ILE B 2 329 ? -7.149  -10.319 -36.513 1.00 51.40 ? 329 ILE B HG13 1  
ATOM 9227   H HG21 . ILE B 2 329 ? -10.308 -10.456 -36.747 1.00 24.32 ? 329 ILE B HG21 1  
ATOM 9228   H HG22 . ILE B 2 329 ? -10.441 -8.917  -37.602 1.00 12.34 ? 329 ILE B HG22 1  
ATOM 9229   H HG23 . ILE B 2 329 ? -9.324  -9.079  -36.248 1.00 50.21 ? 329 ILE B HG23 1  
ATOM 9230   H HD11 . ILE B 2 329 ? -8.882  -11.988 -36.000 1.00 54.41 ? 329 ILE B HD11 1  
ATOM 9231   H HD12 . ILE B 2 329 ? -7.290  -12.716 -36.209 1.00 14.20 ? 329 ILE B HD12 1  
ATOM 9232   H HD13 . ILE B 2 329 ? -8.489  -12.841 -37.496 1.00 73.32 ? 329 ILE B HD13 1  
ATOM 9233   N N    . GLU B 2 330 ? -9.747  -8.754  -40.658 1.00 62.35 ? 330 GLU B N    1  
ATOM 9234   C CA   . GLU B 2 330 ? -10.525 -7.825  -41.508 1.00 62.12 ? 330 GLU B CA   1  
ATOM 9235   C C    . GLU B 2 330 ? -11.187 -8.573  -42.694 1.00 33.41 ? 330 GLU B C    1  
ATOM 9236   O O    . GLU B 2 330 ? -12.399 -8.478  -42.903 1.00 2.15  ? 330 GLU B O    1  
ATOM 9237   C CB   . GLU B 2 330 ? -9.605  -6.676  -42.017 1.00 63.42 ? 330 GLU B CB   1  
ATOM 9238   C CG   . GLU B 2 330 ? -10.304 -5.585  -42.864 1.00 52.43 ? 330 GLU B CG   1  
ATOM 9239   C CD   . GLU B 2 330 ? -11.426 -4.844  -42.106 1.00 15.32 ? 330 GLU B CD   1  
ATOM 9240   O OE1  . GLU B 2 330 ? -11.109 -3.940  -41.292 1.00 3.43  ? 330 GLU B OE1  1  
ATOM 9241   O OE2  . GLU B 2 330 ? -12.622 -5.164  -42.307 1.00 31.04 ? 330 GLU B OE2  1  
ATOM 9242   H H    . GLU B 2 330 ? -8.815  -8.530  -40.475 1.00 43.12 ? 330 GLU B H    1  
ATOM 9243   H HA   . GLU B 2 330 ? -11.302 -7.395  -40.884 1.00 2.31  ? 330 GLU B HA   1  
ATOM 9244   H HB2  . GLU B 2 330 ? -9.155  -6.192  -41.157 1.00 55.20 ? 330 GLU B HB2  1  
ATOM 9245   H HB3  . GLU B 2 330 ? -8.808  -7.110  -42.617 1.00 40.03 ? 330 GLU B HB3  1  
ATOM 9246   H HG2  . GLU B 2 330 ? -9.557  -4.860  -43.175 1.00 33.42 ? 330 GLU B HG2  1  
ATOM 9247   H HG3  . GLU B 2 330 ? -10.719 -6.049  -43.756 1.00 74.44 ? 330 GLU B HG3  1  
ATOM 9248   N N    . LEU B 2 331 ? -10.383 -9.320  -43.459 1.00 22.12 ? 331 LEU B N    1  
ATOM 9249   C CA   . LEU B 2 331 ? -10.887 -10.209 -44.521 1.00 10.23 ? 331 LEU B CA   1  
ATOM 9250   C C    . LEU B 2 331 ? -10.660 -11.664 -44.079 1.00 13.54 ? 331 LEU B C    1  
ATOM 9251   O O    . LEU B 2 331 ? -9.591  -12.233 -44.302 1.00 22.25 ? 331 LEU B O    1  
ATOM 9252   C CB   . LEU B 2 331 ? -10.190 -9.892  -45.878 1.00 51.35 ? 331 LEU B CB   1  
ATOM 9253   C CG   . LEU B 2 331 ? -10.355 -8.424  -46.404 1.00 1.24  ? 331 LEU B CG   1  
ATOM 9254   C CD1  . LEU B 2 331 ? -9.607  -8.210  -47.744 1.00 63.34 ? 331 LEU B CD1  1  
ATOM 9255   C CD2  . LEU B 2 331 ? -11.851 -8.034  -46.528 1.00 50.02 ? 331 LEU B CD2  1  
ATOM 9256   H H    . LEU B 2 331 ? -9.421  -9.279  -43.303 1.00 62.30 ? 331 LEU B H    1  
ATOM 9257   H HA   . LEU B 2 331 ? -11.960 -10.049 -44.635 1.00 43.05 ? 331 LEU B HA   1  
ATOM 9258   H HB2  . LEU B 2 331 ? -9.130  -10.099 -45.765 1.00 44.05 ? 331 LEU B HB2  1  
ATOM 9259   H HB3  . LEU B 2 331 ? -10.586 -10.571 -46.627 1.00 24.22 ? 331 LEU B HB3  1  
ATOM 9260   H HG   . LEU B 2 331 ? -9.907  -7.753  -45.681 1.00 14.24 ? 331 LEU B HG   1  
ATOM 9261   H HD11 . LEU B 2 331 ? -10.006 -8.873  -48.502 1.00 24.41 ? 331 LEU B HD11 1  
ATOM 9262   H HD12 . LEU B 2 331 ? -8.554  -8.418  -47.610 1.00 50.30 ? 331 LEU B HD12 1  
ATOM 9263   H HD13 . LEU B 2 331 ? -9.722  -7.182  -48.069 1.00 52.30 ? 331 LEU B HD13 1  
ATOM 9264   H HD21 . LEU B 2 331 ? -12.327 -8.098  -45.557 1.00 43.32 ? 331 LEU B HD21 1  
ATOM 9265   H HD22 . LEU B 2 331 ? -12.354 -8.703  -47.215 1.00 22.50 ? 331 LEU B HD22 1  
ATOM 9266   H HD23 . LEU B 2 331 ? -11.936 -7.018  -46.893 1.00 64.42 ? 331 LEU B HD23 1  
ATOM 9267   N N    . LEU B 2 332 ? -11.661 -12.235 -43.385 1.00 24.01 ? 332 LEU B N    1  
ATOM 9268   C CA   . LEU B 2 332 ? -11.563 -13.585 -42.790 1.00 41.10 ? 332 LEU B CA   1  
ATOM 9269   C C    . LEU B 2 332 ? -11.937 -14.680 -43.814 1.00 1.42  ? 332 LEU B C    1  
ATOM 9270   O O    . LEU B 2 332 ? -11.539 -15.835 -43.641 1.00 54.30 ? 332 LEU B O    1  
ATOM 9271   C CB   . LEU B 2 332 ? -12.463 -13.675 -41.520 1.00 61.02 ? 332 LEU B CB   1  
ATOM 9272   C CG   . LEU B 2 332 ? -12.395 -15.011 -40.696 1.00 34.21 ? 332 LEU B CG   1  
ATOM 9273   C CD1  . LEU B 2 332 ? -10.956 -15.306 -40.192 1.00 44.32 ? 332 LEU B CD1  1  
ATOM 9274   C CD2  . LEU B 2 332 ? -13.410 -15.003 -39.521 1.00 74.41 ? 332 LEU B CD2  1  
ATOM 9275   H H    . LEU B 2 332 ? -12.497 -11.734 -43.272 1.00 22.41 ? 332 LEU B H    1  
ATOM 9276   H HA   . LEU B 2 332 ? -10.529 -13.739 -42.489 1.00 50.25 ? 332 LEU B HA   1  
ATOM 9277   H HB2  . LEU B 2 332 ? -12.191 -12.858 -40.861 1.00 43.23 ? 332 LEU B HB2  1  
ATOM 9278   H HB3  . LEU B 2 332 ? -13.494 -13.522 -41.831 1.00 60.51 ? 332 LEU B HB3  1  
ATOM 9279   H HG   . LEU B 2 332 ? -12.669 -15.828 -41.356 1.00 30.23 ? 332 LEU B HG   1  
ATOM 9280   H HD11 . LEU B 2 332 ? -10.282 -15.388 -41.037 1.00 34.43 ? 332 LEU B HD11 1  
ATOM 9281   H HD12 . LEU B 2 332 ? -10.943 -16.239 -39.645 1.00 64.20 ? 332 LEU B HD12 1  
ATOM 9282   H HD13 . LEU B 2 332 ? -10.618 -14.507 -39.543 1.00 13.23 ? 332 LEU B HD13 1  
ATOM 9283   H HD21 . LEU B 2 332 ? -13.180 -14.195 -38.835 1.00 14.34 ? 332 LEU B HD21 1  
ATOM 9284   H HD22 . LEU B 2 332 ? -13.360 -15.944 -38.990 1.00 31.31 ? 332 LEU B HD22 1  
ATOM 9285   H HD23 . LEU B 2 332 ? -14.413 -14.871 -39.906 1.00 72.31 ? 332 LEU B HD23 1  
ATOM 9286   N N    . SER B 2 333 ? -12.702 -14.303 -44.864 1.00 44.53 ? 333 SER B N    1  
ATOM 9287   C CA   . SER B 2 333 ? -13.147 -15.223 -45.943 1.00 11.42 ? 333 SER B CA   1  
ATOM 9288   C C    . SER B 2 333 ? -13.833 -16.498 -45.367 1.00 31.41 ? 333 SER B C    1  
ATOM 9289   O O    . SER B 2 333 ? -13.622 -17.620 -45.850 1.00 23.21 ? 333 SER B O    1  
ATOM 9290   C CB   . SER B 2 333 ? -11.944 -15.573 -46.869 1.00 24.40 ? 333 SER B CB   1  
ATOM 9291   O OG   . SER B 2 333 ? -11.351 -14.396 -47.408 1.00 65.04 ? 333 SER B OG   1  
ATOM 9292   H H    . SER B 2 333 ? -12.961 -13.367 -44.930 1.00 1.24  ? 333 SER B H    1  
ATOM 9293   H HA   . SER B 2 333 ? -13.886 -14.688 -46.527 1.00 51.04 ? 333 SER B HA   1  
ATOM 9294   H HB2  . SER B 2 333 ? -11.193 -16.106 -46.303 1.00 64.22 ? 333 SER B HB2  1  
ATOM 9295   H HB3  . SER B 2 333 ? -12.285 -16.192 -47.688 1.00 33.33 ? 333 SER B HB3  1  
ATOM 9296   H HG   . SER B 2 333 ? -10.697 -14.642 -48.071 1.00 61.53 ? 333 SER B HG   1  
ATOM 9297   N N    . LYS B 2 334 ? -14.663 -16.288 -44.330 1.00 11.42 ? 334 LYS B N    1  
ATOM 9298   C CA   . LYS B 2 334 ? -15.317 -17.373 -43.574 1.00 63.11 ? 334 LYS B CA   1  
ATOM 9299   C C    . LYS B 2 334 ? -16.447 -17.998 -44.421 1.00 20.24 ? 334 LYS B C    1  
ATOM 9300   O O    . LYS B 2 334 ? -16.511 -19.222 -44.578 1.00 43.22 ? 334 LYS B O    1  
ATOM 9301   C CB   . LYS B 2 334 ? -15.848 -16.804 -42.213 1.00 14.11 ? 334 LYS B CB   1  
ATOM 9302   C CG   . LYS B 2 334 ? -16.065 -17.830 -41.063 1.00 53.13 ? 334 LYS B CG   1  
ATOM 9303   C CD   . LYS B 2 334 ? -17.287 -18.761 -41.253 1.00 51.03 ? 334 LYS B CD   1  
ATOM 9304   C CE   . LYS B 2 334 ? -17.448 -19.773 -40.105 1.00 12.30 ? 334 LYS B CE   1  
ATOM 9305   N NZ   . LYS B 2 334 ? -16.267 -20.665 -39.959 1.00 54.11 ? 334 LYS B NZ   1  
ATOM 9306   H H    . LYS B 2 334 ? -14.845 -15.363 -44.068 1.00 40.34 ? 334 LYS B H    1  
ATOM 9307   H HA   . LYS B 2 334 ? -14.566 -18.134 -43.370 1.00 1.54  ? 334 LYS B HA   1  
ATOM 9308   H HB2  . LYS B 2 334 ? -15.135 -16.067 -41.856 1.00 0.15  ? 334 LYS B HB2  1  
ATOM 9309   H HB3  . LYS B 2 334 ? -16.788 -16.294 -42.392 1.00 2.53  ? 334 LYS B HB3  1  
ATOM 9310   H HG2  . LYS B 2 334 ? -15.173 -18.441 -40.973 1.00 63.21 ? 334 LYS B HG2  1  
ATOM 9311   H HG3  . LYS B 2 334 ? -16.194 -17.274 -40.137 1.00 1.03  ? 334 LYS B HG3  1  
ATOM 9312   H HD2  . LYS B 2 334 ? -18.182 -18.149 -41.298 1.00 24.03 ? 334 LYS B HD2  1  
ATOM 9313   H HD3  . LYS B 2 334 ? -17.182 -19.300 -42.188 1.00 63.13 ? 334 LYS B HD3  1  
ATOM 9314   H HE2  . LYS B 2 334 ? -17.587 -19.236 -39.178 1.00 41.01 ? 334 LYS B HE2  1  
ATOM 9315   H HE3  . LYS B 2 334 ? -18.323 -20.385 -40.293 1.00 41.21 ? 334 LYS B HE3  1  
ATOM 9316   H HZ1  . LYS B 2 334 ? -16.126 -21.220 -40.825 1.00 54.15 ? 334 LYS B HZ1  1  
ATOM 9317   H HZ2  . LYS B 2 334 ? -16.413 -21.320 -39.163 1.00 33.40 ? 334 LYS B HZ2  1  
ATOM 9318   H HZ3  . LYS B 2 334 ? -15.410 -20.103 -39.779 1.00 65.35 ? 334 LYS B HZ3  1  
ATOM 9319   N N    . ASN B 2 335 ? -17.325 -17.138 -44.964 1.00 14.43 ? 335 ASN B N    1  
ATOM 9320   C CA   . ASN B 2 335 ? -18.509 -17.562 -45.739 1.00 53.24 ? 335 ASN B CA   1  
ATOM 9321   C C    . ASN B 2 335 ? -18.688 -16.640 -46.964 1.00 70.32 ? 335 ASN B C    1  
ATOM 9322   O O    . ASN B 2 335 ? -18.347 -15.457 -46.904 1.00 21.40 ? 335 ASN B O    1  
ATOM 9323   C CB   . ASN B 2 335 ? -19.767 -17.541 -44.820 1.00 13.04 ? 335 ASN B CB   1  
ATOM 9324   C CG   . ASN B 2 335 ? -21.056 -18.041 -45.486 1.00 73.25 ? 335 ASN B CG   1  
ATOM 9325   O OD1  . ASN B 2 335 ? -21.027 -18.850 -46.418 1.00 11.23 ? 335 ASN B OD1  1  
ATOM 9326   N ND2  . ASN B 2 335 ? -22.200 -17.570 -45.003 1.00 72.11 ? 335 ASN B ND2  1  
ATOM 9327   H H    . ASN B 2 335 ? -17.164 -16.176 -44.854 1.00 0.11  ? 335 ASN B H    1  
ATOM 9328   H HA   . ASN B 2 335 ? -18.339 -18.576 -46.091 1.00 51.42 ? 335 ASN B HA   1  
ATOM 9329   H HB2  . ASN B 2 335 ? -19.583 -18.172 -43.959 1.00 41.30 ? 335 ASN B HB2  1  
ATOM 9330   H HB3  . ASN B 2 335 ? -19.928 -16.527 -44.475 1.00 43.22 ? 335 ASN B HB3  1  
ATOM 9331   H HD21 . ASN B 2 335 ? -22.160 -16.933 -44.258 1.00 11.40 ? 335 ASN B HD21 1  
ATOM 9332   H HD22 . ASN B 2 335 ? -23.033 -17.882 -45.407 1.00 74.12 ? 335 ASN B HD22 1  
ATOM 9333   N N    . GLU B 2 336 ? -19.247 -17.197 -48.062 1.00 2.43  ? 336 GLU B N    1  
ATOM 9334   C CA   . GLU B 2 336 ? -19.428 -16.485 -49.354 1.00 60.30 ? 336 GLU B CA   1  
ATOM 9335   C C    . GLU B 2 336 ? -20.412 -15.309 -49.221 1.00 3.40  ? 336 GLU B C    1  
ATOM 9336   O O    . GLU B 2 336 ? -20.336 -14.323 -49.965 1.00 3.21  ? 336 GLU B O    1  
ATOM 9337   C CB   . GLU B 2 336 ? -19.947 -17.468 -50.444 1.00 22.21 ? 336 GLU B CB   1  
ATOM 9338   C CG   . GLU B 2 336 ? -19.190 -18.812 -50.528 1.00 32.55 ? 336 GLU B CG   1  
ATOM 9339   C CD   . GLU B 2 336 ? -17.659 -18.665 -50.557 1.00 61.02 ? 336 GLU B CD   1  
ATOM 9340   O OE1  . GLU B 2 336 ? -16.996 -18.986 -49.540 1.00 4.44  ? 336 GLU B OE1  1  
ATOM 9341   O OE2  . GLU B 2 336 ? -17.109 -18.228 -51.594 1.00 11.31 ? 336 GLU B OE2  1  
ATOM 9342   H H    . GLU B 2 336 ? -19.546 -18.133 -48.007 1.00 0.34  ? 336 GLU B H    1  
ATOM 9343   H HA   . GLU B 2 336 ? -18.461 -16.099 -49.662 1.00 73.55 ? 336 GLU B HA   1  
ATOM 9344   H HB2  . GLU B 2 336 ? -20.990 -17.692 -50.243 1.00 24.51 ? 336 GLU B HB2  1  
ATOM 9345   H HB3  . GLU B 2 336 ? -19.883 -16.982 -51.414 1.00 15.32 ? 336 GLU B HB3  1  
ATOM 9346   H HG2  . GLU B 2 336 ? -19.471 -19.417 -49.671 1.00 65.15 ? 336 GLU B HG2  1  
ATOM 9347   H HG3  . GLU B 2 336 ? -19.507 -19.330 -51.430 1.00 64.14 ? 336 GLU B HG3  1  
ATOM 9348   N N    . LYS B 2 337 ? -21.329 -15.437 -48.260 1.00 41.34 ? 337 LYS B N    1  
ATOM 9349   C CA   . LYS B 2 337 ? -22.391 -14.461 -48.006 1.00 30.14 ? 337 LYS B CA   1  
ATOM 9350   C C    . LYS B 2 337 ? -22.341 -14.010 -46.538 1.00 52.23 ? 337 LYS B C    1  
ATOM 9351   O O    . LYS B 2 337 ? -21.640 -14.628 -45.721 1.00 33.23 ? 337 LYS B O    1  
ATOM 9352   C CB   . LYS B 2 337 ? -23.757 -15.110 -48.351 1.00 43.03 ? 337 LYS B CB   1  
ATOM 9353   C CG   . LYS B 2 337 ? -24.081 -16.393 -47.544 1.00 12.53 ? 337 LYS B CG   1  
ATOM 9354   C CD   . LYS B 2 337 ? -25.299 -17.196 -48.077 1.00 50.22 ? 337 LYS B CD   1  
ATOM 9355   C CE   . LYS B 2 337 ? -26.661 -16.482 -47.926 1.00 22.24 ? 337 LYS B CE   1  
ATOM 9356   N NZ   . LYS B 2 337 ? -26.848 -15.354 -48.881 1.00 62.43 ? 337 LYS B NZ   1  
ATOM 9357   H H    . LYS B 2 337 ? -21.278 -16.224 -47.679 1.00 71.10 ? 337 LYS B H    1  
ATOM 9358   H HA   . LYS B 2 337 ? -22.234 -13.592 -48.643 1.00 51.34 ? 337 LYS B HA   1  
ATOM 9359   H HB2  . LYS B 2 337 ? -24.547 -14.384 -48.173 1.00 33.33 ? 337 LYS B HB2  1  
ATOM 9360   H HB3  . LYS B 2 337 ? -23.761 -15.361 -49.407 1.00 35.42 ? 337 LYS B HB3  1  
ATOM 9361   H HG2  . LYS B 2 337 ? -23.209 -17.040 -47.569 1.00 11.13 ? 337 LYS B HG2  1  
ATOM 9362   H HG3  . LYS B 2 337 ? -24.270 -16.110 -46.512 1.00 2.35  ? 337 LYS B HG3  1  
ATOM 9363   H HD2  . LYS B 2 337 ? -25.142 -17.406 -49.126 1.00 34.33 ? 337 LYS B HD2  1  
ATOM 9364   H HD3  . LYS B 2 337 ? -25.342 -18.140 -47.540 1.00 32.12 ? 337 LYS B HD3  1  
ATOM 9365   H HE2  . LYS B 2 337 ? -27.450 -17.203 -48.096 1.00 10.42 ? 337 LYS B HE2  1  
ATOM 9366   H HE3  . LYS B 2 337 ? -26.747 -16.102 -46.916 1.00 4.35  ? 337 LYS B HE3  1  
ATOM 9367   H HZ1  . LYS B 2 337 ? -26.197 -14.577 -48.651 1.00 44.11 ? 337 LYS B HZ1  1  
ATOM 9368   H HZ2  . LYS B 2 337 ? -27.823 -14.999 -48.826 1.00 61.15 ? 337 LYS B HZ2  1  
ATOM 9369   H HZ3  . LYS B 2 337 ? -26.663 -15.672 -49.856 1.00 32.41 ? 337 LYS B HZ3  1  
ATOM 9370   N N    . GLY B 2 338 ? -23.090 -12.938 -46.206 1.00 33.31 ? 338 GLY B N    1  
ATOM 9371   C CA   . GLY B 2 338 ? -23.174 -12.434 -44.826 1.00 54.24 ? 338 GLY B CA   1  
ATOM 9372   C C    . GLY B 2 338 ? -24.149 -13.248 -43.979 1.00 12.34 ? 338 GLY B C    1  
ATOM 9373   O O    . GLY B 2 338 ? -25.161 -12.714 -43.501 1.00 72.34 ? 338 GLY B O    1  
ATOM 9374   H H    . GLY B 2 338 ? -23.589 -12.478 -46.913 1.00 2.35  ? 338 GLY B H    1  
ATOM 9375   H HA2  . GLY B 2 338 ? -22.192 -12.470 -44.365 1.00 63.03 ? 338 GLY B HA2  1  
ATOM 9376   H HA3  . GLY B 2 338 ? -23.502 -11.404 -44.852 1.00 73.12 ? 338 GLY B HA3  1  
ATOM 9377   N N    . PHE B 2 339 ? -23.824 -14.556 -43.812 1.00 72.23 ? 339 PHE B N    1  
ATOM 9378   C CA   . PHE B 2 339 ? -24.617 -15.543 -43.041 1.00 12.12 ? 339 PHE B CA   1  
ATOM 9379   C C    . PHE B 2 339 ? -26.030 -15.749 -43.633 1.00 43.34 ? 339 PHE B C    1  
ATOM 9380   O O    . PHE B 2 339 ? -26.333 -15.259 -44.725 1.00 73.41 ? 339 PHE B O    1  
ATOM 9381   C CB   . PHE B 2 339 ? -24.669 -15.153 -41.534 1.00 13.13 ? 339 PHE B CB   1  
ATOM 9382   C CG   . PHE B 2 339 ? -23.281 -14.957 -40.925 1.00 13.45 ? 339 PHE B CG   1  
ATOM 9383   C CD1  . PHE B 2 339 ? -22.453 -16.049 -40.691 1.00 2.43  ? 339 PHE B CD1  1  
ATOM 9384   C CD2  . PHE B 2 339 ? -22.798 -13.681 -40.625 1.00 74.33 ? 339 PHE B CD2  1  
ATOM 9385   C CE1  . PHE B 2 339 ? -21.188 -15.874 -40.173 1.00 30.13 ? 339 PHE B CE1  1  
ATOM 9386   C CE2  . PHE B 2 339 ? -21.533 -13.508 -40.101 1.00 60.23 ? 339 PHE B CE2  1  
ATOM 9387   C CZ   . PHE B 2 339 ? -20.726 -14.606 -39.877 1.00 22.33 ? 339 PHE B CZ   1  
ATOM 9388   H H    . PHE B 2 339 ? -22.999 -14.870 -44.225 1.00 0.51  ? 339 PHE B H    1  
ATOM 9389   H HA   . PHE B 2 339 ? -24.094 -16.490 -43.130 1.00 3.40  ? 339 PHE B HA   1  
ATOM 9390   H HB2  . PHE B 2 339 ? -25.233 -14.230 -41.422 1.00 11.33 ? 339 PHE B HB2  1  
ATOM 9391   H HB3  . PHE B 2 339 ? -25.173 -15.936 -40.980 1.00 73.11 ? 339 PHE B HB3  1  
ATOM 9392   H HD1  . PHE B 2 339 ? -22.809 -17.049 -40.917 1.00 63.10 ? 339 PHE B HD1  1  
ATOM 9393   H HD2  . PHE B 2 339 ? -23.430 -12.818 -40.802 1.00 30.11 ? 339 PHE B HD2  1  
ATOM 9394   H HE1  . PHE B 2 339 ? -20.560 -16.735 -39.994 1.00 44.54 ? 339 PHE B HE1  1  
ATOM 9395   H HE2  . PHE B 2 339 ? -21.173 -12.514 -39.871 1.00 51.04 ? 339 PHE B HE2  1  
ATOM 9396   H HZ   . PHE B 2 339 ? -19.734 -14.474 -39.470 1.00 14.21 ? 339 PHE B HZ   1  
ATOM 9397   N N    . PHE B 2 340 ? -26.876 -16.519 -42.923 1.00 41.41 ? 340 PHE B N    1  
ATOM 9398   C CA   . PHE B 2 340 ? -28.288 -16.715 -43.302 1.00 75.24 ? 340 PHE B CA   1  
ATOM 9399   C C    . PHE B 2 340 ? -29.152 -15.586 -42.701 1.00 5.11  ? 340 PHE B C    1  
ATOM 9400   O O    . PHE B 2 340 ? -29.921 -14.957 -43.431 1.00 31.21 ? 340 PHE B O    1  
ATOM 9401   C CB   . PHE B 2 340 ? -28.803 -18.127 -42.883 1.00 22.20 ? 340 PHE B CB   1  
ATOM 9402   C CG   . PHE B 2 340 ? -28.702 -18.464 -41.388 1.00 13.12 ? 340 PHE B CG   1  
ATOM 9403   C CD1  . PHE B 2 340 ? -27.508 -18.926 -40.841 1.00 2.35  ? 340 PHE B CD1  1  
ATOM 9404   C CD2  . PHE B 2 340 ? -29.800 -18.315 -40.540 1.00 44.14 ? 340 PHE B CD2  1  
ATOM 9405   C CE1  . PHE B 2 340 ? -27.412 -19.224 -39.499 1.00 73.44 ? 340 PHE B CE1  1  
ATOM 9406   C CE2  . PHE B 2 340 ? -29.701 -18.614 -39.199 1.00 1.22  ? 340 PHE B CE2  1  
ATOM 9407   C CZ   . PHE B 2 340 ? -28.508 -19.067 -38.677 1.00 14.44 ? 340 PHE B CZ   1  
ATOM 9408   H H    . PHE B 2 340 ? -26.543 -16.964 -42.120 1.00 30.14 ? 340 PHE B H    1  
ATOM 9409   H HA   . PHE B 2 340 ? -28.344 -16.649 -44.394 1.00 22.24 ? 340 PHE B HA   1  
ATOM 9410   H HB2  . PHE B 2 340 ? -29.845 -18.220 -43.181 1.00 34.04 ? 340 PHE B HB2  1  
ATOM 9411   H HB3  . PHE B 2 340 ? -28.237 -18.876 -43.430 1.00 75.21 ? 340 PHE B HB3  1  
ATOM 9412   H HD1  . PHE B 2 340 ? -26.642 -19.048 -41.483 1.00 14.42 ? 340 PHE B HD1  1  
ATOM 9413   H HD2  . PHE B 2 340 ? -30.742 -17.959 -40.945 1.00 23.44 ? 340 PHE B HD2  1  
ATOM 9414   H HE1  . PHE B 2 340 ? -26.479 -19.585 -39.095 1.00 63.21 ? 340 PHE B HE1  1  
ATOM 9415   H HE2  . PHE B 2 340 ? -30.560 -18.490 -38.553 1.00 5.32  ? 340 PHE B HE2  1  
ATOM 9416   H HZ   . PHE B 2 340 ? -28.431 -19.304 -37.625 1.00 21.42 ? 340 PHE B HZ   1  
ATOM 9417   N N    . LEU B 2 341 ? -28.962 -15.339 -41.370 1.00 63.13 ? 341 LEU B N    1  
ATOM 9418   C CA   . LEU B 2 341 ? -29.644 -14.288 -40.560 1.00 72.50 ? 341 LEU B CA   1  
ATOM 9419   C C    . LEU B 2 341 ? -31.119 -14.051 -40.976 1.00 15.53 ? 341 LEU B C    1  
ATOM 9420   O O    . LEU B 2 341 ? -31.410 -13.211 -41.839 1.00 54.34 ? 341 LEU B O    1  
ATOM 9421   C CB   . LEU B 2 341 ? -28.824 -12.958 -40.570 1.00 31.41 ? 341 LEU B CB   1  
ATOM 9422   C CG   . LEU B 2 341 ? -29.380 -11.775 -39.698 1.00 75.34 ? 341 LEU B CG   1  
ATOM 9423   C CD1  . LEU B 2 341 ? -29.447 -12.134 -38.195 1.00 64.10 ? 341 LEU B CD1  1  
ATOM 9424   C CD2  . LEU B 2 341 ? -28.561 -10.484 -39.927 1.00 53.34 ? 341 LEU B CD2  1  
ATOM 9425   H H    . LEU B 2 341 ? -28.320 -15.902 -40.902 1.00 71.51 ? 341 LEU B H    1  
ATOM 9426   H HA   . LEU B 2 341 ? -29.651 -14.658 -39.539 1.00 35.23 ? 341 LEU B HA   1  
ATOM 9427   H HB2  . LEU B 2 341 ? -27.817 -13.179 -40.236 1.00 53.32 ? 341 LEU B HB2  1  
ATOM 9428   H HB3  . LEU B 2 341 ? -28.766 -12.615 -41.596 1.00 74.20 ? 341 LEU B HB3  1  
ATOM 9429   H HG   . LEU B 2 341 ? -30.396 -11.569 -40.016 1.00 52.44 ? 341 LEU B HG   1  
ATOM 9430   H HD11 . LEU B 2 341 ? -28.455 -12.354 -37.821 1.00 33.33 ? 341 LEU B HD11 1  
ATOM 9431   H HD12 . LEU B 2 341 ? -30.079 -13.001 -38.056 1.00 2.34  ? 341 LEU B HD12 1  
ATOM 9432   H HD13 . LEU B 2 341 ? -29.863 -11.304 -37.639 1.00 23.04 ? 341 LEU B HD13 1  
ATOM 9433   H HD21 . LEU B 2 341 ? -28.597 -10.213 -40.974 1.00 63.35 ? 341 LEU B HD21 1  
ATOM 9434   H HD22 . LEU B 2 341 ? -27.530 -10.640 -39.634 1.00 64.41 ? 341 LEU B HD22 1  
ATOM 9435   H HD23 . LEU B 2 341 ? -28.981 -9.678  -39.340 1.00 1.43  ? 341 LEU B HD23 1  
ATOM 9436   N N    . GLN B 2 342 ? -32.032 -14.846 -40.403 1.00 14.51 ? 342 GLN B N    1  
ATOM 9437   C CA   . GLN B 2 342 ? -33.475 -14.709 -40.654 1.00 64.14 ? 342 GLN B CA   1  
ATOM 9438   C C    . GLN B 2 342 ? -34.093 -13.836 -39.557 1.00 32.51 ? 342 GLN B C    1  
ATOM 9439   O O    . GLN B 2 342 ? -34.490 -12.696 -39.802 1.00 60.41 ? 342 GLN B O    1  
ATOM 9440   C CB   . GLN B 2 342 ? -34.143 -16.108 -40.704 1.00 24.13 ? 342 GLN B CB   1  
ATOM 9441   C CG   . GLN B 2 342 ? -33.595 -17.043 -41.795 1.00 64.25 ? 342 GLN B CG   1  
ATOM 9442   C CD   . GLN B 2 342 ? -33.787 -16.496 -43.213 1.00 63.52 ? 342 GLN B CD   1  
ATOM 9443   O OE1  . GLN B 2 342 ? -34.812 -16.742 -43.848 1.00 14.05 ? 342 GLN B OE1  1  
ATOM 9444   N NE2  . GLN B 2 342 ? -32.810 -15.753 -43.717 1.00 21.43 ? 342 GLN B NE2  1  
ATOM 9445   H H    . GLN B 2 342 ? -31.726 -15.545 -39.783 1.00 31.11 ? 342 GLN B H    1  
ATOM 9446   H HA   . GLN B 2 342 ? -33.618 -14.216 -41.616 1.00 22.45 ? 342 GLN B HA   1  
ATOM 9447   H HB2  . GLN B 2 342 ? -34.001 -16.595 -39.743 1.00 44.21 ? 342 GLN B HB2  1  
ATOM 9448   H HB3  . GLN B 2 342 ? -35.210 -15.986 -40.868 1.00 22.25 ? 342 GLN B HB3  1  
ATOM 9449   H HG2  . GLN B 2 342 ? -32.534 -17.200 -41.621 1.00 61.53 ? 342 GLN B HG2  1  
ATOM 9450   H HG3  . GLN B 2 342 ? -34.105 -17.999 -41.720 1.00 74.32 ? 342 GLN B HG3  1  
ATOM 9451   H HE21 . GLN B 2 342 ? -32.017 -15.585 -43.162 1.00 11.21 ? 342 GLN B HE21 1  
ATOM 9452   H HE22 . GLN B 2 342 ? -32.925 -15.385 -44.617 1.00 72.23 ? 342 GLN B HE22 1  
ATOM 9453   N N    . VAL B 2 343 ? -34.125 -14.390 -38.341 1.00 31.21 ? 343 VAL B N    1  
ATOM 9454   C CA   . VAL B 2 343 ? -34.634 -13.721 -37.146 1.00 13.43 ? 343 VAL B CA   1  
ATOM 9455   C C    . VAL B 2 343 ? -34.060 -14.454 -35.919 1.00 30.51 ? 343 VAL B C    1  
ATOM 9456   O O    . VAL B 2 343 ? -34.632 -15.417 -35.405 1.00 50.15 ? 343 VAL B O    1  
ATOM 9457   C CB   . VAL B 2 343 ? -36.224 -13.630 -37.134 1.00 11.55 ? 343 VAL B CB   1  
ATOM 9458   C CG1  . VAL B 2 343 ? -36.904 -15.013 -37.336 1.00 64.24 ? 343 VAL B CG1  1  
ATOM 9459   C CG2  . VAL B 2 343 ? -36.738 -12.925 -35.853 1.00 30.24 ? 343 VAL B CG2  1  
ATOM 9460   H H    . VAL B 2 343 ? -33.770 -15.300 -38.239 1.00 21.40 ? 343 VAL B H    1  
ATOM 9461   H HA   . VAL B 2 343 ? -34.239 -12.705 -37.147 1.00 3.54  ? 343 VAL B HA   1  
ATOM 9462   H HB   . VAL B 2 343 ? -36.513 -13.010 -37.983 1.00 44.51 ? 343 VAL B HB   1  
ATOM 9463   H HG11 . VAL B 2 343 ? -37.979 -14.892 -37.378 1.00 11.42 ? 343 VAL B HG11 1  
