data_6Q2J
# 
_entry.id   6Q2J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6Q2J         
WWPDB D_1000243517 
EMDB  EMD-20572    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Cryo-EM structure of extracellular dimeric complex of RET/GFRAL/GDF15' 
_pdbx_database_related.db_id          EMD-20572 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q2J 
_pdbx_database_status.recvd_initial_deposition_date   2019-08-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, J.'          1 ? 
'Shang, G.J.'     2 ? 
'Chen, Y.J.'      3 ? 
'Brautigam, C.A.' 4 ? 
'Liou, J.'        5 ? 
'Zhang, X.W.'     6 ? 
'Bai, X.C.'       7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.47650 
_citation.pdbx_database_id_PubMed   31535977 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, J.'          1 0000-0002-1059-280X 
primary 'Shang, G.'       2 0000-0002-0187-7934 
primary 'Chen, Y.J.'      3 ?                   
primary 'Brautigam, C.A.' 4 0000-0001-6563-1338 
primary 'Liou, J.'        5 0000-0003-1546-3115 
primary 'Zhang, X.'       6 0000-0002-3634-6711 
primary 'Bai, X.C.'       7 0000-0002-4234-5686 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q2J 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q2J 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Growth/differentiation factor 15'                    14879.113 2  ?        ? ? ? 
2 polymer     man 'GDNF family receptor alpha-like'                     39120.598 2  ?        ? ? ? 
3 polymer     man 'Proto-oncogene tyrosine-protein kinase receptor Ret' 69100.812 2  2.7.10.1 ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose              221.208   14 ?        ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                         40.078    8  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;GDF-15,Macrophage inhibitory cytokine 1,MIC-1,NSAID-activated gene 1 protein,NAG-1,NSAID-regulated gene 1 protein,NRG-1,Placental TGF-beta,Placental bone morphogenetic protein,Prostate differentiation factor
;
3 'Cadherin family member 12,Proto-oncogene c-Ret' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSSHHHHHHSSGLEVLFQGPHMARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANM
HAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
;MGSSHHHHHHSSGLEVLFQGPHMARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANM
HAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
A,B ? 
2 'polypeptide(L)' no no 
;QTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGK
KCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIP
FNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCI
STLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKI
TLTGFHSPFNGEVGTHHHHHHHH
;
;QTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGK
KCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIP
FNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCI
STLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKI
TLTGFHSPFNGEVGTHHHHHHHH
;
C,D ? 
3 'polypeptide(L)' no no 
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNHGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRGTHHHHHHHH
;
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNHGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRGTHHHHHHHH
;
E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  GLU n 
1 16  VAL n 
1 17  LEU n 
1 18  PHE n 
1 19  GLN n 
1 20  GLY n 
1 21  PRO n 
1 22  HIS n 
1 23  MET n 
1 24  ALA n 
1 25  ARG n 
1 26  ASN n 
1 27  GLY n 
1 28  ASP n 
1 29  HIS n 
1 30  CYS n 
1 31  PRO n 
1 32  LEU n 
1 33  GLY n 
1 34  PRO n 
1 35  GLY n 
1 36  ARG n 
1 37  CYS n 
1 38  CYS n 
1 39  ARG n 
1 40  LEU n 
1 41  HIS n 
1 42  THR n 
1 43  VAL n 
1 44  ARG n 
1 45  ALA n 
1 46  SER n 
1 47  LEU n 
1 48  GLU n 
1 49  ASP n 
1 50  LEU n 
1 51  GLY n 
1 52  TRP n 
1 53  ALA n 
1 54  ASP n 
1 55  TRP n 
1 56  VAL n 
1 57  LEU n 
1 58  SER n 
1 59  PRO n 
1 60  ARG n 
1 61  GLU n 
1 62  VAL n 
1 63  GLN n 
1 64  VAL n 
1 65  THR n 
1 66  MET n 
1 67  CYS n 
1 68  ILE n 
1 69  GLY n 
1 70  ALA n 
1 71  CYS n 
1 72  PRO n 
1 73  SER n 
1 74  GLN n 
1 75  PHE n 
1 76  ARG n 
1 77  ALA n 
1 78  ALA n 
1 79  ASN n 
1 80  MET n 
1 81  HIS n 
1 82  ALA n 
1 83  GLN n 
1 84  ILE n 
1 85  LYS n 
1 86  THR n 
1 87  SER n 
1 88  LEU n 
1 89  HIS n 
1 90  ARG n 
1 91  LEU n 
1 92  LYS n 
1 93  PRO n 
1 94  ASP n 
1 95  THR n 
1 96  VAL n 
1 97  PRO n 
1 98  ALA n 
1 99  PRO n 
1 100 CYS n 
1 101 CYS n 
1 102 VAL n 
1 103 PRO n 
1 104 ALA n 
1 105 SER n 
1 106 TYR n 
1 107 ASN n 
1 108 PRO n 
1 109 MET n 
1 110 VAL n 
1 111 LEU n 
1 112 ILE n 
1 113 GLN n 
1 114 LYS n 
1 115 THR n 
1 116 ASP n 
1 117 THR n 
1 118 GLY n 
1 119 VAL n 
1 120 SER n 
1 121 LEU n 
1 122 GLN n 
1 123 THR n 
1 124 TYR n 
1 125 ASP n 
1 126 ASP n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 LYS n 
1 131 ASP n 
1 132 CYS n 
1 133 HIS n 
1 134 CYS n 
1 135 ILE n 
2 1   GLN n 
2 2   THR n 
2 3   ASN n 
2 4   ASN n 
2 5   CYS n 
2 6   THR n 
2 7   TYR n 
2 8   LEU n 
2 9   ARG n 
2 10  GLU n 
2 11  GLN n 
2 12  CYS n 
2 13  LEU n 
2 14  ARG n 
2 15  ASP n 
2 16  ALA n 
2 17  ASN n 
2 18  GLY n 
2 19  CYS n 
2 20  LYS n 
2 21  HIS n 
2 22  ALA n 
2 23  TRP n 
2 24  ARG n 
2 25  VAL n 
2 26  MET n 
2 27  GLU n 
2 28  ASP n 
2 29  ALA n 
2 30  CYS n 
2 31  ASN n 
2 32  ASP n 
2 33  SER n 
2 34  ASP n 
2 35  PRO n 
2 36  GLY n 
2 37  ASP n 
2 38  PRO n 
2 39  CYS n 
2 40  LYS n 
2 41  MET n 
2 42  ARG n 
2 43  ASN n 
2 44  SER n 
2 45  SER n 
2 46  TYR n 
2 47  CYS n 
2 48  ASN n 
2 49  LEU n 
2 50  SER n 
2 51  ILE n 
2 52  GLN n 
2 53  TYR n 
2 54  LEU n 
2 55  VAL n 
2 56  GLU n 
2 57  SER n 
2 58  ASN n 
2 59  PHE n 
2 60  GLN n 
2 61  PHE n 
2 62  LYS n 
2 63  GLU n 
2 64  CYS n 
2 65  LEU n 
2 66  CYS n 
2 67  THR n 
2 68  ASP n 
2 69  ASP n 
2 70  PHE n 
2 71  TYR n 
2 72  CYS n 
2 73  THR n 
2 74  VAL n 
2 75  ASN n 
2 76  LYS n 
2 77  LEU n 
2 78  LEU n 
2 79  GLY n 
2 80  LYS n 
2 81  LYS n 
2 82  CYS n 
2 83  ILE n 
2 84  ASN n 
2 85  LYS n 
2 86  SER n 
2 87  ASP n 
2 88  ASN n 
2 89  VAL n 
2 90  LYS n 
2 91  GLU n 
2 92  ASP n 
2 93  LYS n 
2 94  PHE n 
2 95  LYS n 
2 96  TRP n 
2 97  ASN n 
2 98  LEU n 
2 99  THR n 
2 100 THR n 
2 101 ARG n 
2 102 SER n 
2 103 HIS n 
2 104 HIS n 
2 105 GLY n 
2 106 PHE n 
2 107 LYS n 
2 108 GLY n 
2 109 MET n 
2 110 TRP n 
2 111 SER n 
2 112 CYS n 
2 113 LEU n 
2 114 GLU n 
2 115 VAL n 
2 116 ALA n 
2 117 GLU n 
2 118 ALA n 
2 119 CYS n 
2 120 VAL n 
2 121 GLY n 
2 122 ASP n 
2 123 VAL n 
2 124 VAL n 
2 125 CYS n 
2 126 ASN n 
2 127 ALA n 
2 128 GLN n 
2 129 LEU n 
2 130 ALA n 
2 131 SER n 
2 132 TYR n 
2 133 LEU n 
2 134 LYS n 
2 135 ALA n 
2 136 CYS n 
2 137 SER n 
2 138 ALA n 
2 139 ASN n 
2 140 GLY n 
2 141 ASN n 
2 142 PRO n 
2 143 CYS n 
2 144 ASP n 
2 145 LEU n 
2 146 LYS n 
2 147 GLN n 
2 148 CYS n 
2 149 GLN n 
2 150 ALA n 
2 151 ALA n 
2 152 ILE n 
2 153 ARG n 
2 154 PHE n 
2 155 PHE n 
2 156 TYR n 
2 157 GLN n 
2 158 ASN n 
2 159 ILE n 
2 160 PRO n 
2 161 PHE n 
2 162 ASN n 
2 163 ILE n 
2 164 ALA n 
2 165 GLN n 
2 166 MET n 
2 167 LEU n 
2 168 ALA n 
2 169 PHE n 
2 170 CYS n 
2 171 ASP n 
2 172 CYS n 
2 173 ALA n 
2 174 GLN n 
2 175 SER n 
2 176 ASP n 
2 177 ILE n 
2 178 PRO n 
2 179 CYS n 
2 180 GLN n 
2 181 GLN n 
2 182 SER n 
2 183 LYS n 
2 184 GLU n 
2 185 ALA n 
2 186 LEU n 
2 187 HIS n 
2 188 SER n 
2 189 LYS n 
2 190 THR n 
2 191 CYS n 
2 192 ALA n 
2 193 VAL n 
2 194 ASN n 
2 195 MET n 
2 196 VAL n 
2 197 PRO n 
2 198 PRO n 
2 199 PRO n 
2 200 THR n 
2 201 CYS n 
2 202 LEU n 
2 203 SER n 
2 204 VAL n 
2 205 ILE n 
2 206 ARG n 
2 207 SER n 
2 208 CYS n 
2 209 GLN n 
2 210 ASN n 
2 211 ASP n 
2 212 GLU n 
2 213 LEU n 
2 214 CYS n 
2 215 ARG n 
2 216 ARG n 
2 217 HIS n 
2 218 TYR n 
2 219 ARG n 
2 220 THR n 
2 221 PHE n 
2 222 GLN n 
2 223 SER n 
2 224 LYS n 
2 225 CYS n 
2 226 TRP n 
2 227 GLN n 
2 228 ARG n 
2 229 VAL n 
2 230 THR n 
2 231 ARG n 
2 232 LYS n 
2 233 CYS n 
2 234 HIS n 
2 235 GLU n 
2 236 ASP n 
2 237 GLU n 
2 238 ASN n 
2 239 CYS n 
2 240 ILE n 
2 241 SER n 
2 242 THR n 
2 243 LEU n 
2 244 SER n 
2 245 LYS n 
2 246 GLN n 
2 247 ASP n 
2 248 LEU n 
2 249 THR n 
2 250 CYS n 
2 251 SER n 
2 252 GLY n 
2 253 SER n 
2 254 ASP n 
2 255 ASP n 
2 256 CYS n 
2 257 LYS n 
2 258 ALA n 
2 259 ALA n 
2 260 TYR n 
2 261 ILE n 
2 262 ASP n 
2 263 ILE n 
2 264 LEU n 
2 265 GLY n 
2 266 THR n 
2 267 VAL n 
2 268 LEU n 
2 269 GLN n 
2 270 VAL n 
2 271 GLN n 
2 272 CYS n 
2 273 THR n 
2 274 CYS n 
2 275 ARG n 
2 276 THR n 
2 277 ILE n 
2 278 THR n 
2 279 GLN n 
2 280 SER n 
2 281 GLU n 
2 282 GLU n 
2 283 SER n 
2 284 LEU n 
2 285 CYS n 
2 286 LYS n 
2 287 ILE n 
2 288 PHE n 
2 289 GLN n 
2 290 HIS n 
2 291 MET n 
2 292 LEU n 
2 293 HIS n 
2 294 ARG n 
2 295 LYS n 
2 296 SER n 
2 297 CYS n 
2 298 PHE n 
2 299 ASN n 
2 300 TYR n 
2 301 PRO n 
2 302 THR n 
2 303 LEU n 
2 304 SER n 
2 305 ASN n 
2 306 VAL n 
2 307 LYS n 
2 308 GLY n 
2 309 MET n 
2 310 ALA n 
2 311 LEU n 
2 312 TYR n 
2 313 THR n 
2 314 ARG n 
2 315 LYS n 
2 316 HIS n 
2 317 ALA n 
2 318 ASN n 
2 319 LYS n 
2 320 ILE n 
2 321 THR n 
2 322 LEU n 
2 323 THR n 
2 324 GLY n 
2 325 PHE n 
2 326 HIS n 
2 327 SER n 
2 328 PRO n 
2 329 PHE n 
2 330 ASN n 
2 331 GLY n 
2 332 GLU n 
2 333 VAL n 
2 334 GLY n 
2 335 THR n 
2 336 HIS n 
2 337 HIS n 
2 338 HIS n 
2 339 HIS n 
2 340 HIS n 
2 341 HIS n 
2 342 HIS n 
2 343 HIS n 
3 1   LEU n 
3 2   TYR n 
3 3   PHE n 
3 4   SER n 
3 5   ARG n 
3 6   ASP n 
3 7   ALA n 
3 8   TYR n 
3 9   TRP n 
3 10  GLU n 
3 11  LYS n 
3 12  LEU n 
3 13  TYR n 
3 14  VAL n 
3 15  ASP n 
3 16  GLN n 
3 17  ALA n 
3 18  ALA n 
3 19  GLY n 
3 20  THR n 
3 21  PRO n 
3 22  LEU n 
3 23  LEU n 
3 24  TYR n 
3 25  VAL n 
3 26  HIS n 
3 27  ALA n 
3 28  LEU n 
3 29  ARG n 
3 30  ASP n 
3 31  ALA n 
3 32  PRO n 
3 33  GLU n 
3 34  GLU n 
3 35  VAL n 
3 36  PRO n 
3 37  SER n 
3 38  PHE n 
3 39  ARG n 
3 40  LEU n 
3 41  GLY n 
3 42  GLN n 
3 43  HIS n 
3 44  LEU n 
3 45  TYR n 
3 46  GLY n 
3 47  THR n 
3 48  TYR n 
3 49  ARG n 
3 50  THR n 
3 51  ARG n 
3 52  LEU n 
3 53  HIS n 
3 54  GLU n 
3 55  ASN n 
3 56  ASN n 
3 57  TRP n 
3 58  ILE n 
3 59  CYS n 
3 60  ILE n 
3 61  GLN n 
3 62  GLU n 
3 63  ASP n 
3 64  THR n 
3 65  GLY n 
3 66  LEU n 
3 67  LEU n 
3 68  TYR n 
3 69  LEU n 
3 70  ASN n 
3 71  ARG n 
3 72  SER n 
3 73  LEU n 
3 74  ASP n 
3 75  HIS n 
3 76  SER n 
3 77  SER n 
3 78  TRP n 
3 79  GLU n 
3 80  LYS n 
3 81  LEU n 
3 82  SER n 
3 83  VAL n 
3 84  ARG n 
3 85  ASN n 
3 86  HIS n 
3 87  GLY n 
3 88  PHE n 
3 89  PRO n 
3 90  LEU n 
3 91  LEU n 
3 92  THR n 
3 93  VAL n 
3 94  TYR n 
3 95  LEU n 
3 96  LYS n 
3 97  VAL n 
3 98  PHE n 
3 99  LEU n 
3 100 SER n 
3 101 PRO n 
3 102 THR n 
3 103 SER n 
3 104 LEU n 
3 105 ARG n 
3 106 GLU n 
3 107 GLY n 
3 108 GLU n 
3 109 CYS n 
3 110 GLN n 
3 111 TRP n 
3 112 PRO n 
3 113 GLY n 
3 114 CYS n 
3 115 ALA n 
3 116 ARG n 
3 117 VAL n 
3 118 TYR n 
3 119 PHE n 
3 120 SER n 
3 121 PHE n 
3 122 PHE n 
3 123 ASN n 
3 124 THR n 
3 125 SER n 
3 126 PHE n 
3 127 PRO n 
3 128 ALA n 
3 129 CYS n 
3 130 SER n 
3 131 SER n 
3 132 LEU n 
3 133 LYS n 
3 134 PRO n 
3 135 ARG n 
3 136 GLU n 
3 137 LEU n 
3 138 CYS n 
3 139 PHE n 
3 140 PRO n 
3 141 GLU n 
3 142 THR n 
3 143 ARG n 
3 144 PRO n 
3 145 SER n 
3 146 PHE n 
3 147 ARG n 
3 148 ILE n 
3 149 ARG n 
3 150 GLU n 
3 151 ASN n 
3 152 ARG n 
3 153 PRO n 
3 154 PRO n 
3 155 GLY n 
3 156 THR n 
3 157 PHE n 
3 158 HIS n 
3 159 GLN n 
3 160 PHE n 
3 161 ARG n 
3 162 LEU n 
3 163 LEU n 
3 164 PRO n 
3 165 VAL n 
3 166 GLN n 
3 167 PHE n 
3 168 LEU n 
3 169 CYS n 
3 170 PRO n 
3 171 ASN n 
3 172 ILE n 
3 173 SER n 
3 174 VAL n 
3 175 ALA n 
3 176 TYR n 
3 177 ARG n 
3 178 LEU n 
3 179 LEU n 
3 180 GLU n 
3 181 GLY n 
3 182 GLU n 
3 183 GLY n 
3 184 LEU n 
3 185 PRO n 
3 186 PHE n 
3 187 ARG n 
3 188 CYS n 
3 189 ALA n 
3 190 PRO n 
3 191 ASP n 
3 192 SER n 
3 193 LEU n 
3 194 GLU n 
3 195 VAL n 
3 196 SER n 
3 197 THR n 
3 198 ARG n 
3 199 TRP n 
3 200 ALA n 
3 201 LEU n 
3 202 ASP n 
3 203 ARG n 
3 204 GLU n 
3 205 GLN n 
3 206 ARG n 
3 207 GLU n 
3 208 LYS n 
3 209 TYR n 
3 210 GLU n 
3 211 LEU n 
3 212 VAL n 
3 213 ALA n 
3 214 VAL n 
3 215 CYS n 
3 216 THR n 
3 217 VAL n 
3 218 HIS n 
3 219 ALA n 
3 220 GLY n 
3 221 ALA n 
3 222 ARG n 
3 223 GLU n 
3 224 GLU n 
3 225 VAL n 
3 226 VAL n 
3 227 MET n 
3 228 VAL n 
3 229 PRO n 
3 230 PHE n 
3 231 PRO n 
3 232 VAL n 
3 233 THR n 
3 234 VAL n 
3 235 TYR n 
3 236 ASP n 
3 237 GLU n 
3 238 ASP n 
3 239 ASP n 
3 240 SER n 
3 241 ALA n 
3 242 PRO n 
3 243 THR n 
3 244 PHE n 
3 245 PRO n 
3 246 ALA n 
3 247 GLY n 
3 248 VAL n 
3 249 ASP n 
3 250 THR n 
3 251 ALA n 
3 252 SER n 
3 253 ALA n 
3 254 VAL n 
3 255 VAL n 
3 256 GLU n 
3 257 PHE n 
3 258 LYS n 
3 259 ARG n 
3 260 LYS n 
3 261 GLU n 
3 262 ASP n 
3 263 THR n 
3 264 VAL n 
3 265 VAL n 
3 266 ALA n 
3 267 THR n 
3 268 LEU n 
3 269 ARG n 
3 270 VAL n 
3 271 PHE n 
3 272 ASP n 
3 273 ALA n 
3 274 ASP n 
3 275 VAL n 
3 276 VAL n 
3 277 PRO n 
3 278 ALA n 
3 279 SER n 
3 280 GLY n 
3 281 GLU n 
3 282 LEU n 
3 283 VAL n 
3 284 ARG n 
3 285 ARG n 
3 286 TYR n 
3 287 THR n 
3 288 SER n 
3 289 THR n 
3 290 LEU n 
3 291 LEU n 
3 292 PRO n 
3 293 GLY n 
3 294 ASP n 
3 295 THR n 
3 296 TRP n 
3 297 ALA n 
3 298 GLN n 
3 299 GLN n 
3 300 THR n 
3 301 PHE n 
3 302 ARG n 
3 303 VAL n 
3 304 GLU n 
3 305 HIS n 
3 306 TRP n 
3 307 PRO n 
3 308 ASN n 
3 309 GLU n 
3 310 THR n 
3 311 SER n 
3 312 VAL n 
3 313 GLN n 
3 314 ALA n 
3 315 ASN n 
3 316 GLY n 
3 317 SER n 
3 318 PHE n 
3 319 VAL n 
3 320 ARG n 
3 321 ALA n 
3 322 THR n 
3 323 VAL n 
3 324 HIS n 
3 325 ASP n 
3 326 TYR n 
3 327 ARG n 
3 328 LEU n 
3 329 VAL n 
3 330 LEU n 
3 331 ASN n 
3 332 ARG n 
3 333 ASN n 
3 334 LEU n 
3 335 SER n 
3 336 ILE n 
3 337 SER n 
3 338 GLU n 
3 339 ASN n 
3 340 ARG n 
3 341 THR n 
3 342 MET n 
3 343 GLN n 
3 344 LEU n 
3 345 ALA n 
3 346 VAL n 
3 347 LEU n 
3 348 VAL n 
3 349 ASN n 
3 350 ASP n 
3 351 SER n 
3 352 ASP n 
3 353 PHE n 
3 354 GLN n 
3 355 GLY n 
3 356 PRO n 
3 357 GLY n 
3 358 ALA n 
3 359 GLY n 
3 360 VAL n 
3 361 LEU n 
3 362 LEU n 
3 363 LEU n 
3 364 HIS n 
3 365 PHE n 
3 366 ASN n 
3 367 VAL n 
3 368 SER n 
3 369 VAL n 
3 370 LEU n 
3 371 PRO n 
3 372 VAL n 
3 373 SER n 
3 374 LEU n 
3 375 HIS n 
3 376 LEU n 
3 377 PRO n 
3 378 SER n 
3 379 THR n 
3 380 TYR n 
3 381 SER n 
3 382 LEU n 
3 383 SER n 
3 384 VAL n 
3 385 SER n 
3 386 ARG n 
3 387 ARG n 
3 388 ALA n 
3 389 ARG n 
3 390 ARG n 
3 391 PHE n 
3 392 ALA n 
3 393 GLN n 
3 394 ILE n 
3 395 GLY n 
3 396 LYS n 
3 397 VAL n 
3 398 CYS n 
3 399 VAL n 
3 400 GLU n 
3 401 ASN n 
3 402 CYS n 
3 403 GLN n 
3 404 ALA n 
3 405 PHE n 
3 406 SER n 
3 407 GLY n 
3 408 ILE n 
3 409 ASN n 
3 410 VAL n 
3 411 GLN n 
3 412 TYR n 
3 413 LYS n 
3 414 LEU n 
3 415 HIS n 
3 416 SER n 
3 417 SER n 
3 418 GLY n 
3 419 ALA n 
3 420 ASN n 
3 421 CYS n 
3 422 SER n 
3 423 THR n 
3 424 LEU n 
3 425 GLY n 
3 426 VAL n 
3 427 VAL n 
3 428 THR n 
3 429 SER n 
3 430 ALA n 
3 431 GLU n 
3 432 ASP n 
3 433 THR n 
3 434 SER n 
3 435 GLY n 
3 436 ILE n 
3 437 LEU n 
3 438 PHE n 
3 439 VAL n 
3 440 ASN n 
3 441 ASP n 
3 442 THR n 
3 443 LYS n 
3 444 ALA n 
3 445 LEU n 
3 446 ARG n 
3 447 ARG n 
3 448 PRO n 
3 449 LYS n 
3 450 CYS n 
3 451 ALA n 
3 452 GLU n 
3 453 LEU n 
3 454 HIS n 
3 455 TYR n 
3 456 MET n 
3 457 VAL n 
3 458 VAL n 
3 459 ALA n 
3 460 THR n 
3 461 ASP n 
3 462 GLN n 
3 463 GLN n 
3 464 THR n 
3 465 SER n 
3 466 ARG n 
3 467 GLN n 
3 468 ALA n 
3 469 GLN n 
3 470 ALA n 
3 471 GLN n 
3 472 LEU n 
3 473 LEU n 
3 474 VAL n 
3 475 THR n 
3 476 VAL n 
3 477 GLU n 
3 478 GLY n 
3 479 SER n 
3 480 TYR n 
3 481 VAL n 
3 482 ALA n 
3 483 GLU n 
3 484 GLU n 
3 485 ALA n 
3 486 GLY n 
3 487 CYS n 
3 488 PRO n 
3 489 LEU n 
3 490 SER n 
3 491 CYS n 
3 492 ALA n 
3 493 VAL n 
3 494 SER n 
3 495 LYS n 
3 496 ARG n 
3 497 ARG n 
3 498 LEU n 
3 499 GLU n 
3 500 CYS n 
3 501 GLU n 
3 502 GLU n 
3 503 CYS n 
3 504 GLY n 
3 505 GLY n 
3 506 LEU n 
3 507 GLY n 
3 508 SER n 
3 509 PRO n 
3 510 THR n 
3 511 GLY n 
3 512 ARG n 
3 513 CYS n 
3 514 GLU n 
3 515 TRP n 
3 516 ARG n 
3 517 GLN n 
3 518 GLY n 
3 519 ASP n 
3 520 GLY n 
3 521 LYS n 
3 522 GLY n 
3 523 ILE n 
3 524 THR n 
3 525 ARG n 
3 526 ASN n 
3 527 PHE n 
3 528 SER n 
3 529 THR n 
3 530 CYS n 
3 531 SER n 
3 532 PRO n 
3 533 SER n 
3 534 THR n 
3 535 LYS n 
3 536 THR n 
3 537 CYS n 
3 538 PRO n 
3 539 ASP n 
3 540 GLY n 
3 541 HIS n 
3 542 CYS n 
3 543 ASP n 
3 544 VAL n 
3 545 VAL n 
3 546 GLU n 
3 547 THR n 
3 548 GLN n 
3 549 ASP n 
3 550 ILE n 
3 551 ASN n 
3 552 ILE n 
3 553 CYS n 
3 554 PRO n 
3 555 GLN n 
3 556 ASP n 
3 557 CYS n 
3 558 LEU n 
3 559 ARG n 
3 560 GLY n 
3 561 SER n 
3 562 ILE n 
3 563 VAL n 
3 564 GLY n 
3 565 GLY n 
3 566 HIS n 
3 567 GLU n 
3 568 PRO n 
3 569 GLY n 
3 570 GLU n 
3 571 PRO n 
3 572 ARG n 
3 573 GLY n 
3 574 ILE n 
3 575 LYS n 
3 576 ALA n 
3 577 GLY n 
3 578 TYR n 
3 579 GLY n 
3 580 THR n 
3 581 CYS n 
3 582 ASN n 
3 583 CYS n 
3 584 PHE n 
3 585 PRO n 
3 586 GLU n 
3 587 GLU n 
3 588 GLU n 
3 589 LYS n 
3 590 CYS n 
3 591 PHE n 
3 592 CYS n 
3 593 GLU n 
3 594 PRO n 
3 595 GLU n 
3 596 ASP n 
3 597 ILE n 
3 598 GLN n 
3 599 ASP n 
3 600 PRO n 
3 601 LEU n 
3 602 CYS n 
3 603 ASP n 
3 604 GLU n 
3 605 LEU n 
3 606 CYS n 
3 607 ARG n 
3 608 GLY n 
3 609 THR n 
3 610 HIS n 
3 611 HIS n 
3 612 HIS n 
3 613 HIS n 
3 614 HIS n 
3 615 HIS n 
3 616 HIS n 
3 617 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 Human ? 'GDF15, MIC1, PDF, PLAB, PTGFB'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562  ? ? ? ? ? ? ? ? ?      ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 343 Human ? 'GFRAL, C6orf144, UNQ9356/PRO34128' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
human 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? HEK293 ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 617 Human ? 'RET, CDHF12, CDHR16, PTC, RET51'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
human 'Homo sapiens'     9606 ? ? ? ? ? ? ? ? HEK293 ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GDF15_HUMAN Q99988 ? 1 
;ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVP
ASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
;
197 
2 UNP GFRAL_HUMAN Q6UXV0 ? 2 
;QTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGK
KCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIP
FNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCI
STLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKI
TLTGFHSPFNGEV
;
20  
3 UNP RET_HUMAN   P07949 ? 3 
;LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEK
LSVRNRGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQF
RLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDS
APTFPAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVR
ATVHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVCVE
NCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSY
VAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRG
SIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCR
;
29  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6Q2J A 24 ? 135 ? Q99988 197 ? 308 ? 197 308 
2 2 6Q2J C 1  ? 333 ? Q6UXV0 20  ? 352 ? 20  352 
3 3 6Q2J E 1  ? 607 ? P07949 29  ? 635 ? 29  635 
4 1 6Q2J B 24 ? 135 ? Q99988 197 ? 308 ? 197 308 
5 2 6Q2J D 1  ? 333 ? Q6UXV0 20  ? 352 ? 20  352 
6 3 6Q2J F 1  ? 607 ? P07949 29  ? 635 ? 29  635 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6Q2J MET A 1   ? UNP Q99988 ?   ?   'initiating methionine' 174 1  
1 6Q2J GLY A 2   ? UNP Q99988 ?   ?   'expression tag'        175 2  
1 6Q2J SER A 3   ? UNP Q99988 ?   ?   'expression tag'        176 3  
1 6Q2J SER A 4   ? UNP Q99988 ?   ?   'expression tag'        177 4  
1 6Q2J HIS A 5   ? UNP Q99988 ?   ?   'expression tag'        178 5  
1 6Q2J HIS A 6   ? UNP Q99988 ?   ?   'expression tag'        179 6  
1 6Q2J HIS A 7   ? UNP Q99988 ?   ?   'expression tag'        180 7  
1 6Q2J HIS A 8   ? UNP Q99988 ?   ?   'expression tag'        181 8  
1 6Q2J HIS A 9   ? UNP Q99988 ?   ?   'expression tag'        182 9  
1 6Q2J HIS A 10  ? UNP Q99988 ?   ?   'expression tag'        183 10 
1 6Q2J SER A 11  ? UNP Q99988 ?   ?   'expression tag'        184 11 
1 6Q2J SER A 12  ? UNP Q99988 ?   ?   'expression tag'        185 12 
1 6Q2J GLY A 13  ? UNP Q99988 ?   ?   'expression tag'        186 13 
1 6Q2J LEU A 14  ? UNP Q99988 ?   ?   'expression tag'        187 14 
1 6Q2J GLU A 15  ? UNP Q99988 ?   ?   'expression tag'        188 15 
1 6Q2J VAL A 16  ? UNP Q99988 ?   ?   'expression tag'        189 16 
1 6Q2J LEU A 17  ? UNP Q99988 ?   ?   'expression tag'        190 17 
1 6Q2J PHE A 18  ? UNP Q99988 ?   ?   'expression tag'        191 18 
1 6Q2J GLN A 19  ? UNP Q99988 ?   ?   'expression tag'        192 19 
1 6Q2J GLY A 20  ? UNP Q99988 ?   ?   'expression tag'        193 20 
1 6Q2J PRO A 21  ? UNP Q99988 ?   ?   'expression tag'        194 21 
1 6Q2J HIS A 22  ? UNP Q99988 ?   ?   'expression tag'        195 22 
1 6Q2J MET A 23  ? UNP Q99988 ?   ?   'expression tag'        196 23 
2 6Q2J GLY C 334 ? UNP Q6UXV0 ?   ?   'expression tag'        353 24 
2 6Q2J THR C 335 ? UNP Q6UXV0 ?   ?   'expression tag'        354 25 
2 6Q2J HIS C 336 ? UNP Q6UXV0 ?   ?   'expression tag'        355 26 
2 6Q2J HIS C 337 ? UNP Q6UXV0 ?   ?   'expression tag'        356 27 
2 6Q2J HIS C 338 ? UNP Q6UXV0 ?   ?   'expression tag'        357 28 
2 6Q2J HIS C 339 ? UNP Q6UXV0 ?   ?   'expression tag'        358 29 
2 6Q2J HIS C 340 ? UNP Q6UXV0 ?   ?   'expression tag'        359 30 
2 6Q2J HIS C 341 ? UNP Q6UXV0 ?   ?   'expression tag'        360 31 
2 6Q2J HIS C 342 ? UNP Q6UXV0 ?   ?   'expression tag'        361 32 
2 6Q2J HIS C 343 ? UNP Q6UXV0 ?   ?   'expression tag'        362 33 
3 6Q2J HIS E 86  ? UNP P07949 ARG 114 conflict                114 34 
3 6Q2J GLY E 608 ? UNP P07949 ?   ?   'expression tag'        636 35 
3 6Q2J THR E 609 ? UNP P07949 ?   ?   'expression tag'        637 36 
3 6Q2J HIS E 610 ? UNP P07949 ?   ?   'expression tag'        638 37 
3 6Q2J HIS E 611 ? UNP P07949 ?   ?   'expression tag'        639 38 
3 6Q2J HIS E 612 ? UNP P07949 ?   ?   'expression tag'        640 39 
3 6Q2J HIS E 613 ? UNP P07949 ?   ?   'expression tag'        641 40 
3 6Q2J HIS E 614 ? UNP P07949 ?   ?   'expression tag'        642 41 
3 6Q2J HIS E 615 ? UNP P07949 ?   ?   'expression tag'        643 42 
3 6Q2J HIS E 616 ? UNP P07949 ?   ?   'expression tag'        644 43 
3 6Q2J HIS E 617 ? UNP P07949 ?   ?   'expression tag'        645 44 
4 6Q2J MET B 1   ? UNP Q99988 ?   ?   'initiating methionine' 174 45 
4 6Q2J GLY B 2   ? UNP Q99988 ?   ?   'expression tag'        175 46 
4 6Q2J SER B 3   ? UNP Q99988 ?   ?   'expression tag'        176 47 
4 6Q2J SER B 4   ? UNP Q99988 ?   ?   'expression tag'        177 48 
4 6Q2J HIS B 5   ? UNP Q99988 ?   ?   'expression tag'        178 49 
4 6Q2J HIS B 6   ? UNP Q99988 ?   ?   'expression tag'        179 50 
4 6Q2J HIS B 7   ? UNP Q99988 ?   ?   'expression tag'        180 51 
4 6Q2J HIS B 8   ? UNP Q99988 ?   ?   'expression tag'        181 52 
4 6Q2J HIS B 9   ? UNP Q99988 ?   ?   'expression tag'        182 53 
4 6Q2J HIS B 10  ? UNP Q99988 ?   ?   'expression tag'        183 54 
4 6Q2J SER B 11  ? UNP Q99988 ?   ?   'expression tag'        184 55 
4 6Q2J SER B 12  ? UNP Q99988 ?   ?   'expression tag'        185 56 
4 6Q2J GLY B 13  ? UNP Q99988 ?   ?   'expression tag'        186 57 
4 6Q2J LEU B 14  ? UNP Q99988 ?   ?   'expression tag'        187 58 
4 6Q2J GLU B 15  ? UNP Q99988 ?   ?   'expression tag'        188 59 
4 6Q2J VAL B 16  ? UNP Q99988 ?   ?   'expression tag'        189 60 
4 6Q2J LEU B 17  ? UNP Q99988 ?   ?   'expression tag'        190 61 
4 6Q2J PHE B 18  ? UNP Q99988 ?   ?   'expression tag'        191 62 
4 6Q2J GLN B 19  ? UNP Q99988 ?   ?   'expression tag'        192 63 
4 6Q2J GLY B 20  ? UNP Q99988 ?   ?   'expression tag'        193 64 
4 6Q2J PRO B 21  ? UNP Q99988 ?   ?   'expression tag'        194 65 
4 6Q2J HIS B 22  ? UNP Q99988 ?   ?   'expression tag'        195 66 
4 6Q2J MET B 23  ? UNP Q99988 ?   ?   'expression tag'        196 67 
5 6Q2J GLY D 334 ? UNP Q6UXV0 ?   ?   'expression tag'        353 68 
5 6Q2J THR D 335 ? UNP Q6UXV0 ?   ?   'expression tag'        354 69 
5 6Q2J HIS D 336 ? UNP Q6UXV0 ?   ?   'expression tag'        355 70 
5 6Q2J HIS D 337 ? UNP Q6UXV0 ?   ?   'expression tag'        356 71 
5 6Q2J HIS D 338 ? UNP Q6UXV0 ?   ?   'expression tag'        357 72 
5 6Q2J HIS D 339 ? UNP Q6UXV0 ?   ?   'expression tag'        358 73 
5 6Q2J HIS D 340 ? UNP Q6UXV0 ?   ?   'expression tag'        359 74 
5 6Q2J HIS D 341 ? UNP Q6UXV0 ?   ?   'expression tag'        360 75 
5 6Q2J HIS D 342 ? UNP Q6UXV0 ?   ?   'expression tag'        361 76 
5 6Q2J HIS D 343 ? UNP Q6UXV0 ?   ?   'expression tag'        362 77 
6 6Q2J HIS F 86  ? UNP P07949 ARG 114 conflict                114 78 
6 6Q2J GLY F 608 ? UNP P07949 ?   ?   'expression tag'        636 79 
6 6Q2J THR F 609 ? UNP P07949 ?   ?   'expression tag'        637 80 
6 6Q2J HIS F 610 ? UNP P07949 ?   ?   'expression tag'        638 81 
6 6Q2J HIS F 611 ? UNP P07949 ?   ?   'expression tag'        639 82 
6 6Q2J HIS F 612 ? UNP P07949 ?   ?   'expression tag'        640 83 
6 6Q2J HIS F 613 ? UNP P07949 ?   ?   'expression tag'        641 84 
6 6Q2J HIS F 614 ? UNP P07949 ?   ?   'expression tag'        642 85 
6 6Q2J HIS F 615 ? UNP P07949 ?   ?   'expression tag'        643 86 
6 6Q2J HIS F 616 ? UNP P07949 ?   ?   'expression tag'        644 87 
6 6Q2J HIS F 617 ? UNP P07949 ?   ?   'expression tag'        645 88 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q2J 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6Q2J 
_struct.title                        'Cryo-EM structure of extracellular dimeric complex of RET/GFRAL/GDF15' 
_struct.pdbx_descriptor              
;Growth/differentiation factor 15, GDNF family receptor alpha-like, Proto-oncogene tyrosine-protein kinase receptor Ret (E.C.2.7.10.1)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q2J 
_struct_keywords.text            'RET, receptor tyrosine kinase, cryo-EM, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 47  ? GLY A 51  ? LEU A 220 GLY A 224 1 ? 5  
HELX_P HELX_P2  AA2 ASN A 79  ? LYS A 92  ? ASN A 252 LYS A 265 1 ? 14 
HELX_P HELX_P3  AA3 SER B 111 ? VAL B 120 ? SER C 130 VAL C 139 1 ? 10 
HELX_P HELX_P4  AA4 ASP B 122 ? CYS B 136 ? ASP C 141 CYS C 155 1 ? 15 
HELX_P HELX_P5  AA5 ASP B 144 ? ASN B 158 ? ASP C 163 ASN C 177 1 ? 15 
HELX_P HELX_P6  AA6 PRO B 160 ? PHE B 169 ? PRO C 179 PHE C 188 1 ? 10 
HELX_P HELX_P7  AA7 ASP B 176 ? HIS B 187 ? ASP C 195 HIS C 206 1 ? 12 
HELX_P HELX_P8  AA8 THR B 200 ? ASN B 210 ? THR C 219 ASN C 229 1 ? 11 
HELX_P HELX_P9  AA9 ASP B 211 ? CYS B 225 ? ASP C 230 CYS C 244 1 ? 15 
HELX_P HELX_P10 AB1 TRP B 226 ? HIS B 234 ? TRP C 245 HIS C 253 1 ? 9  
HELX_P HELX_P11 AB2 ASP B 236 ? SER B 241 ? ASP C 255 SER C 260 1 ? 6  
HELX_P HELX_P12 AB3 SER B 253 ? LEU B 264 ? SER C 272 LEU C 283 1 ? 12 
HELX_P HELX_P13 AB4 THR B 266 ? VAL B 270 ? THR C 285 VAL C 289 5 ? 5  
HELX_P HELX_P14 AB5 GLU B 281 ? HIS B 293 ? GLU C 300 HIS C 312 1 ? 13 
HELX_P HELX_P15 AB6 GLY C 46  ? THR C 50  ? GLY E 74  THR E 78  5 ? 5  
HELX_P HELX_P16 AB7 ASP C 74  ? ASN C 85  ? ASP E 102 ASN E 113 1 ? 12 
HELX_P HELX_P17 AB8 ALA C 128 ? LEU C 132 ? ALA E 156 LEU E 160 5 ? 5  
HELX_P HELX_P18 AB9 LYS C 133 ? LEU C 137 ? LYS E 161 LEU E 165 5 ? 5  
HELX_P HELX_P19 AC1 LEU C 162 ? CYS C 169 ? LEU E 190 CYS E 197 1 ? 8  
HELX_P HELX_P20 AC2 ASP C 294 ? GLN C 299 ? ASP E 322 GLN E 327 1 ? 6  
HELX_P HELX_P21 AC3 ASN C 401 ? PHE C 405 ? ASN E 429 PHE E 433 5 ? 5  
HELX_P HELX_P22 AC4 ARG C 447 ? CYS C 450 ? ARG E 475 CYS E 478 5 ? 4  
HELX_P HELX_P23 AC5 CYS C 553 ? CYS C 557 ? CYS E 581 CYS E 585 5 ? 5  
HELX_P HELX_P24 AC6 LEU D 47  ? GLY D 51  ? LEU B 220 GLY B 224 1 ? 5  
HELX_P HELX_P25 AC7 ASN D 79  ? LYS D 92  ? ASN B 252 LYS B 265 1 ? 14 
HELX_P HELX_P26 AC8 SER E 111 ? VAL E 120 ? SER D 130 VAL D 139 1 ? 10 
HELX_P HELX_P27 AC9 ASP E 122 ? CYS E 136 ? ASP D 141 CYS D 155 1 ? 15 
HELX_P HELX_P28 AD1 ASP E 144 ? ASN E 158 ? ASP D 163 ASN D 177 1 ? 15 
HELX_P HELX_P29 AD2 PRO E 160 ? PHE E 169 ? PRO D 179 PHE D 188 1 ? 10 
HELX_P HELX_P30 AD3 ASP E 176 ? HIS E 187 ? ASP D 195 HIS D 206 1 ? 12 
HELX_P HELX_P31 AD4 THR E 200 ? ASN E 210 ? THR D 219 ASN D 229 1 ? 11 
HELX_P HELX_P32 AD5 ASP E 211 ? CYS E 225 ? ASP D 230 CYS D 244 1 ? 15 
HELX_P HELX_P33 AD6 TRP E 226 ? HIS E 234 ? TRP D 245 HIS D 253 1 ? 9  
HELX_P HELX_P34 AD7 ASP E 236 ? SER E 241 ? ASP D 255 SER D 260 1 ? 6  
HELX_P HELX_P35 AD8 SER E 253 ? LEU E 264 ? SER D 272 LEU D 283 1 ? 12 
HELX_P HELX_P36 AD9 THR E 266 ? VAL E 270 ? THR D 285 VAL D 289 5 ? 5  
HELX_P HELX_P37 AE1 GLU E 281 ? HIS E 293 ? GLU D 300 HIS D 312 1 ? 13 
HELX_P HELX_P38 AE2 GLY F 46  ? THR F 50  ? GLY F 74  THR F 78  5 ? 5  
HELX_P HELX_P39 AE3 ASP F 74  ? ASN F 85  ? ASP F 102 ASN F 113 1 ? 12 
HELX_P HELX_P40 AE4 ALA F 128 ? LEU F 132 ? ALA F 156 LEU F 160 5 ? 5  
HELX_P HELX_P41 AE5 LYS F 133 ? LEU F 137 ? LYS F 161 LEU F 165 5 ? 5  
HELX_P HELX_P42 AE6 LEU F 162 ? CYS F 169 ? LEU F 190 CYS F 197 1 ? 8  
HELX_P HELX_P43 AE7 ASP F 294 ? GLN F 299 ? ASP F 322 GLN F 327 1 ? 6  
HELX_P HELX_P44 AE8 ASN F 401 ? PHE F 405 ? ASN F 429 PHE F 433 5 ? 5  
HELX_P HELX_P45 AE9 ARG F 447 ? CYS F 450 ? ARG F 475 CYS F 478 5 ? 4  
HELX_P HELX_P46 AF1 CYS F 553 ? CYS F 557 ? CYS F 581 CYS F 585 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 30  SG  ? ? ? 1_555 A  CYS 37  SG ? ? A CYS 203 A CYS 210 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2  disulf ?   ? A CYS 38  SG  ? ? ? 1_555 A  CYS 101 SG ? ? A CYS 211 A CYS 274 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf3  disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A  CYS 132 SG ? ? A CYS 240 A CYS 305 1_555 ? ? ? ? ? ? ? 2.012 ? ?               
disulf4  disulf ?   ? A CYS 71  SG  ? ? ? 1_555 A  CYS 134 SG ? ? A CYS 244 A CYS 307 1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf5  disulf ?   ? A CYS 100 SG  ? ? ? 1_555 D  CYS 100 SG ? ? A CYS 273 B CYS 273 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf6  disulf ?   ? B CYS 112 SG  ? ? ? 1_555 B  CYS 170 SG ? ? C CYS 131 C CYS 189 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf7  disulf ?   ? B CYS 119 SG  ? ? ? 1_555 B  CYS 125 SG ? ? C CYS 138 C CYS 144 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf8  disulf ?   ? B CYS 136 SG  ? ? ? 1_555 B  CYS 148 SG ? ? C CYS 155 C CYS 167 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf9  disulf ?   ? B CYS 143 SG  ? ? ? 1_555 B  CYS 191 SG ? ? C CYS 162 C CYS 210 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf10 disulf ?   ? B CYS 172 SG  ? ? ? 1_555 B  CYS 179 SG ? ? C CYS 191 C CYS 198 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf11 disulf ?   ? B CYS 201 SG  ? ? ? 1_555 B  CYS 272 SG ? ? C CYS 220 C CYS 291 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf12 disulf ?   ? B CYS 208 SG  ? ? ? 1_555 B  CYS 214 SG ? ? C CYS 227 C CYS 233 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf13 disulf ?   ? B CYS 225 SG  ? ? ? 1_555 B  CYS 256 SG ? ? C CYS 244 C CYS 275 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf14 disulf ?   ? B CYS 233 SG  ? ? ? 1_555 B  CYS 239 SG ? ? C CYS 252 C CYS 258 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf15 disulf ?   ? B CYS 250 SG  ? ? ? 1_555 B  CYS 297 SG ? ? C CYS 269 C CYS 316 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf16 disulf ?   ? B CYS 274 SG  ? ? ? 1_555 B  CYS 285 SG ? ? C CYS 293 C CYS 304 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf17 disulf ?   ? C CYS 109 SG  ? ? ? 1_555 C  CYS 114 SG ? ? E CYS 137 E CYS 142 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf18 disulf ?   ? C CYS 129 SG  ? ? ? 1_555 C  CYS 169 SG ? ? E CYS 157 E CYS 197 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf19 disulf ?   ? C CYS 138 SG  ? ? ? 1_555 C  CYS 215 SG ? ? E CYS 166 E CYS 243 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf20 disulf ?   ? C CYS 398 SG  ? ? ? 1_555 C  CYS 402 SG ? ? E CYS 426 E CYS 430 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf21 disulf ?   ? C CYS 421 SG  ? ? ? 1_555 C  CYS 450 SG ? ? E CYS 449 E CYS 478 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf22 disulf ?   ? C CYS 487 SG  ? ? ? 1_555 C  CYS 503 SG ? ? E CYS 515 E CYS 531 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf23 disulf ?   ? C CYS 491 SG  ? ? ? 1_555 C  CYS 513 SG ? ? E CYS 519 E CYS 541 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf24 disulf ?   ? C CYS 500 SG  ? ? ? 1_555 C  CYS 530 SG ? ? E CYS 528 E CYS 558 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf25 disulf ?   ? C CYS 537 SG  ? ? ? 1_555 C  CYS 553 SG ? ? E CYS 565 E CYS 581 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf26 disulf ?   ? C CYS 542 SG  ? ? ? 1_555 C  CYS 557 SG ? ? E CYS 570 E CYS 585 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf27 disulf ?   ? C CYS 581 SG  ? ? ? 1_555 C  CYS 592 SG ? ? E CYS 609 E CYS 620 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf28 disulf ?   ? C CYS 583 SG  ? ? ? 1_555 C  CYS 590 SG ? ? E CYS 611 E CYS 618 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf29 disulf ?   ? D CYS 30  SG  ? ? ? 1_555 D  CYS 37  SG ? ? B CYS 203 B CYS 210 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf30 disulf ?   ? D CYS 38  SG  ? ? ? 1_555 D  CYS 101 SG ? ? B CYS 211 B CYS 274 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf31 disulf ?   ? D CYS 67  SG  ? ? ? 1_555 D  CYS 132 SG ? ? B CYS 240 B CYS 305 1_555 ? ? ? ? ? ? ? 2.011 ? ?               
disulf32 disulf ?   ? D CYS 71  SG  ? ? ? 1_555 D  CYS 134 SG ? ? B CYS 244 B CYS 307 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf33 disulf ?   ? E CYS 112 SG  ? ? ? 1_555 E  CYS 170 SG ? ? D CYS 131 D CYS 189 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf34 disulf ?   ? E CYS 119 SG  ? ? ? 1_555 E  CYS 125 SG ? ? D CYS 138 D CYS 144 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf35 disulf ?   ? E CYS 136 SG  ? ? ? 1_555 E  CYS 148 SG ? ? D CYS 155 D CYS 167 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf36 disulf ?   ? E CYS 143 SG  ? ? ? 1_555 E  CYS 191 SG ? ? D CYS 162 D CYS 210 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf37 disulf ?   ? E CYS 172 SG  ? ? ? 1_555 E  CYS 179 SG ? ? D CYS 191 D CYS 198 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf38 disulf ?   ? E CYS 201 SG  ? ? ? 1_555 E  CYS 272 SG ? ? D CYS 220 D CYS 291 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf39 disulf ?   ? E CYS 208 SG  ? ? ? 1_555 E  CYS 214 SG ? ? D CYS 227 D CYS 233 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf40 disulf ?   ? E CYS 225 SG  ? ? ? 1_555 E  CYS 256 SG ? ? D CYS 244 D CYS 275 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf41 disulf ?   ? E CYS 233 SG  ? ? ? 1_555 E  CYS 239 SG ? ? D CYS 252 D CYS 258 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf42 disulf ?   ? E CYS 250 SG  ? ? ? 1_555 E  CYS 297 SG ? ? D CYS 269 D CYS 316 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf43 disulf ?   ? E CYS 274 SG  ? ? ? 1_555 E  CYS 285 SG ? ? D CYS 293 D CYS 304 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf44 disulf ?   ? F CYS 109 SG  ? ? ? 1_555 F  CYS 114 SG ? ? F CYS 137 F CYS 142 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf45 disulf ?   ? F CYS 129 SG  ? ? ? 1_555 F  CYS 169 SG ? ? F CYS 157 F CYS 197 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf46 disulf ?   ? F CYS 138 SG  ? ? ? 1_555 F  CYS 215 SG ? ? F CYS 166 F CYS 243 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf47 disulf ?   ? F CYS 398 SG  ? ? ? 1_555 F  CYS 402 SG ? ? F CYS 426 F CYS 430 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf48 disulf ?   ? F CYS 421 SG  ? ? ? 1_555 F  CYS 450 SG ? ? F CYS 449 F CYS 478 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf49 disulf ?   ? F CYS 487 SG  ? ? ? 1_555 F  CYS 503 SG ? ? F CYS 515 F CYS 531 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf50 disulf ?   ? F CYS 491 SG  ? ? ? 1_555 F  CYS 513 SG ? ? F CYS 519 F CYS 541 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf51 disulf ?   ? F CYS 500 SG  ? ? ? 1_555 F  CYS 530 SG ? ? F CYS 528 F CYS 558 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf52 disulf ?   ? F CYS 537 SG  ? ? ? 1_555 F  CYS 553 SG ? ? F CYS 565 F CYS 581 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf53 disulf ?   ? F CYS 542 SG  ? ? ? 1_555 F  CYS 557 SG ? ? F CYS 570 F CYS 585 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf54 disulf ?   ? F CYS 581 SG  ? ? ? 1_555 F  CYS 592 SG ? ? F CYS 609 F CYS 620 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf55 disulf ?   ? F CYS 583 SG  ? ? ? 1_555 F  CYS 590 SG ? ? F CYS 611 F CYS 618 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
covale1  covale one ? C ASN 70  ND2 ? ? ? 1_555 M  NAG .   C1 ? ? E ASN 98  E NAG 707 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale2  covale one ? C ASN 308 ND2 ? ? ? 1_555 H  NAG .   C1 ? ? E ASN 336 E NAG 702 1_555 ? ? ? ? ? ? ? 1.433 ? N-Glycosylation 
covale3  covale one ? C ASN 333 ND2 ? ? ? 1_555 G  NAG .   C1 ? ? E ASN 361 E NAG 701 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale4  covale one ? C ASN 339 ND2 ? ? ? 1_555 L  NAG .   C1 ? ? E ASN 367 E NAG 706 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale5  covale one ? C ASN 349 ND2 ? ? ? 1_555 I  NAG .   C1 ? ? E ASN 377 E NAG 703 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale6  covale one ? C ASN 366 ND2 ? ? ? 1_555 J  NAG .   C1 ? ? E ASN 394 E NAG 704 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale7  covale one ? C ASN 440 ND2 ? ? ? 1_555 K  NAG .   C1 ? ? E ASN 468 E NAG 705 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale8  covale one ? F ASN 70  ND2 ? ? ? 1_555 X  NAG .   C1 ? ? F ASN 98  F NAG 707 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale9  covale one ? F ASN 308 ND2 ? ? ? 1_555 S  NAG .   C1 ? ? F ASN 336 F NAG 702 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale10 covale one ? F ASN 333 ND2 ? ? ? 1_555 R  NAG .   C1 ? ? F ASN 361 F NAG 701 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale11 covale one ? F ASN 339 ND2 ? ? ? 1_555 W  NAG .   C1 ? ? F ASN 367 F NAG 706 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale12 covale one ? F ASN 349 ND2 ? ? ? 1_555 T  NAG .   C1 ? ? F ASN 377 F NAG 703 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale13 covale one ? F ASN 366 ND2 ? ? ? 1_555 U  NAG .   C1 ? ? F ASN 394 F NAG 704 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale14 covale one ? F ASN 440 ND2 ? ? ? 1_555 V  NAG .   C1 ? ? F ASN 468 F NAG 705 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
metalc1  metalc ?   ? C GLU 150 OE1 ? ? ? 1_555 P  CA  .   CA ? ? E GLU 178 E CA  710 1_555 ? ? ? ? ? ? ? 2.326 ? ?               
metalc2  metalc ?   ? C GLU 150 OE2 ? ? ? 1_555 P  CA  .   CA ? ? E GLU 178 E CA  710 1_555 ? ? ? ? ? ? ? 2.393 ? ?               
metalc3  metalc ?   ? C ASN 151 OD1 ? ? ? 1_555 P  CA  .   CA ? ? E ASN 179 E CA  710 1_555 ? ? ? ? ? ? ? 2.441 ? ?               
metalc4  metalc ?   ? C ASP 202 OD1 ? ? ? 1_555 P  CA  .   CA ? ? E ASP 230 E CA  710 1_555 ? ? ? ? ? ? ? 2.386 ? ?               
metalc5  metalc ?   ? C GLU 204 OE2 ? ? ? 1_555 O  CA  .   CA ? ? E GLU 232 E CA  709 1_555 ? ? ? ? ? ? ? 2.389 ? ?               
metalc6  metalc ?   ? C GLU 204 OE1 ? ? ? 1_555 P  CA  .   CA ? ? E GLU 232 E CA  710 1_555 ? ? ? ? ? ? ? 2.368 ? ?               
metalc7  metalc ?   ? C ASP 236 OD1 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 264 E CA  709 1_555 ? ? ? ? ? ? ? 2.373 ? ?               
metalc8  metalc ?   ? C ASP 236 OD2 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 264 E CA  709 1_555 ? ? ? ? ? ? ? 3.192 ? ?               
metalc9  metalc ?   ? C GLU 237 O   ? ? ? 1_555 O  CA  .   CA ? ? E GLU 265 E CA  709 1_555 ? ? ? ? ? ? ? 2.447 ? ?               
metalc10 metalc ?   ? C ASP 238 OD1 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 266 E CA  708 1_555 ? ? ? ? ? ? ? 2.403 ? ?               
metalc11 metalc ?   ? C ASP 238 OD2 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 266 E CA  708 1_555 ? ? ? ? ? ? ? 2.581 ? ?               
metalc12 metalc ?   ? C ASP 239 OD1 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 267 E CA  709 1_555 ? ? ? ? ? ? ? 2.321 ? ?               
metalc13 metalc ?   ? C ASP 239 OD2 ? ? ? 1_555 P  CA  .   CA ? ? E ASP 267 E CA  710 1_555 ? ? ? ? ? ? ? 2.227 ? ?               
metalc14 metalc ?   ? C SER 240 O   ? ? ? 1_555 N  CA  .   CA ? ? E SER 268 E CA  708 1_555 ? ? ? ? ? ? ? 2.568 ? ?               
metalc15 metalc ?   ? C ASP 272 OD1 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 300 E CA  708 1_555 ? ? ? ? ? ? ? 2.746 ? ?               
metalc16 metalc ?   ? C ASP 272 OD2 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 300 E CA  708 1_555 ? ? ? ? ? ? ? 2.309 ? ?               
metalc17 metalc ?   ? C ASP 274 OD2 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 302 E CA  708 1_555 ? ? ? ? ? ? ? 2.349 ? ?               
metalc18 metalc ?   ? C ASP 274 OD1 ? ? ? 1_555 O  CA  .   CA ? ? E ASP 302 E CA  709 1_555 ? ? ? ? ? ? ? 2.449 ? ?               
metalc19 metalc ?   ? C ASP 350 OD1 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 378 E CA  708 1_555 ? ? ? ? ? ? ? 2.703 ? ?               
metalc20 metalc ?   ? C ASP 350 OD2 ? ? ? 1_555 N  CA  .   CA ? ? E ASP 378 E CA  708 1_555 ? ? ? ? ? ? ? 2.434 ? ?               
metalc21 metalc ?   ? C THR 536 O   ? ? ? 1_555 Q  CA  .   CA ? ? E THR 564 E CA  711 1_555 ? ? ? ? ? ? ? 2.321 ? ?               
metalc22 metalc ?   ? C CYS 537 O   ? ? ? 1_555 Q  CA  .   CA ? ? E CYS 565 E CA  711 1_555 ? ? ? ? ? ? ? 2.819 ? ?               
metalc23 metalc ?   ? C ASP 539 OD1 ? ? ? 1_555 Q  CA  .   CA ? ? E ASP 567 E CA  711 1_555 ? ? ? ? ? ? ? 2.274 ? ?               
metalc24 metalc ?   ? C ASP 539 OD2 ? ? ? 1_555 Q  CA  .   CA ? ? E ASP 567 E CA  711 1_555 ? ? ? ? ? ? ? 2.511 ? ?               
metalc25 metalc ?   ? C HIS 541 O   ? ? ? 1_555 Q  CA  .   CA ? ? E HIS 569 E CA  711 1_555 ? ? ? ? ? ? ? 2.552 ? ?               
metalc26 metalc ?   ? C GLU 546 OE1 ? ? ? 1_555 Q  CA  .   CA ? ? E GLU 574 E CA  711 1_555 ? ? ? ? ? ? ? 2.365 ? ?               
metalc27 metalc ?   ? C GLU 546 OE2 ? ? ? 1_555 Q  CA  .   CA ? ? E GLU 574 E CA  711 1_555 ? ? ? ? ? ? ? 2.443 ? ?               
metalc28 metalc ?   ? C ASP 556 OD2 ? ? ? 1_555 Q  CA  .   CA ? ? E ASP 584 E CA  711 1_555 ? ? ? ? ? ? ? 2.430 ? ?               
metalc29 metalc ?   ? F GLU 150 OE1 ? ? ? 1_555 AA CA  .   CA ? ? F GLU 178 F CA  710 1_555 ? ? ? ? ? ? ? 2.326 ? ?               
metalc30 metalc ?   ? F GLU 150 OE2 ? ? ? 1_555 AA CA  .   CA ? ? F GLU 178 F CA  710 1_555 ? ? ? ? ? ? ? 2.392 ? ?               
metalc31 metalc ?   ? F ASN 151 OD1 ? ? ? 1_555 AA CA  .   CA ? ? F ASN 179 F CA  710 1_555 ? ? ? ? ? ? ? 2.442 ? ?               
metalc32 metalc ?   ? F ASP 202 OD1 ? ? ? 1_555 AA CA  .   CA ? ? F ASP 230 F CA  710 1_555 ? ? ? ? ? ? ? 2.386 ? ?               
metalc33 metalc ?   ? F GLU 204 OE2 ? ? ? 1_555 Z  CA  .   CA ? ? F GLU 232 F CA  709 1_555 ? ? ? ? ? ? ? 2.389 ? ?               
metalc34 metalc ?   ? F GLU 204 OE1 ? ? ? 1_555 AA CA  .   CA ? ? F GLU 232 F CA  710 1_555 ? ? ? ? ? ? ? 2.368 ? ?               
metalc35 metalc ?   ? F ASP 236 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? F ASP 264 F CA  709 1_555 ? ? ? ? ? ? ? 2.373 ? ?               
metalc36 metalc ?   ? F ASP 236 OD2 ? ? ? 1_555 Z  CA  .   CA ? ? F ASP 264 F CA  709 1_555 ? ? ? ? ? ? ? 3.192 ? ?               
metalc37 metalc ?   ? F GLU 237 O   ? ? ? 1_555 Z  CA  .   CA ? ? F GLU 265 F CA  709 1_555 ? ? ? ? ? ? ? 2.447 ? ?               
metalc38 metalc ?   ? F ASP 238 OD1 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 266 F CA  708 1_555 ? ? ? ? ? ? ? 2.402 ? ?               
metalc39 metalc ?   ? F ASP 238 OD2 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 266 F CA  708 1_555 ? ? ? ? ? ? ? 2.581 ? ?               
metalc40 metalc ?   ? F ASP 239 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? F ASP 267 F CA  709 1_555 ? ? ? ? ? ? ? 2.321 ? ?               
metalc41 metalc ?   ? F ASP 239 OD2 ? ? ? 1_555 AA CA  .   CA ? ? F ASP 267 F CA  710 1_555 ? ? ? ? ? ? ? 2.227 ? ?               
metalc42 metalc ?   ? F SER 240 O   ? ? ? 1_555 Y  CA  .   CA ? ? F SER 268 F CA  708 1_555 ? ? ? ? ? ? ? 2.568 ? ?               
metalc43 metalc ?   ? F ASP 272 OD1 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 300 F CA  708 1_555 ? ? ? ? ? ? ? 2.746 ? ?               
metalc44 metalc ?   ? F ASP 272 OD2 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 300 F CA  708 1_555 ? ? ? ? ? ? ? 2.309 ? ?               
metalc45 metalc ?   ? F ASP 274 OD2 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 302 F CA  708 1_555 ? ? ? ? ? ? ? 2.349 ? ?               
metalc46 metalc ?   ? F ASP 274 OD1 ? ? ? 1_555 Z  CA  .   CA ? ? F ASP 302 F CA  709 1_555 ? ? ? ? ? ? ? 2.450 ? ?               
metalc47 metalc ?   ? F ASP 350 OD1 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 378 F CA  708 1_555 ? ? ? ? ? ? ? 2.703 ? ?               
metalc48 metalc ?   ? F ASP 350 OD2 ? ? ? 1_555 Y  CA  .   CA ? ? F ASP 378 F CA  708 1_555 ? ? ? ? ? ? ? 2.434 ? ?               
metalc49 metalc ?   ? F THR 536 O   ? ? ? 1_555 BA CA  .   CA ? ? F THR 564 F CA  711 1_555 ? ? ? ? ? ? ? 2.321 ? ?               
metalc50 metalc ?   ? F CYS 537 O   ? ? ? 1_555 BA CA  .   CA ? ? F CYS 565 F CA  711 1_555 ? ? ? ? ? ? ? 2.819 ? ?               
metalc51 metalc ?   ? F ASP 539 OD1 ? ? ? 1_555 BA CA  .   CA ? ? F ASP 567 F CA  711 1_555 ? ? ? ? ? ? ? 2.274 ? ?               
metalc52 metalc ?   ? F ASP 539 OD2 ? ? ? 1_555 BA CA  .   CA ? ? F ASP 567 F CA  711 1_555 ? ? ? ? ? ? ? 2.511 ? ?               
metalc53 metalc ?   ? F HIS 541 O   ? ? ? 1_555 BA CA  .   CA ? ? F HIS 569 F CA  711 1_555 ? ? ? ? ? ? ? 2.552 ? ?               
metalc54 metalc ?   ? F GLU 546 OE1 ? ? ? 1_555 BA CA  .   CA ? ? F GLU 574 F CA  711 1_555 ? ? ? ? ? ? ? 2.366 ? ?               
metalc55 metalc ?   ? F GLU 546 OE2 ? ? ? 1_555 BA CA  .   CA ? ? F GLU 574 F CA  711 1_555 ? ? ? ? ? ? ? 2.443 ? ?               
metalc56 metalc ?   ? F ASP 556 OD2 ? ? ? 1_555 BA CA  .   CA ? ? F ASP 584 F CA  711 1_555 ? ? ? ? ? ? ? 2.430 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 58  A . ? SER 231 A PRO 59  A ? PRO 232 A 1 5.99  
2 VAL 196 B . ? VAL 215 C PRO 197 B ? PRO 216 C 1 -1.77 
3 TRP 111 C . ? TRP 139 E PRO 112 C ? PRO 140 E 1 3.14  
4 SER 58  D . ? SER 231 B PRO 59  D ? PRO 232 B 1 6.06  
5 VAL 196 E . ? VAL 215 D PRO 197 E ? PRO 216 D 1 -1.79 
6 TRP 111 F . ? TRP 139 F PRO 112 F ? PRO 140 F 1 3.18  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 3 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 4 ? 
AC5 ? 3 ? 
AC6 ? 2 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
AD2 ? 3 ? 
AD3 ? 4 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? parallel      
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? parallel      
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD3 1 2 ? parallel      
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? anti-parallel 
AD7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 39  ? SER A 46  ? ARG A 212 SER A 219 
AA1 2 GLU A 61  ? ILE A 68  ? GLU A 234 ILE A 241 
AA2 1 CYS A 100 ? THR A 115 ? CYS A 273 THR A 288 
AA2 2 GLY A 118 ? ILE A 135 ? GLY A 291 ILE A 308 
AA3 1 TYR C 2   ? PHE C 3   ? TYR E 30  PHE E 31  
AA3 2 ALA C 27  ? LEU C 28  ? ALA E 55  LEU E 56  
AA4 1 ALA C 7   ? TYR C 8   ? ALA E 35  TYR E 36  
AA4 2 CYS C 114 ? SER C 125 ? CYS E 142 SER E 153 
AA4 3 LYS C 11  ? VAL C 14  ? LYS E 39  VAL E 42  
AA5 1 ALA C 7   ? TYR C 8   ? ALA E 35  TYR E 36  
AA5 2 CYS C 114 ? SER C 125 ? CYS E 142 SER E 153 
AA5 3 VAL C 93  ? PHE C 98  ? VAL E 121 PHE E 126 
AA5 4 ARG C 39  ? LEU C 40  ? ARG E 67  LEU E 68  
AA6 1 PRO C 21  ? TYR C 24  ? PRO E 49  TYR E 52  
AA6 2 LEU C 66  ? LEU C 69  ? LEU E 94  LEU E 97  
AA6 3 ILE C 58  ? GLN C 61  ? ILE E 86  GLN E 89  
AA7 1 HIS C 43  ? LEU C 44  ? HIS E 71  LEU E 72  
AA7 2 HIS C 53  ? GLU C 54  ? HIS E 81  GLU E 82  
AA8 1 PHE C 146 ? ARG C 149 ? PHE E 174 ARG E 177 
AA8 2 VAL C 225 ? TYR C 235 ? VAL E 253 TYR E 263 
AA8 3 LYS C 208 ? VAL C 217 ? LYS E 236 VAL E 245 
AA8 4 VAL C 174 ? LEU C 178 ? VAL E 202 LEU E 206 
AA9 1 THR C 156 ? GLN C 159 ? THR E 184 GLN E 187 
AA9 2 GLU C 194 ? THR C 197 ? GLU E 222 THR E 225 
AA9 3 PHE C 186 ? ALA C 189 ? PHE E 214 ALA E 217 
AB1 1 THR C 250 ? VAL C 255 ? THR E 278 VAL E 283 
AB1 2 VAL C 360 ? VAL C 369 ? VAL E 388 VAL E 397 
AB1 3 ARG C 340 ? ASP C 350 ? ARG E 368 ASP E 378 
AB1 4 TYR C 286 ? LEU C 290 ? TYR E 314 LEU E 318 
AB2 1 VAL C 264 ? ASP C 272 ? VAL E 292 ASP E 300 
AB2 2 VAL C 319 ? LEU C 330 ? VAL E 347 LEU E 358 
AB2 3 PHE C 301 ? VAL C 312 ? PHE E 329 VAL E 340 
AB3 1 THR C 379 ? TYR C 380 ? THR E 407 TYR E 408 
AB3 2 GLN C 467 ? GLU C 477 ? GLN E 495 GLU E 505 
AB3 3 SER C 383 ? SER C 385 ? SER E 411 SER E 413 
AB4 1 THR C 379 ? TYR C 380 ? THR E 407 TYR E 408 
AB4 2 GLN C 467 ? GLU C 477 ? GLN E 495 GLU E 505 
AB4 3 GLU C 452 ? ASP C 461 ? GLU E 480 ASP E 489 
AB4 4 VAL C 410 ? HIS C 415 ? VAL E 438 HIS E 443 
AB5 1 GLN C 393 ? VAL C 397 ? GLN E 421 VAL E 425 
AB5 2 SER C 434 ? VAL C 439 ? SER E 462 VAL E 467 
AB5 3 LEU C 424 ? SER C 429 ? LEU E 452 SER E 457 
AB6 1 GLU C 514 ? ARG C 516 ? GLU E 542 ARG E 544 
AB6 2 THR C 529 ? SER C 531 ? THR E 557 SER E 559 
AB7 1 SER C 561 ? VAL C 563 ? SER E 589 VAL E 591 
AB7 2 LYS C 589 ? GLU C 593 ? LYS E 617 GLU E 621 
AB7 3 THR C 580 ? PHE C 584 ? THR E 608 PHE E 612 
AB8 1 HIS C 566 ? PRO C 568 ? HIS E 594 PRO E 596 
AB8 2 ILE C 574 ? GLY C 577 ? ILE E 602 GLY E 605 
AB9 1 ARG D 39  ? SER D 46  ? ARG B 212 SER B 219 
AB9 2 GLU D 61  ? ILE D 68  ? GLU B 234 ILE B 241 
AC1 1 CYS D 100 ? THR D 115 ? CYS B 273 THR B 288 
AC1 2 GLY D 118 ? ILE D 135 ? GLY B 291 ILE B 308 
AC2 1 TYR F 2   ? PHE F 3   ? TYR F 30  PHE F 31  
AC2 2 ALA F 27  ? LEU F 28  ? ALA F 55  LEU F 56  
AC3 1 ALA F 7   ? TYR F 8   ? ALA F 35  TYR F 36  
AC3 2 CYS F 114 ? SER F 125 ? CYS F 142 SER F 153 
AC3 3 LYS F 11  ? VAL F 14  ? LYS F 39  VAL F 42  
AC4 1 ALA F 7   ? TYR F 8   ? ALA F 35  TYR F 36  
AC4 2 CYS F 114 ? SER F 125 ? CYS F 142 SER F 153 
AC4 3 VAL F 93  ? PHE F 98  ? VAL F 121 PHE F 126 
AC4 4 ARG F 39  ? LEU F 40  ? ARG F 67  LEU F 68  
AC5 1 PRO F 21  ? TYR F 24  ? PRO F 49  TYR F 52  
AC5 2 LEU F 66  ? LEU F 69  ? LEU F 94  LEU F 97  
AC5 3 ILE F 58  ? GLN F 61  ? ILE F 86  GLN F 89  
AC6 1 HIS F 43  ? LEU F 44  ? HIS F 71  LEU F 72  
AC6 2 HIS F 53  ? GLU F 54  ? HIS F 81  GLU F 82  
AC7 1 PHE F 146 ? ARG F 149 ? PHE F 174 ARG F 177 
AC7 2 VAL F 225 ? TYR F 235 ? VAL F 253 TYR F 263 
AC7 3 LYS F 208 ? VAL F 217 ? LYS F 236 VAL F 245 
AC7 4 VAL F 174 ? LEU F 178 ? VAL F 202 LEU F 206 
AC8 1 THR F 156 ? GLN F 159 ? THR F 184 GLN F 187 
AC8 2 GLU F 194 ? THR F 197 ? GLU F 222 THR F 225 
AC8 3 PHE F 186 ? ALA F 189 ? PHE F 214 ALA F 217 
AC9 1 THR F 250 ? VAL F 255 ? THR F 278 VAL F 283 
AC9 2 VAL F 360 ? VAL F 369 ? VAL F 388 VAL F 397 
AC9 3 ARG F 340 ? ASP F 350 ? ARG F 368 ASP F 378 
AC9 4 TYR F 286 ? LEU F 290 ? TYR F 314 LEU F 318 
AD1 1 VAL F 264 ? ASP F 272 ? VAL F 292 ASP F 300 
AD1 2 VAL F 319 ? LEU F 330 ? VAL F 347 LEU F 358 
AD1 3 PHE F 301 ? VAL F 312 ? PHE F 329 VAL F 340 
AD2 1 THR F 379 ? TYR F 380 ? THR F 407 TYR F 408 
AD2 2 GLN F 467 ? GLU F 477 ? GLN F 495 GLU F 505 
AD2 3 SER F 383 ? SER F 385 ? SER F 411 SER F 413 
AD3 1 THR F 379 ? TYR F 380 ? THR F 407 TYR F 408 
AD3 2 GLN F 467 ? GLU F 477 ? GLN F 495 GLU F 505 
AD3 3 GLU F 452 ? ASP F 461 ? GLU F 480 ASP F 489 
AD3 4 VAL F 410 ? HIS F 415 ? VAL F 438 HIS F 443 
AD4 1 GLN F 393 ? VAL F 397 ? GLN F 421 VAL F 425 
AD4 2 SER F 434 ? VAL F 439 ? SER F 462 VAL F 467 
AD4 3 LEU F 424 ? SER F 429 ? LEU F 452 SER F 457 
AD5 1 GLU F 514 ? ARG F 516 ? GLU F 542 ARG F 544 
AD5 2 THR F 529 ? SER F 531 ? THR F 557 SER F 559 
AD6 1 SER F 561 ? VAL F 563 ? SER F 589 VAL F 591 
AD6 2 LYS F 589 ? GLU F 593 ? LYS F 617 GLU F 621 
AD6 3 THR F 580 ? PHE F 584 ? THR F 608 PHE F 612 
AD7 1 HIS F 566 ? PRO F 568 ? HIS F 594 PRO F 596 
AD7 2 ILE F 574 ? GLY F 577 ? ILE F 602 GLY F 605 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 43  ? N VAL A 216 O VAL A 64  ? O VAL A 237 
AA2 1 2 N ASN A 107 ? N ASN A 280 O LEU A 128 ? O LEU A 301 
AA3 1 2 N TYR C 2   ? N TYR E 30  O LEU C 28  ? O LEU E 56  
AA4 1 2 N TYR C 8   ? N TYR E 36  O TYR C 118 ? O TYR E 146 
AA4 2 3 O THR C 124 ? O THR E 152 N VAL C 14  ? N VAL E 42  
AA5 1 2 N TYR C 8   ? N TYR E 36  O TYR C 118 ? O TYR E 146 
AA5 2 3 O VAL C 117 ? O VAL E 145 N LEU C 95  ? N LEU E 123 
AA5 3 4 O PHE C 98  ? O PHE E 126 N ARG C 39  ? N ARG E 67  
AA6 1 2 N LEU C 23  ? N LEU E 51  O LEU C 67  ? O LEU E 95  
AA6 2 3 O TYR C 68  ? O TYR E 96  N CYS C 59  ? N CYS E 87  
AA7 1 2 N LEU C 44  ? N LEU E 72  O HIS C 53  ? O HIS E 81  
AA8 1 2 N ILE C 148 ? N ILE E 176 O TYR C 235 ? O TYR E 263 
AA8 2 3 O VAL C 228 ? O VAL E 256 N ALA C 213 ? N ALA E 241 
AA8 3 4 O VAL C 214 ? O VAL E 242 N ARG C 177 ? N ARG E 205 
AA9 1 2 N PHE C 157 ? N PHE E 185 O VAL C 195 ? O VAL E 223 
AA9 2 3 O SER C 196 ? O SER E 224 N ARG C 187 ? N ARG E 215 
AB1 1 2 N ALA C 253 ? N ALA E 281 O ASN C 366 ? O ASN E 394 
AB1 2 3 O LEU C 361 ? O LEU E 389 N VAL C 348 ? N VAL E 376 
AB1 3 4 O LEU C 347 ? O LEU E 375 N THR C 289 ? N THR E 317 
AB2 1 2 N VAL C 270 ? N VAL E 298 O HIS C 324 ? O HIS E 352 
AB2 2 3 O ASP C 325 ? O ASP E 353 N TRP C 306 ? N TRP E 334 
AB3 1 2 N TYR C 380 ? N TYR E 408 O LEU C 473 ? O LEU E 501 
AB3 2 3 O GLU C 477 ? O GLU E 505 N VAL C 384 ? N VAL E 412 
AB4 1 2 N TYR C 380 ? N TYR E 408 O LEU C 473 ? O LEU E 501 
AB4 2 3 O ALA C 468 ? O ALA E 496 N ALA C 459 ? N ALA E 487 
AB4 3 4 O THR C 460 ? O THR E 488 N GLN C 411 ? N GLN E 439 
AB5 1 2 N VAL C 397 ? N VAL E 425 O GLY C 435 ? O GLY E 463 
AB5 2 3 O ILE C 436 ? O ILE E 464 N VAL C 427 ? N VAL E 455 
AB6 1 2 N GLU C 514 ? N GLU E 542 O SER C 531 ? O SER E 559 
AB7 1 2 N VAL C 563 ? N VAL E 591 O CYS C 592 ? O CYS E 620 
AB7 2 3 O LYS C 589 ? O LYS E 617 N PHE C 584 ? N PHE E 612 
AB8 1 2 N GLU C 567 ? N GLU E 595 O ALA C 576 ? O ALA E 604 
AB9 1 2 N VAL D 43  ? N VAL B 216 O VAL D 64  ? O VAL B 237 
AC1 1 2 N ASN D 107 ? N ASN B 280 O LEU D 128 ? O LEU B 301 
AC2 1 2 N TYR F 2   ? N TYR F 30  O LEU F 28  ? O LEU F 56  
AC3 1 2 N TYR F 8   ? N TYR F 36  O TYR F 118 ? O TYR F 146 
AC3 2 3 O THR F 124 ? O THR F 152 N VAL F 14  ? N VAL F 42  
AC4 1 2 N TYR F 8   ? N TYR F 36  O TYR F 118 ? O TYR F 146 
AC4 2 3 O VAL F 117 ? O VAL F 145 N LEU F 95  ? N LEU F 123 
AC4 3 4 O PHE F 98  ? O PHE F 126 N ARG F 39  ? N ARG F 67  
AC5 1 2 N LEU F 23  ? N LEU F 51  O LEU F 67  ? O LEU F 95  
AC5 2 3 O TYR F 68  ? O TYR F 96  N CYS F 59  ? N CYS F 87  
AC6 1 2 N LEU F 44  ? N LEU F 72  O HIS F 53  ? O HIS F 81  
AC7 1 2 N ILE F 148 ? N ILE F 176 O TYR F 235 ? O TYR F 263 
AC7 2 3 O VAL F 228 ? O VAL F 256 N ALA F 213 ? N ALA F 241 
AC7 3 4 O VAL F 214 ? O VAL F 242 N ARG F 177 ? N ARG F 205 
AC8 1 2 N PHE F 157 ? N PHE F 185 O VAL F 195 ? O VAL F 223 
AC8 2 3 O SER F 196 ? O SER F 224 N ARG F 187 ? N ARG F 215 
AC9 1 2 N ALA F 253 ? N ALA F 281 O ASN F 366 ? O ASN F 394 
AC9 2 3 O LEU F 361 ? O LEU F 389 N VAL F 348 ? N VAL F 376 
AC9 3 4 O LEU F 347 ? O LEU F 375 N THR F 289 ? N THR F 317 
AD1 1 2 N VAL F 270 ? N VAL F 298 O HIS F 324 ? O HIS F 352 
AD1 2 3 O ASP F 325 ? O ASP F 353 N TRP F 306 ? N TRP F 334 
AD2 1 2 N TYR F 380 ? N TYR F 408 O LEU F 473 ? O LEU F 501 
AD2 2 3 O GLU F 477 ? O GLU F 505 N VAL F 384 ? N VAL F 412 
AD3 1 2 N TYR F 380 ? N TYR F 408 O LEU F 473 ? O LEU F 501 
AD3 2 3 O ALA F 468 ? O ALA F 496 N ALA F 459 ? N ALA F 487 
AD3 3 4 O THR F 460 ? O THR F 488 N GLN F 411 ? N GLN F 439 
AD4 1 2 N VAL F 397 ? N VAL F 425 O GLY F 435 ? O GLY F 463 
AD4 2 3 O ILE F 436 ? O ILE F 464 N VAL F 427 ? N VAL F 455 
AD5 1 2 N GLU F 514 ? N GLU F 542 O SER F 531 ? O SER F 559 
AD6 1 2 N VAL F 563 ? N VAL F 591 O CYS F 592 ? O CYS F 620 
AD6 2 3 O LYS F 589 ? O LYS F 617 N PHE F 584 ? N PHE F 612 
AD7 1 2 N GLU F 567 ? N GLU F 595 O ALA F 576 ? O ALA F 604 
# 
_atom_sites.entry_id                    6Q2J 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ASP A  1 28  ? 104.879 126.924 87.940  1.00 93.07  ?  201 ASP A N   1 
ATOM   2     C  CA  . ASP A  1 28  ? 106.280 126.614 88.187  1.00 93.07  ?  201 ASP A CA  1 
ATOM   3     C  C   . ASP A  1 28  ? 107.017 127.951 88.327  1.00 93.07  ?  201 ASP A C   1 
ATOM   4     O  O   . ASP A  1 28  ? 106.387 129.006 88.300  1.00 93.07  ?  201 ASP A O   1 
ATOM   5     C  CB  . ASP A  1 28  ? 106.846 125.748 87.051  1.00 93.07  ?  201 ASP A CB  1 
ATOM   6     C  CG  . ASP A  1 28  ? 108.120 125.011 87.441  1.00 93.07  ?  201 ASP A CG  1 
ATOM   7     O  OD1 . ASP A  1 28  ? 108.027 124.028 88.205  1.00 93.07  ?  201 ASP A OD1 1 
ATOM   8     O  OD2 . ASP A  1 28  ? 109.209 125.418 86.986  1.00 93.07  ?  201 ASP A OD2 1 
ATOM   9     N  N   . HIS A  1 29  ? 108.342 127.916 88.479  1.00 89.61  ?  202 HIS A N   1 
ATOM   10    C  CA  . HIS A  1 29  ? 109.117 129.124 88.724  1.00 89.61  ?  202 HIS A CA  1 
ATOM   11    C  C   . HIS A  1 29  ? 110.361 129.247 87.852  1.00 89.61  ?  202 HIS A C   1 
ATOM   12    O  O   . HIS A  1 29  ? 111.073 130.249 87.960  1.00 89.61  ?  202 HIS A O   1 
ATOM   13    C  CB  . HIS A  1 29  ? 109.520 129.195 90.202  1.00 89.61  ?  202 HIS A CB  1 
ATOM   14    C  CG  . HIS A  1 29  ? 110.218 127.966 90.692  1.00 89.61  ?  202 HIS A CG  1 
ATOM   15    N  ND1 . HIS A  1 29  ? 111.571 127.764 90.532  1.00 89.61  ?  202 HIS A ND1 1 
ATOM   16    C  CD2 . HIS A  1 29  ? 109.747 126.874 91.338  1.00 89.61  ?  202 HIS A CD2 1 
ATOM   17    C  CE1 . HIS A  1 29  ? 111.905 126.598 91.057  1.00 89.61  ?  202 HIS A CE1 1 
ATOM   18    N  NE2 . HIS A  1 29  ? 110.817 126.038 91.554  1.00 89.61  ?  202 HIS A NE2 1 
ATOM   19    N  N   . CYS A  1 30  ? 110.641 128.274 86.998  1.00 83.47  ?  203 CYS A N   1 
ATOM   20    C  CA  . CYS A  1 30  ? 111.770 128.400 86.087  1.00 83.47  ?  203 CYS A CA  1 
ATOM   21    C  C   . CYS A  1 30  ? 111.363 129.234 84.878  1.00 83.47  ?  203 CYS A C   1 
ATOM   22    O  O   . CYS A  1 30  ? 110.383 128.898 84.203  1.00 83.47  ?  203 CYS A O   1 
ATOM   23    C  CB  . CYS A  1 30  ? 112.261 127.025 85.642  1.00 83.47  ?  203 CYS A CB  1 
ATOM   24    S  SG  . CYS A  1 30  ? 113.655 127.043 84.483  1.00 83.47  ?  203 CYS A SG  1 
ATOM   25    N  N   . PRO A  1 31  ? 112.073 130.324 84.579  1.00 77.69  ?  204 PRO A N   1 
ATOM   26    C  CA  . PRO A  1 31  ? 111.634 131.212 83.494  1.00 77.69  ?  204 PRO A CA  1 
ATOM   27    C  C   . PRO A  1 31  ? 111.888 130.658 82.103  1.00 77.69  ?  204 PRO A C   1 
ATOM   28    O  O   . PRO A  1 31  ? 111.309 131.159 81.133  1.00 77.69  ?  204 PRO A O   1 
ATOM   29    C  CB  . PRO A  1 31  ? 112.455 132.487 83.733  1.00 77.69  ?  204 PRO A CB  1 
ATOM   30    C  CG  . PRO A  1 31  ? 112.892 132.405 85.156  1.00 77.69  ?  204 PRO A CG  1 
ATOM   31    C  CD  . PRO A  1 31  ? 113.114 130.949 85.408  1.00 77.69  ?  204 PRO A CD  1 
ATOM   32    N  N   . LEU A  1 32  ? 112.734 129.638 81.975  1.00 77.44  ?  205 LEU A N   1 
ATOM   33    C  CA  . LEU A  1 32  ? 113.121 129.131 80.666  1.00 77.44  ?  205 LEU A CA  1 
ATOM   34    C  C   . LEU A  1 32  ? 112.521 127.770 80.350  1.00 77.44  ?  205 LEU A C   1 
ATOM   35    O  O   . LEU A  1 32  ? 113.077 127.041 79.520  1.00 77.44  ?  205 LEU A O   1 
ATOM   36    C  CB  . LEU A  1 32  ? 114.647 129.066 80.557  1.00 77.44  ?  205 LEU A CB  1 
ATOM   37    C  CG  . LEU A  1 32  ? 115.353 130.420 80.587  1.00 77.44  ?  205 LEU A CG  1 
ATOM   38    C  CD1 . LEU A  1 32  ? 116.860 130.240 80.607  1.00 77.44  ?  205 LEU A CD1 1 
ATOM   39    C  CD2 . LEU A  1 32  ? 114.925 131.265 79.400  1.00 77.44  ?  205 LEU A CD2 1 
ATOM   40    N  N   . GLY A  1 33  ? 111.404 127.409 80.974  1.00 80.68  ?  206 GLY A N   1 
ATOM   41    C  CA  . GLY A  1 33  ? 110.813 126.107 80.786  1.00 80.68  ?  206 GLY A CA  1 
ATOM   42    C  C   . GLY A  1 33  ? 111.118 125.205 81.963  1.00 80.68  ?  206 GLY A C   1 
ATOM   43    O  O   . GLY A  1 33  ? 112.278 125.044 82.353  1.00 80.68  ?  206 GLY A O   1 
ATOM   44    N  N   . PRO A  1 34  ? 110.076 124.611 82.559  1.00 82.10  ?  207 PRO A N   1 
ATOM   45    C  CA  . PRO A  1 34  ? 110.264 123.823 83.788  1.00 82.10  ?  207 PRO A CA  1 
ATOM   46    C  C   . PRO A  1 34  ? 111.091 122.565 83.567  1.00 82.10  ?  207 PRO A C   1 
ATOM   47    O  O   . PRO A  1 34  ? 110.732 121.691 82.775  1.00 82.10  ?  207 PRO A O   1 
ATOM   48    C  CB  . PRO A  1 34  ? 108.829 123.479 84.206  1.00 82.10  ?  207 PRO A CB  1 
ATOM   49    C  CG  . PRO A  1 34  ? 107.982 124.519 83.551  1.00 82.10  ?  207 PRO A CG  1 
ATOM   50    C  CD  . PRO A  1 34  ? 108.652 124.795 82.240  1.00 82.10  ?  207 PRO A CD  1 
ATOM   51    N  N   . GLY A  1 35  ? 112.210 122.485 84.280  1.00 72.89  ?  208 GLY A N   1 
ATOM   52    C  CA  . GLY A  1 35  ? 113.163 121.407 84.109  1.00 72.89  ?  208 GLY A CA  1 
ATOM   53    C  C   . GLY A  1 35  ? 114.508 121.861 83.586  1.00 72.89  ?  208 GLY A C   1 
ATOM   54    O  O   . GLY A  1 35  ? 115.458 121.069 83.576  1.00 72.89  ?  208 GLY A O   1 
ATOM   55    N  N   . ARG A  1 36  ? 114.618 123.116 83.151  1.00 75.43  ?  209 ARG A N   1 
ATOM   56    C  CA  . ARG A  1 36  ? 115.833 123.635 82.540  1.00 75.43  ?  209 ARG A CA  1 
ATOM   57    C  C   . ARG A  1 36  ? 116.593 124.597 83.444  1.00 75.43  ?  209 ARG A C   1 
ATOM   58    O  O   . ARG A  1 36  ? 117.507 125.283 82.970  1.00 75.43  ?  209 ARG A O   1 
ATOM   59    C  CB  . ARG A  1 36  ? 115.489 124.318 81.215  1.00 75.43  ?  209 ARG A CB  1 
ATOM   60    C  CG  . ARG A  1 36  ? 114.943 123.364 80.167  1.00 75.43  ?  209 ARG A CG  1 
ATOM   61    C  CD  . ARG A  1 36  ? 114.481 124.100 78.920  1.00 75.43  ?  209 ARG A CD  1 
ATOM   62    N  NE  . ARG A  1 36  ? 115.580 124.723 78.191  1.00 75.43  ?  209 ARG A NE  1 
ATOM   63    C  CZ  . ARG A  1 36  ? 115.415 125.557 77.169  1.00 75.43  ?  209 ARG A CZ  1 
ATOM   64    N  NH1 . ARG A  1 36  ? 116.470 126.079 76.558  1.00 75.43  ?  209 ARG A NH1 1 
ATOM   65    N  NH2 . ARG A  1 36  ? 114.194 125.872 76.759  1.00 75.43  ?  209 ARG A NH2 1 
ATOM   66    N  N   . CYS A  1 37  ? 116.242 124.672 84.726  1.00 71.95  ?  210 CYS A N   1 
ATOM   67    C  CA  . CYS A  1 37  ? 116.926 125.551 85.666  1.00 71.95  ?  210 CYS A CA  1 
ATOM   68    C  C   . CYS A  1 37  ? 117.799 124.729 86.610  1.00 71.95  ?  210 CYS A C   1 
ATOM   69    O  O   . CYS A  1 37  ? 117.943 123.512 86.469  1.00 71.95  ?  210 CYS A O   1 
ATOM   70    C  CB  . CYS A  1 37  ? 115.925 126.413 86.439  1.00 71.95  ?  210 CYS A CB  1 
ATOM   71    S  SG  . CYS A  1 37  ? 115.218 127.815 85.529  1.00 71.95  ?  210 CYS A SG  1 
ATOM   72    N  N   . CYS A  1 38  ? 118.387 125.413 87.591  1.00 62.65  ?  211 CYS A N   1 
ATOM   73    C  CA  . CYS A  1 38  ? 119.310 124.816 88.550  1.00 62.65  ?  211 CYS A CA  1 
ATOM   74    C  C   . CYS A  1 38  ? 118.549 123.929 89.528  1.00 62.65  ?  211 CYS A C   1 
ATOM   75    O  O   . CYS A  1 38  ? 118.065 124.401 90.561  1.00 62.65  ?  211 CYS A O   1 
ATOM   76    C  CB  . CYS A  1 38  ? 120.073 125.923 89.280  1.00 62.65  ?  211 CYS A CB  1 
ATOM   77    S  SG  . CYS A  1 38  ? 121.203 125.431 90.606  1.00 62.65  ?  211 CYS A SG  1 
ATOM   78    N  N   . ARG A  1 39  ? 118.450 122.642 89.204  1.00 57.03  ?  212 ARG A N   1 
ATOM   79    C  CA  . ARG A  1 39  ? 117.789 121.657 90.052  1.00 57.03  ?  212 ARG A CA  1 
ATOM   80    C  C   . ARG A  1 39  ? 118.666 120.414 90.118  1.00 57.03  ?  212 ARG A C   1 
ATOM   81    O  O   . ARG A  1 39  ? 119.731 120.362 89.496  1.00 57.03  ?  212 ARG A O   1 
ATOM   82    C  CB  . ARG A  1 39  ? 116.399 121.322 89.511  1.00 57.03  ?  212 ARG A CB  1 
ATOM   83    C  CG  . ARG A  1 39  ? 116.433 120.622 88.167  1.00 57.03  ?  212 ARG A CG  1 
ATOM   84    C  CD  . ARG A  1 39  ? 115.043 120.297 87.671  1.00 57.03  ?  212 ARG A CD  1 
ATOM   85    N  NE  . ARG A  1 39  ? 115.074 119.663 86.359  1.00 57.03  ?  212 ARG A NE  1 
ATOM   86    C  CZ  . ARG A  1 39  ? 115.184 118.354 86.169  1.00 57.03  ?  212 ARG A CZ  1 
ATOM   87    N  NH1 . ARG A  1 39  ? 115.206 117.861 84.940  1.00 57.03  ?  212 ARG A NH1 1 
ATOM   88    N  NH2 . ARG A  1 39  ? 115.267 117.536 87.208  1.00 57.03  ?  212 ARG A NH2 1 
ATOM   89    N  N   . LEU A  1 40  ? 118.225 119.405 90.858  1.00 49.58  ?  213 LEU A N   1 
ATOM   90    C  CA  . LEU A  1 40  ? 119.012 118.191 91.008  1.00 49.58  ?  213 LEU A CA  1 
ATOM   91    C  C   . LEU A  1 40  ? 118.806 117.252 89.827  1.00 49.58  ?  213 LEU A C   1 
ATOM   92    O  O   . LEU A  1 40  ? 117.853 117.380 89.056  1.00 49.58  ?  213 LEU A O   1 
ATOM   93    C  CB  . LEU A  1 40  ? 118.666 117.452 92.301  1.00 49.58  ?  213 LEU A CB  1 
ATOM   94    C  CG  . LEU A  1 40  ? 119.296 117.904 93.617  1.00 49.58  ?  213 LEU A CG  1 
ATOM   95    C  CD1 . LEU A  1 40  ? 118.629 119.147 94.172  1.00 49.58  ?  213 LEU A CD1 1 
ATOM   96    C  CD2 . LEU A  1 40  ? 119.248 116.774 94.620  1.00 49.58  ?  213 LEU A CD2 1 
ATOM   97    N  N   . HIS A  1 41  ? 119.721 116.294 89.704  1.00 51.63  ?  214 HIS A N   1 
ATOM   98    C  CA  . HIS A  1 41  ? 119.653 115.204 88.748  1.00 51.63  ?  214 HIS A CA  1 
ATOM   99    C  C   . HIS A  1 41  ? 120.374 114.016 89.355  1.00 51.63  ?  214 HIS A C   1 
ATOM   100   O  O   . HIS A  1 41  ? 121.313 114.178 90.141  1.00 51.63  ?  214 HIS A O   1 
ATOM   101   C  CB  . HIS A  1 41  ? 120.311 115.547 87.406  1.00 51.63  ?  214 HIS A CB  1 
ATOM   102   C  CG  . HIS A  1 41  ? 119.569 116.563 86.601  1.00 51.63  ?  214 HIS A CG  1 
ATOM   103   N  ND1 . HIS A  1 41  ? 119.782 117.916 86.733  1.00 51.63  ?  214 HIS A ND1 1 
ATOM   104   C  CD2 . HIS A  1 41  ? 118.623 116.422 85.644  1.00 51.63  ?  214 HIS A CD2 1 
ATOM   105   C  CE1 . HIS A  1 41  ? 118.994 118.567 85.896  1.00 51.63  ?  214 HIS A CE1 1 
ATOM   106   N  NE2 . HIS A  1 41  ? 118.281 117.683 85.223  1.00 51.63  ?  214 HIS A NE2 1 
ATOM   107   N  N   . THR A  1 42  ? 119.938 112.820 88.983  1.00 52.35  ?  215 THR A N   1 
ATOM   108   C  CA  . THR A  1 42  ? 120.611 111.594 89.382  1.00 52.35  ?  215 THR A CA  1 
ATOM   109   C  C   . THR A  1 42  ? 121.223 110.954 88.148  1.00 52.35  ?  215 THR A C   1 
ATOM   110   O  O   . THR A  1 42  ? 120.507 110.597 87.208  1.00 52.35  ?  215 THR A O   1 
ATOM   111   C  CB  . THR A  1 42  ? 119.651 110.625 90.069  1.00 52.35  ?  215 THR A CB  1 
ATOM   112   O  OG1 . THR A  1 42  ? 119.151 111.222 91.271  1.00 52.35  ?  215 THR A OG1 1 
ATOM   113   C  CG2 . THR A  1 42  ? 120.368 109.335 90.413  1.00 52.35  ?  215 THR A CG2 1 
ATOM   114   N  N   . VAL A  1 43  ? 122.544 110.826 88.151  1.00 54.04  ?  216 VAL A N   1 
ATOM   115   C  CA  . VAL A  1 43  ? 123.290 110.210 87.064  1.00 54.04  ?  216 VAL A CA  1 
ATOM   116   C  C   . VAL A  1 43  ? 123.834 108.885 87.577  1.00 54.04  ?  216 VAL A C   1 
ATOM   117   O  O   . VAL A  1 43  ? 124.372 108.813 88.688  1.00 54.04  ?  216 VAL A O   1 
ATOM   118   C  CB  . VAL A  1 43  ? 124.416 111.132 86.557  1.00 54.04  ?  216 VAL A CB  1 
ATOM   119   C  CG1 . VAL A  1 43  ? 125.231 110.461 85.464  1.00 54.04  ?  216 VAL A CG1 1 
ATOM   120   C  CG2 . VAL A  1 43  ? 123.827 112.429 86.037  1.00 54.04  ?  216 VAL A CG2 1 
ATOM   121   N  N   . ARG A  1 44  ? 123.664 107.838 86.783  1.00 61.78  ?  217 ARG A N   1 
ATOM   122   C  CA  . ARG A  1 44  ? 124.055 106.490 87.157  1.00 61.78  ?  217 ARG A CA  1 
ATOM   123   C  C   . ARG A  1 44  ? 125.397 106.162 86.521  1.00 61.78  ?  217 ARG A C   1 
ATOM   124   O  O   . ARG A  1 44  ? 125.613 106.444 85.338  1.00 61.78  ?  217 ARG A O   1 
ATOM   125   C  CB  . ARG A  1 44  ? 122.979 105.506 86.707  1.00 61.78  ?  217 ARG A CB  1 
ATOM   126   C  CG  . ARG A  1 44  ? 123.215 104.065 87.063  1.00 61.78  ?  217 ARG A CG  1 
ATOM   127   C  CD  . ARG A  1 44  ? 122.040 103.243 86.571  1.00 61.78  ?  217 ARG A CD  1 
ATOM   128   N  NE  . ARG A  1 44  ? 121.876 103.356 85.124  1.00 61.78  ?  217 ARG A NE  1 
ATOM   129   C  CZ  . ARG A  1 44  ? 122.558 102.650 84.229  1.00 61.78  ?  217 ARG A CZ  1 
ATOM   130   N  NH1 . ARG A  1 44  ? 123.459 101.763 84.623  1.00 61.78  ?  217 ARG A NH1 1 
ATOM   131   N  NH2 . ARG A  1 44  ? 122.334 102.832 82.936  1.00 61.78  ?  217 ARG A NH2 1 
ATOM   132   N  N   . ALA A  1 45  ? 126.300 105.574 87.303  1.00 56.25  ?  218 ALA A N   1 
ATOM   133   C  CA  . ALA A  1 45  ? 127.633 105.272 86.804  1.00 56.25  ?  218 ALA A CA  1 
ATOM   134   C  C   . ALA A  1 45  ? 128.120 103.958 87.393  1.00 56.25  ?  218 ALA A C   1 
ATOM   135   O  O   . ALA A  1 45  ? 127.536 103.428 88.340  1.00 56.25  ?  218 ALA A O   1 
ATOM   136   C  CB  . ALA A  1 45  ? 128.618 106.398 87.131  1.00 56.25  ?  218 ALA A CB  1 
ATOM   137   N  N   . SER A  1 46  ? 129.187 103.427 86.808  1.00 49.76  ?  219 SER A N   1 
ATOM   138   C  CA  . SER A  1 46  ? 129.841 102.245 87.342  1.00 49.76  ?  219 SER A CA  1 
ATOM   139   C  C   . SER A  1 46  ? 131.217 102.612 87.886  1.00 49.76  ?  219 SER A C   1 
ATOM   140   O  O   . SER A  1 46  ? 131.687 103.742 87.747  1.00 49.76  ?  219 SER A O   1 
ATOM   141   C  CB  . SER A  1 46  ? 129.961 101.163 86.273  1.00 49.76  ?  219 SER A CB  1 
ATOM   142   O  OG  . SER A  1 46  ? 130.846 101.565 85.246  1.00 49.76  ?  219 SER A OG  1 
ATOM   143   N  N   . LEU A  1 47  ? 131.870 101.634 88.512  1.00 44.48  ?  220 LEU A N   1 
ATOM   144   C  CA  . LEU A  1 47  ? 133.152 101.909 89.146  1.00 44.48  ?  220 LEU A CA  1 
ATOM   145   C  C   . LEU A  1 47  ? 134.287 102.036 88.139  1.00 44.48  ?  220 LEU A C   1 
ATOM   146   O  O   . LEU A  1 47  ? 135.265 102.738 88.415  1.00 44.48  ?  220 LEU A O   1 
ATOM   147   C  CB  . LEU A  1 47  ? 133.473 100.823 90.166  1.00 44.48  ?  220 LEU A CB  1 
ATOM   148   C  CG  . LEU A  1 47  ? 132.493 100.767 91.335  1.00 44.48  ?  220 LEU A CG  1 
ATOM   149   C  CD1 . LEU A  1 47  ? 132.830 99.607  92.249  1.00 44.48  ?  220 LEU A CD1 1 
ATOM   150   C  CD2 . LEU A  1 47  ? 132.491 102.076 92.098  1.00 44.48  ?  220 LEU A CD2 1 
ATOM   151   N  N   . GLU A  1 48  ? 134.185 101.382 86.982  1.00 49.77  ?  221 GLU A N   1 
ATOM   152   C  CA  . GLU A  1 48  ? 135.165 101.606 85.928  1.00 49.77  ?  221 GLU A CA  1 
ATOM   153   C  C   . GLU A  1 48  ? 134.963 102.948 85.247  1.00 49.77  ?  221 GLU A C   1 
ATOM   154   O  O   . GLU A  1 48  ? 135.913 103.490 84.673  1.00 49.77  ?  221 GLU A O   1 
ATOM   155   C  CB  . GLU A  1 48  ? 135.106 100.496 84.875  1.00 49.77  ?  221 GLU A CB  1 
ATOM   156   C  CG  . GLU A  1 48  ? 135.551 99.129  85.361  1.00 49.77  ?  221 GLU A CG  1 
ATOM   157   C  CD  . GLU A  1 48  ? 134.419 98.328  85.968  1.00 49.77  ?  221 GLU A CD  1 
ATOM   158   O  OE1 . GLU A  1 48  ? 133.267 98.810  85.939  1.00 49.77  ?  221 GLU A OE1 1 
ATOM   159   O  OE2 . GLU A  1 48  ? 134.679 97.216  86.470  1.00 49.77  ?  221 GLU A OE2 1 
ATOM   160   N  N   . ASP A  1 49  ? 133.738 103.478 85.283  1.00 48.84  ?  222 ASP A N   1 
ATOM   161   C  CA  . ASP A  1 49  ? 133.489 104.819 84.771  1.00 48.84  ?  222 ASP A CA  1 
ATOM   162   C  C   . ASP A  1 49  ? 134.192 105.864 85.623  1.00 48.84  ?  222 ASP A C   1 
ATOM   163   O  O   . ASP A  1 49  ? 134.798 106.802 85.095  1.00 48.84  ?  222 ASP A O   1 
ATOM   164   C  CB  . ASP A  1 49  ? 131.987 105.088 84.726  1.00 48.84  ?  222 ASP A CB  1 
ATOM   165   C  CG  . ASP A  1 49  ? 131.274 104.235 83.701  1.00 48.84  ?  222 ASP A CG  1 
ATOM   166   O  OD1 . ASP A  1 49  ? 131.901 103.879 82.683  1.00 48.84  ?  222 ASP A OD1 1 
ATOM   167   O  OD2 . ASP A  1 49  ? 130.089 103.911 83.920  1.00 48.84  ?  222 ASP A OD2 1 
ATOM   168   N  N   . LEU A  1 50  ? 134.127 105.711 86.943  1.00 41.49  ?  223 LEU A N   1 
ATOM   169   C  CA  . LEU A  1 50  ? 134.877 106.568 87.845  1.00 41.49  ?  223 LEU A CA  1 
ATOM   170   C  C   . LEU A  1 50  ? 136.336 106.158 87.948  1.00 41.49  ?  223 LEU A C   1 
ATOM   171   O  O   . LEU A  1 50  ? 137.152 106.950 88.429  1.00 41.49  ?  223 LEU A O   1 
ATOM   172   C  CB  . LEU A  1 50  ? 134.249 106.546 89.240  1.00 41.49  ?  223 LEU A CB  1 
ATOM   173   C  CG  . LEU A  1 50  ? 132.797 107.009 89.328  1.00 41.49  ?  223 LEU A CG  1 
ATOM   174   C  CD1 . LEU A  1 50  ? 132.284 106.867 90.748  1.00 41.49  ?  223 LEU A CD1 1 
ATOM   175   C  CD2 . LEU A  1 50  ? 132.650 108.431 88.833  1.00 41.49  ?  223 LEU A CD2 1 
ATOM   176   N  N   . GLY A  1 51  ? 136.680 104.953 87.505  1.00 40.73  ?  224 GLY A N   1 
ATOM   177   C  CA  . GLY A  1 51  ? 138.021 104.439 87.690  1.00 40.73  ?  224 GLY A CA  1 
ATOM   178   C  C   . GLY A  1 51  ? 138.300 104.079 89.130  1.00 40.73  ?  224 GLY A C   1 
ATOM   179   O  O   . GLY A  1 51  ? 139.391 104.356 89.638  1.00 40.73  ?  224 GLY A O   1 
ATOM   180   N  N   . TRP A  1 52  ? 137.328 103.471 89.809  1.00 37.62  ?  225 TRP A N   1 
ATOM   181   C  CA  . TRP A  1 52  ? 137.450 103.192 91.234  1.00 37.62  ?  225 TRP A CA  1 
ATOM   182   C  C   . TRP A  1 52  ? 137.502 101.699 91.528  1.00 37.62  ?  225 TRP A C   1 
ATOM   183   O  O   . TRP A  1 52  ? 137.298 101.292 92.676  1.00 37.62  ?  225 TRP A O   1 
ATOM   184   C  CB  . TRP A  1 52  ? 136.289 103.807 92.014  1.00 37.62  ?  225 TRP A CB  1 
ATOM   185   C  CG  . TRP A  1 52  ? 136.241 105.298 92.051  1.00 37.62  ?  225 TRP A CG  1 
ATOM   186   C  CD1 . TRP A  1 52  ? 137.090 106.173 91.446  1.00 37.62  ?  225 TRP A CD1 1 
ATOM   187   C  CD2 . TRP A  1 52  ? 135.312 106.090 92.794  1.00 37.62  ?  225 TRP A CD2 1 
ATOM   188   N  NE1 . TRP A  1 52  ? 136.724 107.462 91.736  1.00 37.62  ?  225 TRP A NE1 1 
ATOM   189   C  CE2 . TRP A  1 52  ? 135.637 107.436 92.569  1.00 37.62  ?  225 TRP A CE2 1 
ATOM   190   C  CE3 . TRP A  1 52  ? 134.228 105.787 93.623  1.00 37.62  ?  225 TRP A CE3 1 
ATOM   191   C  CZ2 . TRP A  1 52  ? 134.921 108.477 93.140  1.00 37.62  ?  225 TRP A CZ2 1 
ATOM   192   C  CZ3 . TRP A  1 52  ? 133.518 106.819 94.186  1.00 37.62  ?  225 TRP A CZ3 1 
ATOM   193   C  CH2 . TRP A  1 52  ? 133.865 108.148 93.942  1.00 37.62  ?  225 TRP A CH2 1 
ATOM   194   N  N   . ALA A  1 53  ? 137.777 100.874 90.517  1.00 40.53  ?  226 ALA A N   1 
ATOM   195   C  CA  . ALA A  1 53  ? 137.702 99.426  90.681  1.00 40.53  ?  226 ALA A CA  1 
ATOM   196   C  C   . ALA A  1 53  ? 138.833 98.871  91.539  1.00 40.53  ?  226 ALA A C   1 
ATOM   197   O  O   . ALA A  1 53  ? 138.724 97.750  92.047  1.00 40.53  ?  226 ALA A O   1 
ATOM   198   C  CB  . ALA A  1 53  ? 137.706 98.740  89.313  1.00 40.53  ?  226 ALA A CB  1 
ATOM   199   N  N   . ASP A  1 54  ? 139.913 99.629  91.718  1.00 39.51  ?  227 ASP A N   1 
ATOM   200   C  CA  . ASP A  1 54  ? 141.050 99.129  92.478  1.00 39.51  ?  227 ASP A CA  1 
ATOM   201   C  C   . ASP A  1 54  ? 140.869 99.276  93.982  1.00 39.51  ?  227 ASP A C   1 
ATOM   202   O  O   . ASP A  1 54  ? 141.614 98.650  94.743  1.00 39.51  ?  227 ASP A O   1 
ATOM   203   C  CB  . ASP A  1 54  ? 142.326 99.849  92.041  1.00 39.51  ?  227 ASP A CB  1 
ATOM   204   C  CG  . ASP A  1 54  ? 142.762 99.463  90.645  1.00 39.51  ?  227 ASP A CG  1 
ATOM   205   O  OD1 . ASP A  1 54  ? 142.489 98.317  90.231  1.00 39.51  ?  227 ASP A OD1 1 
ATOM   206   O  OD2 . ASP A  1 54  ? 143.376 100.306 89.959  1.00 39.51  ?  227 ASP A OD2 1 
ATOM   207   N  N   . TRP A  1 55  ? 139.915 100.088 94.435  1.00 35.16  ?  228 TRP A N   1 
ATOM   208   C  CA  . TRP A  1 55  ? 139.761 100.337 95.860  1.00 35.16  ?  228 TRP A CA  1 
ATOM   209   C  C   . TRP A  1 55  ? 138.320 100.419 96.341  1.00 35.16  ?  228 TRP A C   1 
ATOM   210   O  O   . TRP A  1 55  ? 138.106 100.797 97.497  1.00 35.16  ?  228 TRP A O   1 
ATOM   211   C  CB  . TRP A  1 55  ? 140.495 101.627 96.253  1.00 35.16  ?  228 TRP A CB  1 
ATOM   212   C  CG  . TRP A  1 55  ? 139.981 102.845 95.566  1.00 35.16  ?  228 TRP A CG  1 
ATOM   213   C  CD1 . TRP A  1 55  ? 140.284 103.259 94.305  1.00 35.16  ?  228 TRP A CD1 1 
ATOM   214   C  CD2 . TRP A  1 55  ? 139.120 103.845 96.118  1.00 35.16  ?  228 TRP A CD2 1 
ATOM   215   N  NE1 . TRP A  1 55  ? 139.638 104.434 94.023  1.00 35.16  ?  228 TRP A NE1 1 
ATOM   216   C  CE2 . TRP A  1 55  ? 138.919 104.818 95.122  1.00 35.16  ?  228 TRP A CE2 1 
ATOM   217   C  CE3 . TRP A  1 55  ? 138.491 104.006 97.353  1.00 35.16  ?  228 TRP A CE3 1 
ATOM   218   C  CZ2 . TRP A  1 55  ? 138.116 105.932 95.322  1.00 35.16  ?  228 TRP A CZ2 1 
ATOM   219   C  CZ3 . TRP A  1 55  ? 137.690 105.111 97.547  1.00 35.16  ?  228 TRP A CZ3 1 
ATOM   220   C  CH2 . TRP A  1 55  ? 137.511 106.061 96.539  1.00 35.16  ?  228 TRP A CH2 1 
ATOM   221   N  N   . VAL A  1 56  ? 137.332 100.088 95.510  1.00 39.10  ?  229 VAL A N   1 
ATOM   222   C  CA  . VAL A  1 56  ? 135.927 100.094 95.909  1.00 39.10  ?  229 VAL A CA  1 
ATOM   223   C  C   . VAL A  1 56  ? 135.340 98.722  95.608  1.00 39.10  ?  229 VAL A C   1 
ATOM   224   O  O   . VAL A  1 56  ? 135.366 98.268  94.458  1.00 39.10  ?  229 VAL A O   1 
ATOM   225   C  CB  . VAL A  1 56  ? 135.119 101.189 95.194  1.00 39.10  ?  229 VAL A CB  1 
ATOM   226   C  CG1 . VAL A  1 56  ? 133.664 101.113 95.596  1.00 39.10  ?  229 VAL A CG1 1 
ATOM   227   C  CG2 . VAL A  1 56  ? 135.678 102.560 95.506  1.00 39.10  ?  229 VAL A CG2 1 
ATOM   228   N  N   . LEU A  1 57  ? 134.803 98.062  96.636  1.00 42.31  ?  230 LEU A N   1 
ATOM   229   C  CA  . LEU A  1 57  ? 134.195 96.750  96.443  1.00 42.31  ?  230 LEU A CA  1 
ATOM   230   C  C   . LEU A  1 57  ? 132.686 96.849  96.244  1.00 42.31  ?  230 LEU A C   1 
ATOM   231   O  O   . LEU A  1 57  ? 132.129 96.200  95.352  1.00 42.31  ?  230 LEU A O   1 
ATOM   232   C  CB  . LEU A  1 57  ? 134.514 95.843  97.631  1.00 42.31  ?  230 LEU A CB  1 
ATOM   233   C  CG  . LEU A  1 57  ? 133.967 94.419  97.544  1.00 42.31  ?  230 LEU A CG  1 
ATOM   234   C  CD1 . LEU A  1 57  ? 134.560 93.693  96.350  1.00 42.31  ?  230 LEU A CD1 1 
ATOM   235   C  CD2 . LEU A  1 57  ? 134.247 93.658  98.827  1.00 42.31  ?  230 LEU A CD2 1 
ATOM   236   N  N   . SER A  1 58  ? 132.012 97.652  97.062  1.00 42.52  ?  231 SER A N   1 
ATOM   237   C  CA  . SER A  1 58  ? 130.566 97.804  96.987  1.00 42.52  ?  231 SER A CA  1 
ATOM   238   C  C   . SER A  1 58  ? 130.221 99.252  97.304  1.00 42.52  ?  231 SER A C   1 
ATOM   239   O  O   . SER A  1 58  ? 130.819 99.848  98.208  1.00 42.52  ?  231 SER A O   1 
ATOM   240   C  CB  . SER A  1 58  ? 129.858 96.849  97.959  1.00 42.52  ?  231 SER A CB  1 
ATOM   241   O  OG  . SER A  1 58  ? 128.451 97.005  97.917  1.00 42.52  ?  231 SER A OG  1 
ATOM   242   N  N   . PRO A  1 59  ? 129.245 99.847  96.596  1.00 41.80  ?  232 PRO A N   1 
ATOM   243   C  CA  . PRO A  1 59  ? 128.313 99.323  95.590  1.00 41.80  ?  232 PRO A CA  1 
ATOM   244   C  C   . PRO A  1 59  ? 128.925 99.104  94.218  1.00 41.80  ?  232 PRO A C   1 
ATOM   245   O  O   . PRO A  1 59  ? 129.910 99.745  93.869  1.00 41.80  ?  232 PRO A O   1 
ATOM   246   C  CB  . PRO A  1 59  ? 127.249 100.413 95.512  1.00 41.80  ?  232 PRO A CB  1 
ATOM   247   C  CG  . PRO A  1 59  ? 127.984 101.647 95.817  1.00 41.80  ?  232 PRO A CG  1 
ATOM   248   C  CD  . PRO A  1 59  ? 129.026 101.282 96.830  1.00 41.80  ?  232 PRO A CD  1 
ATOM   249   N  N   . ARG A  1 60  ? 128.330 98.192  93.451  1.00 54.26  ?  233 ARG A N   1 
ATOM   250   C  CA  . ARG A  1 60  ? 128.830 97.919  92.110  1.00 54.26  ?  233 ARG A CA  1 
ATOM   251   C  C   . ARG A  1 60  ? 128.306 98.935  91.104  1.00 54.26  ?  233 ARG A C   1 
ATOM   252   O  O   . ARG A  1 60  ? 128.812 99.015  89.979  1.00 54.26  ?  233 ARG A O   1 
ATOM   253   C  CB  . ARG A  1 60  ? 128.449 96.500  91.692  1.00 54.26  ?  233 ARG A CB  1 
ATOM   254   C  CG  . ARG A  1 60  ? 129.130 95.416  92.512  1.00 54.26  ?  233 ARG A CG  1 
ATOM   255   C  CD  . ARG A  1 60  ? 128.690 94.033  92.066  1.00 54.26  ?  233 ARG A CD  1 
ATOM   256   N  NE  . ARG A  1 60  ? 129.131 93.735  90.707  1.00 54.26  ?  233 ARG A NE  1 
ATOM   257   C  CZ  . ARG A  1 60  ? 128.737 92.675  90.010  1.00 54.26  ?  233 ARG A CZ  1 
ATOM   258   N  NH1 . ARG A  1 60  ? 127.888 91.806  90.542  1.00 54.26  ?  233 ARG A NH1 1 
ATOM   259   N  NH2 . ARG A  1 60  ? 129.188 92.484  88.779  1.00 54.26  ?  233 ARG A NH2 1 
ATOM   260   N  N   . GLU A  1 61  ? 127.296 99.711  91.483  1.00 56.37  ?  234 GLU A N   1 
ATOM   261   C  CA  . GLU A  1 61  ? 126.694 100.699 90.602  1.00 56.37  ?  234 GLU A CA  1 
ATOM   262   C  C   . GLU A  1 61  ? 126.238 101.882 91.446  1.00 56.37  ?  234 GLU A C   1 
ATOM   263   O  O   . GLU A  1 61  ? 125.520 101.707 92.435  1.00 56.37  ?  234 GLU A O   1 
ATOM   264   C  CB  . GLU A  1 61  ? 125.529 100.075 89.832  1.00 56.37  ?  234 GLU A CB  1 
ATOM   265   C  CG  . GLU A  1 61  ? 125.042 100.856 88.633  1.00 56.37  ?  234 GLU A CG  1 
ATOM   266   C  CD  . GLU A  1 61  ? 124.030 100.063 87.826  1.00 56.37  ?  234 GLU A CD  1 
ATOM   267   O  OE1 . GLU A  1 61  ? 123.626 98.975  88.286  1.00 56.37  ?  234 GLU A OE1 1 
ATOM   268   O  OE2 . GLU A  1 61  ? 123.676 100.498 86.714  1.00 56.37  ?  234 GLU A OE2 1 
ATOM   269   N  N   . VAL A  1 62  ? 126.662 103.083 91.060  1.00 55.90  ?  235 VAL A N   1 
ATOM   270   C  CA  . VAL A  1 62  ? 126.616 104.255 91.928  1.00 55.90  ?  235 VAL A CA  1 
ATOM   271   C  C   . VAL A  1 62  ? 125.620 105.255 91.354  1.00 55.90  ?  235 VAL A C   1 
ATOM   272   O  O   . VAL A  1 62  ? 125.714 105.646 90.181  1.00 55.90  ?  235 VAL A O   1 
ATOM   273   C  CB  . VAL A  1 62  ? 128.004 104.889 92.091  1.00 55.90  ?  235 VAL A CB  1 
ATOM   274   C  CG1 . VAL A  1 62  ? 127.939 106.077 93.027  1.00 55.90  ?  235 VAL A CG1 1 
ATOM   275   C  CG2 . VAL A  1 62  ? 128.998 103.864 92.598  1.00 55.90  ?  235 VAL A CG2 1 
ATOM   276   N  N   . GLN A  1 63  ? 124.664 105.668 92.185  1.00 58.66  ?  236 GLN A N   1 
ATOM   277   C  CA  . GLN A  1 63  ? 123.733 106.740 91.854  1.00 58.66  ?  236 GLN A CA  1 
ATOM   278   C  C   . GLN A  1 63  ? 124.281 108.041 92.429  1.00 58.66  ?  236 GLN A C   1 
ATOM   279   O  O   . GLN A  1 63  ? 124.429 108.164 93.649  1.00 58.66  ?  236 GLN A O   1 
ATOM   280   C  CB  . GLN A  1 63  ? 122.354 106.445 92.441  1.00 58.66  ?  236 GLN A CB  1 
ATOM   281   C  CG  . GLN A  1 63  ? 121.742 105.110 92.045  1.00 58.66  ?  236 GLN A CG  1 
ATOM   282   C  CD  . GLN A  1 63  ? 121.406 105.018 90.573  1.00 58.66  ?  236 GLN A CD  1 
ATOM   283   O  OE1 . GLN A  1 63  ? 120.993 105.996 89.955  1.00 58.66  ?  236 GLN A OE1 1 
ATOM   284   N  NE2 . GLN A  1 63  ? 121.559 103.827 90.008  1.00 58.66  ?  236 GLN A NE2 1 
ATOM   285   N  N   . VAL A  1 64  ? 124.573 109.019 91.573  1.00 51.03  ?  237 VAL A N   1 
ATOM   286   C  CA  . VAL A  1 64  ? 125.181 110.271 92.002  1.00 51.03  ?  237 VAL A CA  1 
ATOM   287   C  C   . VAL A  1 64  ? 124.181 111.399 91.796  1.00 51.03  ?  237 VAL A C   1 
ATOM   288   O  O   . VAL A  1 64  ? 123.597 111.529 90.717  1.00 51.03  ?  237 VAL A O   1 
ATOM   289   C  CB  . VAL A  1 64  ? 126.488 110.549 91.233  1.00 51.03  ?  237 VAL A CB  1 
ATOM   290   C  CG1 . VAL A  1 64  ? 127.114 111.855 91.684  1.00 51.03  ?  237 VAL A CG1 1 
ATOM   291   C  CG2 . VAL A  1 64  ? 127.457 109.411 91.425  1.00 51.03  ?  237 VAL A CG2 1 
ATOM   292   N  N   . THR A  1 65  ? 123.986 112.214 92.829  1.00 43.73  ?  238 THR A N   1 
ATOM   293   C  CA  . THR A  1 65  ? 123.125 113.387 92.748  1.00 43.73  ?  238 THR A CA  1 
ATOM   294   C  C   . THR A  1 65  ? 123.984 114.608 92.454  1.00 43.73  ?  238 THR A C   1 
ATOM   295   O  O   . THR A  1 65  ? 124.753 115.049 93.313  1.00 43.73  ?  238 THR A O   1 
ATOM   296   C  CB  . THR A  1 65  ? 122.346 113.594 94.044  1.00 43.73  ?  238 THR A CB  1 
ATOM   297   O  OG1 . THR A  1 65  ? 123.265 113.835 95.115  1.00 43.73  ?  238 THR A OG1 1 
ATOM   298   C  CG2 . THR A  1 65  ? 121.516 112.370 94.361  1.00 43.73  ?  238 THR A CG2 1 
ATOM   299   N  N   . MET A  1 66  ? 123.847 115.154 91.249  1.00 50.63  ?  239 MET A N   1 
ATOM   300   C  CA  . MET A  1 66  ? 124.567 116.358 90.860  1.00 50.63  ?  239 MET A CA  1 
ATOM   301   C  C   . MET A  1 66  ? 123.612 117.291 90.136  1.00 50.63  ?  239 MET A C   1 
ATOM   302   O  O   . MET A  1 66  ? 122.496 116.908 89.791  1.00 50.63  ?  239 MET A O   1 
ATOM   303   C  CB  . MET A  1 66  ? 125.753 116.052 89.958  1.00 50.63  ?  239 MET A CB  1 
ATOM   304   C  CG  . MET A  1 66  ? 125.345 115.529 88.610  1.00 50.63  ?  239 MET A CG  1 
ATOM   305   S  SD  . MET A  1 66  ? 126.781 115.200 87.600  1.00 50.63  ?  239 MET A SD  1 
ATOM   306   C  CE  . MET A  1 66  ? 127.430 113.772 88.440  1.00 50.63  ?  239 MET A CE  1 
ATOM   307   N  N   . CYS A  1 67  ? 124.061 118.512 89.877  1.00 50.84  ?  240 CYS A N   1 
ATOM   308   C  CA  . CYS A  1 67  ? 123.164 119.552 89.399  1.00 50.84  ?  240 CYS A CA  1 
ATOM   309   C  C   . CYS A  1 67  ? 123.550 120.042 88.015  1.00 50.84  ?  240 CYS A C   1 
ATOM   310   O  O   . CYS A  1 67  ? 124.709 120.372 87.758  1.00 50.84  ?  240 CYS A O   1 
ATOM   311   C  CB  . CYS A  1 67  ? 123.130 120.701 90.392  1.00 50.84  ?  240 CYS A CB  1 
ATOM   312   S  SG  . CYS A  1 67  ? 122.374 120.120 91.897  1.00 50.84  ?  240 CYS A SG  1 
ATOM   313   N  N   . ILE A  1 68  ? 122.555 120.086 87.132  1.00 57.00  ?  241 ILE A N   1 
ATOM   314   C  CA  . ILE A  1 68  ? 122.728 120.410 85.723  1.00 57.00  ?  241 ILE A CA  1 
ATOM   315   C  C   . ILE A  1 68  ? 121.810 121.583 85.416  1.00 57.00  ?  241 ILE A C   1 
ATOM   316   O  O   . ILE A  1 68  ? 120.700 121.672 85.948  1.00 57.00  ?  241 ILE A O   1 
ATOM   317   C  CB  . ILE A  1 68  ? 122.386 119.188 84.831  1.00 57.00  ?  241 ILE A CB  1 
ATOM   318   C  CG1 . ILE A  1 68  ? 123.231 117.975 85.215  1.00 57.00  ?  241 ILE A CG1 1 
ATOM   319   C  CG2 . ILE A  1 68  ? 122.610 119.470 83.350  1.00 57.00  ?  241 ILE A CG2 1 
ATOM   320   C  CD1 . ILE A  1 68  ? 122.754 116.689 84.583  1.00 57.00  ?  241 ILE A CD1 1 
ATOM   321   N  N   . GLY A  1 69  ? 122.278 122.503 84.579  1.00 63.08  ?  242 GLY A N   1 
ATOM   322   C  CA  . GLY A  1 69  ? 121.379 123.492 84.032  1.00 63.08  ?  242 GLY A CA  1 
ATOM   323   C  C   . GLY A  1 69  ? 122.042 124.836 83.853  1.00 63.08  ?  242 GLY A C   1 
ATOM   324   O  O   . GLY A  1 69  ? 123.256 124.932 83.675  1.00 63.08  ?  242 GLY A O   1 
ATOM   325   N  N   . ALA A  1 70  ? 121.222 125.882 83.889  1.00 66.80  ?  243 ALA A N   1 
ATOM   326   C  CA  . ALA A  1 70  ? 121.679 127.251 83.734  1.00 66.80  ?  243 ALA A CA  1 
ATOM   327   C  C   . ALA A  1 70  ? 121.054 128.114 84.817  1.00 66.80  ?  243 ALA A C   1 
ATOM   328   O  O   . ALA A  1 70  ? 120.153 127.681 85.539  1.00 66.80  ?  243 ALA A O   1 
ATOM   329   C  CB  . ALA A  1 70  ? 121.328 127.806 82.350  1.00 66.80  ?  243 ALA A CB  1 
ATOM   330   N  N   . CYS A  1 71  ? 121.546 129.344 84.924  1.00 69.97  ?  244 CYS A N   1 
ATOM   331   C  CA  . CYS A  1 71  ? 121.046 130.314 85.896  1.00 69.97  ?  244 CYS A CA  1 
ATOM   332   C  C   . CYS A  1 71  ? 120.623 131.587 85.180  1.00 69.97  ?  244 CYS A C   1 
ATOM   333   O  O   . CYS A  1 71  ? 121.480 132.326 84.663  1.00 69.97  ?  244 CYS A O   1 
ATOM   334   C  CB  . CYS A  1 71  ? 122.103 130.617 86.952  1.00 69.97  ?  244 CYS A CB  1 
ATOM   335   S  SG  . CYS A  1 71  ? 122.461 129.233 88.026  1.00 69.97  ?  244 CYS A SG  1 
ATOM   336   N  N   . PRO A  1 72  ? 119.332 131.887 85.119  1.00 72.97  ?  245 PRO A N   1 
ATOM   337   C  CA  . PRO A  1 72  ? 118.900 133.169 84.556  1.00 72.97  ?  245 PRO A CA  1 
ATOM   338   C  C   . PRO A  1 72  ? 118.990 134.281 85.584  1.00 72.97  ?  245 PRO A C   1 
ATOM   339   O  O   . PRO A  1 72  ? 119.502 134.071 86.688  1.00 72.97  ?  245 PRO A O   1 
ATOM   340   C  CB  . PRO A  1 72  ? 117.452 132.896 84.145  1.00 72.97  ?  245 PRO A CB  1 
ATOM   341   C  CG  . PRO A  1 72  ? 117.000 131.869 85.114  1.00 72.97  ?  245 PRO A CG  1 
ATOM   342   C  CD  . PRO A  1 72  ? 118.192 131.002 85.408  1.00 72.97  ?  245 PRO A CD  1 
ATOM   343   N  N   . SER A  1 73  ? 118.503 135.467 85.232  1.00 73.87  ?  246 SER A N   1 
ATOM   344   C  CA  . SER A  1 73  ? 118.555 136.600 86.144  1.00 73.87  ?  246 SER A CA  1 
ATOM   345   C  C   . SER A  1 73  ? 117.585 136.410 87.303  1.00 73.87  ?  246 SER A C   1 
ATOM   346   O  O   . SER A  1 73  ? 116.462 135.933 87.118  1.00 73.87  ?  246 SER A O   1 
ATOM   347   C  CB  . SER A  1 73  ? 118.235 137.891 85.398  1.00 73.87  ?  246 SER A CB  1 
ATOM   348   O  OG  . SER A  1 73  ? 119.213 138.157 84.409  1.00 73.87  ?  246 SER A OG  1 
ATOM   349   N  N   . GLN A  1 74  ? 118.053 136.750 88.505  1.00 74.89  ?  247 GLN A N   1 
ATOM   350   C  CA  . GLN A  1 74  ? 117.311 136.775 89.765  1.00 74.89  ?  247 GLN A CA  1 
ATOM   351   C  C   . GLN A  1 74  ? 116.785 135.412 90.199  1.00 74.89  ?  247 GLN A C   1 
ATOM   352   O  O   . GLN A  1 74  ? 115.912 135.351 91.072  1.00 74.89  ?  247 GLN A O   1 
ATOM   353   C  CB  . GLN A  1 74  ? 116.142 137.771 89.726  1.00 74.89  ?  247 GLN A CB  1 
ATOM   354   C  CG  . GLN A  1 74  ? 116.550 139.227 89.596  1.00 74.89  ?  247 GLN A CG  1 
ATOM   355   C  CD  . GLN A  1 74  ? 115.352 140.154 89.530  1.00 74.89  ?  247 GLN A CD  1 
ATOM   356   O  OE1 . GLN A  1 74  ? 114.206 139.705 89.518  1.00 74.89  ?  247 GLN A OE1 1 
ATOM   357   N  NE2 . GLN A  1 74  ? 115.610 141.454 89.484  1.00 74.89  ?  247 GLN A NE2 1 
ATOM   358   N  N   . PHE A  1 75  ? 117.280 134.315 89.633  1.00 74.20  ?  248 PHE A N   1 
ATOM   359   C  CA  . PHE A  1 75  ? 116.794 132.994 90.007  1.00 74.20  ?  248 PHE A CA  1 
ATOM   360   C  C   . PHE A  1 75  ? 117.639 132.420 91.133  1.00 74.20  ?  248 PHE A C   1 
ATOM   361   O  O   . PHE A  1 75  ? 118.702 131.843 90.877  1.00 74.20  ?  248 PHE A O   1 
ATOM   362   C  CB  . PHE A  1 75  ? 116.798 132.044 88.812  1.00 74.20  ?  248 PHE A CB  1 
ATOM   363   C  CG  . PHE A  1 75  ? 116.258 130.680 89.131  1.00 74.20  ?  248 PHE A CG  1 
ATOM   364   C  CD1 . PHE A  1 75  ? 114.898 130.486 89.299  1.00 74.20  ?  248 PHE A CD1 1 
ATOM   365   C  CD2 . PHE A  1 75  ? 117.106 129.593 89.269  1.00 74.20  ?  248 PHE A CD2 1 
ATOM   366   C  CE1 . PHE A  1 75  ? 114.395 129.235 89.599  1.00 74.20  ?  248 PHE A CE1 1 
ATOM   367   C  CE2 . PHE A  1 75  ? 116.608 128.340 89.570  1.00 74.20  ?  248 PHE A CE2 1 
ATOM   368   C  CZ  . PHE A  1 75  ? 115.251 128.162 89.734  1.00 74.20  ?  248 PHE A CZ  1 
ATOM   369   N  N   . ARG A  1 76  ? 117.162 132.596 92.370  1.00 69.96  ?  249 ARG A N   1 
ATOM   370   C  CA  . ARG A  1 76  ? 117.715 131.983 93.584  1.00 69.96  ?  249 ARG A CA  1 
ATOM   371   C  C   . ARG A  1 76  ? 119.174 132.400 93.796  1.00 69.96  ?  249 ARG A C   1 
ATOM   372   O  O   . ARG A  1 76  ? 120.052 131.590 94.097  1.00 69.96  ?  249 ARG A O   1 
ATOM   373   C  CB  . ARG A  1 76  ? 117.553 130.457 93.549  1.00 69.96  ?  249 ARG A CB  1 
ATOM   374   C  CG  . ARG A  1 76  ? 117.584 129.763 94.912  1.00 69.96  ?  249 ARG A CG  1 
ATOM   375   C  CD  . ARG A  1 76  ? 117.461 128.259 94.763  1.00 69.96  ?  249 ARG A CD  1 
ATOM   376   N  NE  . ARG A  1 76  ? 116.185 127.867 94.181  1.00 69.96  ?  249 ARG A NE  1 
ATOM   377   C  CZ  . ARG A  1 76  ? 115.890 126.628 93.810  1.00 69.96  ?  249 ARG A CZ  1 
ATOM   378   N  NH1 . ARG A  1 76  ? 116.779 125.660 93.970  1.00 69.96  ?  249 ARG A NH1 1 
ATOM   379   N  NH2 . ARG A  1 76  ? 114.705 126.355 93.285  1.00 69.96  ?  249 ARG A NH2 1 
ATOM   380   N  N   . ALA A  1 77  ? 119.440 133.685 93.595  1.00 73.64  ?  250 ALA A N   1 
ATOM   381   C  CA  . ALA A  1 77  ? 120.767 134.240 93.830  1.00 73.64  ?  250 ALA A CA  1 
ATOM   382   C  C   . ALA A  1 77  ? 121.010 134.285 95.331  1.00 73.64  ?  250 ALA A C   1 
ATOM   383   O  O   . ALA A  1 77  ? 120.448 135.130 96.032  1.00 73.64  ?  250 ALA A O   1 
ATOM   384   C  CB  . ALA A  1 77  ? 120.884 135.626 93.208  1.00 73.64  ?  250 ALA A CB  1 
ATOM   385   N  N   . ALA A  1 78  ? 121.851 133.379 95.831  1.00 75.02  ?  251 ALA A N   1 
ATOM   386   C  CA  . ALA A  1 78  ? 121.963 133.198 97.275  1.00 75.02  ?  251 ALA A CA  1 
ATOM   387   C  C   . ALA A  1 78  ? 122.800 134.279 97.948  1.00 75.02  ?  251 ALA A C   1 
ATOM   388   O  O   . ALA A  1 78  ? 122.904 134.294 99.180  1.00 75.02  ?  251 ALA A O   1 
ATOM   389   C  CB  . ALA A  1 78  ? 122.550 131.824 97.587  1.00 75.02  ?  251 ALA A CB  1 
ATOM   390   N  N   . ASN A  1 79  ? 123.406 135.177 97.179  1.00 87.57  ?  252 ASN A N   1 
ATOM   391   C  CA  . ASN A  1 79  ? 124.143 136.293 97.754  1.00 87.57  ?  252 ASN A CA  1 
ATOM   392   C  C   . ASN A  1 79  ? 124.066 137.484 96.805  1.00 87.57  ?  252 ASN A C   1 
ATOM   393   O  O   . ASN A  1 79  ? 123.670 137.357 95.642  1.00 87.57  ?  252 ASN A O   1 
ATOM   394   C  CB  . ASN A  1 79  ? 125.589 135.895 98.071  1.00 87.57  ?  252 ASN A CB  1 
ATOM   395   C  CG  . ASN A  1 79  ? 126.339 135.356 96.864  1.00 87.57  ?  252 ASN A CG  1 
ATOM   396   O  OD1 . ASN A  1 79  ? 125.807 135.265 95.758  1.00 87.57  ?  252 ASN A OD1 1 
ATOM   397   N  ND2 . ASN A  1 79  ? 127.600 135.010 97.076  1.00 87.57  ?  252 ASN A ND2 1 
ATOM   398   N  N   . MET A  1 80  ? 124.469 138.654 97.304  1.00 95.77  ?  253 MET A N   1 
ATOM   399   C  CA  . MET A  1 80  ? 124.503 139.843 96.465  1.00 95.77  ?  253 MET A CA  1 
ATOM   400   C  C   . MET A  1 80  ? 125.632 139.804 95.453  1.00 95.77  ?  253 MET A C   1 
ATOM   401   O  O   . MET A  1 80  ? 125.583 140.534 94.456  1.00 95.77  ?  253 MET A O   1 
ATOM   402   C  CB  . MET A  1 80  ? 124.640 141.104 97.319  1.00 95.77  ?  253 MET A CB  1 
ATOM   403   C  CG  . MET A  1 80  ? 123.448 141.387 98.201  1.00 95.77  ?  253 MET A CG  1 
ATOM   404   S  SD  . MET A  1 80  ? 123.633 142.942 99.077  1.00 95.77  ?  253 MET A SD  1 
ATOM   405   C  CE  . MET A  1 80  ? 123.446 144.080 97.710  1.00 95.77  ?  253 MET A CE  1 
ATOM   406   N  N   . HIS A  1 81  ? 126.650 138.970 95.690  1.00 88.06  ?  254 HIS A N   1 
ATOM   407   C  CA  . HIS A  1 81  ? 127.729 138.820 94.723  1.00 88.06  ?  254 HIS A CA  1 
ATOM   408   C  C   . HIS A  1 81  ? 127.222 138.203 93.429  1.00 88.06  ?  254 HIS A C   1 
ATOM   409   O  O   . HIS A  1 81  ? 127.734 138.515 92.349  1.00 88.06  ?  254 HIS A O   1 
ATOM   410   C  CB  . HIS A  1 81  ? 128.856 137.973 95.309  1.00 88.06  ?  254 HIS A CB  1 
ATOM   411   C  CG  . HIS A  1 81  ? 130.051 137.868 94.417  1.00 88.06  ?  254 HIS A CG  1 
ATOM   412   N  ND1 . HIS A  1 81  ? 130.964 138.889 94.275  1.00 88.06  ?  254 HIS A ND1 1 
ATOM   413   C  CD2 . HIS A  1 81  ? 130.470 136.873 93.601  1.00 88.06  ?  254 HIS A CD2 1 
ATOM   414   C  CE1 . HIS A  1 81  ? 131.901 138.523 93.420  1.00 88.06  ?  254 HIS A CE1 1 
ATOM   415   N  NE2 . HIS A  1 81  ? 131.624 137.304 92.996  1.00 88.06  ?  254 HIS A NE2 1 
ATOM   416   N  N   . ALA A  1 82  ? 126.193 137.358 93.516  1.00 86.29  ?  255 ALA A N   1 
ATOM   417   C  CA  . ALA A  1 82  ? 125.576 136.817 92.312  1.00 86.29  ?  255 ALA A CA  1 
ATOM   418   C  C   . ALA A  1 82  ? 124.844 137.898 91.531  1.00 86.29  ?  255 ALA A C   1 
ATOM   419   O  O   . ALA A  1 82  ? 124.874 137.900 90.297  1.00 86.29  ?  255 ALA A O   1 
ATOM   420   C  CB  . ALA A  1 82  ? 124.622 135.684 92.675  1.00 86.29  ?  255 ALA A CB  1 
ATOM   421   N  N   . GLN A  1 83  ? 124.201 138.838 92.228  1.00 90.03  ?  256 GLN A N   1 
ATOM   422   C  CA  . GLN A  1 83  ? 123.519 139.932 91.543  1.00 90.03  ?  256 GLN A CA  1 
ATOM   423   C  C   . GLN A  1 83  ? 124.507 140.880 90.877  1.00 90.03  ?  256 GLN A C   1 
ATOM   424   O  O   . GLN A  1 83  ? 124.277 141.329 89.746  1.00 90.03  ?  256 GLN A O   1 
ATOM   425   C  CB  . GLN A  1 83  ? 122.631 140.696 92.522  1.00 90.03  ?  256 GLN A CB  1 
ATOM   426   C  CG  . GLN A  1 83  ? 121.405 139.933 92.965  1.00 90.03  ?  256 GLN A CG  1 
ATOM   427   C  CD  . GLN A  1 83  ? 120.533 140.740 93.902  1.00 90.03  ?  256 GLN A CD  1 
ATOM   428   O  OE1 . GLN A  1 83  ? 120.907 141.831 94.328  1.00 90.03  ?  256 GLN A OE1 1 
ATOM   429   N  NE2 . GLN A  1 83  ? 119.350 140.219 94.206  1.00 90.03  ?  256 GLN A NE2 1 
ATOM   430   N  N   . ILE A  1 84  ? 125.611 141.185 91.564  1.00 90.51  ?  257 ILE A N   1 
ATOM   431   C  CA  . ILE A  1 84  ? 126.656 142.023 90.984  1.00 90.51  ?  257 ILE A CA  1 
ATOM   432   C  C   . ILE A  1 84  ? 127.287 141.329 89.789  1.00 90.51  ?  257 ILE A C   1 
ATOM   433   O  O   . ILE A  1 84  ? 127.564 141.956 88.759  1.00 90.51  ?  257 ILE A O   1 
ATOM   434   C  CB  . ILE A  1 84  ? 127.704 142.365 92.055  1.00 90.51  ?  257 ILE A CB  1 
ATOM   435   C  CG1 . ILE A  1 84  ? 127.058 143.156 93.178  1.00 90.51  ?  257 ILE A CG1 1 
ATOM   436   C  CG2 . ILE A  1 84  ? 128.848 143.171 91.474  1.00 90.51  ?  257 ILE A CG2 1 
ATOM   437   C  CD1 . ILE A  1 84  ? 127.932 143.278 94.364  1.00 90.51  ?  257 ILE A CD1 1 