ATOM 9464   H HG12 . VAL B 2 343 ? -36.653 -15.670 -36.511 1.00 34.22 ? 343 VAL B HG12 1  
ATOM 9465   H HG13 . VAL B 2 343 ? -36.560 -15.459 -38.261 1.00 62.41 ? 343 VAL B HG13 1  
ATOM 9466   H HG21 . VAL B 2 343 ? -36.298 -11.938 -35.775 1.00 44.21 ? 343 VAL B HG21 1  
ATOM 9467   H HG22 . VAL B 2 343 ? -36.468 -13.503 -34.978 1.00 65.15 ? 343 VAL B HG22 1  
ATOM 9468   H HG23 . VAL B 2 343 ? -37.818 -12.826 -35.892 1.00 21.10 ? 343 VAL B HG23 1  
ATOM 9469   N N    . GLU B 2 344 ? -32.862 -14.021 -35.493 1.00 12.24 ? 344 GLU B N    1  
ATOM 9470   C CA   . GLU B 2 344 ? -32.118 -14.659 -34.379 1.00 73.03 ? 344 GLU B CA   1  
ATOM 9471   C C    . GLU B 2 344 ? -32.380 -13.872 -33.080 1.00 65.45 ? 344 GLU B C    1  
ATOM 9472   O O    . GLU B 2 344 ? -31.533 -13.809 -32.178 1.00 13.40 ? 344 GLU B O    1  
ATOM 9473   C CB   . GLU B 2 344 ? -30.591 -14.709 -34.716 1.00 4.42  ? 344 GLU B CB   1  
ATOM 9474   C CG   . GLU B 2 344 ? -30.236 -15.100 -36.174 1.00 71.35 ? 344 GLU B CG   1  
ATOM 9475   C CD   . GLU B 2 344 ? -30.943 -16.369 -36.687 1.00 11.31 ? 344 GLU B CD   1  
ATOM 9476   O OE1  . GLU B 2 344 ? -31.773 -16.272 -37.632 1.00 4.04  ? 344 GLU B OE1  1  
ATOM 9477   O OE2  . GLU B 2 344 ? -30.688 -17.465 -36.143 1.00 4.40  ? 344 GLU B OE2  1  
ATOM 9478   H H    . GLU B 2 344 ? -32.461 -13.241 -35.933 1.00 25.44 ? 344 GLU B H    1  
ATOM 9479   H HA   . GLU B 2 344 ? -32.490 -15.677 -34.244 1.00 43.44 ? 344 GLU B HA   1  
ATOM 9480   H HB2  . GLU B 2 344 ? -30.157 -13.734 -34.522 1.00 21.31 ? 344 GLU B HB2  1  
ATOM 9481   H HB3  . GLU B 2 344 ? -30.117 -15.428 -34.053 1.00 42.01 ? 344 GLU B HB3  1  
ATOM 9482   H HG2  . GLU B 2 344 ? -30.497 -14.267 -36.821 1.00 74.33 ? 344 GLU B HG2  1  
ATOM 9483   H HG3  . GLU B 2 344 ? -29.160 -15.254 -36.241 1.00 73.44 ? 344 GLU B HG3  1  
ATOM 9484   N N    . GLY B 2 345 ? -33.600 -13.313 -32.987 1.00 32.10 ? 345 GLY B N    1  
ATOM 9485   C CA   . GLY B 2 345 ? -33.935 -12.298 -32.001 1.00 24.24 ? 345 GLY B CA   1  
ATOM 9486   C C    . GLY B 2 345 ? -33.526 -10.927 -32.518 1.00 43.12 ? 345 GLY B C    1  
ATOM 9487   O O    . GLY B 2 345 ? -34.372 -10.081 -32.815 1.00 62.31 ? 345 GLY B O    1  
ATOM 9488   H H    . GLY B 2 345 ? -34.292 -13.601 -33.613 1.00 24.45 ? 345 GLY B H    1  
ATOM 9489   H HA2  . GLY B 2 345 ? -35.004 -12.321 -31.829 1.00 63.14 ? 345 GLY B HA2  1  
ATOM 9490   H HA3  . GLY B 2 345 ? -33.423 -12.500 -31.066 1.00 45.22 ? 345 GLY B HA3  1  
ATOM 9491   N N    . ALA B 2 346 ? -32.205 -10.745 -32.663 1.00 32.03 ? 346 ALA B N    1  
ATOM 9492   C CA   . ALA B 2 346 ? -31.589 -9.567  -33.295 1.00 42.41 ? 346 ALA B CA   1  
ATOM 9493   C C    . ALA B 2 346 ? -30.492 -10.043 -34.267 1.00 13.10 ? 346 ALA B C    1  
ATOM 9494   O O    . ALA B 2 346 ? -30.387 -11.246 -34.552 1.00 24.11 ? 346 ALA B O    1  
ATOM 9495   C CB   . ALA B 2 346 ? -31.013 -8.633  -32.209 1.00 72.22 ? 346 ALA B CB   1  
ATOM 9496   H H    . ALA B 2 346 ? -31.605 -11.450 -32.335 1.00 21.55 ? 346 ALA B H    1  
ATOM 9497   H HA   . ALA B 2 346 ? -32.343 -9.024  -33.859 1.00 4.22  ? 346 ALA B HA   1  
ATOM 9498   H HB1  . ALA B 2 346 ? -31.807 -8.310  -31.548 1.00 2.04  ? 346 ALA B HB1  1  
ATOM 9499   H HB2  . ALA B 2 346 ? -30.560 -7.763  -32.672 1.00 23.24 ? 346 ALA B HB2  1  
ATOM 9500   H HB3  . ALA B 2 346 ? -30.262 -9.160  -31.634 1.00 72.51 ? 346 ALA B HB3  1  
ATOM 9501   N N    . SER B 2 347 ? -29.695 -9.099  -34.798 1.00 25.51 ? 347 SER B N    1  
ATOM 9502   C CA   . SER B 2 347 ? -28.439 -9.425  -35.500 1.00 33.22 ? 347 SER B CA   1  
ATOM 9503   C C    . SER B 2 347 ? -27.367 -9.835  -34.472 1.00 72.21 ? 347 SER B C    1  
ATOM 9504   O O    . SER B 2 347 ? -27.536 -9.587  -33.275 1.00 45.25 ? 347 SER B O    1  
ATOM 9505   C CB   . SER B 2 347 ? -27.954 -8.216  -36.330 1.00 14.42 ? 347 SER B CB   1  
ATOM 9506   O OG   . SER B 2 347 ? -27.709 -7.073  -35.518 1.00 15.23 ? 347 SER B OG   1  
ATOM 9507   H H    . SER B 2 347 ? -29.956 -8.158  -34.720 1.00 35.53 ? 347 SER B H    1  
ATOM 9508   H HA   . SER B 2 347 ? -28.624 -10.262 -36.168 1.00 64.41 ? 347 SER B HA   1  
ATOM 9509   H HB2  . SER B 2 347 ? -27.039 -8.473  -36.842 1.00 1.42  ? 347 SER B HB2  1  
ATOM 9510   H HB3  . SER B 2 347 ? -28.709 -7.960  -37.064 1.00 64.22 ? 347 SER B HB3  1  
ATOM 9511   H HG   . SER B 2 347 ? -27.036 -6.522  -35.939 1.00 40.42 ? 347 SER B HG   1  
ATOM 9512   N N    . ILE B 2 348 ? -26.258 -10.443 -34.930 1.00 32.04 ? 348 ILE B N    1  
ATOM 9513   C CA   . ILE B 2 348 ? -25.149 -10.854 -34.034 1.00 31.45 ? 348 ILE B CA   1  
ATOM 9514   C C    . ILE B 2 348 ? -24.219 -9.629  -33.743 1.00 64.44 ? 348 ILE B C    1  
ATOM 9515   O O    . ILE B 2 348 ? -23.010 -9.647  -34.008 1.00 73.42 ? 348 ILE B O    1  
ATOM 9516   C CB   . ILE B 2 348 ? -24.365 -12.106 -34.630 1.00 71.43 ? 348 ILE B CB   1  
ATOM 9517   C CG1  . ILE B 2 348 ? -23.249 -12.615 -33.633 1.00 12.31 ? 348 ILE B CG1  1  
ATOM 9518   C CG2  . ILE B 2 348 ? -23.796 -11.806 -36.049 1.00 31.44 ? 348 ILE B CG2  1  
ATOM 9519   C CD1  . ILE B 2 348 ? -22.406 -13.776 -34.138 1.00 41.41 ? 348 ILE B CD1  1  
ATOM 9520   H H    . ILE B 2 348 ? -26.179 -10.617 -35.888 1.00 0.15  ? 348 ILE B H    1  
ATOM 9521   H HA   . ILE B 2 348 ? -25.593 -11.168 -33.090 1.00 22.44 ? 348 ILE B HA   1  
ATOM 9522   H HB   . ILE B 2 348 ? -25.099 -12.902 -34.749 1.00 1.41  ? 348 ILE B HB   1  
ATOM 9523   H HG12 . ILE B 2 348 ? -22.566 -11.805 -33.416 1.00 11.10 ? 348 ILE B HG12 1  
ATOM 9524   H HG13 . ILE B 2 348 ? -23.716 -12.931 -32.707 1.00 3.13  ? 348 ILE B HG13 1  
ATOM 9525   H HG21 . ILE B 2 348 ? -23.062 -11.011 -35.989 1.00 50.23 ? 348 ILE B HG21 1  
ATOM 9526   H HG22 . ILE B 2 348 ? -24.599 -11.497 -36.703 1.00 51.52 ? 348 ILE B HG22 1  
ATOM 9527   H HG23 . ILE B 2 348 ? -23.331 -12.695 -36.458 1.00 4.11  ? 348 ILE B HG23 1  
ATOM 9528   H HD11 . ILE B 2 348 ? -23.043 -14.619 -34.367 1.00 31.43 ? 348 ILE B HD11 1  
ATOM 9529   H HD12 . ILE B 2 348 ? -21.696 -14.061 -33.377 1.00 53.11 ? 348 ILE B HD12 1  
ATOM 9530   H HD13 . ILE B 2 348 ? -21.874 -13.474 -35.029 1.00 42.31 ? 348 ILE B HD13 1  
ATOM 9531   N N    . ASP B 2 349 ? -24.825 -8.543  -33.195 1.00 55.52 ? 349 ASP B N    1  
ATOM 9532   C CA   . ASP B 2 349 ? -24.107 -7.307  -32.842 1.00 10.43 ? 349 ASP B CA   1  
ATOM 9533   C C    . ASP B 2 349 ? -23.065 -7.626  -31.771 1.00 4.33  ? 349 ASP B C    1  
ATOM 9534   O O    . ASP B 2 349 ? -21.866 -7.398  -31.971 1.00 30.33 ? 349 ASP B O    1  
ATOM 9535   C CB   . ASP B 2 349 ? -25.091 -6.201  -32.356 1.00 24.34 ? 349 ASP B CB   1  
ATOM 9536   C CG   . ASP B 2 349 ? -24.376 -4.874  -32.035 1.00 33.21 ? 349 ASP B CG   1  
ATOM 9537   O OD1  . ASP B 2 349 ? -24.239 -4.026  -32.930 1.00 10.12 ? 349 ASP B OD1  1  
ATOM 9538   O OD2  . ASP B 2 349 ? -23.919 -4.697  -30.883 1.00 71.13 ? 349 ASP B OD2  1  
ATOM 9539   H H    . ASP B 2 349 ? -25.780 -8.588  -33.010 1.00 30.40 ? 349 ASP B H    1  
ATOM 9540   H HA   . ASP B 2 349 ? -23.600 -6.959  -33.734 1.00 3.31  ? 349 ASP B HA   1  
ATOM 9541   H HB2  . ASP B 2 349 ? -25.832 -6.025  -33.126 1.00 22.23 ? 349 ASP B HB2  1  
ATOM 9542   H HB3  . ASP B 2 349 ? -25.602 -6.546  -31.458 1.00 63.42 ? 349 ASP B HB3  1  
ATOM 9543   N N    . LYS B 2 350 ? -23.570 -8.116  -30.617 1.00 20.03 ? 350 LYS B N    1  
ATOM 9544   C CA   . LYS B 2 350 ? -22.779 -8.802  -29.577 1.00 23.23 ? 350 LYS B CA   1  
ATOM 9545   C C    . LYS B 2 350 ? -21.753 -7.885  -28.842 1.00 54.40 ? 350 LYS B C    1  
ATOM 9546   O O    . LYS B 2 350 ? -21.246 -8.271  -27.784 1.00 63.42 ? 350 LYS B O    1  
ATOM 9547   C CB   . LYS B 2 350 ? -22.069 -10.044 -30.213 1.00 73.13 ? 350 LYS B CB   1  
ATOM 9548   C CG   . LYS B 2 350 ? -21.329 -10.967 -29.219 1.00 74.52 ? 350 LYS B CG   1  
ATOM 9549   C CD   . LYS B 2 350 ? -20.314 -11.900 -29.916 1.00 14.13 ? 350 LYS B CD   1  
ATOM 9550   C CE   . LYS B 2 350 ? -19.442 -12.664 -28.901 1.00 40.03 ? 350 LYS B CE   1  
ATOM 9551   N NZ   . LYS B 2 350 ? -18.335 -13.411 -29.552 1.00 52.13 ? 350 LYS B NZ   1  
ATOM 9552   H H    . LYS B 2 350 ? -24.526 -8.013  -30.460 1.00 74.24 ? 350 LYS B H    1  
ATOM 9553   H HA   . LYS B 2 350 ? -23.490 -9.161  -28.838 1.00 64.10 ? 350 LYS B HA   1  
ATOM 9554   H HB2  . LYS B 2 350 ? -22.811 -10.636 -30.736 1.00 74.04 ? 350 LYS B HB2  1  
ATOM 9555   H HB3  . LYS B 2 350 ? -21.345 -9.687  -30.948 1.00 41.52 ? 350 LYS B HB3  1  
ATOM 9556   H HG2  . LYS B 2 350 ? -20.801 -10.354 -28.494 1.00 51.32 ? 350 LYS B HG2  1  
ATOM 9557   H HG3  . LYS B 2 350 ? -22.064 -11.573 -28.693 1.00 44.14 ? 350 LYS B HG3  1  
ATOM 9558   H HD2  . LYS B 2 350 ? -20.851 -12.613 -30.534 1.00 41.14 ? 350 LYS B HD2  1  
ATOM 9559   H HD3  . LYS B 2 350 ? -19.666 -11.301 -30.550 1.00 34.05 ? 350 LYS B HD3  1  
ATOM 9560   H HE2  . LYS B 2 350 ? -19.010 -11.955 -28.205 1.00 54.41 ? 350 LYS B HE2  1  
ATOM 9561   H HE3  . LYS B 2 350 ? -20.063 -13.365 -28.354 1.00 45.40 ? 350 LYS B HE3  1  
ATOM 9562   H HZ1  . LYS B 2 350 ? -18.704 -14.044 -30.286 1.00 53.23 ? 350 LYS B HZ1  1  
ATOM 9563   H HZ2  . LYS B 2 350 ? -17.828 -13.991 -28.848 1.00 21.22 ? 350 LYS B HZ2  1  
ATOM 9564   H HZ3  . LYS B 2 350 ? -17.662 -12.746 -29.987 1.00 22.41 ? 350 LYS B HZ3  1  
ATOM 9565   N N    . GLN B 2 351 ? -21.508 -6.658  -29.387 1.00 20.34 ? 351 GLN B N    1  
ATOM 9566   C CA   . GLN B 2 351 ? -20.313 -5.822  -29.096 1.00 45.24 ? 351 GLN B CA   1  
ATOM 9567   C C    . GLN B 2 351 ? -19.042 -6.423  -29.753 1.00 33.34 ? 351 GLN B C    1  
ATOM 9568   O O    . GLN B 2 351 ? -17.943 -5.886  -29.578 1.00 11.54 ? 351 GLN B O    1  
ATOM 9569   C CB   . GLN B 2 351 ? -20.103 -5.566  -27.560 1.00 53.43 ? 351 GLN B CB   1  
ATOM 9570   C CG   . GLN B 2 351 ? -21.007 -4.484  -26.918 1.00 71.32 ? 351 GLN B CG   1  
ATOM 9571   C CD   . GLN B 2 351 ? -22.485 -4.546  -27.323 1.00 62.13 ? 351 GLN B CD   1  
ATOM 9572   O OE1  . GLN B 2 351 ? -23.286 -5.251  -26.707 1.00 24.32 ? 351 GLN B OE1  1  
ATOM 9573   N NE2  . GLN B 2 351 ? -22.855 -3.781  -28.345 1.00 64.31 ? 351 GLN B NE2  1  
ATOM 9574   H H    . GLN B 2 351 ? -22.173 -6.289  -30.004 1.00 11.34 ? 351 GLN B H    1  
ATOM 9575   H HA   . GLN B 2 351 ? -20.494 -4.865  -29.576 1.00 50.01 ? 351 GLN B HA   1  
ATOM 9576   H HB2  . GLN B 2 351 ? -20.273 -6.495  -27.031 1.00 15.24 ? 351 GLN B HB2  1  
ATOM 9577   H HB3  . GLN B 2 351 ? -19.068 -5.274  -27.391 1.00 3.15  ? 351 GLN B HB3  1  
ATOM 9578   H HG2  . GLN B 2 351 ? -20.949 -4.586  -25.841 1.00 35.25 ? 351 GLN B HG2  1  
ATOM 9579   H HG3  . GLN B 2 351 ? -20.616 -3.507  -27.191 1.00 15.41 ? 351 GLN B HG3  1  
ATOM 9580   H HE21 . GLN B 2 351 ? -22.173 -3.224  -28.777 1.00 63.15 ? 351 GLN B HE21 1  
ATOM 9581   H HE22 . GLN B 2 351 ? -23.786 -3.817  -28.640 1.00 3.04  ? 351 GLN B HE22 1  
ATOM 9582   N N    . ASP B 2 352 ? -19.213 -7.496  -30.557 1.00 74.35 ? 352 ASP B N    1  
ATOM 9583   C CA   . ASP B 2 352 ? -18.096 -8.243  -31.167 1.00 2.01  ? 352 ASP B CA   1  
ATOM 9584   C C    . ASP B 2 352 ? -18.567 -8.982  -32.437 1.00 21.22 ? 352 ASP B C    1  
ATOM 9585   O O    . ASP B 2 352 ? -19.743 -9.306  -32.583 1.00 73.12 ? 352 ASP B O    1  
ATOM 9586   C CB   . ASP B 2 352 ? -17.477 -9.249  -30.144 1.00 12.23 ? 352 ASP B CB   1  
ATOM 9587   C CG   . ASP B 2 352 ? -16.357 -10.139 -30.734 1.00 30.22 ? 352 ASP B CG   1  
ATOM 9588   O OD1  . ASP B 2 352 ? -16.520 -11.389 -30.788 1.00 23.32 ? 352 ASP B OD1  1  
ATOM 9589   O OD2  . ASP B 2 352 ? -15.342 -9.586  -31.207 1.00 33.03 ? 352 ASP B OD2  1  
ATOM 9590   H H    . ASP B 2 352 ? -20.125 -7.786  -30.764 1.00 11.34 ? 352 ASP B H    1  
ATOM 9591   H HA   . ASP B 2 352 ? -17.337 -7.519  -31.459 1.00 14.32 ? 352 ASP B HA   1  
ATOM 9592   H HB2  . ASP B 2 352 ? -17.055 -8.688  -29.319 1.00 1.51  ? 352 ASP B HB2  1  
ATOM 9593   H HB3  . ASP B 2 352 ? -18.270 -9.883  -29.757 1.00 12.24 ? 352 ASP B HB3  1  
ATOM 9594   N N    . HIS B 2 353 ? -17.605 -9.242  -33.336 1.00 31.14 ? 353 HIS B N    1  
ATOM 9595   C CA   . HIS B 2 353 ? -17.815 -9.948  -34.612 1.00 1.43  ? 353 HIS B CA   1  
ATOM 9596   C C    . HIS B 2 353 ? -16.516 -10.691 -34.974 1.00 3.44  ? 353 HIS B C    1  
ATOM 9597   O O    . HIS B 2 353 ? -16.559 -11.833 -35.438 1.00 12.21 ? 353 HIS B O    1  
ATOM 9598   C CB   . HIS B 2 353 ? -18.235 -8.943  -35.723 1.00 21.11 ? 353 HIS B CB   1  
ATOM 9599   C CG   . HIS B 2 353 ? -18.161 -9.458  -37.143 1.00 54.01 ? 353 HIS B CG   1  
ATOM 9600   N ND1  . HIS B 2 353 ? -17.109 -9.161  -37.987 1.00 41.32 ? 353 HIS B ND1  1  
ATOM 9601   C CD2  . HIS B 2 353 ? -18.998 -10.255 -37.854 1.00 23.22 ? 353 HIS B CD2  1  
ATOM 9602   C CE1  . HIS B 2 353 ? -17.308 -9.741  -39.155 1.00 54.12 ? 353 HIS B CE1  1  
ATOM 9603   N NE2  . HIS B 2 353 ? -18.446 -10.413 -39.101 1.00 74.33 ? 353 HIS B NE2  1  
ATOM 9604   H H    . HIS B 2 353 ? -16.691 -8.969  -33.110 1.00 53.53 ? 353 HIS B H    1  
ATOM 9605   H HA   . HIS B 2 353 ? -18.606 -10.684 -34.471 1.00 34.04 ? 353 HIS B HA   1  
ATOM 9606   H HB2  . HIS B 2 353 ? -19.257 -8.634  -35.548 1.00 71.05 ? 353 HIS B HB2  1  
ATOM 9607   H HB3  . HIS B 2 353 ? -17.601 -8.065  -35.657 1.00 51.02 ? 353 HIS B HB3  1  
ATOM 9608   H HD1  . HIS B 2 353 ? -16.341 -8.586  -37.766 1.00 43.51 ? 353 HIS B HD1  1  
ATOM 9609   H HD2  . HIS B 2 353 ? -19.928 -10.687 -37.501 1.00 40.31 ? 353 HIS B HD2  1  
ATOM 9610   H HE1  . HIS B 2 353 ? -16.645 -9.687  -40.006 1.00 71.54 ? 353 HIS B HE1  1  
ATOM 9611   H HE2  . HIS B 2 353 ? -18.920 -10.765 -39.886 1.00 37.66 ? 353 HIS B HE2  1  
ATOM 9612   N N    . ALA B 2 354 ? -15.365 -10.018 -34.756 1.00 13.42 ? 354 ALA B N    1  
ATOM 9613   C CA   . ALA B 2 354 ? -14.026 -10.603 -34.975 1.00 42.13 ? 354 ALA B CA   1  
ATOM 9614   C C    . ALA B 2 354 ? -12.930 -9.809  -34.223 1.00 24.34 ? 354 ALA B C    1  
ATOM 9615   O O    . ALA B 2 354 ? -11.737 -10.007 -34.488 1.00 44.11 ? 354 ALA B O    1  
ATOM 9616   C CB   . ALA B 2 354 ? -13.718 -10.671 -36.484 1.00 70.11 ? 354 ALA B CB   1  
ATOM 9617   H H    . ALA B 2 354 ? -15.418 -9.087  -34.456 1.00 45.25 ? 354 ALA B H    1  
ATOM 9618   H HA   . ALA B 2 354 ? -14.034 -11.618 -34.587 1.00 21.23 ? 354 ALA B HA   1  
ATOM 9619   H HB1  . ALA B 2 354 ? -14.485 -11.245 -36.990 1.00 72.23 ? 354 ALA B HB1  1  
ATOM 9620   H HB2  . ALA B 2 354 ? -12.757 -11.144 -36.644 1.00 20.30 ? 354 ALA B HB2  1  
ATOM 9621   H HB3  . ALA B 2 354 ? -13.695 -9.669  -36.893 1.00 50.52 ? 354 ALA B HB3  1  
ATOM 9622   N N    . ALA B 2 355 ? -13.357 -8.963  -33.251 1.00 52.22 ? 355 ALA B N    1  
ATOM 9623   C CA   . ALA B 2 355 ? -12.487 -8.029  -32.481 1.00 75.44 ? 355 ALA B CA   1  
ATOM 9624   C C    . ALA B 2 355 ? -11.871 -6.952  -33.409 1.00 24.43 ? 355 ALA B C    1  
ATOM 9625   O O    . ALA B 2 355 ? -12.356 -5.817  -33.436 1.00 63.12 ? 355 ALA B O    1  
ATOM 9626   C CB   . ALA B 2 355 ? -11.412 -8.779  -31.656 1.00 31.34 ? 355 ALA B CB   1  
ATOM 9627   H H    . ALA B 2 355 ? -14.306 -8.983  -33.022 1.00 31.34 ? 355 ALA B H    1  
ATOM 9628   H HA   . ALA B 2 355 ? -13.146 -7.524  -31.774 1.00 20.23 ? 355 ALA B HA   1  
ATOM 9629   H HB1  . ALA B 2 355 ? -11.887 -9.516  -31.024 1.00 11.03 ? 355 ALA B HB1  1  
ATOM 9630   H HB2  . ALA B 2 355 ? -10.868 -8.076  -31.040 1.00 53.44 ? 355 ALA B HB2  1  
ATOM 9631   H HB3  . ALA B 2 355 ? -10.723 -9.275  -32.327 1.00 44.11 ? 355 ALA B HB3  1  
ATOM 9632   N N    . ASN B 2 356 ? -10.816 -7.348  -34.159 1.00 54.04 ? 356 ASN B N    1  
ATOM 9633   C CA   . ASN B 2 356 ? -10.174 -6.552  -35.233 1.00 10.13 ? 356 ASN B CA   1  
ATOM 9634   C C    . ASN B 2 356 ? -9.546  -5.227  -34.711 1.00 41.33 ? 356 ASN B C    1  
ATOM 9635   O O    . ASN B 2 356 ? -10.279 -4.275  -34.410 1.00 53.15 ? 356 ASN B O    1  
ATOM 9636   C CB   . ASN B 2 356 ? -11.176 -6.300  -36.391 1.00 53.03 ? 356 ASN B CB   1  
ATOM 9637   C CG   . ASN B 2 356 ? -10.536 -5.812  -37.696 1.00 72.34 ? 356 ASN B CG   1  
ATOM 9638   O OD1  . ASN B 2 356 ? -9.360  -6.063  -37.970 1.00 74.32 ? 356 ASN B OD1  1  
ATOM 9639   N ND2  . ASN B 2 356 ? -11.325 -5.165  -38.536 1.00 45.14 ? 356 ASN B ND2  1  
ATOM 9640   H H    . ASN B 2 356 ? -10.456 -8.240  -33.989 1.00 23.14 ? 356 ASN B H    1  
ATOM 9641   H HA   . ASN B 2 356 ? -9.377  -7.174  -35.613 1.00 32.14 ? 356 ASN B HA   1  
ATOM 9642   H HB2  . ASN B 2 356 ? -11.700 -7.222  -36.605 1.00 22.43 ? 356 ASN B HB2  1  
ATOM 9643   H HB3  . ASN B 2 356 ? -11.900 -5.561  -36.064 1.00 3.13  ? 356 ASN B HB3  1  
ATOM 9644   H HD21 . ASN B 2 356 ? -12.261 -5.033  -38.281 1.00 4.13  ? 356 ASN B HD21 1  
ATOM 9645   H HD22 . ASN B 2 356 ? -10.946 -4.861  -39.386 1.00 34.41 ? 356 ASN B HD22 1  
ATOM 9646   N N    . PRO B 2 357 ? -8.174  -5.146  -34.630 1.00 55.22 ? 357 PRO B N    1  
ATOM 9647   C CA   . PRO B 2 357 ? -7.446  -3.994  -34.013 1.00 34.25 ? 357 PRO B CA   1  
ATOM 9648   C C    . PRO B 2 357 ? -7.800  -2.622  -34.639 1.00 11.12 ? 357 PRO B C    1  
ATOM 9649   O O    . PRO B 2 357 ? -7.943  -2.515  -35.863 1.00 52.34 ? 357 PRO B O    1  
ATOM 9650   C CB   . PRO B 2 357 ? -5.955  -4.344  -34.257 1.00 44.35 ? 357 PRO B CB   1  
ATOM 9651   C CG   . PRO B 2 357 ? -5.937  -5.830  -34.427 1.00 14.44 ? 357 PRO B CG   1  
ATOM 9652   C CD   . PRO B 2 357 ? -7.218  -6.168  -35.142 1.00 23.35 ? 357 PRO B CD   1  
ATOM 9653   H HA   . PRO B 2 357 ? -7.638  -3.956  -32.943 1.00 20.11 ? 357 PRO B HA   1  
ATOM 9654   H HB2  . PRO B 2 357 ? -5.580  -3.845  -35.156 1.00 53.43 ? 357 PRO B HB2  1  
ATOM 9655   H HB3  . PRO B 2 357 ? -5.353  -4.059  -33.404 1.00 71.03 ? 357 PRO B HB3  1  
ATOM 9656   H HG2  . PRO B 2 357 ? -5.074  -6.132  -35.015 1.00 62.41 ? 357 PRO B HG2  1  
ATOM 9657   H HG3  . PRO B 2 357 ? -5.915  -6.316  -33.456 1.00 74.21 ? 357 PRO B HG3  1  
ATOM 9658   H HD2  . PRO B 2 357 ? -7.100  -6.081  -36.218 1.00 42.14 ? 357 PRO B HD2  1  
ATOM 9659   H HD3  . PRO B 2 357 ? -7.547  -7.167  -34.882 1.00 33.13 ? 357 PRO B HD3  1  
ATOM 9660   N N    . CYS B 2 358 ? -7.928  -1.589  -33.775 1.00 23.30 ? 358 CYS B N    1  
ATOM 9661   C CA   . CYS B 2 358 ? -8.266  -0.209  -34.178 1.00 73.32 ? 358 CYS B CA   1  
ATOM 9662   C C    . CYS B 2 358 ? -7.138  0.453   -35.010 1.00 3.43  ? 358 CYS B C    1  
ATOM 9663   O O    . CYS B 2 358 ? -6.006  -0.046  -35.054 1.00 30.40 ? 358 CYS B O    1  
ATOM 9664   C CB   . CYS B 2 358 ? -8.581  0.633   -32.925 1.00 32.13 ? 358 CYS B CB   1  
ATOM 9665   S SG   . CYS B 2 358 ? -9.946  -0.015  -31.937 1.00 73.24 ? 358 CYS B SG   1  
ATOM 9666   H H    . CYS B 2 358 ? -7.789  -1.767  -32.827 1.00 13.32 ? 358 CYS B H    1  
ATOM 9667   H HA   . CYS B 2 358 ? -9.159  -0.259  -34.788 1.00 43.24 ? 358 CYS B HA   1  
ATOM 9668   H HB2  . CYS B 2 358 ? -7.709  0.671   -32.285 1.00 75.21 ? 358 CYS B HB2  1  
ATOM 9669   H HB3  . CYS B 2 358 ? -8.846  1.641   -33.221 1.00 31.30 ? 358 CYS B HB3  1  
ATOM 9670   H HG   . CYS B 2 358 ? -10.820 0.968   -31.774 1.00 15.14 ? 358 CYS B HG   1  
ATOM 9671   N N    . GLY B 2 359 ? -7.472  1.579   -35.676 1.00 2.15  ? 359 GLY B N    1  
ATOM 9672   C CA   . GLY B 2 359 ? -6.498  2.342   -36.462 1.00 3.11  ? 359 GLY B CA   1  
ATOM 9673   C C    . GLY B 2 359 ? -5.454  3.023   -35.578 1.00 53.54 ? 359 GLY B C    1  
ATOM 9674   O O    . GLY B 2 359 ? -5.809  3.902   -34.788 1.00 62.01 ? 359 GLY B O    1  
ATOM 9675   H H    . GLY B 2 359 ? -8.397  1.898   -35.629 1.00 30.02 ? 359 GLY B H    1  
ATOM 9676   H HA2  . GLY B 2 359 ? -6.004  1.677   -37.165 1.00 72.04 ? 359 GLY B HA2  1  
ATOM 9677   H HA3  . GLY B 2 359 ? -7.027  3.100   -37.023 1.00 63.32 ? 359 GLY B HA3  1  
ATOM 9678   N N    . GLN B 2 360 ? -4.177  2.575   -35.698 1.00 23.31 ? 360 GLN B N    1  
ATOM 9679   C CA   . GLN B 2 360 ? -3.026  3.067   -34.891 1.00 15.21 ? 360 GLN B CA   1  
ATOM 9680   C C    . GLN B 2 360 ? -3.224  2.688   -33.394 1.00 45.12 ? 360 GLN B C    1  
ATOM 9681   O O    . GLN B 2 360 ? -2.821  3.428   -32.486 1.00 20.13 ? 360 GLN B O    1  
ATOM 9682   C CB   . GLN B 2 360 ? -2.821  4.610   -35.081 1.00 21.53 ? 360 GLN B CB   1  
ATOM 9683   C CG   . GLN B 2 360 ? -1.389  5.141   -34.776 1.00 12.45 ? 360 GLN B CG   1  
ATOM 9684   C CD   . GLN B 2 360 ? -0.388  4.924   -35.920 1.00 4.22  ? 360 GLN B CD   1  
ATOM 9685   O OE1  . GLN B 2 360 ? -0.769  4.883   -37.087 1.00 53.34 ? 360 GLN B OE1  1  
ATOM 9686   N NE2  . GLN B 2 360 ? 0.891   4.868   -35.606 1.00 2.44  ? 360 GLN B NE2  1  
ATOM 9687   H H    . GLN B 2 360 ? -4.003  1.875   -36.361 1.00 11.03 ? 360 GLN B H    1  
ATOM 9688   H HA   . GLN B 2 360 ? -2.148  2.548   -35.256 1.00 1.52  ? 360 GLN B HA   1  
ATOM 9689   H HB2  . GLN B 2 360 ? -3.062  4.865   -36.109 1.00 32.53 ? 360 GLN B HB2  1  
ATOM 9690   H HB3  . GLN B 2 360 ? -3.521  5.136   -34.438 1.00 10.51 ? 360 GLN B HB3  1  
ATOM 9691   H HG2  . GLN B 2 360 ? -1.447  6.200   -34.581 1.00 2.12  ? 360 GLN B HG2  1  
ATOM 9692   H HG3  . GLN B 2 360 ? -1.017  4.639   -33.889 1.00 41.14 ? 360 GLN B HG3  1  
ATOM 9693   H HE21 . GLN B 2 360 ? 1.142   4.965   -34.665 1.00 25.33 ? 360 GLN B HE21 1  
ATOM 9694   H HE22 . GLN B 2 360 ? 1.544   4.732   -36.323 1.00 23.11 ? 360 GLN B HE22 1  
ATOM 9695   N N    . ILE B 2 361 ? -3.823  1.493   -33.169 1.00 22.12 ? 361 ILE B N    1  
ATOM 9696   C CA   . ILE B 2 361 ? -4.183  0.974   -31.819 1.00 21.32 ? 361 ILE B CA   1  
ATOM 9697   C C    . ILE B 2 361 ? -2.951  0.872   -30.882 1.00 1.41  ? 361 ILE B C    1  
ATOM 9698   O O    . ILE B 2 361 ? -3.061  1.069   -29.666 1.00 24.31 ? 361 ILE B O    1  
ATOM 9699   C CB   . ILE B 2 361 ? -4.906  -0.424  -31.944 1.00 42.23 ? 361 ILE B CB   1  
ATOM 9700   C CG1  . ILE B 2 361 ? -5.377  -0.965  -30.551 1.00 2.23  ? 361 ILE B CG1  1  
ATOM 9701   C CG2  . ILE B 2 361 ? -4.009  -1.456  -32.677 1.00 35.43 ? 361 ILE B CG2  1  