ATOM   438   N  N   . LYS A  1 85  ? 127.477 140.015 89.892  1.00 88.87  ?  258 LYS A N   1 
ATOM   439   C  CA  . LYS A  1 85  ? 128.080 139.260 88.807  1.00 88.87  ?  258 LYS A CA  1 
ATOM   440   C  C   . LYS A  1 85  ? 127.135 139.168 87.618  1.00 88.87  ?  258 LYS A C   1 
ATOM   441   O  O   . LYS A  1 85  ? 127.582 139.237 86.470  1.00 88.87  ?  258 LYS A O   1 
ATOM   442   C  CB  . LYS A  1 85  ? 128.477 137.880 89.332  1.00 88.87  ?  258 LYS A CB  1 
ATOM   443   C  CG  . LYS A  1 85  ? 129.439 137.101 88.469  1.00 88.87  ?  258 LYS A CG  1 
ATOM   444   C  CD  . LYS A  1 85  ? 129.912 135.862 89.212  1.00 88.87  ?  258 LYS A CD  1 
ATOM   445   C  CE  . LYS A  1 85  ? 130.937 135.092 88.408  1.00 88.87  ?  258 LYS A CE  1 
ATOM   446   N  NZ  . LYS A  1 85  ? 131.403 133.881 89.130  1.00 88.87  ?  258 LYS A NZ  1 
ATOM   447   N  N   . THR A  1 86  ? 125.826 139.103 87.879  1.00 90.42  ?  259 THR A N   1 
ATOM   448   C  CA  . THR A  1 86  ? 124.834 139.122 86.810  1.00 90.42  ?  259 THR A CA  1 
ATOM   449   C  C   . THR A  1 86  ? 124.818 140.470 86.101  1.00 90.42  ?  259 THR A C   1 
ATOM   450   O  O   . THR A  1 86  ? 124.807 140.535 84.866  1.00 90.42  ?  259 THR A O   1 
ATOM   451   C  CB  . THR A  1 86  ? 123.452 138.803 87.380  1.00 90.42  ?  259 THR A CB  1 
ATOM   452   O  OG1 . THR A  1 86  ? 123.487 137.537 88.045  1.00 90.42  ?  259 THR A OG1 1 
ATOM   453   C  CG2 . THR A  1 86  ? 122.417 138.744 86.273  1.00 90.42  ?  259 THR A CG2 1 
ATOM   454   N  N   . SER A  1 87  ? 124.842 141.561 86.874  1.00 94.71  ?  260 SER A N   1 
ATOM   455   C  CA  . SER A  1 87  ? 124.796 142.895 86.283  1.00 94.71  ?  260 SER A CA  1 
ATOM   456   C  C   . SER A  1 87  ? 126.063 143.202 85.493  1.00 94.71  ?  260 SER A C   1 
ATOM   457   O  O   . SER A  1 87  ? 125.999 143.796 84.411  1.00 94.71  ?  260 SER A O   1 
ATOM   458   C  CB  . SER A  1 87  ? 124.579 143.943 87.373  1.00 94.71  ?  260 SER A CB  1 
ATOM   459   O  OG  . SER A  1 87  ? 123.323 143.767 88.003  1.00 94.71  ?  260 SER A OG  1 
ATOM   460   N  N   . LEU A  1 88  ? 127.219 142.778 85.999  1.00 93.89  ?  261 LEU A N   1 
ATOM   461   C  CA  . LEU A  1 88  ? 128.458 143.007 85.272  1.00 93.89  ?  261 LEU A CA  1 
ATOM   462   C  C   . LEU A  1 88  ? 128.627 142.047 84.105  1.00 93.89  ?  261 LEU A C   1 
ATOM   463   O  O   . LEU A  1 88  ? 129.370 142.359 83.171  1.00 93.89  ?  261 LEU A O   1 
ATOM   464   C  CB  . LEU A  1 88  ? 129.645 142.921 86.227  1.00 93.89  ?  261 LEU A CB  1 
ATOM   465   C  CG  . LEU A  1 88  ? 129.675 144.102 87.198  1.00 93.89  ?  261 LEU A CG  1 
ATOM   466   C  CD1 . LEU A  1 88  ? 130.723 143.926 88.267  1.00 93.89  ?  261 LEU A CD1 1 
ATOM   467   C  CD2 . LEU A  1 88  ? 129.930 145.381 86.428  1.00 93.89  ?  261 LEU A CD2 1 
ATOM   468   N  N   . HIS A  1 89  ? 127.955 140.894 84.128  1.00 94.46  ?  262 HIS A N   1 
ATOM   469   C  CA  . HIS A  1 89  ? 127.898 140.066 82.932  1.00 94.46  ?  262 HIS A CA  1 
ATOM   470   C  C   . HIS A  1 89  ? 126.990 140.686 81.882  1.00 94.46  ?  262 HIS A C   1 
ATOM   471   O  O   . HIS A  1 89  ? 127.237 140.531 80.681  1.00 94.46  ?  262 HIS A O   1 
ATOM   472   C  CB  . HIS A  1 89  ? 127.424 138.656 83.288  1.00 94.46  ?  262 HIS A CB  1 
ATOM   473   C  CG  . HIS A  1 89  ? 127.371 137.723 82.119  1.00 94.46  ?  262 HIS A CG  1 
ATOM   474   N  ND1 . HIS A  1 89  ? 128.503 137.219 81.517  1.00 94.46  ?  262 HIS A ND1 1 
ATOM   475   C  CD2 . HIS A  1 89  ? 126.321 137.195 81.447  1.00 94.46  ?  262 HIS A CD2 1 
ATOM   476   C  CE1 . HIS A  1 89  ? 128.154 136.426 80.521  1.00 94.46  ?  262 HIS A CE1 1 
ATOM   477   N  NE2 . HIS A  1 89  ? 126.835 136.393 80.457  1.00 94.46  ?  262 HIS A NE2 1 
ATOM   478   N  N   . ARG A  1 90  ? 125.940 141.387 82.317  1.00 99.91  ?  263 ARG A N   1 
ATOM   479   C  CA  . ARG A  1 90  ? 125.102 142.126 81.378  1.00 99.91  ?  263 ARG A CA  1 
ATOM   480   C  C   . ARG A  1 90  ? 125.840 143.327 80.800  1.00 99.91  ?  263 ARG A C   1 
ATOM   481   O  O   . ARG A  1 90  ? 125.624 143.688 79.638  1.00 99.91  ?  263 ARG A O   1 
ATOM   482   C  CB  . ARG A  1 90  ? 123.809 142.575 82.059  1.00 99.91  ?  263 ARG A CB  1 
ATOM   483   C  CG  . ARG A  1 90  ? 122.858 141.440 82.396  1.00 99.91  ?  263 ARG A CG  1 
ATOM   484   C  CD  . ARG A  1 90  ? 121.640 141.941 83.153  1.00 99.91  ?  263 ARG A CD  1 
ATOM   485   N  NE  . ARG A  1 90  ? 120.806 142.817 82.338  1.00 99.91  ?  263 ARG A NE  1 
ATOM   486   C  CZ  . ARG A  1 90  ? 119.829 142.389 81.545  1.00 99.91  ?  263 ARG A CZ  1 
ATOM   487   N  NH1 . ARG A  1 90  ? 119.117 143.256 80.837  1.00 99.91  ?  263 ARG A NH1 1 
ATOM   488   N  NH2 . ARG A  1 90  ? 119.561 141.093 81.460  1.00 99.91  ?  263 ARG A NH2 1 
ATOM   489   N  N   . LEU A  1 91  ? 126.710 143.957 81.589  1.00 100.32 ?  264 LEU A N   1 
ATOM   490   C  CA  . LEU A  1 91  ? 127.516 145.061 81.072  1.00 100.32 ?  264 LEU A CA  1 
ATOM   491   C  C   . LEU A  1 91  ? 128.686 144.550 80.237  1.00 100.32 ?  264 LEU A C   1 
ATOM   492   O  O   . LEU A  1 91  ? 128.769 144.813 79.033  1.00 100.32 ?  264 LEU A O   1 
ATOM   493   C  CB  . LEU A  1 91  ? 128.025 145.926 82.224  1.00 100.32 ?  264 LEU A CB  1 
ATOM   494   C  CG  . LEU A  1 91  ? 128.935 147.066 81.767  1.00 100.32 ?  264 LEU A CG  1 
ATOM   495   C  CD1 . LEU A  1 91  ? 128.176 148.074 80.919  1.00 100.32 ?  264 LEU A CD1 1 
ATOM   496   C  CD2 . LEU A  1 91  ? 129.597 147.733 82.953  1.00 100.32 ?  264 LEU A CD2 1 
ATOM   497   N  N   . LYS A  1 92  ? 129.601 143.816 80.865  1.00 99.03  ?  265 LYS A N   1 
ATOM   498   C  CA  . LYS A  1 92  ? 130.792 143.307 80.196  1.00 99.03  ?  265 LYS A CA  1 
ATOM   499   C  C   . LYS A  1 92  ? 130.667 141.798 80.059  1.00 99.03  ?  265 LYS A C   1 
ATOM   500   O  O   . LYS A  1 92  ? 130.888 141.071 81.041  1.00 99.03  ?  265 LYS A O   1 
ATOM   501   C  CB  . LYS A  1 92  ? 132.051 143.678 80.976  1.00 99.03  ?  265 LYS A CB  1 
ATOM   502   C  CG  . LYS A  1 92  ? 132.298 145.178 81.059  1.00 99.03  ?  265 LYS A CG  1 
ATOM   503   C  CD  . LYS A  1 92  ? 133.601 145.500 81.777  1.00 99.03  ?  265 LYS A CD  1 
ATOM   504   C  CE  . LYS A  1 92  ? 133.494 145.265 83.274  1.00 99.03  ?  265 LYS A CE  1 
ATOM   505   N  NZ  . LYS A  1 92  ? 132.566 146.230 83.921  1.00 99.03  ?  265 LYS A NZ  1 
ATOM   506   N  N   . PRO A  1 93  ? 130.318 141.281 78.879  1.00 100.53 ?  266 PRO A N   1 
ATOM   507   C  CA  . PRO A  1 93  ? 129.950 139.861 78.786  1.00 100.53 ?  266 PRO A CA  1 
ATOM   508   C  C   . PRO A  1 93  ? 131.127 138.901 78.852  1.00 100.53 ?  266 PRO A C   1 
ATOM   509   O  O   . PRO A  1 93  ? 131.018 137.847 79.488  1.00 100.53 ?  266 PRO A O   1 
ATOM   510   C  CB  . PRO A  1 93  ? 129.232 139.781 77.432  1.00 100.53 ?  266 PRO A CB  1 
ATOM   511   C  CG  . PRO A  1 93  ? 129.811 140.896 76.634  1.00 100.53 ?  266 PRO A CG  1 
ATOM   512   C  CD  . PRO A  1 93  ? 130.112 141.998 77.609  1.00 100.53 ?  266 PRO A CD  1 
ATOM   513   N  N   . ASP A  1 94  ? 132.253 139.235 78.225  1.00 104.30 ?  267 ASP A N   1 
ATOM   514   C  CA  . ASP A  1 94  ? 133.356 138.296 78.071  1.00 104.30 ?  267 ASP A CA  1 
ATOM   515   C  C   . ASP A  1 94  ? 134.449 138.481 79.116  1.00 104.30 ?  267 ASP A C   1 
ATOM   516   O  O   . ASP A  1 94  ? 135.429 137.732 79.119  1.00 104.30 ?  267 ASP A O   1 
ATOM   517   C  CB  . ASP A  1 94  ? 133.952 138.399 76.667  1.00 104.30 ?  267 ASP A CB  1 
ATOM   518   C  CG  . ASP A  1 94  ? 133.009 137.883 75.598  1.00 104.30 ?  267 ASP A CG  1 
ATOM   519   O  OD1 . ASP A  1 94  ? 132.187 136.995 75.908  1.00 104.30 ?  267 ASP A OD1 1 
ATOM   520   O  OD2 . ASP A  1 94  ? 133.088 138.362 74.448  1.00 104.30 ?  267 ASP A OD2 1 
ATOM   521   N  N   . THR A  1 95  ? 134.308 139.461 80.003  1.00 99.12  ?  268 THR A N   1 
ATOM   522   C  CA  . THR A  1 95  ? 135.247 139.597 81.108  1.00 99.12  ?  268 THR A CA  1 
ATOM   523   C  C   . THR A  1 95  ? 134.682 138.917 82.345  1.00 99.12  ?  268 THR A C   1 
ATOM   524   O  O   . THR A  1 95  ? 135.346 138.080 82.964  1.00 99.12  ?  268 THR A O   1 
ATOM   525   C  CB  . THR A  1 95  ? 135.544 141.067 81.393  1.00 99.12  ?  268 THR A CB  1 
ATOM   526   O  OG1 . THR A  1 95  ? 136.120 141.672 80.229  1.00 99.12  ?  268 THR A OG1 1 
ATOM   527   C  CG2 . THR A  1 95  ? 136.514 141.194 82.556  1.00 99.12  ?  268 THR A CG2 1 
ATOM   528   N  N   . VAL A  1 96  ? 133.451 139.260 82.701  1.00 95.44  ?  269 VAL A N   1 
ATOM   529   C  CA  . VAL A  1 96  ? 132.793 138.690 83.871  1.00 95.44  ?  269 VAL A CA  1 
ATOM   530   C  C   . VAL A  1 96  ? 131.961 137.492 83.431  1.00 95.44  ?  269 VAL A C   1 
ATOM   531   O  O   . VAL A  1 96  ? 131.161 137.607 82.493  1.00 95.44  ?  269 VAL A O   1 
ATOM   532   C  CB  . VAL A  1 96  ? 131.923 139.739 84.576  1.00 95.44  ?  269 VAL A CB  1 
ATOM   533   C  CG1 . VAL A  1 96  ? 131.183 139.120 85.746  1.00 95.44  ?  269 VAL A CG1 1 
ATOM   534   C  CG2 . VAL A  1 96  ? 132.775 140.911 85.022  1.00 95.44  ?  269 VAL A CG2 1 
ATOM   535   N  N   . PRO A  1 97  ? 132.118 136.331 84.059  1.00 89.36  ?  270 PRO A N   1 
ATOM   536   C  CA  . PRO A  1 97  ? 131.313 135.169 83.677  1.00 89.36  ?  270 PRO A CA  1 
ATOM   537   C  C   . PRO A  1 97  ? 129.959 135.156 84.366  1.00 89.36  ?  270 PRO A C   1 
ATOM   538   O  O   . PRO A  1 97  ? 129.752 135.789 85.403  1.00 89.36  ?  270 PRO A O   1 
ATOM   539   C  CB  . PRO A  1 97  ? 132.173 133.989 84.143  1.00 89.36  ?  270 PRO A CB  1 
ATOM   540   C  CG  . PRO A  1 97  ? 132.908 134.530 85.315  1.00 89.36  ?  270 PRO A CG  1 
ATOM   541   C  CD  . PRO A  1 97  ? 133.180 135.978 85.016  1.00 89.36  ?  270 PRO A CD  1 
ATOM   542   N  N   . ALA A  1 98  ? 129.027 134.427 83.759  1.00 81.00  ?  271 ALA A N   1 
ATOM   543   C  CA  . ALA A  1 98  ? 127.730 134.190 84.365  1.00 81.00  ?  271 ALA A CA  1 
ATOM   544   C  C   . ALA A  1 98  ? 127.891 133.293 85.592  1.00 81.00  ?  271 ALA A C   1 
ATOM   545   O  O   . ALA A  1 98  ? 128.828 132.495 85.660  1.00 81.00  ?  271 ALA A O   1 
ATOM   546   C  CB  . ALA A  1 98  ? 126.792 133.541 83.348  1.00 81.00  ?  271 ALA A CB  1 
ATOM   547   N  N   . PRO A  1 99  ? 127.007 133.417 86.584  1.00 72.21  ?  272 PRO A N   1 
ATOM   548   C  CA  . PRO A  1 99  ? 127.117 132.558 87.770  1.00 72.21  ?  272 PRO A CA  1 
ATOM   549   C  C   . PRO A  1 99  ? 126.748 131.113 87.463  1.00 72.21  ?  272 PRO A C   1 
ATOM   550   O  O   . PRO A  1 99  ? 125.939 130.822 86.580  1.00 72.21  ?  272 PRO A O   1 
ATOM   551   C  CB  . PRO A  1 99  ? 126.135 133.194 88.757  1.00 72.21  ?  272 PRO A CB  1 
ATOM   552   C  CG  . PRO A  1 99  ? 125.175 133.914 87.918  1.00 72.21  ?  272 PRO A CG  1 
ATOM   553   C  CD  . PRO A  1 99  ? 125.950 134.427 86.752  1.00 72.21  ?  272 PRO A CD  1 
ATOM   554   N  N   . CYS A  1 100 ? 127.366 130.199 88.207  1.00 64.57  ?  273 CYS A N   1 
ATOM   555   C  CA  . CYS A  1 100 ? 127.186 128.767 88.022  1.00 64.57  ?  273 CYS A CA  1 
ATOM   556   C  C   . CYS A  1 100 ? 126.250 128.188 89.076  1.00 64.57  ?  273 CYS A C   1 
ATOM   557   O  O   . CYS A  1 100 ? 126.085 128.730 90.171  1.00 64.57  ?  273 CYS A O   1 
ATOM   558   C  CB  . CYS A  1 100 ? 128.531 128.035 88.076  1.00 64.57  ?  273 CYS A CB  1 
ATOM   559   S  SG  . CYS A  1 100 ? 129.635 128.309 86.674  1.00 64.57  ?  273 CYS A SG  1 
ATOM   560   N  N   . CYS A  1 101 ? 125.643 127.056 88.725  1.00 54.69  ?  274 CYS A N   1 
ATOM   561   C  CA  . CYS A  1 101 ? 124.780 126.289 89.615  1.00 54.69  ?  274 CYS A CA  1 
ATOM   562   C  C   . CYS A  1 101 ? 125.628 125.303 90.406  1.00 54.69  ?  274 CYS A C   1 
ATOM   563   O  O   . CYS A  1 101 ? 126.112 124.313 89.855  1.00 54.69  ?  274 CYS A O   1 
ATOM   564   C  CB  . CYS A  1 101 ? 123.706 125.556 88.809  1.00 54.69  ?  274 CYS A CB  1 
ATOM   565   S  SG  . CYS A  1 101 ? 122.690 124.362 89.717  1.00 54.69  ?  274 CYS A SG  1 
ATOM   566   N  N   . VAL A  1 102 ? 125.820 125.577 91.694  1.00 41.72  ?  275 VAL A N   1 
ATOM   567   C  CA  . VAL A  1 102 ? 126.686 124.741 92.523  1.00 41.72  ?  275 VAL A CA  1 
ATOM   568   C  C   . VAL A  1 102 ? 125.886 124.203 93.708  1.00 41.72  ?  275 VAL A C   1 
ATOM   569   O  O   . VAL A  1 102 ? 124.816 124.748 94.025  1.00 41.72  ?  275 VAL A O   1 
ATOM   570   C  CB  . VAL A  1 102 ? 127.920 125.521 93.003  1.00 41.72  ?  275 VAL A CB  1 
ATOM   571   C  CG1 . VAL A  1 102 ? 128.690 126.109 91.834  1.00 41.72  ?  275 VAL A CG1 1 
ATOM   572   C  CG2 . VAL A  1 102 ? 127.535 126.557 94.016  1.00 41.72  ?  275 VAL A CG2 1 
ATOM   573   N  N   . PRO A  1 103 ? 126.337 123.131 94.364  1.00 33.98  ?  276 PRO A N   1 
ATOM   574   C  CA  . PRO A  1 103 ? 125.613 122.641 95.542  1.00 33.98  ?  276 PRO A CA  1 
ATOM   575   C  C   . PRO A  1 103 ? 125.788 123.534 96.755  1.00 33.98  ?  276 PRO A C   1 
ATOM   576   O  O   . PRO A  1 103 ? 126.763 124.277 96.872  1.00 33.98  ?  276 PRO A O   1 
ATOM   577   C  CB  . PRO A  1 103 ? 126.230 121.263 95.781  1.00 33.98  ?  276 PRO A CB  1 
ATOM   578   C  CG  . PRO A  1 103 ? 126.738 120.856 94.471  1.00 33.98  ?  276 PRO A CG  1 
ATOM   579   C  CD  . PRO A  1 103 ? 127.237 122.094 93.831  1.00 33.98  ?  276 PRO A CD  1 
ATOM   580   N  N   . ALA A  1 104 ? 124.824 123.439 97.669  1.00 35.63  ?  277 ALA A N   1 
ATOM   581   C  CA  . ALA A  1 104 ? 124.842 124.151 98.939  1.00 35.63  ?  277 ALA A CA  1 
ATOM   582   C  C   . ALA A  1 104 ? 125.293 123.265 100.090 1.00 35.63  ?  277 ALA A C   1 
ATOM   583   O  O   . ALA A  1 104 ? 126.245 123.602 100.798 1.00 35.63  ?  277 ALA A O   1 
ATOM   584   C  CB  . ALA A  1 104 ? 123.451 124.712 99.246  1.00 35.63  ?  277 ALA A CB  1 
ATOM   585   N  N   . SER A  1 105 ? 124.613 122.143 100.297 1.00 37.16  ?  278 SER A N   1 
ATOM   586   C  CA  . SER A  1 105 ? 124.976 121.177 101.320 1.00 37.16  ?  278 SER A CA  1 
ATOM   587   C  C   . SER A  1 105 ? 125.100 119.807 100.674 1.00 37.16  ?  278 SER A C   1 
ATOM   588   O  O   . SER A  1 105 ? 124.550 119.557 99.600  1.00 37.16  ?  278 SER A O   1 
ATOM   589   C  CB  . SER A  1 105 ? 123.946 121.142 102.453 1.00 37.16  ?  278 SER A CB  1 
ATOM   590   O  OG  . SER A  1 105 ? 122.692 120.684 101.980 1.00 37.16  ?  278 SER A OG  1 
ATOM   591   N  N   . TYR A  1 106 ? 125.826 118.915 101.338 1.00 32.30  ?  279 TYR A N   1 
ATOM   592   C  CA  . TYR A  1 106 ? 126.153 117.620 100.766 1.00 32.30  ?  279 TYR A CA  1 
ATOM   593   C  C   . TYR A  1 106 ? 125.644 116.487 101.645 1.00 32.30  ?  279 TYR A C   1 
ATOM   594   O  O   . TYR A  1 106 ? 125.551 116.622 102.868 1.00 32.30  ?  279 TYR A O   1 
ATOM   595   C  CB  . TYR A  1 106 ? 127.662 117.482 100.560 1.00 32.30  ?  279 TYR A CB  1 
ATOM   596   C  CG  . TYR A  1 106 ? 128.207 118.372 99.473  1.00 32.30  ?  279 TYR A CG  1 
ATOM   597   C  CD1 . TYR A  1 106 ? 128.061 118.029 98.138  1.00 32.30  ?  279 TYR A CD1 1 
ATOM   598   C  CD2 . TYR A  1 106 ? 128.880 119.545 99.780  1.00 32.30  ?  279 TYR A CD2 1 
ATOM   599   C  CE1 . TYR A  1 106 ? 128.560 118.829 97.142  1.00 32.30  ?  279 TYR A CE1 1 
ATOM   600   C  CE2 . TYR A  1 106 ? 129.382 120.353 98.786  1.00 32.30  ?  279 TYR A CE2 1 
ATOM   601   C  CZ  . TYR A  1 106 ? 129.214 119.988 97.472  1.00 32.30  ?  279 TYR A CZ  1 
ATOM   602   O  OH  . TYR A  1 106 ? 129.709 120.780 96.472  1.00 32.30  ?  279 TYR A OH  1 
ATOM   603   N  N   . ASN A  1 107 ? 125.316 115.365 101.004 1.00 31.48  ?  280 ASN A N   1 
ATOM   604   C  CA  . ASN A  1 107 ? 124.950 114.137 101.692 1.00 31.48  ?  280 ASN A CA  1 
ATOM   605   C  C   . ASN A  1 107 ? 126.113 113.157 101.655 1.00 31.48  ?  280 ASN A C   1 
ATOM   606   O  O   . ASN A  1 107 ? 126.735 112.981 100.603 1.00 31.48  ?  280 ASN A O   1 
ATOM   607   C  CB  . ASN A  1 107 ? 123.721 113.484 101.059 1.00 31.48  ?  280 ASN A CB  1 
ATOM   608   C  CG  . ASN A  1 107 ? 122.441 114.213 101.389 1.00 31.48  ?  280 ASN A CG  1 
ATOM   609   O  OD1 . ASN A  1 107 ? 122.236 114.643 102.522 1.00 31.48  ?  280 ASN A OD1 1 
ATOM   610   N  ND2 . ASN A  1 107 ? 121.568 114.351 100.401 1.00 31.48  ?  280 ASN A ND2 1 
ATOM   611   N  N   . PRO A  1 108 ? 126.432 112.511 102.773 1.00 26.59  ?  281 PRO A N   1 
ATOM   612   C  CA  . PRO A  1 108 ? 127.527 111.538 102.777 1.00 26.59  ?  281 PRO A CA  1 
ATOM   613   C  C   . PRO A  1 108 ? 127.151 110.254 102.056 1.00 26.59  ?  281 PRO A C   1 
ATOM   614   O  O   . PRO A  1 108 ? 125.985 110.012 101.740 1.00 26.59  ?  281 PRO A O   1 
ATOM   615   C  CB  . PRO A  1 108 ? 127.764 111.287 104.270 1.00 26.59  ?  281 PRO A CB  1 
ATOM   616   C  CG  . PRO A  1 108 ? 126.456 111.567 104.901 1.00 26.59  ?  281 PRO A CG  1 
ATOM   617   C  CD  . PRO A  1 108 ? 125.841 112.682 104.110 1.00 26.59  ?  281 PRO A CD  1 
ATOM   618   N  N   . MET A  1 109 ? 128.157 109.428 101.782 1.00 27.49  ?  282 MET A N   1 
ATOM   619   C  CA  . MET A  1 109 ? 127.912 108.133 101.167 1.00 27.49  ?  282 MET A CA  1 
ATOM   620   C  C   . MET A  1 109 ? 128.931 107.134 101.693 1.00 27.49  ?  282 MET A C   1 
ATOM   621   O  O   . MET A  1 109 ? 130.100 107.465 101.898 1.00 27.49  ?  282 MET A O   1 
ATOM   622   C  CB  . MET A  1 109 ? 127.964 108.219 99.635  1.00 27.49  ?  282 MET A CB  1 
ATOM   623   C  CG  . MET A  1 109 ? 127.545 106.945 98.917  1.00 27.49  ?  282 MET A CG  1 
ATOM   624   S  SD  . MET A  1 109 ? 127.441 107.119 97.129  1.00 27.49  ?  282 MET A SD  1 
ATOM   625   C  CE  . MET A  1 109 ? 127.035 105.449 96.637  1.00 27.49  ?  282 MET A CE  1 
ATOM   626   N  N   . VAL A  1 110 ? 128.472 105.907 101.925 1.00 31.05  ?  283 VAL A N   1 
ATOM   627   C  CA  . VAL A  1 110 ? 129.294 104.837 102.477 1.00 31.05  ?  283 VAL A CA  1 
ATOM   628   C  C   . VAL A  1 110 ? 129.768 103.960 101.332 1.00 31.05  ?  283 VAL A C   1 
ATOM   629   O  O   . VAL A  1 110 ? 128.963 103.514 100.507 1.00 31.05  ?  283 VAL A O   1 
ATOM   630   C  CB  . VAL A  1 110 ? 128.526 104.016 103.521 1.00 31.05  ?  283 VAL A CB  1 
ATOM   631   C  CG1 . VAL A  1 110 ? 129.311 102.790 103.934 1.00 31.05  ?  283 VAL A CG1 1 
ATOM   632   C  CG2 . VAL A  1 110 ? 128.271 104.861 104.722 1.00 31.05  ?  283 VAL A CG2 1 
ATOM   633   N  N   . LEU A  1 111 ? 131.072 103.724 101.277 1.00 30.15  ?  284 LEU A N   1 
ATOM   634   C  CA  . LEU A  1 111 ? 131.676 102.842 100.294 1.00 30.15  ?  284 LEU A CA  1 
ATOM   635   C  C   . LEU A  1 111 ? 132.411 101.723 101.017 1.00 30.15  ?  284 LEU A C   1 
ATOM   636   O  O   . LEU A  1 111 ? 132.730 101.837 102.206 1.00 30.15  ?  284 LEU A O   1 
ATOM   637   C  CB  . LEU A  1 111 ? 132.632 103.607 99.371  1.00 30.15  ?  284 LEU A CB  1 
ATOM   638   C  CG  . LEU A  1 111 ? 132.061 104.366 98.167  1.00 30.15  ?  284 LEU A CG  1 
ATOM   639   C  CD1 . LEU A  1 111 ? 131.291 105.620 98.546  1.00 30.15  ?  284 LEU A CD1 1 
ATOM   640   C  CD2 . LEU A  1 111 ? 133.177 104.725 97.216  1.00 30.15  ?  284 LEU A CD2 1 
ATOM   641   N  N   . ILE A  1 112 ? 132.659 100.633 100.298 1.00 37.80  ?  285 ILE A N   1 
ATOM   642   C  CA  . ILE A  1 112 ? 133.366 99.485  100.852 1.00 37.80  ?  285 ILE A CA  1 
ATOM   643   C  C   . ILE A  1 112 ? 134.704 99.350  100.140 1.00 37.80  ?  285 ILE A C   1 
ATOM   644   O  O   . ILE A  1 112 ? 134.758 99.217  98.911  1.00 37.80  ?  285 ILE A O   1 
ATOM   645   C  CB  . ILE A  1 112 ? 132.521 98.211  100.743 1.00 37.80  ?  285 ILE A CB  1 
ATOM   646   C  CG1 . ILE A  1 112 ? 131.360 98.277  101.733 1.00 37.80  ?  285 ILE A CG1 1 
ATOM   647   C  CG2 . ILE A  1 112 ? 133.352 96.985  100.987 1.00 37.80  ?  285 ILE A CG2 1 
ATOM   648   C  CD1 . ILE A  1 112 ? 130.395 97.131  101.625 1.00 37.80  ?  285 ILE A CD1 1 
ATOM   649   N  N   . GLN A  1 113 ? 135.785 99.376  100.913 1.00 36.91  ?  286 GLN A N   1 
ATOM   650   C  CA  . GLN A  1 113 ? 137.136 99.498  100.393 1.00 36.91  ?  286 GLN A CA  1 
ATOM   651   C  C   . GLN A  1 113 ? 137.928 98.217  100.607 1.00 36.91  ?  286 GLN A C   1 
ATOM   652   O  O   . GLN A  1 113 ? 137.871 97.605  101.680 1.00 36.91  ?  286 GLN A O   1 
ATOM   653   C  CB  . GLN A  1 113 ? 137.862 100.653 101.074 1.00 36.91  ?  286 GLN A CB  1 
ATOM   654   C  CG  . GLN A  1 113 ? 137.279 102.003 100.789 1.00 36.91  ?  286 GLN A CG  1 
ATOM   655   C  CD  . GLN A  1 113 ? 137.960 103.083 101.584 1.00 36.91  ?  286 GLN A CD  1 
ATOM   656   O  OE1 . GLN A  1 113 ? 138.840 102.807 102.398 1.00 36.91  ?  286 GLN A OE1 1 
ATOM   657   N  NE2 . GLN A  1 113 ? 137.545 104.322 101.373 1.00 36.91  ?  286 GLN A NE2 1 
ATOM   658   N  N   . LYS A  1 114 ? 138.683 97.832  99.580  1.00 36.70  ?  287 LYS A N   1 
ATOM   659   C  CA  . LYS A  1 114 ? 139.634 96.727  99.667  1.00 36.70  ?  287 LYS A CA  1 
ATOM   660   C  C   . LYS A  1 114 ? 140.971 97.263  100.169 1.00 36.70  ?  287 LYS A C   1 
ATOM   661   O  O   . LYS A  1 114 ? 141.853 97.616  99.386  1.00 36.70  ?  287 LYS A O   1 
ATOM   662   C  CB  . LYS A  1 114 ? 139.792 96.050  98.312  1.00 36.70  ?  287 LYS A CB  1 
ATOM   663   C  CG  . LYS A  1 114 ? 138.581 95.279  97.844  1.00 36.70  ?  287 LYS A CG  1 
ATOM   664   C  CD  . LYS A  1 114 ? 138.798 94.766  96.434  1.00 36.70  ?  287 LYS A CD  1 
ATOM   665   C  CE  . LYS A  1 114 ? 139.863 93.683  96.410  1.00 36.70  ?  287 LYS A CE  1 
ATOM   666   N  NZ  . LYS A  1 114 ? 140.036 93.100  95.052  1.00 36.70  ?  287 LYS A NZ  1 
ATOM   667   N  N   . THR A  1 115 ? 141.121 97.315  101.486 1.00 42.20  ?  288 THR A N   1 
ATOM   668   C  CA  . THR A  1 115 ? 142.327 97.856  102.084 1.00 42.20  ?  288 THR A CA  1 
ATOM   669   C  C   . THR A  1 115 ? 143.430 96.799  102.105 1.00 42.20  ?  288 THR A C   1 
ATOM   670   O  O   . THR A  1 115 ? 143.320 95.727  101.503 1.00 42.20  ?  288 THR A O   1 
ATOM   671   C  CB  . THR A  1 115 ? 142.041 98.366  103.496 1.00 42.20  ?  288 THR A CB  1 
ATOM   672   O  OG1 . THR A  1 115 ? 141.640 97.271  104.326 1.00 42.20  ?  288 THR A OG1 1 
ATOM   673   C  CG2 . THR A  1 115 ? 140.930 99.395  103.470 1.00 42.20  ?  288 THR A CG2 1 
ATOM   674   N  N   . ASP A  1 116 ? 144.514 97.111  102.816 1.00 48.96  ?  289 ASP A N   1 
ATOM   675   C  CA  . ASP A  1 116 ? 145.632 96.180  102.904 1.00 48.96  ?  289 ASP A CA  1 
ATOM   676   C  C   . ASP A  1 116 ? 145.312 95.029  103.851 1.00 48.96  ?  289 ASP A C   1 
ATOM   677   O  O   . ASP A  1 116 ? 145.684 93.881  103.586 1.00 48.96  ?  289 ASP A O   1 
ATOM   678   C  CB  . ASP A  1 116 ? 146.886 96.930  103.358 1.00 48.96  ?  289 ASP A CB  1 
ATOM   679   C  CG  . ASP A  1 116 ? 148.171 96.164  103.085 1.00 48.96  ?  289 ASP A CG  1 
ATOM   680   O  OD1 . ASP A  1 116 ? 148.114 95.046  102.532 1.00 48.96  ?  289 ASP A OD1 1 
ATOM   681   O  OD2 . ASP A  1 116 ? 149.251 96.693  103.421 1.00 48.96  ?  289 ASP A OD2 1 
ATOM   682   N  N   . THR A  1 117 ? 144.608 95.313  104.944 1.00 49.55  ?  290 THR A N   1 
ATOM   683   C  CA  . THR A  1 117 ? 144.271 94.314  105.951 1.00 49.55  ?  290 THR A CA  1 
ATOM   684   C  C   . THR A  1 117 ? 142.921 93.653  105.695 1.00 49.55  ?  290 THR A C   1 
ATOM   685   O  O   . THR A  1 117 ? 142.344 93.055  106.607 1.00 49.55  ?  290 THR A O   1 
ATOM   686   C  CB  . THR A  1 117 ? 144.276 94.940  107.344 1.00 49.55  ?  290 THR A CB  1 
ATOM   687   O  OG1 . THR A  1 117 ? 143.280 95.967  107.410 1.00 49.55  ?  290 THR A OG1 1 
ATOM   688   C  CG2 . THR A  1 117 ? 145.637 95.543  107.650 1.00 49.55  ?  290 THR A CG2 1 
ATOM   689   N  N   . GLY A  1 118 ? 142.397 93.751  104.479 1.00 43.99  ?  291 GLY A N   1 
ATOM   690   C  CA  . GLY A  1 118 ? 141.153 93.092  104.152 1.00 43.99  ?  291 GLY A CA  1 
ATOM   691   C  C   . GLY A  1 118 ? 140.142 94.050  103.558 1.00 43.99  ?  291 GLY A C   1 
ATOM   692   O  O   . GLY A  1 118 ? 140.422 94.747  102.583 1.00 43.99  ?  291 GLY A O   1 
ATOM   693   N  N   . VAL A  1 119 ? 138.952 94.074  104.150 1.00 43.60  ?  292 VAL A N   1 
ATOM   694   C  CA  . VAL A  1 119 ? 137.802 94.801  103.619 1.00 43.60  ?  292 VAL A CA  1 
ATOM   695   C  C   . VAL A  1 119 ? 137.225 95.657  104.741 1.00 43.60  ?  292 VAL A C   1 
ATOM   696   O  O   . VAL A  1 119 ? 136.998 95.161  105.849 1.00 43.60  ?  292 VAL A O   1 
ATOM   697   C  CB  . VAL A  1 119 ? 136.748 93.827  103.056 1.00 43.60  ?  292 VAL A CB  1 
ATOM   698   C  CG1 . VAL A  1 119 ? 135.466 94.539  102.727 1.00 43.60  ?  292 VAL A CG1 1 
ATOM   699   C  CG2 . VAL A  1 119 ? 137.271 93.120  101.810 1.00 43.60  ?  292 VAL A CG2 1 
ATOM   700   N  N   . SER A  1 120 ? 136.992 96.942  104.467 1.00 40.56  ?  293 SER A N   1 
ATOM   701   C  CA  . SER A  1 120 ? 136.482 97.861  105.480 1.00 40.56  ?  293 SER A CA  1 
ATOM   702   C  C   . SER A  1 120 ? 135.415 98.771  104.882 1.00 40.56  ?  293 SER A C   1 
ATOM   703   O  O   . SER A  1 120 ? 135.244 98.833  103.663 1.00 40.56  ?  293 SER A O   1 
ATOM   704   C  CB  . SER A  1 120 ? 137.610 98.697  106.088 1.00 40.56  ?  293 SER A CB  1 
ATOM   705   O  OG  . SER A  1 120 ? 137.106 99.583  107.072 1.00 40.56  ?  293 SER A OG  1 
ATOM   706   N  N   . LEU A  1 121 ? 134.679 99.458  105.753 1.00 37.13  ?  294 LEU A N   1 
ATOM   707   C  CA  . LEU A  1 121 ? 133.616 100.373 105.345 1.00 37.13  ?  294 LEU A CA  1 
ATOM   708   C  C   . LEU A  1 121 ? 134.005 101.801 105.707 1.00 37.13  ?  294 LEU A C   1 
ATOM   709   O  O   . LEU A  1 121 ? 134.293 102.093 106.873 1.00 37.13  ?  294 LEU A O   1 
ATOM   710   C  CB  . LEU A  1 121 ? 132.290 100.005 106.009 1.00 37.13  ?  294 LEU A CB  1 
ATOM   711   C  CG  . LEU A  1 121 ? 131.393 98.913  105.418 1.00 37.13  ?  294 LEU A CG  1 
ATOM   712   C  CD1 . LEU A  1 121 ? 131.944 97.517  105.638 1.00 37.13  ?  294 LEU A CD1 1 
ATOM   713   C  CD2 . LEU A  1 121 ? 129.998 99.027  106.002 1.00 37.13  ?  294 LEU A CD2 1 
ATOM   714   N  N   . GLN A  1 122 ? 133.998 102.692 104.719 1.00 33.22  ?  295 GLN A N   1 
ATOM   715   C  CA  . GLN A  1 122 ? 134.283 104.101 104.945 1.00 33.22  ?  295 GLN A CA  1 
ATOM   716   C  C   . GLN A  1 122 ? 133.085 104.966 104.583 1.00 33.22  ?  295 GLN A C   1 
ATOM   717   O  O   . GLN A  1 122 ? 132.220 104.574 103.796 1.00 33.22  ?  295 GLN A O   1 
ATOM   718   C  CB  . GLN A  1 122 ? 135.508 104.562 104.149 1.00 33.22  ?  295 GLN A CB  1 
ATOM   719   C  CG  . GLN A  1 122 ? 136.840 104.131 104.736 1.00 33.22  ?  295 GLN A CG  1 
ATOM   720   C  CD  . GLN A  1 122 ? 137.128 104.794 106.066 1.00 33.22  ?  295 GLN A CD  1 
ATOM   721   O  OE1 . GLN A  1 122 ? 137.108 104.149 107.112 1.00 33.22  ?  295 GLN A OE1 1 
ATOM   722   N  NE2 . GLN A  1 122 ? 137.396 106.093 106.033 1.00 33.22  ?  295 GLN A NE2 1 
ATOM   723   N  N   . THR A  1 123 ? 133.051 106.156 105.177 1.00 28.54  ?  296 THR A N   1 
ATOM   724   C  CA  . THR A  1 123 ? 132.022 107.158 104.931 1.00 28.54  ?  296 THR A CA  1 
ATOM   725   C  C   . THR A  1 123 ? 132.688 108.414 104.392 1.00 28.54  ?  296 THR A C   1 
ATOM   726   O  O   . THR A  1 123 ? 133.525 109.013 105.074 1.00 28.54  ?  296 THR A O   1 
ATOM   727   C  CB  . THR A  1 123 ? 131.253 107.480 106.212 1.00 28.54  ?  296 THR A CB  1 
ATOM   728   O  OG1 . THR A  1 123 ? 130.615 106.295 106.701 1.00 28.54  ?  296 THR A OG1 1 
ATOM   729   C  CG2 . THR A  1 123 ? 130.210 108.548 105.947 1.00 28.54  ?  296 THR A CG2 1 
ATOM   730   N  N   . TYR A  1 124 ? 132.318 108.816 103.181 1.00 27.54  ?  297 TYR A N   1 
ATOM   731   C  CA  . TYR A  1 124 ? 132.875 110.006 102.550 1.00 27.54  ?  297 TYR A CA  1 
ATOM   732   C  C   . TYR A  1 124 ? 131.877 111.147 102.685 1.00 27.54  ?  297 TYR A C   1 
ATOM   733   O  O   . TYR A  1 124 ? 130.688 110.977 102.391 1.00 27.54  ?  297 TYR A O   1 
ATOM   734   C  CB  . TYR A  1 124 ? 133.223 109.740 101.089 1.00 27.54  ?  297 TYR A CB  1 
ATOM   735   C  CG  . TYR A  1 124 ? 134.443 108.865 100.911 1.00 27.54  ?  297 TYR A CG  1 
ATOM   736   C  CD1 . TYR A  1 124 ? 135.313 108.625 101.968 1.00 27.54  ?  297 TYR A CD1 1 
ATOM   737   C  CD2 . TYR A  1 124 ? 134.731 108.289 99.685  1.00 27.54  ?  297 TYR A CD2 1 
ATOM   738   C  CE1 . TYR A  1 124 ? 136.426 107.833 101.809 1.00 27.54  ?  297 TYR A CE1 1 
ATOM   739   C  CE2 . TYR A  1 124 ? 135.848 107.495 99.515  1.00 27.54  ?  297 TYR A CE2 1 
ATOM   740   C  CZ  . TYR A  1 124 ? 136.689 107.274 100.581 1.00 27.54  ?  297 TYR A CZ  1 
ATOM   741   O  OH  . TYR A  1 124 ? 137.800 106.485 100.423 1.00 27.54  ?  297 TYR A OH  1 
ATOM   742   N  N   . ASP A  1 125 ? 132.373 112.311 103.115 1.00 29.81  ?  298 ASP A N   1 
ATOM   743   C  CA  . ASP A  1 125 ? 131.525 113.373 103.645 1.00 29.81  ?  298 ASP A CA  1 
ATOM   744   C  C   . ASP A  1 125 ? 131.072 114.371 102.591 1.00 29.81  ?  298 ASP A C   1 
ATOM   745   O  O   . ASP A  1 125 ? 130.286 115.268 102.909 1.00 29.81  ?  298 ASP A O   1 
ATOM   746   C  CB  . ASP A  1 125 ? 132.271 114.114 104.753 1.00 29.81  ?  298 ASP A CB  1 
ATOM   747   C  CG  . ASP A  1 125 ? 132.517 113.247 105.968 1.00 29.81  ?  298 ASP A CG  1 
ATOM   748   O  OD1 . ASP A  1 125 ? 131.693 112.348 106.237 1.00 29.81  ?  298 ASP A OD1 1 
ATOM   749   O  OD2 . ASP A  1 125 ? 133.539 113.459 106.653 1.00 29.81  ?  298 ASP A OD2 1 
ATOM   750   N  N   . ASP A  1 126 ? 131.559 114.259 101.361 1.00 34.28  ?  299 ASP A N   1 
ATOM   751   C  CA  . ASP A  1 126 ? 131.302 115.292 100.368 1.00 34.28  ?  299 ASP A CA  1 
ATOM   752   C  C   . ASP A  1 126 ? 130.985 114.706 99.001  1.00 34.28  ?  299 ASP A C   1 
ATOM   753   O  O   . ASP A  1 126 ? 131.505 115.182 97.988  1.00 34.28  ?  299 ASP A O   1 
ATOM   754   C  CB  . ASP A  1 126 ? 132.506 116.236 100.296 1.00 34.28  ?  299 ASP A CB  1 
ATOM   755   C  CG  . ASP A  1 126 ? 133.829 115.495 100.094 1.00 34.28  ?  299 ASP A CG  1 
ATOM   756   O  OD1 . ASP A  1 126 ? 133.834 114.248 100.040 1.00 34.28  ?  299 ASP A OD1 1 
ATOM   757   O  OD2 . ASP A  1 126 ? 134.879 116.163 100.021 1.00 34.28  ?  299 ASP A OD2 1 
ATOM   758   N  N   . LEU A  1 127 ? 130.140 113.682 98.948  1.00 30.25  ?  300 LEU A N   1 
ATOM   759   C  CA  . LEU A  1 127 ? 130.078 112.888 97.731  1.00 30.25  ?  300 LEU A CA  1 
ATOM   760   C  C   . LEU A  1 127 ? 128.763 113.072 96.983  1.00 30.25  ?  300 LEU A C   1 
ATOM   761   O  O   . LEU A  1 127 ? 128.727 112.914 95.759  1.00 30.25  ?  300 LEU A O   1 
ATOM   762   C  CB  . LEU A  1 127 ? 130.319 111.419 98.084  1.00 30.25  ?  300 LEU A CB  1 
ATOM   763   C  CG  . LEU A  1 127 ? 130.837 110.445 97.026  1.00 30.25  ?  300 LEU A CG  1 
ATOM   764   C  CD1 . LEU A  1 127 ? 131.674 109.371 97.695  1.00 30.25  ?  300 LEU A CD1 1 
ATOM   765   C  CD2 . LEU A  1 127 ? 129.742 109.804 96.203  1.00 30.25  ?  300 LEU A CD2 1 
ATOM   766   N  N   . LEU A  1 128 ? 127.682 113.410 97.678  1.00 32.45  ?  301 LEU A N   1 
ATOM   767   C  CA  . LEU A  1 128 ? 126.372 113.555 97.056  1.00 32.45  ?  301 LEU A CA  1 
ATOM   768   C  C   . LEU A  1 128 ? 125.766 114.905 97.404  1.00 32.45  ?  301 LEU A C   1 
ATOM   769   O  O   . LEU A  1 128 ? 125.668 115.260 98.580  1.00 32.45  ?  301 LEU A O   1 
ATOM   770   C  CB  . LEU A  1 128 ? 125.424 112.443 97.499  1.00 32.45  ?  301 LEU A CB  1 
ATOM   771   C  CG  . LEU A  1 128 ? 125.805 111.037 97.052  1.00 32.45  ?  301 LEU A CG  1 
ATOM   772   C  CD1 . LEU A  1 128 ? 124.807 110.020 97.574  1.00 32.45  ?  301 LEU A CD1 1 
ATOM   773   C  CD2 . LEU A  1 128 ? 125.901 110.986 95.550  1.00 32.45  ?  301 LEU A CD2 1 
ATOM   774   N  N   . ALA A  1 129 ? 125.334 115.639 96.381  1.00 34.99  ?  302 ALA A N   1 
ATOM   775   C  CA  . ALA A  1 129 ? 124.707 116.937 96.576  1.00 34.99  ?  302 ALA A CA  1 
ATOM   776   C  C   . ALA A  1 129 ? 123.298 116.777 97.126  1.00 34.99  ?  302 ALA A C   1 
ATOM   777   O  O   . ALA A  1 129 ? 122.656 115.743 96.935  1.00 34.99  ?  302 ALA A O   1 
ATOM   778   C  CB  . ALA A  1 129 ? 124.658 117.714 95.263  1.00 34.99  ?  302 ALA A CB  1 
ATOM   779   N  N   . LYS A  1 130 ? 122.818 117.817 97.802  1.00 37.91  ?  303 LYS A N   1 
ATOM   780   C  CA  . LYS A  1 130 ? 121.487 117.827 98.395  1.00 37.91  ?  303 LYS A CA  1 
ATOM   781   C  C   . LYS A  1 130 ? 120.563 118.854 97.762  1.00 37.91  ?  303 LYS A C   1 
ATOM   782   O  O   . LYS A  1 130 ? 119.418 118.534 97.440  1.00 37.91  ?  303 LYS A O   1 
ATOM   783   C  CB  . LYS A  1 130 ? 121.591 118.089 99.901  1.00 37.91  ?  303 LYS A CB  1 
ATOM   784   C  CG  . LYS A  1 130 ? 120.279 117.989 100.647 1.00 37.91  ?  303 LYS A CG  1 
ATOM   785   C  CD  . LYS A  1 130 ? 120.496 118.171 102.139 1.00 37.91  ?  303 LYS A CD  1 
ATOM   786   C  CE  . LYS A  1 130 ? 119.210 117.966 102.919 1.00 37.91  ?  303 LYS A CE  1 
ATOM   787   N  NZ  . LYS A  1 130 ? 118.217 119.040 102.648 1.00 37.91  ?  303 LYS A NZ  1 
ATOM   788   N  N   . ASP A  1 131 ? 121.034 120.082 97.573  1.00 42.02  ?  304 ASP A N   1 
ATOM   789   C  CA  . ASP A  1 131 ? 120.260 121.133 96.924  1.00 42.02  ?  304 ASP A CA  1 
ATOM   790   C  C   . ASP A  1 131 ? 121.226 122.106 96.269  1.00 42.02  ?  304 ASP A C   1 
ATOM   791   O  O   . ASP A  1 131 ? 122.350 122.278 96.744  1.00 42.02  ?  304 ASP A O   1 
ATOM   792   C  CB  . ASP A  1 131 ? 119.334 121.845 97.916  1.00 42.02  ?  304 ASP A CB  1 
ATOM   793   C  CG  . ASP A  1 131 ? 120.054 122.323 99.168  1.00 42.02  ?  304 ASP A CG  1 
ATOM   794   O  OD1 . ASP A  1 131 ? 121.245 122.000 99.358  1.00 42.02  ?  304 ASP A OD1 1 
ATOM   795   O  OD2 . ASP A  1 131 ? 119.414 123.027 99.977  1.00 42.02  ?  304 ASP A OD2 1 
ATOM   796   N  N   . CYS A  1 132 ? 120.815 122.704 95.159  1.00 45.54  ?  305 CYS A N   1 
ATOM   797   C  CA  . CYS A  1 132 ? 121.727 123.522 94.378  1.00 45.54  ?  305 CYS A CA  1 
ATOM   798   C  C   . CYS A  1 132 ? 121.154 124.900 94.103  1.00 45.54  ?  305 CYS A C   1 
ATOM   799   O  O   . CYS A  1 132 ? 119.964 125.051 93.821  1.00 45.54  ?  305 CYS A O   1 
ATOM   800   C  CB  . CYS A  1 132 ? 122.074 122.838 93.065  1.00 45.54  ?  305 CYS A CB  1 
ATOM   801   S  SG  . CYS A  1 132 ? 123.073 121.379 93.302  1.00 45.54  ?  305 CYS A SG  1 
ATOM   802   N  N   . HIS A  1 133 ? 122.028 125.901 94.168  1.00 46.64  ?  306 HIS A N   1 
ATOM   803   C  CA  . HIS A  1 133 ? 121.653 127.280 93.909  1.00 46.64  ?  306 HIS A CA  1 
ATOM   804   C  C   . HIS A  1 133 ? 122.707 127.921 93.023  1.00 46.64  ?  306 HIS A C   1 
ATOM   805   O  O   . HIS A  1 133 ? 123.773 127.351 92.775  1.00 46.64  ?  306 HIS A O   1 
ATOM   806   C  CB  . HIS A  1 133 ? 121.496 128.072 95.205  1.00 46.64  ?  306 HIS A CB  1 
ATOM   807   C  CG  . HIS A  1 133 ? 122.753 128.166 96.008  1.00 46.64  ?  306 HIS A CG  1 
ATOM   808   N  ND1 . HIS A  1 133 ? 123.707 129.136 95.791  1.00 46.64  ?  306 HIS A ND1 1 
ATOM   809   C  CD2 . HIS A  1 133 ? 123.205 127.418 97.038  1.00 46.64  ?  306 HIS A CD2 1 
ATOM   810   C  CE1 . HIS A  1 133 ? 124.697 128.976 96.650  1.00 46.64  ?  306 HIS A CE1 1 
ATOM   811   N  NE2 . HIS A  1 133 ? 124.416 127.941 97.419  1.00 46.64  ?  306 HIS A NE2 1 
ATOM   812   N  N   . CYS A  1 134 ? 122.414 129.133 92.570  1.00 56.21  ?  307 CYS A N   1 
ATOM   813   C  CA  . CYS A  1 134 ? 123.289 129.863 91.668  1.00 56.21  ?  307 CYS A CA  1 
ATOM   814   C  C   . CYS A  1 134 ? 124.189 130.797 92.463  1.00 56.21  ?  307 CYS A C   1 
ATOM   815   O  O   . CYS A  1 134 ? 123.728 131.480 93.381  1.00 56.21  ?  307 CYS A O   1 
ATOM   816   C  CB  . CYS A  1 134 ? 122.463 130.664 90.666  1.00 56.21  ?  307 CYS A CB  1 
ATOM   817   S  SG  . CYS A  1 134 ? 121.368 129.646 89.678  1.00 56.21  ?  307 CYS A SG  1 
ATOM   818   N  N   . ILE A  1 135 ? 125.472 130.823 92.109  1.00 61.99  ?  308 ILE A N   1 
ATOM   819   C  CA  . ILE A  1 135 ? 126.417 131.708 92.781  1.00 61.99  ?  308 ILE A CA  1 
ATOM   820   C  C   . ILE A  1 135 ? 127.571 132.002 91.836  1.00 61.99  ?  308 ILE A C   1 
ATOM   821   O  O   . ILE A  1 135 ? 127.763 131.301 90.845  1.00 61.99  ?  308 ILE A O   1 
ATOM   822   C  CB  . ILE A  1 135 ? 126.917 131.100 94.108  1.00 61.99  ?  308 ILE A CB  1 
ATOM   823   C  CG1 . ILE A  1 135 ? 127.426 132.182 95.049  1.00 61.99  ?  308 ILE A CG1 1 
ATOM   824   C  CG2 . ILE A  1 135 ? 128.072 130.170 93.874  1.00 61.99  ?  308 ILE A CG2 1 
ATOM   825   C  CD1 . ILE A  1 135 ? 127.632 131.669 96.452  1.00 61.99  ?  308 ILE A CD1 1 
ATOM   826   O  OXT . ILE A  1 135 ? 128.337 132.942 92.028  1.00 61.99  ?  308 ILE A OXT 1 
ATOM   827   N  N   . TRP B  2 110 ? 123.772 82.647  104.568 1.00 73.17  ?  129 TRP C N   1 
ATOM   828   C  CA  . TRP B  2 110 ? 123.578 84.012  104.096 1.00 73.17  ?  129 TRP C CA  1 
ATOM   829   C  C   . TRP B  2 110 ? 124.547 84.938  104.823 1.00 73.17  ?  129 TRP C C   1 
ATOM   830   O  O   . TRP B  2 110 ? 124.278 85.389  105.935 1.00 73.17  ?  129 TRP C O   1 
ATOM   831   C  CB  . TRP B  2 110 ? 122.126 84.444  104.304 1.00 73.17  ?  129 TRP C CB  1 
ATOM   832   C  CG  . TRP B  2 110 ? 121.787 85.750  103.674 1.00 73.17  ?  129 TRP C CG  1 
ATOM   833   C  CD1 . TRP B  2 110 ? 121.542 86.928  104.310 1.00 73.17  ?  129 TRP C CD1 1 
ATOM   834   C  CD2 . TRP B  2 110 ? 121.673 86.020  102.271 1.00 73.17  ?  129 TRP C CD2 1 
ATOM   835   N  NE1 . TRP B  2 110 ? 121.267 87.913  103.393 1.00 73.17  ?  129 TRP C NE1 1 
ATOM   836   C  CE2 . TRP B  2 110 ? 121.345 87.381  102.133 1.00 73.17  ?  129 TRP C CE2 1 
ATOM   837   C  CE3 . TRP B  2 110 ? 121.814 85.241  101.119 1.00 73.17  ?  129 TRP C CE3 1 
ATOM   838   C  CZ2 . TRP B  2 110 ? 121.157 87.981  100.891 1.00 73.17  ?  129 TRP C CZ2 1 
ATOM   839   C  CZ3 . TRP B  2 110 ? 121.625 85.837  99.889  1.00 73.17  ?  129 TRP C CZ3 1 
ATOM   840   C  CH2 . TRP B  2 110 ? 121.299 87.193  99.784  1.00 73.17  ?  129 TRP C CH2 1 
ATOM   841   N  N   . SER B  2 111 ? 125.677 85.217  104.178 1.00 70.67  ?  130 SER C N   1 
ATOM   842   C  CA  . SER B  2 111 ? 126.814 85.814  104.859 1.00 70.67  ?  130 SER C CA  1 
ATOM   843   C  C   . SER B  2 111 ? 126.652 87.323  105.008 1.00 70.67  ?  130 SER C C   1 
ATOM   844   O  O   . SER B  2 111 ? 125.819 87.958  104.356 1.00 70.67  ?  130 SER C O   1 
ATOM   845   C  CB  . SER B  2 111 ? 128.106 85.508  104.107 1.00 70.67  ?  130 SER C CB  1 
ATOM   846   O  OG  . SER B  2 111 ? 129.216 86.101  104.755 1.00 70.67  ?  130 SER C OG  1 
ATOM   847   N  N   . CYS B  2 112 ? 127.490 87.898  105.877 1.00 67.72  ?  131 CYS C N   1 
ATOM   848   C  CA  . CYS B  2 112 ? 127.409 89.325  106.168 1.00 67.72  ?  131 CYS C CA  1 
ATOM   849   C  C   . CYS B  2 112 ? 127.980 90.170  105.042 1.00 67.72  ?  131 CYS C C   1 
ATOM   850   O  O   . CYS B  2 112 ? 127.635 91.350  104.924 1.00 67.72  ?  131 CYS C O   1 
ATOM   851   C  CB  . CYS B  2 112 ? 128.136 89.635  107.472 1.00 67.72  ?  131 CYS C CB  1 
ATOM   852   S  SG  . CYS B  2 112 ? 127.441 88.821  108.919 1.00 67.72  ?  131 CYS C SG  1 
ATOM   853   N  N   . LEU B  2 113 ? 128.860 89.593  104.222 1.00 65.99  ?  132 LEU C N   1 
ATOM   854   C  CA  . LEU B  2 113 ? 129.396 90.327  103.083 1.00 65.99  ?  132 LEU C CA  1 
ATOM   855   C  C   . LEU B  2 113 ? 128.314 90.601  102.052 1.00 65.99  ?  132 LEU C C   1 
ATOM   856   O  O   . LEU B  2 113 ? 128.247 91.700  101.491 1.00 65.99  ?  132 LEU C O   1 
ATOM   857   C  CB  . LEU B  2 113 ? 130.547 89.554  102.449 1.00 65.99  ?  132 LEU C CB  1 
ATOM   858   C  CG  . LEU B  2 113 ? 131.234 90.255  101.283 1.00 65.99  ?  132 LEU C CG  1 
ATOM   859   C  CD1 . LEU B  2 113 ? 131.831 91.556  101.757 1.00 65.99  ?  132 LEU C CD1 1 
ATOM   860   C  CD2 . LEU B  2 113 ? 132.302 89.362  100.689 1.00 65.99  ?  132 LEU C CD2 1 
ATOM   861   N  N   . GLU B  2 114 ? 127.441 89.621  101.807 1.00 67.15  ?  133 GLU C N   1 
ATOM   862   C  CA  . GLU B  2 114 ? 126.323 89.844  100.901 1.00 67.15  ?  133 GLU C CA  1 
ATOM   863   C  C   . GLU B  2 114 ? 125.314 90.821  101.479 1.00 67.15  ?  133 GLU C C   1 
ATOM   864   O  O   . GLU B  2 114 ? 124.704 91.582  100.723 1.00 67.15  ?  133 GLU C O   1 
ATOM   865   C  CB  . GLU B  2 114 ? 125.642 88.521  100.566 1.00 67.15  ?  133 GLU C CB  1 
ATOM   866   C  CG  . GLU B  2 114 ? 126.540 87.563  99.809  1.00 67.15  ?  133 GLU C CG  1 
ATOM   867   C  CD  . GLU B  2 114 ? 126.925 88.079  98.434  1.00 67.15  ?  133 GLU C CD  1 
ATOM   868   O  OE1 . GLU B  2 114 ? 126.095 88.758  97.790  1.00 67.15  ?  133 GLU C OE1 1 
ATOM   869   O  OE2 . GLU B  2 114 ? 128.065 87.813  98.000  1.00 67.15  ?  133 GLU C OE2 1 
ATOM   870   N  N   . VAL B  2 115 ? 125.169 90.851  102.803 1.00 61.00  ?  134 VAL C N   1 
ATOM   871   C  CA  . VAL B  2 115 ? 124.311 91.841  103.441 1.00 61.00  ?  134 VAL C CA  1 
ATOM   872   C  C   . VAL B  2 115 ? 124.885 93.245  103.271 1.00 61.00  ?  134 VAL C C   1 
ATOM   873   O  O   . VAL B  2 115 ? 124.152 94.197  102.967 1.00 61.00  ?  134 VAL C O   1 
ATOM   874   C  CB  . VAL B  2 115 ? 124.118 91.468  104.919 1.00 61.00  ?  134 VAL C CB  1 
ATOM   875   C  CG1 . VAL B  2 115 ? 123.421 92.564  105.649 1.00 61.00  ?  134 VAL C CG1 1 
ATOM   876   C  CG2 . VAL B  2 115 ? 123.312 90.195  105.020 1.00 61.00  ?  134 VAL C CG2 1 
ATOM   877   N  N   . ALA B  2 116 ? 126.203 93.390  103.429 1.00 60.14  ?  135 ALA C N   1 
ATOM   878   C  CA  . ALA B  2 116 ? 126.842 94.690  103.241 1.00 60.14  ?  135 ALA C CA  1 
ATOM   879   C  C   . ALA B  2 116 ? 126.780 95.128  101.786 1.00 60.14  ?  135 ALA C C   1 
ATOM   880   O  O   . ALA B  2 116 ? 126.631 96.316  101.493 1.00 60.14  ?  135 ALA C O   1 
ATOM   881   C  CB  . ALA B  2 116 ? 128.291 94.644  103.718 1.00 60.14  ?  135 ALA C CB  1 
ATOM   882   N  N   . GLU B  2 117 ? 126.882 94.180  100.859 1.00 58.25  ?  136 GLU C N   1 
ATOM   883   C  CA  . GLU B  2 117 ? 126.748 94.526  99.453  1.00 58.25  ?  136 GLU C CA  1 
ATOM   884   C  C   . GLU B  2 117 ? 125.299 94.733  99.034  1.00 58.25  ?  136 GLU C C   1 
ATOM   885   O  O   . GLU B  2 117 ? 125.061 95.281  97.953  1.00 58.25  ?  136 GLU C O   1 
ATOM   886   C  CB  . GLU B  2 117 ? 127.398 93.447  98.589  1.00 58.25  ?  136 GLU C CB  1 
ATOM   887   C  CG  . GLU B  2 117 ? 128.904 93.377  98.749  1.00 58.25  ?  136 GLU C CG  1 
ATOM   888   C  CD  . GLU B  2 117 ? 129.534 92.284  97.918  1.00 58.25  ?  136 GLU C CD  1 
ATOM   889   O  OE1 . GLU B  2 117 ? 128.787 91.497  97.301  1.00 58.25  ?  136 GLU C OE1 1 
ATOM   890   O  OE2 . GLU B  2 117 ? 130.780 92.208  97.884  1.00 58.25  ?  136 GLU C OE2 1 
ATOM   891   N  N   . ALA B  2 118 ? 124.332 94.318  99.853  1.00 55.93  ?  137 ALA C N   1 
ATOM   892   C  CA  . ALA B  2 118 ? 122.923 94.495  99.536  1.00 55.93  ?  137 ALA C CA  1 
ATOM   893   C  C   . ALA B  2 118 ? 122.297 95.706  100.215 1.00 55.93  ?  137 ALA C C   1 
ATOM   894   O  O   . ALA B  2 118 ? 121.265 96.195  99.746  1.00 55.93  ?  137 ALA C O   1 
ATOM   895   C  CB  . ALA B  2 118 ? 122.140 93.235  99.904  1.00 55.93  ?  137 ALA C CB  1 
ATOM   896   N  N   . CYS B  2 119 ? 122.879 96.203  101.305 1.00 55.89  ?  138 CYS C N   1 
ATOM   897   C  CA  . CYS B  2 119 ? 122.378 97.444  101.887 1.00 55.89  ?  138 CYS C CA  1 
ATOM   898   C  C   . CYS B  2 119 ? 122.808 98.672  101.098 1.00 55.89  ?  138 CYS C C   1 
ATOM   899   O  O   . CYS B  2 119 ? 121.988 99.558  100.835 1.00 55.89  ?  138 CYS C O   1 
ATOM   900   C  CB  . CYS B  2 119 ? 122.838 97.598  103.338 1.00 55.89  ?  138 CYS C CB  1 
ATOM   901   S  SG  . CYS B  2 119 ? 122.465 99.248  104.037 1.00 55.89  ?  138 CYS C SG  1 
ATOM   902   N  N   . VAL B  2 120 ? 124.080 98.735  100.703 1.00 48.85  ?  139 VAL C N   1 
ATOM   903   C  CA  . VAL B  2 120 ? 124.615 99.941  100.085 1.00 48.85  ?  139 VAL C CA  1 
ATOM   904   C  C   . VAL B  2 120 ? 124.087 100.127 98.664  1.00 48.85  ?  139 VAL C C   1 
ATOM   905   O  O   . VAL B  2 120 ? 124.013 101.263 98.177  1.00 48.85  ?  139 VAL C O   1 
ATOM   906   C  CB  . VAL B  2 120 ? 126.149 99.870  100.179 1.00 48.85  ?  139 VAL C CB  1 
ATOM   907   C  CG1 . VAL B  2 120 ? 126.802 101.135 99.693  1.00 48.85  ?  139 VAL C CG1 1 
ATOM   908   C  CG2 . VAL B  2 120 ? 126.566 99.612  101.614 1.00 48.85  ?  139 VAL C CG2 1 
ATOM   909   N  N   . GLY B  2 121 ? 123.646 99.050  98.009  1.00 51.80  ?  140 GLY C N   1 
ATOM   910   C  CA  . GLY B  2 121 ? 123.010 99.191  96.708  1.00 51.80  ?  140 GLY C CA  1 
ATOM   911   C  C   . GLY B  2 121 ? 121.673 99.907  96.761  1.00 51.80  ?  140 GLY C C   1 
ATOM   912   O  O   . GLY B  2 121 ? 121.254 100.519 95.776  1.00 51.80  ?  140 GLY C O   1 
ATOM   913   N  N   . ASP B  2 122 ? 120.996 99.857  97.906  1.00 54.07  ?  141 ASP C N   1 
ATOM   914   C  CA  . ASP B  2 122 ? 119.737 100.560 98.116  1.00 54.07  ?  141 ASP C CA  1 
ATOM   915   C  C   . ASP B  2 122 ? 120.014 101.908 98.773  1.00 54.07  ?  141 ASP C C   1 
ATOM   916   O  O   . ASP B  2 122 ? 120.733 101.979 99.775  1.00 54.07  ?  141 ASP C O   1 
ATOM   917   C  CB  . ASP B  2 122 ? 118.789 99.728  98.980  1.00 54.07  ?  141 ASP C CB  1 
ATOM   918   C  CG  . ASP B  2 122 ? 117.400 100.330 99.069  1.00 54.07  ?  141 ASP C CG  1 
ATOM   919   O  OD1 . ASP B  2 122 ? 116.645 100.236 98.078  1.00 54.07  ?  141 ASP C OD1 1 
ATOM   920   O  OD2 . ASP B  2 122 ? 117.063 100.895 100.130 1.00 54.07  ?  141 ASP C OD2 1 
ATOM   921   N  N   . VAL B  2 123 ? 119.417 102.967 98.218  1.00 51.23  ?  142 VAL C N   1 
ATOM   922   C  CA  . VAL B  2 123 ? 119.820 104.336 98.530  1.00 51.23  ?  142 VAL C CA  1 
ATOM   923   C  C   . VAL B  2 123 ? 119.380 104.741 99.933  1.00 51.23  ?  142 VAL C C   1 
ATOM   924   O  O   . VAL B  2 123 ? 120.125 105.415 100.657 1.00 51.23  ?  142 VAL C O   1 
ATOM   925   C  CB  . VAL B  2 123 ? 119.261 105.283 97.453  1.00 51.23  ?  142 VAL C CB  1 
ATOM   926   C  CG1 . VAL B  2 123 ? 119.659 106.722 97.720  1.00 51.23  ?  142 VAL C CG1 1 
ATOM   927   C  CG2 . VAL B  2 123 ? 119.730 104.845 96.083  1.00 51.23  ?  142 VAL C CG2 1 
ATOM   928   N  N   . VAL B  2 124 ? 118.179 104.328 100.343 1.00 49.15  ?  143 VAL C N   1 
ATOM   929   C  CA  . VAL B  2 124 ? 117.681 104.661 101.675 1.00 49.15  ?  143 VAL C CA  1 
ATOM   930   C  C   . VAL B  2 124 ? 118.505 103.957 102.746 1.00 49.15  ?  143 VAL C C   1 
ATOM   931   O  O   . VAL B  2 124 ? 118.891 104.567 103.755 1.00 49.15  ?  143 VAL C O   1 
ATOM   932   C  CB  . VAL B  2 124 ? 116.188 104.305 101.779 1.00 49.15  ?  143 VAL C CB  1 
ATOM   933   C  CG1 . VAL B  2 124 ? 115.649 104.631 103.163 1.00 49.15  ?  143 VAL C CG1 1 
ATOM   934   C  CG2 . VAL B  2 124 ? 115.399 105.027 100.700 1.00 49.15  ?  143 VAL C CG2 1 
ATOM   935   N  N   . CYS B  2 125 ? 118.821 102.675 102.522 1.00 52.14  ?  144 CYS C N   1 
ATOM   936   C  CA  . CYS B  2 125 ? 119.691 101.948 103.439 1.00 52.14  ?  144 CYS C CA  1 
ATOM   937   C  C   . CYS B  2 125 ? 121.095 102.532 103.437 1.00 52.14  ?  144 CYS C C   1 
ATOM   938   O  O   . CYS B  2 125 ? 121.755 102.548 104.477 1.00 52.14  ?  144 CYS C O   1 
ATOM   939   C  CB  . CYS B  2 125 ? 119.734 100.462 103.067 1.00 52.14  ?  144 CYS C CB  1 
ATOM   940   S  SG  . CYS B  2 125 ? 120.450 99.321  104.328 1.00 52.14  ?  144 CYS C SG  1 
ATOM   941   N  N   . ASN B  2 126 ? 121.533 103.078 102.298 1.00 45.25  ?  145 ASN C N   1 
ATOM   942   C  CA  . ASN B  2 126 ? 122.857 103.687 102.210 1.00 45.25  ?  145 ASN C CA  1 
ATOM   943   C  C   . ASN B  2 126 ? 122.937 104.968 103.032 1.00 45.25  ?  145 ASN C C   1 
ATOM   944   O  O   . ASN B  2 126 ? 123.906 105.174 103.769 1.00 45.25  ?  145 ASN C O   1 
ATOM   945   C  CB  . ASN B  2 126 ? 123.196 103.961 100.747 1.00 45.25  ?  145 ASN C CB  1 
ATOM   946   C  CG  . ASN B  2 126 ? 124.665 104.237 100.522 1.00 45.25  ?  145 ASN C CG  1 
ATOM   947   O  OD1 . ASN B  2 126 ? 125.465 104.229 101.453 1.00 45.25  ?  145 ASN C OD1 1 
ATOM   948   N  ND2 . ASN B  2 126 ? 125.031 104.473 99.268  1.00 45.25  ?  145 ASN C ND2 1 
ATOM   949   N  N   . ALA B  2 127 ? 121.920 105.828 102.946 1.00 43.47  ?  146 ALA C N   1 
ATOM   950   C  CA  . ALA B  2 127 ? 121.956 107.079 103.699 1.00 43.47  ?  146 ALA C CA  1 
ATOM   951   C  C   . ALA B  2 127 ? 121.755 106.841 105.192 1.00 43.47  ?  146 ALA C C   1 
ATOM   952   O  O   . ALA B  2 127 ? 122.401 107.496 106.028 1.00 43.47  ?  146 ALA C O   1 
ATOM   953   C  CB  . ALA B  2 127 ? 120.903 108.045 103.166 1.00 43.47  ?  146 ALA C CB  1 
ATOM   954   N  N   . GLN B  2 128 ? 120.870 105.903 105.550 1.00 44.89  ?  147 GLN C N   1 
ATOM   955   C  CA  . GLN B  2 128 ? 120.708 105.584 106.962 1.00 44.89  ?  147 GLN C CA  1 
ATOM   956   C  C   . GLN B  2 128 ? 121.939 104.885 107.516 1.00 44.89  ?  147 GLN C C   1 
ATOM   957   O  O   . GLN B  2 128 ? 122.305 105.112 108.673 1.00 44.89  ?  147 GLN C O   1 
ATOM   958   C  CB  . GLN B  2 128 ? 119.460 104.738 107.182 1.00 44.89  ?  147 GLN C CB  1 
ATOM   959   C  CG  . GLN B  2 128 ? 118.170 105.449 106.823 1.00 44.89  ?  147 GLN C CG  1 
ATOM   960   C  CD  . GLN B  2 128 ? 117.924 106.685 107.662 1.00 44.89  ?  147 GLN C CD  1 
ATOM   961   O  OE1 . GLN B  2 128 ? 118.231 106.719 108.852 1.00 44.89  ?  147 GLN C OE1 1 
ATOM   962   N  NE2 . GLN B  2 128 ? 117.356 107.709 107.042 1.00 44.89  ?  147 GLN C NE2 1 
ATOM   963   N  N   . LEU B  2 129 ? 122.627 104.092 106.688 1.00 44.92  ?  148 LEU C N   1 
ATOM   964   C  CA  . LEU B  2 129 ? 123.903 103.515 107.085 1.00 44.92  ?  148 LEU C CA  1 
ATOM   965   C  C   . LEU B  2 129 ? 124.968 104.590 107.233 1.00 44.92  ?  148 LEU C C   1 
ATOM   966   O  O   . LEU B  2 129 ? 125.877 104.459 108.058 1.00 44.92  ?  148 LEU C O   1 
ATOM   967   C  CB  . LEU B  2 129 ? 124.330 102.465 106.059 1.00 44.92  ?  148 LEU C CB  1 
ATOM   968   C  CG  . LEU B  2 129 ? 125.614 101.676 106.304 1.00 44.92  ?  148 LEU C CG  1 
ATOM   969   C  CD1 . LEU B  2 129 ? 125.489 100.833 107.552 1.00 44.92  ?  148 LEU C CD1 1 
ATOM   970   C  CD2 . LEU B  2 129 ? 125.934 100.816 105.106 1.00 44.92  ?  148 LEU C CD2 1 
ATOM   971   N  N   . ALA B  2 130 ? 124.866 105.667 106.449 1.00 42.69  ?  149 ALA C N   1 
ATOM   972   C  CA  . ALA B  2 130 ? 125.822 106.763 106.565 1.00 42.69  ?  149 ALA C CA  1 
ATOM   973   C  C   . ALA B  2 130 ? 125.681 107.484 107.891 1.00 42.69  ?  149 ALA C C   1 
ATOM   974   O  O   . ALA B  2 130 ? 126.680 107.714 108.586 1.00 42.69  ?  149 ALA C O   1 