ATOM 9702   C CD1  . ILE B 2 361 ? -6.313  -2.156  -30.619 1.00 61.31 ? 361 ILE B CD1  1  
ATOM 9703   H H    . ILE B 2 361 ? -4.038  0.935   -33.947 1.00 12.23 ? 361 ILE B H    1  
ATOM 9704   H HA   . ILE B 2 361 ? -4.889  1.678   -31.384 1.00 61.10 ? 361 ILE B HA   1  
ATOM 9705   H HB   . ILE B 2 361 ? -5.785  -0.272  -32.568 1.00 33.24 ? 361 ILE B HB   1  
ATOM 9706   H HG12 . ILE B 2 361 ? -4.514  -1.268  -29.971 1.00 64.41 ? 361 ILE B HG12 1  
ATOM 9707   H HG13 . ILE B 2 361 ? -5.893  -0.176  -30.016 1.00 53.21 ? 361 ILE B HG13 1  
ATOM 9708   H HG21 . ILE B 2 361 ? -3.102  -1.623  -32.107 1.00 4.20  ? 361 ILE B HG21 1  
ATOM 9709   H HG22 . ILE B 2 361 ? -3.747  -1.082  -33.657 1.00 23.12 ? 361 ILE B HG22 1  
ATOM 9710   H HG23 . ILE B 2 361 ? -4.539  -2.395  -32.786 1.00 21.42 ? 361 ILE B HG23 1  
ATOM 9711   H HD11 . ILE B 2 361 ? -7.198  -1.893  -31.184 1.00 11.40 ? 361 ILE B HD11 1  
ATOM 9712   H HD12 . ILE B 2 361 ? -6.599  -2.446  -29.620 1.00 64.33 ? 361 ILE B HD12 1  
ATOM 9713   H HD13 . ILE B 2 361 ? -5.811  -2.982  -31.103 1.00 11.23 ? 361 ILE B HD13 1  
ATOM 9714   N N    . GLY B 2 362 ? -1.788  0.581   -31.474 1.00 14.35 ? 362 GLY B N    1  
ATOM 9715   C CA   . GLY B 2 362 ? -0.530  0.532   -30.747 1.00 42.32 ? 362 GLY B CA   1  
ATOM 9716   C C    . GLY B 2 362 ? 0.637   0.673   -31.691 1.00 72.35 ? 362 GLY B C    1  
ATOM 9717   O O    . GLY B 2 362 ? 1.023   -0.307  -32.351 1.00 23.23 ? 362 GLY B O    1  
ATOM 9718   H H    . GLY B 2 362 ? -1.788  0.394   -32.435 1.00 42.23 ? 362 GLY B H    1  
ATOM 9719   H HA2  . GLY B 2 362 ? -0.501  1.331   -30.012 1.00 21.54 ? 362 GLY B HA2  1  
ATOM 9720   H HA3  . GLY B 2 362 ? -0.451  -0.416  -30.232 1.00 22.52 ? 362 GLY B HA3  1  
ATOM 9721   N N    . GLU B 2 363 ? 1.162   1.906   -31.786 1.00 5.21  ? 363 GLU B N    1  
ATOM 9722   C CA   . GLU B 2 363 ? 2.361   2.232   -32.569 1.00 62.31 ? 363 GLU B CA   1  
ATOM 9723   C C    . GLU B 2 363 ? 2.684   3.710   -32.321 1.00 20.24 ? 363 GLU B C    1  
ATOM 9724   O O    . GLU B 2 363 ? 2.189   4.551   -33.054 1.00 51.53 ? 363 GLU B O    1  
ATOM 9725   C CB   . GLU B 2 363 ? 2.135   1.938   -34.099 1.00 62.03 ? 363 GLU B CB   1  
ATOM 9726   C CG   . GLU B 2 363 ? 3.409   1.844   -34.970 1.00 73.13 ? 363 GLU B CG   1  
ATOM 9727   C CD   . GLU B 2 363 ? 4.154   3.174   -35.235 1.00 22.41 ? 363 GLU B CD   1  
ATOM 9728   O OE1  . GLU B 2 363 ? 5.239   3.390   -34.651 1.00 71.51 ? 363 GLU B OE1  1  
ATOM 9729   O OE2  . GLU B 2 363 ? 3.670   3.990   -36.050 1.00 23.04 ? 363 GLU B OE2  1  
ATOM 9730   H H    . GLU B 2 363 ? 0.713   2.638   -31.313 1.00 23.01 ? 363 GLU B H    1  
ATOM 9731   H HA   . GLU B 2 363 ? 3.182   1.625   -32.201 1.00 23.25 ? 363 GLU B HA   1  
ATOM 9732   H HB2  . GLU B 2 363 ? 1.615   0.991   -34.183 1.00 71.21 ? 363 GLU B HB2  1  
ATOM 9733   H HB3  . GLU B 2 363 ? 1.494   2.710   -34.514 1.00 60.54 ? 363 GLU B HB3  1  
ATOM 9734   H HG2  . GLU B 2 363 ? 4.095   1.155   -34.490 1.00 43.32 ? 363 GLU B HG2  1  
ATOM 9735   H HG3  . GLU B 2 363 ? 3.129   1.414   -35.929 1.00 14.24 ? 363 GLU B HG3  1  
ATOM 9736   N N    . THR B 2 364 ? 3.454   4.002   -31.248 1.00 1.12  ? 364 THR B N    1  
ATOM 9737   C CA   . THR B 2 364 ? 3.899   5.373   -30.884 1.00 74.04 ? 364 THR B CA   1  
ATOM 9738   C C    . THR B 2 364 ? 2.702   6.309   -30.488 1.00 45.52 ? 364 THR B C    1  
ATOM 9739   O O    . THR B 2 364 ? 2.544   6.667   -29.312 1.00 64.51 ? 364 THR B O    1  
ATOM 9740   C CB   . THR B 2 364 ? 4.782   5.999   -32.028 1.00 10.41 ? 364 THR B CB   1  
ATOM 9741   O OG1  . THR B 2 364 ? 5.913   5.144   -32.270 1.00 14.34 ? 364 THR B OG1  1  
ATOM 9742   C CG2  . THR B 2 364 ? 5.284   7.419   -31.708 1.00 54.44 ? 364 THR B CG2  1  
ATOM 9743   H H    . THR B 2 364 ? 3.746   3.264   -30.682 1.00 35.03 ? 364 THR B H    1  
ATOM 9744   H HA   . THR B 2 364 ? 4.531   5.262   -30.008 1.00 64.54 ? 364 THR B HA   1  
ATOM 9745   H HB   . THR B 2 364 ? 4.179   6.039   -32.936 1.00 10.42 ? 364 THR B HB   1  
ATOM 9746   H HG1  . THR B 2 364 ? 5.701   4.542   -32.985 1.00 34.15 ? 364 THR B HG1  1  
ATOM 9747   H HG21 . THR B 2 364 ? 5.901   7.398   -30.821 1.00 12.22 ? 364 THR B HG21 1  
ATOM 9748   H HG22 . THR B 2 364 ? 4.437   8.081   -31.543 1.00 13.22 ? 364 THR B HG22 1  
ATOM 9749   H HG23 . THR B 2 364 ? 5.874   7.791   -32.531 1.00 70.13 ? 364 THR B HG23 1  
ATOM 9750   N N    . VAL B 2 365 ? 1.864   6.672   -31.485 1.00 71.41 ? 365 VAL B N    1  
ATOM 9751   C CA   . VAL B 2 365 ? 0.695   7.577   -31.361 1.00 42.24 ? 365 VAL B CA   1  
ATOM 9752   C C    . VAL B 2 365 ? 1.188   8.998   -30.973 1.00 73.30 ? 365 VAL B C    1  
ATOM 9753   O O    . VAL B 2 365 ? 0.614   9.676   -30.116 1.00 74.01 ? 365 VAL B O    1  
ATOM 9754   C CB   . VAL B 2 365 ? -0.437  6.989   -30.407 1.00 32.20 ? 365 VAL B CB   1  
ATOM 9755   C CG1  . VAL B 2 365 ? -1.730  7.853   -30.433 1.00 73.32 ? 365 VAL B CG1  1  
ATOM 9756   C CG2  . VAL B 2 365 ? -0.761  5.519   -30.790 1.00 64.13 ? 365 VAL B CG2  1  
ATOM 9757   H H    . VAL B 2 365 ? 2.059   6.333   -32.375 1.00 71.34 ? 365 VAL B H    1  
ATOM 9758   H HA   . VAL B 2 365 ? 0.272   7.652   -32.358 1.00 34.41 ? 365 VAL B HA   1  
ATOM 9759   H HB   . VAL B 2 365 ? -0.049  6.990   -29.387 1.00 22.42 ? 365 VAL B HB   1  
ATOM 9760   H HG11 . VAL B 2 365 ? -2.131  7.888   -31.441 1.00 13.54 ? 365 VAL B HG11 1  
ATOM 9761   H HG12 . VAL B 2 365 ? -1.501  8.859   -30.109 1.00 23.51 ? 365 VAL B HG12 1  
ATOM 9762   H HG13 . VAL B 2 365 ? -2.473  7.428   -29.771 1.00 21.15 ? 365 VAL B HG13 1  
ATOM 9763   H HG21 . VAL B 2 365 ? -1.153  5.478   -31.802 1.00 3.11  ? 365 VAL B HG21 1  
ATOM 9764   H HG22 . VAL B 2 365 ? -1.495  5.113   -30.109 1.00 44.32 ? 365 VAL B HG22 1  
ATOM 9765   H HG23 . VAL B 2 365 ? 0.140   4.920   -30.733 1.00 74.51 ? 365 VAL B HG23 1  
ATOM 9766   N N    . ASP B 2 366 ? 2.301   9.401   -31.654 1.00 24.43 ? 366 ASP B N    1  
ATOM 9767   C CA   . ASP B 2 366 ? 2.998   10.716  -31.519 1.00 3.32  ? 366 ASP B CA   1  
ATOM 9768   C C    . ASP B 2 366 ? 3.715   10.857  -30.151 1.00 1.53  ? 366 ASP B C    1  
ATOM 9769   O O    . ASP B 2 366 ? 4.936   11.041  -30.099 1.00 1.04  ? 366 ASP B O    1  
ATOM 9770   C CB   . ASP B 2 366 ? 2.027   11.906  -31.791 1.00 1.21  ? 366 ASP B CB   1  
ATOM 9771   C CG   . ASP B 2 366 ? 2.674   13.297  -31.648 1.00 42.35 ? 366 ASP B CG   1  
ATOM 9772   O OD1  . ASP B 2 366 ? 2.330   14.047  -30.703 1.00 50.12 ? 366 ASP B OD1  1  
ATOM 9773   O OD2  . ASP B 2 366 ? 3.536   13.647  -32.476 1.00 42.24 ? 366 ASP B OD2  1  
ATOM 9774   H H    . ASP B 2 366 ? 2.672   8.766   -32.303 1.00 44.34 ? 366 ASP B H    1  
ATOM 9775   H HA   . ASP B 2 366 ? 3.760   10.720  -32.291 1.00 42.33 ? 366 ASP B HA   1  
ATOM 9776   H HB2  . ASP B 2 366 ? 1.640   11.818  -32.801 1.00 52.52 ? 366 ASP B HB2  1  
ATOM 9777   H HB3  . ASP B 2 366 ? 1.188   11.835  -31.102 1.00 22.30 ? 366 ASP B HB3  1  
ATOM 9778   N N    . LEU B 2 367 ? 2.935   10.781  -29.061 1.00 75.05 ? 367 LEU B N    1  
ATOM 9779   C CA   . LEU B 2 367 ? 3.415   10.806  -27.657 1.00 50.43 ? 367 LEU B CA   1  
ATOM 9780   C C    . LEU B 2 367 ? 4.504   9.724   -27.360 1.00 24.03 ? 367 LEU B C    1  
ATOM 9781   O O    . LEU B 2 367 ? 5.325   9.914   -26.455 1.00 72.23 ? 367 LEU B O    1  
ATOM 9782   C CB   . LEU B 2 367 ? 2.171   10.633  -26.728 1.00 71.45 ? 367 LEU B CB   1  
ATOM 9783   C CG   . LEU B 2 367 ? 2.412   10.622  -25.183 1.00 10.50 ? 367 LEU B CG   1  
ATOM 9784   C CD1  . LEU B 2 367 ? 3.127   11.906  -24.703 1.00 53.23 ? 367 LEU B CD1  1  
ATOM 9785   C CD2  . LEU B 2 367 ? 1.075   10.412  -24.425 1.00 72.21 ? 367 LEU B CD2  1  
ATOM 9786   H H    . LEU B 2 367 ? 1.973   10.744  -29.205 1.00 61.55 ? 367 LEU B H    1  
ATOM 9787   H HA   . LEU B 2 367 ? 3.840   11.789  -27.481 1.00 73.51 ? 367 LEU B HA   1  
ATOM 9788   H HB2  . LEU B 2 367 ? 1.477   11.437  -26.949 1.00 14.12 ? 367 LEU B HB2  1  
ATOM 9789   H HB3  . LEU B 2 367 ? 1.686   9.695   -26.998 1.00 41.32 ? 367 LEU B HB3  1  
ATOM 9790   H HG   . LEU B 2 367 ? 3.060   9.789   -24.942 1.00 65.23 ? 367 LEU B HG   1  
ATOM 9791   H HD11 . LEU B 2 367 ? 3.253   11.876  -23.628 1.00 2.45  ? 367 LEU B HD11 1  
ATOM 9792   H HD12 . LEU B 2 367 ? 2.545   12.778  -24.971 1.00 5.23  ? 367 LEU B HD12 1  
ATOM 9793   H HD13 . LEU B 2 367 ? 4.102   11.973  -25.169 1.00 50.44 ? 367 LEU B HD13 1  
ATOM 9794   H HD21 . LEU B 2 367 ? 0.636   9.469   -24.721 1.00 21.30 ? 367 LEU B HD21 1  
ATOM 9795   H HD22 . LEU B 2 367 ? 0.384   11.215  -24.656 1.00 5.51  ? 367 LEU B HD22 1  
ATOM 9796   H HD23 . LEU B 2 367 ? 1.259   10.396  -23.359 1.00 51.31 ? 367 LEU B HD23 1  
ATOM 9797   N N    . ASP B 2 368 ? 4.473   8.613   -28.138 1.00 41.24 ? 368 ASP B N    1  
ATOM 9798   C CA   . ASP B 2 368 ? 5.385   7.426   -28.027 1.00 52.42 ? 368 ASP B CA   1  
ATOM 9799   C C    . ASP B 2 368 ? 4.955   6.464   -26.895 1.00 21.21 ? 368 ASP B C    1  
ATOM 9800   O O    . ASP B 2 368 ? 5.351   5.310   -26.882 1.00 53.11 ? 368 ASP B O    1  
ATOM 9801   C CB   . ASP B 2 368 ? 6.890   7.822   -27.907 1.00 61.52 ? 368 ASP B CB   1  
ATOM 9802   C CG   . ASP B 2 368 ? 7.870   6.638   -28.046 1.00 71.23 ? 368 ASP B CG   1  
ATOM 9803   O OD1  . ASP B 2 368 ? 8.340   6.109   -27.014 1.00 33.54 ? 368 ASP B OD1  1  
ATOM 9804   O OD2  . ASP B 2 368 ? 8.148   6.224   -29.193 1.00 41.24 ? 368 ASP B OD2  1  
ATOM 9805   H H    . ASP B 2 368 ? 3.798   8.585   -28.843 1.00 21.22 ? 368 ASP B H    1  
ATOM 9806   H HA   . ASP B 2 368 ? 5.259   6.888   -28.957 1.00 35.32 ? 368 ASP B HA   1  
ATOM 9807   H HB2  . ASP B 2 368 ? 7.117   8.542   -28.685 1.00 51.13 ? 368 ASP B HB2  1  
ATOM 9808   H HB3  . ASP B 2 368 ? 7.051   8.301   -26.945 1.00 73.23 ? 368 ASP B HB3  1  
ATOM 9809   N N    . GLU B 2 369 ? 4.077   6.925   -26.002 1.00 2.41  ? 369 GLU B N    1  
ATOM 9810   C CA   . GLU B 2 369 ? 3.637   6.161   -24.816 1.00 21.13 ? 369 GLU B CA   1  
ATOM 9811   C C    . GLU B 2 369 ? 2.902   4.847   -25.182 1.00 70.10 ? 369 GLU B C    1  
ATOM 9812   O O    . GLU B 2 369 ? 2.772   3.963   -24.341 1.00 40.22 ? 369 GLU B O    1  
ATOM 9813   C CB   . GLU B 2 369 ? 2.748   7.067   -23.935 1.00 21.34 ? 369 GLU B CB   1  
ATOM 9814   C CG   . GLU B 2 369 ? 2.363   6.494   -22.553 1.00 13.34 ? 369 GLU B CG   1  
ATOM 9815   C CD   . GLU B 2 369 ? 1.356   7.384   -21.819 1.00 13.42 ? 369 GLU B CD   1  
ATOM 9816   O OE1  . GLU B 2 369 ? 1.670   8.580   -21.603 1.00 31.31 ? 369 GLU B OE1  1  
ATOM 9817   O OE2  . GLU B 2 369 ? 0.247   6.908   -21.472 1.00 52.20 ? 369 GLU B OE2  1  
ATOM 9818   H H    . GLU B 2 369 ? 3.721   7.819   -26.127 1.00 73.34 ? 369 GLU B H    1  
ATOM 9819   H HA   . GLU B 2 369 ? 4.527   5.904   -24.253 1.00 74.11 ? 369 GLU B HA   1  
ATOM 9820   H HB2  . GLU B 2 369 ? 3.277   7.996   -23.768 1.00 5.54  ? 369 GLU B HB2  1  
ATOM 9821   H HB3  . GLU B 2 369 ? 1.831   7.290   -24.474 1.00 12.12 ? 369 GLU B HB3  1  
ATOM 9822   H HG2  . GLU B 2 369 ? 1.937   5.509   -22.691 1.00 14.52 ? 369 GLU B HG2  1  
ATOM 9823   H HG3  . GLU B 2 369 ? 3.260   6.404   -21.941 1.00 22.11 ? 369 GLU B HG3  1  
ATOM 9824   N N    . ALA B 2 370 ? 2.457   4.712   -26.454 1.00 74.25 ? 370 ALA B N    1  
ATOM 9825   C CA   . ALA B 2 370 ? 1.818   3.466   -26.953 1.00 0.12  ? 370 ALA B CA   1  
ATOM 9826   C C    . ALA B 2 370 ? 2.749   2.246   -26.805 1.00 54.03 ? 370 ALA B C    1  
ATOM 9827   O O    . ALA B 2 370 ? 2.283   1.100   -26.748 1.00 40.00 ? 370 ALA B O    1  
ATOM 9828   C CB   . ALA B 2 370 ? 1.379   3.629   -28.411 1.00 21.11 ? 370 ALA B CB   1  
ATOM 9829   H H    . ALA B 2 370 ? 2.561   5.466   -27.063 1.00 60.43 ? 370 ALA B H    1  
ATOM 9830   H HA   . ALA B 2 370 ? 0.923   3.294   -26.351 1.00 43.10 ? 370 ALA B HA   1  
ATOM 9831   H HB1  . ALA B 2 370 ? 2.245   3.771   -29.044 1.00 11.02 ? 370 ALA B HB1  1  
ATOM 9832   H HB2  . ALA B 2 370 ? 0.728   4.491   -28.500 1.00 44.44 ? 370 ALA B HB2  1  
ATOM 9833   H HB3  . ALA B 2 370 ? 0.843   2.747   -28.739 1.00 14.01 ? 370 ALA B HB3  1  
ATOM 9834   N N    . VAL B 2 371 ? 4.067   2.515   -26.750 1.00 25.43 ? 371 VAL B N    1  
ATOM 9835   C CA   . VAL B 2 371 ? 5.104   1.489   -26.607 1.00 0.04  ? 371 VAL B CA   1  
ATOM 9836   C C    . VAL B 2 371 ? 5.744   1.516   -25.188 1.00 3.44  ? 371 VAL B C    1  
ATOM 9837   O O    . VAL B 2 371 ? 6.750   0.847   -24.949 1.00 52.11 ? 371 VAL B O    1  
ATOM 9838   C CB   . VAL B 2 371 ? 6.208   1.654   -27.718 1.00 4.32  ? 371 VAL B CB   1  
ATOM 9839   C CG1  . VAL B 2 371 ? 5.577   1.716   -29.132 1.00 74.11 ? 371 VAL B CG1  1  
ATOM 9840   C CG2  . VAL B 2 371 ? 7.108   2.877   -27.447 1.00 31.44 ? 371 VAL B CG2  1  
ATOM 9841   H H    . VAL B 2 371 ? 4.352   3.449   -26.799 1.00 51.15 ? 371 VAL B H    1  
ATOM 9842   H HA   . VAL B 2 371 ? 4.639   0.514   -26.746 1.00 74.12 ? 371 VAL B HA   1  
ATOM 9843   H HB   . VAL B 2 371 ? 6.840   0.767   -27.686 1.00 65.22 ? 371 VAL B HB   1  
ATOM 9844   H HG11 . VAL B 2 371 ? 5.005   0.815   -29.318 1.00 21.24 ? 371 VAL B HG11 1  
ATOM 9845   H HG12 . VAL B 2 371 ? 6.358   1.797   -29.876 1.00 35.23 ? 371 VAL B HG12 1  
ATOM 9846   H HG13 . VAL B 2 371 ? 4.921   2.577   -29.208 1.00 3.40  ? 371 VAL B HG13 1  
ATOM 9847   H HG21 . VAL B 2 371 ? 6.509   3.771   -27.413 1.00 11.44 ? 371 VAL B HG21 1  
ATOM 9848   H HG22 . VAL B 2 371 ? 7.839   2.974   -28.235 1.00 11.10 ? 371 VAL B HG22 1  
ATOM 9849   H HG23 . VAL B 2 371 ? 7.622   2.757   -26.499 1.00 33.25 ? 371 VAL B HG23 1  
ATOM 9850   N N    . GLN B 2 372 ? 5.128   2.254   -24.245 1.00 2.24  ? 372 GLN B N    1  
ATOM 9851   C CA   . GLN B 2 372 ? 5.653   2.450   -22.870 1.00 52.21 ? 372 GLN B CA   1  
ATOM 9852   C C    . GLN B 2 372 ? 4.533   2.284   -21.824 1.00 33.22 ? 372 GLN B C    1  
ATOM 9853   O O    . GLN B 2 372 ? 3.357   2.531   -22.104 1.00 63.20 ? 372 GLN B O    1  
ATOM 9854   C CB   . GLN B 2 372 ? 6.324   3.860   -22.738 1.00 13.44 ? 372 GLN B CB   1  
ATOM 9855   C CG   . GLN B 2 372 ? 6.864   4.266   -21.330 1.00 44.20 ? 372 GLN B CG   1  
ATOM 9856   C CD   . GLN B 2 372 ? 7.918   3.319   -20.708 1.00 14.21 ? 372 GLN B CD   1  
ATOM 9857   O OE1  . GLN B 2 372 ? 7.926   2.102   -20.915 1.00 34.32 ? 372 GLN B OE1  1  
ATOM 9858   N NE2  . GLN B 2 372 ? 8.826   3.875   -19.938 1.00 60.13 ? 372 GLN B NE2  1  
ATOM 9859   H H    . GLN B 2 372 ? 4.280   2.670   -24.470 1.00 15.50 ? 372 GLN B H    1  
ATOM 9860   H HA   . GLN B 2 372 ? 6.404   1.687   -22.686 1.00 3.44  ? 372 GLN B HA   1  
ATOM 9861   H HB2  . GLN B 2 372 ? 7.157   3.906   -23.431 1.00 44.32 ? 372 GLN B HB2  1  
ATOM 9862   H HB3  . GLN B 2 372 ? 5.599   4.611   -23.044 1.00 14.21 ? 372 GLN B HB3  1  
ATOM 9863   H HG2  . GLN B 2 372 ? 7.298   5.256   -21.404 1.00 20.11 ? 372 GLN B HG2  1  
ATOM 9864   H HG3  . GLN B 2 372 ? 6.020   4.317   -20.644 1.00 2.22  ? 372 GLN B HG3  1  
ATOM 9865   H HE21 . GLN B 2 372 ? 8.783   4.845   -19.790 1.00 32.23 ? 372 GLN B HE21 1  
ATOM 9866   H HE22 . GLN B 2 372 ? 9.494   3.296   -19.519 1.00 3.32  ? 372 GLN B HE22 1  
ATOM 9867   N N    . ARG B 2 373 ? 4.919   1.841   -20.613 1.00 70.13 ? 373 ARG B N    1  
ATOM 9868   C CA   . ARG B 2 373 ? 4.009   1.739   -19.465 1.00 63.23 ? 373 ARG B CA   1  
ATOM 9869   C C    . ARG B 2 373 ? 4.781   2.021   -18.151 1.00 3.41  ? 373 ARG B C    1  
ATOM 9870   O O    . ARG B 2 373 ? 4.648   1.281   -17.158 1.00 11.33 ? 373 ARG B O    1  
ATOM 9871   C CB   . ARG B 2 373 ? 3.303   0.352   -19.448 1.00 40.23 ? 373 ARG B CB   1  
ATOM 9872   C CG   . ARG B 2 373 ? 4.244   -0.881  -19.374 1.00 70.54 ? 373 ARG B CG   1  
ATOM 9873   C CD   . ARG B 2 373 ? 3.529   -2.109  -18.788 1.00 1.31  ? 373 ARG B CD   1  
ATOM 9874   N NE   . ARG B 2 373 ? 2.986   -1.784  -17.448 1.00 13.34 ? 373 ARG B NE   1  
ATOM 9875   C CZ   . ARG B 2 373 ? 1.707   -1.889  -17.068 1.00 11.23 ? 373 ARG B CZ   1  
ATOM 9876   N NH1  . ARG B 2 373 ? 0.790   -2.342  -17.902 1.00 42.00 ? 373 ARG B NH1  1  
ATOM 9877   N NH2  . ARG B 2 373 ? 1.347   -1.468  -15.865 1.00 72.05 ? 373 ARG B NH2  1  
ATOM 9878   H H    . ARG B 2 373 ? 5.858   1.584   -20.486 1.00 4.40  ? 373 ARG B H    1  
ATOM 9879   H HA   . ARG B 2 373 ? 3.248   2.508   -19.567 1.00 61.23 ? 373 ARG B HA   1  
ATOM 9880   H HB2  . ARG B 2 373 ? 2.635   0.322   -18.596 1.00 42.24 ? 373 ARG B HB2  1  
ATOM 9881   H HB3  . ARG B 2 373 ? 2.704   0.261   -20.350 1.00 72.20 ? 373 ARG B HB3  1  
ATOM 9882   H HG2  . ARG B 2 373 ? 4.595   -1.120  -20.372 1.00 52.12 ? 373 ARG B HG2  1  
ATOM 9883   H HG3  . ARG B 2 373 ? 5.098   -0.637  -18.748 1.00 11.33 ? 373 ARG B HG3  1  
ATOM 9884   H HD2  . ARG B 2 373 ? 2.726   -2.410  -19.455 1.00 12.41 ? 373 ARG B HD2  1  
ATOM 9885   H HD3  . ARG B 2 373 ? 4.239   -2.919  -18.690 1.00 42.02 ? 373 ARG B HD3  1  
ATOM 9886   H HE   . ARG B 2 373 ? 3.633   -1.466  -16.790 1.00 62.20 ? 373 ARG B HE   1  
ATOM 9887   H HH11 . ARG B 2 373 ? 1.044   -2.616  -18.833 1.00 70.21 ? 373 ARG B HH11 1  
ATOM 9888   H HH12 . ARG B 2 373 ? -0.163  -2.421  -17.607 1.00 53.24 ? 373 ARG B HH12 1  
ATOM 9889   H HH21 . ARG B 2 373 ? 2.031   -1.071  -15.249 1.00 24.13 ? 373 ARG B HH21 1  
ATOM 9890   H HH22 . ARG B 2 373 ? 0.389   -1.539  -15.565 1.00 33.21 ? 373 ARG B HH22 1  
ATOM 9891   N N    . ALA B 2 374 ? 5.547   3.143   -18.163 1.00 51.42 ? 374 ALA B N    1  
ATOM 9892   C CA   . ALA B 2 374 ? 6.482   3.547   -17.078 1.00 30.53 ? 374 ALA B CA   1  
ATOM 9893   C C    . ALA B 2 374 ? 7.670   2.560   -16.942 1.00 71.45 ? 374 ALA B C    1  
ATOM 9894   O O    . ALA B 2 374 ? 7.761   1.579   -17.698 1.00 32.54 ? 374 ALA B O    1  
ATOM 9895   C CB   . ALA B 2 374 ? 5.740   3.739   -15.734 1.00 1.03  ? 374 ALA B CB   1  
ATOM 9896   H H    . ALA B 2 374 ? 5.469   3.739   -18.936 1.00 64.34 ? 374 ALA B H    1  
ATOM 9897   H HA   . ALA B 2 374 ? 6.887   4.509   -17.366 1.00 71.13 ? 374 ALA B HA   1  
ATOM 9898   H HB1  . ALA B 2 374 ? 6.428   4.116   -14.990 1.00 24.33 ? 374 ALA B HB1  1  
ATOM 9899   H HB2  . ALA B 2 374 ? 5.335   2.791   -15.402 1.00 0.33  ? 374 ALA B HB2  1  
ATOM 9900   H HB3  . ALA B 2 374 ? 4.931   4.445   -15.864 1.00 11.02 ? 374 ALA B HB3  1  
ATOM 9901   N N    . LEU B 2 375 ? 8.594   2.841   -15.993 1.00 2.55  ? 375 LEU B N    1  
ATOM 9902   C CA   . LEU B 2 375 ? 9.724   1.935   -15.678 1.00 51.21 ? 375 LEU B CA   1  
ATOM 9903   C C    . LEU B 2 375 ? 10.353  2.298   -14.318 1.00 44.20 ? 375 LEU B C    1  
ATOM 9904   O O    . LEU B 2 375 ? 10.767  1.409   -13.565 1.00 62.01 ? 375 LEU B O    1  
ATOM 9905   C CB   . LEU B 2 375 ? 10.801  1.965   -16.802 1.00 54.41 ? 375 LEU B CB   1  
ATOM 9906   C CG   . LEU B 2 375 ? 11.997  0.968   -16.659 1.00 13.12 ? 375 LEU B CG   1  
ATOM 9907   C CD1  . LEU B 2 375 ? 11.517  -0.506  -16.657 1.00 61.23 ? 375 LEU B CD1  1  
ATOM 9908   C CD2  . LEU B 2 375 ? 13.054  1.213   -17.762 1.00 55.21 ? 375 LEU B CD2  1  
ATOM 9909   H H    . LEU B 2 375 ? 8.518   3.682   -15.499 1.00 64.54 ? 375 LEU B H    1  
ATOM 9910   H HA   . LEU B 2 375 ? 9.324   0.926   -15.608 1.00 72.22 ? 375 LEU B HA   1  
ATOM 9911   H HB2  . LEU B 2 375 ? 10.305  1.763   -17.748 1.00 52.23 ? 375 LEU B HB2  1  
ATOM 9912   H HB3  . LEU B 2 375 ? 11.203  2.971   -16.849 1.00 3.11  ? 375 LEU B HB3  1  
ATOM 9913   H HG   . LEU B 2 375 ? 12.477  1.148   -15.704 1.00 13.13 ? 375 LEU B HG   1  
ATOM 9914   H HD11 . LEU B 2 375 ? 12.369  -1.168  -16.556 1.00 31.24 ? 375 LEU B HD11 1  
ATOM 9915   H HD12 . LEU B 2 375 ? 10.999  -0.730  -17.581 1.00 42.11 ? 375 LEU B HD12 1  
ATOM 9916   H HD13 . LEU B 2 375 ? 10.846  -0.670  -15.824 1.00 14.12 ? 375 LEU B HD13 1  
ATOM 9917   H HD21 . LEU B 2 375 ? 13.419  2.230   -17.698 1.00 32.52 ? 375 LEU B HD21 1  
ATOM 9918   H HD22 . LEU B 2 375 ? 12.614  1.053   -18.740 1.00 54.30 ? 375 LEU B HD22 1  
ATOM 9919   H HD23 . LEU B 2 375 ? 13.883  0.532   -17.629 1.00 41.54 ? 375 LEU B HD23 1  
ATOM 9920   N N    . GLU B 2 376 ? 10.429  3.610   -14.017 1.00 10.43 ? 376 GLU B N    1  
ATOM 9921   C CA   . GLU B 2 376 ? 11.072  4.132   -12.785 1.00 44.34 ? 376 GLU B CA   1  
ATOM 9922   C C    . GLU B 2 376 ? 10.071  4.818   -11.848 1.00 44.02 ? 376 GLU B C    1  
ATOM 9923   O O    . GLU B 2 376 ? 9.037   5.325   -12.286 1.00 33.23 ? 376 GLU B O    1  
ATOM 9924   C CB   . GLU B 2 376 ? 12.210  5.106   -13.174 1.00 52.22 ? 376 GLU B CB   1  
ATOM 9925   C CG   . GLU B 2 376 ? 13.443  4.409   -13.784 1.00 34.21 ? 376 GLU B CG   1  
ATOM 9926   C CD   . GLU B 2 376 ? 14.376  3.812   -12.722 1.00 61.31 ? 376 GLU B CD   1  
ATOM 9927   O OE1  . GLU B 2 376 ? 14.309  2.593   -12.455 1.00 73.13 ? 376 GLU B OE1  1  
ATOM 9928   O OE2  . GLU B 2 376 ? 15.167  4.581   -12.127 1.00 60.11 ? 376 GLU B OE2  1  
ATOM 9929   H H    . GLU B 2 376 ? 10.053  4.256   -14.653 1.00 54.25 ? 376 GLU B H    1  
ATOM 9930   H HA   . GLU B 2 376 ? 11.509  3.291   -12.248 1.00 11.32 ? 376 GLU B HA   1  
ATOM 9931   H HB2  . GLU B 2 376 ? 11.825  5.819   -13.901 1.00 25.02 ? 376 GLU B HB2  1  
ATOM 9932   H HB3  . GLU B 2 376 ? 12.529  5.658   -12.294 1.00 64.14 ? 376 GLU B HB3  1  
ATOM 9933   H HG2  . GLU B 2 376 ? 13.107  3.619   -14.452 1.00 14.23 ? 376 GLU B HG2  1  
ATOM 9934   H HG3  . GLU B 2 376 ? 14.000  5.131   -14.368 1.00 35.13 ? 376 GLU B HG3  1  
ATOM 9935   N N    . PHE B 2 377 ? 10.415  4.816   -10.549 1.00 60.11 ? 377 PHE B N    1  
ATOM 9936   C CA   . PHE B 2 377 ? 9.611   5.436   -9.488  1.00 72.02 ? 377 PHE B CA   1  
ATOM 9937   C C    . PHE B 2 377 ? 10.452  5.478   -8.204  1.00 11.42 ? 377 PHE B C    1  
ATOM 9938   O O    . PHE B 2 377 ? 10.796  6.551   -7.702  1.00 70.12 ? 377 PHE B O    1  
ATOM 9939   C CB   . PHE B 2 377 ? 8.279   4.660   -9.264  1.00 13.33 ? 377 PHE B CB   1  
ATOM 9940   C CG   . PHE B 2 377 ? 7.319   5.319   -8.271  1.00 64.30 ? 377 PHE B CG   1  
ATOM 9941   C CD1  . PHE B 2 377 ? 6.566   6.431   -8.645  1.00 73.31 ? 377 PHE B CD1  1  
ATOM 9942   C CD2  . PHE B 2 377 ? 7.166   4.822   -6.975  1.00 50.03 ? 377 PHE B CD2  1  
ATOM 9943   C CE1  . PHE B 2 377 ? 5.692   7.024   -7.757  1.00 43.32 ? 377 PHE B CE1  1  
ATOM 9944   C CE2  . PHE B 2 377 ? 6.290   5.419   -6.089  1.00 34.03 ? 377 PHE B CE2  1  
ATOM 9945   C CZ   . PHE B 2 377 ? 5.555   6.518   -6.481  1.00 22.11 ? 377 PHE B CZ   1  
ATOM 9946   H H    . PHE B 2 377 ? 11.255  4.368   -10.295 1.00 65.42 ? 377 PHE B H    1  
ATOM 9947   H HA   . PHE B 2 377 ? 9.386   6.455   -9.798  1.00 33.20 ? 377 PHE B HA   1  
ATOM 9948   H HB2  . PHE B 2 377 ? 7.764   4.573   -10.214 1.00 62.43 ? 377 PHE B HB2  1  
ATOM 9949   H HB3  . PHE B 2 377 ? 8.511   3.656   -8.911  1.00 2.44  ? 377 PHE B HB3  1  
ATOM 9950   H HD1  . PHE B 2 377 ? 6.669   6.834   -9.649  1.00 63.21 ? 377 PHE B HD1  1  
ATOM 9951   H HD2  . PHE B 2 377 ? 7.741   3.959   -6.664  1.00 23.21 ? 377 PHE B HD2  1  
ATOM 9952   H HE1  . PHE B 2 377 ? 5.115   7.886   -8.064  1.00 34.01 ? 377 PHE B HE1  1  
ATOM 9953   H HE2  . PHE B 2 377 ? 6.181   5.022   -5.090  1.00 23.35 ? 377 PHE B HE2  1  
ATOM 9954   H HZ   . PHE B 2 377 ? 4.867   6.984   -5.787  1.00 10.22 ? 377 PHE B HZ   1  
ATOM 9955   N N    . ALA B 2 378 ? 10.795  4.276   -7.717  1.00 13.42 ? 378 ALA B N    1  
ATOM 9956   C CA   . ALA B 2 378 ? 11.570  4.056   -6.490  1.00 22.45 ? 378 ALA B CA   1  
ATOM 9957   C C    . ALA B 2 378 ? 11.880  2.552   -6.355  1.00 61.10 ? 378 ALA B C    1  
ATOM 9958   O O    . ALA B 2 378 ? 11.117  1.809   -5.711  1.00 43.31 ? 378 ALA B O    1  
ATOM 9959   C CB   . ALA B 2 378 ? 10.809  4.570   -5.247  1.00 22.31 ? 378 ALA B CB   1  
ATOM 9960   H H    . ALA B 2 378 ? 10.521  3.494   -8.222  1.00 73.45 ? 378 ALA B H    1  
ATOM 9961   H HA   . ALA B 2 378 ? 12.503  4.607   -6.578  1.00 71.43 ? 378 ALA B HA   1  
ATOM 9962   H HB1  . ALA B 2 378 ? 11.401  4.396   -4.359  1.00 71.21 ? 378 ALA B HB1  1  
ATOM 9963   H HB2  . ALA B 2 378 ? 9.863   4.050   -5.156  1.00 2.24  ? 378 ALA B HB2  1  
ATOM 9964   H HB3  . ALA B 2 378 ? 10.620  5.631   -5.350  1.00 54.24 ? 378 ALA B HB3  1  
ATOM 9965   N N    . LYS B 2 379 ? 12.972  2.096   -7.012  1.00 72.01 ? 379 LYS B N    1  
ATOM 9966   C CA   . LYS B 2 379 ? 13.445  0.688   -6.922  1.00 15.05 ? 379 LYS B CA   1  
ATOM 9967   C C    . LYS B 2 379 ? 13.829  0.311   -5.468  1.00 13.43 ? 379 LYS B C    1  
ATOM 9968   O O    . LYS B 2 379 ? 13.898  -0.881  -5.131  1.00 1.33  ? 379 LYS B O    1  
ATOM 9969   C CB   . LYS B 2 379 ? 14.655  0.448   -7.879  1.00 13.33 ? 379 LYS B CB   1  
ATOM 9970   C CG   . LYS B 2 379 ? 14.317  0.399   -9.391  1.00 53.43 ? 379 LYS B CG   1  
ATOM 9971   C CD   . LYS B 2 379 ? 13.316  -0.732  -9.745  1.00 34.34 ? 379 LYS B CD   1  
ATOM 9972   C CE   . LYS B 2 379 ? 13.179  -0.977  -11.261 1.00 30.04 ? 379 LYS B CE   1  
ATOM 9973   N NZ   . LYS B 2 379 ? 12.743  0.221   -12.019 1.00 14.33 ? 379 LYS B NZ   1  
ATOM 9974   H H    . LYS B 2 379 ? 13.473  2.723   -7.577  1.00 21.35 ? 379 LYS B H    1  
ATOM 9975   H HA   . LYS B 2 379 ? 12.622  0.043   -7.232  1.00 70.13 ? 379 LYS B HA   1  
ATOM 9976   H HB2  . LYS B 2 379 ? 15.376  1.245   -7.726  1.00 40.15 ? 379 LYS B HB2  1  
ATOM 9977   H HB3  . LYS B 2 379 ? 15.134  -0.493  -7.615  1.00 73.22 ? 379 LYS B HB3  1  
ATOM 9978   H HG2  . LYS B 2 379 ? 13.883  1.352   -9.684  1.00 32.45 ? 379 LYS B HG2  1  
ATOM 9979   H HG3  . LYS B 2 379 ? 15.235  0.245   -9.948  1.00 41.32 ? 379 LYS B HG3  1  
ATOM 9980   H HD2  . LYS B 2 379 ? 13.652  -1.653  -9.283  1.00 31.31 ? 379 LYS B HD2  1  
ATOM 9981   H HD3  . LYS B 2 379 ? 12.341  -0.474  -9.344  1.00 43.15 ? 379 LYS B HD3  1  
ATOM 9982   H HE2  . LYS B 2 379 ? 14.134  -1.295  -11.649 1.00 52.12 ? 379 LYS B HE2  1  
ATOM 9983   H HE3  . LYS B 2 379 ? 12.456  -1.769  -11.418 1.00 0.14  ? 379 LYS B HE3  1  
ATOM 9984   H HZ1  . LYS B 2 379 ? 13.430  0.989   -11.897 1.00 14.24 ? 379 LYS B HZ1  1  
ATOM 9985   H HZ2  . LYS B 2 379 ? 11.815  0.551   -11.682 1.00 15.31 ? 379 LYS B HZ2  1  
ATOM 9986   H HZ3  . LYS B 2 379 ? 12.676  -0.004  -13.032 1.00 52.11 ? 379 LYS B HZ3  1  
ATOM 9987   N N    . LYS B 2 380 ? 14.097  1.361   -4.641  1.00 11.22 ? 380 LYS B N    1  
ATOM 9988   C CA   . LYS B 2 380 ? 14.407  1.279   -3.188  1.00 13.42 ? 380 LYS B CA   1  
ATOM 9989   C C    . LYS B 2 380 ? 15.875  0.898   -2.947  1.00 53.14 ? 380 LYS B C    1  
ATOM 9990   O O    . LYS B 2 380 ? 16.568  1.604   -2.206  1.00 2.11  ? 380 LYS B O    1  
ATOM 9991   C CB   . LYS B 2 380 ? 13.441  0.332   -2.405  1.00 10.44 ? 380 LYS B CB   1  
ATOM 9992   C CG   . LYS B 2 380 ? 11.977  0.819   -2.372  1.00 23.32 ? 380 LYS B CG   1  
ATOM 9993   C CD   . LYS B 2 380 ? 11.030  -0.196  -1.694  1.00 12.44 ? 380 LYS B CD   1  
ATOM 9994   C CE   . LYS B 2 380 ? 9.625   0.375   -1.465  1.00 2.32  ? 380 LYS B CE   1  
ATOM 9995   N NZ   . LYS B 2 380 ? 9.644   1.539   -0.539  1.00 12.33 ? 380 LYS B NZ   1  
ATOM 9996   H H    . LYS B 2 380 ? 14.105  2.252   -5.045  1.00 21.15 ? 380 LYS B H    1  
ATOM 9997   H HA   . LYS B 2 380 ? 14.265  2.291   -2.804  1.00 11.32 ? 380 LYS B HA   1  
ATOM 9998   H HB2  . LYS B 2 380 ? 13.466  -0.646  -2.875  1.00 24.04 ? 380 LYS B HB2  1  
ATOM 9999   H HB3  . LYS B 2 380 ? 13.791  0.231   -1.380  1.00 21.34 ? 380 LYS B HB3  1  
ATOM 10000  H HG2  . LYS B 2 380 ? 11.932  1.759   -1.831  1.00 60.01 ? 380 LYS B HG2  1  
ATOM 10001  H HG3  . LYS B 2 380 ? 11.644  0.981   -3.391  1.00 12.23 ? 380 LYS B HG3  1  
ATOM 10002  H HD2  . LYS B 2 380 ? 10.949  -1.080  -2.320  1.00 41.44 ? 380 LYS B HD2  1  
ATOM 10003  H HD3  . LYS B 2 380 ? 11.450  -0.483  -0.734  1.00 61.24 ? 380 LYS B HD3  1  
ATOM 10004  H HE2  . LYS B 2 380 ? 9.205   0.691   -2.410  1.00 40.34 ? 380 LYS B HE2  1  
ATOM 10005  H HE3  . LYS B 2 380 ? 9.001   -0.395  -1.036  1.00 40.23 ? 380 LYS B HE3  1  
ATOM 10006  H HZ1  . LYS B 2 380 ? 8.674   1.820   -0.303  1.00 31.33 ? 380 LYS B HZ1  1  
ATOM 10007  H HZ2  . LYS B 2 380 ? 10.126  2.351   -0.981  1.00 61.25 ? 380 LYS B HZ2  1  
ATOM 10008  H HZ3  . LYS B 2 380 ? 10.148  1.293   0.340   1.00 72.40 ? 380 LYS B HZ3  1  
ATOM 10009  N N    . GLU B 2 381 ? 16.330  -0.210  -3.589  1.00 35.52 ? 381 GLU B N    1  
ATOM 10010  C CA   . GLU B 2 381 ? 17.687  -0.770  -3.425  1.00 4.24  ? 381 GLU B CA   1  
ATOM 10011  C C    . GLU B 2 381 ? 17.877  -1.301  -1.982  1.00 12.32 ? 381 GLU B C    1  
ATOM 10012  O O    . GLU B 2 381 ? 17.805  -2.512  -1.741  1.00 74.34 ? 381 GLU B O    1  
ATOM 10013  C CB   . GLU B 2 381 ? 18.780  0.282   -3.800  1.00 13.53 ? 381 GLU B CB   1  
ATOM 10014  C CG   . GLU B 2 381 ? 20.232  -0.208  -3.666  1.00 41.51 ? 381 GLU B CG   1  
ATOM 10015  C CD   . GLU B 2 381 ? 21.252  0.938   -3.697  1.00 63.13 ? 381 GLU B CD   1  
ATOM 10016  O OE1  . GLU B 2 381 ? 21.662  1.363   -4.801  1.00 31.12 ? 381 GLU B OE1  1  
ATOM 10017  O OE2  . GLU B 2 381 ? 21.669  1.412   -2.611  1.00 64.44 ? 381 GLU B OE2  1  
ATOM 10018  H H    . GLU B 2 381 ? 15.728  -0.658  -4.205  1.00 62.44 ? 381 GLU B H    1  
ATOM 10019  H HA   . GLU B 2 381 ? 17.763  -1.612  -4.112  1.00 64.44 ? 381 GLU B HA   1  
ATOM 10020  H HB2  . GLU B 2 381 ? 18.616  0.595   -4.826  1.00 3.24  ? 381 GLU B HB2  1  
ATOM 10021  H HB3  . GLU B 2 381 ? 18.649  1.151   -3.157  1.00 0.53  ? 381 GLU B HB3  1  
ATOM 10022  H HG2  . GLU B 2 381 ? 20.336  -0.747  -2.727  1.00 14.52 ? 381 GLU B HG2  1  
ATOM 10023  H HG3  . GLU B 2 381 ? 20.443  -0.891  -4.482  1.00 53.30 ? 381 GLU B HG3  1  
ATOM 10024  N N    . GLY B 2 382 ? 18.083  -0.368  -1.030  1.00 11.12 ? 382 GLY B N    1  
ATOM 10025  C CA   . GLY B 2 382 ? 18.216  -0.689  0.391   1.00 22.55 ? 382 GLY B CA   1  
ATOM 10026  C C    . GLY B 2 382 ? 19.660  -0.704  0.880   1.00 73.10 ? 382 GLY B C    1  
ATOM 10027  O O    . GLY B 2 382 ? 19.899  -0.602  2.076   1.00 11.01 ? 382 GLY B O    1  
ATOM 10028  H H    . GLY B 2 382 ? 18.134  0.575   -1.307  1.00 22.51 ? 382 GLY B H    1  
ATOM 10029  H HA2  . GLY B 2 382 ? 17.672  0.055   0.954   1.00 11.20 ? 382 GLY B HA2  1  
ATOM 10030  H HA3  . GLY B 2 382 ? 17.771  -1.658  0.589   1.00 43.43 ? 382 GLY B HA3  1  
ATOM 10031  N N    . ASN B 2 383 ? 20.629  -0.817  -0.051  1.00 43.31 ? 383 ASN B N    1  
ATOM 10032  C CA   . ASN B 2 383 ? 22.081  -0.917  0.279   1.00 42.05 ? 383 ASN B CA   1  
ATOM 10033  C C    . ASN B 2 383 ? 22.630  0.402   0.886   1.00 61.54 ? 383 ASN B C    1  
ATOM 10034  O O    . ASN B 2 383 ? 23.733  0.430   1.446   1.00 21.55 ? 383 ASN B O    1  
ATOM 10035  C CB   . ASN B 2 383 ? 22.871  -1.337  -0.994  1.00 4.03  ? 383 ASN B CB   1  
ATOM 10036  C CG   . ASN B 2 383 ? 24.393  -1.495  -0.813  1.00 73.10 ? 383 ASN B CG   1  
ATOM 10037  O OD1  . ASN B 2 383 ? 25.154  -1.253  -1.740  1.00 2.13  ? 383 ASN B OD1  1  
ATOM 10038  N ND2  . ASN B 2 383 ? 24.850  -1.915  0.361   1.00 12.54 ? 383 ASN B ND2  1  
ATOM 10039  H H    . ASN B 2 383 ? 20.369  -0.821  -0.995  1.00 22.02 ? 383 ASN B H    1  
ATOM 10040  H HA   . ASN B 2 383 ? 22.193  -1.701  1.022   1.00 42.12 ? 383 ASN B HA   1  
ATOM 10041  H HB2  . ASN B 2 383 ? 22.489  -2.285  -1.339  1.00 54.40 ? 383 ASN B HB2  1  
ATOM 10042  H HB3  . ASN B 2 383 ? 22.691  -0.595  -1.769  1.00 44.12 ? 383 ASN B HB3  1  
ATOM 10043  H HD21 . ASN B 2 383 ? 24.208  -2.114  1.075   1.00 2.00  ? 383 ASN B HD21 1  
ATOM 10044  H HD22 . ASN B 2 383 ? 25.818  -1.989  0.476   1.00 25.14 ? 383 ASN B HD22 1  
ATOM 10045  N N    . THR B 2 384 ? 21.828  1.477   0.799   1.00 63.41 ? 384 THR B N    1  
ATOM 10046  C CA   . THR B 2 384 ? 22.109  2.764   1.463   1.00 45.42 ? 384 THR B CA   1  
ATOM 10047  C C    . THR B 2 384 ? 22.117  2.639   3.018   1.00 45.31 ? 384 THR B C    1  
ATOM 10048  O O    . THR B 2 384 ? 22.598  3.539   3.713   1.00 42.41 ? 384 THR B O    1  
ATOM 10049  C CB   . THR B 2 384 ? 21.061  3.840   1.014   1.00 54.54 ? 384 THR B CB   1  
ATOM 10050  O OG1  . THR B 2 384 ? 19.725  3.346   1.234   1.00 11.15 ? 384 THR B OG1  1  
ATOM 10051  C CG2  . THR B 2 384 ? 21.230  4.206   -0.475  1.00 2.24  ? 384 THR B CG2  1  
ATOM 10052  H H    . THR B 2 384 ? 21.018  1.407   0.251   1.00 15.34 ? 384 THR B H    1  
ATOM 10053  H HA   . THR B 2 384 ? 23.092  3.094   1.139   1.00 71.44 ? 384 THR B HA   1  
ATOM 10054  H HB   . THR B 2 384 ? 21.202  4.741   1.605   1.00 21.34 ? 384 THR B HB   1  
ATOM 10055  H HG1  . THR B 2 384 ? 19.130  3.739   0.587   1.00 32.13 ? 384 THR B HG1  1  
ATOM 10056  H HG21 . THR B 2 384 ? 21.086  3.323   -1.084  1.00 63.21 ? 384 THR B HG21 1  
ATOM 10057  H HG22 . THR B 2 384 ? 22.226  4.598   -0.646  1.00 20.22 ? 384 THR B HG22 1  
ATOM 10058  H HG23 . THR B 2 384 ? 20.501  4.953   -0.753  1.00 21.24 ? 384 THR B HG23 1  
ATOM 10059  N N    . LEU B 2 385 ? 21.568  1.522   3.543   1.00 71.34 ? 385 LEU B N    1  
ATOM 10060  C CA   . LEU B 2 385 ? 21.601  1.192   4.990   1.00 53.03 ? 385 LEU B CA   1  
ATOM 10061  C C    . LEU B 2 385 ? 23.004  0.685   5.436   1.00 21.14 ? 385 LEU B C    1  
ATOM 10062  O O    . LEU B 2 385 ? 23.952  0.694   4.642   1.00 62.34 ? 385 LEU B O    1  
ATOM 10063  C CB   . LEU B 2 385 ? 20.512  0.132   5.313   1.00 62.21 ? 385 LEU B CB   1  
ATOM 10064  C CG   . LEU B 2 385 ? 19.034  0.513   4.960   1.00 11.53 ? 385 LEU B CG   1  
ATOM 10065  C CD1  . LEU B 2 385 ? 18.072  -0.669  5.242   1.00 21.12 ? 385 LEU B CD1  1  
ATOM 10066  C CD2  . LEU B 2 385 ? 18.587  1.803   5.702   1.00 75.12 ? 385 LEU B CD2  1  
ATOM 10067  H H    . LEU B 2 385 ? 21.121  0.901   2.935   1.00 30.33 ? 385 LEU B H    1  
ATOM 10068  H HA   . LEU B 2 385 ? 21.379  2.098   5.544   1.00 34.24 ? 385 LEU B HA   1  
ATOM 10069  H HB2  . LEU B 2 385 ? 20.761  -0.777  4.773   1.00 10.41 ? 385 LEU B HB2  1  
ATOM 10070  H HB3  . LEU B 2 385 ? 20.557  -0.088  6.375   1.00 43.13 ? 385 LEU B HB3  1  
ATOM 10071  H HG   . LEU B 2 385 ? 18.981  0.717   3.896   1.00 20.31 ? 385 LEU B HG   1  
ATOM 10072  H HD11 . LEU B 2 385 ? 18.089  -0.919  6.295   1.00 54.04 ? 385 LEU B HD11 1  
ATOM 10073  H HD12 . LEU B 2 385 ? 18.382  -1.535  4.668   1.00 75.43 ? 385 LEU B HD12 1  
ATOM 10074  H HD13 . LEU B 2 385 ? 17.066  -0.400  4.951   1.00 42.03 ? 385 LEU B HD13 1  
ATOM 10075  H HD21 . LEU B 2 385 ? 17.563  2.038   5.438   1.00 41.12 ? 385 LEU B HD21 1  
ATOM 10076  H HD22 . LEU B 2 385 ? 19.220  2.632   5.410   1.00 40.25 ? 385 LEU B HD22 1  
ATOM 10077  H HD23 . LEU B 2 385 ? 18.659  1.661   6.772   1.00 14.13 ? 385 LEU B HD23 1  
ATOM 10078  N N    . VAL B 2 386 ? 23.111  0.278   6.734   1.00 34.03 ? 386 VAL B N    1  
ATOM 10079  C CA   . VAL B 2 386 ? 24.352  -0.262  7.380   1.00 22.44 ? 386 VAL B CA   1  
ATOM 10080  C C    . VAL B 2 386 ? 25.355  0.864   7.750   1.00 62.42 ? 386 VAL B C    1  
ATOM 10081  O O    . VAL B 2 386 ? 25.947  0.829   8.834   1.00 12.05 ? 386 VAL B O    1  
ATOM 10082  C CB   . VAL B 2 386 ? 25.077  -1.405  6.537   1.00 61.12 ? 386 VAL B CB   1  
ATOM 10083  C CG1  . VAL B 2 386 ? 26.409  -1.862  7.186   1.00 43.31 ? 386 VAL B CG1  1  
ATOM 10084  C CG2  . VAL B 2 386 ? 24.138  -2.616  6.324   1.00 15.01 ? 386 VAL B CG2  1  
ATOM 10085  H H    . VAL B 2 386 ? 22.319  0.351   7.295   1.00 34.35 ? 386 VAL B H    1  
ATOM 10086  H HA   . VAL B 2 386 ? 24.023  -0.713  8.313   1.00 32.42 ? 386 VAL B HA   1  
ATOM 10087  H HB   . VAL B 2 386 ? 25.313  -0.992  5.557   1.00 72.42 ? 386 VAL B HB   1  
ATOM 10088  H HG11 . VAL B 2 386 ? 26.865  -2.637  6.582   1.00 23.02 ? 386 VAL B HG11 1  
ATOM 10089  H HG12 . VAL B 2 386 ? 26.221  -2.248  8.180   1.00 72.04 ? 386 VAL B HG12 1  
ATOM 10090  H HG13 . VAL B 2 386 ? 27.087  -1.022  7.254   1.00 41.24 ? 386 VAL B HG13 1  
ATOM 10091  H HG21 . VAL B 2 386 ? 23.239  -2.293  5.811   1.00 75.23 ? 386 VAL B HG21 1  
ATOM 10092  H HG22 . VAL B 2 386 ? 23.863  -3.048  7.278   1.00 3.15  ? 386 VAL B HG22 1  
ATOM 10093  H HG23 . VAL B 2 386 ? 24.636  -3.367  5.722   1.00 34.34 ? 386 VAL B HG23 1  
ATOM 10094  N N    . ILE B 2 387 ? 25.526  1.859   6.861   1.00 62.20 ? 387 ILE B N    1  
ATOM 10095  C CA   . ILE B 2 387 ? 26.527  2.934   7.017   1.00 64.14 ? 387 ILE B CA   1  
ATOM 10096  C C    . ILE B 2 387 ? 26.053  3.980   8.061   1.00 10.42 ? 387 ILE B C    1  
ATOM 10097  O O    . ILE B 2 387 ? 25.578  5.069   7.709   1.00 32.13 ? 387 ILE B O    1  
ATOM 10098  C CB   . ILE B 2 387 ? 26.836  3.610   5.621   1.00 73.40 ? 387 ILE B CB   1  
ATOM 10099  C CG1  . ILE B 2 387 ? 27.173  2.524   4.547   1.00 43.30 ? 387 ILE B CG1  1  
ATOM 10100  C CG2  . ILE B 2 387 ? 27.974  4.666   5.715   1.00 4.43  ? 387 ILE B CG2  1  
ATOM 10101  C CD1  . ILE B 2 387 ? 28.417  1.683   4.832   1.00 74.12 ? 387 ILE B CD1  1  
ATOM 10102  H H    . ILE B 2 387 ? 24.971  1.869   6.060   1.00 11.55 ? 387 ILE B H    1  
ATOM 10103  H HA   . ILE B 2 387 ? 27.443  2.476   7.379   1.00 71.22 ? 387 ILE B HA   1  
ATOM 10104  H HB   . ILE B 2 387 ? 25.933  4.131   5.305   1.00 25.31 ? 387 ILE B HB   1  
ATOM 10105  H HG12 . ILE B 2 387 ? 26.339  1.842   4.460   1.00 31.13 ? 387 ILE B HG12 1  
ATOM 10106  H HG13 . ILE B 2 387 ? 27.321  3.009   3.591   1.00 24.33 ? 387 ILE B HG13 1  
ATOM 10107  H HG21 . ILE B 2 387 ? 28.152  5.103   4.739   1.00 71.44 ? 387 ILE B HG21 1  
ATOM 10108  H HG22 . ILE B 2 387 ? 28.885  4.198   6.066   1.00 31.02 ? 387 ILE B HG22 1  
ATOM 10109  H HG23 . ILE B 2 387 ? 27.690  5.449   6.407   1.00 21.14 ? 387 ILE B HG23 1  
ATOM 10110  H HD11 . ILE B 2 387 ? 28.575  0.988   4.017   1.00 21.55 ? 387 ILE B HD11 1  
ATOM 10111  H HD12 . ILE B 2 387 ? 28.282  1.127   5.750   1.00 45.43 ? 387 ILE B HD12 1  
ATOM 10112  H HD13 . ILE B 2 387 ? 29.280  2.326   4.923   1.00 13.23 ? 387 ILE B HD13 1  
ATOM 10113  N N    . VAL B 2 388 ? 26.155  3.570   9.350   1.00 54.33 ? 388 VAL B N    1  
ATOM 10114  C CA   . VAL B 2 388 ? 25.792  4.354   10.555  1.00 2.42  ? 388 VAL B CA   1  
ATOM 10115  C C    . VAL B 2 388 ? 24.447  5.102   10.397  1.00 1.25  ? 388 VAL B C    1  
ATOM 10116  O O    . VAL B 2 388 ? 24.412  6.235   9.925   1.00 14.31 ? 388 VAL B O    1  
ATOM 10117  C CB   . VAL B 2 388 ? 26.949  5.343   10.983  1.00 40.41 ? 388 VAL B CB   1  
ATOM 10118  C CG1  . VAL B 2 388 ? 26.653  6.017   12.350  1.00 15.40 ? 388 VAL B CG1  1  
ATOM 10119  C CG2  . VAL B 2 388 ? 28.320  4.619   10.995  1.00 34.23 ? 388 VAL B CG2  1  
ATOM 10120  H H    . VAL B 2 388 ? 26.509  2.673   9.499   1.00 54.35 ? 388 VAL B H    1  
ATOM 10121  H HA   . VAL B 2 388 ? 25.673  3.630   11.355  1.00 0.34  ? 388 VAL B HA   1  
ATOM 10122  H HB   . VAL B 2 388 ? 27.002  6.135   10.232  1.00 20.14 ? 388 VAL B HB   1  
ATOM 10123  H HG11 . VAL B 2 388 ? 25.724  6.576   12.291  1.00 23.34 ? 388 VAL B HG11 1  
ATOM 10124  H HG12 . VAL B 2 388 ? 27.454  6.700   12.603  1.00 32.43 ? 388 VAL B HG12 1  
ATOM 10125  H HG13 . VAL B 2 388 ? 26.569  5.265   13.124  1.00 61.03 ? 388 VAL B HG13 1  
ATOM 10126  H HG21 . VAL B 2 388 ? 28.521  4.205   10.014  1.00 25.31 ? 388 VAL B HG21 1  
ATOM 10127  H HG22 . VAL B 2 388 ? 28.309  3.819   11.724  1.00 74.43 ? 388 VAL B HG22 1  
ATOM 10128  H HG23 . VAL B 2 388 ? 29.103  5.323   11.248  1.00 2.30  ? 388 VAL B HG23 1  
ATOM 10129  N N    . THR B 2 389 ? 23.342  4.468   10.812  1.00 12.22 ? 389 THR B N    1  
ATOM 10130  C CA   . THR B 2 389 ? 21.986  5.027   10.632  1.00 33.51 ? 389 THR B CA   1  
ATOM 10131  C C    . THR B 2 389 ? 21.679  6.174   11.643  1.00 51.34 ? 389 THR B C    1  
ATOM 10132  O O    . THR B 2 389 ? 20.564  6.703   11.664  1.00 51.54 ? 389 THR B O    1  
ATOM 10133  C CB   . THR B 2 389 ? 20.910  3.889   10.701  1.00 13.14 ? 389 THR B CB   1  
ATOM 10134  O OG1  . THR B 2 389 ? 21.087  3.116   11.895  1.00 12.22 ? 389 THR B OG1  1  
ATOM 10135  C CG2  . THR B 2 389 ? 20.981  2.951   9.476   1.00 71.25 ? 389 THR B CG2  1  
ATOM 10136  H H    . THR B 2 389 ? 23.436  3.605   11.267  1.00 34.05 ? 389 THR B H    1  
ATOM 10137  H HA   . THR B 2 389 ? 21.941  5.455   9.634   1.00 21.42 ? 389 THR B HA   1  
ATOM 10138  H HB   . THR B 2 389 ? 19.923  4.342   10.727  1.00 14.13 ? 389 THR B HB   1  
ATOM 10139  H HG1  . THR B 2 389 ? 20.227  2.854   12.239  1.00 70.14 ? 389 THR B HG1  1  
ATOM 10140  H HG21 . THR B 2 389 ? 20.800  3.517   8.572   1.00 2.31  ? 389 THR B HG21 1  
ATOM 10141  H HG22 . THR B 2 389 ? 20.230  2.176   9.565   1.00 51.24 ? 389 THR B HG22 1  
ATOM 10142  H HG23 . THR B 2 389 ? 21.960  2.490   9.422   1.00 2.45  ? 389 THR B HG23 1  
ATOM 10143  N N    . ALA B 2 390 ? 22.681  6.549   12.473  1.00 70.34 ? 390 ALA B N    1  
ATOM 10144  C CA   . ALA B 2 390 ? 22.611  7.732   13.356  1.00 51.43 ? 390 ALA B CA   1  
ATOM 10145  C C    . ALA B 2 390 ? 23.258  8.958   12.677  1.00 42.31 ? 390 ALA B C    1  
ATOM 10146  O O    . ALA B 2 390 ? 22.568  9.898   12.267  1.00 31.50 ? 390 ALA B O    1  
ATOM 10147  C CB   . ALA B 2 390 ? 23.309  7.430   14.699  1.00 63.42 ? 390 ALA B CB   1  
ATOM 10148  H H    . ALA B 2 390 ? 23.490  5.998   12.498  1.00 73.41 ? 390 ALA B H    1  
ATOM 10149  H HA   . ALA B 2 390 ? 21.563  7.946   13.562  1.00 33.43 ? 390 ALA B HA   1  
ATOM 10150  H HB1  . ALA B 2 390 ? 24.355  7.206   14.525  1.00 0.22  ? 390 ALA B HB1  1  
ATOM 10151  H HB2  . ALA B 2 390 ? 22.839  6.578   15.171  1.00 4.23  ? 390 ALA B HB2  1  
ATOM 10152  H HB3  . ALA B 2 390 ? 23.231  8.288   15.354  1.00 53.02 ? 390 ALA B HB3  1  
ATOM 10153  N N    . ASP B 2 391 ? 24.595  8.905   12.533  1.00 2.35  ? 391 ASP B N    1  
ATOM 10154  C CA   . ASP B 2 391 ? 25.431  10.056  12.110  1.00 11.12 ? 391 ASP B CA   1  
ATOM 10155  C C    . ASP B 2 391 ? 25.630  10.080  10.585  1.00 40.52 ? 391 ASP B C    1  
ATOM 10156  O O    . ASP B 2 391 ? 26.117  11.075  10.043  1.00 35.30 ? 391 ASP B O    1  
ATOM 10157  C CB   . ASP B 2 391 ? 26.817  9.975   12.815  1.00 23.04 ? 391 ASP B CB   1  
ATOM 10158  C CG   . ASP B 2 391 ? 26.708  9.658   14.316  1.00 15.03 ? 391 ASP B CG   1  
ATOM 10159  O OD1  . ASP B 2 391 ? 27.361  8.702   14.786  1.00 34.41 ? 391 ASP B OD1  1  
ATOM 10160  O OD2  . ASP B 2 391 ? 25.945  10.348  15.032  1.00 64.12 ? 391 ASP B OD2  1  
ATOM 10161  H H    . ASP B 2 391 ? 25.044  8.060   12.723  1.00 61.44 ? 391 ASP B H    1  
ATOM 10162  H HA   . ASP B 2 391 ? 24.934  10.977  12.418  1.00 14.14 ? 391 ASP B HA   1  
ATOM 10163  H HB2  . ASP B 2 391 ? 27.419  9.206   12.335  1.00 62.22 ? 391 ASP B HB2  1  
ATOM 10164  H HB3  . ASP B 2 391 ? 27.331  10.928  12.709  1.00 32.05 ? 391 ASP B HB3  1  
ATOM 10165  N N    . HIS B 2 392 ? 25.269  8.955   9.922   1.00 72.42 ? 392 HIS B N    1  
ATOM 10166  C CA   . HIS B 2 392 ? 25.484  8.711   8.470   1.00 11.25 ? 392 HIS B CA   1  
ATOM 10167  C C    . HIS B 2 392 ? 27.002  8.639   8.122   1.00 34.13 ? 392 HIS B C    1  
ATOM 10168  O O    . HIS B 2 392 ? 27.390  8.727   6.949   1.00 5.35  ? 392 HIS B O    1  
ATOM 10169  C CB   . HIS B 2 392 ? 24.707  9.748   7.598   1.00 4.33  ? 392 HIS B CB   1  
ATOM 10170  C CG   . HIS B 2 392 ? 24.655  9.388   6.133   1.00 64.42 ? 392 HIS B CG   1  
ATOM 10171  N ND1  . HIS B 2 392 ? 25.241  10.147  5.146   1.00 54.20 ? 392 HIS B ND1  1  
ATOM 10172  C CD2  . HIS B 2 392 ? 24.123  8.312   5.507   1.00 15.44 ? 392 HIS B CD2  1  
ATOM 10173  C CE1  . HIS B 2 392 ? 25.081  9.556   3.983   1.00 51.11 ? 392 HIS B CE1  1  
ATOM 10174  N NE2  . HIS B 2 392 ? 24.404  8.445   4.172   1.00 71.40 ? 392 HIS B NE2  1  
ATOM 10175  H H    . HIS B 2 392 ? 24.830  8.247   10.438  1.00 41.33 ? 392 HIS B H    1  
ATOM 10176  H HA   . HIS B 2 392 ? 25.070  7.725   8.272   1.00 15.31 ? 392 HIS B HA   1  