ATOM   975   C  CB  . ALA B  2 130 ? 125.654 107.738 105.406 1.00 42.69  ?  149 ALA C CB  1 
ATOM   976   N  N   . SER B  2 131 ? 124.445 107.824 108.263 1.00 44.68  ?  150 SER C N   1 
ATOM   977   C  CA  . SER B  2 131 ? 124.216 108.419 109.579 1.00 44.68  ?  150 SER C CA  1 
ATOM   978   C  C   . SER B  2 131 ? 124.559 107.446 110.702 1.00 44.68  ?  150 SER C C   1 
ATOM   979   O  O   . SER B  2 131 ? 125.094 107.861 111.739 1.00 44.68  ?  150 SER C O   1 
ATOM   980   C  CB  . SER B  2 131 ? 122.769 108.887 109.701 1.00 44.68  ?  150 SER C CB  1 
ATOM   981   O  OG  . SER B  2 131 ? 122.493 109.923 108.775 1.00 44.68  ?  150 SER C OG  1 
ATOM   982   N  N   . TYR B  2 132 ? 124.328 106.150 110.469 1.00 45.91  ?  151 TYR C N   1 
ATOM   983   C  CA  . TYR B  2 132 ? 124.679 105.099 111.418 1.00 45.91  ?  151 TYR C CA  1 
ATOM   984   C  C   . TYR B  2 132 ? 126.177 105.057 111.691 1.00 45.91  ?  151 TYR C C   1 
ATOM   985   O  O   . TYR B  2 132 ? 126.613 105.137 112.846 1.00 45.91  ?  151 TYR C O   1 
ATOM   986   C  CB  . TYR B  2 132 ? 124.207 103.763 110.854 1.00 45.91  ?  151 TYR C CB  1 
ATOM   987   C  CG  . TYR B  2 132 ? 124.509 102.562 111.700 1.00 45.91  ?  151 TYR C CG  1 
ATOM   988   C  CD1 . TYR B  2 132 ? 123.755 102.279 112.823 1.00 45.91  ?  151 TYR C CD1 1 
ATOM   989   C  CD2 . TYR B  2 132 ? 125.535 101.693 111.361 1.00 45.91  ?  151 TYR C CD2 1 
ATOM   990   C  CE1 . TYR B  2 132 ? 124.019 101.175 113.589 1.00 45.91  ?  151 TYR C CE1 1 
ATOM   991   C  CE2 . TYR B  2 132 ? 125.808 100.585 112.129 1.00 45.91  ?  151 TYR C CE2 1 
ATOM   992   C  CZ  . TYR B  2 132 ? 125.046 100.333 113.242 1.00 45.91  ?  151 TYR C CZ  1 
ATOM   993   O  OH  . TYR B  2 132 ? 125.309 99.230  114.014 1.00 45.91  ?  151 TYR C OH  1 
ATOM   994   N  N   . LEU B  2 133 ? 126.978 104.931 110.633 1.00 45.32  ?  152 LEU C N   1 
ATOM   995   C  CA  . LEU B  2 133 ? 128.420 104.787 110.790 1.00 45.32  ?  152 LEU C CA  1 
ATOM   996   C  C   . LEU B  2 133 ? 129.058 106.081 111.271 1.00 45.32  ?  152 LEU C C   1 
ATOM   997   O  O   . LEU B  2 133 ? 130.054 106.049 111.999 1.00 45.32  ?  152 LEU C O   1 
ATOM   998   C  CB  . LEU B  2 133 ? 129.053 104.331 109.478 1.00 45.32  ?  152 LEU C CB  1 
ATOM   999   C  CG  . LEU B  2 133 ? 128.698 102.914 109.041 1.00 45.32  ?  152 LEU C CG  1 
ATOM   1000  C  CD1 . LEU B  2 133 ? 129.308 102.607 107.696 1.00 45.32  ?  152 LEU C CD1 1 
ATOM   1001  C  CD2 . LEU B  2 133 ? 129.171 101.924 110.075 1.00 45.32  ?  152 LEU C CD2 1 
ATOM   1002  N  N   . LYS B  2 134 ? 128.499 107.233 110.883 1.00 52.52  ?  153 LYS C N   1 
ATOM   1003  C  CA  . LYS B  2 134 ? 129.032 108.491 111.393 1.00 52.52  ?  153 LYS C CA  1 
ATOM   1004  C  C   . LYS B  2 134 ? 128.713 108.668 112.871 1.00 52.52  ?  153 LYS C C   1 
ATOM   1005  O  O   . LYS B  2 134 ? 129.518 109.242 113.611 1.00 52.52  ?  153 LYS C O   1 
ATOM   1006  C  CB  . LYS B  2 134 ? 128.490 109.662 110.573 1.00 52.52  ?  153 LYS C CB  1 
ATOM   1007  C  CG  . LYS B  2 134 ? 129.105 111.008 110.913 1.00 52.52  ?  153 LYS C CG  1 
ATOM   1008  C  CD  . LYS B  2 134 ? 128.645 112.092 109.955 1.00 52.52  ?  153 LYS C CD  1 
ATOM   1009  C  CE  . LYS B  2 134 ? 127.211 112.502 110.230 1.00 52.52  ?  153 LYS C CE  1 
ATOM   1010  N  NZ  . LYS B  2 134 ? 126.791 113.649 109.382 1.00 52.52  ?  153 LYS C NZ  1 
ATOM   1011  N  N   . ALA B  2 135 ? 127.575 108.154 113.332 1.00 54.43  ?  154 ALA C N   1 
ATOM   1012  C  CA  . ALA B  2 135 ? 127.287 108.204 114.757 1.00 54.43  ?  154 ALA C CA  1 
ATOM   1013  C  C   . ALA B  2 135 ? 127.983 107.106 115.546 1.00 54.43  ?  154 ALA C C   1 
ATOM   1014  O  O   . ALA B  2 135 ? 128.069 107.214 116.772 1.00 54.43  ?  154 ALA C O   1 
ATOM   1015  C  CB  . ALA B  2 135 ? 125.779 108.127 114.990 1.00 54.43  ?  154 ALA C CB  1 
ATOM   1016  N  N   . CYS B  2 136 ? 128.482 106.059 114.890 1.00 62.78  ?  155 CYS C N   1 
ATOM   1017  C  CA  . CYS B  2 136 ? 129.094 104.937 115.599 1.00 62.78  ?  155 CYS C CA  1 
ATOM   1018  C  C   . CYS B  2 136 ? 130.499 104.659 115.081 1.00 62.78  ?  155 CYS C C   1 
ATOM   1019  O  O   . CYS B  2 136 ? 130.850 103.513 114.783 1.00 62.78  ?  155 CYS C O   1 
ATOM   1020  C  CB  . CYS B  2 136 ? 128.238 103.676 115.488 1.00 62.78  ?  155 CYS C CB  1 
ATOM   1021  S  SG  . CYS B  2 136 ? 126.627 103.768 116.285 1.00 62.78  ?  155 CYS C SG  1 
ATOM   1022  N  N   . SER B  2 137 ? 131.326 105.695 114.963 1.00 76.68  ?  156 SER C N   1 
ATOM   1023  C  CA  . SER B  2 137 ? 132.713 105.532 114.552 1.00 76.68  ?  156 SER C CA  1 
ATOM   1024  C  C   . SER B  2 137 ? 133.647 106.022 115.647 1.00 76.68  ?  156 SER C C   1 
ATOM   1025  O  O   . SER B  2 137 ? 133.262 106.822 116.504 1.00 76.68  ?  156 SER C O   1 
ATOM   1026  C  CB  . SER B  2 137 ? 133.021 106.286 113.256 1.00 76.68  ?  156 SER C CB  1 
ATOM   1027  O  OG  . SER B  2 137 ? 134.375 106.118 112.880 1.00 76.68  ?  156 SER C OG  1 
ATOM   1028  N  N   . ALA B  2 138 ? 134.883 105.533 115.605 1.00 89.40  ?  157 ALA C N   1 
ATOM   1029  C  CA  . ALA B  2 138 ? 135.882 105.931 116.586 1.00 89.40  ?  157 ALA C CA  1 
ATOM   1030  C  C   . ALA B  2 138 ? 136.516 107.258 116.190 1.00 89.40  ?  157 ALA C C   1 
ATOM   1031  O  O   . ALA B  2 138 ? 136.855 107.475 115.023 1.00 89.40  ?  157 ALA C O   1 
ATOM   1032  C  CB  . ALA B  2 138 ? 136.951 104.849 116.719 1.00 89.40  ?  157 ALA C CB  1 
ATOM   1033  N  N   . ASN B  2 139 ? 136.674 108.149 117.170 1.00 94.02  ?  158 ASN C N   1 
ATOM   1034  C  CA  . ASN B  2 139 ? 137.279 109.460 116.966 1.00 94.02  ?  158 ASN C CA  1 
ATOM   1035  C  C   . ASN B  2 139 ? 138.720 109.518 117.456 1.00 94.02  ?  158 ASN C C   1 
ATOM   1036  O  O   . ASN B  2 139 ? 139.184 110.585 117.878 1.00 94.02  ?  158 ASN C O   1 
ATOM   1037  C  CB  . ASN B  2 139 ? 136.447 110.530 117.673 1.00 94.02  ?  158 ASN C CB  1 
ATOM   1038  C  CG  . ASN B  2 139 ? 135.069 110.693 117.069 1.00 94.02  ?  158 ASN C CG  1 
ATOM   1039  O  OD1 . ASN B  2 139 ? 134.908 110.699 115.848 1.00 94.02  ?  158 ASN C OD1 1 
ATOM   1040  N  ND2 . ASN B  2 139 ? 134.061 110.819 117.925 1.00 94.02  ?  158 ASN C ND2 1 
ATOM   1041  N  N   . GLY B  2 140 ? 139.442 108.400 117.409 1.00 94.72  ?  159 GLY C N   1 
ATOM   1042  C  CA  . GLY B  2 140 ? 140.629 108.255 118.226 1.00 94.72  ?  159 GLY C CA  1 
ATOM   1043  C  C   . GLY B  2 140 ? 140.166 108.195 119.665 1.00 94.72  ?  159 GLY C C   1 
ATOM   1044  O  O   . GLY B  2 140 ? 140.777 108.769 120.571 1.00 94.72  ?  159 GLY C O   1 
ATOM   1045  N  N   . ASN B  2 141 ? 139.061 107.486 119.862 1.00 94.58  ?  160 ASN C N   1 
ATOM   1046  C  CA  . ASN B  2 141 ? 138.187 107.597 121.017 1.00 94.58  ?  160 ASN C CA  1 
ATOM   1047  C  C   . ASN B  2 141 ? 137.198 106.442 120.934 1.00 94.58  ?  160 ASN C C   1 
ATOM   1048  O  O   . ASN B  2 141 ? 136.715 106.134 119.837 1.00 94.58  ?  160 ASN C O   1 
ATOM   1049  C  CB  . ASN B  2 141 ? 137.475 108.955 120.984 1.00 94.58  ?  160 ASN C CB  1 
ATOM   1050  C  CG  . ASN B  2 141 ? 136.705 109.273 122.253 1.00 94.58  ?  160 ASN C CG  1 
ATOM   1051  O  OD1 . ASN B  2 141 ? 136.687 108.507 123.209 1.00 94.58  ?  160 ASN C OD1 1 
ATOM   1052  N  ND2 . ASN B  2 141 ? 136.050 110.425 122.255 1.00 94.58  ?  160 ASN C ND2 1 
ATOM   1053  N  N   . PRO B  2 142 ? 136.906 105.750 122.033 1.00 91.62  ?  161 PRO C N   1 
ATOM   1054  C  CA  . PRO B  2 142 ? 135.733 104.872 122.044 1.00 91.62  ?  161 PRO C CA  1 
ATOM   1055  C  C   . PRO B  2 142 ? 134.453 105.664 121.834 1.00 91.62  ?  161 PRO C C   1 
ATOM   1056  O  O   . PRO B  2 142 ? 134.338 106.825 122.238 1.00 91.62  ?  161 PRO C O   1 
ATOM   1057  C  CB  . PRO B  2 142 ? 135.782 104.234 123.436 1.00 91.62  ?  161 PRO C CB  1 
ATOM   1058  C  CG  . PRO B  2 142 ? 137.232 104.220 123.764 1.00 91.62  ?  161 PRO C CG  1 
ATOM   1059  C  CD  . PRO B  2 142 ? 137.801 105.480 123.173 1.00 91.62  ?  161 PRO C CD  1 
ATOM   1060  N  N   . CYS B  2 143 ? 133.498 105.019 121.163 1.00 85.08  ?  162 CYS C N   1 
ATOM   1061  C  CA  . CYS B  2 143 ? 132.269 105.665 120.727 1.00 85.08  ?  162 CYS C CA  1 
ATOM   1062  C  C   . CYS B  2 143 ? 131.412 106.078 121.919 1.00 85.08  ?  162 CYS C C   1 
ATOM   1063  O  O   . CYS B  2 143 ? 131.494 105.506 123.009 1.00 85.08  ?  162 CYS C O   1 
ATOM   1064  C  CB  . CYS B  2 143 ? 131.460 104.723 119.836 1.00 85.08  ?  162 CYS C CB  1 
ATOM   1065  S  SG  . CYS B  2 143 ? 132.263 104.212 118.304 1.00 85.08  ?  162 CYS C SG  1 
ATOM   1066  N  N   . ASP B  2 144 ? 130.586 107.095 121.702 1.00 73.74  ?  163 ASP C N   1 
ATOM   1067  C  CA  . ASP B  2 144 ? 129.580 107.448 122.688 1.00 73.74  ?  163 ASP C CA  1 
ATOM   1068  C  C   . ASP B  2 144 ? 128.484 106.395 122.654 1.00 73.74  ?  163 ASP C C   1 
ATOM   1069  O  O   . ASP B  2 144 ? 128.008 106.010 121.582 1.00 73.74  ?  163 ASP C O   1 
ATOM   1070  C  CB  . ASP B  2 144 ? 129.004 108.836 122.407 1.00 73.74  ?  163 ASP C CB  1 
ATOM   1071  C  CG  . ASP B  2 144 ? 128.251 109.409 123.597 1.00 73.74  ?  163 ASP C CG  1 
ATOM   1072  O  OD1 . ASP B  2 144 ? 128.198 108.747 124.654 1.00 73.74  ?  163 ASP C OD1 1 
ATOM   1073  O  OD2 . ASP B  2 144 ? 127.709 110.526 123.474 1.00 73.74  ?  163 ASP C OD2 1 
ATOM   1074  N  N   . LEU B  2 145 ? 128.090 105.922 123.835 1.00 67.04  ?  164 LEU C N   1 
ATOM   1075  C  CA  . LEU B  2 145 ? 127.240 104.740 123.912 1.00 67.04  ?  164 LEU C CA  1 
ATOM   1076  C  C   . LEU B  2 145 ? 125.803 105.054 123.514 1.00 67.04  ?  164 LEU C C   1 
ATOM   1077  O  O   . LEU B  2 145 ? 125.236 104.396 122.634 1.00 67.04  ?  164 LEU C O   1 
ATOM   1078  C  CB  . LEU B  2 145 ? 127.292 104.151 125.322 1.00 67.04  ?  164 LEU C CB  1 
ATOM   1079  C  CG  . LEU B  2 145 ? 126.551 102.828 125.486 1.00 67.04  ?  164 LEU C CG  1 
ATOM   1080  C  CD1 . LEU B  2 145 ? 127.182 101.772 124.596 1.00 67.04  ?  164 LEU C CD1 1 
ATOM   1081  C  CD2 . LEU B  2 145 ? 126.560 102.385 126.937 1.00 67.04  ?  164 LEU C CD2 1 
ATOM   1082  N  N   . LYS B  2 146 ? 125.203 106.066 124.144 1.00 65.30  ?  165 LYS C N   1 
ATOM   1083  C  CA  . LYS B  2 146 ? 123.791 106.349 123.923 1.00 65.30  ?  165 LYS C CA  1 
ATOM   1084  C  C   . LYS B  2 146 ? 123.519 106.928 122.544 1.00 65.30  ?  165 LYS C C   1 
ATOM   1085  O  O   . LYS B  2 146 ? 122.458 106.644 121.976 1.00 65.30  ?  165 LYS C O   1 
ATOM   1086  C  CB  . LYS B  2 146 ? 123.273 107.291 125.005 1.00 65.30  ?  165 LYS C CB  1 
ATOM   1087  C  CG  . LYS B  2 146 ? 123.251 106.655 126.381 1.00 65.30  ?  165 LYS C CG  1 
ATOM   1088  C  CD  . LYS B  2 146 ? 122.666 107.582 127.425 1.00 65.30  ?  165 LYS C CD  1 
ATOM   1089  C  CE  . LYS B  2 146 ? 122.715 106.937 128.799 1.00 65.30  ?  165 LYS C CE  1 
ATOM   1090  N  NZ  . LYS B  2 146 ? 121.814 105.754 128.886 1.00 65.30  ?  165 LYS C NZ  1 
ATOM   1091  N  N   . GLN B  2 147 ? 124.459 107.702 121.992 1.00 65.48  ?  166 GLN C N   1 
ATOM   1092  C  CA  . GLN B  2 147 ? 124.339 108.157 120.609 1.00 65.48  ?  166 GLN C CA  1 
ATOM   1093  C  C   . GLN B  2 147 ? 124.326 106.980 119.647 1.00 65.48  ?  166 GLN C C   1 
ATOM   1094  O  O   . GLN B  2 147 ? 123.510 106.935 118.718 1.00 65.48  ?  166 GLN C O   1 
ATOM   1095  C  CB  . GLN B  2 147 ? 125.487 109.100 120.253 1.00 65.48  ?  166 GLN C CB  1 
ATOM   1096  C  CG  . GLN B  2 147 ? 125.470 110.433 120.964 1.00 65.48  ?  166 GLN C CG  1 
ATOM   1097  C  CD  . GLN B  2 147 ? 126.631 111.316 120.549 1.00 65.48  ?  166 GLN C CD  1 
ATOM   1098  O  OE1 . GLN B  2 147 ? 127.489 110.906 119.766 1.00 65.48  ?  166 GLN C OE1 1 
ATOM   1099  N  NE2 . GLN B  2 147 ? 126.664 112.536 121.072 1.00 65.48  ?  166 GLN C NE2 1 
ATOM   1100  N  N   . CYS B  2 148 ? 125.195 105.996 119.883 1.00 61.42  ?  167 CYS C N   1 
ATOM   1101  C  CA  . CYS B  2 148 ? 125.284 104.856 118.979 1.00 61.42  ?  167 CYS C CA  1 
ATOM   1102  C  C   . CYS B  2 148 ? 124.062 103.955 119.106 1.00 61.42  ?  167 CYS C C   1 
ATOM   1103  O  O   . CYS B  2 148 ? 123.564 103.438 118.102 1.00 61.42  ?  167 CYS C O   1 
ATOM   1104  C  CB  . CYS B  2 148 ? 126.566 104.076 119.251 1.00 61.42  ?  167 CYS C CB  1 
ATOM   1105  S  SG  . CYS B  2 148 ? 126.886 102.797 118.045 1.00 61.42  ?  167 CYS C SG  1 
ATOM   1106  N  N   . GLN B  2 149 ? 123.541 103.792 120.325 1.00 55.48  ?  168 GLN C N   1 
ATOM   1107  C  CA  . GLN B  2 149 ? 122.341 102.982 120.522 1.00 55.48  ?  168 GLN C CA  1 
ATOM   1108  C  C   . GLN B  2 149 ? 121.108 103.643 119.916 1.00 55.48  ?  168 GLN C C   1 
ATOM   1109  O  O   . GLN B  2 149 ? 120.264 102.964 119.308 1.00 55.48  ?  168 GLN C O   1 
ATOM   1110  C  CB  . GLN B  2 149 ? 122.130 102.727 122.009 1.00 55.48  ?  168 GLN C CB  1 
ATOM   1111  C  CG  . GLN B  2 149 ? 123.159 101.811 122.628 1.00 55.48  ?  168 GLN C CG  1 
ATOM   1112  C  CD  . GLN B  2 149 ? 122.918 101.603 124.103 1.00 55.48  ?  168 GLN C CD  1 
ATOM   1113  O  OE1 . GLN B  2 149 ? 122.006 102.192 124.679 1.00 55.48  ?  168 GLN C OE1 1 
ATOM   1114  N  NE2 . GLN B  2 149 ? 123.737 100.768 124.728 1.00 55.48  ?  168 GLN C NE2 1 
ATOM   1115  N  N   . ALA B  2 150 ? 120.988 104.967 120.067 1.00 53.59  ?  169 ALA C N   1 
ATOM   1116  C  CA  . ALA B  2 150 ? 119.916 105.692 119.399 1.00 53.59  ?  169 ALA C CA  1 
ATOM   1117  C  C   . ALA B  2 150 ? 120.061 105.626 117.887 1.00 53.59  ?  169 ALA C C   1 
ATOM   1118  O  O   . ALA B  2 150 ? 119.054 105.567 117.176 1.00 53.59  ?  169 ALA C O   1 
ATOM   1119  C  CB  . ALA B  2 150 ? 119.893 107.143 119.867 1.00 53.59  ?  169 ALA C CB  1 
ATOM   1120  N  N   . ALA B  2 151 ? 121.298 105.585 117.386 1.00 51.70  ?  170 ALA C N   1 
ATOM   1121  C  CA  . ALA B  2 151 ? 121.518 105.410 115.956 1.00 51.70  ?  170 ALA C CA  1 
ATOM   1122  C  C   . ALA B  2 151 ? 121.110 104.023 115.476 1.00 51.70  ?  170 ALA C C   1 
ATOM   1123  O  O   . ALA B  2 151 ? 120.590 103.894 114.365 1.00 51.70  ?  170 ALA C O   1 
ATOM   1124  C  CB  . ALA B  2 151 ? 122.981 105.673 115.619 1.00 51.70  ?  170 ALA C CB  1 
ATOM   1125  N  N   . ILE B  2 152 ? 121.329 102.984 116.289 1.00 50.48  ?  171 ILE C N   1 
ATOM   1126  C  CA  . ILE B  2 152 ? 120.889 101.634 115.921 1.00 50.48  ?  171 ILE C CA  1 
ATOM   1127  C  C   . ILE B  2 152 ? 119.365 101.572 115.857 1.00 50.48  ?  171 ILE C C   1 
ATOM   1128  O  O   . ILE B  2 152 ? 118.780 101.028 114.904 1.00 50.48  ?  171 ILE C O   1 
ATOM   1129  C  CB  . ILE B  2 152 ? 121.439 100.586 116.906 1.00 50.48  ?  171 ILE C CB  1 
ATOM   1130  C  CG1 . ILE B  2 152 ? 122.959 100.531 116.895 1.00 50.48  ?  171 ILE C CG1 1 
ATOM   1131  C  CG2 . ILE B  2 152 ? 120.970 99.217  116.525 1.00 50.48  ?  171 ILE C CG2 1 
ATOM   1132  C  CD1 . ILE B  2 152 ? 123.542 99.697  118.013 1.00 50.48  ?  171 ILE C CD1 1 
ATOM   1133  N  N   . ARG B  2 153 ? 118.701 102.126 116.880 1.00 51.44  ?  172 ARG C N   1 
ATOM   1134  C  CA  . ARG B  2 153 ? 117.241 102.109 116.906 1.00 51.44  ?  172 ARG C CA  1 
ATOM   1135  C  C   . ARG B  2 153 ? 116.645 102.971 115.805 1.00 51.44  ?  172 ARG C C   1 
ATOM   1136  O  O   . ARG B  2 153 ? 115.576 102.650 115.278 1.00 51.44  ?  172 ARG C O   1 
ATOM   1137  C  CB  . ARG B  2 153 ? 116.726 102.577 118.260 1.00 51.44  ?  172 ARG C CB  1 
ATOM   1138  C  CG  . ARG B  2 153 ? 117.017 101.637 119.395 1.00 51.44  ?  172 ARG C CG  1 
ATOM   1139  C  CD  . ARG B  2 153 ? 116.492 102.213 120.688 1.00 51.44  ?  172 ARG C CD  1 
ATOM   1140  N  NE  . ARG B  2 153 ? 117.201 103.437 121.049 1.00 51.44  ?  172 ARG C NE  1 
ATOM   1141  C  CZ  . ARG B  2 153 ? 116.857 104.227 122.059 1.00 51.44  ?  172 ARG C CZ  1 
ATOM   1142  N  NH1 . ARG B  2 153 ? 115.815 103.921 122.813 1.00 51.44  ?  172 ARG C NH1 1 
ATOM   1143  N  NH2 . ARG B  2 153 ? 117.556 105.323 122.317 1.00 51.44  ?  172 ARG C NH2 1 
ATOM   1144  N  N   . PHE B  2 154 ? 117.319 104.056 115.436 1.00 49.50  ?  173 PHE C N   1 
ATOM   1145  C  CA  . PHE B  2 154 ? 116.866 104.879 114.328 1.00 49.50  ?  173 PHE C CA  1 
ATOM   1146  C  C   . PHE B  2 154 ? 117.179 104.243 112.981 1.00 49.50  ?  173 PHE C C   1 
ATOM   1147  O  O   . PHE B  2 154 ? 116.491 104.531 111.998 1.00 49.50  ?  173 PHE C O   1 
ATOM   1148  C  CB  . PHE B  2 154 ? 117.513 106.261 114.438 1.00 49.50  ?  173 PHE C CB  1 
ATOM   1149  C  CG  . PHE B  2 154 ? 116.998 107.262 113.453 1.00 49.50  ?  173 PHE C CG  1 
ATOM   1150  C  CD1 . PHE B  2 154 ? 115.781 107.887 113.657 1.00 49.50  ?  173 PHE C CD1 1 
ATOM   1151  C  CD2 . PHE B  2 154 ? 117.739 107.593 112.330 1.00 49.50  ?  173 PHE C CD2 1 
ATOM   1152  C  CE1 . PHE B  2 154 ? 115.309 108.821 112.757 1.00 49.50  ?  173 PHE C CE1 1 
ATOM   1153  C  CE2 . PHE B  2 154 ? 117.272 108.522 111.423 1.00 49.50  ?  173 PHE C CE2 1 
ATOM   1154  C  CZ  . PHE B  2 154 ? 116.055 109.137 111.636 1.00 49.50  ?  173 PHE C CZ  1 
ATOM   1155  N  N   . PHE B  2 155 ? 118.191 103.376 112.922 1.00 44.36  ?  174 PHE C N   1 
ATOM   1156  C  CA  . PHE B  2 155 ? 118.558 102.725 111.673 1.00 44.36  ?  174 PHE C CA  1 
ATOM   1157  C  C   . PHE B  2 155 ? 117.625 101.575 111.331 1.00 44.36  ?  174 PHE C C   1 
ATOM   1158  O  O   . PHE B  2 155 ? 117.229 101.430 110.171 1.00 44.36  ?  174 PHE C O   1 
ATOM   1159  C  CB  . PHE B  2 155 ? 120.001 102.228 111.748 1.00 44.36  ?  174 PHE C CB  1 
ATOM   1160  C  CG  . PHE B  2 155 ? 120.430 101.417 110.557 1.00 44.36  ?  174 PHE C CG  1 
ATOM   1161  C  CD1 . PHE B  2 155 ? 120.668 102.017 109.339 1.00 44.36  ?  174 PHE C CD1 1 
ATOM   1162  C  CD2 . PHE B  2 155 ? 120.613 100.050 110.665 1.00 44.36  ?  174 PHE C CD2 1 
ATOM   1163  C  CE1 . PHE B  2 155 ? 121.064 101.267 108.252 1.00 44.36  ?  174 PHE C CE1 1 
ATOM   1164  C  CE2 . PHE B  2 155 ? 121.008 99.301  109.582 1.00 44.36  ?  174 PHE C CE2 1 
ATOM   1165  C  CZ  . PHE B  2 155 ? 121.235 99.909  108.378 1.00 44.36  ?  174 PHE C CZ  1 
ATOM   1166  N  N   . TYR B  2 156 ? 117.278 100.736 112.313 1.00 44.84  ?  175 TYR C N   1 
ATOM   1167  C  CA  . TYR B  2 156 ? 116.466 99.564  111.983 1.00 44.84  ?  175 TYR C CA  1 
ATOM   1168  C  C   . TYR B  2 156 ? 115.019 99.919  111.675 1.00 44.84  ?  175 TYR C C   1 
ATOM   1169  O  O   . TYR B  2 156 ? 114.330 99.153  110.993 1.00 44.84  ?  175 TYR C O   1 
ATOM   1170  C  CB  . TYR B  2 156 ? 116.512 98.515  113.090 1.00 44.84  ?  175 TYR C CB  1 
ATOM   1171  C  CG  . TYR B  2 156 ? 117.747 97.663  113.054 1.00 44.84  ?  175 TYR C CG  1 
ATOM   1172  C  CD1 . TYR B  2 156 ? 117.928 96.726  112.050 1.00 44.84  ?  175 TYR C CD1 1 
ATOM   1173  C  CD2 . TYR B  2 156 ? 118.707 97.754  114.045 1.00 44.84  ?  175 TYR C CD2 1 
ATOM   1174  C  CE1 . TYR B  2 156 ? 119.049 95.935  112.010 1.00 44.84  ?  175 TYR C CE1 1 
ATOM   1175  C  CE2 . TYR B  2 156 ? 119.827 96.959  114.014 1.00 44.84  ?  175 TYR C CE2 1 
ATOM   1176  C  CZ  . TYR B  2 156 ? 119.994 96.056  112.997 1.00 44.84  ?  175 TYR C CZ  1 
ATOM   1177  O  OH  . TYR B  2 156 ? 121.115 95.269  112.974 1.00 44.84  ?  175 TYR C OH  1 
ATOM   1178  N  N   . GLN B  2 157 ? 114.538 101.061 112.152 1.00 47.50  ?  176 GLN C N   1 
ATOM   1179  C  CA  . GLN B  2 157 ? 113.148 101.409 111.893 1.00 47.50  ?  176 GLN C CA  1 
ATOM   1180  C  C   . GLN B  2 157 ? 112.965 101.996 110.502 1.00 47.50  ?  176 GLN C C   1 
ATOM   1181  O  O   . GLN B  2 157 ? 111.911 101.812 109.884 1.00 47.50  ?  176 GLN C O   1 
ATOM   1182  C  CB  . GLN B  2 157 ? 112.654 102.385 112.954 1.00 47.50  ?  176 GLN C CB  1 
ATOM   1183  C  CG  . GLN B  2 157 ? 112.560 101.773 114.327 1.00 47.50  ?  176 GLN C CG  1 
ATOM   1184  C  CD  . GLN B  2 157 ? 112.186 102.787 115.375 1.00 47.50  ?  176 GLN C CD  1 
ATOM   1185  O  OE1 . GLN B  2 157 ? 112.058 103.975 115.086 1.00 47.50  ?  176 GLN C OE1 1 
ATOM   1186  N  NE2 . GLN B  2 157 ? 112.015 102.327 116.607 1.00 47.50  ?  176 GLN C NE2 1 
ATOM   1187  N  N   . ASN B  2 158 ? 113.980 102.689 109.985 1.00 43.52  ?  177 ASN C N   1 
ATOM   1188  C  CA  . ASN B  2 158 ? 113.849 103.469 108.762 1.00 43.52  ?  177 ASN C CA  1 
ATOM   1189  C  C   . ASN B  2 158 ? 114.412 102.762 107.540 1.00 43.52  ?  177 ASN C C   1 
ATOM   1190  O  O   . ASN B  2 158 ? 114.869 103.424 106.602 1.00 43.52  ?  177 ASN C O   1 
ATOM   1191  C  CB  . ASN B  2 158 ? 114.525 104.822 108.950 1.00 43.52  ?  177 ASN C CB  1 
ATOM   1192  C  CG  . ASN B  2 158 ? 113.827 105.669 109.974 1.00 43.52  ?  177 ASN C CG  1 
ATOM   1193  O  OD1 . ASN B  2 158 ? 112.602 105.761 109.986 1.00 43.52  ?  177 ASN C OD1 1 
ATOM   1194  N  ND2 . ASN B  2 158 ? 114.597 106.273 110.862 1.00 43.52  ?  177 ASN C ND2 1 
ATOM   1195  N  N   . ILE B  2 159 ? 114.402 101.435 107.529 1.00 48.69  ?  178 ILE C N   1 
ATOM   1196  C  CA  . ILE B  2 159 ? 114.884 100.639 106.402 1.00 48.69  ?  178 ILE C CA  1 
ATOM   1197  C  C   . ILE B  2 159 ? 113.804 99.609  106.087 1.00 48.69  ?  178 ILE C C   1 
ATOM   1198  O  O   . ILE B  2 159 ? 112.937 99.376  106.941 1.00 48.69  ?  178 ILE C O   1 
ATOM   1199  C  CB  . ILE B  2 159 ? 116.243 99.996  106.729 1.00 48.69  ?  178 ILE C CB  1 
ATOM   1200  C  CG1 . ILE B  2 159 ? 116.163 99.200  108.029 1.00 48.69  ?  178 ILE C CG1 1 
ATOM   1201  C  CG2 . ILE B  2 159 ? 117.343 101.037 106.790 1.00 48.69  ?  178 ILE C CG2 1 
ATOM   1202  C  CD1 . ILE B  2 159 ? 117.440 98.466  108.358 1.00 48.69  ?  178 ILE C CD1 1 
ATOM   1203  N  N   . PRO B  2 160 ? 113.770 99.011  104.891 1.00 56.36  ?  179 PRO C N   1 
ATOM   1204  C  CA  . PRO B  2 160 ? 112.786 97.953  104.623 1.00 56.36  ?  179 PRO C CA  1 
ATOM   1205  C  C   . PRO B  2 160 ? 113.019 96.731  105.499 1.00 56.36  ?  179 PRO C C   1 
ATOM   1206  O  O   . PRO B  2 160 ? 114.116 96.489  106.005 1.00 56.36  ?  179 PRO C O   1 
ATOM   1207  C  CB  . PRO B  2 160 ? 113.004 97.628  103.142 1.00 56.36  ?  179 PRO C CB  1 
ATOM   1208  C  CG  . PRO B  2 160 ? 113.572 98.862  102.577 1.00 56.36  ?  179 PRO C CG  1 
ATOM   1209  C  CD  . PRO B  2 160 ? 114.440 99.437  103.650 1.00 56.36  ?  179 PRO C CD  1 
ATOM   1210  N  N   . PHE B  2 161 ? 111.949 95.957  105.685 1.00 61.09  ?  180 PHE C N   1 
ATOM   1211  C  CA  . PHE B  2 161 ? 111.969 94.903  106.692 1.00 61.09  ?  180 PHE C CA  1 
ATOM   1212  C  C   . PHE B  2 161 ? 112.823 93.712  106.277 1.00 61.09  ?  180 PHE C C   1 
ATOM   1213  O  O   . PHE B  2 161 ? 113.402 93.045  107.141 1.00 61.09  ?  180 PHE C O   1 
ATOM   1214  C  CB  . PHE B  2 161 ? 110.543 94.447  107.003 1.00 61.09  ?  180 PHE C CB  1 
ATOM   1215  C  CG  . PHE B  2 161 ? 110.465 93.426  108.096 1.00 61.09  ?  180 PHE C CG  1 
ATOM   1216  C  CD1 . PHE B  2 161 ? 110.678 93.794  109.416 1.00 61.09  ?  180 PHE C CD1 1 
ATOM   1217  C  CD2 . PHE B  2 161 ? 110.185 92.100  107.809 1.00 61.09  ?  180 PHE C CD2 1 
ATOM   1218  C  CE1 . PHE B  2 161 ? 110.615 92.859  110.429 1.00 61.09  ?  180 PHE C CE1 1 
ATOM   1219  C  CE2 . PHE B  2 161 ? 110.119 91.159  108.819 1.00 61.09  ?  180 PHE C CE2 1 
ATOM   1220  C  CZ  . PHE B  2 161 ? 110.335 91.540  110.131 1.00 61.09  ?  180 PHE C CZ  1 
ATOM   1221  N  N   . ASN B  2 162 ? 112.926 93.442  104.975 1.00 60.99  ?  181 ASN C N   1 
ATOM   1222  C  CA  . ASN B  2 162 ? 113.752 92.331  104.514 1.00 60.99  ?  181 ASN C CA  1 
ATOM   1223  C  C   . ASN B  2 162 ? 115.232 92.590  104.767 1.00 60.99  ?  181 ASN C C   1 
ATOM   1224  O  O   . ASN B  2 162 ? 115.974 91.673  105.136 1.00 60.99  ?  181 ASN C O   1 
ATOM   1225  C  CB  . ASN B  2 162 ? 113.490 92.064  103.032 1.00 60.99  ?  181 ASN C CB  1 
ATOM   1226  C  CG  . ASN B  2 162 ? 113.653 93.306  102.166 1.00 60.99  ?  181 ASN C CG  1 
ATOM   1227  O  OD1 . ASN B  2 162 ? 113.980 94.391  102.651 1.00 60.99  ?  181 ASN C OD1 1 
ATOM   1228  N  ND2 . ASN B  2 162 ? 113.431 93.145  100.868 1.00 60.99  ?  181 ASN C ND2 1 
ATOM   1229  N  N   . ILE B  2 163 ? 115.668 93.841  104.607 1.00 60.45  ?  182 ILE C N   1 
ATOM   1230  C  CA  . ILE B  2 163 ? 117.076 94.170  104.791 1.00 60.45  ?  182 ILE C CA  1 
ATOM   1231  C  C   . ILE B  2 163 ? 117.446 94.121  106.267 1.00 60.45  ?  182 ILE C C   1 
ATOM   1232  O  O   . ILE B  2 163 ? 118.514 93.618  106.630 1.00 60.45  ?  182 ILE C O   1 
ATOM   1233  C  CB  . ILE B  2 163 ? 117.380 95.536  104.152 1.00 60.45  ?  182 ILE C CB  1 
ATOM   1234  C  CG1 . ILE B  2 163 ? 117.149 95.465  102.643 1.00 60.45  ?  182 ILE C CG1 1 
ATOM   1235  C  CG2 . ILE B  2 163 ? 118.802 95.967  104.420 1.00 60.45  ?  182 ILE C CG2 1 
ATOM   1236  C  CD1 . ILE B  2 163 ? 117.165 96.806  101.956 1.00 60.45  ?  182 ILE C CD1 1 
ATOM   1237  N  N   . ALA B  2 164 ? 116.551 94.586  107.144 1.00 57.68  ?  183 ALA C N   1 
ATOM   1238  C  CA  . ALA B  2 164 ? 116.786 94.466  108.581 1.00 57.68  ?  183 ALA C CA  1 
ATOM   1239  C  C   . ALA B  2 164 ? 116.762 93.009  109.027 1.00 57.68  ?  183 ALA C C   1 
ATOM   1240  O  O   . ALA B  2 164 ? 117.545 92.609  109.899 1.00 57.68  ?  183 ALA C O   1 
ATOM   1241  C  CB  . ALA B  2 164 ? 115.750 95.275  109.354 1.00 57.68  ?  183 ALA C CB  1 
ATOM   1242  N  N   . GLN B  2 165 ? 115.896 92.199  108.409 1.00 63.40  ?  184 GLN C N   1 
ATOM   1243  C  CA  . GLN B  2 165 ? 115.851 90.769  108.704 1.00 63.40  ?  184 GLN C CA  1 
ATOM   1244  C  C   . GLN B  2 165 ? 117.143 90.071  108.299 1.00 63.40  ?  184 GLN C C   1 
ATOM   1245  O  O   . GLN B  2 165 ? 117.669 89.241  109.049 1.00 63.40  ?  184 GLN C O   1 
ATOM   1246  C  CB  . GLN B  2 165 ? 114.658 90.136  107.992 1.00 63.40  ?  184 GLN C CB  1 
ATOM   1247  C  CG  . GLN B  2 165 ? 114.529 88.643  108.192 1.00 63.40  ?  184 GLN C CG  1 
ATOM   1248  C  CD  . GLN B  2 165 ? 113.322 88.069  107.486 1.00 63.40  ?  184 GLN C CD  1 
ATOM   1249  O  OE1 . GLN B  2 165 ? 112.551 88.795  106.859 1.00 63.40  ?  184 GLN C OE1 1 
ATOM   1250  N  NE2 . GLN B  2 165 ? 113.164 86.756  107.562 1.00 63.40  ?  184 GLN C NE2 1 
ATOM   1251  N  N   . MET B  2 166 ? 117.673 90.402  107.121 1.00 61.73  ?  185 MET C N   1 
ATOM   1252  C  CA  . MET B  2 166 ? 118.920 89.793  106.671 1.00 61.73  ?  185 MET C CA  1 
ATOM   1253  C  C   . MET B  2 166 ? 120.112 90.331  107.451 1.00 61.73  ?  185 MET C C   1 
ATOM   1254  O  O   . MET B  2 166 ? 121.128 89.645  107.601 1.00 61.73  ?  185 MET C O   1 
ATOM   1255  C  CB  . MET B  2 166 ? 119.114 90.035  105.178 1.00 61.73  ?  185 MET C CB  1 
ATOM   1256  C  CG  . MET B  2 166 ? 118.108 89.336  104.300 1.00 61.73  ?  185 MET C CG  1 
ATOM   1257  S  SD  . MET B  2 166 ? 118.448 89.621  102.555 1.00 61.73  ?  185 MET C SD  1 
ATOM   1258  C  CE  . MET B  2 166 ? 117.992 91.344  102.396 1.00 61.73  ?  185 MET C CE  1 
ATOM   1259  N  N   . LEU B  2 167 ? 120.009 91.561  107.953 1.00 58.65  ?  186 LEU C N   1 
ATOM   1260  C  CA  . LEU B  2 167 ? 121.165 92.196  108.569 1.00 58.65  ?  186 LEU C CA  1 
ATOM   1261  C  C   . LEU B  2 167 ? 121.250 91.853  110.045 1.00 58.65  ?  186 LEU C C   1 
ATOM   1262  O  O   . LEU B  2 167 ? 122.318 91.961  110.656 1.00 58.65  ?  186 LEU C O   1 
ATOM   1263  C  CB  . LEU B  2 167 ? 121.097 93.706  108.346 1.00 58.65  ?  186 LEU C CB  1 
ATOM   1264  C  CG  . LEU B  2 167 ? 122.335 94.583  108.530 1.00 58.65  ?  186 LEU C CG  1 
ATOM   1265  C  CD1 . LEU B  2 167 ? 122.287 95.685  107.492 1.00 58.65  ?  186 LEU C CD1 1 
ATOM   1266  C  CD2 . LEU B  2 167 ? 122.431 95.186  109.916 1.00 58.65  ?  186 LEU C CD2 1 
ATOM   1267  N  N   . ALA B  2 168 ? 120.140 91.432  110.636 1.00 59.10  ?  187 ALA C N   1 
ATOM   1268  C  CA  . ALA B  2 168 ? 120.213 90.911  111.989 1.00 59.10  ?  187 ALA C CA  1 
ATOM   1269  C  C   . ALA B  2 168 ? 120.745 89.486  112.046 1.00 59.10  ?  187 ALA C C   1 
ATOM   1270  O  O   . ALA B  2 168 ? 121.229 89.067  113.101 1.00 59.10  ?  187 ALA C O   1 
ATOM   1271  C  CB  . ALA B  2 168 ? 118.835 90.962  112.640 1.00 59.10  ?  187 ALA C CB  1 
ATOM   1272  N  N   . PHE B  2 169 ? 120.686 88.743  110.938 1.00 60.91  ?  188 PHE C N   1 
ATOM   1273  C  CA  . PHE B  2 169 ? 120.823 87.291  110.955 1.00 60.91  ?  188 PHE C CA  1 
ATOM   1274  C  C   . PHE B  2 169 ? 121.861 86.770  109.966 1.00 60.91  ?  188 PHE C C   1 
ATOM   1275  O  O   . PHE B  2 169 ? 121.582 85.816  109.235 1.00 60.91  ?  188 PHE C O   1 
ATOM   1276  C  CB  . PHE B  2 169 ? 119.461 86.654  110.674 1.00 60.91  ?  188 PHE C CB  1 
ATOM   1277  C  CG  . PHE B  2 169 ? 118.498 86.756  111.819 1.00 60.91  ?  188 PHE C CG  1 
ATOM   1278  C  CD1 . PHE B  2 169 ? 118.957 86.822  113.122 1.00 60.91  ?  188 PHE C CD1 1 
ATOM   1279  C  CD2 . PHE B  2 169 ? 117.138 86.841  111.591 1.00 60.91  ?  188 PHE C CD2 1 
ATOM   1280  C  CE1 . PHE B  2 169 ? 118.080 86.926  114.174 1.00 60.91  ?  188 PHE C CE1 1 
ATOM   1281  C  CE2 . PHE B  2 169 ? 116.259 86.953  112.643 1.00 60.91  ?  188 PHE C CE2 1 
ATOM   1282  C  CZ  . PHE B  2 169 ? 116.730 86.994  113.935 1.00 60.91  ?  188 PHE C CZ  1 
ATOM   1283  N  N   . CYS B  2 170 ? 123.047 87.363  109.921 1.00 69.00  ?  189 CYS C N   1 
ATOM   1284  C  CA  . CYS B  2 170 ? 124.108 86.856  109.064 1.00 69.00  ?  189 CYS C CA  1 
ATOM   1285  C  C   . CYS B  2 170 ? 125.260 86.305  109.898 1.00 69.00  ?  189 CYS C C   1 
ATOM   1286  O  O   . CYS B  2 170 ? 125.497 86.738  111.026 1.00 69.00  ?  189 CYS C O   1 
ATOM   1287  C  CB  . CYS B  2 170 ? 124.616 87.949  108.126 1.00 69.00  ?  189 CYS C CB  1 
ATOM   1288  S  SG  . CYS B  2 170 ? 125.473 89.334  108.933 1.00 69.00  ?  189 CYS C SG  1 
ATOM   1289  N  N   . ASP B  2 171 ? 125.992 85.359  109.312 1.00 74.28  ?  190 ASP C N   1 
ATOM   1290  C  CA  . ASP B  2 171 ? 127.115 84.688  109.968 1.00 74.28  ?  190 ASP C CA  1 
ATOM   1291  C  C   . ASP B  2 171 ? 128.175 84.371  108.917 1.00 74.28  ?  190 ASP C C   1 
ATOM   1292  O  O   . ASP B  2 171 ? 127.984 84.627  107.725 1.00 74.28  ?  190 ASP C O   1 
ATOM   1293  C  CB  . ASP B  2 171 ? 126.644 83.424  110.692 1.00 74.28  ?  190 ASP C CB  1 
ATOM   1294  C  CG  . ASP B  2 171 ? 125.952 83.728  111.998 1.00 74.28  ?  190 ASP C CG  1 
ATOM   1295  O  OD1 . ASP B  2 171 ? 126.412 84.644  112.714 1.00 74.28  ?  190 ASP C OD1 1 
ATOM   1296  O  OD2 . ASP B  2 171 ? 124.924 83.080  112.287 1.00 74.28  ?  190 ASP C OD2 1 
ATOM   1297  N  N   . CYS B  2 172 ? 129.293 83.793  109.358 1.00 80.27  ?  191 CYS C N   1 
ATOM   1298  C  CA  . CYS B  2 172 ? 130.375 83.422  108.457 1.00 80.27  ?  191 CYS C CA  1 
ATOM   1299  C  C   . CYS B  2 172 ? 131.072 82.168  108.955 1.00 80.27  ?  191 CYS C C   1 
ATOM   1300  O  O   . CYS B  2 172 ? 130.996 81.822  110.137 1.00 80.27  ?  191 CYS C O   1 
ATOM   1301  C  CB  . CYS B  2 172 ? 131.420 84.534  108.309 1.00 80.27  ?  191 CYS C CB  1 
ATOM   1302  S  SG  . CYS B  2 172 ? 130.920 85.950  107.327 1.00 80.27  ?  191 CYS C SG  1 
ATOM   1303  N  N   . ALA B  2 173 ? 131.755 81.493  108.032 1.00 84.37  ?  192 ALA C N   1 
ATOM   1304  C  CA  . ALA B  2 173 ? 132.724 80.474  108.408 1.00 84.37  ?  192 ALA C CA  1 
ATOM   1305  C  C   . ALA B  2 173 ? 133.933 81.150  109.037 1.00 84.37  ?  192 ALA C C   1 
ATOM   1306  O  O   . ALA B  2 173 ? 134.224 82.312  108.741 1.00 84.37  ?  192 ALA C O   1 
ATOM   1307  C  CB  . ALA B  2 173 ? 133.141 79.653  107.190 1.00 84.37  ?  192 ALA C CB  1 
ATOM   1308  N  N   . GLN B  2 174 ? 134.635 80.423  109.910 1.00 86.27  ?  193 GLN C N   1 
ATOM   1309  C  CA  . GLN B  2 174 ? 135.727 81.020  110.670 1.00 86.27  ?  193 GLN C CA  1 
ATOM   1310  C  C   . GLN B  2 174 ? 136.933 81.345  109.793 1.00 86.27  ?  193 GLN C C   1 
ATOM   1311  O  O   . GLN B  2 174 ? 137.658 82.305  110.081 1.00 86.27  ?  193 GLN C O   1 
ATOM   1312  C  CB  . GLN B  2 174 ? 136.120 80.079  111.813 1.00 86.27  ?  193 GLN C CB  1 
ATOM   1313  C  CG  . GLN B  2 174 ? 137.103 80.654  112.824 1.00 86.27  ?  193 GLN C CG  1 
ATOM   1314  C  CD  . GLN B  2 174 ? 136.517 81.811  113.608 1.00 86.27  ?  193 GLN C CD  1 
ATOM   1315  O  OE1 . GLN B  2 174 ? 135.342 81.795  113.974 1.00 86.27  ?  193 GLN C OE1 1 
ATOM   1316  N  NE2 . GLN B  2 174 ? 137.338 82.817  113.882 1.00 86.27  ?  193 GLN C NE2 1 
ATOM   1317  N  N   . SER B  2 175 ? 137.138 80.601  108.707 1.00 85.21  ?  194 SER C N   1 
ATOM   1318  C  CA  . SER B  2 175 ? 138.307 80.835  107.866 1.00 85.21  ?  194 SER C CA  1 
ATOM   1319  C  C   . SER B  2 175 ? 138.096 82.025  106.936 1.00 85.21  ?  194 SER C C   1 
ATOM   1320  O  O   . SER B  2 175 ? 139.062 82.674  106.518 1.00 85.21  ?  194 SER C O   1 
ATOM   1321  C  CB  . SER B  2 175 ? 138.631 79.577  107.060 1.00 85.21  ?  194 SER C CB  1 
ATOM   1322  O  OG  . SER B  2 175 ? 137.619 79.310  106.105 1.00 85.21  ?  194 SER C OG  1 
ATOM   1323  N  N   . ASP B  2 176 ? 136.842 82.323  106.594 1.00 82.52  ?  195 ASP C N   1 
ATOM   1324  C  CA  . ASP B  2 176 ? 136.540 83.364  105.617 1.00 82.52  ?  195 ASP C CA  1 
ATOM   1325  C  C   . ASP B  2 176 ? 136.741 84.741  106.242 1.00 82.52  ?  195 ASP C C   1 
ATOM   1326  O  O   . ASP B  2 176 ? 135.886 85.218  106.994 1.00 82.52  ?  195 ASP C O   1 
ATOM   1327  C  CB  . ASP B  2 176 ? 135.108 83.198  105.101 1.00 82.52  ?  195 ASP C CB  1 
ATOM   1328  C  CG  . ASP B  2 176 ? 134.870 83.912  103.786 1.00 82.52  ?  195 ASP C CG  1 
ATOM   1329  O  OD1 . ASP B  2 176 ? 135.817 84.526  103.260 1.00 82.52  ?  195 ASP C OD1 1 
ATOM   1330  O  OD2 . ASP B  2 176 ? 133.735 83.848  103.271 1.00 82.52  ?  195 ASP C OD2 1 
ATOM   1331  N  N   . ILE B  2 177 ? 137.865 85.384  105.940 1.00 77.64  ?  196 ILE C N   1 
ATOM   1332  C  CA  . ILE B  2 177 ? 138.269 86.614  106.627 1.00 77.64  ?  196 ILE C CA  1 
ATOM   1333  C  C   . ILE B  2 177 ? 137.545 87.908  106.211 1.00 77.64  ?  196 ILE C C   1 
ATOM   1334  O  O   . ILE B  2 177 ? 137.274 88.707  107.121 1.00 77.64  ?  196 ILE C O   1 
ATOM   1335  C  CB  . ILE B  2 177 ? 139.811 86.757  106.581 1.00 77.64  ?  196 ILE C CB  1 
ATOM   1336  C  CG1 . ILE B  2 177 ? 140.320 87.837  107.546 1.00 77.64  ?  196 ILE C CG1 1 
ATOM   1337  C  CG2 . ILE B  2 177 ? 140.373 86.966  105.182 1.00 77.64  ?  196 ILE C CG2 1 
ATOM   1338  C  CD1 . ILE B  2 177 ? 140.086 87.516  109.005 1.00 77.64  ?  196 ILE C CD1 1 
ATOM   1339  N  N   . PRO B  2 178 ? 137.168 88.205  104.942 1.00 72.06  ?  197 PRO C N   1 
ATOM   1340  C  CA  . PRO B  2 178 ? 136.598 89.546  104.705 1.00 72.06  ?  197 PRO C CA  1 
ATOM   1341  C  C   . PRO B  2 178 ? 135.175 89.723  105.221 1.00 72.06  ?  197 PRO C C   1 
ATOM   1342  O  O   . PRO B  2 178 ? 134.844 90.815  105.699 1.00 72.06  ?  197 PRO C O   1 
ATOM   1343  C  CB  . PRO B  2 178 ? 136.660 89.695  103.181 1.00 72.06  ?  197 PRO C CB  1 
ATOM   1344  C  CG  . PRO B  2 178 ? 136.501 88.360  102.688 1.00 72.06  ?  197 PRO C CG  1 
ATOM   1345  C  CD  . PRO B  2 178 ? 137.184 87.460  103.660 1.00 72.06  ?  197 PRO C CD  1 
ATOM   1346  N  N   . CYS B  2 179 ? 134.329 88.691  105.167 1.00 72.78  ?  198 CYS C N   1 
ATOM   1347  C  CA  . CYS B  2 179 ? 132.981 88.833  105.705 1.00 72.78  ?  198 CYS C CA  1 
ATOM   1348  C  C   . CYS B  2 179 ? 133.002 88.849  107.224 1.00 72.78  ?  198 CYS C C   1 
ATOM   1349  O  O   . CYS B  2 179 ? 132.218 89.570  107.852 1.00 72.78  ?  198 CYS C O   1 
ATOM   1350  C  CB  . CYS B  2 179 ? 132.080 87.707  105.210 1.00 72.78  ?  198 CYS C CB  1 
ATOM   1351  S  SG  . CYS B  2 179 ? 132.408 86.122  105.959 1.00 72.78  ?  198 CYS C SG  1 
ATOM   1352  N  N   . GLN B  2 180 ? 133.903 88.065  107.819 1.00 74.91  ?  199 GLN C N   1 
ATOM   1353  C  CA  . GLN B  2 180 ? 134.141 88.143  109.255 1.00 74.91  ?  199 GLN C CA  1 
ATOM   1354  C  C   . GLN B  2 180 ? 134.629 89.525  109.661 1.00 74.91  ?  199 GLN C C   1 
ATOM   1355  O  O   . GLN B  2 180 ? 134.258 90.025  110.728 1.00 74.91  ?  199 GLN C O   1 
ATOM   1356  C  CB  . GLN B  2 180 ? 135.154 87.075  109.669 1.00 74.91  ?  199 GLN C CB  1 
ATOM   1357  C  CG  . GLN B  2 180 ? 135.454 87.025  111.155 1.00 74.91  ?  199 GLN C CG  1 
ATOM   1358  C  CD  . GLN B  2 180 ? 136.431 85.929  111.512 1.00 74.91  ?  199 GLN C CD  1 
ATOM   1359  O  OE1 . GLN B  2 180 ? 136.902 85.195  110.645 1.00 74.91  ?  199 GLN C OE1 1 
ATOM   1360  N  NE2 . GLN B  2 180 ? 136.749 85.815  112.796 1.00 74.91  ?  199 GLN C NE2 1 
ATOM   1361  N  N   . GLN B  2 181 ? 135.422 90.172  108.806 1.00 69.52  ?  200 GLN C N   1 
ATOM   1362  C  CA  . GLN B  2 181 ? 135.895 91.518  109.082 1.00 69.52  ?  200 GLN C CA  1 
ATOM   1363  C  C   . GLN B  2 181 ? 134.801 92.569  108.931 1.00 69.52  ?  200 GLN C C   1 
ATOM   1364  O  O   . GLN B  2 181 ? 134.733 93.496  109.745 1.00 69.52  ?  200 GLN C O   1 
ATOM   1365  C  CB  . GLN B  2 181 ? 137.073 91.846  108.164 1.00 69.52  ?  200 GLN C CB  1 
ATOM   1366  C  CG  . GLN B  2 181 ? 137.742 93.169  108.471 1.00 69.52  ?  200 GLN C CG  1 
ATOM   1367  C  CD  . GLN B  2 181 ? 138.392 93.180  109.840 1.00 69.52  ?  200 GLN C CD  1 
ATOM   1368  O  OE1 . GLN B  2 181 ? 139.031 92.210  110.245 1.00 69.52  ?  200 GLN C OE1 1 
ATOM   1369  N  NE2 . GLN B  2 181 ? 138.224 94.279  110.564 1.00 69.52  ?  200 GLN C NE2 1 
ATOM   1370  N  N   . SER B  2 182 ? 133.942 92.446  107.921 1.00 64.43  ?  201 SER C N   1 
ATOM   1371  C  CA  . SER B  2 182 ? 132.838 93.383  107.751 1.00 64.43  ?  201 SER C CA  1 
ATOM   1372  C  C   . SER B  2 182 ? 131.713 93.155  108.751 1.00 64.43  ?  201 SER C C   1 
ATOM   1373  O  O   . SER B  2 182 ? 130.872 94.044  108.929 1.00 64.43  ?  201 SER C O   1 
ATOM   1374  C  CB  . SER B  2 182 ? 132.278 93.301  106.329 1.00 64.43  ?  201 SER C CB  1 
ATOM   1375  O  OG  . SER B  2 182 ? 131.636 92.064  106.107 1.00 64.43  ?  201 SER C OG  1 
ATOM   1376  N  N   . LYS B  2 183 ? 131.675 91.991  109.396 1.00 66.82  ?  202 LYS C N   1 
ATOM   1377  C  CA  . LYS B  2 183 ? 130.701 91.721  110.442 1.00 66.82  ?  202 LYS C CA  1 
ATOM   1378  C  C   . LYS B  2 183 ? 130.902 92.596  111.675 1.00 66.82  ?  202 LYS C C   1 
ATOM   1379  O  O   . LYS B  2 183 ? 129.916 92.947  112.329 1.00 66.82  ?  202 LYS C O   1 
ATOM   1380  C  CB  . LYS B  2 183 ? 130.747 90.235  110.828 1.00 66.82  ?  202 LYS C CB  1 
ATOM   1381  C  CG  . LYS B  2 183 ? 129.632 89.776  111.757 1.00 66.82  ?  202 LYS C CG  1 
ATOM   1382  C  CD  . LYS B  2 183 ? 129.673 88.278  112.002 1.00 66.82  ?  202 LYS C CD  1 
ATOM   1383  C  CE  . LYS B  2 183 ? 130.805 87.901  112.942 1.00 66.82  ?  202 LYS C CE  1 
ATOM   1384  N  NZ  . LYS B  2 183 ? 130.764 86.459  113.313 1.00 66.82  ?  202 LYS C NZ  1 
ATOM   1385  N  N   . GLU B  2 184 ? 132.136 92.995  111.997 1.00 68.54  ?  203 GLU C N   1 
ATOM   1386  C  CA  . GLU B  2 184 ? 132.316 93.973  113.063 1.00 68.54  ?  203 GLU C CA  1 
ATOM   1387  C  C   . GLU B  2 184 ? 131.980 95.388  112.625 1.00 68.54  ?  203 GLU C C   1 
ATOM   1388  O  O   . GLU B  2 184 ? 131.904 96.282  113.474 1.00 68.54  ?  203 GLU C O   1 
ATOM   1389  C  CB  . GLU B  2 184 ? 133.748 93.975  113.608 1.00 68.54  ?  203 GLU C CB  1 
ATOM   1390  C  CG  . GLU B  2 184 ? 134.170 92.704  114.308 1.00 68.54  ?  203 GLU C CG  1 
ATOM   1391  C  CD  . GLU B  2 184 ? 134.912 91.771  113.387 1.00 68.54  ?  203 GLU C CD  1 
ATOM   1392  O  OE1 . GLU B  2 184 ? 135.237 92.204  112.268 1.00 68.54  ?  203 GLU C OE1 1 
ATOM   1393  O  OE2 . GLU B  2 184 ? 135.169 90.614  113.778 1.00 68.54  ?  203 GLU C OE2 1 
ATOM   1394  N  N   . ALA B  2 185 ? 131.792 95.617  111.327 1.00 63.98  ?  204 ALA C N   1 
ATOM   1395  C  CA  . ALA B  2 185 ? 131.439 96.938  110.829 1.00 63.98  ?  204 ALA C CA  1 
ATOM   1396  C  C   . ALA B  2 185 ? 129.935 97.123  110.698 1.00 63.98  ?  204 ALA C C   1 
ATOM   1397  O  O   . ALA B  2 185 ? 129.420 98.200  111.016 1.00 63.98  ?  204 ALA C O   1 
ATOM   1398  C  CB  . ALA B  2 185 ? 132.111 97.190  109.478 1.00 63.98  ?  204 ALA C CB  1 
ATOM   1399  N  N   . LEU B  2 186 ? 129.217 96.101  110.226 1.00 61.14  ?  205 LEU C N   1 
ATOM   1400  C  CA  . LEU B  2 186 ? 127.768 96.229  110.096 1.00 61.14  ?  205 LEU C CA  1 
ATOM   1401  C  C   . LEU B  2 186 ? 127.089 96.224  111.455 1.00 61.14  ?  205 LEU C C   1 
ATOM   1402  O  O   . LEU B  2 186 ? 126.233 97.070  111.732 1.00 61.14  ?  205 LEU C O   1 
ATOM   1403  C  CB  . LEU B  2 186 ? 127.205 95.107  109.232 1.00 61.14  ?  205 LEU C CB  1 
ATOM   1404  C  CG  . LEU B  2 186 ? 127.572 95.103  107.755 1.00 61.14  ?  205 LEU C CG  1 
ATOM   1405  C  CD1 . LEU B  2 186 ? 126.989 93.867  107.114 1.00 61.14  ?  205 LEU C CD1 1 
ATOM   1406  C  CD2 . LEU B  2 186 ? 127.062 96.354  107.077 1.00 61.14  ?  205 LEU C CD2 1 
ATOM   1407  N  N   . HIS B  2 187 ? 127.457 95.281  112.317 1.00 65.07  ?  206 HIS C N   1 
ATOM   1408  C  CA  . HIS B  2 187 ? 126.876 95.186  113.647 1.00 65.07  ?  206 HIS C CA  1 
ATOM   1409  C  C   . HIS B  2 187 ? 127.455 96.193  114.628 1.00 65.07  ?  206 HIS C C   1 
ATOM   1410  O  O   . HIS B  2 187 ? 126.880 96.362  115.710 1.00 65.07  ?  206 HIS C O   1 
ATOM   1411  C  CB  . HIS B  2 187 ? 127.063 93.774  114.211 1.00 65.07  ?  206 HIS C CB  1 
ATOM   1412  C  CG  . HIS B  2 187 ? 126.264 92.729  113.500 1.00 65.07  ?  206 HIS C CG  1 
ATOM   1413  N  ND1 . HIS B  2 187 ? 126.732 92.063  112.388 1.00 65.07  ?  206 HIS C ND1 1 
ATOM   1414  C  CD2 . HIS B  2 187 ? 125.029 92.232  113.743 1.00 65.07  ?  206 HIS C CD2 1 
ATOM   1415  C  CE1 . HIS B  2 187 ? 125.819 91.203  111.976 1.00 65.07  ?  206 HIS C CE1 1 
ATOM   1416  N  NE2 . HIS B  2 187 ? 124.776 91.285  112.781 1.00 65.07  ?  206 HIS C NE2 1 
ATOM   1417  N  N   . SER B  2 188 ? 128.547 96.873  114.255 1.00 66.91  ?  207 SER C N   1 
ATOM   1418  C  CA  . SER B  2 188 ? 129.324 97.766  115.125 1.00 66.91  ?  207 SER C CA  1 
ATOM   1419  C  C   . SER B  2 188 ? 129.722 97.057  116.414 1.00 66.91  ?  207 SER C C   1 
ATOM   1420  O  O   . SER B  2 188 ? 129.374 97.477  117.519 1.00 66.91  ?  207 SER C O   1 
ATOM   1421  C  CB  . SER B  2 188 ? 128.575 99.066  115.423 1.00 66.91  ?  207 SER C CB  1 
ATOM   1422  O  OG  . SER B  2 188 ? 127.458 98.830  116.259 1.00 66.91  ?  207 SER C OG  1 
ATOM   1423  N  N   . LYS B  2 189 ? 130.466 95.960  116.255 1.00 70.89  ?  208 LYS C N   1 
ATOM   1424  C  CA  . LYS B  2 189 ? 130.761 95.088  117.387 1.00 70.89  ?  208 LYS C CA  1 
ATOM   1425  C  C   . LYS B  2 189 ? 131.780 95.714  118.327 1.00 70.89  ?  208 LYS C C   1 
ATOM   1426  O  O   . LYS B  2 189 ? 131.895 95.304  119.486 1.00 70.89  ?  208 LYS C O   1 
ATOM   1427  C  CB  . LYS B  2 189 ? 131.255 93.733  116.886 1.00 70.89  ?  208 LYS C CB  1 
ATOM   1428  C  CG  . LYS B  2 189 ? 130.185 92.908  116.194 1.00 70.89  ?  208 LYS C CG  1 
ATOM   1429  C  CD  . LYS B  2 189 ? 130.752 91.608  115.646 1.00 70.89  ?  208 LYS C CD  1 
ATOM   1430  C  CE  . LYS B  2 189 ? 131.104 90.634  116.760 1.00 70.89  ?  208 LYS C CE  1 
ATOM   1431  N  NZ  . LYS B  2 189 ? 129.894 90.120  117.457 1.00 70.89  ?  208 LYS C NZ  1 
ATOM   1432  N  N   . THR B  2 190 ? 132.525 96.710  117.853 1.00 71.31  ?  209 THR C N   1 
ATOM   1433  C  CA  . THR B  2 190 ? 133.481 97.377  118.727 1.00 71.31  ?  209 THR C CA  1 
ATOM   1434  C  C   . THR B  2 190 ? 132.795 98.358  119.668 1.00 71.31  ?  209 THR C C   1 
ATOM   1435  O  O   . THR B  2 190 ? 133.112 98.391  120.862 1.00 71.31  ?  209 THR C O   1 
ATOM   1436  C  CB  . THR B  2 190 ? 134.538 98.097  117.893 1.00 71.31  ?  209 THR C CB  1 
ATOM   1437  O  OG1 . THR B  2 190 ? 133.909 99.110  117.100 1.00 71.31  ?  209 THR C OG1 1 
ATOM   1438  C  CG2 . THR B  2 190 ? 135.245 97.113  116.975 1.00 71.31  ?  209 THR C CG2 1 
ATOM   1439  N  N   . CYS B  2 191 ? 131.851 99.154  119.158 1.00 73.59  ?  210 CYS C N   1 
ATOM   1440  C  CA  . CYS B  2 191 ? 131.243 100.226 119.932 1.00 73.59  ?  210 CYS C CA  1 
ATOM   1441  C  C   . CYS B  2 191 ? 129.884 99.884  120.521 1.00 73.59  ?  210 CYS C C   1 
ATOM   1442  O  O   . CYS B  2 191 ? 129.376 100.661 121.334 1.00 73.59  ?  210 CYS C O   1 
ATOM   1443  C  CB  . CYS B  2 191 ? 131.098 101.491 119.070 1.00 73.59  ?  210 CYS C CB  1 
ATOM   1444  S  SG  . CYS B  2 191 ? 132.673 102.239 118.578 1.00 73.59  ?  210 CYS C SG  1 
ATOM   1445  N  N   . ALA B  2 192 ? 129.283 98.769  120.139 1.00 66.10  ?  211 ALA C N   1 
ATOM   1446  C  CA  . ALA B  2 192 ? 127.968 98.440  120.681 1.00 66.10  ?  211 ALA C CA  1 
ATOM   1447  C  C   . ALA B  2 192 ? 127.895 97.060  121.314 1.00 66.10  ?  211 ALA C C   1 
ATOM   1448  O  O   . ALA B  2 192 ? 127.234 96.901  122.341 1.00 66.10  ?  211 ALA C O   1 
ATOM   1449  C  CB  . ALA B  2 192 ? 126.906 98.557  119.581 1.00 66.10  ?  211 ALA C CB  1 
ATOM   1450  N  N   . VAL B  2 193 ? 128.553 96.059  120.734 1.00 62.98  ?  212 VAL C N   1 
ATOM   1451  C  CA  . VAL B  2 193 ? 128.389 94.684  121.190 1.00 62.98  ?  212 VAL C CA  1 
ATOM   1452  C  C   . VAL B  2 193 ? 129.444 94.326  122.228 1.00 62.98  ?  212 VAL C C   1 
ATOM   1453  O  O   . VAL B  2 193 ? 129.114 94.023  123.378 1.00 62.98  ?  212 VAL C O   1 
ATOM   1454  C  CB  . VAL B  2 193 ? 128.438 93.703  120.007 1.00 62.98  ?  212 VAL C CB  1 
ATOM   1455  C  CG1 . VAL B  2 193 ? 128.315 92.274  120.499 1.00 62.98  ?  212 VAL C CG1 1 
ATOM   1456  C  CG2 . VAL B  2 193 ? 127.345 94.027  119.009 1.00 62.98  ?  212 VAL C CG2 1 
ATOM   1457  N  N   . ASN B  2 194 ? 130.716 94.354  121.838 1.00 66.83  ?  213 ASN C N   1 
ATOM   1458  C  CA  . ASN B  2 194 ? 131.794 93.934  122.729 1.00 66.83  ?  213 ASN C CA  1 
ATOM   1459  C  C   . ASN B  2 194 ? 132.173 95.087  123.646 1.00 66.83  ?  213 ASN C C   1 
ATOM   1460  O  O   . ASN B  2 194 ? 133.066 95.877  123.325 1.00 66.83  ?  213 ASN C O   1 
ATOM   1461  C  CB  . ASN B  2 194 ? 133.009 93.463  121.935 1.00 66.83  ?  213 ASN C CB  1 
ATOM   1462  C  CG  . ASN B  2 194 ? 132.728 92.223  121.122 1.00 66.83  ?  213 ASN C CG  1 
ATOM   1463  O  OD1 . ASN B  2 194 ? 132.744 92.256  119.892 1.00 66.83  ?  213 ASN C OD1 1 
ATOM   1464  N  ND2 . ASN B  2 194 ? 132.475 91.114  121.805 1.00 66.83  ?  213 ASN C ND2 1 
ATOM   1465  N  N   . MET B  2 195 ? 131.501 95.185  124.784 1.00 66.20  ?  214 MET C N   1 
ATOM   1466  C  CA  . MET B  2 195 ? 131.923 96.058  125.865 1.00 66.20  ?  214 MET C CA  1 
ATOM   1467  C  C   . MET B  2 195 ? 132.885 95.279  126.751 1.00 66.20  ?  214 MET C C   1 
ATOM   1468  O  O   . MET B  2 195 ? 132.646 94.108  127.054 1.00 66.20  ?  214 MET C O   1 
ATOM   1469  C  CB  . MET B  2 195 ? 130.726 96.551  126.676 1.00 66.20  ?  214 MET C CB  1 
ATOM   1470  C  CG  . MET B  2 195 ? 131.073 97.570  127.741 1.00 66.20  ?  214 MET C CG  1 
ATOM   1471  S  SD  . MET B  2 195 ? 129.634 98.110  128.679 1.00 66.20  ?  214 MET C SD  1 
ATOM   1472  C  CE  . MET B  2 195 ? 128.791 99.103  127.452 1.00 66.20  ?  214 MET C CE  1 
ATOM   1473  N  N   . VAL B  2 196 ? 133.981 95.918  127.146 1.00 66.78  ?  215 VAL C N   1 
ATOM   1474  C  CA  . VAL B  2 196 ? 135.009 95.239  127.931 1.00 66.78  ?  215 VAL C CA  1 
ATOM   1475  C  C   . VAL B  2 196 ? 135.096 95.879  129.311 1.00 66.78  ?  215 VAL C C   1 
ATOM   1476  O  O   . VAL B  2 196 ? 135.291 97.098  129.410 1.00 66.78  ?  215 VAL C O   1 
ATOM   1477  C  CB  . VAL B  2 196 ? 136.367 95.274  127.214 1.00 66.78  ?  215 VAL C CB  1 
ATOM   1478  C  CG1 . VAL B  2 196 ? 137.448 94.681  128.099 1.00 66.78  ?  215 VAL C CG1 1 
ATOM   1479  C  CG2 . VAL B  2 196 ? 136.284 94.516  125.902 1.00 66.78  ?  215 VAL C CG2 1 
ATOM   1480  N  N   . PRO B  2 197 ? 134.955 95.109  130.407 1.00 66.03  ?  216 PRO C N   1 
ATOM   1481  C  CA  . PRO B  2 197 ? 134.681 93.667  130.471 1.00 66.03  ?  216 PRO C CA  1 
ATOM   1482  C  C   . PRO B  2 197 ? 133.210 93.336  130.224 1.00 66.03  ?  216 PRO C C   1 
ATOM   1483  O  O   . PRO B  2 197 ? 132.362 94.154  130.580 1.00 66.03  ?  216 PRO C O   1 
ATOM   1484  C  CB  . PRO B  2 197 ? 135.088 93.301  131.898 1.00 66.03  ?  216 PRO C CB  1 
ATOM   1485  C  CG  . PRO B  2 197 ? 134.870 94.544  132.670 1.00 66.03  ?  216 PRO C CG  1 
ATOM   1486  C  CD  . PRO B  2 197 ? 135.199 95.677  131.744 1.00 66.03  ?  216 PRO C CD  1 
ATOM   1487  N  N   . PRO B  2 198 ? 132.928 92.190  129.605 1.00 60.21  ?  217 PRO C N   1 
ATOM   1488  C  CA  . PRO B  2 198 ? 131.547 91.852  129.243 1.00 60.21  ?  217 PRO C CA  1 
ATOM   1489  C  C   . PRO B  2 198 ? 130.697 91.631  130.479 1.00 60.21  ?  217 PRO C C   1 
ATOM   1490  O  O   . PRO B  2 198 ? 131.098 90.899  131.395 1.00 60.21  ?  217 PRO C O   1 
ATOM   1491  C  CB  . PRO B  2 198 ? 131.701 90.556  128.435 1.00 60.21  ?  217 PRO C CB  1 
ATOM   1492  C  CG  . PRO B  2 198 ? 133.105 90.568  127.958 1.00 60.21  ?  217 PRO C CG  1 
ATOM   1493  C  CD  . PRO B  2 198 ? 133.883 91.211  129.062 1.00 60.21  ?  217 PRO C CD  1 
ATOM   1494  N  N   . PRO B  2 199 ? 129.530 92.263  130.552 1.00 52.77  ?  218 PRO C N   1 
ATOM   1495  C  CA  . PRO B  2 199 ? 128.702 92.142  131.753 1.00 52.77  ?  218 PRO C CA  1 
ATOM   1496  C  C   . PRO B  2 199 ? 127.986 90.806  131.792 1.00 52.77  ?  218 PRO C C   1 
ATOM   1497  O  O   . PRO B  2 199 ? 127.896 90.097  130.789 1.00 52.77  ?  218 PRO C O   1 
ATOM   1498  C  CB  . PRO B  2 199 ? 127.708 93.297  131.608 1.00 52.77  ?  218 PRO C CB  1 
ATOM   1499  C  CG  . PRO B  2 199 ? 127.578 93.463  130.137 1.00 52.77  ?  218 PRO C CG  1 
ATOM   1500  C  CD  . PRO B  2 199 ? 128.925 93.157  129.552 1.00 52.77  ?  218 PRO C CD  1 
ATOM   1501  N  N   . THR B  2 200 ? 127.485 90.459  132.972 1.00 48.95  ?  219 THR C N   1 
ATOM   1502  C  CA  . THR B  2 200 ? 126.678 89.259  133.110 1.00 48.95  ?  219 THR C CA  1 
ATOM   1503  C  C   . THR B  2 200 ? 125.323 89.468  132.446 1.00 48.95  ?  219 THR C C   1 
ATOM   1504  O  O   . THR B  2 200 ? 124.873 90.600  132.257 1.00 48.95  ?  219 THR C O   1 
ATOM   1505  C  CB  . THR B  2 200 ? 126.494 88.915  134.583 1.00 48.95  ?  219 THR C CB  1 
ATOM   1506  O  OG1 . THR B  2 200 ? 125.791 89.980  135.232 1.00 48.95  ?  219 THR C OG1 1 
ATOM   1507  C  CG2 . THR B  2 200 ? 127.840 88.750  135.248 1.00 48.95  ?  219 THR C CG2 1 
ATOM   1508  N  N   . CYS B  2 201 ? 124.669 88.362  132.080 1.00 46.22  ?  220 CYS C N   1 
ATOM   1509  C  CA  . CYS B  2 201 ? 123.368 88.467  131.427 1.00 46.22  ?  220 CYS C CA  1 
ATOM   1510  C  C   . CYS B  2 201 ? 122.289 88.910  132.404 1.00 46.22  ?  220 CYS C C   1 
ATOM   1511  O  O   . CYS B  2 201 ? 121.306 89.545  131.994 1.00 46.22  ?  220 CYS C O   1 