ATOM 10177  H HB2  . HIS B 2 392 ? 23.686  9.820   7.954   1.00 44.14 ? 392 HIS B HB2  1  
ATOM 10178  H HB3  . HIS B 2 392 ? 25.179  10.720  7.694   1.00 3.03  ? 392 HIS B HB3  1  
ATOM 10179  H HD1  . HIS B 2 392 ? 25.694  11.004  5.279   1.00 42.33 ? 392 HIS B HD1  1  
ATOM 10180  H HD2  . HIS B 2 392 ? 23.577  7.501   5.975   1.00 55.24 ? 392 HIS B HD2  1  
ATOM 10181  H HE1  . HIS B 2 392 ? 25.449  9.920   3.036   1.00 72.12 ? 392 HIS B HE1  1  
ATOM 10182  H HE2  . HIS B 2 392 ? 24.228  7.772   3.483   1.00 37.66 ? 392 HIS B HE2  1  
ATOM 10183  N N    . ALA B 2 393 ? 27.830  8.411   9.171   1.00 43.24 ? 393 ALA B N    1  
ATOM 10184  C CA   . ALA B 2 393 ? 29.306  8.305   9.092   1.00 0.41  ? 393 ALA B CA   1  
ATOM 10185  C C    . ALA B 2 393 ? 29.966  9.641   8.690   1.00 61.53 ? 393 ALA B C    1  
ATOM 10186  O O    . ALA B 2 393 ? 30.563  10.318  9.539   1.00 3.35  ? 393 ALA B O    1  
ATOM 10187  C CB   . ALA B 2 393 ? 29.754  7.149   8.172   1.00 11.15 ? 393 ALA B CB   1  
ATOM 10188  H H    . ALA B 2 393 ? 27.418  8.311   10.051  1.00 55.14 ? 393 ALA B H    1  
ATOM 10189  H HA   . ALA B 2 393 ? 29.642  8.060   10.098  1.00 55.50 ? 393 ALA B HA   1  
ATOM 10190  H HB1  . ALA B 2 393 ? 30.833  7.031   8.216   1.00 11.11 ? 393 ALA B HB1  1  
ATOM 10191  H HB2  . ALA B 2 393 ? 29.461  7.360   7.153   1.00 23.24 ? 393 ALA B HB2  1  
ATOM 10192  H HB3  . ALA B 2 393 ? 29.283  6.228   8.492   1.00 52.52 ? 393 ALA B HB3  1  
ATOM 10193  N N    . HIS B 2 394 ? 29.832  10.010  7.389   1.00 31.13 ? 394 HIS B N    1  
ATOM 10194  C CA   . HIS B 2 394 ? 30.464  11.205  6.793   1.00 3.42  ? 394 HIS B CA   1  
ATOM 10195  C C    . HIS B 2 394 ? 31.991  11.125  7.011   1.00 41.55 ? 394 HIS B C    1  
ATOM 10196  O O    . HIS B 2 394 ? 32.558  11.892  7.802   1.00 22.24 ? 394 HIS B O    1  
ATOM 10197  C CB   . HIS B 2 394 ? 29.841  12.518  7.366   1.00 30.14 ? 394 HIS B CB   1  
ATOM 10198  C CG   . HIS B 2 394 ? 30.213  13.781  6.613   1.00 4.40  ? 394 HIS B CG   1  
ATOM 10199  N ND1  . HIS B 2 394 ? 29.411  14.337  5.641   1.00 73.31 ? 394 HIS B ND1  1  
ATOM 10200  C CD2  . HIS B 2 394 ? 31.308  14.584  6.688   1.00 63.42 ? 394 HIS B CD2  1  
ATOM 10201  C CE1  . HIS B 2 394 ? 29.988  15.419  5.153   1.00 65.05 ? 394 HIS B CE1  1  
ATOM 10202  N NE2  . HIS B 2 394 ? 31.140  15.591  5.769   1.00 13.35 ? 394 HIS B NE2  1  
ATOM 10203  H H    . HIS B 2 394 ? 29.285  9.446   6.808   1.00 54.42 ? 394 HIS B H    1  
ATOM 10204  H HA   . HIS B 2 394 ? 30.273  11.164  5.724   1.00 54.44 ? 394 HIS B HA   1  
ATOM 10205  H HB2  . HIS B 2 394 ? 28.763  12.425  7.350   1.00 42.22 ? 394 HIS B HB2  1  
ATOM 10206  H HB3  . HIS B 2 394 ? 30.154  12.640  8.397   1.00 22.14 ? 394 HIS B HB3  1  
ATOM 10207  H HD1  . HIS B 2 394 ? 28.539  13.988  5.350   1.00 45.21 ? 394 HIS B HD1  1  
ATOM 10208  H HD2  . HIS B 2 394 ? 32.156  14.449  7.350   1.00 63.33 ? 394 HIS B HD2  1  
ATOM 10209  H HE1  . HIS B 2 394 ? 29.581  16.056  4.382   1.00 64.11 ? 394 HIS B HE1  1  
ATOM 10210  H HE2  . HIS B 2 394 ? 31.693  16.399  5.708   1.00 37.66 ? 394 HIS B HE2  1  
ATOM 10211  N N    . ALA B 2 395 ? 32.613  10.126  6.348   1.00 71.44 ? 395 ALA B N    1  
ATOM 10212  C CA   . ALA B 2 395 ? 34.035  9.761   6.542   1.00 60.11 ? 395 ALA B CA   1  
ATOM 10213  C C    . ALA B 2 395 ? 34.296  9.321   8.015   1.00 33.05 ? 395 ALA B C    1  
ATOM 10214  O O    . ALA B 2 395 ? 33.354  8.871   8.684   1.00 21.14 ? 395 ALA B O    1  
ATOM 10215  C CB   . ALA B 2 395 ? 34.966  10.907  6.077   1.00 21.40 ? 395 ALA B CB   1  
ATOM 10216  H H    . ALA B 2 395 ? 32.088  9.603   5.705   1.00 32.11 ? 395 ALA B H    1  
ATOM 10217  H HA   . ALA B 2 395 ? 34.222  8.902   5.906   1.00 74.32 ? 395 ALA B HA   1  
ATOM 10218  H HB1  . ALA B 2 395 ? 35.998  10.598  6.178   1.00 4.53  ? 395 ALA B HB1  1  
ATOM 10219  H HB2  . ALA B 2 395 ? 34.796  11.790  6.680   1.00 75.42 ? 395 ALA B HB2  1  
ATOM 10220  H HB3  . ALA B 2 395 ? 34.763  11.141  5.040   1.00 41.31 ? 395 ALA B HB3  1  
ATOM 10221  N N    . SER B 2 396 ? 35.574  9.382   8.476   1.00 64.42 ? 396 SER B N    1  
ATOM 10222  C CA   . SER B 2 396 ? 35.968  9.142   9.887   1.00 75.55 ? 396 SER B CA   1  
ATOM 10223  C C    . SER B 2 396 ? 35.660  7.691   10.352  1.00 31.11 ? 396 SER B C    1  
ATOM 10224  O O    . SER B 2 396 ? 36.562  6.846   10.380  1.00 22.13 ? 396 SER B O    1  
ATOM 10225  C CB   . SER B 2 396 ? 35.326  10.199  10.831  1.00 0.31  ? 396 SER B CB   1  
ATOM 10226  O OG   . SER B 2 396 ? 35.765  10.026  12.171  1.00 70.15 ? 396 SER B OG   1  
ATOM 10227  H H    . SER B 2 396 ? 36.282  9.597   7.844   1.00 21.40 ? 396 SER B H    1  
ATOM 10228  H HA   . SER B 2 396 ? 37.043  9.278   9.927   1.00 51.52 ? 396 SER B HA   1  
ATOM 10229  H HB2  . SER B 2 396 ? 35.604  11.192  10.501  1.00 14.22 ? 396 SER B HB2  1  
ATOM 10230  H HB3  . SER B 2 396 ? 34.249  10.100  10.801  1.00 32.13 ? 396 SER B HB3  1  
ATOM 10231  H HG   . SER B 2 396 ? 35.710  10.862  12.639  1.00 30.15 ? 396 SER B HG   1  
ATOM 10232  N N    . GLN B 2 397 ? 34.383  7.430   10.712  1.00 60.24 ? 397 GLN B N    1  
ATOM 10233  C CA   . GLN B 2 397 ? 33.894  6.106   11.150  1.00 71.41 ? 397 GLN B CA   1  
ATOM 10234  C C    . GLN B 2 397 ? 34.082  5.061   10.027  1.00 52.12 ? 397 GLN B C    1  
ATOM 10235  O O    . GLN B 2 397 ? 34.462  3.911   10.285  1.00 34.03 ? 397 GLN B O    1  
ATOM 10236  C CB   . GLN B 2 397 ? 32.394  6.226   11.553  1.00 14.41 ? 397 GLN B CB   1  
ATOM 10237  C CG   . GLN B 2 397 ? 32.118  7.248   12.682  1.00 13.13 ? 397 GLN B CG   1  
ATOM 10238  C CD   . GLN B 2 397 ? 30.628  7.483   12.965  1.00 41.11 ? 397 GLN B CD   1  
ATOM 10239  O OE1  . GLN B 2 397 ? 29.788  7.365   12.086  1.00 40.01 ? 397 GLN B OE1  1  
ATOM 10240  N NE2  . GLN B 2 397 ? 30.291  7.836   14.193  1.00 43.25 ? 397 GLN B NE2  1  
ATOM 10241  H H    . GLN B 2 397 ? 33.734  8.164   10.668  1.00 70.24 ? 397 GLN B H    1  
ATOM 10242  H HA   . GLN B 2 397 ? 34.474  5.806   12.018  1.00 71.11 ? 397 GLN B HA   1  
ATOM 10243  H HB2  . GLN B 2 397 ? 31.823  6.526   10.681  1.00 4.41  ? 397 GLN B HB2  1  
ATOM 10244  H HB3  . GLN B 2 397 ? 32.038  5.253   11.881  1.00 44.14 ? 397 GLN B HB3  1  
ATOM 10245  H HG2  . GLN B 2 397 ? 32.588  6.890   13.592  1.00 33.34 ? 397 GLN B HG2  1  
ATOM 10246  H HG3  . GLN B 2 397 ? 32.566  8.196   12.408  1.00 4.23  ? 397 GLN B HG3  1  
ATOM 10247  H HE21 . GLN B 2 397 ? 31.001  7.932   14.859  1.00 51.41 ? 397 GLN B HE21 1  
ATOM 10248  H HE22 . GLN B 2 397 ? 29.339  7.979   14.386  1.00 75.54 ? 397 GLN B HE22 1  
ATOM 10249  N N    . ILE B 2 398 ? 33.806  5.498   8.782   1.00 63.32 ? 398 ILE B N    1  
ATOM 10250  C CA   . ILE B 2 398 ? 34.057  4.718   7.559   1.00 22.34 ? 398 ILE B CA   1  
ATOM 10251  C C    . ILE B 2 398 ? 34.187  5.704   6.375   1.00 22.20 ? 398 ILE B C    1  
ATOM 10252  O O    . ILE B 2 398 ? 33.248  6.446   6.064   1.00 33.44 ? 398 ILE B O    1  
ATOM 10253  C CB   . ILE B 2 398 ? 32.944  3.609   7.319   1.00 62.15 ? 398 ILE B CB   1  
ATOM 10254  C CG1  . ILE B 2 398 ? 33.217  2.799   6.012   1.00 45.42 ? 398 ILE B CG1  1  
ATOM 10255  C CG2  . ILE B 2 398 ? 31.505  4.187   7.330   1.00 54.31 ? 398 ILE B CG2  1  
ATOM 10256  C CD1  . ILE B 2 398 ? 32.245  1.653   5.746   1.00 75.44 ? 398 ILE B CD1  1  
ATOM 10257  H H    . ILE B 2 398 ? 33.415  6.390   8.683   1.00 31.35 ? 398 ILE B H    1  
ATOM 10258  H HA   . ILE B 2 398 ? 35.020  4.211   7.687   1.00 32.44 ? 398 ILE B HA   1  
ATOM 10259  H HB   . ILE B 2 398 ? 33.009  2.923   8.162   1.00 52.24 ? 398 ILE B HB   1  
ATOM 10260  H HG12 . ILE B 2 398 ? 33.158  3.466   5.164   1.00 34.24 ? 398 ILE B HG12 1  
ATOM 10261  H HG13 . ILE B 2 398 ? 34.214  2.379   6.054   1.00 31.12 ? 398 ILE B HG13 1  
ATOM 10262  H HG21 . ILE B 2 398 ? 31.383  4.893   6.516   1.00 22.24 ? 398 ILE B HG21 1  
ATOM 10263  H HG22 . ILE B 2 398 ? 31.317  4.694   8.266   1.00 20.42 ? 398 ILE B HG22 1  
ATOM 10264  H HG23 . ILE B 2 398 ? 30.786  3.384   7.215   1.00 64.03 ? 398 ILE B HG23 1  
ATOM 10265  H HD11 . ILE B 2 398 ? 31.245  2.046   5.625   1.00 55.34 ? 398 ILE B HD11 1  
ATOM 10266  H HD12 . ILE B 2 398 ? 32.262  0.954   6.571   1.00 15.33 ? 398 ILE B HD12 1  
ATOM 10267  H HD13 . ILE B 2 398 ? 32.539  1.144   4.839   1.00 4.14  ? 398 ILE B HD13 1  
ATOM 10268  N N    . VAL B 2 399 ? 35.390  5.746   5.757   1.00 54.24 ? 399 VAL B N    1  
ATOM 10269  C CA   . VAL B 2 399 ? 35.764  6.789   4.768   1.00 73.32 ? 399 VAL B CA   1  
ATOM 10270  C C    . VAL B 2 399 ? 35.960  6.215   3.339   1.00 5.03  ? 399 VAL B C    1  
ATOM 10271  O O    . VAL B 2 399 ? 35.435  6.779   2.371   1.00 34.45 ? 399 VAL B O    1  
ATOM 10272  C CB   . VAL B 2 399 ? 37.050  7.589   5.254   1.00 44.23 ? 399 VAL B CB   1  
ATOM 10273  C CG1  . VAL B 2 399 ? 38.219  6.644   5.636   1.00 72.41 ? 399 VAL B CG1  1  
ATOM 10274  C CG2  . VAL B 2 399 ? 37.499  8.649   4.211   1.00 42.13 ? 399 VAL B CG2  1  
ATOM 10275  H H    . VAL B 2 399 ? 36.049  5.054   5.968   1.00 32.41 ? 399 VAL B H    1  
ATOM 10276  H HA   . VAL B 2 399 ? 34.942  7.507   4.723   1.00 12.43 ? 399 VAL B HA   1  
ATOM 10277  H HB   . VAL B 2 399 ? 36.770  8.125   6.159   1.00 52.43 ? 399 VAL B HB   1  
ATOM 10278  H HG11 . VAL B 2 399 ? 37.902  5.974   6.424   1.00 13.25 ? 399 VAL B HG11 1  
ATOM 10279  H HG12 . VAL B 2 399 ? 39.065  7.225   5.985   1.00 13.41 ? 399 VAL B HG12 1  
ATOM 10280  H HG13 . VAL B 2 399 ? 38.520  6.063   4.773   1.00 2.45  ? 399 VAL B HG13 1  
ATOM 10281  H HG21 . VAL B 2 399 ? 37.793  8.161   3.289   1.00 54.42 ? 399 VAL B HG21 1  
ATOM 10282  H HG22 . VAL B 2 399 ? 38.340  9.215   4.595   1.00 11.02 ? 399 VAL B HG22 1  
ATOM 10283  H HG23 . VAL B 2 399 ? 36.682  9.331   4.007   1.00 13.33 ? 399 VAL B HG23 1  
ATOM 10284  N N    . ALA B 2 400 ? 36.696  5.090   3.205   1.00 5.32  ? 400 ALA B N    1  
ATOM 10285  C CA   . ALA B 2 400 ? 37.068  4.538   1.878   1.00 15.44 ? 400 ALA B CA   1  
ATOM 10286  C C    . ALA B 2 400 ? 35.841  3.965   1.104   1.00 33.12 ? 400 ALA B C    1  
ATOM 10287  O O    . ALA B 2 400 ? 35.622  4.365   -0.046  1.00 51.41 ? 400 ALA B O    1  
ATOM 10288  C CB   . ALA B 2 400 ? 38.220  3.512   1.994   1.00 50.33 ? 400 ALA B CB   1  
ATOM 10289  H H    . ALA B 2 400 ? 36.991  4.622   4.007   1.00 50.30 ? 400 ALA B H    1  
ATOM 10290  H HA   . ALA B 2 400 ? 37.454  5.375   1.299   1.00 22.33 ? 400 ALA B HA   1  
ATOM 10291  H HB1  . ALA B 2 400 ? 39.063  3.967   2.493   1.00 20.31 ? 400 ALA B HB1  1  
ATOM 10292  H HB2  . ALA B 2 400 ? 38.522  3.184   1.006   1.00 74.52 ? 400 ALA B HB2  1  
ATOM 10293  H HB3  . ALA B 2 400 ? 37.888  2.656   2.567   1.00 74.11 ? 400 ALA B HB3  1  
ATOM 10294  N N    . PRO B 2 401 ? 35.021  3.010   1.677   1.00 71.04 ? 401 PRO B N    1  
ATOM 10295  C CA   . PRO B 2 401 ? 33.778  2.557   1.029   1.00 1.12  ? 401 PRO B CA   1  
ATOM 10296  C C    . PRO B 2 401 ? 32.515  3.268   1.591   1.00 53.44 ? 401 PRO B C    1  
ATOM 10297  O O    . PRO B 2 401 ? 32.153  3.074   2.759   1.00 64.15 ? 401 PRO B O    1  
ATOM 10298  C CB   . PRO B 2 401 ? 33.794  1.043   1.351   1.00 13.42 ? 401 PRO B CB   1  
ATOM 10299  C CG   . PRO B 2 401 ? 34.587  0.890   2.637   1.00 4.34  ? 401 PRO B CG   1  
ATOM 10300  C CD   . PRO B 2 401 ? 35.232  2.240   2.934   1.00 42.14 ? 401 PRO B CD   1  
ATOM 10301  H HA   . PRO B 2 401 ? 33.819  2.693   -0.050  1.00 71.34 ? 401 PRO B HA   1  
ATOM 10302  H HB2  . PRO B 2 401 ? 32.774  0.670   1.470   1.00 61.31 ? 401 PRO B HB2  1  
ATOM 10303  H HB3  . PRO B 2 401 ? 34.279  0.499   0.550   1.00 35.32 ? 401 PRO B HB3  1  
ATOM 10304  H HG2  . PRO B 2 401 ? 33.923  0.601   3.449   1.00 71.23 ? 401 PRO B HG2  1  
ATOM 10305  H HG3  . PRO B 2 401 ? 35.354  0.132   2.512   1.00 61.23 ? 401 PRO B HG3  1  
ATOM 10306  H HD2  . PRO B 2 401 ? 34.743  2.730   3.769   1.00 11.55 ? 401 PRO B HD2  1  
ATOM 10307  H HD3  . PRO B 2 401 ? 36.289  2.119   3.145   1.00 23.11 ? 401 PRO B HD3  1  
ATOM 10308  N N    . ASP B 2 402 ? 31.858  4.106   0.760   1.00 14.02 ? 402 ASP B N    1  
ATOM 10309  C CA   . ASP B 2 402 ? 30.558  4.722   1.126   1.00 74.34 ? 402 ASP B CA   1  
ATOM 10310  C C    . ASP B 2 402 ? 29.454  3.643   1.066   1.00 4.20  ? 402 ASP B C    1  
ATOM 10311  O O    . ASP B 2 402 ? 28.558  3.632   1.905   1.00 20.11 ? 402 ASP B O    1  
ATOM 10312  C CB   . ASP B 2 402 ? 30.216  5.945   0.218   1.00 53.32 ? 402 ASP B CB   1  
ATOM 10313  C CG   . ASP B 2 402 ? 29.841  5.582   -1.239  1.00 54.14 ? 402 ASP B CG   1  
ATOM 10314  O OD1  . ASP B 2 402 ? 28.635  5.418   -1.542  1.00 41.02 ? 402 ASP B OD1  1  
ATOM 10315  O OD2  . ASP B 2 402 ? 30.748  5.441   -2.088  1.00 41.54 ? 402 ASP B OD2  1  
ATOM 10316  H H    . ASP B 2 402 ? 32.254  4.320   -0.111  1.00 32.30 ? 402 ASP B H    1  
ATOM 10317  H HA   . ASP B 2 402 ? 30.640  5.064   2.156   1.00 21.14 ? 402 ASP B HA   1  
ATOM 10318  H HB2  . ASP B 2 402 ? 29.388  6.487   0.665   1.00 71.32 ? 402 ASP B HB2  1  
ATOM 10319  H HB3  . ASP B 2 402 ? 31.075  6.608   0.198   1.00 22.42 ? 402 ASP B HB3  1  
ATOM 10320  N N    . THR B 2 403 ? 29.553  2.774   0.032   1.00 35.02 ? 403 THR B N    1  
ATOM 10321  C CA   . THR B 2 403 ? 28.748  1.542   -0.152  1.00 32.00 ? 403 THR B CA   1  
ATOM 10322  C C    . THR B 2 403 ? 29.079  0.949   -1.548  1.00 3.11  ? 403 THR B C    1  
ATOM 10323  O O    . THR B 2 403 ? 29.796  1.589   -2.323  1.00 51.30 ? 403 THR B O    1  
ATOM 10324  C CB   . THR B 2 403 ? 27.193  1.758   0.010   1.00 32.43 ? 403 THR B CB   1  
ATOM 10325  O OG1  . THR B 2 403 ? 26.546  0.487   0.129   1.00 44.03 ? 403 THR B OG1  1  
ATOM 10326  C CG2  . THR B 2 403 ? 26.550  2.558   -1.147  1.00 22.11 ? 403 THR B CG2  1  
ATOM 10327  H H    . THR B 2 403 ? 30.222  2.982   -0.658  1.00 34.41 ? 403 THR B H    1  
ATOM 10328  H HA   . THR B 2 403 ? 29.077  0.830   0.606   1.00 44.25 ? 403 THR B HA   1  
ATOM 10329  H HB   . THR B 2 403 ? 27.031  2.307   0.932   1.00 51.22 ? 403 THR B HB   1  
ATOM 10330  H HG1  . THR B 2 403 ? 25.782  0.573   0.707   1.00 73.20 ? 403 THR B HG1  1  
ATOM 10331  H HG21 . THR B 2 403 ? 26.681  2.033   -2.081  1.00 2.03  ? 403 THR B HG21 1  
ATOM 10332  H HG22 . THR B 2 403 ? 27.010  3.541   -1.219  1.00 4.25  ? 403 THR B HG22 1  
ATOM 10333  H HG23 . THR B 2 403 ? 25.489  2.677   -0.962  1.00 31.13 ? 403 THR B HG23 1  
ATOM 10334  N N    . LYS B 2 404 ? 28.559  -0.270  -1.852  1.00 70.03 ? 404 LYS B N    1  
ATOM 10335  C CA   . LYS B 2 404 ? 28.816  -1.038  -3.123  1.00 22.13 ? 404 LYS B CA   1  
ATOM 10336  C C    . LYS B 2 404 ? 30.225  -1.676  -3.155  1.00 41.33 ? 404 LYS B C    1  
ATOM 10337  O O    . LYS B 2 404 ? 30.381  -2.845  -3.529  1.00 34.12 ? 404 LYS B O    1  
ATOM 10338  C CB   . LYS B 2 404 ? 28.597  -0.196  -4.426  1.00 51.15 ? 404 LYS B CB   1  
ATOM 10339  C CG   . LYS B 2 404 ? 27.186  0.385   -4.614  1.00 2.34  ? 404 LYS B CG   1  
ATOM 10340  C CD   . LYS B 2 404 ? 26.094  -0.697  -4.738  1.00 12.34 ? 404 LYS B CD   1  
ATOM 10341  C CE   . LYS B 2 404 ? 24.698  -0.080  -4.851  1.00 42.03 ? 404 LYS B CE   1  
ATOM 10342  N NZ   . LYS B 2 404 ? 24.408  0.838   -3.716  1.00 51.01 ? 404 LYS B NZ   1  
ATOM 10343  H H    . LYS B 2 404 ? 27.959  -0.684  -1.191  1.00 42.40 ? 404 LYS B H    1  
ATOM 10344  H HA   . LYS B 2 404 ? 28.103  -1.854  -3.126  1.00 61.42 ? 404 LYS B HA   1  
ATOM 10345  H HB2  . LYS B 2 404 ? 29.300  0.632   -4.426  1.00 44.41 ? 404 LYS B HB2  1  
ATOM 10346  H HB3  . LYS B 2 404 ? 28.817  -0.822  -5.289  1.00 12.21 ? 404 LYS B HB3  1  
ATOM 10347  H HG2  . LYS B 2 404 ? 26.955  1.023   -3.765  1.00 45.02 ? 404 LYS B HG2  1  
ATOM 10348  H HG3  . LYS B 2 404 ? 27.180  0.991   -5.517  1.00 30.44 ? 404 LYS B HG3  1  
ATOM 10349  H HD2  . LYS B 2 404 ? 26.287  -1.296  -5.620  1.00 30.31 ? 404 LYS B HD2  1  
ATOM 10350  H HD3  . LYS B 2 404 ? 26.127  -1.334  -3.860  1.00 32.11 ? 404 LYS B HD3  1  
ATOM 10351  H HE2  . LYS B 2 404 ? 24.627  0.477   -5.776  1.00 43.00 ? 404 LYS B HE2  1  
ATOM 10352  H HE3  . LYS B 2 404 ? 23.957  -0.873  -4.857  1.00 71.14 ? 404 LYS B HE3  1  
ATOM 10353  H HZ1  . LYS B 2 404 ? 24.419  0.312   -2.819  1.00 24.31 ? 404 LYS B HZ1  1  
ATOM 10354  H HZ2  . LYS B 2 404 ? 23.472  1.275   -3.837  1.00 42.44 ? 404 LYS B HZ2  1  
ATOM 10355  H HZ3  . LYS B 2 404 ? 25.123  1.590   -3.676  1.00 32.22 ? 404 LYS B HZ3  1  
ATOM 10356  N N    . ALA B 2 405 ? 31.245  -0.878  -2.805  1.00 62.12 ? 405 ALA B N    1  
ATOM 10357  C CA   . ALA B 2 405 ? 32.647  -1.313  -2.733  1.00 71.24 ? 405 ALA B CA   1  
ATOM 10358  C C    . ALA B 2 405 ? 32.922  -2.500  -1.750  1.00 2.34  ? 405 ALA B C    1  
ATOM 10359  O O    . ALA B 2 405 ? 33.769  -3.327  -2.091  1.00 50.03 ? 405 ALA B O    1  
ATOM 10360  C CB   . ALA B 2 405 ? 33.554  -0.110  -2.430  1.00 71.04 ? 405 ALA B CB   1  
ATOM 10361  H H    . ALA B 2 405 ? 31.054  0.053   -2.608  1.00 35.34 ? 405 ALA B H    1  
ATOM 10362  H HA   . ALA B 2 405 ? 32.906  -1.650  -3.735  1.00 30.01 ? 405 ALA B HA   1  
ATOM 10363  H HB1  . ALA B 2 405 ? 34.592  -0.406  -2.495  1.00 14.24 ? 405 ALA B HB1  1  
ATOM 10364  H HB2  . ALA B 2 405 ? 33.352  0.271   -1.437  1.00 42.04 ? 405 ALA B HB2  1  
ATOM 10365  H HB3  . ALA B 2 405 ? 33.358  0.677   -3.152  1.00 50.24 ? 405 ALA B HB3  1  
ATOM 10366  N N    . PRO B 2 406 ? 32.271  -2.597  -0.519  1.00 42.33 ? 406 PRO B N    1  
ATOM 10367  C CA   . PRO B 2 406 ? 32.428  -3.773  0.394   1.00 1.13  ? 406 PRO B CA   1  
ATOM 10368  C C    . PRO B 2 406 ? 32.367  -5.157  -0.308  1.00 31.44 ? 406 PRO B C    1  
ATOM 10369  O O    . PRO B 2 406 ? 31.290  -5.736  -0.504  1.00 44.44 ? 406 PRO B O    1  
ATOM 10370  C CB   . PRO B 2 406 ? 31.265  -3.596  1.390   1.00 33.22 ? 406 PRO B CB   1  
ATOM 10371  C CG   . PRO B 2 406 ? 31.107  -2.113  1.509   1.00 22.15 ? 406 PRO B CG   1  
ATOM 10372  C CD   . PRO B 2 406 ? 31.402  -1.562  0.125   1.00 42.41 ? 406 PRO B CD   1  
ATOM 10373  H HA   . PRO B 2 406 ? 33.370  -3.702  0.933   1.00 12.44 ? 406 PRO B HA   1  
ATOM 10374  H HB2  . PRO B 2 406 ? 30.355  -4.058  0.998   1.00 15.51 ? 406 PRO B HB2  1  
ATOM 10375  H HB3  . PRO B 2 406 ? 31.515  -4.028  2.353   1.00 45.41 ? 406 PRO B HB3  1  
ATOM 10376  H HG2  . PRO B 2 406 ? 30.095  -1.865  1.811   1.00 2.21  ? 406 PRO B HG2  1  
ATOM 10377  H HG3  . PRO B 2 406 ? 31.821  -1.717  2.222   1.00 43.34 ? 406 PRO B HG3  1  
ATOM 10378  H HD2  . PRO B 2 406 ? 30.484  -1.433  -0.441  1.00 64.23 ? 406 PRO B HD2  1  
ATOM 10379  H HD3  . PRO B 2 406 ? 31.925  -0.616  0.191   1.00 2.41  ? 406 PRO B HD3  1  
ATOM 10380  N N    . GLY B 2 407 ? 33.551  -5.637  -0.704  1.00 42.41 ? 407 GLY B N    1  
ATOM 10381  C CA   . GLY B 2 407 ? 33.721  -6.903  -1.415  1.00 55.33 ? 407 GLY B CA   1  
ATOM 10382  C C    . GLY B 2 407 ? 34.852  -7.708  -0.812  1.00 15.25 ? 407 GLY B C    1  
ATOM 10383  O O    . GLY B 2 407 ? 34.740  -8.931  -0.652  1.00 41.03 ? 407 GLY B O    1  
ATOM 10384  H H    . GLY B 2 407 ? 34.350  -5.105  -0.504  1.00 14.12 ? 407 GLY B H    1  
ATOM 10385  H HA2  . GLY B 2 407 ? 32.803  -7.480  -1.368  1.00 74.04 ? 407 GLY B HA2  1  
ATOM 10386  H HA3  . GLY B 2 407 ? 33.954  -6.696  -2.448  1.00 22.50 ? 407 GLY B HA3  1  
ATOM 10387  N N    . LEU B 2 408 ? 35.946  -7.007  -0.459  1.00 62.12 ? 408 LEU B N    1  
ATOM 10388  C CA   . LEU B 2 408 ? 37.062  -7.580  0.324   1.00 41.41 ? 408 LEU B CA   1  
ATOM 10389  C C    . LEU B 2 408 ? 36.558  -7.983  1.726   1.00 40.24 ? 408 LEU B C    1  
ATOM 10390  O O    . LEU B 2 408 ? 36.934  -9.030  2.264   1.00 42.04 ? 408 LEU B O    1  
ATOM 10391  C CB   . LEU B 2 408 ? 38.217  -6.547  0.434   1.00 11.13 ? 408 LEU B CB   1  
ATOM 10392  C CG   . LEU B 2 408 ? 39.488  -6.999  1.228   1.00 63.22 ? 408 LEU B CG   1  
ATOM 10393  C CD1  . LEU B 2 408 ? 40.193  -8.194  0.545   1.00 72.03 ? 408 LEU B CD1  1  
ATOM 10394  C CD2  . LEU B 2 408 ? 40.463  -5.820  1.444   1.00 31.42 ? 408 LEU B CD2  1  
ATOM 10395  H H    . LEU B 2 408 ? 36.007  -6.072  -0.732  1.00 72.55 ? 408 LEU B H    1  
ATOM 10396  H HA   . LEU B 2 408 ? 37.421  -8.465  -0.199  1.00 1.15  ? 408 LEU B HA   1  
ATOM 10397  H HB2  . LEU B 2 408 ? 38.524  -6.277  -0.573  1.00 54.33 ? 408 LEU B HB2  1  
ATOM 10398  H HB3  . LEU B 2 408 ? 37.820  -5.659  0.910   1.00 24.02 ? 408 LEU B HB3  1  
ATOM 10399  H HG   . LEU B 2 408 ? 39.171  -7.340  2.207   1.00 42.30 ? 408 LEU B HG   1  
ATOM 10400  H HD11 . LEU B 2 408 ? 41.063  -8.481  1.122   1.00 53.22 ? 408 LEU B HD11 1  
ATOM 10401  H HD12 . LEU B 2 408 ? 40.502  -7.923  -0.456  1.00 53.32 ? 408 LEU B HD12 1  
ATOM 10402  H HD13 . LEU B 2 408 ? 39.514  -9.036  0.493   1.00 12.14 ? 408 LEU B HD13 1  
ATOM 10403  H HD21 . LEU B 2 408 ? 41.307  -6.145  2.037   1.00 71.34 ? 408 LEU B HD21 1  
ATOM 10404  H HD22 . LEU B 2 408 ? 39.955  -5.018  1.963   1.00 1.41  ? 408 LEU B HD22 1  
ATOM 10405  H HD23 . LEU B 2 408 ? 40.818  -5.452  0.487   1.00 33.42 ? 408 LEU B HD23 1  
ATOM 10406  N N    . THR B 2 409 ? 35.687  -7.121  2.289   1.00 55.13 ? 409 THR B N    1  
ATOM 10407  C CA   . THR B 2 409 ? 34.997  -7.364  3.569   1.00 14.21 ? 409 THR B CA   1  
ATOM 10408  C C    . THR B 2 409 ? 33.898  -8.439  3.412   1.00 14.22 ? 409 THR B C    1  
ATOM 10409  O O    . THR B 2 409 ? 33.430  -8.998  4.412   1.00 2.12  ? 409 THR B O    1  
ATOM 10410  C CB   . THR B 2 409 ? 34.354  -6.037  4.098   1.00 73.52 ? 409 THR B CB   1  
ATOM 10411  O OG1  . THR B 2 409 ? 33.442  -5.519  3.113   1.00 5.13  ? 409 THR B OG1  1  
ATOM 10412  C CG2  . THR B 2 409 ? 35.414  -4.961  4.414   1.00 43.42 ? 409 THR B CG2  1  
ATOM 10413  H H    . THR B 2 409 ? 35.492  -6.284  1.813   1.00 2.33  ? 409 THR B H    1  
ATOM 10414  H HA   . THR B 2 409 ? 35.727  -7.710  4.295   1.00 2.23  ? 409 THR B HA   1  