ATOM   1512  C  CB  . CYS B  2 201 ? 122.993 87.135  130.785 1.00 46.22  ?  220 CYS C CB  1 
ATOM   1513  S  SG  . CYS B  2 201 ? 124.150 86.575  129.514 1.00 46.22  ?  220 CYS C SG  1 
ATOM   1514  N  N   . LEU B  2 202 ? 122.466 88.592  133.690 1.00 44.66  ?  221 LEU C N   1 
ATOM   1515  C  CA  . LEU B  2 202 ? 121.559 89.088  134.717 1.00 44.66  ?  221 LEU C CA  1 
ATOM   1516  C  C   . LEU B  2 202 ? 121.577 90.607  134.780 1.00 44.66  ?  221 LEU C C   1 
ATOM   1517  O  O   . LEU B  2 202 ? 120.520 91.240  134.881 1.00 44.66  ?  221 LEU C O   1 
ATOM   1518  C  CB  . LEU B  2 202 ? 121.932 88.500  136.073 1.00 44.66  ?  221 LEU C CB  1 
ATOM   1519  C  CG  . LEU B  2 202 ? 121.712 87.004  136.231 1.00 44.66  ?  221 LEU C CG  1 
ATOM   1520  C  CD1 . LEU B  2 202 ? 122.278 86.520  137.548 1.00 44.66  ?  221 LEU C CD1 1 
ATOM   1521  C  CD2 . LEU B  2 202 ? 120.236 86.741  136.159 1.00 44.66  ?  221 LEU C CD2 1 
ATOM   1522  N  N   . SER B  2 203 ? 122.763 91.213  134.670 1.00 45.16  ?  222 SER C N   1 
ATOM   1523  C  CA  . SER B  2 203 ? 122.842 92.667  134.724 1.00 45.16  ?  222 SER C CA  1 
ATOM   1524  C  C   . SER B  2 203 ? 122.301 93.304  133.450 1.00 45.16  ?  222 SER C C   1 
ATOM   1525  O  O   . SER B  2 203 ? 121.759 94.414  133.490 1.00 45.16  ?  222 SER C O   1 
ATOM   1526  C  CB  . SER B  2 203 ? 124.277 93.105  134.989 1.00 45.16  ?  222 SER C CB  1 
ATOM   1527  O  OG  . SER B  2 203 ? 124.702 92.665  136.268 1.00 45.16  ?  222 SER C OG  1 
ATOM   1528  N  N   . VAL B  2 204 ? 122.395 92.598  132.320 1.00 43.25  ?  223 VAL C N   1 
ATOM   1529  C  CA  . VAL B  2 204 ? 121.792 93.089  131.082 1.00 43.25  ?  223 VAL C CA  1 
ATOM   1530  C  C   . VAL B  2 204 ? 120.269 93.093  131.193 1.00 43.25  ?  223 VAL C C   1 
ATOM   1531  O  O   . VAL B  2 204 ? 119.604 94.047  130.769 1.00 43.25  ?  223 VAL C O   1 
ATOM   1532  C  CB  . VAL B  2 204 ? 122.281 92.252  129.885 1.00 43.25  ?  223 VAL C CB  1 
ATOM   1533  C  CG1 . VAL B  2 204 ? 121.562 92.638  128.611 1.00 43.25  ?  223 VAL C CG1 1 
ATOM   1534  C  CG2 . VAL B  2 204 ? 123.764 92.433  129.702 1.00 43.25  ?  223 VAL C CG2 1 
ATOM   1535  N  N   . ILE B  2 205 ? 119.697 92.062  131.821 1.00 43.61  ?  224 ILE C N   1 
ATOM   1536  C  CA  . ILE B  2 205 ? 118.242 92.005  131.976 1.00 43.61  ?  224 ILE C CA  1 
ATOM   1537  C  C   . ILE B  2 205 ? 117.751 93.010  133.022 1.00 43.61  ?  224 ILE C C   1 
ATOM   1538  O  O   . ILE B  2 205 ? 116.685 93.623  132.857 1.00 43.61  ?  224 ILE C O   1 
ATOM   1539  C  CB  . ILE B  2 205 ? 117.816 90.558  132.283 1.00 43.61  ?  224 ILE C CB  1 
ATOM   1540  C  CG1 . ILE B  2 205 ? 118.108 89.688  131.065 1.00 43.61  ?  224 ILE C CG1 1 
ATOM   1541  C  CG2 . ILE B  2 205 ? 116.349 90.446  132.631 1.00 43.61  ?  224 ILE C CG2 1 
ATOM   1542  C  CD1 . ILE B  2 205 ? 117.367 90.134  129.828 1.00 43.61  ?  224 ILE C CD1 1 
ATOM   1543  N  N   . ARG B  2 206 ? 118.529 93.228  134.087 1.00 44.07  ?  225 ARG C N   1 
ATOM   1544  C  CA  . ARG B  2 206 ? 118.228 94.305  135.034 1.00 44.07  ?  225 ARG C CA  1 
ATOM   1545  C  C   . ARG B  2 206 ? 118.248 95.671  134.356 1.00 44.07  ?  225 ARG C C   1 
ATOM   1546  O  O   . ARG B  2 206 ? 117.336 96.487  134.550 1.00 44.07  ?  225 ARG C O   1 
ATOM   1547  C  CB  . ARG B  2 206 ? 119.223 94.287  136.195 1.00 44.07  ?  225 ARG C CB  1 
ATOM   1548  C  CG  . ARG B  2 206 ? 118.783 93.572  137.468 1.00 44.07  ?  225 ARG C CG  1 
ATOM   1549  C  CD  . ARG B  2 206 ? 118.589 92.098  137.258 1.00 44.07  ?  225 ARG C CD  1 
ATOM   1550  N  NE  . ARG B  2 206 ? 118.503 91.355  138.504 1.00 44.07  ?  225 ARG C NE  1 
ATOM   1551  C  CZ  . ARG B  2 206 ? 119.554 90.791  139.087 1.00 44.07  ?  225 ARG C CZ  1 
ATOM   1552  N  NH1 . ARG B  2 206 ? 119.417 90.122  140.223 1.00 44.07  ?  225 ARG C NH1 1 
ATOM   1553  N  NH2 . ARG B  2 206 ? 120.749 90.884  138.518 1.00 44.07  ?  225 ARG C NH2 1 
ATOM   1554  N  N   . SER B  2 207 ? 119.270 95.923  133.532 1.00 45.70  ?  226 SER C N   1 
ATOM   1555  C  CA  . SER B  2 207 ? 119.398 97.211  132.859 1.00 45.70  ?  226 SER C CA  1 
ATOM   1556  C  C   . SER B  2 207 ? 118.297 97.412  131.829 1.00 45.70  ?  226 SER C C   1 
ATOM   1557  O  O   . SER B  2 207 ? 117.852 98.540  131.594 1.00 45.70  ?  226 SER C O   1 
ATOM   1558  C  CB  . SER B  2 207 ? 120.769 97.318  132.198 1.00 45.70  ?  226 SER C CB  1 
ATOM   1559  O  OG  . SER B  2 207 ? 120.885 98.531  131.479 1.00 45.70  ?  226 SER C OG  1 
ATOM   1560  N  N   . CYS B  2 208 ? 117.845 96.326  131.201 1.00 48.76  ?  227 CYS C N   1 
ATOM   1561  C  CA  . CYS B  2 208 ? 116.729 96.432  130.270 1.00 48.76  ?  227 CYS C CA  1 
ATOM   1562  C  C   . CYS B  2 208 ? 115.419 96.730  130.980 1.00 48.76  ?  227 CYS C C   1 
ATOM   1563  O  O   . CYS B  2 208 ? 114.700 97.648  130.580 1.00 48.76  ?  227 CYS C O   1 
ATOM   1564  C  CB  . CYS B  2 208 ? 116.583 95.153  129.462 1.00 48.76  ?  227 CYS C CB  1 
ATOM   1565  S  SG  . CYS B  2 208 ? 115.180 95.225  128.370 1.00 48.76  ?  227 CYS C SG  1 
ATOM   1566  N  N   . GLN B  2 209 ? 115.089 95.978  132.029 1.00 51.28  ?  228 GLN C N   1 
ATOM   1567  C  CA  . GLN B  2 209 ? 113.820 96.200  132.710 1.00 51.28  ?  228 GLN C CA  1 
ATOM   1568  C  C   . GLN B  2 209 ? 113.804 97.448  133.584 1.00 51.28  ?  228 GLN C C   1 
ATOM   1569  O  O   . GLN B  2 209 ? 112.729 97.829  134.057 1.00 51.28  ?  228 GLN C O   1 
ATOM   1570  C  CB  . GLN B  2 209 ? 113.444 94.984  133.553 1.00 51.28  ?  228 GLN C CB  1 
ATOM   1571  C  CG  . GLN B  2 209 ? 113.000 93.799  132.733 1.00 51.28  ?  228 GLN C CG  1 
ATOM   1572  C  CD  . GLN B  2 209 ? 112.637 92.614  133.591 1.00 51.28  ?  228 GLN C CD  1 
ATOM   1573  O  OE1 . GLN B  2 209 ? 112.804 92.642  134.810 1.00 51.28  ?  228 GLN C OE1 1 
ATOM   1574  N  NE2 . GLN B  2 209 ? 112.129 91.564  132.962 1.00 51.28  ?  228 GLN C NE2 1 
ATOM   1575  N  N   . ASN B  2 210 ? 114.944 98.096  133.813 1.00 54.42  ?  229 ASN C N   1 
ATOM   1576  C  CA  . ASN B  2 210 ? 114.921 99.404  134.454 1.00 54.42  ?  229 ASN C CA  1 
ATOM   1577  C  C   . ASN B  2 210 ? 114.784 100.552 133.460 1.00 54.42  ?  229 ASN C C   1 
ATOM   1578  O  O   . ASN B  2 210 ? 114.904 101.713 133.860 1.00 54.42  ?  229 ASN C O   1 
ATOM   1579  C  CB  . ASN B  2 210 ? 116.173 99.606  135.309 1.00 54.42  ?  229 ASN C CB  1 
ATOM   1580  C  CG  . ASN B  2 210 ? 116.156 98.761  136.563 1.00 54.42  ?  229 ASN C CG  1 
ATOM   1581  O  OD1 . ASN B  2 210 ? 115.114 98.595  137.196 1.00 54.42  ?  229 ASN C OD1 1 
ATOM   1582  N  ND2 . ASN B  2 210 ? 117.311 98.229  136.936 1.00 54.42  ?  229 ASN C ND2 1 
ATOM   1583  N  N   . ASP B  2 211 ? 114.540 100.259 132.186 1.00 60.91  ?  230 ASP C N   1 
ATOM   1584  C  CA  . ASP B  2 211 ? 114.302 101.266 131.161 1.00 60.91  ?  230 ASP C CA  1 
ATOM   1585  C  C   . ASP B  2 211 ? 113.032 100.922 130.395 1.00 60.91  ?  230 ASP C C   1 
ATOM   1586  O  O   . ASP B  2 211 ? 112.840 99.773  129.993 1.00 60.91  ?  230 ASP C O   1 
ATOM   1587  C  CB  . ASP B  2 211 ? 115.484 101.354 130.198 1.00 60.91  ?  230 ASP C CB  1 
ATOM   1588  C  CG  . ASP B  2 211 ? 115.312 102.447 129.175 1.00 60.91  ?  230 ASP C CG  1 
ATOM   1589  O  OD1 . ASP B  2 211 ? 115.449 103.630 129.545 1.00 60.91  ?  230 ASP C OD1 1 
ATOM   1590  O  OD2 . ASP B  2 211 ? 115.039 102.124 128.001 1.00 60.91  ?  230 ASP C OD2 1 
ATOM   1591  N  N   . GLU B  2 212 ? 112.182 101.928 130.166 1.00 67.70  ?  231 GLU C N   1 
ATOM   1592  C  CA  . GLU B  2 212 ? 110.808 101.676 129.731 1.00 67.70  ?  231 GLU C CA  1 
ATOM   1593  C  C   . GLU B  2 212 ? 110.704 101.192 128.288 1.00 67.70  ?  231 GLU C C   1 
ATOM   1594  O  O   . GLU B  2 212 ? 109.874 100.320 127.991 1.00 67.70  ?  231 GLU C O   1 
ATOM   1595  C  CB  . GLU B  2 212 ? 109.970 102.940 129.909 1.00 67.70  ?  231 GLU C CB  1 
ATOM   1596  C  CG  . GLU B  2 212 ? 109.774 103.342 131.356 1.00 67.70  ?  231 GLU C CG  1 
ATOM   1597  C  CD  . GLU B  2 212 ? 108.923 102.351 132.127 1.00 67.70  ?  231 GLU C CD  1 
ATOM   1598  O  OE1 . GLU B  2 212 ? 108.021 101.737 131.519 1.00 67.70  ?  231 GLU C OE1 1 
ATOM   1599  O  OE2 . GLU B  2 212 ? 109.154 102.187 133.344 1.00 67.70  ?  231 GLU C OE2 1 
ATOM   1600  N  N   . LEU B  2 213 ? 111.517 101.745 127.386 1.00 63.86  ?  232 LEU C N   1 
ATOM   1601  C  CA  . LEU B  2 213 ? 111.482 101.326 125.989 1.00 63.86  ?  232 LEU C CA  1 
ATOM   1602  C  C   . LEU B  2 213 ? 111.977 99.892  125.836 1.00 63.86  ?  232 LEU C C   1 
ATOM   1603  O  O   . LEU B  2 213 ? 111.364 99.082  125.121 1.00 63.86  ?  232 LEU C O   1 
ATOM   1604  C  CB  . LEU B  2 213 ? 112.313 102.301 125.155 1.00 63.86  ?  232 LEU C CB  1 
ATOM   1605  C  CG  . LEU B  2 213 ? 112.291 102.278 123.629 1.00 63.86  ?  232 LEU C CG  1 
ATOM   1606  C  CD1 . LEU B  2 213 ? 112.411 103.700 123.128 1.00 63.86  ?  232 LEU C CD1 1 
ATOM   1607  C  CD2 . LEU B  2 213 ? 113.434 101.448 123.070 1.00 63.86  ?  232 LEU C CD2 1 
ATOM   1608  N  N   . CYS B  2 214 ? 113.064 99.553  126.534 1.00 59.48  ?  233 CYS C N   1 
ATOM   1609  C  CA  . CYS B  2 214 ? 113.530 98.175  126.545 1.00 59.48  ?  233 CYS C CA  1 
ATOM   1610  C  C   . CYS B  2 214 ? 112.541 97.271  127.263 1.00 59.48  ?  233 CYS C C   1 
ATOM   1611  O  O   . CYS B  2 214 ? 112.420 96.097  126.910 1.00 59.48  ?  233 CYS C O   1 
ATOM   1612  C  CB  . CYS B  2 214 ? 114.907 98.082  127.204 1.00 59.48  ?  233 CYS C CB  1 
ATOM   1613  S  SG  . CYS B  2 214 ? 115.788 96.509  126.924 1.00 59.48  ?  233 CYS C SG  1 
ATOM   1614  N  N   . ARG B  2 215 ? 111.810 97.806  128.247 1.00 59.95  ?  234 ARG C N   1 
ATOM   1615  C  CA  . ARG B  2 215 ? 110.802 97.023  128.955 1.00 59.95  ?  234 ARG C CA  1 
ATOM   1616  C  C   . ARG B  2 215 ? 109.677 96.600  128.023 1.00 59.95  ?  234 ARG C C   1 
ATOM   1617  O  O   . ARG B  2 215 ? 109.309 95.420  127.989 1.00 59.95  ?  234 ARG C O   1 
ATOM   1618  C  CB  . ARG B  2 215 ? 110.251 97.829  130.126 1.00 59.95  ?  234 ARG C CB  1 
ATOM   1619  C  CG  . ARG B  2 215 ? 109.293 97.090  131.019 1.00 59.95  ?  234 ARG C CG  1 
ATOM   1620  C  CD  . ARG B  2 215 ? 108.904 97.979  132.181 1.00 59.95  ?  234 ARG C CD  1 
ATOM   1621  N  NE  . ARG B  2 215 ? 107.943 97.344  133.074 1.00 59.95  ?  234 ARG C NE  1 
ATOM   1622  C  CZ  . ARG B  2 215 ? 107.448 97.924  134.161 1.00 59.95  ?  234 ARG C CZ  1 
ATOM   1623  N  NH1 . ARG B  2 215 ? 106.576 97.279  134.921 1.00 59.95  ?  234 ARG C NH1 1 
ATOM   1624  N  NH2 . ARG B  2 215 ? 107.823 99.153  134.486 1.00 59.95  ?  234 ARG C NH2 1 
ATOM   1625  N  N   . ARG B  2 216 ? 109.160 97.540  127.223 1.00 61.09  ?  235 ARG C N   1 
ATOM   1626  C  CA  . ARG B  2 216 ? 108.115 97.203  126.258 1.00 61.09  ?  235 ARG C CA  1 
ATOM   1627  C  C   . ARG B  2 216 ? 108.630 96.263  125.172 1.00 61.09  ?  235 ARG C C   1 
ATOM   1628  O  O   . ARG B  2 216 ? 107.948 95.290  124.812 1.00 61.09  ?  235 ARG C O   1 
ATOM   1629  C  CB  . ARG B  2 216 ? 107.548 98.469  125.622 1.00 61.09  ?  235 ARG C CB  1 
ATOM   1630  C  CG  . ARG B  2 216 ? 106.768 99.358  126.565 1.00 61.09  ?  235 ARG C CG  1 
ATOM   1631  C  CD  . ARG B  2 216 ? 106.127 100.511 125.808 1.00 61.09  ?  235 ARG C CD  1 
ATOM   1632  N  NE  . ARG B  2 216 ? 107.115 101.453 125.290 1.00 61.09  ?  235 ARG C NE  1 
ATOM   1633  C  CZ  . ARG B  2 216 ? 107.361 101.640 123.997 1.00 61.09  ?  235 ARG C CZ  1 
ATOM   1634  N  NH1 . ARG B  2 216 ? 106.694 100.947 123.087 1.00 61.09  ?  235 ARG C NH1 1 
ATOM   1635  N  NH2 . ARG B  2 216 ? 108.276 102.519 123.616 1.00 61.09  ?  235 ARG C NH2 1 
ATOM   1636  N  N   . HIS B  2 217 ? 109.836 96.522  124.649 1.00 54.51  ?  236 HIS C N   1 
ATOM   1637  C  CA  . HIS B  2 217 ? 110.339 95.691  123.559 1.00 54.51  ?  236 HIS C CA  1 
ATOM   1638  C  C   . HIS B  2 217 ? 110.713 94.289  124.025 1.00 54.51  ?  236 HIS C C   1 
ATOM   1639  O  O   . HIS B  2 217 ? 110.483 93.314  123.300 1.00 54.51  ?  236 HIS C O   1 
ATOM   1640  C  CB  . HIS B  2 217 ? 111.515 96.385  122.890 1.00 54.51  ?  236 HIS C CB  1 
ATOM   1641  C  CG  . HIS B  2 217 ? 111.117 97.598  122.112 1.00 54.51  ?  236 HIS C CG  1 
ATOM   1642  N  ND1 . HIS B  2 217 ? 111.014 98.848  122.680 1.00 54.51  ?  236 HIS C ND1 1 
ATOM   1643  C  CD2 . HIS B  2 217 ? 110.771 97.745  120.813 1.00 54.51  ?  236 HIS C CD2 1 
ATOM   1644  C  CE1 . HIS B  2 217 ? 110.630 99.715  121.761 1.00 54.51  ?  236 HIS C CE1 1 
ATOM   1645  N  NE2 . HIS B  2 217 ? 110.480 99.072  120.618 1.00 54.51  ?  236 HIS C NE2 1 
ATOM   1646  N  N   . TYR B  2 218 ? 111.223 94.151  125.245 1.00 52.99  ?  237 TYR C N   1 
ATOM   1647  C  CA  . TYR B  2 218 ? 111.500 92.825  125.774 1.00 52.99  ?  237 TYR C CA  1 
ATOM   1648  C  C   . TYR B  2 218 ? 110.225 92.105  126.188 1.00 52.99  ?  237 TYR C C   1 
ATOM   1649  O  O   . TYR B  2 218 ? 110.175 90.873  126.126 1.00 52.99  ?  237 TYR C O   1 
ATOM   1650  C  CB  . TYR B  2 218 ? 112.476 92.926  126.943 1.00 52.99  ?  237 TYR C CB  1 
ATOM   1651  C  CG  . TYR B  2 218 ? 112.788 91.600  127.572 1.00 52.99  ?  237 TYR C CG  1 
ATOM   1652  C  CD1 . TYR B  2 218 ? 113.514 90.641  126.881 1.00 52.99  ?  237 TYR C CD1 1 
ATOM   1653  C  CD2 . TYR B  2 218 ? 112.365 91.310  128.858 1.00 52.99  ?  237 TYR C CD2 1 
ATOM   1654  C  CE1 . TYR B  2 218 ? 113.799 89.423  127.450 1.00 52.99  ?  237 TYR C CE1 1 
ATOM   1655  C  CE2 . TYR B  2 218 ? 112.646 90.097  129.439 1.00 52.99  ?  237 TYR C CE2 1 
ATOM   1656  C  CZ  . TYR B  2 218 ? 113.363 89.158  128.731 1.00 52.99  ?  237 TYR C CZ  1 
ATOM   1657  O  OH  . TYR B  2 218 ? 113.644 87.946  129.313 1.00 52.99  ?  237 TYR C OH  1 
ATOM   1658  N  N   . ARG B  2 219 ? 109.181 92.840  126.586 1.00 55.11  ?  238 ARG C N   1 
ATOM   1659  C  CA  . ARG B  2 219 ? 107.891 92.205  126.831 1.00 55.11  ?  238 ARG C CA  1 
ATOM   1660  C  C   . ARG B  2 219 ? 107.318 91.633  125.542 1.00 55.11  ?  238 ARG C C   1 
ATOM   1661  O  O   . ARG B  2 219 ? 106.772 90.522  125.527 1.00 55.11  ?  238 ARG C O   1 
ATOM   1662  C  CB  . ARG B  2 219 ? 106.922 93.208  127.450 1.00 55.11  ?  238 ARG C CB  1 
ATOM   1663  C  CG  . ARG B  2 219 ? 105.590 92.601  127.846 1.00 55.11  ?  238 ARG C CG  1 
ATOM   1664  C  CD  . ARG B  2 219 ? 104.651 93.638  128.434 1.00 55.11  ?  238 ARG C CD  1 
ATOM   1665  N  NE  . ARG B  2 219 ? 103.385 93.039  128.840 1.00 55.11  ?  238 ARG C NE  1 
ATOM   1666  C  CZ  . ARG B  2 219 ? 102.348 92.866  128.028 1.00 55.11  ?  238 ARG C CZ  1 
ATOM   1667  N  NH1 . ARG B  2 219 ? 101.232 92.313  128.481 1.00 55.11  ?  238 ARG C NH1 1 
ATOM   1668  N  NH2 . ARG B  2 219 ? 102.429 93.239  126.759 1.00 55.11  ?  238 ARG C NH2 1 
ATOM   1669  N  N   . THR B  2 220 ? 107.466 92.374  124.442 1.00 52.46  ?  239 THR C N   1 
ATOM   1670  C  CA  . THR B  2 220 ? 107.063 91.859  123.136 1.00 52.46  ?  239 THR C CA  1 
ATOM   1671  C  C   . THR B  2 220 ? 107.899 90.645  122.738 1.00 52.46  ?  239 THR C C   1 
ATOM   1672  O  O   . THR B  2 220 ? 107.368 89.663  122.203 1.00 52.46  ?  239 THR C O   1 
ATOM   1673  C  CB  . THR B  2 220 ? 107.180 92.965  122.085 1.00 52.46  ?  239 THR C CB  1 
ATOM   1674  O  OG1 . THR B  2 220 ? 106.391 94.090  122.489 1.00 52.46  ?  239 THR C OG1 1 
ATOM   1675  C  CG2 . THR B  2 220 ? 106.681 92.491  120.733 1.00 52.46  ?  239 THR C CG2 1 
ATOM   1676  N  N   . PHE B  2 221 ? 109.202 90.677  123.036 1.00 52.26  ?  240 PHE C N   1 
ATOM   1677  C  CA  . PHE B  2 221 ? 110.089 89.572  122.676 1.00 52.26  ?  240 PHE C CA  1 
ATOM   1678  C  C   . PHE B  2 221 ? 109.780 88.317  123.483 1.00 52.26  ?  240 PHE C C   1 
ATOM   1679  O  O   . PHE B  2 221 ? 109.927 87.196  122.985 1.00 52.26  ?  240 PHE C O   1 
ATOM   1680  C  CB  . PHE B  2 221 ? 111.541 90.000  122.863 1.00 52.26  ?  240 PHE C CB  1 
ATOM   1681  C  CG  . PHE B  2 221 ? 112.541 88.939  122.523 1.00 52.26  ?  240 PHE C CG  1 
ATOM   1682  C  CD1 . PHE B  2 221 ? 112.748 88.558  121.210 1.00 52.26  ?  240 PHE C CD1 1 
ATOM   1683  C  CD2 . PHE B  2 221 ? 113.309 88.356  123.515 1.00 52.26  ?  240 PHE C CD2 1 
ATOM   1684  C  CE1 . PHE B  2 221 ? 113.682 87.593  120.896 1.00 52.26  ?  240 PHE C CE1 1 
ATOM   1685  C  CE2 . PHE B  2 221 ? 114.243 87.392  123.207 1.00 52.26  ?  240 PHE C CE2 1 
ATOM   1686  C  CZ  . PHE B  2 221 ? 114.430 87.010  121.896 1.00 52.26  ?  240 PHE C CZ  1 
ATOM   1687  N  N   . GLN B  2 222 ? 109.352 88.488  124.735 1.00 56.33  ?  241 GLN C N   1 
ATOM   1688  C  CA  . GLN B  2 222 ? 108.865 87.353  125.511 1.00 56.33  ?  241 GLN C CA  1 
ATOM   1689  C  C   . GLN B  2 222 ? 107.556 86.823  124.950 1.00 56.33  ?  241 GLN C C   1 
ATOM   1690  O  O   . GLN B  2 222 ? 107.371 85.608  124.834 1.00 56.33  ?  241 GLN C O   1 
ATOM   1691  C  CB  . GLN B  2 222 ? 108.678 87.747  126.974 1.00 56.33  ?  241 GLN C CB  1 
ATOM   1692  C  CG  . GLN B  2 222 ? 109.956 87.943  127.733 1.00 56.33  ?  241 GLN C CG  1 
ATOM   1693  C  CD  . GLN B  2 222 ? 110.732 86.665  127.838 1.00 56.33  ?  241 GLN C CD  1 
ATOM   1694  O  OE1 . GLN B  2 222 ? 111.785 86.513  127.228 1.00 56.33  ?  241 GLN C OE1 1 
ATOM   1695  N  NE2 . GLN B  2 222 ? 110.209 85.724  128.606 1.00 56.33  ?  241 GLN C NE2 1 
ATOM   1696  N  N   . SER B  2 223 ? 106.633 87.720  124.603 1.00 56.22  ?  242 SER C N   1 
ATOM   1697  C  CA  . SER B  2 223 ? 105.295 87.281  124.235 1.00 56.22  ?  242 SER C CA  1 
ATOM   1698  C  C   . SER B  2 223 ? 105.237 86.657  122.848 1.00 56.22  ?  242 SER C C   1 
ATOM   1699  O  O   . SER B  2 223 ? 104.325 85.872  122.574 1.00 56.22  ?  242 SER C O   1 
ATOM   1700  C  CB  . SER B  2 223 ? 104.321 88.454  124.319 1.00 56.22  ?  242 SER C CB  1 
ATOM   1701  O  OG  . SER B  2 223 ? 104.206 88.915  125.653 1.00 56.22  ?  242 SER C OG  1 
ATOM   1702  N  N   . LYS B  2 224 ? 106.182 86.976  121.964 1.00 60.62  ?  243 LYS C N   1 
ATOM   1703  C  CA  . LYS B  2 224 ? 106.082 86.427  120.615 1.00 60.62  ?  243 LYS C CA  1 
ATOM   1704  C  C   . LYS B  2 224 ? 106.917 85.165  120.441 1.00 60.62  ?  243 LYS C C   1 
ATOM   1705  O  O   . LYS B  2 224 ? 106.509 84.247  119.722 1.00 60.62  ?  243 LYS C O   1 
ATOM   1706  C  CB  . LYS B  2 224 ? 106.491 87.470  119.576 1.00 60.62  ?  243 LYS C CB  1 
ATOM   1707  C  CG  . LYS B  2 224 ? 105.654 88.732  119.597 1.00 60.62  ?  243 LYS C CG  1 
ATOM   1708  C  CD  . LYS B  2 224 ? 104.192 88.446  119.324 1.00 60.62  ?  243 LYS C CD  1 
ATOM   1709  C  CE  . LYS B  2 224 ? 103.417 89.738  119.146 1.00 60.62  ?  243 LYS C CE  1 
ATOM   1710  N  NZ  . LYS B  2 224 ? 103.345 90.512  120.413 1.00 60.62  ?  243 LYS C NZ  1 
ATOM   1711  N  N   . CYS B  2 225 ? 108.081 85.092  121.084 1.00 63.13  ?  244 CYS C N   1 
ATOM   1712  C  CA  . CYS B  2 225 ? 109.027 84.020  120.790 1.00 63.13  ?  244 CYS C CA  1 
ATOM   1713  C  C   . CYS B  2 225 ? 108.851 82.816  121.711 1.00 63.13  ?  244 CYS C C   1 
ATOM   1714  O  O   . CYS B  2 225 ? 108.542 81.714  121.248 1.00 63.13  ?  244 CYS C O   1 
ATOM   1715  C  CB  . CYS B  2 225 ? 110.457 84.557  120.887 1.00 63.13  ?  244 CYS C CB  1 
ATOM   1716  S  SG  . CYS B  2 225 ? 110.834 85.837  119.687 1.00 63.13  ?  244 CYS C SG  1 
ATOM   1717  N  N   . TRP B  2 226 ? 109.037 83.011  123.012 1.00 62.77  ?  245 TRP C N   1 
ATOM   1718  C  CA  . TRP B  2 226 ? 109.029 81.914  123.978 1.00 62.77  ?  245 TRP C CA  1 
ATOM   1719  C  C   . TRP B  2 226 ? 107.685 81.969  124.694 1.00 62.77  ?  245 TRP C C   1 
ATOM   1720  O  O   . TRP B  2 226 ? 107.545 82.586  125.750 1.00 62.77  ?  245 TRP C O   1 
ATOM   1721  C  CB  . TRP B  2 226 ? 110.204 82.043  124.938 1.00 62.77  ?  245 TRP C CB  1 
ATOM   1722  C  CG  . TRP B  2 226 ? 111.504 82.090  124.211 1.00 62.77  ?  245 TRP C CG  1 
ATOM   1723  C  CD1 . TRP B  2 226 ? 112.196 83.206  123.869 1.00 62.77  ?  245 TRP C CD1 1 
ATOM   1724  C  CD2 . TRP B  2 226 ? 112.255 80.979  123.705 1.00 62.77  ?  245 TRP C CD2 1 
ATOM   1725  N  NE1 . TRP B  2 226 ? 113.339 82.868  123.192 1.00 62.77  ?  245 TRP C NE1 1 
ATOM   1726  C  CE2 . TRP B  2 226 ? 113.398 81.505  123.077 1.00 62.77  ?  245 TRP C CE2 1 
ATOM   1727  C  CE3 . TRP B  2 226 ? 112.076 79.593  123.729 1.00 62.77  ?  245 TRP C CE3 1 
ATOM   1728  C  CZ2 . TRP B  2 226 ? 114.356 80.700  122.479 1.00 62.77  ?  245 TRP C CZ2 1 
ATOM   1729  C  CZ3 . TRP B  2 226 ? 113.029 78.796  123.134 1.00 62.77  ?  245 TRP C CZ3 1 
ATOM   1730  C  CH2 . TRP B  2 226 ? 114.157 79.347  122.520 1.00 62.77  ?  245 TRP C CH2 1 
ATOM   1731  N  N   . GLN B  2 227 ? 106.684 81.314  124.104 1.00 63.56  ?  246 GLN C N   1 
ATOM   1732  C  CA  . GLN B  2 227 ? 105.314 81.520  124.558 1.00 63.56  ?  246 GLN C CA  1 
ATOM   1733  C  C   . GLN B  2 227 ? 104.986 80.672  125.777 1.00 63.56  ?  246 GLN C C   1 
ATOM   1734  O  O   . GLN B  2 227 ? 104.063 81.000  126.529 1.00 63.56  ?  246 GLN C O   1 
ATOM   1735  C  CB  . GLN B  2 227 ? 104.337 81.231  123.423 1.00 63.56  ?  246 GLN C CB  1 
ATOM   1736  C  CG  . GLN B  2 227 ? 104.409 82.242  122.299 1.00 63.56  ?  246 GLN C CG  1 
ATOM   1737  C  CD  . GLN B  2 227 ? 103.450 81.929  121.173 1.00 63.56  ?  246 GLN C CD  1 
ATOM   1738  O  OE1 . GLN B  2 227 ? 102.762 80.909  121.194 1.00 63.56  ?  246 GLN C OE1 1 
ATOM   1739  N  NE2 . GLN B  2 227 ? 103.399 82.807  120.178 1.00 63.56  ?  246 GLN C NE2 1 
ATOM   1740  N  N   . ARG B  2 228 ? 105.715 79.576  125.989 1.00 59.79  ?  247 ARG C N   1 
ATOM   1741  C  CA  . ARG B  2 228 ? 105.510 78.796  127.205 1.00 59.79  ?  247 ARG C CA  1 
ATOM   1742  C  C   . ARG B  2 228 ? 105.999 79.557  128.427 1.00 59.79  ?  247 ARG C C   1 
ATOM   1743  O  O   . ARG B  2 228 ? 105.315 79.598  129.458 1.00 59.79  ?  247 ARG C O   1 
ATOM   1744  C  CB  . ARG B  2 228 ? 106.217 77.452  127.091 1.00 59.79  ?  247 ARG C CB  1 
ATOM   1745  C  CG  . ARG B  2 228 ? 105.580 76.533  126.079 1.00 59.79  ?  247 ARG C CG  1 
ATOM   1746  C  CD  . ARG B  2 228 ? 106.308 75.209  125.997 1.00 59.79  ?  247 ARG C CD  1 
ATOM   1747  N  NE  . ARG B  2 228 ? 105.653 74.300  125.063 1.00 59.79  ?  247 ARG C NE  1 
ATOM   1748  C  CZ  . ARG B  2 228 ? 105.945 74.222  123.770 1.00 59.79  ?  247 ARG C CZ  1 
ATOM   1749  N  NH1 . ARG B  2 228 ? 106.885 74.999  123.252 1.00 59.79  ?  247 ARG C NH1 1 
ATOM   1750  N  NH2 . ARG B  2 228 ? 105.295 73.366  122.995 1.00 59.79  ?  247 ARG C NH2 1 
ATOM   1751  N  N   . VAL B  2 229 ? 107.166 80.193  128.307 1.00 58.89  ?  248 VAL C N   1 
ATOM   1752  C  CA  . VAL B  2 229 ? 107.686 81.069  129.353 1.00 58.89  ?  248 VAL C CA  1 
ATOM   1753  C  C   . VAL B  2 229 ? 106.742 82.242  129.575 1.00 58.89  ?  248 VAL C C   1 
ATOM   1754  O  O   . VAL B  2 229 ? 106.543 82.701  130.708 1.00 58.89  ?  248 VAL C O   1 
ATOM   1755  C  CB  . VAL B  2 229 ? 109.095 81.546  128.962 1.00 58.89  ?  248 VAL C CB  1 
ATOM   1756  C  CG1 . VAL B  2 229 ? 109.703 82.407  130.040 1.00 58.89  ?  248 VAL C CG1 1 
ATOM   1757  C  CG2 . VAL B  2 229 ? 109.975 80.371  128.639 1.00 58.89  ?  248 VAL C CG2 1 
ATOM   1758  N  N   . THR B  2 230 ? 106.120 82.716  128.494 1.00 59.34  ?  249 THR C N   1 
ATOM   1759  C  CA  . THR B  2 230 ? 105.162 83.810  128.573 1.00 59.34  ?  249 THR C CA  1 
ATOM   1760  C  C   . THR B  2 230 ? 103.925 83.404  129.362 1.00 59.34  ?  249 THR C C   1 
ATOM   1761  O  O   . THR B  2 230 ? 103.525 84.091  130.305 1.00 59.34  ?  249 THR C O   1 
ATOM   1762  C  CB  . THR B  2 230 ? 104.771 84.252  127.167 1.00 59.34  ?  249 THR C CB  1 
ATOM   1763  O  OG1 . THR B  2 230 ? 105.949 84.608  126.440 1.00 59.34  ?  249 THR C OG1 1 
ATOM   1764  C  CG2 . THR B  2 230 ? 103.844 85.447  127.233 1.00 59.34  ?  249 THR C CG2 1 
ATOM   1765  N  N   . ARG B  2 231 ? 103.317 82.272  129.011 1.00 60.40  ?  250 ARG C N   1 
ATOM   1766  C  CA  . ARG B  2 231 ? 102.086 81.898  129.691 1.00 60.40  ?  250 ARG C CA  1 
ATOM   1767  C  C   . ARG B  2 231 ? 102.328 81.193  131.016 1.00 60.40  ?  250 ARG C C   1 
ATOM   1768  O  O   . ARG B  2 231 ? 101.355 80.819  131.676 1.00 60.40  ?  250 ARG C O   1 
ATOM   1769  C  CB  . ARG B  2 231 ? 101.216 81.028  128.787 1.00 60.40  ?  250 ARG C CB  1 
ATOM   1770  C  CG  . ARG B  2 231 ? 101.748 79.640  128.517 1.00 60.40  ?  250 ARG C CG  1 
ATOM   1771  C  CD  . ARG B  2 231 ? 100.822 78.880  127.573 1.00 60.40  ?  250 ARG C CD  1 
ATOM   1772  N  NE  . ARG B  2 231 ? 100.773 79.479  126.240 1.00 60.40  ?  250 ARG C NE  1 
ATOM   1773  C  CZ  . ARG B  2 231 ? 99.724  80.129  125.746 1.00 60.40  ?  250 ARG C CZ  1 
ATOM   1774  N  NH1 . ARG B  2 231 ? 98.627  80.274  126.476 1.00 60.40  ?  250 ARG C NH1 1 
ATOM   1775  N  NH2 . ARG B  2 231 ? 99.774  80.639  124.524 1.00 60.40  ?  250 ARG C NH2 1 
ATOM   1776  N  N   . LYS B  2 232 ? 103.580 80.991  131.424 1.00 57.19  ?  251 LYS C N   1 
ATOM   1777  C  CA  . LYS B  2 232 ? 103.809 80.584  132.805 1.00 57.19  ?  251 LYS C CA  1 
ATOM   1778  C  C   . LYS B  2 232 ? 104.254 81.730  133.708 1.00 57.19  ?  251 LYS C C   1 
ATOM   1779  O  O   . LYS B  2 232 ? 103.866 81.757  134.880 1.00 57.19  ?  251 LYS C O   1 
ATOM   1780  C  CB  . LYS B  2 232 ? 104.840 79.455  132.875 1.00 57.19  ?  251 LYS C CB  1 
ATOM   1781  C  CG  . LYS B  2 232 ? 104.398 78.171  132.202 1.00 57.19  ?  251 LYS C CG  1 
ATOM   1782  C  CD  . LYS B  2 232 ? 103.257 77.512  132.938 1.00 57.19  ?  251 LYS C CD  1 
ATOM   1783  C  CE  . LYS B  2 232 ? 102.795 76.263  132.208 1.00 57.19  ?  251 LYS C CE  1 
ATOM   1784  N  NZ  . LYS B  2 232 ? 103.834 75.196  132.219 1.00 57.19  ?  251 LYS C NZ  1 
ATOM   1785  N  N   . CYS B  2 233 ? 105.047 82.685  133.206 1.00 61.88  ?  252 CYS C N   1 
ATOM   1786  C  CA  . CYS B  2 233 ? 105.699 83.663  134.075 1.00 61.88  ?  252 CYS C CA  1 
ATOM   1787  C  C   . CYS B  2 233 ? 105.496 85.121  133.662 1.00 61.88  ?  252 CYS C C   1 
ATOM   1788  O  O   . CYS B  2 233 ? 105.517 85.994  134.537 1.00 61.88  ?  252 CYS C O   1 
ATOM   1789  C  CB  . CYS B  2 233 ? 107.208 83.382  134.122 1.00 61.88  ?  252 CYS C CB  1 
ATOM   1790  S  SG  . CYS B  2 233 ? 107.658 81.643  134.437 1.00 61.88  ?  252 CYS C SG  1 
ATOM   1791  N  N   . HIS B  2 234 ? 105.386 85.401  132.364 1.00 62.57  ?  253 HIS C N   1 
ATOM   1792  C  CA  . HIS B  2 234 ? 105.125 86.666  131.632 1.00 62.57  ?  253 HIS C CA  1 
ATOM   1793  C  C   . HIS B  2 234 ? 106.344 87.588  131.684 1.00 62.57  ?  253 HIS C C   1 
ATOM   1794  O  O   . HIS B  2 234 ? 106.664 88.160  130.632 1.00 62.57  ?  253 HIS C O   1 
ATOM   1795  C  CB  . HIS B  2 234 ? 103.844 87.320  132.176 1.00 62.57  ?  253 HIS C CB  1 
ATOM   1796  C  CG  . HIS B  2 234 ? 102.591 86.531  131.972 1.00 62.57  ?  253 HIS C CG  1 
ATOM   1797  N  ND1 . HIS B  2 234 ? 101.939 86.466  130.760 1.00 62.57  ?  253 HIS C ND1 1 
ATOM   1798  C  CD2 . HIS B  2 234 ? 101.844 85.810  132.841 1.00 62.57  ?  253 HIS C CD2 1 
ATOM   1799  C  CE1 . HIS B  2 234 ? 100.856 85.720  130.885 1.00 62.57  ?  253 HIS C CE1 1 
ATOM   1800  N  NE2 . HIS B  2 234 ? 100.776 85.308  132.137 1.00 62.57  ?  253 HIS C NE2 1 
ATOM   1801  N  N   . GLU B  2 235 ? 107.048 87.704  132.818 1.00 63.54  ?  254 GLU C N   1 
ATOM   1802  C  CA  . GLU B  2 235 ? 108.393 88.264  133.041 1.00 63.54  ?  254 GLU C CA  1 
ATOM   1803  C  C   . GLU B  2 235 ? 108.642 88.029  134.527 1.00 63.54  ?  254 GLU C C   1 
ATOM   1804  O  O   . GLU B  2 235 ? 108.064 88.731  135.358 1.00 63.54  ?  254 GLU C O   1 
ATOM   1805  C  CB  . GLU B  2 235 ? 108.543 89.771  132.738 1.00 63.54  ?  254 GLU C CB  1 
ATOM   1806  C  CG  . GLU B  2 235 ? 108.901 90.230  131.330 1.00 63.54  ?  254 GLU C CG  1 
ATOM   1807  C  CD  . GLU B  2 235 ? 108.817 91.741  131.190 1.00 63.54  ?  254 GLU C CD  1 
ATOM   1808  O  OE1 . GLU B  2 235 ? 108.355 92.400  132.148 1.00 63.54  ?  254 GLU C OE1 1 
ATOM   1809  O  OE2 . GLU B  2 235 ? 109.199 92.274  130.130 1.00 63.54  ?  254 GLU C OE2 1 
ATOM   1810  N  N   . ASP B  2 236 ? 109.536 87.107  134.871 1.00 58.97  ?  255 ASP C N   1 
ATOM   1811  C  CA  . ASP B  2 236 ? 109.841 86.861  136.278 1.00 58.97  ?  255 ASP C CA  1 
ATOM   1812  C  C   . ASP B  2 236 ? 111.147 86.095  136.375 1.00 58.97  ?  255 ASP C C   1 
ATOM   1813  O  O   . ASP B  2 236 ? 111.284 85.030  135.773 1.00 58.97  ?  255 ASP C O   1 
ATOM   1814  C  CB  . ASP B  2 236 ? 108.719 86.079  136.969 1.00 58.97  ?  255 ASP C CB  1 
ATOM   1815  C  CG  . ASP B  2 236 ? 108.830 86.117  138.475 1.00 58.97  ?  255 ASP C CG  1 
ATOM   1816  O  OD1 . ASP B  2 236 ? 108.539 87.183  139.055 1.00 58.97  ?  255 ASP C OD1 1 
ATOM   1817  O  OD2 . ASP B  2 236 ? 109.199 85.090  139.081 1.00 58.97  ?  255 ASP C OD2 1 
ATOM   1818  N  N   . GLU B  2 237 ? 112.097 86.630  137.135 1.00 54.42  ?  256 GLU C N   1 
ATOM   1819  C  CA  . GLU B  2 237 ? 113.366 85.952  137.354 1.00 54.42  ?  256 GLU C CA  1 
ATOM   1820  C  C   . GLU B  2 237 ? 113.162 84.684  138.167 1.00 54.42  ?  256 GLU C C   1 
ATOM   1821  O  O   . GLU B  2 237 ? 113.733 83.633  137.861 1.00 54.42  ?  256 GLU C O   1 
ATOM   1822  C  CB  . GLU B  2 237 ? 114.342 86.876  138.072 1.00 54.42  ?  256 GLU C CB  1 
ATOM   1823  C  CG  . GLU B  2 237 ? 114.711 88.110  137.291 1.00 54.42  ?  256 GLU C CG  1 
ATOM   1824  C  CD  . GLU B  2 237 ? 115.662 88.996  138.057 1.00 54.42  ?  256 GLU C CD  1 
ATOM   1825  O  OE1 . GLU B  2 237 ? 115.942 88.690  139.234 1.00 54.42  ?  256 GLU C OE1 1 
ATOM   1826  O  OE2 . GLU B  2 237 ? 116.125 89.998  137.483 1.00 54.42  ?  256 GLU C OE2 1 
ATOM   1827  N  N   . ASN B  2 238 ? 112.310 84.768  139.187 1.00 53.16  ?  257 ASN C N   1 
ATOM   1828  C  CA  . ASN B  2 238 ? 112.116 83.641  140.088 1.00 53.16  ?  257 ASN C CA  1 
ATOM   1829  C  C   . ASN B  2 238 ? 111.255 82.556  139.452 1.00 53.16  ?  257 ASN C C   1 
ATOM   1830  O  O   . ASN B  2 238 ? 111.134 81.453  139.996 1.00 53.16  ?  257 ASN C O   1 
ATOM   1831  C  CB  . ASN B  2 238 ? 111.492 84.138  141.386 1.00 53.16  ?  257 ASN C CB  1 
ATOM   1832  C  CG  . ASN B  2 238 ? 112.344 85.188  142.070 1.00 53.16  ?  257 ASN C CG  1 
ATOM   1833  O  OD1 . ASN B  2 238 ? 111.938 86.344  142.198 1.00 53.16  ?  257 ASN C OD1 1 
ATOM   1834  N  ND2 . ASN B  2 238 ? 113.535 84.796  142.504 1.00 53.16  ?  257 ASN C ND2 1 
ATOM   1835  N  N   . CYS B  2 239 ? 110.639 82.854  138.304 1.00 51.93  ?  258 CYS C N   1 
ATOM   1836  C  CA  . CYS B  2 239 ? 109.847 81.852  137.598 1.00 51.93  ?  258 CYS C CA  1 
ATOM   1837  C  C   . CYS B  2 239 ? 110.577 81.311  136.373 1.00 51.93  ?  258 CYS C C   1 
ATOM   1838  O  O   . CYS B  2 239 ? 110.371 80.154  135.995 1.00 51.93  ?  258 CYS C O   1 
ATOM   1839  C  CB  . CYS B  2 239 ? 108.490 82.441  137.219 1.00 51.93  ?  258 CYS C CB  1 
ATOM   1840  S  SG  . CYS B  2 239 ? 107.338 81.326  136.413 1.00 51.93  ?  258 CYS C SG  1 
ATOM   1841  N  N   . ILE B  2 240 ? 111.429 82.123  135.741 1.00 49.40  ?  259 ILE C N   1 
ATOM   1842  C  CA  . ILE B  2 240 ? 112.279 81.615  134.669 1.00 49.40  ?  259 ILE C CA  1 
ATOM   1843  C  C   . ILE B  2 240 ? 113.421 80.784  135.247 1.00 49.40  ?  259 ILE C C   1 
ATOM   1844  O  O   . ILE B  2 240 ? 113.874 79.814  134.626 1.00 49.40  ?  259 ILE C O   1 
ATOM   1845  C  CB  . ILE B  2 240 ? 112.759 82.791  133.793 1.00 49.40  ?  259 ILE C CB  1 
ATOM   1846  C  CG1 . ILE B  2 240 ? 111.575 83.373  133.032 1.00 49.40  ?  259 ILE C CG1 1 
ATOM   1847  C  CG2 . ILE B  2 240 ? 113.804 82.391  132.778 1.00 49.40  ?  259 ILE C CG2 1 
ATOM   1848  C  CD1 . ILE B  2 240 ? 111.887 84.642  132.297 1.00 49.40  ?  259 ILE C CD1 1 
ATOM   1849  N  N   . SER B  2 241 ? 113.820 81.060  136.494 1.00 49.98  ?  260 SER C N   1 
ATOM   1850  C  CA  . SER B  2 241 ? 114.904 80.317  137.137 1.00 49.98  ?  260 SER C CA  1 
ATOM   1851  C  C   . SER B  2 241 ? 114.540 78.880  137.498 1.00 49.98  ?  260 SER C C   1 
ATOM   1852  O  O   . SER B  2 241 ? 115.369 78.177  138.083 1.00 49.98  ?  260 SER C O   1 
ATOM   1853  C  CB  . SER B  2 241 ? 115.348 81.039  138.406 1.00 49.98  ?  260 SER C CB  1 
ATOM   1854  O  OG  . SER B  2 241 ? 116.302 80.269  139.114 1.00 49.98  ?  260 SER C OG  1 
ATOM   1855  N  N   . THR B  2 242 ? 113.328 78.432  137.186 1.00 49.81  ?  261 THR C N   1 
ATOM   1856  C  CA  . THR B  2 242 ? 112.875 77.097  137.525 1.00 49.81  ?  261 THR C CA  1 
ATOM   1857  C  C   . THR B  2 242 ? 112.732 76.198  136.311 1.00 49.81  ?  261 THR C C   1 
ATOM   1858  O  O   . THR B  2 242 ? 112.651 74.976  136.470 1.00 49.81  ?  261 THR C O   1 
ATOM   1859  C  CB  . THR B  2 242 ? 111.532 77.179  138.233 1.00 49.81  ?  261 THR C CB  1 
ATOM   1860  O  OG1 . THR B  2 242 ? 110.540 77.586  137.288 1.00 49.81  ?  261 THR C OG1 1 
ATOM   1861  C  CG2 . THR B  2 242 ? 111.599 78.230  139.304 1.00 49.81  ?  261 THR C CG2 1 
ATOM   1862  N  N   . LEU B  2 243 ? 112.705 76.765  135.113 1.00 51.48  ?  262 LEU C N   1 
ATOM   1863  C  CA  . LEU B  2 243 ? 112.451 75.995  133.905 1.00 51.48  ?  262 LEU C CA  1 
ATOM   1864  C  C   . LEU B  2 243 ? 113.695 75.208  133.506 1.00 51.48  ?  262 LEU C C   1 
ATOM   1865  O  O   . LEU B  2 243 ? 114.748 75.280  134.142 1.00 51.48  ?  262 LEU C O   1 
ATOM   1866  C  CB  . LEU B  2 243 ? 111.990 76.915  132.782 1.00 51.48  ?  262 LEU C CB  1 
ATOM   1867  C  CG  . LEU B  2 243 ? 110.614 77.549  132.948 1.00 51.48  ?  262 LEU C CG  1 
ATOM   1868  C  CD1 . LEU B  2 243 ? 110.378 78.546  131.846 1.00 51.48  ?  262 LEU C CD1 1 
ATOM   1869  C  CD2 . LEU B  2 243 ? 109.550 76.475  132.923 1.00 51.48  ?  262 LEU C CD2 1 
ATOM   1870  N  N   . SER B  2 244 ? 113.577 74.446  132.431 1.00 62.97  ?  263 SER C N   1 
ATOM   1871  C  CA  . SER B  2 244 ? 114.651 73.621  131.909 1.00 62.97  ?  263 SER C CA  1 
ATOM   1872  C  C   . SER B  2 244 ? 115.147 74.207  130.593 1.00 62.97  ?  263 SER C C   1 
ATOM   1873  O  O   . SER B  2 244 ? 114.683 75.253  130.139 1.00 62.97  ?  263 SER C O   1 
ATOM   1874  C  CB  . SER B  2 244 ? 114.167 72.187  131.714 1.00 62.97  ?  263 SER C CB  1 
ATOM   1875  O  OG  . SER B  2 244 ? 113.210 72.116  130.671 1.00 62.97  ?  263 SER C OG  1 
ATOM   1876  N  N   . LYS B  2 245 ? 116.101 73.517  129.980 1.00 64.13  ?  264 LYS C N   1 
ATOM   1877  C  CA  . LYS B  2 245 ? 116.460 73.762  128.593 1.00 64.13  ?  264 LYS C CA  1 
ATOM   1878  C  C   . LYS B  2 245 ? 115.846 72.730  127.663 1.00 64.13  ?  264 LYS C C   1 
ATOM   1879  O  O   . LYS B  2 245 ? 116.005 72.833  126.444 1.00 64.13  ?  264 LYS C O   1 
ATOM   1880  C  CB  . LYS B  2 245 ? 117.980 73.778  128.435 1.00 64.13  ?  264 LYS C CB  1 
ATOM   1881  C  CG  . LYS B  2 245 ? 118.644 74.968  129.102 1.00 64.13  ?  264 LYS C CG  1 
ATOM   1882  C  CD  . LYS B  2 245 ? 120.158 74.875  129.019 1.00 64.13  ?  264 LYS C CD  1 
ATOM   1883  C  CE  . LYS B  2 245 ? 120.655 75.088  127.600 1.00 64.13  ?  264 LYS C CE  1 
ATOM   1884  N  NZ  . LYS B  2 245 ? 120.446 76.486  127.144 1.00 64.13  ?  264 LYS C NZ  1 
ATOM   1885  N  N   . GLN B  2 246 ? 115.154 71.735  128.218 1.00 72.26  ?  265 GLN C N   1 
ATOM   1886  C  CA  . GLN B  2 246 ? 114.406 70.790  127.400 1.00 72.26  ?  265 GLN C CA  1 
ATOM   1887  C  C   . GLN B  2 246 ? 113.088 71.399  126.943 1.00 72.26  ?  265 GLN C C   1 
ATOM   1888  O  O   . GLN B  2 246 ? 112.650 71.184  125.807 1.00 72.26  ?  265 GLN C O   1 
ATOM   1889  C  CB  . GLN B  2 246 ? 114.150 69.509  128.194 1.00 72.26  ?  265 GLN C CB  1 
ATOM   1890  C  CG  . GLN B  2 246 ? 115.402 68.750  128.585 1.00 72.26  ?  265 GLN C CG  1 
ATOM   1891  C  CD  . GLN B  2 246 ? 115.095 67.544  129.450 1.00 72.26  ?  265 GLN C CD  1 
ATOM   1892  O  OE1 . GLN B  2 246 ? 113.943 67.299  129.807 1.00 72.26  ?  265 GLN C OE1 1 
ATOM   1893  N  NE2 . GLN B  2 246 ? 116.128 66.787  129.797 1.00 72.26  ?  265 GLN C NE2 1 
ATOM   1894  N  N   . ASP B  2 247 ? 112.446 72.167  127.817 1.00 74.98  ?  266 ASP C N   1 
ATOM   1895  C  CA  . ASP B  2 247 ? 111.100 72.670  127.592 1.00 74.98  ?  266 ASP C CA  1 
ATOM   1896  C  C   . ASP B  2 247 ? 111.068 73.994  126.844 1.00 74.98  ?  266 ASP C C   1 
ATOM   1897  O  O   . ASP B  2 247 ? 110.010 74.630  126.789 1.00 74.98  ?  266 ASP C O   1 
ATOM   1898  C  CB  . ASP B  2 247 ? 110.380 72.816  128.931 1.00 74.98  ?  266 ASP C CB  1 
ATOM   1899  C  CG  . ASP B  2 247 ? 110.126 71.482  129.601 1.00 74.98  ?  266 ASP C CG  1 
ATOM   1900  O  OD1 . ASP B  2 247 ? 109.924 70.477  128.886 1.00 74.98  ?  266 ASP C OD1 1 
ATOM   1901  O  OD2 . ASP B  2 247 ? 110.146 71.437  130.845 1.00 74.98  ?  266 ASP C OD2 1 
ATOM   1902  N  N   . LEU B  2 248 ? 112.185 74.427  126.271 1.00 68.44  ?  267 LEU C N   1 
ATOM   1903  C  CA  . LEU B  2 248 ? 112.254 75.677  125.528 1.00 68.44  ?  267 LEU C CA  1 
ATOM   1904  C  C   . LEU B  2 248 ? 112.239 75.352  124.043 1.00 68.44  ?  267 LEU C C   1 
ATOM   1905  O  O   . LEU B  2 248 ? 113.170 74.720  123.533 1.00 68.44  ?  267 LEU C O   1 
ATOM   1906  C  CB  . LEU B  2 248 ? 113.508 76.465  125.899 1.00 68.44  ?  267 LEU C CB  1 
ATOM   1907  C  CG  . LEU B  2 248 ? 113.584 76.869  127.372 1.00 68.44  ?  267 LEU C CG  1 
ATOM   1908  C  CD1 . LEU B  2 248 ? 114.901 77.547  127.693 1.00 68.44  ?  267 LEU C CD1 1 
ATOM   1909  C  CD2 . LEU B  2 248 ? 112.431 77.764  127.721 1.00 68.44  ?  267 LEU C CD2 1 
ATOM   1910  N  N   . THR B  2 249 ? 111.182 75.776  123.358 1.00 72.78  ?  268 THR C N   1 
ATOM   1911  C  CA  . THR B  2 249 ? 111.031 75.534  121.932 1.00 72.78  ?  268 THR C CA  1 
ATOM   1912  C  C   . THR B  2 249 ? 110.656 76.844  121.264 1.00 72.78  ?  268 THR C C   1 
ATOM   1913  O  O   . THR B  2 249 ? 109.559 77.364  121.487 1.00 72.78  ?  268 THR C O   1 
ATOM   1914  C  CB  . THR B  2 249 ? 109.964 74.471  121.649 1.00 72.78  ?  268 THR C CB  1 
ATOM   1915  O  OG1 . THR B  2 249 ? 110.341 73.234  122.267 1.00 72.78  ?  268 THR C OG1 1 
ATOM   1916  C  CG2 . THR B  2 249 ? 109.808 74.257  120.155 1.00 72.78  ?  268 THR C CG2 1 
ATOM   1917  N  N   . CYS B  2 250 ? 111.562 77.364  120.447 1.00 73.44  ?  269 CYS C N   1 
ATOM   1918  C  CA  . CYS B  2 250 ? 111.385 78.660  119.817 1.00 73.44  ?  269 CYS C CA  1 
ATOM   1919  C  C   . CYS B  2 250 ? 110.308 78.597  118.747 1.00 73.44  ?  269 CYS C C   1 
ATOM   1920  O  O   . CYS B  2 250 ? 110.146 77.580  118.068 1.00 73.44  ?  269 CYS C O   1 
ATOM   1921  C  CB  . CYS B  2 250 ? 112.694 79.131  119.192 1.00 73.44  ?  269 CYS C CB  1 
ATOM   1922  S  SG  . CYS B  2 250 ? 112.617 80.797  118.527 1.00 73.44  ?  269 CYS C SG  1 
ATOM   1923  N  N   . SER B  2 251 ? 109.572 79.692  118.602 1.00 74.52  ?  270 SER C N   1 
ATOM   1924  C  CA  . SER B  2 251 ? 108.577 79.818  117.548 1.00 74.52  ?  270 SER C CA  1 
ATOM   1925  C  C   . SER B  2 251 ? 109.202 80.560  116.375 1.00 74.52  ?  270 SER C C   1 
ATOM   1926  O  O   . SER B  2 251 ? 109.741 81.658  116.545 1.00 74.52  ?  270 SER C O   1 
ATOM   1927  C  CB  . SER B  2 251 ? 107.337 80.547  118.057 1.00 74.52  ?  270 SER C CB  1 
ATOM   1928  O  OG  . SER B  2 251 ? 106.691 79.791  119.064 1.00 74.52  ?  270 SER C OG  1 
ATOM   1929  N  N   . GLY B  2 252 ? 109.131 79.961  115.191 1.00 73.82  ?  271 GLY C N   1 
ATOM   1930  C  CA  . GLY B  2 252 ? 109.767 80.535  114.023 1.00 73.82  ?  271 GLY C CA  1 
ATOM   1931  C  C   . GLY B  2 252 ? 108.912 81.516  113.249 1.00 73.82  ?  271 GLY C C   1 
ATOM   1932  O  O   . GLY B  2 252 ? 109.208 81.816  112.089 1.00 73.82  ?  271 GLY C O   1 
ATOM   1933  N  N   . SER B  2 253 ? 107.849 82.018  113.869 1.00 70.53  ?  272 SER C N   1 
ATOM   1934  C  CA  . SER B  2 253 ? 106.967 82.963  113.206 1.00 70.53  ?  272 SER C CA  1 
ATOM   1935  C  C   . SER B  2 253 ? 107.645 84.321  113.070 1.00 70.53  ?  272 SER C C   1 
ATOM   1936  O  O   . SER B  2 253 ? 108.615 84.634  113.764 1.00 70.53  ?  272 SER C O   1 
ATOM   1937  C  CB  . SER B  2 253 ? 105.658 83.111  113.977 1.00 70.53  ?  272 SER C CB  1 
ATOM   1938  O  OG  . SER B  2 253 ? 105.884 83.721  115.234 1.00 70.53  ?  272 SER C OG  1 
ATOM   1939  N  N   . ASP B  2 254 ? 107.114 85.138  112.162 1.00 68.62  ?  273 ASP C N   1 
ATOM   1940  C  CA  . ASP B  2 254 ? 107.697 86.444  111.885 1.00 68.62  ?  273 ASP C CA  1 
ATOM   1941  C  C   . ASP B  2 254 ? 107.439 87.464  112.984 1.00 68.62  ?  273 ASP C C   1 
ATOM   1942  O  O   . ASP B  2 254 ? 108.088 88.517  112.986 1.00 68.62  ?  273 ASP C O   1 
ATOM   1943  C  CB  . ASP B  2 254 ? 107.177 86.983  110.554 1.00 68.62  ?  273 ASP C CB  1 
ATOM   1944  C  CG  . ASP B  2 254 ? 107.719 86.215  109.370 1.00 68.62  ?  273 ASP C CG  1 
ATOM   1945  O  OD1 . ASP B  2 254 ? 108.830 85.655  109.482 1.00 68.62  ?  273 ASP C OD1 1 
ATOM   1946  O  OD2 . ASP B  2 254 ? 107.038 86.174  108.324 1.00 68.62  ?  273 ASP C OD2 1 
ATOM   1947  N  N   . ASP B  2 255 ? 106.513 87.188  113.905 1.00 66.96  ?  274 ASP C N   1 
ATOM   1948  C  CA  . ASP B  2 255 ? 106.364 88.040  115.079 1.00 66.96  ?  274 ASP C CA  1 
ATOM   1949  C  C   . ASP B  2 255 ? 107.606 87.978  115.957 1.00 66.96  ?  274 ASP C C   1 
ATOM   1950  O  O   . ASP B  2 255 ? 108.038 88.998  116.507 1.00 66.96  ?  274 ASP C O   1 
ATOM   1951  C  CB  . ASP B  2 255 ? 105.129 87.624  115.872 1.00 66.96  ?  274 ASP C CB  1 
ATOM   1952  C  CG  . ASP B  2 255 ? 103.843 87.929  115.145 1.00 66.96  ?  274 ASP C CG  1 
ATOM   1953  O  OD1 . ASP B  2 255 ? 103.826 88.892  114.352 1.00 66.96  ?  274 ASP C OD1 1 
ATOM   1954  O  OD2 . ASP B  2 255 ? 102.849 87.208  115.370 1.00 66.96  ?  274 ASP C OD2 1 
ATOM   1955  N  N   . CYS B  2 256 ? 108.202 86.788  116.075 1.00 62.35  ?  275 CYS C N   1 
ATOM   1956  C  CA  . CYS B  2 256 ? 109.457 86.639  116.803 1.00 62.35  ?  275 CYS C CA  1 
ATOM   1957  C  C   . CYS B  2 256 ? 110.594 87.370  116.096 1.00 62.35  ?  275 CYS C C   1 
ATOM   1958  O  O   . CYS B  2 256 ? 111.452 87.980  116.752 1.00 62.35  ?  275 CYS C O   1 
ATOM   1959  C  CB  . CYS B  2 256 ? 109.782 85.154  116.964 1.00 62.35  ?  275 CYS C CB  1 
ATOM   1960  S  SG  . CYS B  2 256 ? 111.217 84.807  117.986 1.00 62.35  ?  275 CYS C SG  1 
ATOM   1961  N  N   . LYS B  2 257 ? 110.604 87.320  114.757 1.00 57.74  ?  276 LYS C N   1 
ATOM   1962  C  CA  . LYS B  2 257 ? 111.552 88.089  113.954 1.00 57.74  ?  276 LYS C CA  1 
ATOM   1963  C  C   . LYS B  2 257 ? 111.444 89.578  114.246 1.00 57.74  ?  276 LYS C C   1 
ATOM   1964  O  O   . LYS B  2 257 ? 112.450 90.246  114.520 1.00 57.74  ?  276 LYS C O   1 
ATOM   1965  C  CB  . LYS B  2 257 ? 111.291 87.846  112.468 1.00 57.74  ?  276 LYS C CB  1 
ATOM   1966  C  CG  . LYS B  2 257 ? 111.501 86.440  111.957 1.00 57.74  ?  276 LYS C CG  1 
ATOM   1967  C  CD  . LYS B  2 257 ? 112.954 86.153  111.712 1.00 57.74  ?  276 LYS C CD  1 
ATOM   1968  C  CE  . LYS B  2 257 ? 113.143 84.787  111.100 1.00 57.74  ?  276 LYS C CE  1 
ATOM   1969  N  NZ  . LYS B  2 257 ? 112.559 84.696  109.745 1.00 57.74  ?  276 LYS C NZ  1 
ATOM   1970  N  N   . ALA B  2 258 ? 110.217 90.108  114.207 1.00 55.69  ?  277 ALA C N   1 
ATOM   1971  C  CA  . ALA B  2 258 ? 110.012 91.541  114.391 1.00 55.69  ?  277 ALA C CA  1 
ATOM   1972  C  C   . ALA B  2 258 ? 110.337 91.969  115.813 1.00 55.69  ?  277 ALA C C   1 
ATOM   1973  O  O   . ALA B  2 258 ? 110.887 93.055  116.027 1.00 55.69  ?  277 ALA C O   1 
ATOM   1974  C  CB  . ALA B  2 258 ? 108.574 91.915  114.034 1.00 55.69  ?  277 ALA C CB  1 
ATOM   1975  N  N   . ALA B  2 259 ? 110.052 91.110  116.793 1.00 52.41  ?  278 ALA C N   1 
ATOM   1976  C  CA  . ALA B  2 259 ? 110.380 91.426  118.177 1.00 52.41  ?  278 ALA C CA  1 
ATOM   1977  C  C   . ALA B  2 259 ? 111.885 91.441  118.416 1.00 52.41  ?  278 ALA C C   1 
ATOM   1978  O  O   . ALA B  2 259 ? 112.398 92.337  119.103 1.00 52.41  ?  278 ALA C O   1 
ATOM   1979  C  CB  . ALA B  2 259 ? 109.706 90.426  119.108 1.00 52.41  ?  278 ALA C CB  1 
ATOM   1980  N  N   . TYR B  2 260 ? 112.611 90.478  117.838 1.00 50.83  ?  279 TYR C N   1 
ATOM   1981  C  CA  . TYR B  2 260 ? 114.057 90.459  118.027 1.00 50.83  ?  279 TYR C CA  1 
ATOM   1982  C  C   . TYR B  2 260 ? 114.737 91.596  117.273 1.00 50.83  ?  279 TYR C C   1 
ATOM   1983  O  O   . TYR B  2 260 ? 115.775 92.104  117.714 1.00 50.83  ?  279 TYR C O   1 
ATOM   1984  C  CB  . TYR B  2 260 ? 114.642 89.115  117.604 1.00 50.83  ?  279 TYR C CB  1 
ATOM   1985  C  CG  . TYR B  2 260 ? 116.132 89.068  117.809 1.00 50.83  ?  279 TYR C CG  1 
ATOM   1986  C  CD1 . TYR B  2 260 ? 116.666 89.020  119.086 1.00 50.83  ?  279 TYR C CD1 1 
ATOM   1987  C  CD2 . TYR B  2 260 ? 117.003 89.102  116.733 1.00 50.83  ?  279 TYR C CD2 1 
ATOM   1988  C  CE1 . TYR B  2 260 ? 118.025 88.995  119.287 1.00 50.83  ?  279 TYR C CE1 1 
ATOM   1989  C  CE2 . TYR B  2 260 ? 118.364 89.075  116.924 1.00 50.83  ?  279 TYR C CE2 1 
ATOM   1990  C  CZ  . TYR B  2 260 ? 118.868 89.020  118.202 1.00 50.83  ?  279 TYR C CZ  1 
ATOM   1991  O  OH  . TYR B  2 260 ? 120.226 88.992  118.397 1.00 50.83  ?  279 TYR C OH  1 
ATOM   1992  N  N   . ILE B  2 261 ? 114.178 92.014  116.136 1.00 46.60  ?  280 ILE C N   1 
ATOM   1993  C  CA  . ILE B  2 261 ? 114.741 93.184  115.470 1.00 46.60  ?  280 ILE C CA  1 
ATOM   1994  C  C   . ILE B  2 261 ? 114.431 94.449  116.262 1.00 46.60  ?  280 ILE C C   1 
ATOM   1995  O  O   . ILE B  2 261 ? 115.285 95.335  116.390 1.00 46.60  ?  280 ILE C O   1 
ATOM   1996  C  CB  . ILE B  2 261 ? 114.242 93.248  114.019 1.00 46.60  ?  280 ILE C CB  1 
ATOM   1997  C  CG1 . ILE B  2 261 ? 114.822 92.077  113.238 1.00 46.60  ?  280 ILE C CG1 1 
ATOM   1998  C  CG2 . ILE B  2 261 ? 114.655 94.530  113.343 1.00 46.60  ?  280 ILE C CG2 1 
ATOM   1999  C  CD1 . ILE B  2 261 ? 114.168 91.863  111.906 1.00 46.60  ?  280 ILE C CD1 1 
ATOM   2000  N  N   . ASP B  2 262 ? 113.248 94.526  116.874 1.00 50.20  ?  281 ASP C N   1 
ATOM   2001  C  CA  . ASP B  2 262 ? 112.910 95.676  117.701 1.00 50.20  ?  281 ASP C CA  1 
ATOM   2002  C  C   . ASP B  2 262 ? 113.713 95.759  118.993 1.00 50.20  ?  281 ASP C C   1 
ATOM   2003  O  O   . ASP B  2 262 ? 113.826 96.859  119.542 1.00 50.20  ?  281 ASP C O   1 
ATOM   2004  C  CB  . ASP B  2 262 ? 111.416 95.679  118.030 1.00 50.20  ?  281 ASP C CB  1 
ATOM   2005  C  CG  . ASP B  2 262 ? 110.559 96.127  116.861 1.00 50.20  ?  281 ASP C CG  1 
ATOM   2006  O  OD1 . ASP B  2 262 ? 111.052 96.917  116.029 1.00 50.20  ?  281 ASP C OD1 1 
ATOM   2007  O  OD2 . ASP B  2 262 ? 109.388 95.702  116.782 1.00 50.20  ?  281 ASP C OD2 1 
ATOM   2008  N  N   . ILE B  2 263 ? 114.274 94.658  119.501 1.00 46.55  ?  282 ILE C N   1 
ATOM   2009  C  CA  . ILE B  2 263 ? 115.123 94.788  120.685 1.00 46.55  ?  282 ILE C CA  1 
ATOM   2010  C  C   . ILE B  2 263 ? 116.581 95.091  120.352 1.00 46.55  ?  282 ILE C C   1 
ATOM   2011  O  O   . ILE B  2 263 ? 117.350 95.413  121.271 1.00 46.55  ?  282 ILE C O   1 
ATOM   2012  C  CB  . ILE B  2 263 ? 115.071 93.555  121.609 1.00 46.55  ?  282 ILE C CB  1 
ATOM   2013  C  CG1 . ILE B  2 263 ? 115.731 92.353  120.949 1.00 46.55  ?  282 ILE C CG1 1 
ATOM   2014  C  CG2 . ILE B  2 263 ? 113.647 93.260  122.022 1.00 46.55  ?  282 ILE C CG2 1 
ATOM   2015  C  CD1 . ILE B  2 263 ? 116.016 91.236  121.907 1.00 46.55  ?  282 ILE C CD1 1 
ATOM   2016  N  N   . LEU B  2 264 ? 116.988 94.989  119.085 1.00 43.99  ?  283 LEU C N   1 
ATOM   2017  C  CA  . LEU B  2 264 ? 118.341 95.381  118.692 1.00 43.99  ?  283 LEU C CA  1 
ATOM   2018  C  C   . LEU B  2 264 ? 118.502 96.885  118.835 1.00 43.99  ?  283 LEU C C   1 
ATOM   2019  O  O   . LEU B  2 264 ? 117.839 97.656  118.138 1.00 43.99  ?  283 LEU C O   1 
ATOM   2020  C  CB  . LEU B  2 264 ? 118.651 94.962  117.262 1.00 43.99  ?  283 LEU C CB  1 
ATOM   2021  C  CG  . LEU B  2 264 ? 118.969 93.500  117.003 1.00 43.99  ?  283 LEU C CG  1 
ATOM   2022  C  CD1 . LEU B  2 264 ? 119.169 93.276  115.528 1.00 43.99  ?  283 LEU C CD1 1 
ATOM   2023  C  CD2 . LEU B  2 264 ? 120.218 93.130  117.755 1.00 43.99  ?  283 LEU C CD2 1 
ATOM   2024  N  N   . GLY B  2 265 ? 119.387 97.304  119.729 1.00 44.25  ?  284 GLY C N   1 
ATOM   2025  C  CA  . GLY B  2 265 ? 119.644 98.715  119.899 1.00 44.25  ?  284 GLY C CA  1 
ATOM   2026  C  C   . GLY B  2 265 ? 119.644 99.109  121.351 1.00 44.25  ?  284 GLY C C   1 
ATOM   2027  O  O   . GLY B  2 265 ? 120.258 100.101 121.739 1.00 44.25  ?  284 GLY C O   1 
ATOM   2028  N  N   . THR B  2 266 ? 118.962 98.331  122.162 1.00 43.31  ?  285 THR C N   1 
ATOM   2029  C  CA  . THR B  2 266 ? 118.965 98.521  123.596 1.00 43.31  ?  285 THR C CA  1 
ATOM   2030  C  C   . THR B  2 266 ? 120.179 97.809  124.188 1.00 43.31  ?  285 THR C C   1 
ATOM   2031  O  O   . THR B  2 266 ? 121.118 97.438  123.479 1.00 43.31  ?  285 THR C O   1 
ATOM   2032  C  CB  . THR B  2 266 ? 117.642 98.035  124.181 1.00 43.31  ?  285 THR C CB  1 
ATOM   2033  O  OG1 . THR B  2 266 ? 117.423 96.672  123.804 1.00 43.31  ?  285 THR C OG1 1 
ATOM   2034  C  CG2 . THR B  2 266 ? 116.493 98.882  123.672 1.00 43.31  ?  285 THR C CG2 1 
ATOM   2035  N  N   . VAL B  2 267 ? 120.177 97.620  125.509 1.00 40.90  ?  286 VAL C N   1 
ATOM   2036  C  CA  . VAL B  2 267 ? 121.302 96.964  126.161 1.00 40.90  ?  286 VAL C CA  1 
ATOM   2037  C  C   . VAL B  2 267 ? 121.312 95.462  125.879 1.00 40.90  ?  286 VAL C C   1 
ATOM   2038  O  O   . VAL B  2 267 ? 122.318 94.792  126.128 1.00 40.90  ?  286 VAL C O   1 
ATOM   2039  C  CB  . VAL B  2 267 ? 121.255 97.275  127.671 1.00 40.90  ?  286 VAL C CB  1 
ATOM   2040  C  CG1 . VAL B  2 267 ? 120.177 96.461  128.360 1.00 40.90  ?  286 VAL C CG1 1 
ATOM   2041  C  CG2 . VAL B  2 267 ? 122.620 97.120  128.336 1.00 40.90  ?  286 VAL C CG2 1 
ATOM   2042  N  N   . LEU B  2 268 ? 120.231 94.920  125.313 1.00 38.21  ?  287 LEU C N   1 
ATOM   2043  C  CA  . LEU B  2 268 ? 120.115 93.492  125.048 1.00 38.21  ?  287 LEU C CA  1 
ATOM   2044  C  C   . LEU B  2 268 ? 120.985 93.016  123.892 1.00 38.21  ?  287 LEU C C   1 
ATOM   2045  O  O   . LEU B  2 268 ? 121.108 91.804  123.698 1.00 38.21  ?  287 LEU C O   1 
ATOM   2046  C  CB  . LEU B  2 268 ? 118.661 93.141  124.756 1.00 38.21  ?  287 LEU C CB  1 
ATOM   2047  C  CG  . LEU B  2 268 ? 117.680 93.443  125.881 1.00 38.21  ?  287 LEU C CG  1 
ATOM   2048  C  CD1 . LEU B  2 268 ? 116.275 93.127  125.435 1.00 38.21  ?  287 LEU C CD1 1 
ATOM   2049  C  CD2 . LEU B  2 268 ? 118.047 92.660  127.111 1.00 38.21  ?  287 LEU C CD2 1 