ATOM 10415  H HB   . THR B 2 409 ? 33.797  -6.252  5.010   1.00 14.22 ? 409 THR B HB   1  
ATOM 10416  H HG1  . THR B 2 409 ? 32.577  -5.933  3.227   1.00 70.04 ? 409 THR B HG1  1  
ATOM 10417  H HG21 . THR B 2 409 ? 36.090  -5.321  5.180   1.00 3.24  ? 409 THR B HG21 1  
ATOM 10418  H HG22 . THR B 2 409 ? 34.925  -4.065  4.769   1.00 21.55 ? 409 THR B HG22 1  
ATOM 10419  H HG23 . THR B 2 409 ? 35.978  -4.725  3.519   1.00 62.03 ? 409 THR B HG23 1  
ATOM 10420  N N    . GLN B 2 410 ? 33.514  -8.701  2.137   1.00 5.24  ? 410 GLN B N    1  
ATOM 10421  C CA   . GLN B 2 410 ? 32.434  -9.634  1.743   1.00 3.34  ? 410 GLN B CA   1  
ATOM 10422  C C    . GLN B 2 410 ? 31.070  -9.056  2.216   1.00 33.32 ? 410 GLN B C    1  
ATOM 10423  O O    . GLN B 2 410 ? 30.898  -7.830  2.134   1.00 24.30 ? 410 GLN B O    1  
ATOM 10424  C CB   . GLN B 2 410 ? 32.749  -11.084 2.254   1.00 3.40  ? 410 GLN B CB   1  
ATOM 10425  C CG   . GLN B 2 410 ? 32.064  -12.215 1.456   1.00 51.32 ? 410 GLN B CG   1  
ATOM 10426  C CD   . GLN B 2 410 ? 32.320  -13.617 2.024   1.00 23.53 ? 410 GLN B CD   1  
ATOM 10427  O OE1  . GLN B 2 410 ? 32.557  -13.788 3.222   1.00 30.54 ? 410 GLN B OE1  1  
ATOM 10428  N NE2  . GLN B 2 410 ? 32.238  -14.631 1.173   1.00 42.03 ? 410 GLN B NE2  1  
ATOM 10429  H H    . GLN B 2 410 ? 33.983  -8.236  1.425   1.00 52.50 ? 410 GLN B H    1  
ATOM 10430  H HA   . GLN B 2 410 ? 32.423  -9.645  0.660   1.00 53.44 ? 410 GLN B HA   1  
ATOM 10431  H HB2  . GLN B 2 410 ? 33.820  -11.242 2.202   1.00 4.03  ? 410 GLN B HB2  1  
ATOM 10432  H HB3  . GLN B 2 410 ? 32.444  -11.163 3.295   1.00 23.10 ? 410 GLN B HB3  1  
ATOM 10433  H HG2  . GLN B 2 410 ? 30.992  -12.039 1.455   1.00 44.11 ? 410 GLN B HG2  1  
ATOM 10434  H HG3  . GLN B 2 410 ? 32.426  -12.180 0.436   1.00 70.42 ? 410 GLN B HG3  1  
ATOM 10435  H HE21 . GLN B 2 410 ? 32.019  -14.434 0.240   1.00 3.35  ? 410 GLN B HE21 1  
ATOM 10436  H HE22 . GLN B 2 410 ? 32.387  -15.536 1.518   1.00 11.24 ? 410 GLN B HE22 1  
ATOM 10437  N N    . ALA B 2 411 ? 30.105  -9.913  2.634   1.00 63.14 ? 411 ALA B N    1  
ATOM 10438  C CA   . ALA B 2 411 ? 28.771  -9.506  3.166   1.00 25.53 ? 411 ALA B CA   1  
ATOM 10439  C C    . ALA B 2 411 ? 27.761  -9.124  2.050   1.00 43.31 ? 411 ALA B C    1  
ATOM 10440  O O    . ALA B 2 411 ? 26.548  -9.257  2.251   1.00 3.24  ? 411 ALA B O    1  
ATOM 10441  C CB   . ALA B 2 411 ? 28.887  -8.410  4.253   1.00 34.31 ? 411 ALA B CB   1  
ATOM 10442  H H    . ALA B 2 411 ? 30.283  -10.871 2.581   1.00 74.33 ? 411 ALA B H    1  
ATOM 10443  H HA   . ALA B 2 411 ? 28.374  -10.395 3.653   1.00 22.45 ? 411 ALA B HA   1  
ATOM 10444  H HB1  . ALA B 2 411 ? 27.922  -8.236  4.719   1.00 64.40 ? 411 ALA B HB1  1  
ATOM 10445  H HB2  . ALA B 2 411 ? 29.234  -7.489  3.804   1.00 3.30  ? 411 ALA B HB2  1  
ATOM 10446  H HB3  . ALA B 2 411 ? 29.598  -8.723  5.006   1.00 41.32 ? 411 ALA B HB3  1  
ATOM 10447  N N    . LEU B 2 412 ? 28.284  -8.623  0.898   1.00 60.41 ? 412 LEU B N    1  
ATOM 10448  C CA   . LEU B 2 412 ? 27.530  -8.343  -0.350  1.00 52.10 ? 412 LEU B CA   1  
ATOM 10449  C C    . LEU B 2 412 ? 26.270  -7.487  -0.081  1.00 45.13 ? 412 LEU B C    1  
ATOM 10450  O O    . LEU B 2 412 ? 25.149  -8.018  0.007   1.00 54.14 ? 412 LEU B O    1  
ATOM 10451  C CB   . LEU B 2 412 ? 27.209  -9.671  -1.141  1.00 33.12 ? 412 LEU B CB   1  
ATOM 10452  C CG   . LEU B 2 412 ? 27.198  -9.581  -2.719  1.00 54.14 ? 412 LEU B CG   1  
ATOM 10453  C CD1  . LEU B 2 412 ? 27.046  -10.980 -3.362  1.00 45.41 ? 412 LEU B CD1  1  
ATOM 10454  C CD2  . LEU B 2 412 ? 26.113  -8.612  -3.255  1.00 54.34 ? 412 LEU B CD2  1  
ATOM 10455  H H    . LEU B 2 412 ? 29.229  -8.413  0.890   1.00 31.41 ? 412 LEU B H    1  
ATOM 10456  H HA   . LEU B 2 412 ? 28.198  -7.744  -0.965  1.00 61.01 ? 412 LEU B HA   1  
ATOM 10457  H HB2  . LEU B 2 412 ? 27.956  -10.410 -0.860  1.00 52.35 ? 412 LEU B HB2  1  
ATOM 10458  H HB3  . LEU B 2 412 ? 26.243  -10.043 -0.818  1.00 63.44 ? 412 LEU B HB3  1  
ATOM 10459  H HG   . LEU B 2 412 ? 28.156  -9.190  -3.045  1.00 63.34 ? 412 LEU B HG   1  
ATOM 10460  H HD11 . LEU B 2 412 ? 27.867  -11.611 -3.048  1.00 51.20 ? 412 LEU B HD11 1  
ATOM 10461  H HD12 . LEU B 2 412 ? 27.064  -10.891 -4.439  1.00 75.21 ? 412 LEU B HD12 1  
ATOM 10462  H HD13 . LEU B 2 412 ? 26.109  -11.429 -3.055  1.00 72.33 ? 412 LEU B HD13 1  
ATOM 10463  H HD21 . LEU B 2 412 ? 25.130  -8.946  -2.942  1.00 70.20 ? 412 LEU B HD21 1  
ATOM 10464  H HD22 . LEU B 2 412 ? 26.152  -8.580  -4.333  1.00 22.24 ? 412 LEU B HD22 1  
ATOM 10465  H HD23 . LEU B 2 412 ? 26.291  -7.614  -2.867  1.00 72.44 ? 412 LEU B HD23 1  
ATOM 10466  N N    . ASN B 2 413 ? 26.504  -6.165  0.092   1.00 42.21 ? 413 ASN B N    1  
ATOM 10467  C CA   . ASN B 2 413 ? 25.461  -5.122  0.301   1.00 62.42 ? 413 ASN B CA   1  
ATOM 10468  C C    . ASN B 2 413 ? 24.912  -5.128  1.750   1.00 43.25 ? 413 ASN B C    1  
ATOM 10469  O O    . ASN B 2 413 ? 24.901  -4.079  2.401   1.00 22.15 ? 413 ASN B O    1  
ATOM 10470  C CB   . ASN B 2 413 ? 24.293  -5.197  -0.749  1.00 12.13 ? 413 ASN B CB   1  
ATOM 10471  C CG   . ASN B 2 413 ? 24.689  -4.801  -2.190  1.00 71.14 ? 413 ASN B CG   1  
ATOM 10472  O OD1  . ASN B 2 413 ? 23.880  -4.237  -2.930  1.00 12.24 ? 413 ASN B OD1  1  
ATOM 10473  N ND2  . ASN B 2 413 ? 25.912  -5.109  -2.613  1.00 24.00 ? 413 ASN B ND2  1  
ATOM 10474  H H    . ASN B 2 413 ? 27.439  -5.876  0.098   1.00 32.11 ? 413 ASN B H    1  
ATOM 10475  H HA   . ASN B 2 413 ? 25.974  -4.173  0.159   1.00 53.12 ? 413 ASN B HA   1  
ATOM 10476  H HB2  . ASN B 2 413 ? 23.918  -6.211  -0.778  1.00 34.24 ? 413 ASN B HB2  1  
ATOM 10477  H HB3  . ASN B 2 413 ? 23.487  -4.542  -0.429  1.00 34.14 ? 413 ASN B HB3  1  
ATOM 10478  H HD21 . ASN B 2 413 ? 26.512  -5.580  -2.002  1.00 33.30 ? 413 ASN B HD21 1  
ATOM 10479  H HD22 . ASN B 2 413 ? 26.166  -4.843  -3.519  1.00 31.05 ? 413 ASN B HD22 1  
ATOM 10480  N N    . THR B 2 414 ? 24.430  -6.305  2.207   1.00 3.14  ? 414 THR B N    1  
ATOM 10481  C CA   . THR B 2 414 ? 23.922  -6.569  3.577   1.00 54.21 ? 414 THR B CA   1  
ATOM 10482  C C    . THR B 2 414 ? 22.541  -5.909  3.824   1.00 20.03 ? 414 THR B C    1  
ATOM 10483  O O    . THR B 2 414 ? 21.546  -6.610  3.928   1.00 12.11 ? 414 THR B O    1  
ATOM 10484  C CB   . THR B 2 414 ? 24.940  -6.144  4.699   1.00 1.21  ? 414 THR B CB   1  
ATOM 10485  O OG1  . THR B 2 414 ? 26.244  -6.650  4.375   1.00 3.12  ? 414 THR B OG1  1  
ATOM 10486  C CG2  . THR B 2 414 ? 24.513  -6.643  6.103   1.00 73.24 ? 414 THR B CG2  1  
ATOM 10487  H H    . THR B 2 414 ? 24.407  -7.049  1.586   1.00 55.43 ? 414 THR B H    1  
ATOM 10488  H HA   . THR B 2 414 ? 23.794  -7.647  3.645   1.00 45.41 ? 414 THR B HA   1  
ATOM 10489  H HB   . THR B 2 414 ? 24.996  -5.061  4.717   1.00 22.31 ? 414 THR B HB   1  
ATOM 10490  H HG1  . THR B 2 414 ? 26.163  -7.457  3.851   1.00 32.05 ? 414 THR B HG1  1  
ATOM 10491  H HG21 . THR B 2 414 ? 25.241  -6.325  6.837   1.00 3.11  ? 414 THR B HG21 1  
ATOM 10492  H HG22 . THR B 2 414 ? 24.452  -7.722  6.108   1.00 14.51 ? 414 THR B HG22 1  
ATOM 10493  H HG23 . THR B 2 414 ? 23.544  -6.229  6.362   1.00 14.30 ? 414 THR B HG23 1  
ATOM 10494  N N    . LYS B 2 415 ? 22.530  -4.554  3.886   1.00 35.42 ? 415 LYS B N    1  
ATOM 10495  C CA   . LYS B 2 415 ? 21.373  -3.664  4.208   1.00 54.12 ? 415 LYS B CA   1  
ATOM 10496  C C    . LYS B 2 415 ? 20.747  -3.917  5.606   1.00 63.43 ? 415 LYS B C    1  
ATOM 10497  O O    . LYS B 2 415 ? 20.669  -2.994  6.422   1.00 42.43 ? 415 LYS B O    1  
ATOM 10498  C CB   . LYS B 2 415 ? 20.296  -3.555  3.067   1.00 73.02 ? 415 LYS B CB   1  
ATOM 10499  C CG   . LYS B 2 415 ? 19.451  -4.802  2.709   1.00 14.01 ? 415 LYS B CG   1  
ATOM 10500  C CD   . LYS B 2 415 ? 18.292  -4.474  1.729   1.00 10.11 ? 415 LYS B CD   1  
ATOM 10501  C CE   . LYS B 2 415 ? 17.157  -3.662  2.383   1.00 73.42 ? 415 LYS B CE   1  
ATOM 10502  N NZ   . LYS B 2 415 ? 16.499  -4.394  3.500   1.00 62.34 ? 415 LYS B NZ   1  
ATOM 10503  H H    . LYS B 2 415 ? 23.377  -4.109  3.704   1.00 4.43  ? 415 LYS B H    1  
ATOM 10504  H HA   . LYS B 2 415 ? 21.833  -2.675  4.280   1.00 10.24 ? 415 LYS B HA   1  
ATOM 10505  H HB2  . LYS B 2 415 ? 19.605  -2.769  3.342   1.00 72.31 ? 415 LYS B HB2  1  
ATOM 10506  H HB3  . LYS B 2 415 ? 20.808  -3.239  2.161   1.00 0.04  ? 415 LYS B HB3  1  
ATOM 10507  H HG2  . LYS B 2 415 ? 20.100  -5.541  2.252   1.00 11.02 ? 415 LYS B HG2  1  
ATOM 10508  H HG3  . LYS B 2 415 ? 19.039  -5.217  3.625   1.00 54.53 ? 415 LYS B HG3  1  
ATOM 10509  H HD2  . LYS B 2 415 ? 18.688  -3.898  0.898   1.00 14.44 ? 415 LYS B HD2  1  
ATOM 10510  H HD3  . LYS B 2 415 ? 17.880  -5.401  1.344   1.00 61.44 ? 415 LYS B HD3  1  
ATOM 10511  H HE2  . LYS B 2 415 ? 17.564  -2.738  2.767   1.00 10.14 ? 415 LYS B HE2  1  
ATOM 10512  H HE3  . LYS B 2 415 ? 16.412  -3.435  1.630   1.00 51.21 ? 415 LYS B HE3  1  
ATOM 10513  H HZ1  . LYS B 2 415 ? 15.775  -3.789  3.946   1.00 65.12 ? 415 LYS B HZ1  1  
ATOM 10514  H HZ2  . LYS B 2 415 ? 17.198  -4.667  4.221   1.00 75.21 ? 415 LYS B HZ2  1  
ATOM 10515  H HZ3  . LYS B 2 415 ? 16.040  -5.254  3.146   1.00 42.43 ? 415 LYS B HZ3  1  
ATOM 10516  N N    . ASP B 2 416 ? 20.292  -5.142  5.891   1.00 72.04 ? 416 ASP B N    1  
ATOM 10517  C CA   . ASP B 2 416 ? 19.780  -5.510  7.218   1.00 13.32 ? 416 ASP B CA   1  
ATOM 10518  C C    . ASP B 2 416 ? 20.950  -5.786  8.189   1.00 75.33 ? 416 ASP B C    1  
ATOM 10519  O O    . ASP B 2 416 ? 21.532  -6.879  8.200   1.00 32.11 ? 416 ASP B O    1  
ATOM 10520  C CB   . ASP B 2 416 ? 18.813  -6.711  7.105   1.00 63.34 ? 416 ASP B CB   1  
ATOM 10521  C CG   . ASP B 2 416 ? 17.496  -6.316  6.413   1.00 55.42 ? 416 ASP B CG   1  
ATOM 10522  O OD1  . ASP B 2 416 ? 16.579  -5.814  7.096   1.00 72.54 ? 416 ASP B OD1  1  
ATOM 10523  O OD2  . ASP B 2 416 ? 17.371  -6.482  5.185   1.00 73.12 ? 416 ASP B OD2  1  
ATOM 10524  H H    . ASP B 2 416 ? 20.284  -5.816  5.194   1.00 33.53 ? 416 ASP B H    1  
ATOM 10525  H HA   . ASP B 2 416 ? 19.218  -4.652  7.602   1.00 65.52 ? 416 ASP B HA   1  
ATOM 10526  H HB2  . ASP B 2 416 ? 19.291  -7.505  6.537   1.00 34.20 ? 416 ASP B HB2  1  
ATOM 10527  H HB3  . ASP B 2 416 ? 18.585  -7.087  8.098   1.00 72.21 ? 416 ASP B HB3  1  
ATOM 10528  N N    . GLY B 2 417 ? 21.314  -4.725  8.935   1.00 4.34  ? 417 GLY B N    1  
ATOM 10529  C CA   . GLY B 2 417 ? 22.359  -4.757  9.959   1.00 25.04 ? 417 GLY B CA   1  
ATOM 10530  C C    . GLY B 2 417 ? 22.181  -3.585  10.917  1.00 43.15 ? 417 GLY B C    1  
ATOM 10531  O O    . GLY B 2 417 ? 22.992  -2.643  10.934  1.00 34.55 ? 417 GLY B O    1  
ATOM 10532  H H    . GLY B 2 417 ? 20.851  -3.875  8.772   1.00 14.02 ? 417 GLY B H    1  
ATOM 10533  H HA2  . GLY B 2 417 ? 22.300  -5.686  10.517  1.00 62.31 ? 417 GLY B HA2  1  
ATOM 10534  H HA3  . GLY B 2 417 ? 23.329  -4.689  9.484   1.00 44.40 ? 417 GLY B HA3  1  
ATOM 10535  N N    . ALA B 2 418 ? 21.075  -3.638  11.687  1.00 40.44 ? 418 ALA B N    1  
ATOM 10536  C CA   . ALA B 2 418 ? 20.686  -2.579  12.646  1.00 14.33 ? 418 ALA B CA   1  
ATOM 10537  C C    . ALA B 2 418 ? 21.637  -2.563  13.849  1.00 61.35 ? 418 ALA B C    1  
ATOM 10538  O O    . ALA B 2 418 ? 21.878  -1.513  14.445  1.00 22.32 ? 418 ALA B O    1  
ATOM 10539  C CB   . ALA B 2 418 ? 19.234  -2.794  13.101  1.00 70.25 ? 418 ALA B CB   1  
ATOM 10540  H H    . ALA B 2 418 ? 20.510  -4.438  11.630  1.00 43.22 ? 418 ALA B H    1  
ATOM 10541  H HA   . ALA B 2 418 ? 20.744  -1.622  12.138  1.00 62.22 ? 418 ALA B HA   1  
ATOM 10542  H HB1  . ALA B 2 418 ? 18.933  -1.997  13.768  1.00 65.03 ? 418 ALA B HB1  1  
ATOM 10543  H HB2  . ALA B 2 418 ? 19.148  -3.744  13.617  1.00 14.20 ? 418 ALA B HB2  1  
ATOM 10544  H HB3  . ALA B 2 418 ? 18.580  -2.801  12.239  1.00 65.44 ? 418 ALA B HB3  1  
ATOM 10545  N N    . VAL B 2 419 ? 22.149  -3.753  14.205  1.00 2.31  ? 419 VAL B N    1  
ATOM 10546  C CA   . VAL B 2 419 ? 23.209  -3.915  15.190  1.00 15.41 ? 419 VAL B CA   1  
ATOM 10547  C C    . VAL B 2 419 ? 24.523  -4.142  14.416  1.00 3.44  ? 419 VAL B C    1  
ATOM 10548  O O    . VAL B 2 419 ? 25.119  -3.166  13.968  1.00 1.31  ? 419 VAL B O    1  
ATOM 10549  C CB   . VAL B 2 419 ? 22.932  -5.092  16.204  1.00 61.24 ? 419 VAL B CB   1  
ATOM 10550  C CG1  . VAL B 2 419 ? 24.041  -5.176  17.289  1.00 32.05 ? 419 VAL B CG1  1  
ATOM 10551  C CG2  . VAL B 2 419 ? 21.520  -4.971  16.833  1.00 62.03 ? 419 VAL B CG2  1  
ATOM 10552  H H    . VAL B 2 419 ? 21.811  -4.553  13.767  1.00 73.31 ? 419 VAL B H    1  
ATOM 10553  H HA   . VAL B 2 419 ? 23.293  -2.986  15.760  1.00 72.53 ? 419 VAL B HA   1  
ATOM 10554  H HB   . VAL B 2 419 ? 22.960  -6.026  15.638  1.00 54.33 ? 419 VAL B HB   1  
ATOM 10555  H HG11 . VAL B 2 419 ? 24.063  -4.262  17.869  1.00 63.04 ? 419 VAL B HG11 1  
ATOM 10556  H HG12 . VAL B 2 419 ? 25.007  -5.320  16.819  1.00 61.52 ? 419 VAL B HG12 1  
ATOM 10557  H HG13 . VAL B 2 419 ? 23.845  -6.013  17.947  1.00 62.51 ? 419 VAL B HG13 1  
ATOM 10558  H HG21 . VAL B 2 419 ? 21.444  -4.047  17.395  1.00 65.21 ? 419 VAL B HG21 1  
ATOM 10559  H HG22 . VAL B 2 419 ? 21.341  -5.807  17.493  1.00 2.01  ? 419 VAL B HG22 1  
ATOM 10560  H HG23 . VAL B 2 419 ? 20.772  -4.973  16.048  1.00 13.30 ? 419 VAL B HG23 1  
ATOM 10561  N N    . MET B 2 420 ? 24.886  -5.433  14.136  1.00 21.22 ? 420 MET B N    1  
ATOM 10562  C CA   . MET B 2 420 ? 26.231  -5.828  13.640  1.00 15.51 ? 420 MET B CA   1  
ATOM 10563  C C    . MET B 2 420 ? 27.342  -5.181  14.514  1.00 31.43 ? 420 MET B C    1  
ATOM 10564  O O    . MET B 2 420 ? 27.856  -5.810  15.436  1.00 71.51 ? 420 MET B O    1  
ATOM 10565  C CB   . MET B 2 420 ? 26.396  -5.494  12.124  1.00 73.12 ? 420 MET B CB   1  
ATOM 10566  C CG   . MET B 2 420 ? 27.764  -5.862  11.531  1.00 41.00 ? 420 MET B CG   1  
ATOM 10567  S SD   . MET B 2 420 ? 27.928  -5.402  9.788   1.00 65.30 ? 420 MET B SD   1  
ATOM 10568  C CE   . MET B 2 420 ? 29.648  -5.808  9.459   1.00 41.03 ? 420 MET B CE   1  
ATOM 10569  H H    . MET B 2 420 ? 24.209  -6.139  14.235  1.00 73.34 ? 420 MET B H    1  
ATOM 10570  H HA   . MET B 2 420 ? 26.301  -6.904  13.759  1.00 4.21  ? 420 MET B HA   1  
ATOM 10571  H HB2  . MET B 2 420 ? 25.635  -6.028  11.569  1.00 31.23 ? 420 MET B HB2  1  
ATOM 10572  H HB3  . MET B 2 420 ? 26.241  -4.431  11.983  1.00 73.12 ? 420 MET B HB3  1  
ATOM 10573  H HG2  . MET B 2 420 ? 28.538  -5.355  12.094  1.00 52.23 ? 420 MET B HG2  1  
ATOM 10574  H HG3  . MET B 2 420 ? 27.906  -6.932  11.620  1.00 73.22 ? 420 MET B HG3  1  
ATOM 10575  H HE1  . MET B 2 420 ? 29.886  -5.557  8.437   1.00 64.10 ? 420 MET B HE1  1  
ATOM 10576  H HE2  . MET B 2 420 ? 29.810  -6.865  9.618   1.00 51.12 ? 420 MET B HE2  1  
ATOM 10577  H HE3  . MET B 2 420 ? 30.286  -5.242  10.124  1.00 71.03 ? 420 MET B HE3  1  
ATOM 10578  N N    . VAL B 2 421 ? 27.677  -3.907  14.220  1.00 44.12 ? 421 VAL B N    1  
ATOM 10579  C CA   . VAL B 2 421 ? 28.505  -3.054  15.086  1.00 13.52 ? 421 VAL B CA   1  
ATOM 10580  C C    . VAL B 2 421 ? 27.572  -1.952  15.667  1.00 72.13 ? 421 VAL B C    1  
ATOM 10581  O O    . VAL B 2 421 ? 27.082  -2.101  16.790  1.00 72.42 ? 421 VAL B O    1  
ATOM 10582  C CB   . VAL B 2 421 ? 29.723  -2.433  14.294  1.00 60.43 ? 421 VAL B CB   1  
ATOM 10583  C CG1  . VAL B 2 421 ? 30.603  -1.518  15.187  1.00 62.21 ? 421 VAL B CG1  1  
ATOM 10584  C CG2  . VAL B 2 421 ? 30.572  -3.540  13.614  1.00 54.13 ? 421 VAL B CG2  1  
ATOM 10585  H H    . VAL B 2 421 ? 27.326  -3.515  13.390  1.00 41.21 ? 421 VAL B H    1  
ATOM 10586  H HA   . VAL B 2 421 ? 28.895  -3.663  15.907  1.00 52.31 ? 421 VAL B HA   1  
ATOM 10587  H HB   . VAL B 2 421 ? 29.309  -1.809  13.504  1.00 2.24  ? 421 VAL B HB   1  
ATOM 10588  H HG11 . VAL B 2 421 ? 31.020  -2.089  16.009  1.00 61.52 ? 421 VAL B HG11 1  
ATOM 10589  H HG12 . VAL B 2 421 ? 30.005  -0.709  15.586  1.00 62.14 ? 421 VAL B HG12 1  
ATOM 10590  H HG13 . VAL B 2 421 ? 31.409  -1.098  14.596  1.00 51.35 ? 421 VAL B HG13 1  
ATOM 10591  H HG21 . VAL B 2 421 ? 31.375  -3.088  13.045  1.00 25.12 ? 421 VAL B HG21 1  
ATOM 10592  H HG22 . VAL B 2 421 ? 29.949  -4.118  12.943  1.00 30.21 ? 421 VAL B HG22 1  
ATOM 10593  H HG23 . VAL B 2 421 ? 30.991  -4.200  14.365  1.00 20.40 ? 421 VAL B HG23 1  
ATOM 10594  N N    . MET B 2 422 ? 27.276  -0.909  14.835  1.00 3.34  ? 422 MET B N    1  
ATOM 10595  C CA   . MET B 2 422 ? 26.366  0.233   15.139  1.00 40.11 ? 422 MET B CA   1  
ATOM 10596  C C    . MET B 2 422 ? 26.758  0.999   16.421  1.00 33.21 ? 422 MET B C    1  
ATOM 10597  O O    . MET B 2 422 ? 27.263  2.123   16.342  1.00 1.43  ? 422 MET B O    1  
ATOM 10598  C CB   . MET B 2 422 ? 24.879  -0.215  15.198  1.00 64.32 ? 422 MET B CB   1  
ATOM 10599  C CG   . MET B 2 422 ? 23.871  0.945   15.328  1.00 3.40  ? 422 MET B CG   1  
ATOM 10600  S SD   . MET B 2 422 ? 23.935  2.110   13.939  1.00 13.52 ? 422 MET B SD   1  
ATOM 10601  C CE   . MET B 2 422 ? 23.512  1.053   12.550  1.00 74.10 ? 422 MET B CE   1  
ATOM 10602  H H    . MET B 2 422 ? 27.688  -0.912  13.952  1.00 62.12 ? 422 MET B H    1  
ATOM 10603  H HA   . MET B 2 422 ? 26.468  0.922   14.305  1.00 25.21 ? 422 MET B HA   1  
ATOM 10604  H HB2  . MET B 2 422 ? 24.646  -0.771  14.295  1.00 21.12 ? 422 MET B HB2  1  
ATOM 10605  H HB3  . MET B 2 422 ? 24.747  -0.879  16.048  1.00 2.11  ? 422 MET B HB3  1  
ATOM 10606  H HG2  . MET B 2 422 ? 22.870  0.535   15.386  1.00 41.43 ? 422 MET B HG2  1  
ATOM 10607  H HG3  . MET B 2 422 ? 24.081  1.487   16.239  1.00 31.02 ? 422 MET B HG3  1  
ATOM 10608  H HE1  . MET B 2 422 ? 23.466  1.648   11.649  1.00 12.32 ? 422 MET B HE1  1  
ATOM 10609  H HE2  . MET B 2 422 ? 22.551  0.593   12.727  1.00 15.32 ? 422 MET B HE2  1  
ATOM 10610  H HE3  . MET B 2 422 ? 24.264  0.287   12.437  1.00 41.44 ? 422 MET B HE3  1  
ATOM 10611  N N    . SER B 2 423 ? 26.496  0.384   17.588  1.00 61.23 ? 423 SER B N    1  
ATOM 10612  C CA   . SER B 2 423 ? 26.797  0.959   18.911  1.00 32.50 ? 423 SER B CA   1  
ATOM 10613  C C    . SER B 2 423 ? 28.276  1.400   19.048  1.00 41.33 ? 423 SER B C    1  
ATOM 10614  O O    . SER B 2 423 ? 29.161  0.821   18.403  1.00 62.22 ? 423 SER B O    1  
ATOM 10615  C CB   . SER B 2 423 ? 26.430  -0.076  19.991  1.00 2.35  ? 423 SER B CB   1  
ATOM 10616  O OG   . SER B 2 423 ? 26.999  -1.355  19.714  1.00 42.23 ? 423 SER B OG   1  
ATOM 10617  H H    . SER B 2 423 ? 26.076  -0.501  17.558  1.00 43.41 ? 423 SER B H    1  
ATOM 10618  H HA   . SER B 2 423 ? 26.162  1.827   19.037  1.00 61.03 ? 423 SER B HA   1  
ATOM 10619  H HB2  . SER B 2 423 ? 26.784  0.260   20.956  1.00 63.45 ? 423 SER B HB2  1  
ATOM 10620  H HB3  . SER B 2 423 ? 25.353  -0.184  20.027  1.00 13.13 ? 423 SER B HB3  1  
ATOM 10621  H HG   . SER B 2 423 ? 27.576  -1.289  18.938  1.00 63.12 ? 423 SER B HG   1  
ATOM 10622  N N    . TYR B 2 424 ? 28.499  2.431   19.897  1.00 41.31 ? 424 TYR B N    1  
ATOM 10623  C CA   . TYR B 2 424 ? 29.802  3.109   20.115  1.00 45.13 ? 424 TYR B CA   1  
ATOM 10624  C C    . TYR B 2 424 ? 30.141  4.025   18.919  1.00 72.42 ? 424 TYR B C    1  
ATOM 10625  O O    . TYR B 2 424 ? 30.209  5.250   19.074  1.00 60.05 ? 424 TYR B O    1  
ATOM 10626  C CB   . TYR B 2 424 ? 30.950  2.103   20.441  1.00 34.24 ? 424 TYR B CB   1  
ATOM 10627  C CG   . TYR B 2 424 ? 32.241  2.766   20.955  1.00 4.03  ? 424 TYR B CG   1  
ATOM 10628  C CD1  . TYR B 2 424 ? 32.405  3.058   22.311  1.00 23.53 ? 424 TYR B CD1  1  
ATOM 10629  C CD2  . TYR B 2 424 ? 33.285  3.095   20.087  1.00 71.24 ? 424 TYR B CD2  1  
ATOM 10630  C CE1  . TYR B 2 424 ? 33.560  3.649   22.779  1.00 25.35 ? 424 TYR B CE1  1  
ATOM 10631  C CE2  . TYR B 2 424 ? 34.441  3.690   20.553  1.00 21.43 ? 424 TYR B CE2  1  
ATOM 10632  C CZ   . TYR B 2 424 ? 34.573  3.960   21.900  1.00 33.03 ? 424 TYR B CZ   1  
ATOM 10633  O OH   . TYR B 2 424 ? 35.725  4.537   22.377  1.00 25.31 ? 424 TYR B OH   1  
ATOM 10634  H H    . TYR B 2 424 ? 27.735  2.752   20.426  1.00 62.14 ? 424 TYR B H    1  
ATOM 10635  H HA   . TYR B 2 424 ? 29.655  3.747   20.984  1.00 3.21  ? 424 TYR B HA   1  
ATOM 10636  H HB2  . TYR B 2 424 ? 30.597  1.414   21.200  1.00 3.11  ? 424 TYR B HB2  1  
ATOM 10637  H HB3  . TYR B 2 424 ? 31.186  1.530   19.545  1.00 63.14 ? 424 TYR B HB3  1  
ATOM 10638  H HD1  . TYR B 2 424 ? 31.607  2.816   23.009  1.00 41.53 ? 424 TYR B HD1  1  
ATOM 10639  H HD2  . TYR B 2 424 ? 33.173  2.884   19.028  1.00 53.54 ? 424 TYR B HD2  1  
ATOM 10640  H HE1  . TYR B 2 424 ? 33.663  3.864   23.833  1.00 74.22 ? 424 TYR B HE1  1  
ATOM 10641  H HE2  . TYR B 2 424 ? 35.235  3.933   19.865  1.00 55.40 ? 424 TYR B HE2  1  
ATOM 10642  H HH   . TYR B 2 424 ? 35.997  5.242   21.788  1.00 40.23 ? 424 TYR B HH   1  
ATOM 10643  N N    . GLY B 2 425 ? 30.368  3.412   17.737  1.00 42.22 ? 425 GLY B N    1  
ATOM 10644  C CA   . GLY B 2 425 ? 30.574  4.151   16.479  1.00 50.45 ? 425 GLY B CA   1  
ATOM 10645  C C    . GLY B 2 425 ? 31.749  5.128   16.512  1.00 75.12 ? 425 GLY B C    1  
ATOM 10646  O O    . GLY B 2 425 ? 31.617  6.275   16.069  1.00 71.54 ? 425 GLY B O    1  
ATOM 10647  H H    . GLY B 2 425 ? 30.387  2.435   17.716  1.00 61.31 ? 425 GLY B H    1  
ATOM 10648  H HA2  . GLY B 2 425 ? 30.745  3.436   15.691  1.00 12.21 ? 425 GLY B HA2  1  
ATOM 10649  H HA3  . GLY B 2 425 ? 29.669  4.701   16.251  1.00 14.43 ? 425 GLY B HA3  1  
ATOM 10650  N N    . ASN B 2 426 ? 32.882  4.675   17.089  1.00 75.14 ? 426 ASN B N    1  
ATOM 10651  C CA   . ASN B 2 426 ? 34.130  5.478   17.221  1.00 75.43 ? 426 ASN B CA   1  
ATOM 10652  C C    . ASN B 2 426 ? 33.898  6.792   18.019  1.00 24.51 ? 426 ASN B C    1  