ATOM   2050  N  N   . GLN B  2 269 ? 121.573 93.922  123.114 1.00 42.38  ?  288 GLN C N   1 
ATOM   2051  C  CA  . GLN B  2 269 ? 122.485 93.516  122.055 1.00 42.38  ?  288 GLN C CA  1 
ATOM   2052  C  C   . GLN B  2 269 ? 123.862 93.151  122.602 1.00 42.38  ?  288 GLN C C   1 
ATOM   2053  O  O   . GLN B  2 269 ? 124.609 92.427  121.934 1.00 42.38  ?  288 GLN C O   1 
ATOM   2054  C  CB  . GLN B  2 269 ? 122.604 94.640  121.020 1.00 42.38  ?  288 GLN C CB  1 
ATOM   2055  C  CG  . GLN B  2 269 ? 123.257 94.249  119.705 1.00 42.38  ?  288 GLN C CG  1 
ATOM   2056  C  CD  . GLN B  2 269 ? 123.442 95.421  118.778 1.00 42.38  ?  288 GLN C CD  1 
ATOM   2057  O  OE1 . GLN B  2 269 ? 123.160 96.560  119.139 1.00 42.38  ?  288 GLN C OE1 1 
ATOM   2058  N  NE2 . GLN B  2 269 ? 123.919 95.151  117.570 1.00 42.38  ?  288 GLN C NE2 1 
ATOM   2059  N  N   . VAL B  2 270 ? 124.188 93.617  123.814 1.00 45.30  ?  289 VAL C N   1 
ATOM   2060  C  CA  . VAL B  2 270 ? 125.502 93.402  124.413 1.00 45.30  ?  289 VAL C CA  1 
ATOM   2061  C  C   . VAL B  2 270 ? 125.743 91.920  124.652 1.00 45.30  ?  289 VAL C C   1 
ATOM   2062  O  O   . VAL B  2 270 ? 124.937 91.239  125.295 1.00 45.30  ?  289 VAL C O   1 
ATOM   2063  C  CB  . VAL B  2 270 ? 125.613 94.196  125.723 1.00 45.30  ?  289 VAL C CB  1 
ATOM   2064  C  CG1 . VAL B  2 270 ? 126.898 93.863  126.451 1.00 45.30  ?  289 VAL C CG1 1 
ATOM   2065  C  CG2 . VAL B  2 270 ? 125.533 95.679  125.447 1.00 45.30  ?  289 VAL C CG2 1 
ATOM   2066  N  N   . GLN B  2 271 ? 126.852 91.413  124.117 1.00 52.16  ?  290 GLN C N   1 
ATOM   2067  C  CA  . GLN B  2 271 ? 127.212 90.003  124.239 1.00 52.16  ?  290 GLN C CA  1 
ATOM   2068  C  C   . GLN B  2 271 ? 127.615 89.717  125.676 1.00 52.16  ?  290 GLN C C   1 
ATOM   2069  O  O   . GLN B  2 271 ? 128.725 90.039  126.101 1.00 52.16  ?  290 GLN C O   1 
ATOM   2070  C  CB  . GLN B  2 271 ? 128.340 89.655  123.277 1.00 52.16  ?  290 GLN C CB  1 
ATOM   2071  C  CG  . GLN B  2 271 ? 128.696 88.184  123.264 1.00 52.16  ?  290 GLN C CG  1 
ATOM   2072  C  CD  . GLN B  2 271 ? 129.773 87.857  122.253 1.00 52.16  ?  290 GLN C CD  1 
ATOM   2073  O  OE1 . GLN B  2 271 ? 130.304 88.745  121.587 1.00 52.16  ?  290 GLN C OE1 1 
ATOM   2074  N  NE2 . GLN B  2 271 ? 130.098 86.576  122.127 1.00 52.16  ?  290 GLN C NE2 1 
ATOM   2075  N  N   . CYS B  2 272 ? 126.709 89.109  126.427 1.00 50.19  ?  291 CYS C N   1 
ATOM   2076  C  CA  . CYS B  2 272 ? 126.929 88.830  127.835 1.00 50.19  ?  291 CYS C CA  1 
ATOM   2077  C  C   . CYS B  2 272 ? 127.408 87.400  128.037 1.00 50.19  ?  291 CYS C C   1 
ATOM   2078  O  O   . CYS B  2 272 ? 127.007 86.482  127.320 1.00 50.19  ?  291 CYS C O   1 
ATOM   2079  C  CB  . CYS B  2 272 ? 125.648 89.076  128.628 1.00 50.19  ?  291 CYS C CB  1 
ATOM   2080  S  SG  . CYS B  2 272 ? 124.223 88.074  128.147 1.00 50.19  ?  291 CYS C SG  1 
ATOM   2081  N  N   . THR B  2 273 ? 128.283 87.222  129.025 1.00 54.98  ?  292 THR C N   1 
ATOM   2082  C  CA  . THR B  2 273 ? 128.869 85.926  129.336 1.00 54.98  ?  292 THR C CA  1 
ATOM   2083  C  C   . THR B  2 273 ? 128.603 85.580  130.790 1.00 54.98  ?  292 THR C C   1 
ATOM   2084  O  O   . THR B  2 273 ? 128.834 86.400  131.682 1.00 54.98  ?  292 THR C O   1 
ATOM   2085  C  CB  . THR B  2 273 ? 130.377 85.909  129.090 1.00 54.98  ?  292 THR C CB  1 
ATOM   2086  O  OG1 . THR B  2 273 ? 131.007 86.877  129.938 1.00 54.98  ?  292 THR C OG1 1 
ATOM   2087  C  CG2 . THR B  2 273 ? 130.695 86.221  127.635 1.00 54.98  ?  292 THR C CG2 1 
ATOM   2088  N  N   . CYS B  2 274 ? 128.129 84.357  131.024 1.00 58.05  ?  293 CYS C N   1 
ATOM   2089  C  CA  . CYS B  2 274 ? 127.809 83.888  132.370 1.00 58.05  ?  293 CYS C CA  1 
ATOM   2090  C  C   . CYS B  2 274 ? 129.030 83.166  132.928 1.00 58.05  ?  293 CYS C C   1 
ATOM   2091  O  O   . CYS B  2 274 ? 129.054 81.946  133.080 1.00 58.05  ?  293 CYS C O   1 
ATOM   2092  C  CB  . CYS B  2 274 ? 126.586 82.981  132.349 1.00 58.05  ?  293 CYS C CB  1 
ATOM   2093  S  SG  . CYS B  2 274 ? 125.066 83.771  131.785 1.00 58.05  ?  293 CYS C SG  1 
ATOM   2094  N  N   . ARG B  2 275 ? 130.062 83.947  133.237 1.00 58.18  ?  294 ARG C N   1 
ATOM   2095  C  CA  . ARG B  2 275 ? 131.293 83.386  133.775 1.00 58.18  ?  294 ARG C CA  1 
ATOM   2096  C  C   . ARG B  2 275 ? 131.521 83.829  135.209 1.00 58.18  ?  294 ARG C C   1 
ATOM   2097  O  O   . ARG B  2 275 ? 131.707 82.999  136.103 1.00 58.18  ?  294 ARG C O   1 
ATOM   2098  C  CB  . ARG B  2 275 ? 132.490 83.797  132.925 1.00 58.18  ?  294 ARG C CB  1 
ATOM   2099  C  CG  . ARG B  2 275 ? 132.509 83.208  131.539 1.00 58.18  ?  294 ARG C CG  1 
ATOM   2100  C  CD  . ARG B  2 275 ? 133.755 83.665  130.836 1.00 58.18  ?  294 ARG C CD  1 
ATOM   2101  N  NE  . ARG B  2 275 ? 134.931 83.178  131.542 1.00 58.18  ?  294 ARG C NE  1 
ATOM   2102  C  CZ  . ARG B  2 275 ? 136.173 83.550  131.266 1.00 58.18  ?  294 ARG C CZ  1 
ATOM   2103  N  NH1 . ARG B  2 275 ? 137.183 83.055  131.964 1.00 58.18  ?  294 ARG C NH1 1 
ATOM   2104  N  NH2 . ARG B  2 275 ? 136.403 84.414  130.288 1.00 58.18  ?  294 ARG C NH2 1 
ATOM   2105  N  N   . THR B  2 276 ? 131.519 85.136  135.435 1.00 52.45  ?  295 THR C N   1 
ATOM   2106  C  CA  . THR B  2 276 ? 131.788 85.693  136.756 1.00 52.45  ?  295 THR C CA  1 
ATOM   2107  C  C   . THR B  2 276 ? 130.513 85.889  137.568 1.00 52.45  ?  295 THR C C   1 
ATOM   2108  O  O   . THR B  2 276 ? 130.277 86.932  138.177 1.00 52.45  ?  295 THR C O   1 
ATOM   2109  C  CB  . THR B  2 276 ? 132.556 86.998  136.602 1.00 52.45  ?  295 THR C CB  1 
ATOM   2110  O  OG1 . THR B  2 276 ? 132.658 87.650  137.872 1.00 52.45  ?  295 THR C OG1 1 
ATOM   2111  C  CG2 . THR B  2 276 ? 131.907 87.910  135.553 1.00 52.45  ?  295 THR C CG2 1 
ATOM   2112  N  N   . ILE B  2 277 ? 129.702 84.840  137.628 1.00 48.63  ?  296 ILE C N   1 
ATOM   2113  C  CA  . ILE B  2 277 ? 128.408 84.881  138.289 1.00 48.63  ?  296 ILE C CA  1 
ATOM   2114  C  C   . ILE B  2 277 ? 128.363 83.734  139.291 1.00 48.63  ?  296 ILE C C   1 
ATOM   2115  O  O   . ILE B  2 277 ? 129.076 82.735  139.147 1.00 48.63  ?  296 ILE C O   1 
ATOM   2116  C  CB  . ILE B  2 277 ? 127.262 84.818  137.249 1.00 48.63  ?  296 ILE C CB  1 
ATOM   2117  C  CG1 . ILE B  2 277 ? 125.955 85.355  137.831 1.00 48.63  ?  296 ILE C CG1 1 
ATOM   2118  C  CG2 . ILE B  2 277 ? 127.092 83.419  136.683 1.00 48.63  ?  296 ILE C CG2 1 
ATOM   2119  C  CD1 . ILE B  2 277 ? 126.014 86.824  138.169 1.00 48.63  ?  296 ILE C CD1 1 
ATOM   2120  N  N   . THR B  2 278 ? 127.550 83.897  140.333 1.00 49.65  ?  297 THR C N   1 
ATOM   2121  C  CA  . THR B  2 278 ? 127.614 83.018  141.490 1.00 49.65  ?  297 THR C CA  1 
ATOM   2122  C  C   . THR B  2 278 ? 127.032 81.639  141.181 1.00 49.65  ?  297 THR C C   1 
ATOM   2123  O  O   . THR B  2 278 ? 126.592 81.340  140.069 1.00 49.65  ?  297 THR C O   1 
ATOM   2124  C  CB  . THR B  2 278 ? 126.898 83.647  142.681 1.00 49.65  ?  297 THR C CB  1 
ATOM   2125  O  OG1 . THR B  2 278 ? 126.989 82.769  143.809 1.00 49.65  ?  297 THR C OG1 1 
ATOM   2126  C  CG2 . THR B  2 278 ? 125.451 83.900  142.363 1.00 49.65  ?  297 THR C CG2 1 
ATOM   2127  N  N   . GLN B  2 279 ? 127.037 80.790  142.207 1.00 48.79  ?  298 GLN C N   1 
ATOM   2128  C  CA  . GLN B  2 279 ? 126.755 79.374  142.011 1.00 48.79  ?  298 GLN C CA  1 
ATOM   2129  C  C   . GLN B  2 279 ? 125.259 79.115  141.887 1.00 48.79  ?  298 GLN C C   1 
ATOM   2130  O  O   . GLN B  2 279 ? 124.827 78.346  141.021 1.00 48.79  ?  298 GLN C O   1 
ATOM   2131  C  CB  . GLN B  2 279 ? 127.356 78.579  143.172 1.00 48.79  ?  298 GLN C CB  1 
ATOM   2132  C  CG  . GLN B  2 279 ? 127.268 77.076  143.049 1.00 48.79  ?  298 GLN C CG  1 
ATOM   2133  C  CD  . GLN B  2 279 ? 128.228 76.497  142.040 1.00 48.79  ?  298 GLN C CD  1 
ATOM   2134  O  OE1 . GLN B  2 279 ? 129.392 76.877  141.991 1.00 48.79  ?  298 GLN C OE1 1 
ATOM   2135  N  NE2 . GLN B  2 279 ? 127.747 75.568  141.227 1.00 48.79  ?  298 GLN C NE2 1 
ATOM   2136  N  N   . SER B  2 280 ? 124.453 79.761  142.728 1.00 50.98  ?  299 SER C N   1 
ATOM   2137  C  CA  . SER B  2 280 ? 123.021 79.505  142.803 1.00 50.98  ?  299 SER C CA  1 
ATOM   2138  C  C   . SER B  2 280 ? 122.214 80.328  141.810 1.00 50.98  ?  299 SER C C   1 
ATOM   2139  O  O   . SER B  2 280 ? 121.002 80.126  141.696 1.00 50.98  ?  299 SER C O   1 
ATOM   2140  C  CB  . SER B  2 280 ? 122.517 79.776  144.219 1.00 50.98  ?  299 SER C CB  1 
ATOM   2141  O  OG  . SER B  2 280 ? 122.640 81.150  144.534 1.00 50.98  ?  299 SER C OG  1 
ATOM   2142  N  N   . GLU B  2 281 ? 122.848 81.252  141.098 1.00 50.38  ?  300 GLU C N   1 
ATOM   2143  C  CA  . GLU B  2 281 ? 122.182 82.067  140.093 1.00 50.38  ?  300 GLU C CA  1 
ATOM   2144  C  C   . GLU B  2 281 ? 122.730 81.759  138.711 1.00 50.38  ?  300 GLU C C   1 
ATOM   2145  O  O   . GLU B  2 281 ? 122.732 82.613  137.827 1.00 50.38  ?  300 GLU C O   1 
ATOM   2146  C  CB  . GLU B  2 281 ? 122.337 83.550  140.411 1.00 50.38  ?  300 GLU C CB  1 
ATOM   2147  C  CG  . GLU B  2 281 ? 121.630 83.972  141.679 1.00 50.38  ?  300 GLU C CG  1 
ATOM   2148  C  CD  . GLU B  2 281 ? 121.905 85.414  142.043 1.00 50.38  ?  300 GLU C CD  1 
ATOM   2149  O  OE1 . GLU B  2 281 ? 122.779 86.031  141.400 1.00 50.38  ?  300 GLU C OE1 1 
ATOM   2150  O  OE2 . GLU B  2 281 ? 121.245 85.931  142.968 1.00 50.38  ?  300 GLU C OE2 1 
ATOM   2151  N  N   . GLU B  2 282 ? 123.206 80.536  138.521 1.00 53.61  ?  301 GLU C N   1 
ATOM   2152  C  CA  . GLU B  2 282 ? 123.830 80.145  137.269 1.00 53.61  ?  301 GLU C CA  1 
ATOM   2153  C  C   . GLU B  2 282 ? 122.835 79.628  136.246 1.00 53.61  ?  301 GLU C C   1 
ATOM   2154  O  O   . GLU B  2 282 ? 122.972 79.944  135.060 1.00 53.61  ?  301 GLU C O   1 
ATOM   2155  C  CB  . GLU B  2 282 ? 124.895 79.077  137.531 1.00 53.61  ?  301 GLU C CB  1 
ATOM   2156  C  CG  . GLU B  2 282 ? 125.709 78.687  136.316 1.00 53.61  ?  301 GLU C CG  1 
ATOM   2157  C  CD  . GLU B  2 282 ? 126.790 77.684  136.644 1.00 53.61  ?  301 GLU C CD  1 
ATOM   2158  O  OE1 . GLU B  2 282 ? 126.904 77.302  137.828 1.00 53.61  ?  301 GLU C OE1 1 
ATOM   2159  O  OE2 . GLU B  2 282 ? 127.520 77.269  135.720 1.00 53.61  ?  301 GLU C OE2 1 
ATOM   2160  N  N   . SER B  2 283 ? 121.832 78.859  136.680 1.00 48.23  ?  302 SER C N   1 
ATOM   2161  C  CA  . SER B  2 283 ? 120.845 78.315  135.751 1.00 48.23  ?  302 SER C CA  1 
ATOM   2162  C  C   . SER B  2 283 ? 119.969 79.412  135.161 1.00 48.23  ?  302 SER C C   1 
ATOM   2163  O  O   . SER B  2 283 ? 119.596 79.353  133.982 1.00 48.23  ?  302 SER C O   1 
ATOM   2164  C  CB  . SER B  2 283 ? 119.988 77.273  136.463 1.00 48.23  ?  302 SER C CB  1 
ATOM   2165  O  OG  . SER B  2 283 ? 119.244 77.874  137.505 1.00 48.23  ?  302 SER C OG  1 
ATOM   2166  N  N   . LEU B  2 284 ? 119.640 80.423  135.966 1.00 48.79  ?  303 LEU C N   1 
ATOM   2167  C  CA  . LEU B  2 284 ? 118.899 81.581  135.476 1.00 48.79  ?  303 LEU C CA  1 
ATOM   2168  C  C   . LEU B  2 284 ? 119.690 82.340  134.422 1.00 48.79  ?  303 LEU C C   1 
ATOM   2169  O  O   . LEU B  2 284 ? 119.137 82.767  133.401 1.00 48.79  ?  303 LEU C O   1 
ATOM   2170  C  CB  . LEU B  2 284 ? 118.553 82.492  136.649 1.00 48.79  ?  303 LEU C CB  1 
ATOM   2171  C  CG  . LEU B  2 284 ? 117.877 83.819  136.350 1.00 48.79  ?  303 LEU C CG  1 
ATOM   2172  C  CD1 . LEU B  2 284 ? 116.586 83.597  135.609 1.00 48.79  ?  303 LEU C CD1 1 
ATOM   2173  C  CD2 . LEU B  2 284 ? 117.624 84.536  137.659 1.00 48.79  ?  303 LEU C CD2 1 
ATOM   2174  N  N   . CYS B  2 285 ? 120.993 82.508  134.654 1.00 50.80  ?  304 CYS C N   1 
ATOM   2175  C  CA  . CYS B  2 285 ? 121.843 83.179  133.681 1.00 50.80  ?  304 CYS C CA  1 
ATOM   2176  C  C   . CYS B  2 285 ? 121.972 82.346  132.419 1.00 50.80  ?  304 CYS C C   1 
ATOM   2177  O  O   . CYS B  2 285 ? 122.020 82.899  131.318 1.00 50.80  ?  304 CYS C O   1 
ATOM   2178  C  CB  . CYS B  2 285 ? 123.221 83.454  134.287 1.00 50.80  ?  304 CYS C CB  1 
ATOM   2179  S  SG  . CYS B  2 285 ? 124.271 84.678  133.424 1.00 50.80  ?  304 CYS C SG  1 
ATOM   2180  N  N   . LYS B  2 286 ? 121.987 81.018  132.555 1.00 48.24  ?  305 LYS C N   1 
ATOM   2181  C  CA  . LYS B  2 286 ? 122.050 80.157  131.382 1.00 48.24  ?  305 LYS C CA  1 
ATOM   2182  C  C   . LYS B  2 286 ? 120.770 80.222  130.561 1.00 48.24  ?  305 LYS C C   1 
ATOM   2183  O  O   . LYS B  2 286 ? 120.836 80.231  129.329 1.00 48.24  ?  305 LYS C O   1 
ATOM   2184  C  CB  . LYS B  2 286 ? 122.344 78.718  131.797 1.00 48.24  ?  305 LYS C CB  1 
ATOM   2185  C  CG  . LYS B  2 286 ? 123.773 78.490  132.255 1.00 48.24  ?  305 LYS C CG  1 
ATOM   2186  C  CD  . LYS B  2 286 ? 124.014 77.036  132.617 1.00 48.24  ?  305 LYS C CD  1 
ATOM   2187  C  CE  . LYS B  2 286 ? 125.431 76.822  133.116 1.00 48.24  ?  305 LYS C CE  1 
ATOM   2188  N  NZ  . LYS B  2 286 ? 126.426 77.018  132.029 1.00 48.24  ?  305 LYS C NZ  1 
ATOM   2189  N  N   . ILE B  2 287 ? 119.608 80.316  131.210 1.00 47.51  ?  306 ILE C N   1 
ATOM   2190  C  CA  . ILE B  2 287 ? 118.358 80.396  130.455 1.00 47.51  ?  306 ILE C CA  1 
ATOM   2191  C  C   . ILE B  2 287 ? 118.206 81.769  129.802 1.00 47.51  ?  306 ILE C C   1 
ATOM   2192  O  O   . ILE B  2 287 ? 117.747 81.875  128.656 1.00 47.51  ?  306 ILE C O   1 
ATOM   2193  C  CB  . ILE B  2 287 ? 117.164 80.035  131.360 1.00 47.51  ?  306 ILE C CB  1 
ATOM   2194  C  CG1 . ILE B  2 287 ? 117.287 78.586  131.816 1.00 47.51  ?  306 ILE C CG1 1 
ATOM   2195  C  CG2 . ILE B  2 287 ? 115.855 80.158  130.625 1.00 47.51  ?  306 ILE C CG2 1 
ATOM   2196  C  CD1 . ILE B  2 287 ? 116.315 78.201  132.888 1.00 47.51  ?  306 ILE C CD1 1 
ATOM   2197  N  N   . PHE B  2 288 ? 118.617 82.836  130.504 1.00 45.60  ?  307 PHE C N   1 
ATOM   2198  C  CA  . PHE B  2 288 ? 118.645 84.166  129.894 1.00 45.60  ?  307 PHE C CA  1 
ATOM   2199  C  C   . PHE B  2 288 ? 119.598 84.228  128.709 1.00 45.60  ?  307 PHE C C   1 
ATOM   2200  O  O   . PHE B  2 288 ? 119.251 84.780  127.660 1.00 45.60  ?  307 PHE C O   1 
ATOM   2201  C  CB  . PHE B  2 288 ? 119.024 85.227  130.926 1.00 45.60  ?  307 PHE C CB  1 
ATOM   2202  C  CG  . PHE B  2 288 ? 117.864 85.756  131.719 1.00 45.60  ?  307 PHE C CG  1 
ATOM   2203  C  CD1 . PHE B  2 288 ? 116.566 85.586  131.278 1.00 45.60  ?  307 PHE C CD1 1 
ATOM   2204  C  CD2 . PHE B  2 288 ? 118.080 86.455  132.890 1.00 45.60  ?  307 PHE C CD2 1 
ATOM   2205  C  CE1 . PHE B  2 288 ? 115.506 86.087  132.001 1.00 45.60  ?  307 PHE C CE1 1 
ATOM   2206  C  CE2 . PHE B  2 288 ? 117.025 86.958  133.615 1.00 45.60  ?  307 PHE C CE2 1 
ATOM   2207  C  CZ  . PHE B  2 288 ? 115.738 86.772  133.170 1.00 45.60  ?  307 PHE C CZ  1 
ATOM   2208  N  N   . GLN B  2 289 ? 120.794 83.655  128.848 1.00 48.36  ?  308 GLN C N   1 
ATOM   2209  C  CA  . GLN B  2 289 ? 121.739 83.593  127.742 1.00 48.36  ?  308 GLN C CA  1 
ATOM   2210  C  C   . GLN B  2 289 ? 121.222 82.722  126.609 1.00 48.36  ?  308 GLN C C   1 
ATOM   2211  O  O   . GLN B  2 289 ? 121.539 82.983  125.446 1.00 48.36  ?  308 GLN C O   1 
ATOM   2212  C  CB  . GLN B  2 289 ? 123.087 83.073  128.248 1.00 48.36  ?  308 GLN C CB  1 
ATOM   2213  C  CG  . GLN B  2 289 ? 124.219 83.122  127.235 1.00 48.36  ?  308 GLN C CG  1 
ATOM   2214  C  CD  . GLN B  2 289 ? 125.525 82.607  127.793 1.00 48.36  ?  308 GLN C CD  1 
ATOM   2215  O  OE1 . GLN B  2 289 ? 125.595 82.176  128.942 1.00 48.36  ?  308 GLN C OE1 1 
ATOM   2216  N  NE2 . GLN B  2 289 ? 126.570 82.644  126.977 1.00 48.36  ?  308 GLN C NE2 1 
ATOM   2217  N  N   . HIS B  2 290 ? 120.405 81.718  126.923 1.00 49.30  ?  309 HIS C N   1 
ATOM   2218  C  CA  . HIS B  2 290 ? 119.807 80.897  125.882 1.00 49.30  ?  309 HIS C CA  1 
ATOM   2219  C  C   . HIS B  2 290 ? 118.749 81.672  125.107 1.00 49.30  ?  309 HIS C C   1 
ATOM   2220  O  O   . HIS B  2 290 ? 118.672 81.562  123.880 1.00 49.30  ?  309 HIS C O   1 
ATOM   2221  C  CB  . HIS B  2 290 ? 119.215 79.633  126.500 1.00 49.30  ?  309 HIS C CB  1 
ATOM   2222  C  CG  . HIS B  2 290 ? 118.645 78.682  125.498 1.00 49.30  ?  309 HIS C CG  1 
ATOM   2223  N  ND1 . HIS B  2 290 ? 119.433 77.944  124.642 1.00 49.30  ?  309 HIS C ND1 1 
ATOM   2224  C  CD2 . HIS B  2 290 ? 117.366 78.340  125.219 1.00 49.30  ?  309 HIS C CD2 1 
ATOM   2225  C  CE1 . HIS B  2 290 ? 118.664 77.193  123.876 1.00 49.30  ?  309 HIS C CE1 1 
ATOM   2226  N  NE2 . HIS B  2 290 ? 117.405 77.414  124.205 1.00 49.30  ?  309 HIS C NE2 1 
ATOM   2227  N  N   . MET B  2 291 ? 117.936 82.473  125.799 1.00 45.51  ?  310 MET C N   1 
ATOM   2228  C  CA  . MET B  2 291 ? 116.890 83.213  125.098 1.00 45.51  ?  310 MET C CA  1 
ATOM   2229  C  C   . MET B  2 291 ? 117.449 84.399  124.322 1.00 45.51  ?  310 MET C C   1 
ATOM   2230  O  O   . MET B  2 291 ? 116.996 84.676  123.207 1.00 45.51  ?  310 MET C O   1 
ATOM   2231  C  CB  . MET B  2 291 ? 115.808 83.690  126.066 1.00 45.51  ?  310 MET C CB  1 
ATOM   2232  C  CG  . MET B  2 291 ? 114.946 82.588  126.636 1.00 45.51  ?  310 MET C CG  1 
ATOM   2233  S  SD  . MET B  2 291 ? 113.512 83.237  127.504 1.00 45.51  ?  310 MET C SD  1 
ATOM   2234  C  CE  . MET B  2 291 ? 114.264 83.915  128.972 1.00 45.51  ?  310 MET C CE  1 
ATOM   2235  N  N   . LEU B  2 292 ? 118.433 85.106  124.883 1.00 41.96  ?  311 LEU C N   1 
ATOM   2236  C  CA  . LEU B  2 292 ? 118.949 86.305  124.229 1.00 41.96  ?  311 LEU C CA  1 
ATOM   2237  C  C   . LEU B  2 292 ? 119.886 85.990  123.071 1.00 41.96  ?  311 LEU C C   1 
ATOM   2238  O  O   . LEU B  2 292 ? 120.253 86.902  122.326 1.00 41.96  ?  311 LEU C O   1 
ATOM   2239  C  CB  . LEU B  2 292 ? 119.679 87.189  125.238 1.00 41.96  ?  311 LEU C CB  1 
ATOM   2240  C  CG  . LEU B  2 292 ? 118.830 87.753  126.372 1.00 41.96  ?  311 LEU C CG  1 
ATOM   2241  C  CD1 . LEU B  2 292 ? 119.686 88.550  127.322 1.00 41.96  ?  311 LEU C CD1 1 
ATOM   2242  C  CD2 . LEU B  2 292 ? 117.704 88.588  125.834 1.00 41.96  ?  311 LEU C CD2 1 
ATOM   2243  N  N   . HIS B  2 293 ? 120.287 84.733  122.907 1.00 54.37  ?  312 HIS C N   1 
ATOM   2244  C  CA  . HIS B  2 293 ? 121.271 84.391  121.892 1.00 54.37  ?  312 HIS C CA  1 
ATOM   2245  C  C   . HIS B  2 293 ? 120.627 84.407  120.514 1.00 54.37  ?  312 HIS C C   1 
ATOM   2246  O  O   . HIS B  2 293 ? 119.419 84.199  120.378 1.00 54.37  ?  312 HIS C O   1 
ATOM   2247  C  CB  . HIS B  2 293 ? 121.869 83.019  122.192 1.00 54.37  ?  312 HIS C CB  1 
ATOM   2248  C  CG  . HIS B  2 293 ? 123.101 82.708  121.406 1.00 54.37  ?  312 HIS C CG  1 
ATOM   2249  N  ND1 . HIS B  2 293 ? 123.061 82.131  120.158 1.00 54.37  ?  312 HIS C ND1 1 
ATOM   2250  C  CD2 . HIS B  2 293 ? 124.411 82.888  121.696 1.00 54.37  ?  312 HIS C CD2 1 
ATOM   2251  C  CE1 . HIS B  2 293 ? 124.292 81.976  119.706 1.00 54.37  ?  312 HIS C CE1 1 
ATOM   2252  N  NE2 . HIS B  2 293 ? 125.131 82.425  120.622 1.00 54.37  ?  312 HIS C NE2 1 
ATOM   2253  N  N   . ARG B  2 294 ? 121.441 84.658  119.488 1.00 61.96  ?  313 ARG C N   1 
ATOM   2254  C  CA  . ARG B  2 294 ? 120.904 84.850  118.145 1.00 61.96  ?  313 ARG C CA  1 
ATOM   2255  C  C   . ARG B  2 294 ? 120.642 83.515  117.454 1.00 61.96  ?  313 ARG C C   1 
ATOM   2256  O  O   . ARG B  2 294 ? 119.612 83.338  116.794 1.00 61.96  ?  313 ARG C O   1 
ATOM   2257  C  CB  . ARG B  2 294 ? 121.864 85.729  117.339 1.00 61.96  ?  313 ARG C CB  1 
ATOM   2258  C  CG  . ARG B  2 294 ? 121.357 86.204  115.983 1.00 61.96  ?  313 ARG C CG  1 
ATOM   2259  C  CD  . ARG B  2 294 ? 121.898 85.371  114.827 1.00 61.96  ?  313 ARG C CD  1 
ATOM   2260  N  NE  . ARG B  2 294 ? 123.358 85.312  114.855 1.00 61.96  ?  313 ARG C NE  1 
ATOM   2261  C  CZ  . ARG B  2 294 ? 124.163 86.262  114.386 1.00 61.96  ?  313 ARG C CZ  1 
ATOM   2262  N  NH1 . ARG B  2 294 ? 125.479 86.110  114.464 1.00 61.96  ?  313 ARG C NH1 1 
ATOM   2263  N  NH2 . ARG B  2 294 ? 123.661 87.360  113.836 1.00 61.96  ?  313 ARG C NH2 1 
ATOM   2264  N  N   . LYS B  2 295 ? 121.560 82.559  117.595 1.00 64.60  ?  314 LYS C N   1 
ATOM   2265  C  CA  . LYS B  2 295 ? 121.438 81.257  116.947 1.00 64.60  ?  314 LYS C CA  1 
ATOM   2266  C  C   . LYS B  2 295 ? 120.522 80.293  117.688 1.00 64.60  ?  314 LYS C C   1 
ATOM   2267  O  O   . LYS B  2 295 ? 120.457 79.121  117.305 1.00 64.60  ?  314 LYS C O   1 
ATOM   2268  C  CB  . LYS B  2 295 ? 122.813 80.604  116.790 1.00 64.60  ?  314 LYS C CB  1 
ATOM   2269  C  CG  . LYS B  2 295 ? 123.727 81.279  115.791 1.00 64.60  ?  314 LYS C CG  1 
ATOM   2270  C  CD  . LYS B  2 295 ? 125.039 80.519  115.683 1.00 64.60  ?  314 LYS C CD  1 
ATOM   2271  C  CE  . LYS B  2 295 ? 125.998 81.193  114.720 1.00 64.60  ?  314 LYS C CE  1 
ATOM   2272  N  NZ  . LYS B  2 295 ? 127.293 80.469  114.598 1.00 64.60  ?  314 LYS C NZ  1 
ATOM   2273  N  N   . SER B  2 296 ? 119.816 80.743  118.728 1.00 62.83  ?  315 SER C N   1 
ATOM   2274  C  CA  . SER B  2 296 ? 118.919 79.847  119.448 1.00 62.83  ?  315 SER C CA  1 
ATOM   2275  C  C   . SER B  2 296 ? 117.631 79.595  118.679 1.00 62.83  ?  315 SER C C   1 
ATOM   2276  O  O   . SER B  2 296 ? 116.873 78.684  119.029 1.00 62.83  ?  315 SER C O   1 
ATOM   2277  C  CB  . SER B  2 296 ? 118.597 80.416  120.825 1.00 62.83  ?  315 SER C CB  1 
ATOM   2278  O  OG  . SER B  2 296 ? 119.754 80.487  121.635 1.00 62.83  ?  315 SER C OG  1 
ATOM   2279  N  N   . CYS B  2 297 ? 117.358 80.388  117.646 1.00 73.78  ?  316 CYS C N   1 
ATOM   2280  C  CA  . CYS B  2 297 ? 116.137 80.229  116.874 1.00 73.78  ?  316 CYS C CA  1 
ATOM   2281  C  C   . CYS B  2 297 ? 116.338 80.092  115.371 1.00 73.78  ?  316 CYS C C   1 
ATOM   2282  O  O   . CYS B  2 297 ? 115.621 79.296  114.754 1.00 73.78  ?  316 CYS C O   1 
ATOM   2283  C  CB  . CYS B  2 297 ? 115.191 81.408  117.134 1.00 73.78  ?  316 CYS C CB  1 
ATOM   2284  S  SG  . CYS B  2 297 ? 114.507 81.489  118.788 1.00 73.78  ?  316 CYS C SG  1 
ATOM   2285  N  N   . PHE B  2 298 ? 117.274 80.817  114.758 1.00 71.43  ?  317 PHE C N   1 
ATOM   2286  C  CA  . PHE B  2 298 ? 117.356 80.887  113.297 1.00 71.43  ?  317 PHE C CA  1 
ATOM   2287  C  C   . PHE B  2 298 ? 118.804 80.753  112.845 1.00 71.43  ?  317 PHE C C   1 
ATOM   2288  O  O   . PHE B  2 298 ? 119.659 81.559  113.213 1.00 71.43  ?  317 PHE C O   1 
ATOM   2289  C  CB  . PHE B  2 298 ? 116.742 82.181  112.792 1.00 71.43  ?  317 PHE C CB  1 
ATOM   2290  C  CG  . PHE B  2 298 ? 115.311 82.354  113.188 1.00 71.43  ?  317 PHE C CG  1 
ATOM   2291  C  CD1 . PHE B  2 298 ? 114.314 81.602  112.586 1.00 71.43  ?  317 PHE C CD1 1 
ATOM   2292  C  CD2 . PHE B  2 298 ? 114.964 83.272  114.163 1.00 71.43  ?  317 PHE C CD2 1 
ATOM   2293  C  CE1 . PHE B  2 298 ? 112.993 81.754  112.964 1.00 71.43  ?  317 PHE C CE1 1 
ATOM   2294  C  CE2 . PHE B  2 298 ? 113.648 83.432  114.546 1.00 71.43  ?  317 PHE C CE2 1 
ATOM   2295  C  CZ  . PHE B  2 298 ? 112.659 82.675  113.944 1.00 71.43  ?  317 PHE C CZ  1 
ATOM   2296  N  N   . ASN B  2 299 ? 119.068 79.727  112.039 1.00 72.28  ?  318 ASN C N   1 
ATOM   2297  C  CA  . ASN B  2 299 ? 120.326 79.598  111.306 1.00 72.28  ?  318 ASN C CA  1 
ATOM   2298  C  C   . ASN B  2 299 ? 120.149 78.764  110.037 1.00 72.28  ?  318 ASN C C   1 
ATOM   2299  O  O   . ASN B  2 299 ? 120.974 77.907  109.721 1.00 72.28  ?  318 ASN C O   1 
ATOM   2300  C  CB  . ASN B  2 299 ? 121.428 79.001  112.191 1.00 72.28  ?  318 ASN C CB  1 
ATOM   2301  C  CG  . ASN B  2 299 ? 121.038 77.676  112.822 1.00 72.28  ?  318 ASN C CG  1 
ATOM   2302  O  OD1 . ASN B  2 299 ? 119.934 77.166  112.624 1.00 72.28  ?  318 ASN C OD1 1 
ATOM   2303  N  ND2 . ASN B  2 299 ? 121.967 77.098  113.573 1.00 72.28  ?  318 ASN C ND2 1 
ATOM   2304  N  N   . LEU C  3 1   ? 118.638 74.334  156.929 1.00 56.84  ?  29  LEU E N   1 
ATOM   2305  C  CA  . LEU C  3 1   ? 118.760 73.263  155.950 1.00 56.84  ?  29  LEU E CA  1 
ATOM   2306  C  C   . LEU C  3 1   ? 118.732 73.860  154.561 1.00 56.84  ?  29  LEU E C   1 
ATOM   2307  O  O   . LEU C  3 1   ? 118.963 75.053  154.394 1.00 56.84  ?  29  LEU E O   1 
ATOM   2308  C  CB  . LEU C  3 1   ? 117.632 72.251  156.107 1.00 56.84  ?  29  LEU E CB  1 
ATOM   2309  C  CG  . LEU C  3 1   ? 117.524 71.553  157.457 1.00 56.84  ?  29  LEU E CG  1 
ATOM   2310  C  CD1 . LEU C  3 1   ? 116.291 70.698  157.492 1.00 56.84  ?  29  LEU E CD1 1 
ATOM   2311  C  CD2 . LEU C  3 1   ? 118.744 70.719  157.724 1.00 56.84  ?  29  LEU E CD2 1 
ATOM   2312  N  N   . TYR C  3 2   ? 118.437 73.032  153.566 1.00 53.10  ?  30  TYR E N   1 
ATOM   2313  C  CA  . TYR C  3 2   ? 118.262 73.523  152.207 1.00 53.10  ?  30  TYR E CA  1 
ATOM   2314  C  C   . TYR C  3 2   ? 117.373 72.555  151.452 1.00 53.10  ?  30  TYR E C   1 
ATOM   2315  O  O   . TYR C  3 2   ? 117.539 71.339  151.574 1.00 53.10  ?  30  TYR E O   1 
ATOM   2316  C  CB  . TYR C  3 2   ? 119.605 73.702  151.497 1.00 53.10  ?  30  TYR E CB  1 
ATOM   2317  C  CG  . TYR C  3 2   ? 120.407 72.452  151.237 1.00 53.10  ?  30  TYR E CG  1 
ATOM   2318  C  CD1 . TYR C  3 2   ? 121.218 71.909  152.221 1.00 53.10  ?  30  TYR E CD1 1 
ATOM   2319  C  CD2 . TYR C  3 2   ? 120.416 71.864  149.984 1.00 53.10  ?  30  TYR E CD2 1 
ATOM   2320  C  CE1 . TYR C  3 2   ? 121.972 70.782  151.979 1.00 53.10  ?  30  TYR E CE1 1 
ATOM   2321  C  CE2 . TYR C  3 2   ? 121.173 70.740  149.734 1.00 53.10  ?  30  TYR E CE2 1 
ATOM   2322  C  CZ  . TYR C  3 2   ? 121.948 70.207  150.736 1.00 53.10  ?  30  TYR E CZ  1 
ATOM   2323  O  OH  . TYR C  3 2   ? 122.705 69.089  150.499 1.00 53.10  ?  30  TYR E OH  1 
ATOM   2324  N  N   . PHE C  3 3   ? 116.416 73.098  150.706 1.00 51.46  ?  31  PHE E N   1 
ATOM   2325  C  CA  . PHE C  3 3   ? 115.560 72.275  149.870 1.00 51.46  ?  31  PHE E CA  1 
ATOM   2326  C  C   . PHE C  3 3   ? 116.371 71.661  148.743 1.00 51.46  ?  31  PHE E C   1 
ATOM   2327  O  O   . PHE C  3 3   ? 117.342 72.253  148.267 1.00 51.46  ?  31  PHE E O   1 
ATOM   2328  C  CB  . PHE C  3 3   ? 114.414 73.110  149.303 1.00 51.46  ?  31  PHE E CB  1 
ATOM   2329  C  CG  . PHE C  3 3   ? 113.373 73.482  150.312 1.00 51.46  ?  31  PHE E CG  1 
ATOM   2330  C  CD1 . PHE C  3 3   ? 112.313 72.639  150.570 1.00 51.46  ?  31  PHE E CD1 1 
ATOM   2331  C  CD2 . PHE C  3 3   ? 113.465 74.669  151.012 1.00 51.46  ?  31  PHE E CD2 1 
ATOM   2332  C  CE1 . PHE C  3 3   ? 111.357 72.980  151.495 1.00 51.46  ?  31  PHE E CE1 1 
ATOM   2333  C  CE2 . PHE C  3 3   ? 112.512 75.015  151.940 1.00 51.46  ?  31  PHE E CE2 1 
ATOM   2334  C  CZ  . PHE C  3 3   ? 111.460 74.170  152.184 1.00 51.46  ?  31  PHE E CZ  1 
ATOM   2335  N  N   . SER C  3 4   ? 115.975 70.453  148.340 1.00 47.28  ?  32  SER E N   1 
ATOM   2336  C  CA  . SER C  3 4   ? 116.664 69.739  147.273 1.00 47.28  ?  32  SER E CA  1 
ATOM   2337  C  C   . SER C  3 4   ? 116.547 70.462  145.947 1.00 47.28  ?  32  SER E C   1 
ATOM   2338  O  O   . SER C  3 4   ? 117.467 70.404  145.125 1.00 47.28  ?  32  SER E O   1 
ATOM   2339  C  CB  . SER C  3 4   ? 116.088 68.341  147.132 1.00 47.28  ?  32  SER E CB  1 
ATOM   2340  O  OG  . SER C  3 4   ? 114.751 68.411  146.675 1.00 47.28  ?  32  SER E OG  1 
ATOM   2341  N  N   . ARG C  3 5   ? 115.430 71.137  145.721 1.00 46.56  ?  33  ARG E N   1 
ATOM   2342  C  CA  . ARG C  3 5   ? 115.212 71.941  144.537 1.00 46.56  ?  33  ARG E CA  1 
ATOM   2343  C  C   . ARG C  3 5   ? 114.996 73.376  144.983 1.00 46.56  ?  33  ARG E C   1 
ATOM   2344  O  O   . ARG C  3 5   ? 115.004 73.685  146.175 1.00 46.56  ?  33  ARG E O   1 
ATOM   2345  C  CB  . ARG C  3 5   ? 114.017 71.413  143.738 1.00 46.56  ?  33  ARG E CB  1 
ATOM   2346  C  CG  . ARG C  3 5   ? 114.209 69.996  143.237 1.00 46.56  ?  33  ARG E CG  1 
ATOM   2347  C  CD  . ARG C  3 5   ? 112.991 69.481  142.502 1.00 46.56  ?  33  ARG E CD  1 
ATOM   2348  N  NE  . ARG C  3 5   ? 112.755 70.232  141.279 1.00 46.56  ?  33  ARG E NE  1 
ATOM   2349  C  CZ  . ARG C  3 5   ? 111.689 70.076  140.506 1.00 46.56  ?  33  ARG E CZ  1 
ATOM   2350  N  NH1 . ARG C  3 5   ? 110.769 69.177  140.824 1.00 46.56  ?  33  ARG E NH1 1 
ATOM   2351  N  NH2 . ARG C  3 5   ? 111.554 70.807  139.409 1.00 46.56  ?  33  ARG E NH2 1 
ATOM   2352  N  N   . ASP C  3 6   ? 114.816 74.267  144.021 1.00 47.62  ?  34  ASP E N   1 
ATOM   2353  C  CA  . ASP C  3 6   ? 114.403 75.628  144.321 1.00 47.62  ?  34  ASP E CA  1 
ATOM   2354  C  C   . ASP C  3 6   ? 112.909 75.833  144.169 1.00 47.62  ?  34  ASP E C   1 
ATOM   2355  O  O   . ASP C  3 6   ? 112.325 76.636  144.897 1.00 47.62  ?  34  ASP E O   1 
ATOM   2356  C  CB  . ASP C  3 6   ? 115.157 76.624  143.433 1.00 47.62  ?  34  ASP E CB  1 
ATOM   2357  C  CG  . ASP C  3 6   ? 115.047 76.296  141.958 1.00 47.62  ?  34  ASP E CG  1 
ATOM   2358  O  OD1 . ASP C  3 6   ? 114.526 75.214  141.619 1.00 47.62  ?  34  ASP E OD1 1 
ATOM   2359  O  OD2 . ASP C  3 6   ? 115.473 77.128  141.131 1.00 47.62  ?  34  ASP E OD2 1 
ATOM   2360  N  N   . ALA C  3 7   ? 112.280 75.108  143.246 1.00 45.77  ?  35  ALA E N   1 
ATOM   2361  C  CA  . ALA C  3 7   ? 110.841 75.157  143.059 1.00 45.77  ?  35  ALA E CA  1 
ATOM   2362  C  C   . ALA C  3 7   ? 110.326 73.867  142.446 1.00 45.77  ?  35  ALA E C   1 
ATOM   2363  O  O   . ALA C  3 7   ? 111.067 73.135  141.788 1.00 45.77  ?  35  ALA E O   1 
ATOM   2364  C  CB  . ALA C  3 7   ? 110.429 76.323  142.181 1.00 45.77  ?  35  ALA E CB  1 
ATOM   2365  N  N   . TYR C  3 8   ? 109.040 73.621  142.645 1.00 45.66  ?  36  TYR E N   1 
ATOM   2366  C  CA  . TYR C  3 8   ? 108.372 72.410  142.211 1.00 45.66  ?  36  TYR E CA  1 
ATOM   2367  C  C   . TYR C  3 8   ? 107.302 72.775  141.191 1.00 45.66  ?  36  TYR E C   1 
ATOM   2368  O  O   . TYR C  3 8   ? 107.148 73.940  140.823 1.00 45.66  ?  36  TYR E O   1 
ATOM   2369  C  CB  . TYR C  3 8   ? 107.768 71.688  143.416 1.00 45.66  ?  36  TYR E CB  1 
ATOM   2370  C  CG  . TYR C  3 8   ? 108.808 71.190  144.392 1.00 45.66  ?  36  TYR E CG  1 
ATOM   2371  C  CD1 . TYR C  3 8   ? 109.375 69.938  144.249 1.00 45.66  ?  36  TYR E CD1 1 
ATOM   2372  C  CD2 . TYR C  3 8   ? 109.249 71.990  145.433 1.00 45.66  ?  36  TYR E CD2 1 
ATOM   2373  C  CE1 . TYR C  3 8   ? 110.328 69.484  145.133 1.00 45.66  ?  36  TYR E CE1 1 
ATOM   2374  C  CE2 . TYR C  3 8   ? 110.206 71.549  146.312 1.00 45.66  ?  36  TYR E CE2 1 
ATOM   2375  C  CZ  . TYR C  3 8   ? 110.739 70.295  146.160 1.00 45.66  ?  36  TYR E CZ  1 
ATOM   2376  O  OH  . TYR C  3 8   ? 111.693 69.848  147.038 1.00 45.66  ?  36  TYR E OH  1 
ATOM   2377  N  N   . TRP C  3 9   ? 106.564 71.772  140.723 1.00 48.10  ?  37  TRP E N   1 
ATOM   2378  C  CA  . TRP C  3 9   ? 105.506 71.976  139.740 1.00 48.10  ?  37  TRP E CA  1 
ATOM   2379  C  C   . TRP C  3 9   ? 104.411 70.944  139.947 1.00 48.10  ?  37  TRP E C   1 
ATOM   2380  O  O   . TRP C  3 9   ? 104.687 69.823  140.384 1.00 48.10  ?  37  TRP E O   1 
ATOM   2381  C  CB  . TRP C  3 9   ? 106.038 71.875  138.313 1.00 48.10  ?  37  TRP E CB  1 
ATOM   2382  C  CG  . TRP C  3 9   ? 106.864 73.030  137.846 1.00 48.10  ?  37  TRP E CG  1 
ATOM   2383  C  CD1 . TRP C  3 9   ? 108.206 73.180  137.992 1.00 48.10  ?  37  TRP E CD1 1 
ATOM   2384  C  CD2 . TRP C  3 9   ? 106.418 74.154  137.077 1.00 48.10  ?  37  TRP E CD2 1 
ATOM   2385  N  NE1 . TRP C  3 9   ? 108.622 74.345  137.402 1.00 48.10  ?  37  TRP E NE1 1 
ATOM   2386  C  CE2 . TRP C  3 9   ? 107.544 74.959  136.825 1.00 48.10  ?  37  TRP E CE2 1 
ATOM   2387  C  CE3 . TRP C  3 9   ? 105.177 74.564  136.588 1.00 48.10  ?  37  TRP E CE3 1 
ATOM   2388  C  CZ2 . TRP C  3 9   ? 107.467 76.148  136.105 1.00 48.10  ?  37  TRP E CZ2 1 
ATOM   2389  C  CZ3 . TRP C  3 9   ? 105.102 75.749  135.880 1.00 48.10  ?  37  TRP E CZ3 1 
ATOM   2390  C  CH2 . TRP C  3 9   ? 106.238 76.528  135.649 1.00 48.10  ?  37  TRP E CH2 1 
ATOM   2391  N  N   . GLU C  3 10  ? 103.180 71.320  139.605 1.00 55.39  ?  38  GLU E N   1 
ATOM   2392  C  CA  . GLU C  3 10  ? 102.007 70.484  139.804 1.00 55.39  ?  38  GLU E CA  1 
ATOM   2393  C  C   . GLU C  3 10  ? 100.877 71.041  138.952 1.00 55.39  ?  38  GLU E C   1 
ATOM   2394  O  O   . GLU C  3 10  ? 100.795 72.250  138.730 1.00 55.39  ?  38  GLU E O   1 
ATOM   2395  C  CB  . GLU C  3 10  ? 101.604 70.448  141.283 1.00 55.39  ?  38  GLU E CB  1 
ATOM   2396  C  CG  . GLU C  3 10  ? 100.493 69.480  141.651 1.00 55.39  ?  38  GLU E CG  1 
ATOM   2397  C  CD  . GLU C  3 10  ? 100.901 68.025  141.503 1.00 55.39  ?  38  GLU E CD  1 
ATOM   2398  O  OE1 . GLU C  3 10  ? 102.108 67.724  141.605 1.00 55.39  ?  38  GLU E OE1 1 
ATOM   2399  O  OE2 . GLU C  3 10  ? 100.010 67.176  141.297 1.00 55.39  ?  38  GLU E OE2 1 
ATOM   2400  N  N   . LYS C  3 11  ? 100.012 70.155  138.466 1.00 60.92  ?  39  LYS E N   1 
ATOM   2401  C  CA  . LYS C  3 11  ? 98.864  70.536  137.651 1.00 60.92  ?  39  LYS E CA  1 
ATOM   2402  C  C   . LYS C  3 11  ? 97.591  70.333  138.466 1.00 60.92  ?  39  LYS E C   1 
ATOM   2403  O  O   . LYS C  3 11  ? 97.250  69.201  138.820 1.00 60.92  ?  39  LYS E O   1 
ATOM   2404  C  CB  . LYS C  3 11  ? 98.826  69.720  136.363 1.00 60.92  ?  39  LYS E CB  1 
ATOM   2405  C  CG  . LYS C  3 11  ? 99.980  69.995  135.424 1.00 60.92  ?  39  LYS E CG  1 
ATOM   2406  C  CD  . LYS C  3 11  ? 99.864  69.164  134.160 1.00 60.92  ?  39  LYS E CD  1 
ATOM   2407  C  CE  . LYS C  3 11  ? 101.036 69.408  133.226 1.00 60.92  ?  39  LYS E CE  1 
ATOM   2408  N  NZ  . LYS C  3 11  ? 100.937 68.592  131.987 1.00 60.92  ?  39  LYS E NZ  1 
ATOM   2409  N  N   . LEU C  3 12  ? 96.893  71.427  138.762 1.00 64.42  ?  40  LEU E N   1 
ATOM   2410  C  CA  . LEU C  3 12  ? 95.591  71.364  139.413 1.00 64.42  ?  40  LEU E CA  1 
ATOM   2411  C  C   . LEU C  3 12  ? 94.484  71.355  138.370 1.00 64.42  ?  40  LEU E C   1 
ATOM   2412  O  O   . LEU C  3 12  ? 94.615  71.961  137.303 1.00 64.42  ?  40  LEU E O   1 
ATOM   2413  C  CB  . LEU C  3 12  ? 95.397  72.545  140.360 1.00 64.42  ?  40  LEU E CB  1 
ATOM   2414  C  CG  . LEU C  3 12  ? 96.242  72.509  141.623 1.00 64.42  ?  40  LEU E CG  1 
ATOM   2415  C  CD1 . LEU C  3 12  ? 96.074  73.783  142.423 1.00 64.42  ?  40  LEU E CD1 1 
ATOM   2416  C  CD2 . LEU C  3 12  ? 95.820  71.324  142.439 1.00 64.42  ?  40  LEU E CD2 1 
ATOM   2417  N  N   . TYR C  3 13  ? 93.386  70.673  138.686 1.00 72.18  ?  41  TYR E N   1 
ATOM   2418  C  CA  . TYR C  3 13  ? 92.258  70.560  137.776 1.00 72.18  ?  41  TYR E CA  1 
ATOM   2419  C  C   . TYR C  3 13  ? 90.955  70.904  138.484 1.00 72.18  ?  41  TYR E C   1 
ATOM   2420  O  O   . TYR C  3 13  ? 90.894  70.966  139.715 1.00 72.18  ?  41  TYR E O   1 
ATOM   2421  C  CB  . TYR C  3 13  ? 92.152  69.155  137.185 1.00 72.18  ?  41  TYR E CB  1 
ATOM   2422  C  CG  . TYR C  3 13  ? 93.262  68.796  136.232 1.00 72.18  ?  41  TYR E CG  1 
ATOM   2423  C  CD1 . TYR C  3 13  ? 93.305  69.339  134.956 1.00 72.18  ?  41  TYR E CD1 1 
ATOM   2424  C  CD2 . TYR C  3 13  ? 94.240  67.882  136.588 1.00 72.18  ?  41  TYR E CD2 1 
ATOM   2425  C  CE1 . TYR C  3 13  ? 94.309  69.005  134.071 1.00 72.18  ?  41  TYR E CE1 1 
ATOM   2426  C  CE2 . TYR C  3 13  ? 95.246  67.536  135.710 1.00 72.18  ?  41  TYR E CE2 1 
ATOM   2427  C  CZ  . TYR C  3 13  ? 95.275  68.101  134.452 1.00 72.18  ?  41  TYR E CZ  1 
ATOM   2428  O  OH  . TYR C  3 13  ? 96.276  67.761  133.574 1.00 72.18  ?  41  TYR E OH  1 
ATOM   2429  N  N   . VAL C  3 14  ? 89.915  71.135  137.681 1.00 77.48  ?  42  VAL E N   1 
ATOM   2430  C  CA  . VAL C  3 14  ? 88.569  71.407  138.175 1.00 77.48  ?  42  VAL E CA  1 
ATOM   2431  C  C   . VAL C  3 14  ? 88.009  70.163  138.845 1.00 77.48  ?  42  VAL E C   1 
ATOM   2432  O  O   . VAL C  3 14  ? 88.069  69.065  138.278 1.00 77.48  ?  42  VAL E O   1 
ATOM   2433  C  CB  . VAL C  3 14  ? 87.643  71.876  137.036 1.00 77.48  ?  42  VAL E CB  1 
ATOM   2434  C  CG1 . VAL C  3 14  ? 86.207  72.001  137.511 1.00 77.48  ?  42  VAL E CG1 1 
ATOM   2435  C  CG2 . VAL C  3 14  ? 88.109  73.196  136.502 1.00 77.48  ?  42  VAL E CG2 1 
ATOM   2436  N  N   . ASP C  3 15  ? 87.502  70.336  140.073 1.00 81.18  ?  43  ASP E N   1 
ATOM   2437  C  CA  . ASP C  3 15  ? 86.700  69.346  140.801 1.00 81.18  ?  43  ASP E CA  1 
ATOM   2438  C  C   . ASP C  3 15  ? 87.505  68.088  141.126 1.00 81.18  ?  43  ASP E C   1 
ATOM   2439  O  O   . ASP C  3 15  ? 87.023  66.965  140.982 1.00 81.18  ?  43  ASP E O   1 
ATOM   2440  C  CB  . ASP C  3 15  ? 85.412  68.993  140.047 1.00 81.18  ?  43  ASP E CB  1 
ATOM   2441  C  CG  . ASP C  3 15  ? 84.415  70.134  140.029 1.00 81.18  ?  43  ASP E CG  1 
ATOM   2442  O  OD1 . ASP C  3 15  ? 84.407  70.936  140.986 1.00 81.18  ?  43  ASP E OD1 1 
ATOM   2443  O  OD2 . ASP C  3 15  ? 83.638  70.228  139.056 1.00 81.18  ?  43  ASP E OD2 1 
ATOM   2444  N  N   . GLN C  3 16  ? 88.743  68.283  141.564 1.00 74.99  ?  44  GLN E N   1 
ATOM   2445  C  CA  . GLN C  3 16  ? 89.449  67.162  142.151 1.00 74.99  ?  44  GLN E CA  1 
ATOM   2446  C  C   . GLN C  3 16  ? 88.895  66.886  143.544 1.00 74.99  ?  44  GLN E C   1 
ATOM   2447  O  O   . GLN C  3 16  ? 88.394  67.777  144.233 1.00 74.99  ?  44  GLN E O   1 
ATOM   2448  C  CB  . GLN C  3 16  ? 90.951  67.427  142.212 1.00 74.99  ?  44  GLN E CB  1 
ATOM   2449  C  CG  . GLN C  3 16  ? 91.626  67.526  140.861 1.00 74.99  ?  44  GLN E CG  1 
ATOM   2450  C  CD  . GLN C  3 16  ? 93.126  67.657  140.987 1.00 74.99  ?  44  GLN E CD  1 
ATOM   2451  O  OE1 . GLN C  3 16  ? 93.667  67.671  142.090 1.00 74.99  ?  44  GLN E OE1 1 
ATOM   2452  N  NE2 . GLN C  3 16  ? 93.807  67.762  139.856 1.00 74.99  ?  44  GLN E NE2 1 
ATOM   2453  N  N   . ALA C  3 17  ? 88.983  65.629  143.956 1.00 80.57  ?  45  ALA E N   1 
ATOM   2454  C  CA  . ALA C  3 17  ? 88.386  65.182  145.203 1.00 80.57  ?  45  ALA E CA  1 
ATOM   2455  C  C   . ALA C  3 17  ? 89.204  65.662  146.395 1.00 80.57  ?  45  ALA E C   1 
ATOM   2456  O  O   . ALA C  3 17  ? 90.379  66.014  146.280 1.00 80.57  ?  45  ALA E O   1 
ATOM   2457  C  CB  . ALA C  3 17  ? 88.260  63.656  145.221 1.00 80.57  ?  45  ALA E CB  1 
ATOM   2458  N  N   . ALA C  3 18  ? 88.553  65.684  147.552 1.00 80.97  ?  46  ALA E N   1 
ATOM   2459  C  CA  . ALA C  3 18  ? 89.239  66.009  148.791 1.00 80.97  ?  46  ALA E CA  1 
ATOM   2460  C  C   . ALA C  3 18  ? 90.148  64.859  149.205 1.00 80.97  ?  46  ALA E C   1 
ATOM   2461  O  O   . ALA C  3 18  ? 89.863  63.687  148.946 1.00 80.97  ?  46  ALA E O   1 
ATOM   2462  C  CB  . ALA C  3 18  ? 88.231  66.307  149.898 1.00 80.97  ?  46  ALA E CB  1 
ATOM   2463  N  N   . GLY C  3 19  ? 91.255  65.204  149.855 1.00 73.82  ?  47  GLY E N   1 
ATOM   2464  C  CA  . GLY C  3 19  ? 92.220  64.189  150.224 1.00 73.82  ?  47  GLY E CA  1 
ATOM   2465  C  C   . GLY C  3 19  ? 93.015  63.631  149.067 1.00 73.82  ?  47  GLY E C   1 
ATOM   2466  O  O   . GLY C  3 19  ? 93.522  62.511  149.161 1.00 73.82  ?  47  GLY E O   1 
ATOM   2467  N  N   . THR C  3 20  ? 93.125  64.379  147.969 1.00 74.31  ?  48  THR E N   1 
ATOM   2468  C  CA  . THR C  3 20  ? 93.925  63.969  146.827 1.00 74.31  ?  48  THR E CA  1 
ATOM   2469  C  C   . THR C  3 20  ? 95.349  64.456  147.012 1.00 74.31  ?  48  THR E C   1 
ATOM   2470  O  O   . THR C  3 20  ? 95.559  65.674  147.099 1.00 74.31  ?  48  THR E O   1 
ATOM   2471  C  CB  . THR C  3 20  ? 93.350  64.536  145.537 1.00 74.31  ?  48  THR E CB  1 
ATOM   2472  O  OG1 . THR C  3 20  ? 92.036  64.011  145.323 1.00 74.31  ?  48  THR E OG1 1 
ATOM   2473  C  CG2 . THR C  3 20  ? 94.240  64.183  144.360 1.00 74.31  ?  48  THR E CG2 1 
ATOM   2474  N  N   . PRO C  3 21  ? 96.339  63.571  147.091 1.00 68.48  ?  49  PRO E N   1 
ATOM   2475  C  CA  . PRO C  3 21  ? 97.728  64.029  147.182 1.00 68.48  ?  49  PRO E CA  1 
ATOM   2476  C  C   . PRO C  3 21  ? 98.188  64.672  145.886 1.00 68.48  ?  49  PRO E C   1 
ATOM   2477  O  O   . PRO C  3 21  ? 97.827  64.243  144.788 1.00 68.48  ?  49  PRO E O   1 
ATOM   2478  C  CB  . PRO C  3 21  ? 98.508  62.741  147.467 1.00 68.48  ?  49  PRO E CB  1 
ATOM   2479  C  CG  . PRO C  3 21  ? 97.497  61.806  148.044 1.00 68.48  ?  49  PRO E CG  1 
ATOM   2480  C  CD  . PRO C  3 21  ? 96.226  62.123  147.326 1.00 68.48  ?  49  PRO E CD  1 
ATOM   2481  N  N   . LEU C  3 22  ? 98.993  65.724  146.026 1.00 63.80  ?  50  LEU E N   1 
ATOM   2482  C  CA  . LEU C  3 22  ? 99.518  66.448  144.877 1.00 63.80  ?  50  LEU E CA  1 
ATOM   2483  C  C   . LEU C  3 22  ? 101.003 66.179  144.673 1.00 63.80  ?  50  LEU E C   1 
ATOM   2484  O  O   . LEU C  3 22  ? 101.388 65.705  143.601 1.00 63.80  ?  50  LEU E O   1 
ATOM   2485  C  CB  . LEU C  3 22  ? 99.264  67.953  145.023 1.00 63.80  ?  50  LEU E CB  1 
ATOM   2486  C  CG  . LEU C  3 22  ? 97.807  68.395  145.019 1.00 63.80  ?  50  LEU E CG  1 
ATOM   2487  C  CD1 . LEU C  3 22  ? 97.706  69.870  145.337 1.00 63.80  ?  50  LEU E CD1 1 
ATOM   2488  C  CD2 . LEU C  3 22  ? 97.198  68.089  143.671 1.00 63.80  ?  50  LEU E CD2 1 
ATOM   2489  N  N   . LEU C  3 23  ? 101.846 66.434  145.677 1.00 59.58  ?  51  LEU E N   1 
ATOM   2490  C  CA  . LEU C  3 23  ? 103.267 66.137  145.514 1.00 59.58  ?  51  LEU E CA  1 
ATOM   2491  C  C   . LEU C  3 23  ? 103.962 65.967  146.855 1.00 59.58  ?  51  LEU E C   1 
ATOM   2492  O  O   . LEU C  3 23  ? 103.449 66.350  147.906 1.00 59.58  ?  51  LEU E O   1 
ATOM   2493  C  CB  . LEU C  3 23  ? 104.000 67.204  144.678 1.00 59.58  ?  51  LEU E CB  1 
ATOM   2494  C  CG  . LEU C  3 23  ? 103.964 68.707  144.950 1.00 59.58  ?  51  LEU E CG  1 
ATOM   2495  C  CD1 . LEU C  3 23  ? 104.969 69.155  145.978 1.00 59.58  ?  51  LEU E CD1 1 
ATOM   2496  C  CD2 . LEU C  3 23  ? 104.250 69.405  143.651 1.00 59.58  ?  51  LEU E CD2 1 
ATOM   2497  N  N   . TYR C  3 24  ? 105.139 65.357  146.793 1.00 59.88  ?  52  TYR E N   1 
ATOM   2498  C  CA  . TYR C  3 24  ? 106.063 65.299  147.912 1.00 59.88  ?  52  TYR E CA  1 
ATOM   2499  C  C   . TYR C  3 24  ? 107.074 66.433  147.823 1.00 59.88  ?  52  TYR E C   1 
ATOM   2500  O  O   . TYR C  3 24  ? 107.385 66.937  146.743 1.00 59.88  ?  52  TYR E O   1 
ATOM   2501  C  CB  . TYR C  3 24  ? 106.818 63.972  147.945 1.00 59.88  ?  52  TYR E CB  1 
ATOM   2502  C  CG  . TYR C  3 24  ? 106.020 62.775  148.378 1.00 59.88  ?  52  TYR E CG  1 
ATOM   2503  C  CD1 . TYR C  3 24  ? 104.787 62.912  148.992 1.00 59.88  ?  52  TYR E CD1 1 
ATOM   2504  C  CD2 . TYR C  3 24  ? 106.517 61.500  148.187 1.00 59.88  ?  52  TYR E CD2 1 
ATOM   2505  C  CE1 . TYR C  3 24  ? 104.068 61.803  149.393 1.00 59.88  ?  52  TYR E CE1 1 
ATOM   2506  C  CE2 . TYR C  3 24  ? 105.810 60.391  148.583 1.00 59.88  ?  52  TYR E CE2 1 
ATOM   2507  C  CZ  . TYR C  3 24  ? 104.586 60.546  149.185 1.00 59.88  ?  52  TYR E CZ  1 
ATOM   2508  O  OH  . TYR C  3 24  ? 103.883 59.430  149.577 1.00 59.88  ?  52  TYR E OH  1 
ATOM   2509  N  N   . VAL C  3 25  ? 107.591 66.827  148.983 1.00 57.62  ?  53  VAL E N   1 
ATOM   2510  C  CA  . VAL C  3 25  ? 108.772 67.674  149.068 1.00 57.62  ?  53  VAL E CA  1 
ATOM   2511  C  C   . VAL C  3 25  ? 109.744 67.046  150.057 1.00 57.62  ?  53  VAL E C   1 
ATOM   2512  O  O   . VAL C  3 25  ? 109.345 66.409  151.037 1.00 57.62  ?  53  VAL E O   1 
ATOM   2513  C  CB  . VAL C  3 25  ? 108.438 69.127  149.468 1.00 57.62  ?  53  VAL E CB  1 
ATOM   2514  C  CG1 . VAL C  3 25  ? 107.758 69.843  148.332 1.00 57.62  ?  53  VAL E CG1 1 
ATOM   2515  C  CG2 . VAL C  3 25  ? 107.532 69.142  150.661 1.00 57.62  ?  53  VAL E CG2 1 
ATOM   2516  N  N   . HIS C  3 26  ? 111.035 67.212  149.780 1.00 56.00  ?  54  HIS E N   1 
ATOM   2517  C  CA  . HIS C  3 26  ? 112.079 66.649  150.620 1.00 56.00  ?  54  HIS E CA  1 
ATOM   2518  C  C   . HIS C  3 26  ? 113.165 67.688  150.835 1.00 56.00  ?  54  HIS E C   1 
ATOM   2519  O  O   . HIS C  3 26  ? 113.550 68.399  149.904 1.00 56.00  ?  54  HIS E O   1 
ATOM   2520  C  CB  . HIS C  3 26  ? 112.685 65.392  149.999 1.00 56.00  ?  54  HIS E CB  1 
ATOM   2521  C  CG  . HIS C  3 26  ? 111.713 64.267  149.841 1.00 56.00  ?  54  HIS E CG  1 
ATOM   2522  N  ND1 . HIS C  3 26  ? 110.999 64.058  148.682 1.00 56.00  ?  54  HIS E ND1 1 
ATOM   2523  C  CD2 . HIS C  3 26  ? 111.324 63.299  150.702 1.00 56.00  ?  54  HIS E CD2 1 
ATOM   2524  C  CE1 . HIS C  3 26  ? 110.222 63.001  148.831 1.00 56.00  ?  54  HIS E CE1 1 
ATOM   2525  N  NE2 . HIS C  3 26  ? 110.399 62.522  150.049 1.00 56.00  ?  54  HIS E NE2 1 
ATOM   2526  N  N   . ALA C  3 27  ? 113.663 67.760  152.064 1.00 54.82  ?  55  ALA E N   1 
ATOM   2527  C  CA  . ALA C  3 27  ? 114.669 68.741  152.453 1.00 54.82  ?  55  ALA E CA  1 
ATOM   2528  C  C   . ALA C  3 27  ? 115.924 67.998  152.881 1.00 54.82  ?  55  ALA E C   1 
ATOM   2529  O  O   . ALA C  3 27  ? 115.878 67.177  153.801 1.00 54.82  ?  55  ALA E O   1 
ATOM   2530  C  CB  . ALA C  3 27  ? 114.156 69.637  153.578 1.00 54.82  ?  55  ALA E CB  1 
ATOM   2531  N  N   . LEU C  3 28  ? 117.039 68.283  152.216 1.00 52.15  ?  56  LEU E N   1 
ATOM   2532  C  CA  . LEU C  3 28  ? 118.298 67.673  152.602 1.00 52.15  ?  56  LEU E CA  1 
ATOM   2533  C  C   . LEU C  3 28  ? 118.858 68.358  153.841 1.00 52.15  ?  56  LEU E C   1 
ATOM   2534  O  O   . LEU C  3 28  ? 118.331 69.362  154.326 1.00 52.15  ?  56  LEU E O   1 
ATOM   2535  C  CB  . LEU C  3 28  ? 119.306 67.737  151.461 1.00 52.15  ?  56  LEU E CB  1 
ATOM   2536  C  CG  . LEU C  3 28  ? 118.924 66.926  150.226 1.00 52.15  ?  56  LEU E CG  1 
ATOM   2537  C  CD1 . LEU C  3 28  ? 119.951 67.115  149.145 1.00 52.15  ?  56  LEU E CD1 1 
ATOM   2538  C  CD2 . LEU C  3 28  ? 118.781 65.466  150.564 1.00 52.15  ?  56  LEU E CD2 1 
ATOM   2539  N  N   . ARG C  3 29  ? 119.951 67.808  154.349 1.00 61.39  ?  57  ARG E N   1 
ATOM   2540  C  CA  . ARG C  3 29  ? 120.440 68.160  155.669 1.00 61.39  ?  57  ARG E CA  1 
ATOM   2541  C  C   . ARG C  3 29  ? 121.817 68.804  155.596 1.00 61.39  ?  57  ARG E C   1 
ATOM   2542  O  O   . ARG C  3 29  ? 122.637 68.468  154.737 1.00 61.39  ?  57  ARG E O   1 
ATOM   2543  C  CB  . ARG C  3 29  ? 120.484 66.920  156.563 1.00 61.39  ?  57  ARG E CB  1 
ATOM   2544  C  CG  . ARG C  3 29  ? 119.106 66.362  156.855 1.00 61.39  ?  57  ARG E CG  1 
ATOM   2545  C  CD  . ARG C  3 29  ? 119.168 65.140  157.734 1.00 61.39  ?  57  ARG E CD  1 
ATOM   2546  N  NE  . ARG C  3 29  ? 119.780 64.018  157.035 1.00 61.39  ?  57  ARG E NE  1 
ATOM   2547  C  CZ  . ARG C  3 29  ? 120.934 63.467  157.388 1.00 61.39  ?  57  ARG E CZ  1 
ATOM   2548  N  NH1 . ARG C  3 29  ? 121.592 63.931  158.439 1.00 61.39  ?  57  ARG E NH1 1 
ATOM   2549  N  NH2 . ARG C  3 29  ? 121.425 62.450  156.699 1.00 61.39  ?  57  ARG E NH2 1 
ATOM   2550  N  N   . ASP C  3 30  ? 122.054 69.751  156.507 1.00 63.54  ?  58  ASP E N   1 
ATOM   2551  C  CA  . ASP C  3 30  ? 123.377 70.320  156.717 1.00 63.54  ?  58  ASP E CA  1 
ATOM   2552  C  C   . ASP C  3 30  ? 124.059 69.780  157.962 1.00 63.54  ?  58  ASP E C   1 
ATOM   2553  O  O   . ASP C  3 30  ? 125.247 70.051  158.168 1.00 63.54  ?  58  ASP E O   1 
ATOM   2554  C  CB  . ASP C  3 30  ? 123.302 71.849  156.816 1.00 63.54  ?  58  ASP E CB  1 
ATOM   2555  C  CG  . ASP C  3 30  ? 123.106 72.513  155.469 1.00 63.54  ?  58  ASP E CG  1 
ATOM   2556  O  OD1 . ASP C  3 30  ? 123.582 71.955  154.462 1.00 63.54  ?  58  ASP E OD1 1 
ATOM   2557  O  OD2 . ASP C  3 30  ? 122.484 73.593  155.417 1.00 63.54  ?  58  ASP E OD2 1 
ATOM   2558  N  N   . ALA C  3 31  ? 123.343 69.030  158.782 1.00 68.97  ?  59  ALA E N   1 
ATOM   2559  C  CA  . ALA C  3 31  ? 123.872 68.472  160.015 1.00 68.97  ?  59  ALA E CA  1 
ATOM   2560  C  C   . ALA C  3 31  ? 123.330 67.057  160.170 1.00 68.97  ?  59  ALA E C   1 
ATOM   2561  O  O   . ALA C  3 31  ? 122.314 66.721  159.550 1.00 68.97  ?  59  ALA E O   1 
ATOM   2562  C  CB  . ALA C  3 31  ? 123.481 69.356  161.202 1.00 68.97  ?  59  ALA E CB  1 
ATOM   2563  N  N   . PRO C  3 32  ? 123.978 66.190  160.954 1.00 71.80  ?  60  PRO E N   1 
ATOM   2564  C  CA  . PRO C  3 32  ? 123.418 64.850  161.173 1.00 71.80  ?  60  PRO E CA  1 
ATOM   2565  C  C   . PRO C  3 32  ? 122.137 64.840  161.996 1.00 71.80  ?  60  PRO E C   1 
ATOM   2566  O  O   . PRO C  3 32  ? 121.334 63.911  161.873 1.00 71.80  ?  60  PRO E O   1 
ATOM   2567  C  CB  . PRO C  3 32  ? 124.549 64.115  161.905 1.00 71.80  ?  60  PRO E CB  1 
ATOM   2568  C  CG  . PRO C  3 32  ? 125.781 64.829  161.502 1.00 71.80  ?  60  PRO E CG  1 
ATOM   2569  C  CD  . PRO C  3 32  ? 125.384 66.266  161.390 1.00 71.80  ?  60  PRO E CD  1 
ATOM   2570  N  N   . GLU C  3 33  ? 121.926 65.858  162.831 1.00 76.27  ?  61  GLU E N   1 
ATOM   2571  C  CA  . GLU C  3 33  ? 120.838 65.825  163.800 1.00 76.27  ?  61  GLU E CA  1 
ATOM   2572  C  C   . GLU C  3 33  ? 119.582 66.564  163.354 1.00 76.27  ?  61  GLU E C   1 
ATOM   2573  O  O   . GLU C  3 33  ? 118.515 66.337  163.934 1.00 76.27  ?  61  GLU E O   1 
ATOM   2574  C  CB  . GLU C  3 33  ? 121.301 66.420  165.133 1.00 76.27  ?  61  GLU E CB  1 
ATOM   2575  C  CG  . GLU C  3 33  ? 121.605 67.910  165.076 1.00 76.27  ?  61  GLU E CG  1 
ATOM   2576  C  CD  . GLU C  3 33  ? 122.082 68.463  166.403 1.00 76.27  ?  61  GLU E CD  1 
ATOM   2577  O  OE1 . GLU C  3 33  ? 122.212 67.677  167.365 1.00 76.27  ?  61  GLU E OE1 1 
ATOM   2578  O  OE2 . GLU C  3 33  ? 122.323 69.686  166.487 1.00 76.27  ?  61  GLU E OE2 1 
ATOM   2579  N  N   . GLU C  3 34  ? 119.673 67.431  162.350 1.00 75.67  ?  62  GLU E N   1 
ATOM   2580  C  CA  . GLU C  3 34  ? 118.601 68.385  162.075 1.00 75.67  ?  62  GLU E CA  1 
ATOM   2581  C  C   . GLU C  3 34  ? 117.487 67.726  161.270 1.00 75.67  ?  62  GLU E C   1 
ATOM   2582  O  O   . GLU C  3 34  ? 117.695 67.308  160.127 1.00 75.67  ?  62  GLU E O   1 
ATOM   2583  C  CB  . GLU C  3 34  ? 119.169 69.603  161.354 1.00 75.67  ?  62  GLU E CB  1 
ATOM   2584  C  CG  . GLU C  3 34  ? 120.051 70.456  162.254 1.00 75.67  ?  62  GLU E CG  1 
ATOM   2585  C  CD  . GLU C  3 34  ? 120.667 71.638  161.541 1.00 75.67  ?  62  GLU E CD  1 
ATOM   2586  O  OE1 . GLU C  3 34  ? 120.540 71.721  160.305 1.00 75.67  ?  62  GLU E OE1 1 
ATOM   2587  O  OE2 . GLU C  3 34  ? 121.280 72.487  162.221 1.00 75.67  ?  62  GLU E OE2 1 
ATOM   2588  N  N   . VAL C  3 35  ? 116.308 67.643  161.868 1.00 71.33  ?  63  VAL E N   1 
ATOM   2589  C  CA  . VAL C  3 35  ? 115.124 67.060  161.240 1.00 71.33  ?  63  VAL E CA  1 
ATOM   2590  C  C   . VAL C  3 35  ? 114.262 68.202  160.710 1.00 71.33  ?  63  VAL E C   1 
ATOM   2591  O  O   . VAL C  3 35  ? 114.002 69.156  161.456 1.00 71.33  ?  63  VAL E O   1 
ATOM   2592  C  CB  . VAL C  3 35  ? 114.337 66.192  162.241 1.00 71.33  ?  63  VAL E CB  1 
ATOM   2593  C  CG1 . VAL C  3 35  ? 113.052 65.653  161.628 1.00 71.33  ?  63  VAL E CG1 1 
ATOM   2594  C  CG2 . VAL C  3 35  ? 115.207 65.052  162.746 1.00 71.33  ?  63  VAL E CG2 1 
ATOM   2595  N  N   . PRO C  3 36  ? 113.815 68.156  159.445 1.00 67.19  ?  64  PRO E N   1 
ATOM   2596  C  CA  . PRO C  3 36  ? 113.075 69.295  158.882 1.00 67.19  ?  64  PRO E CA  1 
ATOM   2597  C  C   . PRO C  3 36  ? 111.667 69.483  159.423 1.00 67.19  ?  64  PRO E C   1 
ATOM   2598  O  O   . PRO C  3 36  ? 111.144 68.658  160.177 1.00 67.19  ?  64  PRO E O   1 
ATOM   2599  C  CB  . PRO C  3 36  ? 113.034 68.975  157.382 1.00 67.19  ?  64  PRO E CB  1 
ATOM   2600  C  CG  . PRO C  3 36  ? 113.170 67.506  157.306 1.00 67.19  ?  64  PRO E CG  1 
ATOM   2601  C  CD  . PRO C  3 36  ? 114.083 67.123  158.430 1.00 67.19  ?  64  PRO E CD  1 
ATOM   2602  N  N   . SER C  3 37  ? 111.058 70.594  159.021 1.00 62.14  ?  65  SER E N   1 
ATOM   2603  C  CA  . SER C  3 37  ? 109.670 70.908  159.317 1.00 62.14  ?  65  SER E CA  1 
ATOM   2604  C  C   . SER C  3 37  ? 109.094 71.594  158.088 1.00 62.14  ?  65  SER E C   1 
ATOM   2605  O  O   . SER C  3 37  ? 109.821 71.946  157.160 1.00 62.14  ?  65  SER E O   1 
ATOM   2606  C  CB  . SER C  3 37  ? 109.545 71.789  160.561 1.00 62.14  ?  65  SER E CB  1 
ATOM   2607  O  OG  . SER C  3 37  ? 108.195 72.133  160.804 1.00 62.14  ?  65  SER E OG  1 
ATOM   2608  N  N   . PHE C  3 38  ? 107.776 71.772  158.072 1.00 61.89  ?  66  PHE E N   1 
ATOM   2609  C  CA  . PHE C  3 38  ? 107.126 72.349  156.903 1.00 61.89  ?  66  PHE E CA  1 
ATOM   2610  C  C   . PHE C  3 38  ? 105.956 73.224  157.315 1.00 61.89  ?  66  PHE E C   1 
ATOM   2611  O  O   . PHE C  3 38  ? 105.194 72.870  158.219 1.00 61.89  ?  66  PHE E O   1 
ATOM   2612  C  CB  . PHE C  3 38  ? 106.641 71.261  155.935 1.00 61.89  ?  66  PHE E CB  1 
ATOM   2613  C  CG  . PHE C  3 38  ? 107.750 70.555  155.207 1.00 61.89  ?  66  PHE E CG  1 
ATOM   2614  C  CD1 . PHE C  3 38  ? 108.363 71.146  154.114 1.00 61.89  ?  66  PHE E CD1 1 
ATOM   2615  C  CD2 . PHE C  3 38  ? 108.173 69.301  155.610 1.00 61.89  ?  66  PHE E CD2 1 
ATOM   2616  C  CE1 . PHE C  3 38  ? 109.386 70.503  153.443 1.00 61.89  ?  66  PHE E CE1 1 
ATOM   2617  C  CE2 . PHE C  3 38  ? 109.194 68.653  154.940 1.00 61.89  ?  66  PHE E CE2 1 
ATOM   2618  C  CZ  . PHE C  3 38  ? 109.798 69.255  153.855 1.00 61.89  ?  66  PHE E CZ  1 
ATOM   2619  N  N   . ARG C  3 39  ? 105.827 74.368  156.649 1.00 61.91  ?  67  ARG E N   1 
ATOM   2620  C  CA  . ARG C  3 39  ? 104.646 75.211  156.738 1.00 61.91  ?  67  ARG E CA  1 
ATOM   2621  C  C   . ARG C  3 39  ? 104.473 75.926  155.409 1.00 61.91  ?  67  ARG E C   1 
ATOM   2622  O  O   . ARG C  3 39  ? 105.452 76.194  154.707 1.00 61.91  ?  67  ARG E O   1 
ATOM   2623  C  CB  . ARG C  3 39  ? 104.744 76.219  157.892 1.00 61.91  ?  67  ARG E CB  1 
ATOM   2624  C  CG  . ARG C  3 39  ? 105.832 77.268  157.753 1.00 61.91  ?  67  ARG E CG  1 
ATOM   2625  C  CD  . ARG C  3 39  ? 105.859 78.184  158.965 1.00 61.91  ?  67  ARG E CD  1 
ATOM   2626  N  NE  . ARG C  3 39  ? 104.645 78.989  159.068 1.00 61.91  ?  67  ARG E NE  1 
ATOM   2627  C  CZ  . ARG C  3 39  ? 104.472 80.166  158.477 1.00 61.91  ?  67  ARG E CZ  1 
ATOM   2628  N  NH1 . ARG C  3 39  ? 103.332 80.824  158.627 1.00 61.91  ?  67  ARG E NH1 1 
ATOM   2629  N  NH2 . ARG C  3 39  ? 105.441 80.693  157.747 1.00 61.91  ?  67  ARG E NH2 1 
ATOM   2630  N  N   . LEU C  3 40  ? 103.228 76.206  155.052 1.00 62.72  ?  68  LEU E N   1 
ATOM   2631  C  CA  . LEU C  3 40  ? 102.927 76.826  153.774 1.00 62.72  ?  68  LEU E CA  1 
ATOM   2632  C  C   . LEU C  3 40  ? 102.984 78.343  153.874 1.00 62.72  ?  68  LEU E C   1 
ATOM   2633  O  O   . LEU C  3 40  ? 103.186 78.921  154.942 1.00 62.72  ?  68  LEU E O   1 
ATOM   2634  C  CB  . LEU C  3 40  ? 101.550 76.397  153.279 1.00 62.72  ?  68  LEU E CB  1 
ATOM   2635  C  CG  . LEU C  3 40  ? 101.407 74.958  152.804 1.00 62.72  ?  68  LEU E CG  1 
ATOM   2636  C  CD1 . LEU C  3 40  ? 99.949  74.626  152.583 1.00 62.72  ?  68  LEU E CD1 1 
ATOM   2637  C  CD2 . LEU C  3 40  ? 102.185 74.753  151.528 1.00 62.72  ?  68  LEU E CD2 1 
ATOM   2638  N  N   . GLY C  3 41  ? 102.793 78.987  152.728 1.00 66.25  ?  69  GLY E N   1 
ATOM   2639  C  CA  . GLY C  3 41  ? 102.638 80.420  152.705 1.00 66.25  ?  69  GLY E CA  1 
ATOM   2640  C  C   . GLY C  3 41  ? 101.267 80.855  153.176 1.00 66.25  ?  69  GLY E C   1 
ATOM   2641  O  O   . GLY C  3 41  ? 100.410 80.052  153.540 1.00 66.25  ?  69  GLY E O   1 
ATOM   2642  N  N   . GLN C  3 42  ? 101.057 82.167  153.175 1.00 72.44  ?  70  GLN E N   1 
ATOM   2643  C  CA  . GLN C  3 42  ? 99.777  82.688  153.632 1.00 72.44  ?  70  GLN E CA  1 
ATOM   2644  C  C   . GLN C  3 42  ? 98.812  82.894  152.473 1.00 72.44  ?  70  GLN E C   1 
ATOM   2645  O  O   . GLN C  3 42  ? 97.597  82.749  152.647 1.00 72.44  ?  70  GLN E O   1 
ATOM   2646  C  CB  . GLN C  3 42  ? 99.998  83.992  154.398 1.00 72.44  ?  70  GLN E CB  1 
ATOM   2647  C  CG  . GLN C  3 42  ? 98.769  84.531  155.106 1.00 72.44  ?  70  GLN E CG  1 
ATOM   2648  C  CD  . GLN C  3 42  ? 99.063  85.792  155.887 1.00 72.44  ?  70  GLN E CD  1 
ATOM   2649  O  OE1 . GLN C  3 42  ? 100.184 86.299  155.871 1.00 72.44  ?  70  GLN E OE1 1 
ATOM   2650  N  NE2 . GLN C  3 42  ? 98.054  86.308  156.579 1.00 72.44  ?  70  GLN E NE2 1 
ATOM   2651  N  N   . HIS C  3 43  ? 99.323  83.197  151.283 1.00 70.06  ?  71  HIS E N   1 
ATOM   2652  C  CA  . HIS C  3 43  ? 98.486  83.640  150.182 1.00 70.06  ?  71  HIS E CA  1 
ATOM   2653  C  C   . HIS C  3 43  ? 98.848  82.896  148.906 1.00 70.06  ?  71  HIS E C   1 
ATOM   2654  O  O   . HIS C  3 43  ? 99.978  82.440  148.728 1.00 70.06  ?  71  HIS E O   1 
ATOM   2655  C  CB  . HIS C  3 43  ? 98.638  85.144  149.969 1.00 70.06  ?  71  HIS E CB  1 
ATOM   2656  C  CG  . HIS C  3 43  ? 98.313  85.955  151.182 1.00 70.06  ?  71  HIS E CG  1 
ATOM   2657  N  ND1 . HIS C  3 43  ? 97.021  86.180  151.604 1.00 70.06  ?  71  HIS E ND1 1 
ATOM   2658  C  CD2 . HIS C  3 43  ? 99.115  86.582  152.075 1.00 70.06  ?  71  HIS E CD2 1 
ATOM   2659  C  CE1 . HIS C  3 43  ? 97.040  86.920  152.698 1.00 70.06  ?  71  HIS E CE1 1 
ATOM   2660  N  NE2 . HIS C  3 43  ? 98.299  87.180  153.003 1.00 70.06  ?  71  HIS E NE2 1 
ATOM   2661  N  N   . LEU C  3 44  ? 97.868  82.794  148.006 1.00 64.96  ?  72  LEU E N   1 
ATOM   2662  C  CA  . LEU C  3 44  ? 98.035  82.154  146.703 1.00 64.96  ?  72  LEU E CA  1 
ATOM   2663  C  C   . LEU C  3 44  ? 98.477  83.234  145.725 1.00 64.96  ?  72  LEU E C   1 
ATOM   2664  O  O   . LEU C  3 44  ? 97.650  83.979  145.198 1.00 64.96  ?  72  LEU E O   1 
ATOM   2665  C  CB  . LEU C  3 44  ? 96.731  81.508  146.247 1.00 64.96  ?  72  LEU E CB  1 
ATOM   2666  C  CG  . LEU C  3 44  ? 96.131  80.350  147.044 1.00 64.96  ?  72  LEU E CG  1 
ATOM   2667  C  CD1 . LEU C  3 44  ? 94.729  80.056  146.555 1.00 64.96  ?  72  LEU E CD1 1 
ATOM   2668  C  CD2 . LEU C  3 44  ? 96.973  79.121  146.894 1.00 64.96  ?  72  LEU E CD2 1 
ATOM   2669  N  N   . TYR C  3 45  ? 99.779  83.321  145.476 1.00 61.83  ?  73  TYR E N   1 
ATOM   2670  C  CA  . TYR C  3 45  ? 100.294 84.410  144.664 1.00 61.83  ?  73  TYR E CA  1 
ATOM   2671  C  C   . TYR C  3 45  ? 100.032 84.170  143.180 1.00 61.83  ?  73  TYR E C   1 
ATOM   2672  O  O   . TYR C  3 45  ? 99.520  83.130  142.764 1.00 61.83  ?  73  TYR E O   1 
ATOM   2673  C  CB  . TYR C  3 45  ? 101.787 84.602  144.898 1.00 61.83  ?  73  TYR E CB  1 
ATOM   2674  C  CG  . TYR C  3 45  ? 102.144 85.208  146.229 1.00 61.83  ?  73  TYR E CG  1 
ATOM   2675  C  CD1 . TYR C  3 45  ? 101.193 85.849  147.006 1.00 61.83  ?  73  TYR E CD1 1 
ATOM   2676  C  CD2 . TYR C  3 45  ? 103.440 85.144  146.706 1.00 61.83  ?  73  TYR E CD2 1 
ATOM   2677  C  CE1 . TYR C  3 45  ? 101.527 86.406  148.222 1.00 61.83  ?  73  TYR E CE1 1 
ATOM   2678  C  CE2 . TYR C  3 45  ? 103.780 85.696  147.920 1.00 61.83  ?  73  TYR E CE2 1 
ATOM   2679  C  CZ  . TYR C  3 45  ? 102.823 86.323  148.672 1.00 61.83  ?  73  TYR E CZ  1 
ATOM   2680  O  OH  . TYR C  3 45  ? 103.168 86.872  149.882 1.00 61.83  ?  73  TYR E OH  1 
ATOM   2681  N  N   . GLY C  3 46  ? 100.391 85.169  142.380 1.00 65.46  ?  74  GLY E N   1 
ATOM   2682  C  CA  . GLY C  3 46  ? 100.253 85.102  140.941 1.00 65.46  ?  74  GLY E CA  1 
ATOM   2683  C  C   . GLY C  3 46  ? 101.437 85.734  140.243 1.00 65.46  ?  74  GLY E C   1 
ATOM   2684  O  O   . GLY C  3 46  ? 102.551 85.717  140.771 1.00 65.46  ?  74  GLY E O   1 
ATOM   2685  N  N   . THR C  3 47  ? 101.210 86.304  139.065 1.00 70.26  ?  75  THR E N   1 
ATOM   2686  C  CA  . THR C  3 47  ? 102.280 86.915  138.290 1.00 70.26  ?  75  THR E CA  1 
ATOM   2687  C  C   . THR C  3 47  ? 102.692 88.242  138.923 1.00 70.26  ?  75  THR E C   1 
ATOM   2688  O  O   . THR C  3 47  ? 101.847 89.012  139.388 1.00 70.26  ?  75  THR E O   1 
ATOM   2689  C  CB  . THR C  3 47  ? 101.818 87.119  136.844 1.00 70.26  ?  75  THR E CB  1 
ATOM   2690  O  OG1 . THR C  3 47  ? 101.327 85.876  136.332 1.00 70.26  ?  75  THR E OG1 1 
ATOM   2691  C  CG2 . THR C  3 47  ? 102.957 87.566  135.953 1.00 70.26  ?  75  THR E CG2 1 
ATOM   2692  N  N   . TYR C  3 48  ? 104.014 88.481  138.957 1.00 73.00  ?  76  TYR E N   1 
ATOM   2693  C  CA  . TYR C  3 48  ? 104.651 89.654  139.576 1.00 73.00  ?  76  TYR E CA  1 
ATOM   2694  C  C   . TYR C  3 48  ? 104.311 89.780  141.056 1.00 73.00  ?  76  TYR E C   1 
ATOM   2695  O  O   . TYR C  3 48  ? 104.139 90.897  141.549 1.00 73.00  ?  76  TYR E O   1 
ATOM   2696  C  CB  . TYR C  3 48  ? 104.292 90.967  138.872 1.00 73.00  ?  76  TYR E CB  1 
ATOM   2697  C  CG  . TYR C  3 48  ? 104.789 91.136  137.464 1.00 73.00  ?  76  TYR E CG  1 
ATOM   2698  C  CD1 . TYR C  3 48  ? 106.107 91.483  137.209 1.00 73.00  ?  76  TYR E CD1 1 
ATOM   2699  C  CD2 . TYR C  3 48  ? 103.920 91.011  136.391 1.00 73.00  ?  76  TYR E CD2 1 
ATOM   2700  C  CE1 . TYR C  3 48  ? 106.554 91.663  135.916 1.00 73.00  ?  76  TYR E CE1 1 
ATOM   2701  C  CE2 . TYR C  3 48  ? 104.355 91.185  135.101 1.00 73.00  ?  76  TYR E CE2 1 
ATOM   2702  C  CZ  . TYR C  3 48  ? 105.670 91.512  134.869 1.00 73.00  ?  76  TYR E CZ  1 
ATOM   2703  O  OH  . TYR C  3 48  ? 106.093 91.694  133.578 1.00 73.00  ?  76  TYR E OH  1 
ATOM   2704  N  N   . ARG C  3 49  ? 104.223 88.631  141.740 1.00 72.57  ?  77  ARG E N   1 
ATOM   2705  C  CA  . ARG C  3 49  ? 103.783 88.464  143.141 1.00 72.57  ?  77  ARG E CA  1 
ATOM   2706  C  C   . ARG C  3 49  ? 102.554 89.312  143.499 1.00 72.57  ?  77  ARG E C   1 
ATOM   2707  O  O   . ARG C  3 49  ? 102.434 89.867  144.593 1.00 72.57  ?  77  ARG E O   1 
ATOM   2708  C  CB  . ARG C  3 49  ? 104.946 88.677  144.131 1.00 72.57  ?  77  ARG E CB  1 
ATOM   2709  C  CG  . ARG C  3 49  ? 105.613 90.052  144.249 1.00 72.57  ?  77  ARG E CG  1 
ATOM   2710  C  CD  . ARG C  3 49  ? 106.735 90.038  145.274 1.00 72.57  ?  77  ARG E CD  1 
ATOM   2711  N  NE  . ARG C  3 49  ? 107.837 89.172  144.868 1.00 72.57  ?  77  ARG E NE  1 
ATOM   2712  C  CZ  . ARG C  3 49  ? 108.130 88.014  145.449 1.00 72.57  ?  77  ARG E CZ  1 
ATOM   2713  N  NH1 . ARG C  3 49  ? 107.401 87.578  146.466 1.00 72.57  ?  77  ARG E NH1 1 
ATOM   2714  N  NH2 . ARG C  3 49  ? 109.150 87.291  145.010 1.00 72.57  ?  77  ARG E NH2 1 
ATOM   2715  N  N   . THR C  3 50  ? 101.603 89.367  142.569 1.00 71.86  ?  78  THR E N   1 
ATOM   2716  C  CA  . THR C  3 50  ? 100.333 90.047  142.793 1.00 71.86  ?  78  THR E CA  1 
ATOM   2717  C  C   . THR C  3 50  ? 99.473  89.152  143.674 1.00 71.86  ?  78  THR E C   1 
ATOM   2718  O  O   . THR C  3 50  ? 98.960  88.128  143.211 1.00 71.86  ?  78  THR E O   1 
ATOM   2719  C  CB  . THR C  3 50  ? 99.635  90.346  141.472 1.00 71.86  ?  78  THR E CB  1 
ATOM   2720  O  OG1 . THR C  3 50  ? 100.485 91.162  140.657 1.00 71.86  ?  78  THR E OG1 1 
ATOM   2721  C  CG2 . THR C  3 50  ? 98.329  91.076  141.720 1.00 71.86  ?  78  THR E CG2 1 
ATOM   2722  N  N   . ARG C  3 51  ? 99.326  89.538  144.939 1.00 71.62  ?  79  ARG E N   1 
ATOM   2723  C  CA  . ARG C  3 51  ? 98.659  88.707  145.935 1.00 71.62  ?  79  ARG E CA  1 
ATOM   2724  C  C   . ARG C  3 51  ? 97.176  88.571  145.620 1.00 71.62  ?  79  ARG E C   1 
ATOM   2725  O  O   . ARG C  3 51  ? 96.423  89.544  145.707 1.00 71.62  ?  79  ARG E O   1 
ATOM   2726  C  CB  . ARG C  3 51  ? 98.857  89.309  147.320 1.00 71.62  ?  79  ARG E CB  1 
ATOM   2727  C  CG  . ARG C  3 51  ? 98.196  88.530  148.426 1.00 71.62  ?  79  ARG E CG  1 
ATOM   2728  C  CD  . ARG C  3 51  ? 98.511  89.156  149.763 1.00 71.62  ?  79  ARG E CD  1 
ATOM   2729  N  NE  . ARG C  3 51  ? 99.919  88.993  150.109 1.00 71.62  ?  79  ARG E NE  1 
ATOM   2730  C  CZ  . ARG C  3 51  ? 100.504 89.575  151.149 1.00 71.62  ?  79  ARG E CZ  1 
ATOM   2731  N  NH1 . ARG C  3 51  ? 99.803  90.362  151.951 1.00 71.62  ?  79  ARG E NH1 1 
ATOM   2732  N  NH2 . ARG C  3 51  ? 101.791 89.370  151.390 1.00 71.62  ?  79  ARG E NH2 1 
ATOM   2733  N  N   . LEU C  3 52  ? 96.757  87.360  145.253 1.00 73.02  ?  80  LEU E N   1 
ATOM   2734  C  CA  . LEU C  3 52  ? 95.388  87.158  144.786 1.00 73.02  ?  80  LEU E CA  1 
ATOM   2735  C  C   . LEU C  3 52  ? 94.419  87.002  145.954 1.00 73.02  ?  80  LEU E C   1 
ATOM   2736  O  O   . LEU C  3 52  ? 93.527  87.832  146.151 1.00 73.02  ?  80  LEU E O   1 
ATOM   2737  C  CB  . LEU C  3 52  ? 95.323  85.936  143.868 1.00 73.02  ?  80  LEU E CB  1 
ATOM   2738  C  CG  . LEU C  3 52  ? 96.214  85.962  142.627 1.00 73.02  ?  80  LEU E CG  1 
ATOM   2739  C  CD1 . LEU C  3 52  ? 96.056  84.673  141.839 1.00 73.02  ?  80  LEU E CD1 1 
ATOM   2740  C  CD2 . LEU C  3 52  ? 95.939  87.166  141.755 1.00 73.02  ?  80  LEU E CD2 1 
ATOM   2741  N  N   . HIS C  3 53  ? 94.594  85.950  146.750 1.00 74.84  ?  81  HIS E N   1 
ATOM   2742  C  CA  . HIS C  3 53  ? 93.607  85.577  147.752 1.00 74.84  ?  81  HIS E CA  1 
ATOM   2743  C  C   . HIS C  3 53  ? 94.278  84.687  148.786 1.00 74.84  ?  81  HIS E C   1 
ATOM   2744  O  O   . HIS C  3 53  ? 95.254  83.999  148.476 1.00 74.84  ?  81  HIS E O   1 
ATOM   2745  C  CB  . HIS C  3 53  ? 92.422  84.862  147.093 1.00 74.84  ?  81  HIS E CB  1 
ATOM   2746  C  CG  . HIS C  3 53  ? 91.283  84.571  148.018 1.00 74.84  ?  81  HIS E CG  1 
ATOM   2747  N  ND1 . HIS C  3 53  ? 90.424  85.548  148.472 1.00 74.84  ?  81  HIS E ND1 1 
ATOM   2748  C  CD2 . HIS C  3 53  ? 90.846  83.408  148.555 1.00 74.84  ?  81  HIS E CD2 1 
ATOM   2749  C  CE1 . HIS C  3 53  ? 89.516  85.002  149.261 1.00 74.84  ?  81  HIS E CE1 1 
ATOM   2750  N  NE2 . HIS C  3 53  ? 89.750  83.704  149.328 1.00 74.84  ?  81  HIS E NE2 1 
ATOM   2751  N  N   . GLU C  3 54  ? 93.750  84.698  150.007 1.00 77.38  ?  82  GLU E N   1 
ATOM   2752  C  CA  . GLU C  3 54  ? 94.345  83.929  151.091 1.00 77.38  ?  82  GLU E CA  1 
ATOM   2753  C  C   . GLU C  3 54  ? 94.077  82.440  150.888 1.00 77.38  ?  82  GLU E C   1 
ATOM   2754  O  O   . GLU C  3 54  ? 93.056  82.054  150.313 1.00 77.38  ?  82  GLU E O   1 
ATOM   2755  C  CB  . GLU C  3 54  ? 93.789  84.408  152.433 1.00 77.38  ?  82  GLU E CB  1 
ATOM   2756  C  CG  . GLU C  3 54  ? 94.537  83.907  153.661 1.00 77.38  ?  82  GLU E CG  1 
ATOM   2757  C  CD  . GLU C  3 54  ? 93.980  84.461  154.955 1.00 77.38  ?  82  GLU E CD  1 
ATOM   2758  O  OE1 . GLU C  3 54  ? 92.974  85.201  154.902 1.00 77.38  ?  82  GLU E OE1 1 
ATOM   2759  O  OE2 . GLU C  3 54  ? 94.552  84.161  156.024 1.00 77.38  ?  82  GLU E OE2 1 
ATOM   2760  N  N   . ASN C  3 55  ? 95.015  81.609  151.347 1.00 77.88  ?  83  ASN E N   1 
ATOM   2761  C  CA  . ASN C  3 55  ? 94.987  80.168  151.114 1.00 77.88  ?  83  ASN E CA  1 
ATOM   2762  C  C   . ASN C  3 55  ? 93.810  79.507  151.817 1.00 77.88  ?  83  ASN E C   1 
ATOM   2763  O  O   . ASN C  3 55  ? 93.616  79.667  153.024 1.00 77.88  ?  83  ASN E O   1 
ATOM   2764  C  CB  . ASN C  3 55  ? 96.295  79.539  151.605 1.00 77.88  ?  83  ASN E CB  1 
ATOM   2765  C  CG  . ASN C  3 55  ? 96.485  78.115  151.111 1.00 77.88  ?  83  ASN E CG  1 
ATOM   2766  O  OD1 . ASN C  3 55  ? 95.697  77.606  150.314 1.00 77.88  ?  83  ASN E OD1 1 
ATOM   2767  N  ND2 . ASN C  3 55  ? 97.523  77.455  151.608 1.00 77.88  ?  83  ASN E ND2 1 
ATOM   2768  N  N   . ASN C  3 56  ? 93.030  78.755  151.046 1.00 79.09  ?  84  ASN E N   1 
ATOM   2769  C  CA  . ASN C  3 56  ? 91.898  78.021  151.589 1.00 79.09  ?  84  ASN E CA  1 
ATOM   2770  C  C   . ASN C  3 56  ? 92.012  76.537  151.271 1.00 79.09  ?  84  ASN E C   1 
ATOM   2771  O  O   . ASN C  3 56  ? 91.713  75.687  152.114 1.00 79.09  ?  84  ASN E O   1 
ATOM   2772  C  CB  . ASN C  3 56  ? 90.594  78.589  151.031 1.00 79.09  ?  84  ASN E CB  1 
ATOM   2773  C  CG  . ASN C  3 56  ? 90.333  80.003  151.500 1.00 79.09  ?  84  ASN E CG  1 
ATOM   2774  O  OD1 . ASN C  3 56  ? 90.547  80.332  152.666 1.00 79.09  ?  84  ASN E OD1 1 
ATOM   2775  N  ND2 . ASN C  3 56  ? 89.876  80.852  150.589 1.00 79.09  ?  84  ASN E ND2 1 
ATOM   2776  N  N   . TRP C  3 57  ? 92.457  76.220  150.056 1.00 78.51  ?  85  TRP E N   1 
ATOM   2777  C  CA  . TRP C  3 57  ? 92.328  74.859  149.548 1.00 78.51  ?  85  TRP E CA  1 
ATOM   2778  C  C   . TRP C  3 57  ? 93.509  73.987  149.948 1.00 78.51  ?  85  TRP E C   1 
ATOM   2779  O  O   . TRP C  3 57  ? 93.338  72.949  150.597 1.00 78.51  ?  85  TRP E O   1 
ATOM   2780  C  CB  . TRP C  3 57  ? 92.191  74.893  148.029 1.00 78.51  ?  85  TRP E CB  1 
ATOM   2781  C  CG  . TRP C  3 57  ? 90.947  75.549  147.581 1.00 78.51  ?  85  TRP E CG  1 
ATOM   2782  C  CD1 . TRP C  3 57  ? 89.753  74.951  147.332 1.00 78.51  ?  85  TRP E CD1 1 
ATOM   2783  C  CD2 . TRP C  3 57  ? 90.756  76.945  147.348 1.00 78.51  ?  85  TRP E CD2 1 
ATOM   2784  N  NE1 . TRP C  3 57  ? 88.828  75.885  146.938 1.00 78.51  ?  85  TRP E NE1 1 
ATOM   2785  C  CE2 . TRP C  3 57  ? 89.420  77.120  146.945 1.00 78.51  ?  85  TRP E CE2 1 
ATOM   2786  C  CE3 . TRP C  3 57  ? 91.587  78.065  147.434 1.00 78.51  ?  85  TRP E CE3 1 
ATOM   2787  C  CZ2 . TRP C  3 57  ? 88.895  78.367  146.634 1.00 78.51  ?  85  TRP E CZ2 1 
ATOM   2788  C  CZ3 . TRP C  3 57  ? 91.065  79.301  147.121 1.00 78.51  ?  85  TRP E CZ3 1 
ATOM   2789  C  CH2 . TRP C  3 57  ? 89.733  79.444  146.725 1.00 78.51  ?  85  TRP E CH2 1 
ATOM   2790  N  N   . ILE C  3 58  ? 94.715  74.389  149.557 1.00 70.38  ?  86  ILE E N   1 
ATOM   2791  C  CA  . ILE C  3 58  ? 95.866  73.494  149.536 1.00 70.38  ?  86  ILE E CA  1 
ATOM   2792  C  C   . ILE C  3 58  ? 96.401  73.337  150.955 1.00 70.38  ?  86  ILE E C   1 
ATOM   2793  O  O   . ILE C  3 58  ? 96.758  74.318  151.609 1.00 70.38  ?  86  ILE E O   1 
ATOM   2794  C  CB  . ILE C  3 58  ? 96.949  74.009  148.587 1.00 70.38  ?  86  ILE E CB  1 
ATOM   2795  C  CG1 . ILE C  3 58  ? 96.381  74.112  147.173 1.00 70.38  ?  86  ILE E CG1 1 
ATOM   2796  C  CG2 . ILE C  3 58  ? 98.132  73.077  148.599 1.00 70.38  ?  86  ILE E CG2 1 
ATOM   2797  C  CD1 . ILE C  3 58  ? 97.240  74.878  146.220 1.00 70.38  ?  86  ILE E CD1 1 
ATOM   2798  N  N   . CYS C  3 59  ? 96.449  72.100  151.432 1.00 70.58  ?  87  CYS E N   1 
ATOM   2799  C  CA  . CYS C  3 59  ? 96.954  71.788  152.757 1.00 70.58  ?  87  CYS E CA  1 
ATOM   2800  C  C   . CYS C  3 59  ? 98.260  71.011  152.654 1.00 70.58  ?  87  CYS E C   1 
ATOM   2801  O  O   . CYS C  3 59  ? 98.630  70.496  151.593 1.00 70.58  ?  87  CYS E O   1 
ATOM   2802  C  CB  . CYS C  3 59  ? 95.926  70.985  153.554 1.00 70.58  ?  87  CYS E CB  1 
ATOM   2803  S  SG  . CYS C  3 59  ? 96.425  70.624  155.251 1.00 70.58  ?  87  CYS E SG  1 
ATOM   2804  N  N   . ILE C  3 60  ? 98.958  70.930  153.784 1.00 69.18  ?  88  ILE E N   1 
ATOM   2805  C  CA  . ILE C  3 60  ? 100.264 70.293  153.853 1.00 69.18  ?  88  ILE E CA  1 
ATOM   2806  C  C   . ILE C  3 60  ? 100.305 69.382  155.073 1.00 69.18  ?  88  ILE E C   1 
ATOM   2807  O  O   . ILE C  3 60  ? 99.628  69.616  156.079 1.00 69.18  ?  88  ILE E O   1 
ATOM   2808  C  CB  . ILE C  3 60  ? 101.400 71.351  153.888 1.00 69.18  ?  88  ILE E CB  1 
ATOM   2809  C  CG1 . ILE C  3 60  ? 102.771 70.731  153.608 1.00 69.18  ?  88  ILE E CG1 1 
ATOM   2810  C  CG2 . ILE C  3 60  ? 101.421 72.119  155.204 1.00 69.18  ?  88  ILE E CG2 1 
ATOM   2811  C  CD1 . ILE C  3 60  ? 103.862 71.751  153.398 1.00 69.18  ?  88  ILE E CD1 1 
ATOM   2812  N  N   . GLN C  3 61  ? 101.046 68.289  154.943 1.00 72.78  ?  89  GLN E N   1 
ATOM   2813  C  CA  . GLN C  3 61  ? 101.461 67.493  156.083 1.00 72.78  ?  89  GLN E CA  1 
ATOM   2814  C  C   . GLN C  3 61  ? 102.770 68.056  156.614 1.00 72.78  ?  89  GLN E C   1 
ATOM   2815  O  O   . GLN C  3 61  ? 103.718 68.261  155.852 1.00 72.78  ?  89  GLN E O   1 
ATOM   2816  C  CB  . GLN C  3 61  ? 101.622 66.023  155.698 1.00 72.78  ?  89  GLN E CB  1 
ATOM   2817  C  CG  . GLN C  3 61  ? 100.315 65.335  155.371 1.00 72.78  ?  89  GLN E CG  1 
ATOM   2818  C  CD  . GLN C  3 61  ? 99.414  65.227  156.584 1.00 72.78  ?  89  GLN E CD  1 
ATOM   2819  O  OE1 . GLN C  3 61  ? 99.879  64.968  157.694 1.00 72.78  ?  89  GLN E OE1 1 
ATOM   2820  N  NE2 . GLN C  3 61  ? 98.120  65.435  156.381 1.00 72.78  ?  89  GLN E NE2 1 
ATOM   2821  N  N   . GLU C  3 62  ? 102.808 68.323  157.914 1.00 72.61  ?  90  GLU E N   1 
ATOM   2822  C  CA  . GLU C  3 62  ? 103.975 68.915  158.548 1.00 72.61  ?  90  GLU E CA  1 
ATOM   2823  C  C   . GLU C  3 62  ? 105.154 67.954  158.618 1.00 72.61  ?  90  GLU E C   1 
ATOM   2824  O  O   . GLU C  3 62  ? 106.304 68.404  158.613 1.00 72.61  ?  90  GLU E O   1 
ATOM   2825  C  CB  . GLU C  3 62  ? 103.595 69.395  159.956 1.00 72.61  ?  90  GLU E CB  1 
ATOM   2826  C  CG  . GLU C  3 62  ? 104.634 70.237  160.677 1.00 72.61  ?  90  GLU E CG  1 
ATOM   2827  C  CD  . GLU C  3 62  ? 104.157 70.703  162.039 1.00 72.61  ?  90  GLU E CD  1 
ATOM   2828  O  OE1 . GLU C  3 62  ? 103.032 70.332  162.434 1.00 72.61  ?  90  GLU E OE1 1 
ATOM   2829  O  OE2 . GLU C  3 62  ? 104.903 71.443  162.714 1.00 72.61  ?  90  GLU E OE2 1 
ATOM   2830  N  N   . ASP C  3 63  ? 104.903 66.647  158.631 1.00 76.64  ?  91  ASP E N   1 
ATOM   2831  C  CA  . ASP C  3 63  ? 105.963 65.666  158.886 1.00 76.64  ?  91  ASP E CA  1 
ATOM   2832  C  C   . ASP C  3 63  ? 106.590 65.149  157.593 1.00 76.64  ?  91  ASP E C   1 
ATOM   2833  O  O   . ASP C  3 63  ? 107.784 65.345  157.352 1.00 76.64  ?  91  ASP E O   1 
ATOM   2834  C  CB  . ASP C  3 63  ? 105.402 64.514  159.720 1.00 76.64  ?  91  ASP E CB  1 
ATOM   2835  C  CG  . ASP C  3 63  ? 105.002 64.951  161.112 1.00 76.64  ?  91  ASP E CG  1 
ATOM   2836  O  OD1 . ASP C  3 63  ? 105.617 65.904  161.633 1.00 76.64  ?  91  ASP E OD1 1 
ATOM   2837  O  OD2 . ASP C  3 63  ? 104.069 64.349  161.683 1.00 76.64  ?  91  ASP E OD2 1 
ATOM   2838  N  N   . THR C  3 64  ? 105.791 64.503  156.748 1.00 71.34  ?  92  THR E N   1 
ATOM   2839  C  CA  . THR C  3 64  ? 106.333 63.791  155.597 1.00 71.34  ?  92  THR E CA  1 
ATOM   2840  C  C   . THR C  3 64  ? 106.647 64.700  154.422 1.00 71.34  ?  92  THR E C   1 
ATOM   2841  O  O   . THR C  3 64  ? 107.260 64.238  153.454 1.00 71.34  ?  92  THR E O   1 
ATOM   2842  C  CB  . THR C  3 64  ? 105.359 62.707  155.135 1.00 71.34  ?  92  THR E CB  1 
ATOM   2843  O  OG1 . THR C  3 64  ? 104.151 63.319  154.667 1.00 71.34  ?  92  THR E OG1 1 
ATOM   2844  C  CG2 . THR C  3 64  ? 105.029 61.766  156.283 1.00 71.34  ?  92  THR E CG2 1 
ATOM   2845  N  N   . GLY C  3 65  ? 106.251 65.965  154.476 1.00 67.86  ?  93  GLY E N   1 
ATOM   2846  C  CA  . GLY C  3 65  ? 106.457 66.853  153.353 1.00 67.86  ?  93  GLY E CA  1 
ATOM   2847  C  C   . GLY C  3 65  ? 105.548 66.523  152.190 1.00 67.86  ?  93  GLY E C   1 
ATOM   2848  O  O   . GLY C  3 65  ? 106.015 66.193  151.098 1.00 67.86  ?  93  GLY E O   1 
ATOM   2849  N  N   . LEU C  3 66  ? 104.243 66.610  152.421 1.00 67.42  ?  94  LEU E N   1 
ATOM   2850  C  CA  . LEU C  3 66  ? 103.229 66.263  151.438 1.00 67.42  ?  94  LEU E CA  1 
ATOM   2851  C  C   . LEU C  3 66  ? 102.281 67.433  151.227 1.00 67.42  ?  94  LEU E C   1 
ATOM   2852  O  O   . LEU C  3 66  ? 101.670 67.925  152.177 1.00 67.42  ?  94  LEU E O   1 
ATOM   2853  C  CB  . LEU C  3 66  ? 102.446 65.028  151.894 1.00 67.42  ?  94  LEU E CB  1 
ATOM   2854  C  CG  . LEU C  3 66  ? 101.199 64.604  151.117 1.00 67.42  ?  94  LEU E CG  1 
ATOM   2855  C  CD1 . LEU C  3 66  ? 101.492 64.310  149.662 1.00 67.42  ?  94  LEU E CD1 1 
ATOM   2856  C  CD2 . LEU C  3 66  ? 100.599 63.380  151.777 1.00 67.42  ?  94  LEU E CD2 1 
ATOM   2857  N  N   . LEU C  3 67  ? 102.156 67.875  149.980 1.00 64.21  ?  95  LEU E N   1 
ATOM   2858  C  CA  . LEU C  3 67  ? 101.180 68.885  149.597 1.00 64.21  ?  95  LEU E CA  1 
ATOM   2859  C  C   . LEU C  3 67  ? 100.005 68.175  148.951 1.00 64.21  ?  95  LEU E C   1 
ATOM   2860  O  O   . LEU C  3 67  ? 100.201 67.355  148.042 1.00 64.21  ?  95  LEU E O   1 
ATOM   2861  C  CB  . LEU C  3 67  ? 101.776 69.914  148.635 1.00 64.21  ?  95  LEU E CB  1 
ATOM   2862  C  CG  . LEU C  3 67  ? 102.520 71.131  149.186 1.00 64.21  ?  95  LEU E CG  1 
ATOM   2863  C  CD1 . LEU C  3 67  ? 103.855 70.763  149.795 1.00 64.21  ?  95  LEU E CD1 1 
ATOM   2864  C  CD2 . LEU C  3 67  ? 102.712 72.141  148.071 1.00 64.21  ?  95  LEU E CD2 1 
ATOM   2865  N  N   . TYR C  3 68  ? 98.797  68.487  149.426 1.00 69.96  ?  96  TYR E N   1 
ATOM   2866  C  CA  . TYR C  3 68  ? 97.563  67.882  148.948 1.00 69.96  ?  96  TYR E CA  1 
ATOM   2867  C  C   . TYR C  3 68  ? 96.459  68.931  148.988 1.00 69.96  ?  96  TYR E C   1 
ATOM   2868  O  O   . TYR C  3 68  ? 96.685  70.085  149.359 1.00 69.96  ?  96  TYR E O   1 
ATOM   2869  C  CB  . TYR C  3 68  ? 97.178  66.648  149.781 1.00 69.96  ?  96  TYR E CB  1 
ATOM   2870  C  CG  . TYR C  3 68  ? 96.873  66.930  151.233 1.00 69.96  ?  96  TYR E CG  1 
ATOM   2871  C  CD1 . TYR C  3 68  ? 97.887  66.962  152.178 1.00 69.96  ?  96  TYR E CD1 1 
ATOM   2872  C  CD2 . TYR C  3 68  ? 95.570  67.125  151.666 1.00 69.96  ?  96  TYR E CD2 1 
ATOM   2873  C  CE1 . TYR C  3 68  ? 97.617  67.212  153.505 1.00 69.96  ?  96  TYR E CE1 1 
ATOM   2874  C  CE2 . TYR C  3 68  ? 95.290  67.378  152.989 1.00 69.96  ?  96  TYR E CE2 1 
ATOM   2875  C  CZ  . TYR C  3 68  ? 96.316  67.416  153.904 1.00 69.96  ?  96  TYR E CZ  1 
ATOM   2876  O  OH  . TYR C  3 68  ? 96.039  67.665  155.227 1.00 69.96  ?  96  TYR E OH  1 
ATOM   2877  N  N   . LEU C  3 69  ? 95.249  68.516  148.621 1.00 72.57  ?  97  LEU E N   1 
ATOM   2878  C  CA  . LEU C  3 69  ? 94.080  69.388  148.628 1.00 72.57  ?  97  LEU E CA  1 
ATOM   2879  C  C   . LEU C  3 69  ? 93.195  69.060  149.822 1.00 72.57  ?  97  LEU E C   1 
ATOM   2880  O  O   . LEU C  3 69  ? 92.903  67.887  150.076 1.00 72.57  ?  97  LEU E O   1 
ATOM   2881  C  CB  . LEU C  3 69  ? 93.278  69.244  147.337 1.00 72.57  ?  97  LEU E CB  1 
ATOM   2882  C  CG  . LEU C  3 69  ? 93.852  69.834  146.057 1.00 72.57  ?  97  LEU E CG  1 
ATOM   2883  C  CD1 . LEU C  3 69  ? 92.990  69.450  144.875 1.00 72.57  ?  97  LEU E CD1 1 
ATOM   2884  C  CD2 . LEU C  3 69  ? 93.910  71.335  146.195 1.00 72.57  ?  97  LEU E CD2 1 
ATOM   2885  N  N   . ASN C  3 70  ? 92.758  70.093  150.545 1.00 80.99  ?  98  ASN E N   1 
ATOM   2886  C  CA  . ASN C  3 70  ? 91.727  69.879  151.554 1.00 80.99  ?  98  ASN E CA  1 
ATOM   2887  C  C   . ASN C  3 70  ? 90.340  70.060  150.957 1.00 80.99  ?  98  ASN E C   1 
ATOM   2888  O  O   . ASN C  3 70  ? 89.507  69.151  151.012 1.00 80.99  ?  98  ASN E O   1 
ATOM   2889  C  CB  . ASN C  3 70  ? 91.900  70.835  152.730 1.00 80.99  ?  98  ASN E CB  1 
ATOM   2890  C  CG  . ASN C  3 70  ? 91.021  70.462  153.902 1.00 80.99  ?  98  ASN E CG  1 
ATOM   2891  O  OD1 . ASN C  3 70  ? 90.484  69.355  153.949 1.00 80.99  ?  98  ASN E OD1 1 
ATOM   2892  N  ND2 . ASN C  3 70  ? 90.837  71.403  154.831 1.00 80.99  ?  98  ASN E ND2 1 
ATOM   2893  N  N   . ARG C  3 71  ? 90.070  71.235  150.406 1.00 83.76  ?  99  ARG E N   1 
ATOM   2894  C  CA  . ARG C  3 71  ? 88.805  71.533  149.764 1.00 83.76  ?  99  ARG E CA  1 
ATOM   2895  C  C   . ARG C  3 71  ? 88.911  71.206  148.276 1.00 83.76  ?  99  ARG E C   1 
ATOM   2896  O  O   . ARG C  3 71  ? 89.890  70.613  147.817 1.00 83.76  ?  99  ARG E O   1 
ATOM   2897  C  CB  . ARG C  3 71  ? 88.429  72.991  150.023 1.00 83.76  ?  99  ARG E CB  1 
ATOM   2898  C  CG  . ARG C  3 71  ? 88.202  73.292  151.495 1.00 83.76  ?  99  ARG E CG  1 
ATOM   2899  C  CD  . ARG C  3 71  ? 87.856  74.750  151.739 1.00 83.76  ?  99  ARG E CD  1 
ATOM   2900  N  NE  . ARG C  3 71  ? 86.569  75.115  151.156 1.00 83.76  ?  99  ARG E NE  1 
ATOM   2901  C  CZ  . ARG C  3 71  ? 86.426  75.952  150.135 1.00 83.76  ?  99  ARG E CZ  1 
ATOM   2902  N  NH1 . ARG C  3 71  ? 87.493  76.519  149.595 1.00 83.76  ?  99  ARG E NH1 1 
ATOM   2903  N  NH2 . ARG C  3 71  ? 85.220  76.230  149.662 1.00 83.76  ?  99  ARG E NH2 1 
ATOM   2904  N  N   . SER C  3 72  ? 87.899  71.594  147.506 1.00 79.48  ?  100 SER E N   1 
ATOM   2905  C  CA  . SER C  3 72  ? 87.864  71.293  146.083 1.00 79.48  ?  100 SER E CA  1 
ATOM   2906  C  C   . SER C  3 72  ? 87.690  72.601  145.326 1.00 79.48  ?  100 SER E C   1 
ATOM   2907  O  O   . SER C  3 72  ? 87.352  73.638  145.903 1.00 79.48  ?  100 SER E O   1 
ATOM   2908  C  CB  . SER C  3 72  ? 86.749  70.291  145.762 1.00 79.48  ?  100 SER E CB  1 
ATOM   2909  O  OG  . SER C  3 72  ? 85.473  70.864  145.981 1.00 79.48  ?  100 SER E OG  1 
ATOM   2910  N  N   . LEU C  3 73  ? 87.901  72.546  144.018 1.00 79.47  ?  101 LEU E N   1 
ATOM   2911  C  CA  . LEU C  3 73  ? 87.921  73.730  143.173 1.00 79.47  ?  101 LEU E CA  1 
ATOM   2912  C  C   . LEU C  3 73  ? 86.689  73.736  142.280 1.00 79.47  ?  101 LEU E C   1 
ATOM   2913  O  O   . LEU C  3 73  ? 86.555  72.882  141.398 1.00 79.47  ?  101 LEU E O   1 
ATOM   2914  C  CB  . LEU C  3 73  ? 89.191  73.757  142.326 1.00 79.47  ?  101 LEU E CB  1 
ATOM   2915  C  CG  . LEU C  3 73  ? 90.503  73.832  143.104 1.00 79.47  ?  101 LEU E CG  1 
ATOM   2916  C  CD1 . LEU C  3 73  ? 91.665  73.643  142.156 1.00 79.47  ?  101 LEU E CD1 1 
ATOM   2917  C  CD2 . LEU C  3 73  ? 90.633  75.146  143.863 1.00 79.47  ?  101 LEU E CD2 1 
ATOM   2918  N  N   . ASP C  3 74  ? 85.800  74.697  142.502 1.00 84.69  ?  102 ASP E N   1 
ATOM   2919  C  CA  . ASP C  3 74  ? 84.688  74.951  141.600 1.00 84.69  ?  102 ASP E CA  1 
ATOM   2920  C  C   . ASP C  3 74  ? 85.047  76.085  140.648 1.00 84.69  ?  102 ASP E C   1 
ATOM   2921  O  O   . ASP C  3 74  ? 86.088  76.731  140.788 1.00 84.69  ?  102 ASP E O   1 
ATOM   2922  C  CB  . ASP C  3 74  ? 83.403  75.277  142.373 1.00 84.69  ?  102 ASP E CB  1 
ATOM   2923  C  CG  . ASP C  3 74  ? 83.580  76.413  143.364 1.00 84.69  ?  102 ASP E CG  1 
ATOM   2924  O  OD1 . ASP C  3 74  ? 84.726  76.844  143.597 1.00 84.69  ?  102 ASP E OD1 1 
ATOM   2925  O  OD2 . ASP C  3 74  ? 82.561  76.888  143.907 1.00 84.69  ?  102 ASP E OD2 1 
ATOM   2926  N  N   . HIS C  3 75  ? 84.168  76.311  139.667 1.00 84.19  ?  103 HIS E N   1 
ATOM   2927  C  CA  . HIS C  3 75  ? 84.418  77.343  138.665 1.00 84.19  ?  103 HIS E CA  1 
ATOM   2928  C  C   . HIS C  3 75  ? 84.376  78.739  139.271 1.00 84.19  ?  103 HIS E C   1 
ATOM   2929  O  O   . HIS C  3 75  ? 85.071  79.644  138.791 1.00 84.19  ?  103 HIS E O   1 
ATOM   2930  C  CB  . HIS C  3 75  ? 83.396  77.239  137.535 1.00 84.19  ?  103 HIS E CB  1 
ATOM   2931  C  CG  . HIS C  3 75  ? 83.494  75.976  136.738 1.00 84.19  ?  103 HIS E CG  1 
ATOM   2932  N  ND1 . HIS C  3 75  ? 82.836  74.818  137.094 1.00 84.19  ?  103 HIS E ND1 1 
ATOM   2933  C  CD2 . HIS C  3 75  ? 84.156  75.694  135.590 1.00 84.19  ?  103 HIS E CD2 1 
ATOM   2934  C  CE1 . HIS C  3 75  ? 83.096  73.875  136.206 1.00 84.19  ?  103 HIS E CE1 1 
ATOM   2935  N  NE2 . HIS C  3 75  ? 83.894  74.381  135.283 1.00 84.19  ?  103 HIS E NE2 1 
ATOM   2936  N  N   . SER C  3 76  ? 83.587  78.923  140.333 1.00 85.90  ?  104 SER E N   1 
ATOM   2937  C  CA  . SER C  3 76  ? 83.461  80.236  140.956 1.00 85.90  ?  104 SER E CA  1 
ATOM   2938  C  C   . SER C  3 76  ? 84.749  80.658  141.646 1.00 85.90  ?  104 SER E C   1 
ATOM   2939  O  O   . SER C  3 76  ? 85.048  81.853  141.708 1.00 85.90  ?  104 SER E O   1 
ATOM   2940  C  CB  . SER C  3 76  ? 82.303  80.237  141.953 1.00 85.90  ?  104 SER E CB  1 
ATOM   2941  O  OG  . SER C  3 76  ? 82.568  79.377  143.046 1.00 85.90  ?  104 SER E OG  1 
ATOM   2942  N  N   . SER C  3 77  ? 85.540  79.694  142.124 1.00 83.82  ?  105 SER E N   1 
ATOM   2943  C  CA  . SER C  3 77  ? 86.812  80.013  142.767 1.00 83.82  ?  105 SER E CA  1 
ATOM   2944  C  C   . SER C  3 77  ? 87.810  80.595  141.774 1.00 83.82  ?  105 SER E C   1 
ATOM   2945  O  O   . SER C  3 77  ? 88.475  81.596  142.061 1.00 83.82  ?  105 SER E O   1 
ATOM   2946  C  CB  . SER C  3 77  ? 87.389  78.761  143.419 1.00 83.82  ?  105 SER E CB  1 
ATOM   2947  O  OG  . SER C  3 77  ? 86.519  78.264  144.422 1.00 83.82  ?  105 SER E OG  1 
ATOM   2948  N  N   . TRP C  3 78  ? 87.910  80.000  140.591 1.00 82.86  ?  106 TRP E N   1 
ATOM   2949  C  CA  . TRP C  3 78  ? 88.859  80.489  139.606 1.00 82.86  ?  106 TRP E CA  1 
ATOM   2950  C  C   . TRP C  3 78  ? 88.326  81.683  138.833 1.00 82.86  ?  106 TRP E C   1 
ATOM   2951  O  O   . TRP C  3 78  ? 89.123  82.462  138.298 1.00 82.86  ?  106 TRP E O   1 
ATOM   2952  C  CB  . TRP C  3 78  ? 89.257  79.338  138.685 1.00 82.86  ?  106 TRP E CB  1 
ATOM   2953  C  CG  . TRP C  3 78  ? 90.007  78.313  139.475 1.00 82.86  ?  106 TRP E CG  1 
ATOM   2954  C  CD1 . TRP C  3 78  ? 89.482  77.233  140.119 1.00 82.86  ?  106 TRP E CD1 1 
ATOM   2955  C  CD2 . TRP C  3 78  ? 91.417  78.289  139.738 1.00 82.86  ?  106 TRP E CD2 1 
ATOM   2956  N  NE1 . TRP C  3 78  ? 90.475  76.534  140.759 1.00 82.86  ?  106 TRP E NE1 1 
ATOM   2957  C  CE2 . TRP C  3 78  ? 91.673  77.158  140.536 1.00 82.86  ?  106 TRP E CE2 1 
ATOM   2958  C  CE3 . TRP C  3 78  ? 92.488  79.105  139.364 1.00 82.86  ?  106 TRP E CE3 1 
ATOM   2959  C  CZ2 . TRP C  3 78  ? 92.952  76.835  140.981 1.00 82.86  ?  106 TRP E CZ2 1 
ATOM   2960  C  CZ3 . TRP C  3 78  ? 93.757  78.775  139.797 1.00 82.86  ?  106 TRP E CZ3 1 
ATOM   2961  C  CH2 . TRP C  3 78  ? 93.979  77.649  140.595 1.00 82.86  ?  106 TRP E CH2 1 
ATOM   2962  N  N   . GLU C  3 79  ? 87.005  81.875  138.798 1.00 88.55  ?  107 GLU E N   1 
ATOM   2963  C  CA  . GLU C  3 79  ? 86.484  83.159  138.345 1.00 88.55  ?  107 GLU E CA  1 
ATOM   2964  C  C   . GLU C  3 79  ? 86.753  84.250  139.375 1.00 88.55  ?  107 GLU E C   1 
ATOM   2965  O  O   . GLU C  3 79  ? 86.960  85.413  139.015 1.00 88.55  ?  107 GLU E O   1 
ATOM   2966  C  CB  . GLU C  3 79  ? 84.988  83.057  138.045 1.00 88.55  ?  107 GLU E CB  1 
ATOM   2967  C  CG  . GLU C  3 79  ? 84.645  82.201  136.832 1.00 88.55  ?  107 GLU E CG  1 
ATOM   2968  C  CD  . GLU C  3 79  ? 85.123  82.800  135.524 1.00 88.55  ?  107 GLU E CD  1 
ATOM   2969  O  OE1 . GLU C  3 79  ? 85.150  84.043  135.407 1.00 88.55  ?  107 GLU E OE1 1 
ATOM   2970  O  OE2 . GLU C  3 79  ? 85.472  82.022  134.610 1.00 88.55  ?  107 GLU E OE2 1 
ATOM   2971  N  N   . LYS C  3 80  ? 86.756  83.893  140.662 1.00 86.36  ?  108 LYS E N   1 
ATOM   2972  C  CA  . LYS C  3 80  ? 87.090  84.848  141.710 1.00 86.36  ?  108 LYS E CA  1 
ATOM   2973  C  C   . LYS C  3 80  ? 88.563  85.218  141.676 1.00 86.36  ?  108 LYS E C   1 
ATOM   2974  O  O   . LYS C  3 80  ? 88.921  86.374  141.927 1.00 86.36  ?  108 LYS E O   1 
ATOM   2975  C  CB  . LYS C  3 80  ? 86.724  84.252  143.068 1.00 86.36  ?  108 LYS E CB  1 
ATOM   2976  C  CG  . LYS C  3 80  ? 86.854  85.190  144.246 1.00 86.36  ?  108 LYS E CG  1 
ATOM   2977  C  CD  . LYS C  3 80  ? 86.523  84.471  145.545 1.00 86.36  ?  108 LYS E CD  1 
ATOM   2978  C  CE  . LYS C  3 80  ? 85.073  84.677  145.952 1.00 86.36  ?  108 LYS E CE  1 
ATOM   2979  N  NZ  . LYS C  3 80  ? 84.133  83.817  145.179 1.00 86.36  ?  108 LYS E NZ  1 
ATOM   2980  N  N   . LEU C  3 81  ? 89.425  84.253  141.366 1.00 86.57  ?  109 LEU E N   1 
ATOM   2981  C  CA  . LEU C  3 81  ? 90.855  84.524  141.280 1.00 86.57  ?  109 LEU E CA  1 
ATOM   2982  C  C   . LEU C  3 81  ? 91.211  85.267  139.996 1.00 86.57  ?  109 LEU E C   1 
ATOM   2983  O  O   . LEU C  3 81  ? 92.081  86.145  140.004 1.00 86.57  ?  109 LEU E O   1 
ATOM   2984  C  CB  . LEU C  3 81  ? 91.645  83.218  141.376 1.00 86.57  ?  109 LEU E CB  1 
ATOM   2985  C  CG  . LEU C  3 81  ? 91.668  82.524  142.734 1.00 86.57  ?  109 LEU E CG  1 
ATOM   2986  C  CD1 . LEU C  3 81  ? 92.322  81.160  142.631 1.00 86.57  ?  109 LEU E CD1 1 
ATOM   2987  C  CD2 . LEU C  3 81  ? 92.419  83.391  143.708 1.00 86.57  ?  109 LEU E CD2 1 
ATOM   2988  N  N   . SER C  3 82  ? 90.549  84.935  138.885 1.00 91.28  ?  110 SER E N   1 
ATOM   2989  C  CA  . SER C  3 82  ? 90.937  85.491  137.595 1.00 91.28  ?  110 SER E CA  1 
ATOM   2990  C  C   . SER C  3 82  ? 90.582  86.966  137.440 1.00 91.28  ?  110 SER E C   1 
ATOM   2991  O  O   . SER C  3 82  ? 91.166  87.631  136.578 1.00 91.28  ?  110 SER E O   1 
ATOM   2992  C  CB  . SER C  3 82  ? 90.296  84.680  136.469 1.00 91.28  ?  110 SER E CB  1 
ATOM   2993  O  OG  . SER C  3 82  ? 90.685  85.181  135.203 1.00 91.28  ?  110 SER E OG  1 
ATOM   2994  N  N   . VAL C  3 83  ? 89.648  87.490  138.241 1.00 94.31  ?  111 VAL E N   1 
ATOM   2995  C  CA  . VAL C  3 83  ? 89.378  88.929  138.255 1.00 94.31  ?  111 VAL E CA  1 
ATOM   2996  C  C   . VAL C  3 83  ? 90.548  89.726  138.809 1.00 94.31  ?  111 VAL E C   1 
ATOM   2997  O  O   . VAL C  3 83  ? 90.943  90.734  138.207 1.00 94.31  ?  111 VAL E O   1 
ATOM   2998  C  CB  . VAL C  3 83  ? 88.091  89.215  139.056 1.00 94.31  ?  111 VAL E CB  1 
ATOM   2999  C  CG1 . VAL C  3 83  ? 87.875  90.709  139.254 1.00 94.31  ?  111 VAL E CG1 1 
ATOM   3000  C  CG2 . VAL C  3 83  ? 86.888  88.623  138.345 1.00 94.31  ?  111 VAL E CG2 1 
ATOM   3001  N  N   . ARG C  3 84  ? 91.155  89.267  139.901 1.00 91.94  ?  112 ARG E N   1 
ATOM   3002  C  CA  . ARG C  3 84  ? 92.304  89.912  140.526 1.00 91.94  ?  112 ARG E CA  1 
ATOM   3003  C  C   . ARG C  3 84  ? 93.563  89.845  139.657 1.00 91.94  ?  112 ARG E C   1 
ATOM   3004  O  O   . ARG C  3 84  ? 94.488  90.642  139.852 1.00 91.94  ?  112 ARG E O   1 
ATOM   3005  C  CB  . ARG C  3 84  ? 92.536  89.270  141.907 1.00 91.94  ?  112 ARG E CB  1 
ATOM   3006  C  CG  . ARG C  3 84  ? 93.615  89.874  142.803 1.00 91.94  ?  112 ARG E CG  1 
ATOM   3007  C  CD  . ARG C  3 84  ? 93.309  91.296  143.230 1.00 91.94  ?  112 ARG E CD  1 
ATOM   3008  N  NE  . ARG C  3 84  ? 94.354  91.796  144.120 1.00 91.94  ?  112 ARG E NE  1 
ATOM   3009  C  CZ  . ARG C  3 84  ? 94.473  93.060  144.513 1.00 91.94  ?  112 ARG E CZ  1 
ATOM   3010  N  NH1 . ARG C  3 84  ? 95.460  93.411  145.325 1.00 91.94  ?  112 ARG E NH1 1 
ATOM   3011  N  NH2 . ARG C  3 84  ? 93.609  93.973  144.093 1.00 91.94  ?  112 ARG E NH2 1 
ATOM   3012  N  N   . ASN C  3 85  ? 93.571  88.995  138.628 1.00 93.63  ?  113 ASN E N   1 
ATOM   3013  C  CA  . ASN C  3 85  ? 94.714  88.728  137.758 1.00 93.63  ?  113 ASN E CA  1 
ATOM   3014  C  C   . ASN C  3 85  ? 95.005  89.868  136.763 1.00 93.63  ?  113 ASN E C   1 
ATOM   3015  O  O   . ASN C  3 85  ? 95.802  89.662  135.839 1.00 93.63  ?  113 ASN E O   1 
ATOM   3016  C  CB  . ASN C  3 85  ? 94.459  87.418  137.000 1.00 93.63  ?  113 ASN E CB  1 
ATOM   3017  C  CG  . ASN C  3 85  ? 95.733  86.746  136.522 1.00 93.63  ?  113 ASN E CG  1 
ATOM   3018  O  OD1 . ASN C  3 85  ? 96.837  87.173  136.857 1.00 93.63  ?  113 ASN E OD1 1 
ATOM   3019  N  ND2 . ASN C  3 85  ? 95.583  85.727  135.687 1.00 93.63  ?  113 ASN E ND2 1 
ATOM   3020  N  N   . HIS C  3 86  ? 94.369  91.036  136.931 1.00 95.63  ?  114 HIS E N   1 
ATOM   3021  C  CA  . HIS C  3 86  ? 94.590  92.240  136.114 1.00 95.63  ?  114 HIS E CA  1 
ATOM   3022  C  C   . HIS C  3 86  ? 94.277  91.985  134.641 1.00 95.63  ?  114 HIS E C   1 
ATOM   3023  O  O   . HIS C  3 86  ? 94.986  92.444  133.743 1.00 95.63  ?  114 HIS E O   1 
ATOM   3024  C  CB  . HIS C  3 86  ? 96.012  92.788  136.283 1.00 95.63  ?  114 HIS E CB  1 
ATOM   3025  C  CG  . HIS C  3 86  ? 96.322  93.255  137.670 1.00 95.63  ?  114 HIS E CG  1 
ATOM   3026  N  ND1 . HIS C  3 86  ? 95.839  94.440  138.181 1.00 95.63  ?  114 HIS E ND1 1 
ATOM   3027  C  CD2 . HIS C  3 86  ? 97.075  92.702  138.650 1.00 95.63  ?  114 HIS E CD2 1 
ATOM   3028  C  CE1 . HIS C  3 86  ? 96.276  94.595  139.417 1.00 95.63  ?  114 HIS E CE1 1 
ATOM   3029  N  NE2 . HIS C  3 86  ? 97.028  93.555  139.726 1.00 95.63  ?  114 HIS E NE2 1 
ATOM   3030  N  N   . GLY C  3 87  ? 93.207  91.239  134.394 1.00 95.42  ?  115 GLY E N   1 
ATOM   3031  C  CA  . GLY C  3 87  ? 92.793  90.947  133.032 1.00 95.42  ?  115 GLY E CA  1 
ATOM   3032  C  C   . GLY C  3 87  ? 93.697  89.986  132.293 1.00 95.42  ?  115 GLY E C   1 
ATOM   3033  O  O   . GLY C  3 87  ? 93.842  90.093  131.069 1.00 95.42  ?  115 GLY E O   1 
ATOM   3034  N  N   . PHE C  3 88  ? 94.316  89.050  133.006 1.00 89.41  ?  116 PHE E N   1 
ATOM   3035  C  CA  . PHE C  3 88  ? 95.138  88.040  132.371 1.00 89.41  ?  116 PHE E CA  1 
ATOM   3036  C  C   . PHE C  3 88  ? 94.589  86.655  132.680 1.00 89.41  ?  116 PHE E C   1 
ATOM   3037  O  O   . PHE C  3 88  ? 94.069  86.422  133.775 1.00 89.41  ?  116 PHE E O   1 
ATOM   3038  C  CB  . PHE C  3 88  ? 96.595  88.131  132.840 1.00 89.41  ?  116 PHE E CB  1 
ATOM   3039  C  CG  . PHE C  3 88  ? 97.306  89.359  132.359 1.00 89.41  ?  116 PHE E CG  1 
ATOM   3040  C  CD1 . PHE C  3 88  ? 97.810  89.420  131.069 1.00 89.41  ?  116 PHE E CD1 1 
ATOM   3041  C  CD2 . PHE C  3 88  ? 97.475  90.452  133.194 1.00 89.41  ?  116 PHE E CD2 1 
ATOM   3042  C  CE1 . PHE C  3 88  ? 98.470  90.550  130.619 1.00 89.41  ?  116 PHE E CE1 1 
ATOM   3043  C  CE2 . PHE C  3 88  ? 98.132  91.586  132.752 1.00 89.41  ?  116 PHE E CE2 1 
ATOM   3044  C  CZ  . PHE C  3 88  ? 98.631  91.634  131.463 1.00 89.41  ?  116 PHE E CZ  1 
ATOM   3045  N  N   . PRO C  3 89  ? 94.662  85.726  131.727 1.00 86.11  ?  117 PRO E N   1 
ATOM   3046  C  CA  . PRO C  3 89  ? 94.230  84.354  132.009 1.00 86.11  ?  117 PRO E CA  1 
ATOM   3047  C  C   . PRO C  3 89  ? 95.176  83.675  132.987 1.00 86.11  ?  117 PRO E C   1 
ATOM   3048  O  O   . PRO C  3 89  ? 96.398  83.806  132.900 1.00 86.11  ?  117 PRO E O   1 
ATOM   3049  C  CB  . PRO C  3 89  ? 94.254  83.682  130.632 1.00 86.11  ?  117 PRO E CB  1 
ATOM   3050  C  CG  . PRO C  3 89  ? 95.221  84.485  129.838 1.00 86.11  ?  117 PRO E CG  1 
ATOM   3051  C  CD  . PRO C  3 89  ? 95.079  85.895  130.324 1.00 86.11  ?  117 PRO E CD  1 
ATOM   3052  N  N   . LEU C  3 90  ? 94.589  82.948  133.932 1.00 79.89  ?  118 LEU E N   1 
ATOM   3053  C  CA  . LEU C  3 90  ? 95.310  82.426  135.086 1.00 79.89  ?  118 LEU E CA  1 
ATOM   3054  C  C   . LEU C  3 90  ? 95.728  80.982  134.829 1.00 79.89  ?  118 LEU E C   1 
ATOM   3055  O  O   . LEU C  3 90  ? 94.994  80.031  135.099 1.00 79.89  ?  118 LEU E O   1 
ATOM   3056  C  CB  . LEU C  3 90  ? 94.447  82.548  136.335 1.00 79.89  ?  118 LEU E CB  1 
ATOM   3057  C  CG  . LEU C  3 90  ? 95.133  82.217  137.654 1.00 79.89  ?  118 LEU E CG  1 
ATOM   3058  C  CD1 . LEU C  3 90  ? 96.260  83.195  137.900 1.00 79.89  ?  118 LEU E CD1 1 
ATOM   3059  C  CD2 . LEU C  3 90  ? 94.138  82.275  138.784 1.00 79.89  ?  118 LEU E CD2 1 
ATOM   3060  N  N   . LEU C  3 91  ? 96.936  80.828  134.296 1.00 69.23  ?  119 LEU E N   1 
ATOM   3061  C  CA  . LEU C  3 91  ? 97.549  79.524  134.110 1.00 69.23  ?  119 LEU E CA  1 
ATOM   3062  C  C   . LEU C  3 91  ? 98.669  79.260  135.107 1.00 69.23  ?  119 LEU E C   1 
ATOM   3063  O  O   . LEU C  3 91  ? 99.405  78.281  134.949 1.00 69.23  ?  119 LEU E O   1 
ATOM   3064  C  CB  . LEU C  3 91  ? 98.084  79.391  132.685 1.00 69.23  ?  119 LEU E CB  1 
ATOM   3065  C  CG  . LEU C  3 91  ? 97.048  79.338  131.567 1.00 69.23  ?  119 LEU E CG  1 
ATOM   3066  C  CD1 . LEU C  3 91  ? 97.726  79.346  130.208 1.00 69.23  ?  119 LEU E CD1 1 
ATOM   3067  C  CD2 . LEU C  3 91  ? 96.183  78.102  131.730 1.00 69.23  ?  119 LEU E CD2 1 
ATOM   3068  N  N   . THR C  3 92  ? 98.822  80.110  136.122 1.00 62.50  ?  120 THR E N   1 
ATOM   3069  C  CA  . THR C  3 92  ? 99.910  79.971  137.086 1.00 62.50  ?  120 THR E CA  1 
ATOM   3070  C  C   . THR C  3 92  ? 99.514  80.619  138.400 1.00 62.50  ?  120 THR E C   1 
ATOM   3071  O  O   . THR C  3 92  ? 99.261  81.825  138.444 1.00 62.50  ?  120 THR E O   1 
ATOM   3072  C  CB  . THR C  3 92  ? 101.200 80.611  136.566 1.00 62.50  ?  120 THR E CB  1 
ATOM   3073  O  OG1 . THR C  3 92  ? 101.675 79.898  135.418 1.00 62.50  ?  120 THR E OG1 1 
ATOM   3074  C  CG2 . THR C  3 92  ? 102.268 80.604  137.642 1.00 62.50  ?  120 THR E CG2 1 
ATOM   3075  N  N   . VAL C  3 93  ? 99.462  79.826  139.466 1.00 58.21  ?  121 VAL E N   1 
ATOM   3076  C  CA  . VAL C  3 93  ? 99.472  80.360  140.820 1.00 58.21  ?  121 VAL E CA  1 
ATOM   3077  C  C   . VAL C  3 93  ? 100.622 79.684  141.544 1.00 58.21  ?  121 VAL E C   1 
ATOM   3078  O  O   . VAL C  3 93  ? 101.182 78.702  141.060 1.00 58.21  ?  121 VAL E O   1 
ATOM   3079  C  CB  . VAL C  3 93  ? 98.147  80.132  141.573 1.00 58.21  ?  121 VAL E CB  1 
ATOM   3080  C  CG1 . VAL C  3 93  ? 97.016  80.866  140.885 1.00 58.21  ?  121 VAL E CG1 1 
ATOM   3081  C  CG2 . VAL C  3 93  ? 97.843  78.653  141.674 1.00 58.21  ?  121 VAL E CG2 1 
ATOM   3082  N  N   . TYR C  3 94  ? 100.989 80.217  142.710 1.00 55.91  ?  122 TYR E N   1 
ATOM   3083  C  CA  . TYR C  3 94  ? 102.004 79.525  143.489 1.00 55.91  ?  122 TYR E CA  1 
ATOM   3084  C  C   . TYR C  3 94  ? 101.875 79.794  144.973 1.00 55.91  ?  122 TYR E C   1 
ATOM   3085  O  O   . TYR C  3 94  ? 101.239 80.753  145.412 1.00 55.91  ?  122 TYR E O   1 
ATOM   3086  C  CB  . TYR C  3 94  ? 103.426 79.870  143.052 1.00 55.91  ?  122 TYR E CB  1 
ATOM   3087  C  CG  . TYR C  3 94  ? 103.937 81.273  143.228 1.00 55.91  ?  122 TYR E CG  1 
ATOM   3088  C  CD1 . TYR C  3 94  ? 103.802 82.209  142.216 1.00 55.91  ?  122 TYR E CD1 1 
ATOM   3089  C  CD2 . TYR C  3 94  ? 104.644 81.637  144.368 1.00 55.91  ?  122 TYR E CD2 1 
ATOM   3090  C  CE1 . TYR C  3 94  ? 104.306 83.483  142.356 1.00 55.91  ?  122 TYR E CE1 1 
ATOM   3091  C  CE2 . TYR C  3 94  ? 105.150 82.907  144.517 1.00 55.91  ?  122 TYR E CE2 1 
ATOM   3092  C  CZ  . TYR C  3 94  ? 104.978 83.824  143.509 1.00 55.91  ?  122 TYR E CZ  1 
ATOM   3093  O  OH  . TYR C  3 94  ? 105.479 85.092  143.658 1.00 55.91  ?  122 TYR E OH  1 
ATOM   3094  N  N   . LEU C  3 95  ? 102.528 78.924  145.730 1.00 52.65  ?  123 LEU E N   1 
ATOM   3095  C  CA  . LEU C  3 95  ? 102.650 79.020  147.170 1.00 52.65  ?  123 LEU E CA  1 
ATOM   3096  C  C   . LEU C  3 95  ? 104.102 79.265  147.533 1.00 52.65  ?  123 LEU E C   1 
ATOM   3097  O  O   . LEU C  3 95  ? 105.010 79.028  146.737 1.00 52.65  ?  123 LEU E O   1 
ATOM   3098  C  CB  . LEU C  3 95  ? 102.192 77.735  147.856 1.00 52.65  ?  123 LEU E CB  1 
ATOM   3099  C  CG  . LEU C  3 95  ? 100.721 77.377  147.855 1.00 52.65  ?  123 LEU E CG  1 
ATOM   3100  C  CD1 . LEU C  3 95  ? 100.576 75.953  148.304 1.00 52.65  ?  123 LEU E CD1 1 
ATOM   3101  C  CD2 . LEU C  3 95  ? 100.025 78.285  148.825 1.00 52.65  ?  123 LEU E CD2 1 
ATOM   3102  N  N   . LYS C  3 96  ? 104.311 79.714  148.760 1.00 58.40  ?  124 LYS E N   1 
ATOM   3103  C  CA  . LYS C  3 96  ? 105.610 79.653  149.406 1.00 58.40  ?  124 LYS E CA  1 
ATOM   3104  C  C   . LYS C  3 96  ? 105.573 78.495  150.388 1.00 58.40  ?  124 LYS E C   1 
ATOM   3105  O  O   . LYS C  3 96  ? 104.548 78.269  151.038 1.00 58.40  ?  124 LYS E O   1 
ATOM   3106  C  CB  . LYS C  3 96  ? 105.936 80.959  150.127 1.00 58.40  ?  124 LYS E CB  1 
ATOM   3107  C  CG  . LYS C  3 96  ? 106.220 82.127  149.205 1.00 58.40  ?  124 LYS E CG  1 
ATOM   3108  C  CD  . LYS C  3 96  ? 106.611 83.362  150.001 1.00 58.40  ?  124 LYS E CD  1 
ATOM   3109  C  CE  . LYS C  3 96  ? 106.975 84.521  149.087 1.00 58.40  ?  124 LYS E CE  1 
ATOM   3110  N  NZ  . LYS C  3 96  ? 107.380 85.734  149.848 1.00 58.40  ?  124 LYS E NZ  1 
ATOM   3111  N  N   . VAL C  3 97  ? 106.673 77.757  150.492 1.00 56.27  ?  125 VAL E N   1 
ATOM   3112  C  CA  . VAL C  3 97  ? 106.827 76.718  151.496 1.00 56.27  ?  125 VAL E CA  1 
ATOM   3113  C  C   . VAL C  3 97  ? 108.086 77.049  152.269 1.00 56.27  ?  125 VAL E C   1 
ATOM   3114  O  O   . VAL C  3 97  ? 109.173 77.151  151.687 1.00 56.27  ?  125 VAL E O   1 
ATOM   3115  C  CB  . VAL C  3 97  ? 106.923 75.318  150.885 1.00 56.27  ?  125 VAL E CB  1 
ATOM   3116  C  CG1 . VAL C  3 97  ? 107.210 74.301  151.974 1.00 56.27  ?  125 VAL E CG1 1 
ATOM   3117  C  CG2 . VAL C  3 97  ? 105.650 74.970  150.167 1.00 56.27  ?  125 VAL E CG2 1 
ATOM   3118  N  N   . PHE C  3 98  ? 107.947 77.230  153.567 1.00 55.76  ?  126 PHE E N   1 
ATOM   3119  C  CA  . PHE C  3 98  ? 109.111 77.471  154.394 1.00 55.76  ?  126 PHE E CA  1 
ATOM   3120  C  C   . PHE C  3 98  ? 109.488 76.161  155.071 1.00 55.76  ?  126 PHE E C   1 
ATOM   3121  O  O   . PHE C  3 98  ? 108.769 75.165  154.982 1.00 55.76  ?  126 PHE E O   1 
ATOM   3122  C  CB  . PHE C  3 98  ? 108.824 78.565  155.423 1.00 55.76  ?  126 PHE E CB  1 
ATOM   3123  C  CG  . PHE C  3 98  ? 108.512 79.921  154.823 1.00 55.76  ?  126 PHE E CG  1 