ATOM 10653  O O    . ASN B 2 426 ? 34.672  7.751   17.906  1.00 53.14 ? 426 ASN B O    1  
ATOM 10654  C CB   . ASN B 2 426 ? 34.768  5.770   15.821  1.00 15.25 ? 426 ASN B CB   1  
ATOM 10655  C CG   . ASN B 2 426 ? 35.168  4.497   15.061  1.00 42.34 ? 426 ASN B CG   1  
ATOM 10656  O OD1  . ASN B 2 426 ? 34.383  3.949   14.287  1.00 42.12 ? 426 ASN B OD1  1  
ATOM 10657  N ND2  . ASN B 2 426 ? 36.383  4.009   15.296  1.00 44.44 ? 426 ASN B ND2  1  
ATOM 10658  H H    . ASN B 2 426 ? 32.884  3.759   17.438  1.00 45.33 ? 426 ASN B H    1  
ATOM 10659  H HA   . ASN B 2 426 ? 34.823  4.873   17.794  1.00 14.31 ? 426 ASN B HA   1  
ATOM 10660  H HB2  . ASN B 2 426 ? 34.056  6.320   15.213  1.00 63.44 ? 426 ASN B HB2  1  
ATOM 10661  H HB3  . ASN B 2 426 ? 35.653  6.383   15.954  1.00 51.24 ? 426 ASN B HB3  1  
ATOM 10662  H HD21 . ASN B 2 426 ? 36.958  4.481   15.936  1.00 55.43 ? 426 ASN B HD21 1  
ATOM 10663  H HD22 . ASN B 2 426 ? 36.658  3.202   14.814  1.00 21.24 ? 426 ASN B HD22 1  
ATOM 10664  N N    . SER B 2 427 ? 32.851  6.799   18.864  1.00 62.24 ? 427 SER B N    1  
ATOM 10665  C CA   . SER B 2 427 ? 32.462  7.962   19.677  1.00 33.51 ? 427 SER B CA   1  
ATOM 10666  C C    . SER B 2 427 ? 32.219  7.515   21.126  1.00 75.14 ? 427 SER B C    1  
ATOM 10667  O O    . SER B 2 427 ? 32.146  6.311   21.406  1.00 2.05  ? 427 SER B O    1  
ATOM 10668  C CB   . SER B 2 427 ? 31.198  8.620   19.074  1.00 23.33 ? 427 SER B CB   1  
ATOM 10669  O OG   . SER B 2 427 ? 30.846  9.820   19.751  1.00 2.11  ? 427 SER B OG   1  
ATOM 10670  H H    . SER B 2 427 ? 32.313  5.982   18.949  1.00 0.13  ? 427 SER B H    1  
ATOM 10671  H HA   . SER B 2 427 ? 33.275  8.684   19.670  1.00 2.43  ? 427 SER B HA   1  
ATOM 10672  H HB2  . SER B 2 427 ? 31.382  8.860   18.034  1.00 13.01 ? 427 SER B HB2  1  
ATOM 10673  H HB3  . SER B 2 427 ? 30.365  7.932   19.135  1.00 54.11 ? 427 SER B HB3  1  
ATOM 10674  H HG   . SER B 2 427 ? 31.304  10.563  19.340  1.00 65.51 ? 427 SER B HG   1  
ATOM 10675  N N    . GLU B 2 428 ? 32.097  8.494   22.045  1.00 30.04 ? 428 GLU B N    1  
ATOM 10676  C CA   . GLU B 2 428 ? 31.936  8.223   23.481  1.00 44.34 ? 428 GLU B CA   1  
ATOM 10677  C C    . GLU B 2 428 ? 30.487  7.805   23.795  1.00 61.13 ? 428 GLU B C    1  
ATOM 10678  O O    . GLU B 2 428 ? 29.616  8.648   24.068  1.00 4.34  ? 428 GLU B O    1  
ATOM 10679  C CB   . GLU B 2 428 ? 32.356  9.454   24.335  1.00 22.15 ? 428 GLU B CB   1  
ATOM 10680  C CG   . GLU B 2 428 ? 32.236  9.257   25.867  1.00 13.52 ? 428 GLU B CG   1  
ATOM 10681  C CD   . GLU B 2 428 ? 32.565  10.528  26.674  1.00 24.33 ? 428 GLU B CD   1  
ATOM 10682  O OE1  . GLU B 2 428 ? 33.555  10.536  27.440  1.00 73.22 ? 428 GLU B OE1  1  
ATOM 10683  O OE2  . GLU B 2 428 ? 31.834  11.537  26.531  1.00 73.23 ? 428 GLU B OE2  1  
ATOM 10684  H H    . GLU B 2 428 ? 32.106  9.427   21.740  1.00 24.20 ? 428 GLU B H    1  
ATOM 10685  H HA   . GLU B 2 428 ? 32.597  7.393   23.733  1.00 20.51 ? 428 GLU B HA   1  
ATOM 10686  H HB2  . GLU B 2 428 ? 33.387  9.699   24.104  1.00 4.33  ? 428 GLU B HB2  1  
ATOM 10687  H HB3  . GLU B 2 428 ? 31.733  10.298  24.052  1.00 3.21  ? 428 GLU B HB3  1  
ATOM 10688  H HG2  . GLU B 2 428 ? 31.219  8.956   26.104  1.00 1.44  ? 428 GLU B HG2  1  
ATOM 10689  H HG3  . GLU B 2 428 ? 32.911  8.460   26.166  1.00 22.20 ? 428 GLU B HG3  1  
ATOM 10690  N N    . GLU B 2 429 ? 30.238  6.497   23.683  1.00 41.32 ? 429 GLU B N    1  
ATOM 10691  C CA   . GLU B 2 429 ? 29.036  5.861   24.209  1.00 50.54 ? 429 GLU B CA   1  
ATOM 10692  C C    . GLU B 2 429 ? 29.399  5.352   25.613  1.00 3.42  ? 429 GLU B C    1  
ATOM 10693  O O    . GLU B 2 429 ? 30.102  4.338   25.748  1.00 31.01 ? 429 GLU B O    1  
ATOM 10694  C CB   . GLU B 2 429 ? 28.589  4.705   23.279  1.00 53.32 ? 429 GLU B CB   1  
ATOM 10695  C CG   . GLU B 2 429 ? 27.320  3.954   23.733  1.00 63.42 ? 429 GLU B CG   1  
ATOM 10696  C CD   . GLU B 2 429 ? 26.963  2.775   22.811  1.00 1.41  ? 429 GLU B CD   1  
ATOM 10697  O OE1  . GLU B 2 429 ? 27.767  1.818   22.739  1.00 13.01 ? 429 GLU B OE1  1  
ATOM 10698  O OE2  . GLU B 2 429 ? 25.904  2.805   22.142  1.00 40.03 ? 429 GLU B OE2  1  
ATOM 10699  H H    . GLU B 2 429 ? 30.902  5.934   23.233  1.00 21.32 ? 429 GLU B H    1  
ATOM 10700  H HA   . GLU B 2 429 ? 28.239  6.604   24.277  1.00 30.44 ? 429 GLU B HA   1  
ATOM 10701  H HB2  . GLU B 2 429 ? 28.408  5.107   22.288  1.00 34.42 ? 429 GLU B HB2  1  
ATOM 10702  H HB3  . GLU B 2 429 ? 29.401  3.985   23.209  1.00 50.24 ? 429 GLU B HB3  1  
ATOM 10703  H HG2  . GLU B 2 429 ? 27.485  3.568   24.736  1.00 54.03 ? 429 GLU B HG2  1  
ATOM 10704  H HG3  . GLU B 2 429 ? 26.490  4.655   23.762  1.00 2.14  ? 429 GLU B HG3  1  
ATOM 10705  N N    . ASP B 2 430 ? 28.974  6.116   26.633  1.00 42.31 ? 430 ASP B N    1  
ATOM 10706  C CA   . ASP B 2 430 ? 29.351  5.902   28.046  1.00 2.51  ? 430 ASP B CA   1  
ATOM 10707  C C    . ASP B 2 430 ? 28.953  4.503   28.516  1.00 23.35 ? 430 ASP B C    1  
ATOM 10708  O O    . ASP B 2 430 ? 29.792  3.746   29.016  1.00 55.41 ? 430 ASP B O    1  
ATOM 10709  C CB   . ASP B 2 430 ? 28.660  6.958   28.946  1.00 35.44 ? 430 ASP B CB   1  
ATOM 10710  C CG   . ASP B 2 430 ? 28.987  8.394   28.534  1.00 15.34 ? 430 ASP B CG   1  
ATOM 10711  O OD1  . ASP B 2 430 ? 28.245  8.969   27.712  1.00 34.31 ? 430 ASP B OD1  1  
ATOM 10712  O OD2  . ASP B 2 430 ? 30.004  8.943   29.010  1.00 50.21 ? 430 ASP B OD2  1  
ATOM 10713  H H    . ASP B 2 430 ? 28.373  6.861   26.427  1.00 54.12 ? 430 ASP B H    1  
ATOM 10714  H HA   . ASP B 2 430 ? 30.430  6.021   28.129  1.00 24.25 ? 430 ASP B HA   1  
ATOM 10715  H HB2  . ASP B 2 430 ? 27.582  6.816   28.893  1.00 62.42 ? 430 ASP B HB2  1  
ATOM 10716  H HB3  . ASP B 2 430 ? 28.974  6.810   29.977  1.00 53.22 ? 430 ASP B HB3  1  
ATOM 10717  N N    . SER B 2 431 ? 27.659  4.197   28.322  1.00 73.31 ? 431 SER B N    1  
ATOM 10718  C CA   . SER B 2 431 ? 27.024  2.942   28.740  1.00 63.25 ? 431 SER B CA   1  
ATOM 10719  C C    . SER B 2 431 ? 26.990  2.797   30.294  1.00 71.45 ? 431 SER B C    1  
ATOM 10720  O O    . SER B 2 431 ? 26.120  3.394   30.938  1.00 1.21  ? 431 SER B O    1  
ATOM 10721  C CB   . SER B 2 431 ? 27.681  1.728   28.027  1.00 53.42 ? 431 SER B CB   1  
ATOM 10722  O OG   . SER B 2 431 ? 27.696  1.917   26.624  1.00 54.44 ? 431 SER B OG   1  
ATOM 10723  H H    . SER B 2 431 ? 27.101  4.855   27.855  1.00 54.32 ? 431 SER B H    1  
ATOM 10724  H HA   . SER B 2 431 ? 25.990  3.007   28.400  1.00 13.43 ? 431 SER B HA   1  
ATOM 10725  H HB2  . SER B 2 431 ? 28.702  1.622   28.370  1.00 75.05 ? 431 SER B HB2  1  
ATOM 10726  H HB3  . SER B 2 431 ? 27.130  0.826   28.251  1.00 64.14 ? 431 SER B HB3  1  
ATOM 10727  H HG   . SER B 2 431 ? 28.368  2.569   26.404  1.00 44.12 ? 431 SER B HG   1  
ATOM 10728  N N    . GLN B 2 432 ? 27.982  2.073   30.879  1.00 65.32 ? 432 GLN B N    1  
ATOM 10729  C CA   . GLN B 2 432 ? 28.002  1.653   32.312  1.00 32.11 ? 432 GLN B CA   1  
ATOM 10730  C C    . GLN B 2 432 ? 26.768  0.795   32.711  1.00 2.41  ? 432 GLN B C    1  
ATOM 10731  O O    . GLN B 2 432 ? 25.849  0.552   31.918  1.00 10.41 ? 432 GLN B O    1  
ATOM 10732  C CB   . GLN B 2 432 ? 28.182  2.860   33.305  1.00 4.44  ? 432 GLN B CB   1  
ATOM 10733  C CG   . GLN B 2 432 ? 29.634  3.367   33.495  1.00 71.10 ? 432 GLN B CG   1  
ATOM 10734  C CD   . GLN B 2 432 ? 30.218  4.155   32.314  1.00 2.20  ? 432 GLN B CD   1  
ATOM 10735  O OE1  . GLN B 2 432 ? 31.409  4.087   32.041  1.00 53.32 ? 432 GLN B OE1  1  
ATOM 10736  N NE2  . GLN B 2 432 ? 29.401  4.951   31.642  1.00 60.52 ? 432 GLN B NE2  1  
ATOM 10737  H H    . GLN B 2 432 ? 28.749  1.824   30.326  1.00 2.41  ? 432 GLN B H    1  
ATOM 10738  H HA   . GLN B 2 432 ? 28.866  1.008   32.414  1.00 44.43 ? 432 GLN B HA   1  
ATOM 10739  H HB2  . GLN B 2 432 ? 27.582  3.692   32.950  1.00 34.43 ? 432 GLN B HB2  1  
ATOM 10740  H HB3  . GLN B 2 432 ? 27.804  2.570   34.282  1.00 42.31 ? 432 GLN B HB3  1  
ATOM 10741  H HG2  . GLN B 2 432 ? 29.656  4.016   34.360  1.00 54.03 ? 432 GLN B HG2  1  
ATOM 10742  H HG3  . GLN B 2 432 ? 30.272  2.509   33.690  1.00 64.15 ? 432 GLN B HG3  1  
ATOM 10743  H HE21 . GLN B 2 432 ? 28.464  5.003   31.922  1.00 1.33  ? 432 GLN B HE21 1  
ATOM 10744  H HE22 . GLN B 2 432 ? 29.768  5.456   30.892  1.00 33.15 ? 432 GLN B HE22 1  
ATOM 10745  N N    . GLU B 2 433 ? 26.787  0.325   33.971  1.00 32.24 ? 433 GLU B N    1  
ATOM 10746  C CA   . GLU B 2 433 ? 25.720  -0.496  34.572  1.00 40.42 ? 433 GLU B CA   1  
ATOM 10747  C C    . GLU B 2 433 ? 24.589  0.438   35.043  1.00 2.00  ? 433 GLU B C    1  
ATOM 10748  O O    . GLU B 2 433 ? 24.737  1.139   36.053  1.00 5.24  ? 433 GLU B O    1  
ATOM 10749  C CB   . GLU B 2 433 ? 26.285  -1.331  35.767  1.00 12.42 ? 433 GLU B CB   1  
ATOM 10750  C CG   . GLU B 2 433 ? 27.395  -2.364  35.413  1.00 73.43 ? 433 GLU B CG   1  
ATOM 10751  C CD   . GLU B 2 433 ? 28.709  -1.764  34.862  1.00 22.03 ? 433 GLU B CD   1  
ATOM 10752  O OE1  . GLU B 2 433 ? 29.187  -0.738  35.402  1.00 71.51 ? 433 GLU B OE1  1  
ATOM 10753  O OE2  . GLU B 2 433 ? 29.281  -2.329  33.903  1.00 22.31 ? 433 GLU B OE2  1  
ATOM 10754  H H    . GLU B 2 433 ? 27.564  0.536   34.529  1.00 11.51 ? 433 GLU B H    1  
ATOM 10755  H HA   . GLU B 2 433 ? 25.336  -1.175  33.811  1.00 11.51 ? 433 GLU B HA   1  
ATOM 10756  H HB2  . GLU B 2 433 ? 26.698  -0.650  36.502  1.00 33.30 ? 433 GLU B HB2  1  
ATOM 10757  H HB3  . GLU B 2 433 ? 25.467  -1.874  36.228  1.00 52.33 ? 433 GLU B HB3  1  
ATOM 10758  H HG2  . GLU B 2 433 ? 27.636  -2.923  36.313  1.00 51.43 ? 433 GLU B HG2  1  
ATOM 10759  H HG3  . GLU B 2 433 ? 26.989  -3.057  34.681  1.00 43.51 ? 433 GLU B HG3  1  
ATOM 10760  N N    . HIS B 2 434 ? 23.490  0.493   34.270  1.00 61.42 ? 434 HIS B N    1  
ATOM 10761  C CA   . HIS B 2 434 ? 22.375  1.452   34.489  1.00 32.20 ? 434 HIS B CA   1  
ATOM 10762  C C    . HIS B 2 434 ? 21.021  0.724   34.577  1.00 44.43 ? 434 HIS B C    1  
ATOM 10763  O O    . HIS B 2 434 ? 20.916  -0.463  34.249  1.00 65.13 ? 434 HIS B O    1  
ATOM 10764  C CB   . HIS B 2 434 ? 22.346  2.499   33.341  1.00 4.13  ? 434 HIS B CB   1  
ATOM 10765  C CG   . HIS B 2 434 ? 23.378  3.612   33.410  1.00 64.12 ? 434 HIS B CG   1  
ATOM 10766  N ND1  . HIS B 2 434 ? 23.097  4.908   33.036  1.00 3.31  ? 434 HIS B ND1  1  
ATOM 10767  C CD2  . HIS B 2 434 ? 24.683  3.615   33.772  1.00 34.13 ? 434 HIS B CD2  1  
ATOM 10768  C CE1  . HIS B 2 434 ? 24.178  5.646   33.154  1.00 24.30 ? 434 HIS B CE1  1  
ATOM 10769  N NE2  . HIS B 2 434 ? 25.156  4.890   33.600  1.00 21.41 ? 434 HIS B NE2  1  
ATOM 10770  H H    . HIS B 2 434 ? 23.417  -0.135  33.522  1.00 1.44  ? 434 HIS B H    1  
ATOM 10771  H HA   . HIS B 2 434 ? 22.539  1.970   35.431  1.00 4.04  ? 434 HIS B HA   1  
ATOM 10772  H HB2  . HIS B 2 434 ? 22.499  1.990   32.395  1.00 35.12 ? 434 HIS B HB2  1  
ATOM 10773  H HB3  . HIS B 2 434 ? 21.369  2.970   33.312  1.00 65.10 ? 434 HIS B HB3  1  
ATOM 10774  H HD1  . HIS B 2 434 ? 22.224  5.240   32.724  1.00 43.14 ? 434 HIS B HD1  1  
ATOM 10775  H HD2  . HIS B 2 434 ? 25.252  2.762   34.127  1.00 30.44 ? 434 HIS B HD2  1  
ATOM 10776  H HE1  . HIS B 2 434 ? 24.249  6.703   32.930  1.00 73.42 ? 434 HIS B HE1  1  
ATOM 10777  H HE2  . HIS B 2 434 ? 26.103  5.139   33.572  1.00 37.66 ? 434 HIS B HE2  1  
ATOM 10778  N N    . THR B 2 435 ? 19.981  1.483   34.981  1.00 71.24 ? 435 THR B N    1  
ATOM 10779  C CA   . THR B 2 435 ? 18.620  0.961   35.227  1.00 73.42 ? 435 THR B CA   1  
ATOM 10780  C C    . THR B 2 435 ? 17.898  0.575   33.914  1.00 11.32 ? 435 THR B C    1  
ATOM 10781  O O    . THR B 2 435 ? 16.955  -0.227  33.931  1.00 51.00 ? 435 THR B O    1  
ATOM 10782  C CB   . THR B 2 435 ? 17.780  2.025   36.011  1.00 71.20 ? 435 THR B CB   1  
ATOM 10783  O OG1  . THR B 2 435 ? 18.544  2.512   37.134  1.00 50.24 ? 435 THR B OG1  1  
ATOM 10784  C CG2  . THR B 2 435 ? 16.430  1.477   36.530  1.00 35.13 ? 435 THR B CG2  1  
ATOM 10785  H H    . THR B 2 435 ? 20.134  2.441   35.121  1.00 13.13 ? 435 THR B H    1  
ATOM 10786  H HA   . THR B 2 435 ? 18.710  0.076   35.853  1.00 31.23 ? 435 THR B HA   1  
ATOM 10787  H HB   . THR B 2 435 ? 17.580  2.868   35.353  1.00 41.44 ? 435 THR B HB   1  
ATOM 10788  H HG1  . THR B 2 435 ? 18.635  1.807   37.789  1.00 51.33 ? 435 THR B HG1  1  
ATOM 10789  H HG21 . THR B 2 435 ? 15.818  1.163   35.696  1.00 42.21 ? 435 THR B HG21 1  
ATOM 10790  H HG22 . THR B 2 435 ? 15.907  2.254   37.078  1.00 2.33  ? 435 THR B HG22 1  
ATOM 10791  H HG23 . THR B 2 435 ? 16.599  0.634   37.187  1.00 31.21 ? 435 THR B HG23 1  
ATOM 10792  N N    . GLY B 2 436 ? 18.364  1.137   32.783  1.00 12.53 ? 436 GLY B N    1  
ATOM 10793  C CA   . GLY B 2 436 ? 17.789  0.847   31.456  1.00 2.33  ? 436 GLY B CA   1  
ATOM 10794  C C    . GLY B 2 436 ? 17.837  -0.629  31.049  1.00 24.22 ? 436 GLY B C    1  
ATOM 10795  O O    . GLY B 2 436 ? 17.058  -1.068  30.191  1.00 43.54 ? 436 GLY B O    1  
ATOM 10796  H H    . GLY B 2 436 ? 19.107  1.775   32.854  1.00 52.32 ? 436 GLY B H    1  
ATOM 10797  H HA2  . GLY B 2 436 ? 16.757  1.171   31.459  1.00 61.51 ? 436 GLY B HA2  1  
ATOM 10798  H HA3  . GLY B 2 436 ? 18.327  1.422   30.715  1.00 1.43  ? 436 GLY B HA3  1  
ATOM 10799  N N    . SER B 2 437 ? 18.742  -1.379  31.695  1.00 45.41 ? 437 SER B N    1  
ATOM 10800  C CA   . SER B 2 437 ? 18.983  -2.812  31.448  1.00 20.14 ? 437 SER B CA   1  
ATOM 10801  C C    . SER B 2 437 ? 17.704  -3.670  31.580  1.00 33.12 ? 437 SER B C    1  
ATOM 10802  O O    . SER B 2 437 ? 17.468  -4.537  30.733  1.00 51.45 ? 437 SER B O    1  
ATOM 10803  C CB   . SER B 2 437 ? 20.057  -3.296  32.442  1.00 1.30  ? 437 SER B CB   1  
ATOM 10804  O OG   . SER B 2 437 ? 19.653  -3.072  33.784  1.00 54.14 ? 437 SER B OG   1  
ATOM 10805  H H    . SER B 2 437 ? 19.274  -0.948  32.396  1.00 11.33 ? 437 SER B H    1  
ATOM 10806  H HA   . SER B 2 437 ? 19.371  -2.915  30.445  1.00 13.30 ? 437 SER B HA   1  
ATOM 10807  H HB2  . SER B 2 437 ? 20.243  -4.356  32.309  1.00 31.11 ? 437 SER B HB2  1  
ATOM 10808  H HB3  . SER B 2 437 ? 20.973  -2.750  32.266  1.00 23.44 ? 437 SER B HB3  1  
ATOM 10809  H HG   . SER B 2 437 ? 20.381  -3.279  34.379  1.00 72.35 ? 437 SER B HG   1  
ATOM 10810  N N    . GLN B 2 438 ? 16.882  -3.346  32.613  1.00 4.20  ? 438 GLN B N    1  
ATOM 10811  C CA   . GLN B 2 438 ? 15.672  -4.111  33.045  1.00 53.55 ? 438 GLN B CA   1  
ATOM 10812  C C    . GLN B 2 438 ? 14.899  -4.783  31.876  1.00 34.23 ? 438 GLN B C    1  
ATOM 10813  O O    . GLN B 2 438 ? 14.353  -4.094  31.013  1.00 32.11 ? 438 GLN B O    1  
ATOM 10814  C CB   . GLN B 2 438 ? 14.707  -3.169  33.827  1.00 1.24  ? 438 GLN B CB   1  
ATOM 10815  C CG   . GLN B 2 438 ? 15.244  -2.675  35.185  1.00 1.41  ? 438 GLN B CG   1  
ATOM 10816  C CD   . GLN B 2 438 ? 14.327  -1.653  35.877  1.00 71.55 ? 438 GLN B CD   1  
ATOM 10817  O OE1  . GLN B 2 438 ? 13.647  -0.860  35.222  1.00 2.02  ? 438 GLN B OE1  1  
ATOM 10818  N NE2  . GLN B 2 438 ? 14.295  -1.669  37.204  1.00 14.45 ? 438 GLN B NE2  1  
ATOM 10819  H H    . GLN B 2 438 ? 17.108  -2.541  33.122  1.00 21.14 ? 438 GLN B H    1  
ATOM 10820  H HA   . GLN B 2 438 ? 16.016  -4.878  33.725  1.00 35.44 ? 438 GLN B HA   1  
ATOM 10821  H HB2  . GLN B 2 438 ? 14.494  -2.304  33.212  1.00 71.13 ? 438 GLN B HB2  1  
ATOM 10822  H HB3  . GLN B 2 438 ? 13.771  -3.695  34.011  1.00 40.02 ? 438 GLN B HB3  1  
ATOM 10823  H HG2  . GLN B 2 438 ? 15.361  -3.531  35.835  1.00 71.20 ? 438 GLN B HG2  1  
ATOM 10824  H HG3  . GLN B 2 438 ? 16.209  -2.215  35.028  1.00 51.42 ? 438 GLN B HG3  1  
ATOM 10825  H HE21 . GLN B 2 438 ? 14.853  -2.326  37.673  1.00 44.21 ? 438 GLN B HE21 1  
ATOM 10826  H HE22 . GLN B 2 438 ? 13.719  -1.023  37.664  1.00 41.42 ? 438 GLN B HE22 1  
ATOM 10827  N N    . LEU B 2 439 ? 14.880  -6.132  31.859  1.00 43.14 ? 439 LEU B N    1  
ATOM 10828  C CA   . LEU B 2 439 ? 14.262  -6.917  30.771  1.00 74.24 ? 439 LEU B CA   1  
ATOM 10829  C C    . LEU B 2 439 ? 13.721  -8.261  31.304  1.00 41.13 ? 439 LEU B C    1  
ATOM 10830  O O    . LEU B 2 439 ? 14.225  -8.793  32.298  1.00 71.32 ? 439 LEU B O    1  
ATOM 10831  C CB   . LEU B 2 439 ? 15.270  -7.145  29.587  1.00 31.25 ? 439 LEU B CB   1  
ATOM 10832  C CG   . LEU B 2 439 ? 16.476  -8.132  29.805  1.00 13.51 ? 439 LEU B CG   1  
ATOM 10833  C CD1  . LEU B 2 439 ? 17.295  -8.284  28.505  1.00 13.23 ? 439 LEU B CD1  1  
ATOM 10834  C CD2  . LEU B 2 439 ? 17.401  -7.700  30.969  1.00 43.14 ? 439 LEU B CD2  1  
ATOM 10835  H H    . LEU B 2 439 ? 15.286  -6.619  32.610  1.00 35.53 ? 439 LEU B H    1  
ATOM 10836  H HA   . LEU B 2 439 ? 13.414  -6.343  30.398  1.00 15.24 ? 439 LEU B HA   1  
ATOM 10837  H HB2  . LEU B 2 439 ? 14.701  -7.505  28.735  1.00 13.45 ? 439 LEU B HB2  1  
ATOM 10838  H HB3  . LEU B 2 439 ? 15.679  -6.176  29.313  1.00 10.21 ? 439 LEU B HB3  1  
ATOM 10839  H HG   . LEU B 2 439 ? 16.080  -9.111  30.050  1.00 62.22 ? 439 LEU B HG   1  
ATOM 10840  H HD11 . LEU B 2 439 ? 18.108  -8.980  28.662  1.00 32.44 ? 439 LEU B HD11 1  
ATOM 10841  H HD12 . LEU B 2 439 ? 17.702  -7.320  28.209  1.00 64.11 ? 439 LEU B HD12 1  
ATOM 10842  H HD13 . LEU B 2 439 ? 16.657  -8.657  27.717  1.00 74.24 ? 439 LEU B HD13 1  
ATOM 10843  H HD21 . LEU B 2 439 ? 18.204  -8.415  31.081  1.00 41.33 ? 439 LEU B HD21 1  
ATOM 10844  H HD22 . LEU B 2 439 ? 16.833  -7.660  31.889  1.00 11.21 ? 439 LEU B HD22 1  
ATOM 10845  H HD23 . LEU B 2 439 ? 17.821  -6.720  30.765  1.00 53.50 ? 439 LEU B HD23 1  
ATOM 10846  N N    . ARG B 2 440 ? 12.686  -8.780  30.624  1.00 60.21 ? 440 ARG B N    1  
ATOM 10847  C CA   . ARG B 2 440 ? 12.049  -10.069 30.932  1.00 50.43 ? 440 ARG B CA   1  
ATOM 10848  C C    . ARG B 2 440 ? 11.351  -10.577 29.659  1.00 42.21 ? 440 ARG B C    1  
ATOM 10849  O O    . ARG B 2 440 ? 10.245  -10.144 29.328  1.00 32.42 ? 440 ARG B O    1  
ATOM 10850  C CB   . ARG B 2 440 ? 11.046  -9.930  32.120  1.00 53.23 ? 440 ARG B CB   1  
ATOM 10851  C CG   . ARG B 2 440 ? 10.311  -11.234 32.531  1.00 54.44 ? 440 ARG B CG   1  
ATOM 10852  C CD   . ARG B 2 440 ? 11.274  -12.409 32.804  1.00 32.12 ? 440 ARG B CD   1  
ATOM 10853  N NE   . ARG B 2 440 ? 12.305  -12.074 33.810  1.00 45.23 ? 440 ARG B NE   1  
ATOM 10854  C CZ   . ARG B 2 440 ? 13.637  -12.244 33.659  1.00 62.44 ? 440 ARG B CZ   1  
ATOM 10855  N NH1  . ARG B 2 440 ? 14.144  -12.751 32.535  1.00 70.10 ? 440 ARG B NH1  1  
ATOM 10856  N NH2  . ARG B 2 440 ? 14.454  -11.910 34.646  1.00 22.41 ? 440 ARG B NH2  1  
ATOM 10857  H H    . ARG B 2 440 ? 12.323  -8.259  29.881  1.00 5.02  ? 440 ARG B H    1  
ATOM 10858  H HA   . ARG B 2 440 ? 12.831  -10.770 31.210  1.00 54.42 ? 440 ARG B HA   1  
ATOM 10859  H HB2  . ARG B 2 440 ? 11.586  -9.564  32.985  1.00 34.30 ? 440 ARG B HB2  1  
ATOM 10860  H HB3  . ARG B 2 440 ? 10.297  -9.191  31.853  1.00 62.12 ? 440 ARG B HB3  1  
ATOM 10861  H HG2  . ARG B 2 440 ? 9.736   -11.040 33.431  1.00 64.45 ? 440 ARG B HG2  1  
ATOM 10862  H HG3  . ARG B 2 440 ? 9.629   -11.516 31.735  1.00 52.43 ? 440 ARG B HG3  1  
ATOM 10863  H HD2  . ARG B 2 440 ? 10.699  -13.252 33.168  1.00 61.03 ? 440 ARG B HD2  1  
ATOM 10864  H HD3  . ARG B 2 440 ? 11.755  -12.689 31.871  1.00 13.10 ? 440 ARG B HD3  1  
ATOM 10865  H HE   . ARG B 2 440 ? 11.980  -11.697 34.653  1.00 21.43 ? 440 ARG B HE   1  
ATOM 10866  H HH11 . ARG B 2 440 ? 13.539  -13.017 31.782  1.00 21.21 ? 440 ARG B HH11 1  
ATOM 10867  H HH12 . ARG B 2 440 ? 15.137  -12.872 32.439  1.00 74.10 ? 440 ARG B HH12 1  
ATOM 10868  H HH21 . ARG B 2 440 ? 14.087  -11.531 35.500  1.00 12.32 ? 440 ARG B HH21 1  
ATOM 10869  H HH22 . ARG B 2 440 ? 15.446  -12.032 34.545  1.00 63.24 ? 440 ARG B HH22 1  
ATOM 10870  N N    . ILE B 2 441 ? 12.033  -11.479 28.948  1.00 71.21 ? 441 ILE B N    1  
ATOM 10871  C CA   . ILE B 2 441 ? 11.597  -11.974 27.641  1.00 24.03 ? 441 ILE B CA   1  
ATOM 10872  C C    . ILE B 2 441 ? 10.346  -12.857 27.766  1.00 4.34  ? 441 ILE B C    1  
ATOM 10873  O O    . ILE B 2 441 ? 10.361  -13.893 28.447  1.00 71.11 ? 441 ILE B O    1  
ATOM 10874  C CB   . ILE B 2 441 ? 12.764  -12.744 26.931  1.00 24.31 ? 441 ILE B CB   1  
ATOM 10875  C CG1  . ILE B 2 441 ? 13.984  -11.771 26.772  1.00 53.44 ? 441 ILE B CG1  1  
ATOM 10876  C CG2  . ILE B 2 441 ? 12.310  -13.353 25.572  1.00 21.32 ? 441 ILE B CG2  1  
ATOM 10877  C CD1  . ILE B 2 441 ? 15.125  -12.293 25.940  1.00 74.15 ? 441 ILE B CD1  1  
ATOM 10878  H H    . ILE B 2 441 ? 12.864  -11.837 29.327  1.00 2.42  ? 441 ILE B H    1  
ATOM 10879  H HA   . ILE B 2 441 ? 11.353  -11.106 27.026  1.00 10.13 ? 441 ILE B HA   1  
ATOM 10880  H HB   . ILE B 2 441 ? 13.060  -13.570 27.576  1.00 73.01 ? 441 ILE B HB   1  
ATOM 10881  H HG12 . ILE B 2 441 ? 13.651  -10.855 26.302  1.00 22.22 ? 441 ILE B HG12 1  
ATOM 10882  H HG13 . ILE B 2 441 ? 14.378  -11.531 27.753  1.00 43.52 ? 441 ILE B HG13 1  
ATOM 10883  H HG21 . ILE B 2 441 ? 11.994  -12.565 24.900  1.00 72.34 ? 441 ILE B HG21 1  
ATOM 10884  H HG22 . ILE B 2 441 ? 11.484  -14.034 25.731  1.00 13.51 ? 441 ILE B HG22 1  
ATOM 10885  H HG23 . ILE B 2 441 ? 13.131  -13.901 25.118  1.00 13.01 ? 441 ILE B HG23 1  
ATOM 10886  H HD11 . ILE B 2 441 ? 14.796  -12.433 24.918  1.00 44.21 ? 441 ILE B HD11 1  
ATOM 10887  H HD12 . ILE B 2 441 ? 15.471  -13.235 26.340  1.00 61.34 ? 441 ILE B HD12 1  
ATOM 10888  H HD13 . ILE B 2 441 ? 15.935  -11.579 25.954  1.00 1.11  ? 441 ILE B HD13 1  
ATOM 10889  N N    . ALA B 2 442 ? 9.266   -12.404 27.112  1.00 71.41 ? 442 ALA B N    1  
ATOM 10890  C CA   . ALA B 2 442 ? 7.979   -13.104 27.062  1.00 62.22 ? 442 ALA B CA   1  
ATOM 10891  C C    . ALA B 2 442 ? 7.493   -13.189 25.601  1.00 53.34 ? 442 ALA B C    1  
ATOM 10892  O O    . ALA B 2 442 ? 6.296   -13.063 25.309  1.00 30.34 ? 442 ALA B O    1  
ATOM 10893  C CB   . ALA B 2 442 ? 6.976   -12.378 27.970  1.00 23.42 ? 442 ALA B CB   1  
ATOM 10894  H H    . ALA B 2 442 ? 9.339   -11.547 26.642  1.00 23.40 ? 442 ALA B H    1  
ATOM 10895  H HA   . ALA B 2 442 ? 8.110   -14.118 27.440  1.00 71.25 ? 442 ALA B HA   1  
ATOM 10896  H HB1  . ALA B 2 442 ? 6.030   -12.902 27.960  1.00 25.53 ? 442 ALA B HB1  1  
ATOM 10897  H HB2  . ALA B 2 442 ? 6.825   -11.364 27.618  1.00 4.14  ? 442 ALA B HB2  1  
ATOM 10898  H HB3  . ALA B 2 442 ? 7.355   -12.348 28.984  1.00 73.33 ? 442 ALA B HB3  1  
ATOM 10899  N N    . ALA B 2 443 ? 8.453   -13.408 24.684  1.00 74.21 ? 443 ALA B N    1  
ATOM 10900  C CA   . ALA B 2 443 ? 8.175   -13.662 23.259  1.00 42.34 ? 443 ALA B CA   1  
ATOM 10901  C C    . ALA B 2 443 ? 7.784   -15.136 23.053  1.00 4.43  ? 443 ALA B C    1  
ATOM 10902  O O    . ALA B 2 443 ? 7.907   -15.942 23.982  1.00 21.22 ? 443 ALA B O    1  
ATOM 10903  C CB   . ALA B 2 443 ? 9.401   -13.285 22.418  1.00 41.24 ? 443 ALA B CB   1  
ATOM 10904  H H    . ALA B 2 443 ? 9.387   -13.402 24.981  1.00 1.23  ? 443 ALA B H    1  
ATOM 10905  H HA   . ALA B 2 443 ? 7.343   -13.032 22.952  1.00 23.02 ? 443 ALA B HA   1  
ATOM 10906  H HB1  . ALA B 2 443 ? 9.196   -13.454 21.368  1.00 12.13 ? 443 ALA B HB1  1  
ATOM 10907  H HB2  . ALA B 2 443 ? 10.251  -13.885 22.718  1.00 21.33 ? 443 ALA B HB2  1  
ATOM 10908  H HB3  . ALA B 2 443 ? 9.636   -12.238 22.572  1.00 12.11 ? 443 ALA B HB3  1  
ATOM 10909  N N    . TYR B 2 444 ? 7.304   -15.471 21.837  1.00 31.23 ? 444 TYR B N    1  
ATOM 10910  C CA   . TYR B 2 444 ? 6.845   -16.838 21.476  1.00 40.43 ? 444 TYR B CA   1  
ATOM 10911  C C    . TYR B 2 444 ? 7.933   -17.906 21.738  1.00 61.13 ? 444 TYR B C    1  
ATOM 10912  O O    . TYR B 2 444 ? 9.130   -17.654 21.526  1.00 5.43  ? 444 TYR B O    1  
ATOM 10913  C CB   . TYR B 2 444 ? 6.373   -16.888 19.992  1.00 31.12 ? 444 TYR B CB   1  
ATOM 10914  C CG   . TYR B 2 444 ? 7.407   -16.367 18.973  1.00 65.34 ? 444 TYR B CG   1  
ATOM 10915  C CD1  . TYR B 2 444 ? 8.355   -17.220 18.393  1.00 3.32  ? 444 TYR B CD1  1  
ATOM 10916  C CD2  . TYR B 2 444 ? 7.442   -15.015 18.618  1.00 63.12 ? 444 TYR B CD2  1  
ATOM 10917  C CE1  . TYR B 2 444 ? 9.284   -16.743 17.500  1.00 63.24 ? 444 TYR B CE1  1  
ATOM 10918  C CE2  . TYR B 2 444 ? 8.372   -14.539 17.723  1.00 23.14 ? 444 TYR B CE2  1  
ATOM 10919  C CZ   . TYR B 2 444 ? 9.292   -15.402 17.168  1.00 51.44 ? 444 TYR B CZ   1  
ATOM 10920  O OH   . TYR B 2 444 ? 10.215  -14.926 16.265  1.00 3.10  ? 444 TYR B OH   1  
ATOM 10921  H H    . TYR B 2 444 ? 7.257   -14.776 21.154  1.00 61.23 ? 444 TYR B H    1  
ATOM 10922  H HA   . TYR B 2 444 ? 5.990   -17.059 22.114  1.00 1.32  ? 444 TYR B HA   1  
ATOM 10923  H HB2  . TYR B 2 444 ? 6.126   -17.914 19.730  1.00 63.52 ? 444 TYR B HB2  1  
ATOM 10924  H HB3  . TYR B 2 444 ? 5.473   -16.290 19.895  1.00 45.20 ? 444 TYR B HB3  1  
ATOM 10925  H HD1  . TYR B 2 444 ? 8.353   -18.276 18.658  1.00 13.14 ? 444 TYR B HD1  1  
ATOM 10926  H HD2  . TYR B 2 444 ? 6.720   -14.337 19.058  1.00 71.31 ? 444 TYR B HD2  1  
ATOM 10927  H HE1  . TYR B 2 444 ? 10.010  -17.427 17.072  1.00 11.13 ? 444 TYR B HE1  1  
ATOM 10928  H HE2  . TYR B 2 444 ? 8.377   -13.493 17.461  1.00 25.04 ? 444 TYR B HE2  1  
ATOM 10929  H HH   . TYR B 2 444 ? 10.635  -14.139 16.614  1.00 52.43 ? 444 TYR B HH   1  
ATOM 10930  N N    . GLY B 2 445 ? 7.492   -19.085 22.213  1.00 13.43 ? 445 GLY B N    1  
ATOM 10931  C CA   . GLY B 2 445 ? 8.391   -20.184 22.591  1.00 34.02 ? 445 GLY B CA   1  
ATOM 10932  C C    . GLY B 2 445 ? 8.209   -20.550 24.063  1.00 32.43 ? 445 GLY B C    1  
ATOM 10933  O O    . GLY B 2 445 ? 7.528   -21.540 24.362  1.00 74.34 ? 445 GLY B O    1  
ATOM 10934  H H    . GLY B 2 445 ? 6.526   -19.211 22.314  1.00 24.43 ? 445 GLY B H    1  
ATOM 10935  H HA2  . GLY B 2 445 ? 8.161   -21.045 21.975  1.00 32.24 ? 445 GLY B HA2  1  
ATOM 10936  H HA3  . GLY B 2 445 ? 9.427   -19.907 22.422  1.00 72.43 ? 445 GLY B HA3  1  
ATOM 10937  N N    . PRO B 2 446 ? 8.798   -19.757 25.025  1.00 1.21  ? 446 PRO B N    1  
ATOM 10938  C CA   . PRO B 2 446 ? 8.599   -19.975 26.477  1.00 22.55 ? 446 PRO B CA   1  
ATOM 10939  C C    . PRO B 2 446 ? 7.217   -19.454 26.964  1.00 30.25 ? 446 PRO B C    1  
ATOM 10940  O O    . PRO B 2 446 ? 7.122   -18.415 27.640  1.00 13.25 ? 446 PRO B O    1  
ATOM 10941  C CB   . PRO B 2 446 ? 9.785   -19.199 27.104  1.00 13.34 ? 446 PRO B CB   1  
ATOM 10942  C CG   . PRO B 2 446 ? 10.047  -18.071 26.154  1.00 5.15  ? 446 PRO B CG   1  
ATOM 10943  C CD   . PRO B 2 446 ? 9.736   -18.617 24.771  1.00 63.02 ? 446 PRO B CD   1  
ATOM 10944  H HA   . PRO B 2 446 ? 8.683   -21.027 26.729  1.00 15.04 ? 446 PRO B HA   1  
ATOM 10945  H HB2  . PRO B 2 446 ? 9.521   -18.830 28.092  1.00 60.03 ? 446 PRO B HB2  1  
ATOM 10946  H HB3  . PRO B 2 446 ? 10.659  -19.839 27.172  1.00 30.04 ? 446 PRO B HB3  1  
ATOM 10947  H HG2  . PRO B 2 446 ? 9.396   -17.228 26.392  1.00 25.23 ? 446 PRO B HG2  1  
ATOM 10948  H HG3  . PRO B 2 446 ? 11.084  -17.764 26.214  1.00 42.31 ? 446 PRO B HG3  1  
ATOM 10949  H HD2  . PRO B 2 446 ? 9.261   -17.859 24.159  1.00 11.25 ? 446 PRO B HD2  1  
ATOM 10950  H HD3  . PRO B 2 446 ? 10.641  -18.968 24.286  1.00 72.44 ? 446 PRO B HD3  1  
ATOM 10951  N N    . HIS B 2 447 ? 6.150   -20.179 26.570  1.00 3.53  ? 447 HIS B N    1  
ATOM 10952  C CA   . HIS B 2 447 ? 4.755   -19.922 27.001  1.00 21.51 ? 447 HIS B CA   1  
ATOM 10953  C C    . HIS B 2 447 ? 4.055   -21.255 27.291  1.00 34.22 ? 447 HIS B C    1  
ATOM 10954  O O    . HIS B 2 447 ? 4.083   -22.161 26.444  1.00 0.30  ? 447 HIS B O    1  
ATOM 10955  C CB   . HIS B 2 447 ? 3.943   -19.137 25.934  1.00 60.00 ? 447 HIS B CB   1  
ATOM 10956  C CG   . HIS B 2 447 ? 4.346   -17.700 25.795  1.00 43.04 ? 447 HIS B CG   1  
ATOM 10957  N ND1  . HIS B 2 447 ? 3.837   -16.701 26.592  1.00 40.42 ? 447 HIS B ND1  1  
ATOM 10958  C CD2  . HIS B 2 447 ? 5.226   -17.105 24.966  1.00 31.55 ? 447 HIS B CD2  1  
ATOM 10959  C CE1  . HIS B 2 447 ? 4.384   -15.551 26.255  1.00 23.12 ? 447 HIS B CE1  1  
ATOM 10960  N NE2  . HIS B 2 447 ? 5.230   -15.768 25.270  1.00 54.52 ? 447 HIS B NE2  1  
ATOM 10961  H H    . HIS B 2 447 ? 6.308   -20.935 25.965  1.00 60.42 ? 447 HIS B H    1  
ATOM 10962  H HA   . HIS B 2 447 ? 4.787   -19.339 27.923  1.00 10.14 ? 447 HIS B HA   1  
ATOM 10963  H HB2  . HIS B 2 447 ? 4.069   -19.610 24.968  1.00 61.43 ? 447 HIS B HB2  1  
ATOM 10964  H HB3  . HIS B 2 447 ? 2.888   -19.157 26.195  1.00 63.45 ? 447 HIS B HB3  1  
ATOM 10965  H HD1  . HIS B 2 447 ? 3.173   -16.819 27.309  1.00 55.11 ? 447 HIS B HD1  1  
ATOM 10966  H HD2  . HIS B 2 447 ? 5.823   -17.594 24.205  1.00 20.25 ? 447 HIS B HD2  1  
ATOM 10967  H HE1  . HIS B 2 447 ? 4.181   -14.597 26.715  1.00 62.11 ? 447 HIS B HE1  1  
ATOM 10968  H HE2  . HIS B 2 447 ? 5.882   -15.117 24.937  1.00 37.66 ? 447 HIS B HE2  1  
ATOM 10969  N N    . ALA B 2 448 ? 3.446   -21.354 28.494  1.00 3.51  ? 448 ALA B N    1  
ATOM 10970  C CA   . ALA B 2 448 ? 2.637   -22.513 28.922  1.00 72.03 ? 448 ALA B CA   1  
ATOM 10971  C C    . ALA B 2 448 ? 3.451   -23.830 28.982  1.00 31.24 ? 448 ALA B C    1  
ATOM 10972  O O    . ALA B 2 448 ? 4.678   -23.822 28.824  1.00 33.04 ? 448 ALA B O    1  
ATOM 10973  C CB   . ALA B 2 448 ? 1.385   -22.657 28.023  1.00 74.31 ? 448 ALA B CB   1  
ATOM 10974  H H    . ALA B 2 448 ? 3.548   -20.611 29.123  1.00 11.11 ? 448 ALA B H    1  
ATOM 10975  H HA   . ALA B 2 448 ? 2.292   -22.295 29.924  1.00 61.31 ? 448 ALA B HA   1  
ATOM 10976  H HB1  . ALA B 2 448 ? 0.819   -21.735 28.036  1.00 24.50 ? 448 ALA B HB1  1  
ATOM 10977  H HB2  . ALA B 2 448 ? 0.759   -23.463 28.390  1.00 12.14 ? 448 ALA B HB2  1  
ATOM 10978  H HB3  . ALA B 2 448 ? 1.687   -22.876 27.008  1.00 71.12 ? 448 ALA B HB3  1  
ATOM 10979  N N    . ALA B 2 449 ? 2.740   -24.938 29.288  1.00 33.15 ? 449 ALA B N    1  
ATOM 10980  C CA   . ALA B 2 449 ? 3.258   -26.317 29.219  1.00 44.21 ? 449 ALA B CA   1  
ATOM 10981  C C    . ALA B 2 449 ? 4.440   -26.564 30.195  1.00 31.34 ? 449 ALA B C    1  
ATOM 10982  O O    . ALA B 2 449 ? 4.239   -27.066 31.307  1.00 11.14 ? 449 ALA B O    1  
ATOM 10983  C CB   . ALA B 2 449 ? 3.611   -26.676 27.759  1.00 61.52 ? 449 ALA B CB   1  
ATOM 10984  H H    . ALA B 2 449 ? 1.819   -24.815 29.588  1.00 74.42 ? 449 ALA B H    1  
ATOM 10985  H HA   . ALA B 2 449 ? 2.441   -26.963 29.522  1.00 25.41 ? 449 ALA B HA   1  
ATOM 10986  H HB1  . ALA B 2 449 ? 3.913   -27.710 27.698  1.00 2.13  ? 449 ALA B HB1  1  
ATOM 10987  H HB2  . ALA B 2 449 ? 4.422   -26.045 27.412  1.00 24.23 ? 449 ALA B HB2  1  
ATOM 10988  H HB3  . ALA B 2 449 ? 2.747   -26.519 27.128  1.00 62.50 ? 449 ALA B HB3  1  
ATOM 10989  N N    . ASN B 2 450 ? 5.658   -26.181 29.771  1.00 50.14 ? 450 ASN B N    1  
ATOM 10990  C CA   . ASN B 2 450 ? 6.906   -26.396 30.534  1.00 14.15 ? 450 ASN B CA   1  
ATOM 10991  C C    . ASN B 2 450 ? 7.078   -25.334 31.644  1.00 35.34 ? 450 ASN B C    1  
ATOM 10992  O O    . ASN B 2 450 ? 7.599   -25.638 32.724  1.00 11.22 ? 450 ASN B O    1  
ATOM 10993  C CB   . ASN B 2 450 ? 8.118   -26.341 29.555  1.00 61.12 ? 450 ASN B CB   1  
ATOM 10994  C CG   . ASN B 2 450 ? 9.495   -26.521 30.220  1.00 55.33 ? 450 ASN B CG   1  
ATOM 10995  O OD1  . ASN B 2 450 ? 10.455  -25.832 29.871  1.00 60.42 ? 450 ASN B OD1  1  
ATOM 10996  N ND2  . ASN B 2 450 ? 9.624   -27.474 31.132  1.00 43.42 ? 450 ASN B ND2  1  
ATOM 10997  H H    . ASN B 2 450 ? 5.722   -25.722 28.906  1.00 11.14 ? 450 ASN B H    1  
ATOM 10998  H HA   . ASN B 2 450 ? 6.861   -27.380 30.987  1.00 0.11  ? 450 ASN B HA   1  
ATOM 10999  H HB2  . ASN B 2 450 ? 8.005   -27.127 28.819  1.00 62.51 ? 450 ASN B HB2  1  
ATOM 11000  H HB3  . ASN B 2 450 ? 8.110   -25.387 29.038  1.00 5.32  ? 450 ASN B HB3  1  
ATOM 11001  H HD21 . ASN B 2 450 ? 8.845   -28.027 31.342  1.00 63.22 ? 450 ASN B HD21 1  
ATOM 11002  H HD22 . ASN B 2 450 ? 10.501  -27.587 31.562  1.00 33.24 ? 450 ASN B HD22 1  
ATOM 11003  N N    . VAL B 2 451 ? 6.617   -24.099 31.357  1.00 31.21 ? 451 VAL B N    1  
ATOM 11004  C CA   . VAL B 2 451 ? 6.876   -22.903 32.194  1.00 32.22 ? 451 VAL B CA   1  
ATOM 11005  C C    . VAL B 2 451 ? 6.262   -23.049 33.610  1.00 51.31 ? 451 VAL B C    1  
ATOM 11006  O O    . VAL B 2 451 ? 6.977   -23.340 34.570  1.00 51.42 ? 451 VAL B O    1  
ATOM 11007  C CB   . VAL B 2 451 ? 6.352   -21.594 31.478  1.00 51.31 ? 451 VAL B CB   1  
ATOM 11008  C CG1  . VAL B 2 451 ? 6.639   -20.318 32.313  1.00 63.10 ? 451 VAL B CG1  1  
ATOM 11009  C CG2  . VAL B 2 451 ? 6.955   -21.479 30.054  1.00 43.22 ? 451 VAL B CG2  1  
ATOM 11010  H H    . VAL B 2 451 ? 6.078   -23.992 30.552  1.00 40.41 ? 451 VAL B H    1  
ATOM 11011  H HA   . VAL B 2 451 ? 7.956   -22.811 32.299  1.00 13.35 ? 451 VAL B HA   1  
ATOM 11012  H HB   . VAL B 2 451 ? 5.271   -21.683 31.373  1.00 14.11 ? 451 VAL B HB   1  
ATOM 11013  H HG11 . VAL B 2 451 ? 7.706   -20.204 32.460  1.00 71.11 ? 451 VAL B HG11 1  
ATOM 11014  H HG12 . VAL B 2 451 ? 6.157   -20.400 33.280  1.00 74.13 ? 451 VAL B HG12 1  
ATOM 11015  H HG13 . VAL B 2 451 ? 6.253   -19.445 31.801  1.00 42.24 ? 451 VAL B HG13 1  
ATOM 11016  H HG21 . VAL B 2 451 ? 8.035   -21.412 30.115  1.00 74.44 ? 451 VAL B HG21 1  
ATOM 11017  H HG22 . VAL B 2 451 ? 6.570   -20.598 29.561  1.00 74.12 ? 451 VAL B HG22 1  
ATOM 11018  H HG23 . VAL B 2 451 ? 6.686   -22.354 29.474  1.00 54.41 ? 451 VAL B HG23 1  
ATOM 11019  N N    . VAL B 2 452 ? 4.935   -22.874 33.715  1.00 31.32 ? 452 VAL B N    1  
ATOM 11020  C CA   . VAL B 2 452 ? 4.182   -22.955 34.990  1.00 60.45 ? 452 VAL B CA   1  
ATOM 11021  C C    . VAL B 2 452 ? 2.876   -23.733 34.747  1.00 32.12 ? 452 VAL B C    1  
ATOM 11022  O O    . VAL B 2 452 ? 1.796   -23.390 35.261  1.00 15.30 ? 452 VAL B O    1  
ATOM 11023  C CB   . VAL B 2 452 ? 3.888   -21.514 35.582  1.00 5.20  ? 452 VAL B CB   1  
ATOM 11024  C CG1  . VAL B 2 452 ? 5.157   -20.890 36.220  1.00 50.04 ? 452 VAL B CG1  1  
ATOM 11025  C CG2  . VAL B 2 452 ? 3.286   -20.573 34.500  1.00 41.30 ? 452 VAL B CG2  1  
ATOM 11026  H H    . VAL B 2 452 ? 4.425   -22.690 32.898  1.00 54.05 ? 452 VAL B H    1  
ATOM 11027  H HA   . VAL B 2 452 ? 4.777   -23.515 35.713  1.00 53.34 ? 452 VAL B HA   1  
ATOM 11028  H HB   . VAL B 2 452 ? 3.149   -21.623 36.374  1.00 62.03 ? 452 VAL B HB   1  
ATOM 11029  H HG11 . VAL B 2 452 ? 5.532   -21.545 36.997  1.00 22.30 ? 452 VAL B HG11 1  
ATOM 11030  H HG12 . VAL B 2 452 ? 4.917   -19.930 36.654  1.00 63.43 ? 452 VAL B HG12 1  
ATOM 11031  H HG13 . VAL B 2 452 ? 5.924   -20.759 35.464  1.00 24.32 ? 452 VAL B HG13 1  
ATOM 11032  H HG21 . VAL B 2 452 ? 3.086   -19.601 34.929  1.00 74.24 ? 452 VAL B HG21 1  
ATOM 11033  H HG22 . VAL B 2 452 ? 2.357   -20.991 34.125  1.00 42.33 ? 452 VAL B HG22 1  
ATOM 11034  H HG23 . VAL B 2 452 ? 3.981   -20.466 33.674  1.00 73.10 ? 452 VAL B HG23 1  
ATOM 11035  N N    . GLY B 2 453 ? 3.008   -24.825 33.982  1.00 20.42 ? 453 GLY B N    1  
ATOM 11036  C CA   . GLY B 2 453 ? 1.856   -25.512 33.411  1.00 54.04 ? 453 GLY B CA   1  
ATOM 11037  C C    . GLY B 2 453 ? 1.249   -24.686 32.281  1.00 73.44 ? 453 GLY B C    1  
ATOM 11038  O O    . GLY B 2 453 ? 1.907   -23.780 31.761  1.00 40.20 ? 453 GLY B O    1  
ATOM 11039  H H    . GLY B 2 453 ? 3.909   -25.166 33.804  1.00 4.42  ? 453 GLY B H    1  
ATOM 11040  H HA2  . GLY B 2 453 ? 2.180   -26.469 33.018  1.00 71.32 ? 453 GLY B HA2  1  
ATOM 11041  H HA3  . GLY B 2 453 ? 1.110   -25.679 34.178  1.00 64.13 ? 453 GLY B HA3  1  
ATOM 11042  N N    . LEU B 2 454 ? -0.001  -24.976 31.914  1.00 63.32 ? 454 LEU B N    1  
ATOM 11043  C CA   . LEU B 2 454 ? -0.700  -24.279 30.820  1.00 61.42 ? 454 LEU B CA   1  
ATOM 11044  C C    . LEU B 2 454 ? -1.104  -22.852 31.254  1.00 72.50 ? 454 LEU B C    1  
ATOM 11045  O O    . LEU B 2 454 ? -0.591  -21.874 30.695  1.00 53.54 ? 454 LEU B O    1  
ATOM 11046  C CB   . LEU B 2 454 ? -1.913  -25.105 30.316  1.00 31.32 ? 454 LEU B CB   1  
ATOM 11047  C CG   . LEU B 2 454 ? -1.581  -26.418 29.512  1.00 31.24 ? 454 LEU B CG   1  
ATOM 11048  C CD1  . LEU B 2 454 ? -0.661  -26.138 28.296  1.00 11.00 ? 454 LEU B CD1  1  
ATOM 11049  C CD2  . LEU B 2 454 ? -0.999  -27.541 30.409  1.00 0.21  ? 454 LEU B CD2  1  
ATOM 11050  H H    . LEU B 2 454 ? -0.478  -25.676 32.401  1.00 71.50 ? 454 LEU B H    1  
ATOM 11051  H HA   . LEU B 2 454 ? 0.002   -24.189 29.996  1.00 25.40 ? 454 LEU B HA   1  
ATOM 11052  H HB2  . LEU B 2 454 ? -2.522  -25.371 31.176  1.00 51.04 ? 454 LEU B HB2  1  
ATOM 11053  H HB3  . LEU B 2 454 ? -2.517  -24.467 29.674  1.00 73.13 ? 454 LEU B HB3  1  
ATOM 11054  H HG   . LEU B 2 454 ? -2.513  -26.797 29.104  1.00 64.12 ? 454 LEU B HG   1  
ATOM 11055  H HD11 . LEU B 2 454 ? 0.300   -25.765 28.631  1.00 53.31 ? 454 LEU B HD11 1  
ATOM 11056  H HD12 . LEU B 2 454 ? -1.121  -25.400 27.652  1.00 73.10 ? 454 LEU B HD12 1  
ATOM 11057  H HD13 . LEU B 2 454 ? -0.512  -27.051 27.731  1.00 23.13 ? 454 LEU B HD13 1  
ATOM 11058  H HD21 . LEU B 2 454 ? -0.050  -27.228 30.830  1.00 62.14 ? 454 LEU B HD21 1  
ATOM 11059  H HD22 . LEU B 2 454 ? -0.849  -28.435 29.819  1.00 64.25 ? 454 LEU B HD22 1  
ATOM 11060  H HD23 . LEU B 2 454 ? -1.691  -27.763 31.211  1.00 50.15 ? 454 LEU B HD23 1  
ATOM 11061  N N    . THR B 2 455 ? -1.997  -22.740 32.257  1.00 32.52 ? 455 THR B N    1  
ATOM 11062  C CA   . THR B 2 455 ? -2.385  -21.433 32.847  1.00 34.13 ? 455 THR B CA   1  
ATOM 11063  C C    . THR B 2 455 ? -3.207  -21.637 34.144  1.00 53.11 ? 455 THR B C    1  
ATOM 11064  O O    . THR B 2 455 ? -3.522  -22.778 34.515  1.00 30.30 ? 455 THR B O    1  
ATOM 11065  C CB   . THR B 2 455 ? -3.177  -20.526 31.820  1.00 61.41 ? 455 THR B CB   1  
ATOM 11066  O OG1  . THR B 2 455 ? -3.337  -19.187 32.334  1.00 3.42  ? 455 THR B OG1  1  
ATOM 11067  C CG2  . THR B 2 455 ? -4.562  -21.097 31.469  1.00 52.32 ? 455 THR B CG2  1  
ATOM 11068  H H    . THR B 2 455 ? -2.407  -23.558 32.619  1.00 72.10 ? 455 THR B H    1  
ATOM 11069  H HA   . THR B 2 455 ? -1.464  -20.917 33.112  1.00 12.10 ? 455 THR B HA   1  
ATOM 11070  H HB   . THR B 2 455 ? -2.592  -20.469 30.907  1.00 23.22 ? 455 THR B HB   1  
ATOM 11071  H HG1  . THR B 2 455 ? -2.479  -18.840 32.604  1.00 62.35 ? 455 THR B HG1  1  
ATOM 11072  H HG21 . THR B 2 455 ? -4.456  -22.082 31.028  1.00 70.00 ? 455 THR B HG21 1  
ATOM 11073  H HG22 . THR B 2 455 ? -5.055  -20.445 30.761  1.00 34.15 ? 455 THR B HG22 1  
ATOM 11074  H HG23 . THR B 2 455 ? -5.166  -21.169 32.365  1.00 23.11 ? 455 THR B HG23 1  
ATOM 11075  N N    . ASP B 2 456 ? -3.556  -20.518 34.822  1.00 42.40 ? 456 ASP B N    1  
ATOM 11076  C CA   . ASP B 2 456 ? -4.361  -20.524 36.066  1.00 2.51  ? 456 ASP B CA   1  
ATOM 11077  C C    . ASP B 2 456 ? -5.871  -20.559 35.712  1.00 14.22 ? 456 ASP B C    1  
ATOM 11078  O O    . ASP B 2 456 ? -6.634  -19.620 35.989  1.00 31.33 ? 456 ASP B O    1  
ATOM 11079  C CB   . ASP B 2 456 ? -3.984  -19.282 36.932  1.00 44.15 ? 456 ASP B CB   1  
ATOM 11080  C CG   . ASP B 2 456 ? -4.644  -19.267 38.326  1.00 31.02 ? 456 ASP B CG   1  
ATOM 11081  O OD1  . ASP B 2 456 ? -4.288  -20.128 39.169  1.00 74.30 ? 456 ASP B OD1  1  
ATOM 11082  O OD2  . ASP B 2 456 ? -5.509  -18.400 38.592  1.00 23.34 ? 456 ASP B OD2  1  
ATOM 11083  H H    . ASP B 2 456 ? -3.267  -19.650 34.467  1.00 41.32 ? 456 ASP B H    1  
ATOM 11084  H HA   . ASP B 2 456 ? -4.118  -21.427 36.624  1.00 54.51 ? 456 ASP B HA   1  
ATOM 11085  H HB2  . ASP B 2 456 ? -2.908  -19.271 37.071  1.00 24.51 ? 456 ASP B HB2  1  
ATOM 11086  H HB3  . ASP B 2 456 ? -4.267  -18.380 36.395  1.00 24.43 ? 456 ASP B HB3  1  
ATOM 11087  N N    . GLN B 2 457 ? -6.274  -21.660 35.061  1.00 1.33  ? 457 GLN B N    1  
ATOM 11088  C CA   . GLN B 2 457 ? -7.650  -21.881 34.580  1.00 13.43 ? 457 GLN B CA   1  
ATOM 11089  C C    . GLN B 2 457 ? -7.779  -23.351 34.126  1.00 41.54 ? 457 GLN B C    1  
ATOM 11090  O O    . GLN B 2 457 ? -6.769  -24.051 33.972  1.00 32.44 ? 457 GLN B O    1  
ATOM 11091  C CB   . GLN B 2 457 ? -7.984  -20.899 33.399  1.00 42.14 ? 457 GLN B CB   1  
ATOM 11092  C CG   . GLN B 2 457 ? -9.479  -20.810 33.022  1.00 40.21 ? 457 GLN B CG   1  
ATOM 11093  C CD   . GLN B 2 457 ? -9.770  -19.869 31.847  1.00 20.22 ? 457 GLN B CD   1  
ATOM 11094  O OE1  . GLN B 2 457 ? -9.812  -20.290 30.694  1.00 32.35 ? 457 GLN B OE1  1  
ATOM 11095  N NE2  . GLN B 2 457 ? -9.970  -18.591 32.129  1.00 10.53 ? 457 GLN B NE2  1  
ATOM 11096  H H    . GLN B 2 457 ? -5.613  -22.368 34.899  1.00 62.44 ? 457 GLN B H    1  
ATOM 11097  H HA   . GLN B 2 457 ? -8.335  -21.707 35.407  1.00 42.20 ? 457 GLN B HA   1  
ATOM 11098  H HB2  . GLN B 2 457 ? -7.654  -19.905 33.678  1.00 55.21 ? 457 GLN B HB2  1  
ATOM 11099  H HB3  . GLN B 2 457 ? -7.427  -21.210 32.521  1.00 33.11 ? 457 GLN B HB3  1  
ATOM 11100  H HG2  . GLN B 2 457 ? -9.827  -21.805 32.757  1.00 44.04 ? 457 GLN B HG2  1  
ATOM 11101  H HG3  . GLN B 2 457 ? -10.034 -20.470 33.888  1.00 61.03 ? 457 GLN B HG3  1  
ATOM 11102  H HE21 . GLN B 2 457 ? -9.921  -18.309 33.068  1.00 65.21 ? 457 GLN B HE21 1  
ATOM 11103  H HE22 . GLN B 2 457 ? -10.152 -17.976 31.390  1.00 14.21 ? 457 GLN B HE22 1  
ATOM 11104  N N    . THR B 2 458 ? -9.025  -23.819 33.913  1.00 31.22 ? 458 THR B N    1  
ATOM 11105  C CA   . THR B 2 458 ? -9.297  -25.139 33.318  1.00 44.42 ? 458 THR B CA   1  
ATOM 11106  C C    . THR B 2 458 ? -8.921  -25.175 31.813  1.00 72.13 ? 458 THR B C    1  
ATOM 11107  O O    . THR B 2 458 ? -9.019  -26.228 31.176  1.00 44.25 ? 458 THR B O    1  
ATOM 11108  C CB   . THR B 2 458 ? -10.796 -25.533 33.500  1.00 4.33  ? 458 THR B CB   1  
ATOM 11109  O OG1  . THR B 2 458 ? -11.635 -24.471 33.023  1.00 54.22 ? 458 THR B OG1  1  
ATOM 11110  C CG2  . THR B 2 458 ? -11.145 -25.843 34.967  1.00 33.12 ? 458 THR B CG2  1  
ATOM 11111  H H    . THR B 2 458 ? -9.788  -23.259 34.166  1.00 21.35 ? 458 THR B H    1  
ATOM 11112  H HA   . THR B 2 458 ? -8.685  -25.872 33.841  1.00 44.14 ? 458 THR B HA   1  
ATOM 11113  H HB   . THR B 2 458 ? -10.998 -26.424 32.906  1.00 42.24 ? 458 THR B HB   1  
ATOM 11114  H HG1  . THR B 2 458 ? -11.812 -24.604 32.081  1.00 34.31 ? 458 THR B HG1  1  
ATOM 11115  H HG21 . THR B 2 458 ? -10.946 -24.973 35.582  1.00 21.25 ? 458 THR B HG21 1  
ATOM 11116  H HG22 . THR B 2 458 ? -10.548 -26.671 35.321  1.00 60.14 ? 458 THR B HG22 1  
ATOM 11117  H HG23 . THR B 2 458 ? -12.194 -26.109 35.042  1.00 14.32 ? 458 THR B HG23 1  
ATOM 11118  N N    . ASP B 2 459 ? -8.522  -24.011 31.251  1.00 63.05 ? 459 ASP B N    1  
ATOM 11119  C CA   . ASP B 2 459 ? -7.926  -23.928 29.906  1.00 35.32 ? 459 ASP B CA   1  
ATOM 11120  C C    . ASP B 2 459 ? -6.542  -24.607 29.926  1.00 65.42 ? 459 ASP B C    1  
ATOM 11121  O O    . ASP B 2 459 ? -5.516  -23.982 30.232  1.00 73.31 ? 459 ASP B O    1  
ATOM 11122  C CB   . ASP B 2 459 ? -7.818  -22.452 29.433  1.00 22.32 ? 459 ASP B CB   1  
ATOM 11123  C CG   . ASP B 2 459 ? -7.255  -22.303 28.002  1.00 14.20 ? 459 ASP B CG   1  
ATOM 11124  O OD1  . ASP B 2 459 ? -6.061  -21.958 27.845  1.00 30.22 ? 459 ASP B OD1  1  
ATOM 11125  O OD2  . ASP B 2 459 ? -8.012  -22.536 27.031  1.00 43.54 ? 459 ASP B OD2  1  
ATOM 11126  H H    . ASP B 2 459 ? -8.643  -23.186 31.758  1.00 42.33 ? 459 ASP B H    1  
ATOM 11127  H HA   . ASP B 2 459 ? -8.580  -24.468 29.222  1.00 1.04  ? 459 ASP B HA   1  
ATOM 11128  H HB2  . ASP B 2 459 ? -8.812  -22.009 29.456  1.00 55.