ATOM   3124  C  CD1 . PHE C  3 98  ? 108.860 80.246  153.517 1.00 55.76  ?  126 PHE E CD1 1 
ATOM   3125  C  CD2 . PHE C  3 98  ? 107.849 80.869  155.579 1.00 55.76  ?  126 PHE E CD2 1 
ATOM   3126  C  CE1 . PHE C  3 98  ? 108.554 81.484  152.989 1.00 55.76  ?  126 PHE E CE1 1 
ATOM   3127  C  CE2 . PHE C  3 98  ? 107.543 82.108  155.057 1.00 55.76  ?  126 PHE E CE2 1 
ATOM   3128  C  CZ  . PHE C  3 98  ? 107.898 82.415  153.760 1.00 55.76  ?  126 PHE E CZ  1 
ATOM   3129  N  N   . LEU C  3 99  ? 110.632 76.150  155.742 1.00 56.01  ?  127 LEU E N   1 
ATOM   3130  C  CA  . LEU C  3 99  ? 110.962 75.015  156.585 1.00 56.01  ?  127 LEU E CA  1 
ATOM   3131  C  C   . LEU C  3 99  ? 111.531 75.418  157.932 1.00 56.01  ?  127 LEU E C   1 
ATOM   3132  O  O   . LEU C  3 99  ? 111.631 74.563  158.817 1.00 56.01  ?  127 LEU E O   1 
ATOM   3133  C  CB  . LEU C  3 99  ? 111.944 74.072  155.877 1.00 56.01  ?  127 LEU E CB  1 
ATOM   3134  C  CG  . LEU C  3 99  ? 113.450 74.292  155.946 1.00 56.01  ?  127 LEU E CG  1 
ATOM   3135  C  CD1 . LEU C  3 99  ? 114.116 73.046  155.421 1.00 56.01  ?  127 LEU E CD1 1 
ATOM   3136  C  CD2 . LEU C  3 99  ? 113.924 75.498  155.173 1.00 56.01  ?  127 LEU E CD2 1 
ATOM   3137  N  N   . SER C  3 100 ? 111.908 76.679  158.114 1.00 58.49  ?  128 SER E N   1 
ATOM   3138  C  CA  . SER C  3 100 ? 112.278 77.215  159.414 1.00 58.49  ?  128 SER E CA  1 
ATOM   3139  C  C   . SER C  3 100 ? 111.472 78.484  159.651 1.00 58.49  ?  128 SER E C   1 
ATOM   3140  O  O   . SER C  3 100 ? 111.686 79.486  158.946 1.00 58.49  ?  128 SER E O   1 
ATOM   3141  C  CB  . SER C  3 100 ? 113.778 77.505  159.491 1.00 58.49  ?  128 SER E CB  1 
ATOM   3142  O  OG  . SER C  3 100 ? 114.530 76.308  159.402 1.00 58.49  ?  128 SER E OG  1 
ATOM   3143  N  N   . PRO C  3 101 ? 110.529 78.497  160.606 1.00 63.91  ?  129 PRO E N   1 
ATOM   3144  C  CA  . PRO C  3 101 ? 109.699 79.676  160.864 1.00 63.91  ?  129 PRO E CA  1 
ATOM   3145  C  C   . PRO C  3 101 ? 110.484 80.825  161.489 1.00 63.91  ?  129 PRO E C   1 
ATOM   3146  O  O   . PRO C  3 101 ? 110.955 81.687  160.748 1.00 63.91  ?  129 PRO E O   1 
ATOM   3147  C  CB  . PRO C  3 101 ? 108.636 79.148  161.832 1.00 63.91  ?  129 PRO E CB  1 
ATOM   3148  C  CG  . PRO C  3 101 ? 109.283 77.996  162.510 1.00 63.91  ?  129 PRO E CG  1 
ATOM   3149  C  CD  . PRO C  3 101 ? 110.171 77.367  161.481 1.00 63.91  ?  129 PRO E CD  1 
ATOM   3150  N  N   . GLY C  3 107 ? 108.542 86.981  154.002 1.00 71.96  ?  135 GLY E N   1 
ATOM   3151  C  CA  . GLY C  3 107 ? 109.410 87.939  153.343 1.00 71.96  ?  135 GLY E CA  1 
ATOM   3152  C  C   . GLY C  3 107 ? 109.459 87.741  151.843 1.00 71.96  ?  135 GLY E C   1 
ATOM   3153  O  O   . GLY C  3 107 ? 108.443 87.862  151.162 1.00 71.96  ?  135 GLY E O   1 
ATOM   3154  N  N   . GLU C  3 108 ? 110.646 87.435  151.324 1.00 76.07  ?  136 GLU E N   1 
ATOM   3155  C  CA  . GLU C  3 108 ? 110.829 87.134  149.910 1.00 76.07  ?  136 GLU E CA  1 
ATOM   3156  C  C   . GLU C  3 108 ? 111.439 85.748  149.783 1.00 76.07  ?  136 GLU E C   1 
ATOM   3157  O  O   . GLU C  3 108 ? 112.399 85.420  150.487 1.00 76.07  ?  136 GLU E O   1 
ATOM   3158  C  CB  . GLU C  3 108 ? 111.714 88.175  149.221 1.00 76.07  ?  136 GLU E CB  1 
ATOM   3159  C  CG  . GLU C  3 108 ? 111.851 87.967  147.725 1.00 76.07  ?  136 GLU E CG  1 
ATOM   3160  C  CD  . GLU C  3 108 ? 112.655 89.058  147.063 1.00 76.07  ?  136 GLU E CD  1 
ATOM   3161  O  OE1 . GLU C  3 108 ? 113.114 89.970  147.781 1.00 76.07  ?  136 GLU E OE1 1 
ATOM   3162  O  OE2 . GLU C  3 108 ? 112.829 89.006  145.828 1.00 76.07  ?  136 GLU E OE2 1 
ATOM   3163  N  N   . CYS C  3 109 ? 110.881 84.941  148.885 1.00 69.07  ?  137 CYS E N   1 
ATOM   3164  C  CA  . CYS C  3 109 ? 111.238 83.531  148.792 1.00 69.07  ?  137 CYS E CA  1 
ATOM   3165  C  C   . CYS C  3 109 ? 112.530 83.368  148.003 1.00 69.07  ?  137 CYS E C   1 
ATOM   3166  O  O   . CYS C  3 109 ? 112.578 83.672  146.808 1.00 69.07  ?  137 CYS E O   1 
ATOM   3167  C  CB  . CYS C  3 109 ? 110.101 82.751  148.141 1.00 69.07  ?  137 CYS E CB  1 
ATOM   3168  S  SG  . CYS C  3 109 ? 110.348 80.967  148.066 1.00 69.07  ?  137 CYS E SG  1 
ATOM   3169  N  N   . GLN C  3 110 ? 113.580 82.890  148.670 1.00 62.95  ?  138 GLN E N   1 
ATOM   3170  C  CA  . GLN C  3 110 ? 114.825 82.520  148.013 1.00 62.95  ?  138 GLN E CA  1 
ATOM   3171  C  C   . GLN C  3 110 ? 115.363 81.236  148.624 1.00 62.95  ?  138 GLN E C   1 
ATOM   3172  O  O   . GLN C  3 110 ? 115.125 80.943  149.798 1.00 62.95  ?  138 GLN E O   1 
ATOM   3173  C  CB  . GLN C  3 110 ? 115.898 83.613  148.116 1.00 62.95  ?  138 GLN E CB  1 
ATOM   3174  C  CG  . GLN C  3 110 ? 115.653 84.838  147.251 1.00 62.95  ?  138 GLN E CG  1 
ATOM   3175  C  CD  . GLN C  3 110 ? 116.772 85.855  147.353 1.00 62.95  ?  138 GLN E CD  1 
ATOM   3176  O  OE1 . GLN C  3 110 ? 117.716 85.683  148.123 1.00 62.95  ?  138 GLN E OE1 1 
ATOM   3177  N  NE2 . GLN C  3 110 ? 116.673 86.922  146.570 1.00 62.95  ?  138 GLN E NE2 1 
ATOM   3178  N  N   . TRP C  3 111 ? 116.077 80.471  147.803 1.00 52.87  ?  139 TRP E N   1 
ATOM   3179  C  CA  . TRP C  3 111 ? 116.840 79.334  148.294 1.00 52.87  ?  139 TRP E CA  1 
ATOM   3180  C  C   . TRP C  3 111 ? 117.934 79.842  149.231 1.00 52.87  ?  139 TRP E C   1 
ATOM   3181  O  O   . TRP C  3 111 ? 118.521 80.898  148.971 1.00 52.87  ?  139 TRP E O   1 
ATOM   3182  C  CB  . TRP C  3 111 ? 117.465 78.582  147.113 1.00 52.87  ?  139 TRP E CB  1 
ATOM   3183  C  CG  . TRP C  3 111 ? 118.190 77.339  147.489 1.00 52.87  ?  139 TRP E CG  1 
ATOM   3184  C  CD1 . TRP C  3 111 ? 117.643 76.135  147.816 1.00 52.87  ?  139 TRP E CD1 1 
ATOM   3185  C  CD2 . TRP C  3 111 ? 119.597 77.200  147.677 1.00 52.87  ?  139 TRP E CD2 1 
ATOM   3186  N  NE1 . TRP C  3 111 ? 118.627 75.242  148.149 1.00 52.87  ?  139 TRP E NE1 1 
ATOM   3187  C  CE2 . TRP C  3 111 ? 119.836 75.878  148.088 1.00 52.87  ?  139 TRP E CE2 1 
ATOM   3188  C  CE3 . TRP C  3 111 ? 120.681 78.066  147.527 1.00 52.87  ?  139 TRP E CE3 1 
ATOM   3189  C  CZ2 . TRP C  3 111 ? 121.113 75.392  148.325 1.00 52.87  ?  139 TRP E CZ2 1 
ATOM   3190  C  CZ3 . TRP C  3 111 ? 121.948 77.587  147.773 1.00 52.87  ?  139 TRP E CZ3 1 
ATOM   3191  C  CH2 . TRP C  3 111 ? 122.154 76.261  148.168 1.00 52.87  ?  139 TRP E CH2 1 
ATOM   3192  N  N   . PRO C  3 112 ? 118.246 79.129  150.326 1.00 50.01  ?  140 PRO E N   1 
ATOM   3193  C  CA  . PRO C  3 112 ? 117.789 77.844  150.859 1.00 50.01  ?  140 PRO E CA  1 
ATOM   3194  C  C   . PRO C  3 112 ? 116.646 77.912  151.851 1.00 50.01  ?  140 PRO E C   1 
ATOM   3195  O  O   . PRO C  3 112 ? 116.184 76.869  152.305 1.00 50.01  ?  140 PRO E O   1 
ATOM   3196  C  CB  . PRO C  3 112 ? 119.034 77.319  151.561 1.00 50.01  ?  140 PRO E CB  1 
ATOM   3197  C  CG  . PRO C  3 112 ? 119.695 78.531  152.049 1.00 50.01  ?  140 PRO E CG  1 
ATOM   3198  C  CD  . PRO C  3 112 ? 119.458 79.589  151.024 1.00 50.01  ?  140 PRO E CD  1 
ATOM   3199  N  N   . GLY C  3 113 ? 116.197 79.112  152.197 1.00 56.07  ?  141 GLY E N   1 
ATOM   3200  C  CA  . GLY C  3 113 ? 115.191 79.237  153.231 1.00 56.07  ?  141 GLY E CA  1 
ATOM   3201  C  C   . GLY C  3 113 ? 113.806 78.860  152.758 1.00 56.07  ?  141 GLY E C   1 
ATOM   3202  O  O   . GLY C  3 113 ? 113.087 78.126  153.435 1.00 56.07  ?  141 GLY E O   1 
ATOM   3203  N  N   . CYS C  3 114 ? 113.424 79.349  151.589 1.00 58.72  ?  142 CYS E N   1 
ATOM   3204  C  CA  . CYS C  3 114 ? 112.086 79.152  151.069 1.00 58.72  ?  142 CYS E CA  1 
ATOM   3205  C  C   . CYS C  3 114 ? 112.113 78.367  149.769 1.00 58.72  ?  142 CYS E C   1 
ATOM   3206  O  O   . CYS C  3 114 ? 113.104 78.360  149.036 1.00 58.72  ?  142 CYS E O   1 
ATOM   3207  C  CB  . CYS C  3 114 ? 111.386 80.485  150.840 1.00 58.72  ?  142 CYS E CB  1 
ATOM   3208  S  SG  . CYS C  3 114 ? 109.852 80.329  149.928 1.00 58.72  ?  142 CYS E SG  1 
ATOM   3209  N  N   . ALA C  3 115 ? 110.990 77.712  149.492 1.00 52.37  ?  143 ALA E N   1 
ATOM   3210  C  CA  . ALA C  3 115 ? 110.802 76.946  148.272 1.00 52.37  ?  143 ALA E CA  1 
ATOM   3211  C  C   . ALA C  3 115 ? 109.400 77.225  147.773 1.00 52.37  ?  143 ALA E C   1 
ATOM   3212  O  O   . ALA C  3 115 ? 108.425 76.794  148.392 1.00 52.37  ?  143 ALA E O   1 
ATOM   3213  C  CB  . ALA C  3 115 ? 110.986 75.447  148.517 1.00 52.37  ?  143 ALA E CB  1 
ATOM   3214  N  N   . ARG C  3 116 ? 109.291 77.976  146.695 1.00 51.81  ?  144 ARG E N   1 
ATOM   3215  C  CA  . ARG C  3 116 ? 107.985 78.243  146.130 1.00 51.81  ?  144 ARG E CA  1 
ATOM   3216  C  C   . ARG C  3 116 ? 107.527 77.023  145.347 1.00 51.81  ?  144 ARG E C   1 
ATOM   3217  O  O   . ARG C  3 116 ? 108.343 76.279  144.807 1.00 51.81  ?  144 ARG E O   1 
ATOM   3218  C  CB  . ARG C  3 116 ? 108.025 79.491  145.254 1.00 51.81  ?  144 ARG E CB  1 
ATOM   3219  C  CG  . ARG C  3 116 ? 108.948 79.405  144.073 1.00 51.81  ?  144 ARG E CG  1 
ATOM   3220  C  CD  . ARG C  3 116 ? 108.951 80.711  143.332 1.00 51.81  ?  144 ARG E CD  1 
ATOM   3221  N  NE  . ARG C  3 116 ? 109.502 81.795  144.126 1.00 51.81  ?  144 ARG E NE  1 
ATOM   3222  C  CZ  . ARG C  3 116 ? 110.791 82.101  144.161 1.00 51.81  ?  144 ARG E CZ  1 
ATOM   3223  N  NH1 . ARG C  3 116 ? 111.659 81.404  143.441 1.00 51.81  ?  144 ARG E NH1 1 
ATOM   3224  N  NH2 . ARG C  3 116 ? 111.209 83.111  144.909 1.00 51.81  ?  144 ARG E NH2 1 
ATOM   3225  N  N   . VAL C  3 117 ? 106.222 76.788  145.339 1.00 46.51  ?  145 VAL E N   1 
ATOM   3226  C  CA  . VAL C  3 117 ? 105.627 75.631  144.679 1.00 46.51  ?  145 VAL E CA  1 
ATOM   3227  C  C   . VAL C  3 117 ? 104.588 76.127  143.693 1.00 46.51  ?  145 VAL E C   1 
ATOM   3228  O  O   . VAL C  3 117 ? 103.622 76.790  144.084 1.00 46.51  ?  145 VAL E O   1 
ATOM   3229  C  CB  . VAL C  3 117 ? 104.990 74.664  145.688 1.00 46.51  ?  145 VAL E CB  1 
ATOM   3230  C  CG1 . VAL C  3 117 ? 104.240 73.575  144.958 1.00 46.51  ?  145 VAL E CG1 1 
ATOM   3231  C  CG2 . VAL C  3 117 ? 106.046 74.064  146.578 1.00 46.51  ?  145 VAL E CG2 1 
ATOM   3232  N  N   . TYR C  3 118 ? 104.775 75.799  142.426 1.00 47.96  ?  146 TYR E N   1 
ATOM   3233  C  CA  . TYR C  3 118 ? 103.919 76.304  141.367 1.00 47.96  ?  146 TYR E CA  1 
ATOM   3234  C  C   . TYR C  3 118 ? 102.708 75.403  141.206 1.00 47.96  ?  146 TYR E C   1 
ATOM   3235  O  O   . TYR C  3 118 ? 102.710 74.255  141.657 1.00 47.96  ?  146 TYR E O   1 
ATOM   3236  C  CB  . TYR C  3 118 ? 104.684 76.382  140.049 1.00 47.96  ?  146 TYR E CB  1 
ATOM   3237  C  CG  . TYR C  3 118 ? 105.776 77.410  140.053 1.00 47.96  ?  146 TYR E CG  1 
ATOM   3238  C  CD1 . TYR C  3 118 ? 105.723 78.490  140.897 1.00 47.96  ?  146 TYR E CD1 1 
ATOM   3239  C  CD2 . TYR C  3 118 ? 106.886 77.261  139.265 1.00 47.96  ?  146 TYR E CD2 1 
ATOM   3240  C  CE1 . TYR C  3 118 ? 106.710 79.421  140.925 1.00 47.96  ?  146 TYR E CE1 1 
ATOM   3241  C  CE2 . TYR C  3 118 ? 107.895 78.188  139.281 1.00 47.96  ?  146 TYR E CE2 1 
ATOM   3242  C  CZ  . TYR C  3 118 ? 107.798 79.265  140.122 1.00 47.96  ?  146 TYR E CZ  1 
ATOM   3243  O  OH  . TYR C  3 118 ? 108.797 80.195  140.155 1.00 47.96  ?  146 TYR E OH  1 
ATOM   3244  N  N   . PHE C  3 119 ? 101.673 75.936  140.566 1.00 52.67  ?  147 PHE E N   1 
ATOM   3245  C  CA  . PHE C  3 119 ? 100.473 75.189  140.220 1.00 52.67  ?  147 PHE E CA  1 
ATOM   3246  C  C   . PHE C  3 119 ? 99.957  75.756  138.910 1.00 52.67  ?  147 PHE E C   1 
ATOM   3247  O  O   . PHE C  3 119 ? 99.503  76.907  138.862 1.00 52.67  ?  147 PHE E O   1 
ATOM   3248  C  CB  . PHE C  3 119 ? 99.413  75.281  141.313 1.00 52.67  ?  147 PHE E CB  1 
ATOM   3249  C  CG  . PHE C  3 119 ? 99.787  74.576  142.575 1.00 52.67  ?  147 PHE E CG  1 
ATOM   3250  C  CD1 . PHE C  3 119 ? 99.695  73.200  142.664 1.00 52.67  ?  147 PHE E CD1 1 
ATOM   3251  C  CD2 . PHE C  3 119 ? 100.236 75.286  143.671 1.00 52.67  ?  147 PHE E CD2 1 
ATOM   3252  C  CE1 . PHE C  3 119 ? 100.044 72.543  143.824 1.00 52.67  ?  147 PHE E CE1 1 
ATOM   3253  C  CE2 . PHE C  3 119 ? 100.587 74.635  144.835 1.00 52.67  ?  147 PHE E CE2 1 
ATOM   3254  C  CZ  . PHE C  3 119 ? 100.491 73.261  144.910 1.00 52.67  ?  147 PHE E CZ  1 
ATOM   3255  N  N   . SER C  3 120 ? 100.062 74.961  137.851 1.00 62.59  ?  148 SER E N   1 
ATOM   3256  C  CA  . SER C  3 120 ? 99.508  75.300  136.545 1.00 62.59  ?  148 SER E CA  1 
ATOM   3257  C  C   . SER C  3 120 ? 98.106  74.714  136.476 1.00 62.59  ?  148 SER E C   1 
ATOM   3258  O  O   . SER C  3 120 ? 97.930  73.503  136.330 1.00 62.59  ?  148 SER E O   1 
ATOM   3259  C  CB  . SER C  3 120 ? 100.394 74.771  135.424 1.00 62.59  ?  148 SER E CB  1 
ATOM   3260  O  OG  . SER C  3 120 ? 101.656 75.408  135.438 1.00 62.59  ?  148 SER E OG  1 
ATOM   3261  N  N   . PHE C  3 121 ? 97.105  75.577  136.581 1.00 74.08  ?  149 PHE E N   1 
ATOM   3262  C  CA  . PHE C  3 121 ? 95.721  75.144  136.654 1.00 74.08  ?  149 PHE E CA  1 
ATOM   3263  C  C   . PHE C  3 121 ? 95.099  75.044  135.268 1.00 74.08  ?  149 PHE E C   1 
ATOM   3264  O  O   . PHE C  3 121 ? 95.385  75.857  134.384 1.00 74.08  ?  149 PHE E O   1 
ATOM   3265  C  CB  . PHE C  3 121 ? 94.918  76.110  137.518 1.00 74.08  ?  149 PHE E CB  1 
ATOM   3266  C  CG  . PHE C  3 121 ? 93.475  75.754  137.631 1.00 74.08  ?  149 PHE E CG  1 
ATOM   3267  C  CD1 . PHE C  3 121 ? 93.080  74.653  138.371 1.00 74.08  ?  149 PHE E CD1 1 
ATOM   3268  C  CD2 . PHE C  3 121 ? 92.511  76.509  136.987 1.00 74.08  ?  149 PHE E CD2 1 
ATOM   3269  C  CE1 . PHE C  3 121 ? 91.747  74.322  138.482 1.00 74.08  ?  149 PHE E CE1 1 
ATOM   3270  C  CE2 . PHE C  3 121 ? 91.179  76.177  137.084 1.00 74.08  ?  149 PHE E CE2 1 
ATOM   3271  C  CZ  . PHE C  3 121 ? 90.799  75.087  137.839 1.00 74.08  ?  149 PHE E CZ  1 
ATOM   3272  N  N   . PHE C  3 122 ? 94.237  74.045  135.090 1.00 73.80  ?  150 PHE E N   1 
ATOM   3273  C  CA  . PHE C  3 122 ? 93.497  73.842  133.854 1.00 73.80  ?  150 PHE E CA  1 
ATOM   3274  C  C   . PHE C  3 122 ? 92.004  73.917  134.134 1.00 73.80  ?  150 PHE E C   1 
ATOM   3275  O  O   . PHE C  3 122 ? 91.542  73.472  135.190 1.00 73.80  ?  150 PHE E O   1 
ATOM   3276  C  CB  . PHE C  3 122 ? 93.855  72.503  133.218 1.00 73.80  ?  150 PHE E CB  1 
ATOM   3277  C  CG  . PHE C  3 122 ? 95.247  72.455  132.675 1.00 73.80  ?  150 PHE E CG  1 
ATOM   3278  C  CD1 . PHE C  3 122 ? 95.531  72.976  131.422 1.00 73.80  ?  150 PHE E CD1 1 
ATOM   3279  C  CD2 . PHE C  3 122 ? 96.276  71.911  133.422 1.00 73.80  ?  150 PHE E CD2 1 
ATOM   3280  C  CE1 . PHE C  3 122 ? 96.816  72.941  130.916 1.00 73.80  ?  150 PHE E CE1 1 
ATOM   3281  C  CE2 . PHE C  3 122 ? 97.565  71.873  132.925 1.00 73.80  ?  150 PHE E CE2 1 
ATOM   3282  C  CZ  . PHE C  3 122 ? 97.834  72.388  131.669 1.00 73.80  ?  150 PHE E CZ  1 
ATOM   3283  N  N   . ASN C  3 123 ? 91.252  74.460  133.174 1.00 79.03  ?  151 ASN E N   1 
ATOM   3284  C  CA  . ASN C  3 123 ? 89.836  74.749  133.359 1.00 79.03  ?  151 ASN E CA  1 
ATOM   3285  C  C   . ASN C  3 123 ? 88.952  73.528  133.112 1.00 79.03  ?  151 ASN E C   1 
ATOM   3286  O  O   . ASN C  3 123 ? 87.729  73.628  133.243 1.00 79.03  ?  151 ASN E O   1 
ATOM   3287  C  CB  . ASN C  3 123 ? 89.439  75.901  132.427 1.00 79.03  ?  151 ASN E CB  1 
ATOM   3288  C  CG  . ASN C  3 123 ? 88.202  76.650  132.896 1.00 79.03  ?  151 ASN E CG  1 
ATOM   3289  O  OD1 . ASN C  3 123 ? 87.655  76.366  133.962 1.00 79.03  ?  151 ASN E OD1 1 
ATOM   3290  N  ND2 . ASN C  3 123 ? 87.753  77.611  132.093 1.00 79.03  ?  151 ASN E ND2 1 
ATOM   3291  N  N   . THR C  3 124 ? 89.529  72.383  132.768 1.00 78.15  ?  152 THR E N   1 
ATOM   3292  C  CA  . THR C  3 124 ? 88.749  71.173  132.565 1.00 78.15  ?  152 THR E CA  1 
ATOM   3293  C  C   . THR C  3 124 ? 88.865  70.288  133.804 1.00 78.15  ?  152 THR E C   1 
ATOM   3294  O  O   . THR C  3 124 ? 89.634  70.570  134.726 1.00 78.15  ?  152 THR E O   1 
ATOM   3295  C  CB  . THR C  3 124 ? 89.219  70.436  131.315 1.00 78.15  ?  152 THR E CB  1 
ATOM   3296  O  OG1 . THR C  3 124 ? 90.534  69.912  131.536 1.00 78.15  ?  152 THR E OG1 1 
ATOM   3297  C  CG2 . THR C  3 124 ? 89.265  71.390  130.128 1.00 78.15  ?  152 THR E CG2 1 
ATOM   3298  N  N   . SER C  3 125 ? 88.102  69.203  133.840 1.00 79.35  ?  153 SER E N   1 
ATOM   3299  C  CA  . SER C  3 125 ? 88.264  68.203  134.882 1.00 79.35  ?  153 SER E CA  1 
ATOM   3300  C  C   . SER C  3 125 ? 89.426  67.281  134.534 1.00 79.35  ?  153 SER E C   1 
ATOM   3301  O  O   . SER C  3 125 ? 90.035  67.386  133.466 1.00 79.35  ?  153 SER E O   1 
ATOM   3302  C  CB  . SER C  3 125 ? 86.983  67.390  135.068 1.00 79.35  ?  153 SER E CB  1 
ATOM   3303  O  OG  . SER C  3 125 ? 85.928  68.205  135.546 1.00 79.35  ?  153 SER E OG  1 
ATOM   3304  N  N   . PHE C  3 126 ? 89.733  66.378  135.455 1.00 80.48  ?  154 PHE E N   1 
ATOM   3305  C  CA  . PHE C  3 126 ? 90.826  65.442  135.231 1.00 80.48  ?  154 PHE E CA  1 
ATOM   3306  C  C   . PHE C  3 126 ? 90.409  64.410  134.188 1.00 80.48  ?  154 PHE E C   1 
ATOM   3307  O  O   . PHE C  3 126 ? 89.339  63.805  134.317 1.00 80.48  ?  154 PHE E O   1 
ATOM   3308  C  CB  . PHE C  3 126 ? 91.219  64.750  136.529 1.00 80.48  ?  154 PHE E CB  1 
ATOM   3309  C  CG  . PHE C  3 126 ? 92.430  63.882  136.400 1.00 80.48  ?  154 PHE E CG  1 
ATOM   3310  C  CD1 . PHE C  3 126 ? 93.689  64.447  136.358 1.00 80.48  ?  154 PHE E CD1 1 
ATOM   3311  C  CD2 . PHE C  3 126 ? 92.311  62.506  136.304 1.00 80.48  ?  154 PHE E CD2 1 
ATOM   3312  C  CE1 . PHE C  3 126 ? 94.813  63.661  136.234 1.00 80.48  ?  154 PHE E CE1 1 
ATOM   3313  C  CE2 . PHE C  3 126 ? 93.432  61.711  136.179 1.00 80.48  ?  154 PHE E CE2 1 
ATOM   3314  C  CZ  . PHE C  3 126 ? 94.686  62.292  136.145 1.00 80.48  ?  154 PHE E CZ  1 
ATOM   3315  N  N   . PRO C  3 127 ? 91.218  64.180  133.152 1.00 87.73  ?  155 PRO E N   1 
ATOM   3316  C  CA  . PRO C  3 127 ? 90.784  63.307  132.051 1.00 87.73  ?  155 PRO E CA  1 
ATOM   3317  C  C   . PRO C  3 127 ? 90.813  61.825  132.395 1.00 87.73  ?  155 PRO E C   1 
ATOM   3318  O  O   . PRO C  3 127 ? 91.195  61.438  133.503 1.00 87.73  ?  155 PRO E O   1 
ATOM   3319  C  CB  . PRO C  3 127 ? 91.783  63.641  130.937 1.00 87.73  ?  155 PRO E CB  1 
ATOM   3320  C  CG  . PRO C  3 127 ? 93.007  64.081  131.658 1.00 87.73  ?  155 PRO E CG  1 
ATOM   3321  C  CD  . PRO C  3 127 ? 92.532  64.792  132.892 1.00 87.73  ?  155 PRO E CD  1 
ATOM   3322  N  N   . ALA C  3 128 ? 90.409  60.986  131.447 1.00 94.15  ?  156 ALA E N   1 
ATOM   3323  C  CA  . ALA C  3 128 ? 90.398  59.549  131.655 1.00 94.15  ?  156 ALA E CA  1 
ATOM   3324  C  C   . ALA C  3 128 ? 91.786  58.966  131.415 1.00 94.15  ?  156 ALA E C   1 
ATOM   3325  O  O   . ALA C  3 128 ? 92.656  59.591  130.805 1.00 94.15  ?  156 ALA E O   1 
ATOM   3326  C  CB  . ALA C  3 128 ? 89.371  58.880  130.742 1.00 94.15  ?  156 ALA E CB  1 
ATOM   3327  N  N   . CYS C  3 129 ? 91.984  57.740  131.907 1.00 101.42 ?  157 CYS E N   1 
ATOM   3328  C  CA  . CYS C  3 129 ? 93.291  57.098  131.836 1.00 101.42 ?  157 CYS E CA  1 
ATOM   3329  C  C   . CYS C  3 129 ? 93.661  56.693  130.417 1.00 101.42 ?  157 CYS E C   1 
ATOM   3330  O  O   . CYS C  3 129 ? 94.851  56.608  130.100 1.00 101.42 ?  157 CYS E O   1 
ATOM   3331  C  CB  . CYS C  3 129 ? 93.323  55.873  132.749 1.00 101.42 ?  157 CYS E CB  1 
ATOM   3332  S  SG  . CYS C  3 129 ? 93.039  56.231  134.506 1.00 101.42 ?  157 CYS E SG  1 
ATOM   3333  N  N   . SER C  3 130 ? 92.672  56.447  129.558 1.00 100.59 ?  158 SER E N   1 
ATOM   3334  C  CA  . SER C  3 130 ? 92.947  56.161  128.157 1.00 100.59 ?  158 SER E CA  1 
ATOM   3335  C  C   . SER C  3 130 ? 93.364  57.403  127.385 1.00 100.59 ?  158 SER E C   1 
ATOM   3336  O  O   . SER C  3 130 ? 93.969  57.279  126.314 1.00 100.59 ?  158 SER E O   1 
ATOM   3337  C  CB  . SER C  3 130 ? 91.720  55.531  127.495 1.00 100.59 ?  158 SER E CB  1 
ATOM   3338  O  OG  . SER C  3 130 ? 90.643  56.450  127.438 1.00 100.59 ?  158 SER E OG  1 
ATOM   3339  N  N   . SER C  3 131 ? 93.057  58.591  127.901 1.00 99.34  ?  159 SER E N   1 
ATOM   3340  C  CA  . SER C  3 131 ? 93.445  59.845  127.276 1.00 99.34  ?  159 SER E CA  1 
ATOM   3341  C  C   . SER C  3 131 ? 94.732  60.409  127.865 1.00 99.34  ?  159 SER E C   1 
ATOM   3342  O  O   . SER C  3 131 ? 94.950  61.625  127.817 1.00 99.34  ?  159 SER E O   1 
ATOM   3343  C  CB  . SER C  3 131 ? 92.311  60.862  127.397 1.00 99.34  ?  159 SER E CB  1 
ATOM   3344  O  OG  . SER C  3 131 ? 92.058  61.172  128.755 1.00 99.34  ?  159 SER E OG  1 
ATOM   3345  N  N   . LEU C  3 132 ? 95.587  59.553  128.421 1.00 94.53  ?  160 LEU E N   1 
ATOM   3346  C  CA  . LEU C  3 132 ? 96.864  59.971  128.990 1.00 94.53  ?  160 LEU E CA  1 
ATOM   3347  C  C   . LEU C  3 132 ? 97.974  59.145  128.358 1.00 94.53  ?  160 LEU E C   1 
ATOM   3348  O  O   . LEU C  3 132 ? 98.075  57.939  128.606 1.00 94.53  ?  160 LEU E O   1 
ATOM   3349  C  CB  . LEU C  3 132 ? 96.871  59.820  130.509 1.00 94.53  ?  160 LEU E CB  1 
ATOM   3350  C  CG  . LEU C  3 132 ? 95.918  60.740  131.270 1.00 94.53  ?  160 LEU E CG  1 
ATOM   3351  C  CD1 . LEU C  3 132 ? 95.942  60.424  132.756 1.00 94.53  ?  160 LEU E CD1 1 
ATOM   3352  C  CD2 . LEU C  3 132 ? 96.269  62.196  131.016 1.00 94.53  ?  160 LEU E CD2 1 
ATOM   3353  N  N   . LYS C  3 133 ? 98.786  59.796  127.530 1.00 92.29  ?  161 LYS E N   1 
ATOM   3354  C  CA  . LYS C  3 133 ? 99.992  59.193  126.990 1.00 92.29  ?  161 LYS E CA  1 
ATOM   3355  C  C   . LYS C  3 133 ? 100.973 58.916  128.133 1.00 92.29  ?  161 LYS E C   1 
ATOM   3356  O  O   . LYS C  3 133 ? 100.987 59.645  129.128 1.00 92.29  ?  161 LYS E O   1 
ATOM   3357  C  CB  . LYS C  3 133 ? 100.605 60.140  125.955 1.00 92.29  ?  161 LYS E CB  1 
ATOM   3358  C  CG  . LYS C  3 133 ? 101.753 59.606  125.117 1.00 92.29  ?  161 LYS E CG  1 
ATOM   3359  C  CD  . LYS C  3 133 ? 102.170 60.608  124.059 1.00 92.29  ?  161 LYS E CD  1 
ATOM   3360  C  CE  . LYS C  3 133 ? 103.317 60.078  123.218 1.00 92.29  ?  161 LYS E CE  1 
ATOM   3361  N  NZ  . LYS C  3 133 ? 103.736 61.056  122.175 1.00 92.29  ?  161 LYS E NZ  1 
ATOM   3362  N  N   . PRO C  3 134 ? 101.775 57.845  128.036 1.00 91.58  ?  162 PRO E N   1 
ATOM   3363  C  CA  . PRO C  3 134 ? 102.757 57.560  129.103 1.00 91.58  ?  162 PRO E CA  1 
ATOM   3364  C  C   . PRO C  3 134 ? 103.821 58.631  129.318 1.00 91.58  ?  162 PRO E C   1 
ATOM   3365  O  O   . PRO C  3 134 ? 104.475 58.609  130.370 1.00 91.58  ?  162 PRO E O   1 
ATOM   3366  C  CB  . PRO C  3 134 ? 103.384 56.235  128.651 1.00 91.58  ?  162 PRO E CB  1 
ATOM   3367  C  CG  . PRO C  3 134 ? 102.305 55.572  127.902 1.00 91.58  ?  162 PRO E CG  1 
ATOM   3368  C  CD  . PRO C  3 134 ? 101.573 56.666  127.174 1.00 91.58  ?  162 PRO E CD  1 
ATOM   3369  N  N   . ARG C  3 135 ? 104.002 59.554  128.365 1.00 89.98  ?  163 ARG E N   1 
ATOM   3370  C  CA  . ARG C  3 135 ? 104.884 60.705  128.549 1.00 89.98  ?  163 ARG E CA  1 
ATOM   3371  C  C   . ARG C  3 135 ? 104.478 61.536  129.761 1.00 89.98  ?  163 ARG E C   1 
ATOM   3372  O  O   . ARG C  3 135 ? 105.332 62.025  130.508 1.00 89.98  ?  163 ARG E O   1 
ATOM   3373  C  CB  . ARG C  3 135 ? 104.869 61.561  127.282 1.00 89.98  ?  163 ARG E CB  1 
ATOM   3374  C  CG  . ARG C  3 135 ? 105.832 62.728  127.291 1.00 89.98  ?  163 ARG E CG  1 
ATOM   3375  C  CD  . ARG C  3 135 ? 105.756 63.495  125.984 1.00 89.98  ?  163 ARG E CD  1 
ATOM   3376  N  NE  . ARG C  3 135 ? 106.172 62.671  124.853 1.00 89.98  ?  163 ARG E NE  1 
ATOM   3377  C  CZ  . ARG C  3 135 ? 107.432 62.516  124.460 1.00 89.98  ?  163 ARG E CZ  1 
ATOM   3378  N  NH1 . ARG C  3 135 ? 108.413 63.137  125.100 1.00 89.98  ?  163 ARG E NH1 1 
ATOM   3379  N  NH2 . ARG C  3 135 ? 107.712 61.742  123.421 1.00 89.98  ?  163 ARG E NH2 1 
ATOM   3380  N  N   . GLU C  3 136 ? 103.172 61.688  129.983 1.00 90.97  ?  164 GLU E N   1 
ATOM   3381  C  CA  . GLU C  3 136 ? 102.660 62.329  131.187 1.00 90.97  ?  164 GLU E CA  1 
ATOM   3382  C  C   . GLU C  3 136 ? 102.173 61.319  132.221 1.00 90.97  ?  164 GLU E C   1 
ATOM   3383  O  O   . GLU C  3 136 ? 101.379 61.667  133.101 1.00 90.97  ?  164 GLU E O   1 
ATOM   3384  C  CB  . GLU C  3 136 ? 101.549 63.324  130.841 1.00 90.97  ?  164 GLU E CB  1 
ATOM   3385  C  CG  . GLU C  3 136 ? 100.312 62.722  130.197 1.00 90.97  ?  164 GLU E CG  1 
ATOM   3386  C  CD  . GLU C  3 136 ? 100.376 62.745  128.685 1.00 90.97  ?  164 GLU E CD  1 
ATOM   3387  O  OE1 . GLU C  3 136 ? 101.464 63.028  128.138 1.00 90.97  ?  164 GLU E OE1 1 
ATOM   3388  O  OE2 . GLU C  3 136 ? 99.342  62.469  128.041 1.00 90.97  ?  164 GLU E OE2 1 
ATOM   3389  N  N   . LEU C  3 137 ? 102.645 60.073  132.149 1.00 85.96  ?  165 LEU E N   1 
ATOM   3390  C  CA  . LEU C  3 137 ? 102.345 59.105  133.191 1.00 85.96  ?  165 LEU E CA  1 
ATOM   3391  C  C   . LEU C  3 137 ? 103.558 58.698  134.010 1.00 85.96  ?  165 LEU E C   1 
ATOM   3392  O  O   . LEU C  3 137 ? 103.432 57.820  134.870 1.00 85.96  ?  165 LEU E O   1 
ATOM   3393  C  CB  . LEU C  3 137 ? 101.702 57.841  132.602 1.00 85.96  ?  165 LEU E CB  1 
ATOM   3394  C  CG  . LEU C  3 137 ? 100.323 58.007  131.966 1.00 85.96  ?  165 LEU E CG  1 
ATOM   3395  C  CD1 . LEU C  3 137 ? 99.855  56.702  131.343 1.00 85.96  ?  165 LEU E CD1 1 
ATOM   3396  C  CD2 . LEU C  3 137 ? 99.324  58.500  132.985 1.00 85.96  ?  165 LEU E CD2 1 
ATOM   3397  N  N   . CYS C  3 138 ? 104.720 59.300  133.772 1.00 82.90  ?  166 CYS E N   1 
ATOM   3398  C  CA  . CYS C  3 138 ? 105.932 58.972  134.511 1.00 82.90  ?  166 CYS E CA  1 
ATOM   3399  C  C   . CYS C  3 138 ? 106.500 60.166  135.265 1.00 82.90  ?  166 CYS E C   1 
ATOM   3400  O  O   . CYS C  3 138 ? 106.812 60.061  136.454 1.00 82.90  ?  166 CYS E O   1 
ATOM   3401  C  CB  . CYS C  3 138 ? 106.986 58.419  133.551 1.00 82.90  ?  166 CYS E CB  1 
ATOM   3402  S  SG  . CYS C  3 138 ? 106.555 56.845  132.809 1.00 82.90  ?  166 CYS E SG  1 
ATOM   3403  N  N   . PHE C  3 139 ? 106.633 61.303  134.595 1.00 78.15  ?  167 PHE E N   1 
ATOM   3404  C  CA  . PHE C  3 139 ? 107.296 62.474  135.148 1.00 78.15  ?  167 PHE E CA  1 
ATOM   3405  C  C   . PHE C  3 139 ? 106.517 63.727  134.767 1.00 78.15  ?  167 PHE E C   1 
ATOM   3406  O  O   . PHE C  3 139 ? 105.693 63.677  133.845 1.00 78.15  ?  167 PHE E O   1 
ATOM   3407  C  CB  . PHE C  3 139 ? 108.736 62.543  134.632 1.00 78.15  ?  167 PHE E CB  1 
ATOM   3408  C  CG  . PHE C  3 139 ? 109.614 61.437  135.133 1.00 78.15  ?  167 PHE E CG  1 
ATOM   3409  C  CD1 . PHE C  3 139 ? 110.139 61.481  136.413 1.00 78.15  ?  167 PHE E CD1 1 
ATOM   3410  C  CD2 . PHE C  3 139 ? 109.926 60.362  134.319 1.00 78.15  ?  167 PHE E CD2 1 
ATOM   3411  C  CE1 . PHE C  3 139 ? 110.953 60.469  136.876 1.00 78.15  ?  167 PHE E CE1 1 
ATOM   3412  C  CE2 . PHE C  3 139 ? 110.739 59.346  134.774 1.00 78.15  ?  167 PHE E CE2 1 
ATOM   3413  C  CZ  . PHE C  3 139 ? 111.253 59.400  136.057 1.00 78.15  ?  167 PHE E CZ  1 
ATOM   3414  N  N   . PRO C  3 140 ? 106.725 64.858  135.441 1.00 75.48  ?  168 PRO E N   1 
ATOM   3415  C  CA  . PRO C  3 140 ? 106.106 66.109  134.986 1.00 75.48  ?  168 PRO E CA  1 
ATOM   3416  C  C   . PRO C  3 140 ? 106.741 66.616  133.698 1.00 75.48  ?  168 PRO E C   1 
ATOM   3417  O  O   . PRO C  3 140 ? 107.722 66.071  133.186 1.00 75.48  ?  168 PRO E O   1 
ATOM   3418  C  CB  . PRO C  3 140 ? 106.361 67.077  136.144 1.00 75.48  ?  168 PRO E CB  1 
ATOM   3419  C  CG  . PRO C  3 140 ? 106.560 66.206  137.324 1.00 75.48  ?  168 PRO E CG  1 
ATOM   3420  C  CD  . PRO C  3 140 ? 107.263 64.995  136.807 1.00 75.48  ?  168 PRO E CD  1 
ATOM   3421  N  N   . GLU C  3 141 ? 106.151 67.691  133.170 1.00 74.22  ?  169 GLU E N   1 
ATOM   3422  C  CA  . GLU C  3 141 ? 106.721 68.341  131.996 1.00 74.22  ?  169 GLU E CA  1 
ATOM   3423  C  C   . GLU C  3 141 ? 108.036 69.026  132.334 1.00 74.22  ?  169 GLU E C   1 
ATOM   3424  O  O   . GLU C  3 141 ? 109.038 68.839  131.636 1.00 74.22  ?  169 GLU E O   1 
ATOM   3425  C  CB  . GLU C  3 141 ? 105.739 69.354  131.408 1.00 74.22  ?  169 GLU E CB  1 
ATOM   3426  C  CG  . GLU C  3 141 ? 106.283 70.054  130.166 1.00 74.22  ?  169 GLU E CG  1 
ATOM   3427  C  CD  . GLU C  3 141 ? 105.307 71.044  129.561 1.00 74.22  ?  169 GLU E CD  1 
ATOM   3428  O  OE1 . GLU C  3 141 ? 104.190 71.193  130.099 1.00 74.22  ?  169 GLU E OE1 1 
ATOM   3429  O  OE2 . GLU C  3 141 ? 105.663 71.684  128.549 1.00 74.22  ?  169 GLU E OE2 1 
ATOM   3430  N  N   . THR C  3 142 ? 108.051 69.821  133.399 1.00 69.09  ?  170 THR E N   1 
ATOM   3431  C  CA  . THR C  3 142 ? 109.283 70.454  133.860 1.00 69.09  ?  170 THR E CA  1 
ATOM   3432  C  C   . THR C  3 142 ? 110.131 69.408  134.562 1.00 69.09  ?  170 THR E C   1 
ATOM   3433  O  O   . THR C  3 142 ? 109.773 68.923  135.638 1.00 69.09  ?  170 THR E O   1 
ATOM   3434  C  CB  . THR C  3 142 ? 108.983 71.625  134.786 1.00 69.09  ?  170 THR E CB  1 
ATOM   3435  O  OG1 . THR C  3 142 ? 108.235 72.616  134.074 1.00 69.09  ?  170 THR E OG1 1 
ATOM   3436  C  CG2 . THR C  3 142 ? 110.279 72.238  135.273 1.00 69.09  ?  170 THR E CG2 1 
ATOM   3437  N  N   . ARG C  3 143 ? 111.248 69.037  133.939 1.00 66.52  ?  171 ARG E N   1 
ATOM   3438  C  CA  . ARG C  3 143 ? 112.158 68.096  134.564 1.00 66.52  ?  171 ARG E CA  1 
ATOM   3439  C  C   . ARG C  3 143 ? 112.823 68.758  135.767 1.00 66.52  ?  171 ARG E C   1 
ATOM   3440  O  O   . ARG C  3 143 ? 113.082 69.964  135.754 1.00 66.52  ?  171 ARG E O   1 
ATOM   3441  C  CB  . ARG C  3 143 ? 113.205 67.592  133.563 1.00 66.52  ?  171 ARG E CB  1 
ATOM   3442  C  CG  . ARG C  3 143 ? 114.046 68.644  132.835 1.00 66.52  ?  171 ARG E CG  1 
ATOM   3443  C  CD  . ARG C  3 143 ? 115.370 68.969  133.525 1.00 66.52  ?  171 ARG E CD  1 
ATOM   3444  N  NE  . ARG C  3 143 ? 116.244 69.765  132.674 1.00 66.52  ?  171 ARG E NE  1 
ATOM   3445  C  CZ  . ARG C  3 143 ? 117.310 70.428  133.108 1.00 66.52  ?  171 ARG E CZ  1 
ATOM   3446  N  NH1 . ARG C  3 143 ? 117.621 70.418  134.396 1.00 66.52  ?  171 ARG E NH1 1 
ATOM   3447  N  NH2 . ARG C  3 143 ? 118.050 71.123  132.255 1.00 66.52  ?  171 ARG E NH2 1 
ATOM   3448  N  N   . PRO C  3 144 ? 113.087 68.002  136.825 1.00 56.53  ?  172 PRO E N   1 
ATOM   3449  C  CA  . PRO C  3 144 ? 113.737 68.588  137.995 1.00 56.53  ?  172 PRO E CA  1 
ATOM   3450  C  C   . PRO C  3 144 ? 115.197 68.914  137.726 1.00 56.53  ?  172 PRO E C   1 
ATOM   3451  O  O   . PRO C  3 144 ? 115.820 68.413  136.789 1.00 56.53  ?  172 PRO E O   1 
ATOM   3452  C  CB  . PRO C  3 144 ? 113.596 67.499  139.057 1.00 56.53  ?  172 PRO E CB  1 
ATOM   3453  C  CG  . PRO C  3 144 ? 113.462 66.242  138.290 1.00 56.53  ?  172 PRO E CG  1 
ATOM   3454  C  CD  . PRO C  3 144 ? 112.707 66.598  137.053 1.00 56.53  ?  172 PRO E CD  1 
ATOM   3455  N  N   . SER C  3 145 ? 115.732 69.794  138.565 1.00 56.88  ?  173 SER E N   1 
ATOM   3456  C  CA  . SER C  3 145 ? 117.144 70.157  138.512 1.00 56.88  ?  173 SER E CA  1 
ATOM   3457  C  C   . SER C  3 145 ? 117.603 70.289  139.953 1.00 56.88  ?  173 SER E C   1 
ATOM   3458  O  O   . SER C  3 145 ? 117.191 71.219  140.650 1.00 56.88  ?  173 SER E O   1 
ATOM   3459  C  CB  . SER C  3 145 ? 117.358 71.452  137.738 1.00 56.88  ?  173 SER E CB  1 
ATOM   3460  O  OG  . SER C  3 145 ? 116.762 72.546  138.410 1.00 56.88  ?  173 SER E OG  1 
ATOM   3461  N  N   . PHE C  3 146 ? 118.443 69.366  140.396 1.00 49.56  ?  174 PHE E N   1 
ATOM   3462  C  CA  . PHE C  3 146 ? 118.682 69.194  141.817 1.00 49.56  ?  174 PHE E CA  1 
ATOM   3463  C  C   . PHE C  3 146 ? 119.898 69.970  142.287 1.00 49.56  ?  174 PHE E C   1 
ATOM   3464  O  O   . PHE C  3 146 ? 120.638 70.554  141.494 1.00 49.56  ?  174 PHE E O   1 
ATOM   3465  C  CB  . PHE C  3 146 ? 118.831 67.718  142.145 1.00 49.56  ?  174 PHE E CB  1 
ATOM   3466  C  CG  . PHE C  3 146 ? 117.580 66.954  141.934 1.00 49.56  ?  174 PHE E CG  1 
ATOM   3467  C  CD1 . PHE C  3 146 ? 116.565 67.023  142.860 1.00 49.56  ?  174 PHE E CD1 1 
ATOM   3468  C  CD2 . PHE C  3 146 ? 117.397 66.203  140.794 1.00 49.56  ?  174 PHE E CD2 1 
ATOM   3469  C  CE1 . PHE C  3 146 ? 115.403 66.330  142.671 1.00 49.56  ?  174 PHE E CE1 1 
ATOM   3470  C  CE2 . PHE C  3 146 ? 116.235 65.512  140.597 1.00 49.56  ?  174 PHE E CE2 1 
ATOM   3471  C  CZ  . PHE C  3 146 ? 115.240 65.574  141.537 1.00 49.56  ?  174 PHE E CZ  1 
ATOM   3472  N  N   . ARG C  3 147 ? 120.088 69.977  143.600 1.00 48.09  ?  175 ARG E N   1 
ATOM   3473  C  CA  . ARG C  3 147 ? 120.942 70.949  144.262 1.00 48.09  ?  175 ARG E CA  1 
ATOM   3474  C  C   . ARG C  3 147 ? 121.384 70.396  145.608 1.00 48.09  ?  175 ARG E C   1 
ATOM   3475  O  O   . ARG C  3 147 ? 120.606 70.399  146.565 1.00 48.09  ?  175 ARG E O   1 
ATOM   3476  C  CB  . ARG C  3 147 ? 120.174 72.249  144.412 1.00 48.09  ?  175 ARG E CB  1 
ATOM   3477  C  CG  . ARG C  3 147 ? 120.925 73.347  145.045 1.00 48.09  ?  175 ARG E CG  1 
ATOM   3478  C  CD  . ARG C  3 147 ? 120.114 74.609  144.954 1.00 48.09  ?  175 ARG E CD  1 
ATOM   3479  N  NE  . ARG C  3 147 ? 120.015 75.125  143.599 1.00 48.09  ?  175 ARG E NE  1 
ATOM   3480  C  CZ  . ARG C  3 147 ? 119.303 76.193  143.274 1.00 48.09  ?  175 ARG E CZ  1 
ATOM   3481  N  NH1 . ARG C  3 147 ? 118.649 76.853  144.216 1.00 48.09  ?  175 ARG E NH1 1 
ATOM   3482  N  NH2 . ARG C  3 147 ? 119.260 76.611  142.018 1.00 48.09  ?  175 ARG E NH2 1 
ATOM   3483  N  N   . ILE C  3 148 ? 122.625 69.925  145.686 1.00 52.06  ?  176 ILE E N   1 
ATOM   3484  C  CA  . ILE C  3 148 ? 123.167 69.298  146.885 1.00 52.06  ?  176 ILE E CA  1 
ATOM   3485  C  C   . ILE C  3 148 ? 124.421 70.054  147.306 1.00 52.06  ?  176 ILE E C   1 
ATOM   3486  O  O   . ILE C  3 148 ? 125.236 70.435  146.460 1.00 52.06  ?  176 ILE E O   1 
ATOM   3487  C  CB  . ILE C  3 148 ? 123.478 67.806  146.633 1.00 52.06  ?  176 ILE E CB  1 
ATOM   3488  C  CG1 . ILE C  3 148 ? 122.216 67.065  146.217 1.00 52.06  ?  176 ILE E CG1 1 
ATOM   3489  C  CG2 . ILE C  3 148 ? 124.043 67.127  147.865 1.00 52.06  ?  176 ILE E CG2 1 
ATOM   3490  C  CD1 . ILE C  3 148 ? 122.468 65.662  145.781 1.00 52.06  ?  176 ILE E CD1 1 
ATOM   3491  N  N   . ARG C  3 149 ? 124.566 70.301  148.606 1.00 56.05  ?  177 ARG E N   1 
ATOM   3492  C  CA  . ARG C  3 149 ? 125.811 70.829  149.142 1.00 56.05  ?  177 ARG E CA  1 
ATOM   3493  C  C   . ARG C  3 149 ? 126.801 69.696  149.374 1.00 56.05  ?  177 ARG E C   1 
ATOM   3494  O  O   . ARG C  3 149 ? 126.423 68.588  149.762 1.00 56.05  ?  177 ARG E O   1 
ATOM   3495  C  CB  . ARG C  3 149 ? 125.578 71.571  150.457 1.00 56.05  ?  177 ARG E CB  1 
ATOM   3496  C  CG  . ARG C  3 149 ? 124.749 72.830  150.343 1.00 56.05  ?  177 ARG E CG  1 
ATOM   3497  C  CD  . ARG C  3 149 ? 124.699 73.552  151.678 1.00 56.05  ?  177 ARG E CD  1 
ATOM   3498  N  NE  . ARG C  3 149 ? 123.803 74.702  151.653 1.00 56.05  ?  177 ARG E NE  1 
ATOM   3499  C  CZ  . ARG C  3 149 ? 124.153 75.916  151.243 1.00 56.05  ?  177 ARG E CZ  1 
ATOM   3500  N  NH1 . ARG C  3 149 ? 125.382 76.145  150.805 1.00 56.05  ?  177 ARG E NH1 1 
ATOM   3501  N  NH2 . ARG C  3 149 ? 123.269 76.901  151.261 1.00 56.05  ?  177 ARG E NH2 1 
ATOM   3502  N  N   . GLU C  3 150 ? 128.081 69.982  149.144 1.00 59.29  ?  178 GLU E N   1 
ATOM   3503  C  CA  . GLU C  3 150 ? 129.100 68.966  149.352 1.00 59.29  ?  178 GLU E CA  1 
ATOM   3504  C  C   . GLU C  3 150 ? 129.405 68.809  150.837 1.00 59.29  ?  178 GLU E C   1 
ATOM   3505  O  O   . GLU C  3 150 ? 129.093 69.679  151.656 1.00 59.29  ?  178 GLU E O   1 
ATOM   3506  C  CB  . GLU C  3 150 ? 130.388 69.312  148.611 1.00 59.29  ?  178 GLU E CB  1 
ATOM   3507  C  CG  . GLU C  3 150 ? 131.148 70.472  149.215 1.00 59.29  ?  178 GLU E CG  1 
ATOM   3508  C  CD  . GLU C  3 150 ? 132.464 70.726  148.520 1.00 59.29  ?  178 GLU E CD  1 
ATOM   3509  O  OE1 . GLU C  3 150 ? 132.743 70.052  147.510 1.00 59.29  ?  178 GLU E OE1 1 
ATOM   3510  O  OE2 . GLU C  3 150 ? 133.238 71.576  149.002 1.00 59.29  ?  178 GLU E OE2 1 
ATOM   3511  N  N   . ASN C  3 151 ? 130.029 67.673  151.168 1.00 63.61  ?  179 ASN E N   1 
ATOM   3512  C  CA  . ASN C  3 151 ? 130.506 67.318  152.508 1.00 63.61  ?  179 ASN E CA  1 
ATOM   3513  C  C   . ASN C  3 151 ? 129.403 67.349  153.563 1.00 63.61  ?  179 ASN E C   1 
ATOM   3514  O  O   . ASN C  3 151 ? 129.636 67.779  154.696 1.00 63.61  ?  179 ASN E O   1 
ATOM   3515  C  CB  . ASN C  3 151 ? 131.678 68.208  152.942 1.00 63.61  ?  179 ASN E CB  1 
ATOM   3516  C  CG  . ASN C  3 151 ? 132.906 68.011  152.081 1.00 63.61  ?  179 ASN E CG  1 
ATOM   3517  O  OD1 . ASN C  3 151 ? 133.347 68.925  151.384 1.00 63.61  ?  179 ASN E OD1 1 
ATOM   3518  N  ND2 . ASN C  3 151 ? 133.462 66.810  152.119 1.00 63.61  ?  179 ASN E ND2 1 
ATOM   3519  N  N   . ARG C  3 152 ? 128.204 66.905  153.212 1.00 65.15  ?  180 ARG E N   1 
ATOM   3520  C  CA  . ARG C  3 152 ? 127.058 66.896  154.103 1.00 65.15  ?  180 ARG E CA  1 
ATOM   3521  C  C   . ARG C  3 152 ? 126.563 65.468  154.310 1.00 65.15  ?  180 ARG E C   1 
ATOM   3522  O  O   . ARG C  3 152 ? 126.875 64.602  153.485 1.00 65.15  ?  180 ARG E O   1 
ATOM   3523  C  CB  . ARG C  3 152 ? 125.943 67.774  153.523 1.00 65.15  ?  180 ARG E CB  1 
ATOM   3524  C  CG  . ARG C  3 152 ? 126.346 69.230  153.474 1.00 65.15  ?  180 ARG E CG  1 
ATOM   3525  C  CD  . ARG C  3 152 ? 126.544 69.769  154.881 1.00 65.15  ?  180 ARG E CD  1 
ATOM   3526  N  NE  . ARG C  3 152 ? 126.870 71.191  154.892 1.00 65.15  ?  180 ARG E NE  1 
ATOM   3527  C  CZ  . ARG C  3 152 ? 128.109 71.670  154.908 1.00 65.15  ?  180 ARG E CZ  1 
ATOM   3528  N  NH1 . ARG C  3 152 ? 129.141 70.839  154.925 1.00 65.15  ?  180 ARG E NH1 1 
ATOM   3529  N  NH2 . ARG C  3 152 ? 128.316 72.979  154.916 1.00 65.15  ?  180 ARG E NH2 1 
ATOM   3530  N  N   . PRO C  3 153 ? 125.857 65.172  155.408 1.00 66.70  ?  181 PRO E N   1 
ATOM   3531  C  CA  . PRO C  3 153 ? 125.369 63.800  155.641 1.00 66.70  ?  181 PRO E CA  1 
ATOM   3532  C  C   . PRO C  3 153 ? 124.391 63.361  154.566 1.00 66.70  ?  181 PRO E C   1 
ATOM   3533  O  O   . PRO C  3 153 ? 123.646 64.188  154.019 1.00 66.70  ?  181 PRO E O   1 
ATOM   3534  C  CB  . PRO C  3 153 ? 124.682 63.899  157.010 1.00 66.70  ?  181 PRO E CB  1 
ATOM   3535  C  CG  . PRO C  3 153 ? 125.363 65.013  157.681 1.00 66.70  ?  181 PRO E CG  1 
ATOM   3536  C  CD  . PRO C  3 153 ? 125.668 66.009  156.610 1.00 66.70  ?  181 PRO E CD  1 
ATOM   3537  N  N   . PRO C  3 154 ? 124.385 62.074  154.219 1.00 66.49  ?  182 PRO E N   1 
ATOM   3538  C  CA  . PRO C  3 154 ? 123.584 61.619  153.077 1.00 66.49  ?  182 PRO E CA  1 
ATOM   3539  C  C   . PRO C  3 154 ? 122.099 61.603  153.395 1.00 66.49  ?  182 PRO E C   1 
ATOM   3540  O  O   . PRO C  3 154 ? 121.692 61.469  154.550 1.00 66.49  ?  182 PRO E O   1 
ATOM   3541  C  CB  . PRO C  3 154 ? 124.113 60.205  152.824 1.00 66.49  ?  182 PRO E CB  1 
ATOM   3542  C  CG  . PRO C  3 154 ? 124.603 59.756  154.146 1.00 66.49  ?  182 PRO E CG  1 
ATOM   3543  C  CD  . PRO C  3 154 ? 125.163 60.974  154.816 1.00 66.49  ?  182 PRO E CD  1 
ATOM   3544  N  N   . GLY C  3 155 ? 121.286 61.745  152.351 1.00 62.50  ?  183 GLY E N   1 
ATOM   3545  C  CA  . GLY C  3 155 ? 119.850 61.788  152.530 1.00 62.50  ?  183 GLY E CA  1 
ATOM   3546  C  C   . GLY C  3 155 ? 119.057 61.201  151.383 1.00 62.50  ?  183 GLY E C   1 
ATOM   3547  O  O   . GLY C  3 155 ? 119.428 60.169  150.820 1.00 62.50  ?  183 GLY E O   1 
ATOM   3548  N  N   . THR C  3 156 ? 117.963 61.868  151.027 1.00 61.77  ?  184 THR E N   1 
ATOM   3549  C  CA  . THR C  3 156 ? 117.003 61.404  150.034 1.00 61.77  ?  184 THR E CA  1 
ATOM   3550  C  C   . THR C  3 156 ? 116.291 62.615  149.459 1.00 61.77  ?  184 THR E C   1 
ATOM   3551  O  O   . THR C  3 156 ? 115.716 63.400  150.217 1.00 61.77  ?  184 THR E O   1 
ATOM   3552  C  CB  . THR C  3 156 ? 115.982 60.458  150.665 1.00 61.77  ?  184 THR E CB  1 
ATOM   3553  O  OG1 . THR C  3 156 ? 116.611 59.221  151.024 1.00 61.77  ?  184 THR E OG1 1 
ATOM   3554  C  CG2 . THR C  3 156 ? 114.840 60.220  149.727 1.00 61.77  ?  184 THR E CG2 1 
ATOM   3555  N  N   . PHE C  3 157 ? 116.309 62.775  148.135 1.00 56.09  ?  185 PHE E N   1 
ATOM   3556  C  CA  . PHE C  3 157 ? 115.862 64.040  147.565 1.00 56.09  ?  185 PHE E CA  1 
ATOM   3557  C  C   . PHE C  3 157 ? 114.722 63.920  146.554 1.00 56.09  ?  185 PHE E C   1 
ATOM   3558  O  O   . PHE C  3 157 ? 113.934 64.860  146.414 1.00 56.09  ?  185 PHE E O   1 
ATOM   3559  C  CB  . PHE C  3 157 ? 117.059 64.804  146.973 1.00 56.09  ?  185 PHE E CB  1 
ATOM   3560  C  CG  . PHE C  3 157 ? 117.818 64.075  145.902 1.00 56.09  ?  185 PHE E CG  1 
ATOM   3561  C  CD1 . PHE C  3 157 ? 118.913 63.298  146.215 1.00 56.09  ?  185 PHE E CD1 1 
ATOM   3562  C  CD2 . PHE C  3 157 ? 117.476 64.227  144.574 1.00 56.09  ?  185 PHE E CD2 1 
ATOM   3563  C  CE1 . PHE C  3 157 ? 119.627 62.653  145.224 1.00 56.09  ?  185 PHE E CE1 1 
ATOM   3564  C  CE2 . PHE C  3 157 ? 118.184 63.593  143.579 1.00 56.09  ?  185 PHE E CE2 1 
ATOM   3565  C  CZ  . PHE C  3 157 ? 119.260 62.805  143.903 1.00 56.09  ?  185 PHE E CZ  1 
ATOM   3566  N  N   . HIS C  3 158 ? 114.603 62.805  145.847 1.00 58.68  ?  186 HIS E N   1 
ATOM   3567  C  CA  . HIS C  3 158 ? 113.561 62.724  144.832 1.00 58.68  ?  186 HIS E CA  1 
ATOM   3568  C  C   . HIS C  3 158 ? 112.707 61.470  144.992 1.00 58.68  ?  186 HIS E C   1 
ATOM   3569  O  O   . HIS C  3 158 ? 113.170 60.418  145.438 1.00 58.68  ?  186 HIS E O   1 
ATOM   3570  C  CB  . HIS C  3 158 ? 114.173 62.770  143.432 1.00 58.68  ?  186 HIS E CB  1 
ATOM   3571  C  CG  . HIS C  3 158 ? 113.165 62.896  142.334 1.00 58.68  ?  186 HIS E CG  1 
ATOM   3572  N  ND1 . HIS C  3 158 ? 112.419 64.037  142.140 1.00 58.68  ?  186 HIS E ND1 1 
ATOM   3573  C  CD2 . HIS C  3 158 ? 112.793 62.035  141.360 1.00 58.68  ?  186 HIS E CD2 1 
ATOM   3574  C  CE1 . HIS C  3 158 ? 111.623 63.870  141.099 1.00 58.68  ?  186 HIS E CE1 1 
ATOM   3575  N  NE2 . HIS C  3 158 ? 111.831 62.663  140.607 1.00 58.68  ?  186 HIS E NE2 1 
ATOM   3576  N  N   . GLN C  3 159 ? 111.437 61.605  144.618 1.00 63.18  ?  187 GLN E N   1 
ATOM   3577  C  CA  . GLN C  3 159 ? 110.476 60.517  144.630 1.00 63.18  ?  187 GLN E CA  1 
ATOM   3578  C  C   . GLN C  3 159 ? 109.752 60.513  143.290 1.00 63.18  ?  187 GLN E C   1 
ATOM   3579  O  O   . GLN C  3 159 ? 109.495 61.565  142.703 1.00 63.18  ?  187 GLN E O   1 
ATOM   3580  C  CB  . GLN C  3 159 ? 109.494 60.671  145.796 1.00 63.18  ?  187 GLN E CB  1 
ATOM   3581  C  CG  . GLN C  3 159 ? 108.691 59.432  146.126 1.00 63.18  ?  187 GLN E CG  1 
ATOM   3582  C  CD  . GLN C  3 159 ? 107.420 59.323  145.323 1.00 63.18  ?  187 GLN E CD  1 
ATOM   3583  O  OE1 . GLN C  3 159 ? 106.839 60.327  144.920 1.00 63.18  ?  187 GLN E OE1 1 
ATOM   3584  N  NE2 . GLN C  3 159 ? 106.981 58.096  145.081 1.00 63.18  ?  187 GLN E NE2 1 
ATOM   3585  N  N   . PHE C  3 160 ? 109.415 59.318  142.806 1.00 68.94  ?  188 PHE E N   1 
ATOM   3586  C  CA  . PHE C  3 160 ? 109.027 59.141  141.413 1.00 68.94  ?  188 PHE E CA  1 
ATOM   3587  C  C   . PHE C  3 160 ? 107.536 59.244  141.118 1.00 68.94  ?  188 PHE E C   1 
ATOM   3588  O  O   . PHE C  3 160 ? 107.183 59.705  140.028 1.00 68.94  ?  188 PHE E O   1 
ATOM   3589  C  CB  . PHE C  3 160 ? 109.518 57.784  140.896 1.00 68.94  ?  188 PHE E CB  1 
ATOM   3590  C  CG  . PHE C  3 160 ? 110.990 57.724  140.655 1.00 68.94  ?  188 PHE E CG  1 
ATOM   3591  C  CD1 . PHE C  3 160 ? 111.534 58.276  139.508 1.00 68.94  ?  188 PHE E CD1 1 
ATOM   3592  C  CD2 . PHE C  3 160 ? 111.827 57.101  141.558 1.00 68.94  ?  188 PHE E CD2 1 
ATOM   3593  C  CE1 . PHE C  3 160 ? 112.887 58.222  139.269 1.00 68.94  ?  188 PHE E CE1 1 
ATOM   3594  C  CE2 . PHE C  3 160 ? 113.182 57.039  141.324 1.00 68.94  ?  188 PHE E CE2 1 
ATOM   3595  C  CZ  . PHE C  3 160 ? 113.713 57.603  140.178 1.00 68.94  ?  188 PHE E CZ  1 
ATOM   3596  N  N   . ARG C  3 161 ? 106.658 58.815  142.024 1.00 73.39  ?  189 ARG E N   1 
ATOM   3597  C  CA  . ARG C  3 161 ? 105.252 58.588  141.694 1.00 73.39  ?  189 ARG E CA  1 
ATOM   3598  C  C   . ARG C  3 161 ? 104.511 59.903  141.488 1.00 73.39  ?  189 ARG E C   1 
ATOM   3599  O  O   . ARG C  3 161 ? 104.469 60.748  142.388 1.00 73.39  ?  189 ARG E O   1 
ATOM   3600  C  CB  . ARG C  3 161 ? 104.560 57.781  142.790 1.00 73.39  ?  189 ARG E CB  1 
ATOM   3601  C  CG  . ARG C  3 161 ? 105.013 56.350  142.900 1.00 73.39  ?  189 ARG E CG  1 
ATOM   3602  C  CD  . ARG C  3 161 ? 104.326 55.671  144.063 1.00 73.39  ?  189 ARG E CD  1 
ATOM   3603  N  NE  . ARG C  3 161 ? 104.803 54.308  144.262 1.00 73.39  ?  189 ARG E NE  1 
ATOM   3604  C  CZ  . ARG C  3 161 ? 104.423 53.527  145.266 1.00 73.39  ?  189 ARG E CZ  1 
ATOM   3605  N  NH1 . ARG C  3 161 ? 103.559 53.974  146.166 1.00 73.39  ?  189 ARG E NH1 1 
ATOM   3606  N  NH2 . ARG C  3 161 ? 104.909 52.298  145.373 1.00 73.39  ?  189 ARG E NH2 1 
ATOM   3607  N  N   . LEU C  3 162 ? 103.919 60.068  140.305 1.00 72.94  ?  190 LEU E N   1 
ATOM   3608  C  CA  . LEU C  3 162 ? 102.969 61.148  140.085 1.00 72.94  ?  190 LEU E CA  1 
ATOM   3609  C  C   . LEU C  3 162 ? 101.696 60.829  140.852 1.00 72.94  ?  190 LEU E C   1 
ATOM   3610  O  O   . LEU C  3 162 ? 100.898 59.998  140.410 1.00 72.94  ?  190 LEU E O   1 
ATOM   3611  C  CB  . LEU C  3 162 ? 102.676 61.327  138.598 1.00 72.94  ?  190 LEU E CB  1 
ATOM   3612  C  CG  . LEU C  3 162 ? 103.859 61.766  137.745 1.00 72.94  ?  190 LEU E CG  1 
ATOM   3613  C  CD1 . LEU C  3 162 ? 103.466 61.820  136.286 1.00 72.94  ?  190 LEU E CD1 1 
ATOM   3614  C  CD2 . LEU C  3 162 ? 104.349 63.110  138.214 1.00 72.94  ?  190 LEU E CD2 1 
ATOM   3615  N  N   . LEU C  3 163 ? 101.511 61.468  142.006 1.00 69.95  ?  191 LEU E N   1 
ATOM   3616  C  CA  . LEU C  3 163 ? 100.465 61.120  142.967 1.00 69.95  ?  191 LEU E CA  1 
ATOM   3617  C  C   . LEU C  3 163 ? 99.018  61.240  142.465 1.00 69.95  ?  191 LEU E C   1 
ATOM   3618  O  O   . LEU C  3 163 ? 98.225  60.338  142.773 1.00 69.95  ?  191 LEU E O   1 
ATOM   3619  C  CB  . LEU C  3 163 ? 100.656 61.937  144.250 1.00 69.95  ?  191 LEU E CB  1 
ATOM   3620  C  CG  . LEU C  3 163 ? 101.960 61.658  144.999 1.00 69.95  ?  191 LEU E CG  1 
ATOM   3621  C  CD1 . LEU C  3 163 ? 102.104 62.578  146.201 1.00 69.95  ?  191 LEU E CD1 1 
ATOM   3622  C  CD2 . LEU C  3 163 ? 102.044 60.204  145.422 1.00 69.95  ?  191 LEU E CD2 1 
ATOM   3623  N  N   . PRO C  3 164 ? 98.604  62.276  141.705 1.00 71.11  ?  192 PRO E N   1 
ATOM   3624  C  CA  . PRO C  3 164 ? 97.230  62.235  141.172 1.00 71.11  ?  192 PRO E CA  1 
ATOM   3625  C  C   . PRO C  3 164 ? 97.016  61.166  140.116 1.00 71.11  ?  192 PRO E C   1 
ATOM   3626  O  O   . PRO C  3 164 ? 95.880  60.710  139.943 1.00 71.11  ?  192 PRO E O   1 
ATOM   3627  C  CB  . PRO C  3 164 ? 97.029  63.640  140.588 1.00 71.11  ?  192 PRO E CB  1 
ATOM   3628  C  CG  . PRO C  3 164 ? 97.996  64.477  141.278 1.00 71.11  ?  192 PRO E CG  1 
ATOM   3629  C  CD  . PRO C  3 164 ? 99.187  63.612  141.457 1.00 71.11  ?  192 PRO E CD  1 
ATOM   3630  N  N   . VAL C  3 165 ? 98.073  60.740  139.423 1.00 72.84  ?  193 VAL E N   1 
ATOM   3631  C  CA  . VAL C  3 165 ? 97.929  59.686  138.424 1.00 72.84  ?  193 VAL E CA  1 
ATOM   3632  C  C   . VAL C  3 165 ? 97.641  58.346  139.087 1.00 72.84  ?  193 VAL E C   1 
ATOM   3633  O  O   . VAL C  3 165 ? 96.664  57.674  138.739 1.00 72.84  ?  193 VAL E O   1 
ATOM   3634  C  CB  . VAL C  3 165 ? 99.176  59.628  137.526 1.00 72.84  ?  193 VAL E CB  1 
ATOM   3635  C  CG1 . VAL C  3 165 ? 99.170  58.369  136.694 1.00 72.84  ?  193 VAL E CG1 1 
ATOM   3636  C  CG2 . VAL C  3 165 ? 99.203  60.839  136.617 1.00 72.84  ?  193 VAL E CG2 1 
ATOM   3637  N  N   . GLN C  3 166 ? 98.457  57.945  140.069 1.00 72.10  ?  194 GLN E N   1 
ATOM   3638  C  CA  . GLN C  3 166 ? 98.171  56.688  140.753 1.00 72.10  ?  194 GLN E CA  1 
ATOM   3639  C  C   . GLN C  3 166 ? 96.965  56.800  141.675 1.00 72.10  ?  194 GLN E C   1 
ATOM   3640  O  O   . GLN C  3 166 ? 96.395  55.772  142.053 1.00 72.10  ?  194 GLN E O   1 
ATOM   3641  C  CB  . GLN C  3 166 ? 99.367  56.189  141.566 1.00 72.10  ?  194 GLN E CB  1 
ATOM   3642  C  CG  . GLN C  3 166 ? 99.667  56.967  142.833 1.00 72.10  ?  194 GLN E CG  1 
ATOM   3643  C  CD  . GLN C  3 166 ? 100.703 56.267  143.689 1.00 72.10  ?  194 GLN E CD  1 
ATOM   3644  O  OE1 . GLN C  3 166 ? 101.143 55.164  143.369 1.00 72.10  ?  194 GLN E OE1 1 
ATOM   3645  N  NE2 . GLN C  3 166 ? 101.086 56.895  144.793 1.00 72.10  ?  194 GLN E NE2 1 
ATOM   3646  N  N   . PHE C  3 167 ? 96.564  58.015  142.045 1.00 75.94  ?  195 PHE E N   1 
ATOM   3647  C  CA  . PHE C  3 167 ? 95.309  58.174  142.758 1.00 75.94  ?  195 PHE E CA  1 
ATOM   3648  C  C   . PHE C  3 167 ? 94.102  58.057  141.837 1.00 75.94  ?  195 PHE E C   1 
ATOM   3649  O  O   . PHE C  3 167 ? 93.030  57.649  142.295 1.00 75.94  ?  195 PHE E O   1 
ATOM   3650  C  CB  . PHE C  3 167 ? 95.289  59.521  143.480 1.00 75.94  ?  195 PHE E CB  1 
ATOM   3651  C  CG  . PHE C  3 167 ? 94.076  59.733  144.327 1.00 75.94  ?  195 PHE E CG  1 
ATOM   3652  C  CD1 . PHE C  3 167 ? 93.934  59.061  145.528 1.00 75.94  ?  195 PHE E CD1 1 
ATOM   3653  C  CD2 . PHE C  3 167 ? 93.081  60.607  143.927 1.00 75.94  ?  195 PHE E CD2 1 
ATOM   3654  C  CE1 . PHE C  3 167 ? 92.818  59.252  146.315 1.00 75.94  ?  195 PHE E CE1 1 
ATOM   3655  C  CE2 . PHE C  3 167 ? 91.961  60.804  144.708 1.00 75.94  ?  195 PHE E CE2 1 
ATOM   3656  C  CZ  . PHE C  3 167 ? 91.830  60.125  145.904 1.00 75.94  ?  195 PHE E CZ  1 
ATOM   3657  N  N   . LEU C  3 168 ? 94.251  58.381  140.548 1.00 80.19  ?  196 LEU E N   1 
ATOM   3658  C  CA  . LEU C  3 168 ? 93.104  58.389  139.647 1.00 80.19  ?  196 LEU E CA  1 
ATOM   3659  C  C   . LEU C  3 168 ? 93.300  57.469  138.443 1.00 80.19  ?  196 LEU E C   1 
ATOM   3660  O  O   . LEU C  3 168 ? 92.543  57.551  137.470 1.00 80.19  ?  196 LEU E O   1 
ATOM   3661  C  CB  . LEU C  3 168 ? 92.792  59.814  139.185 1.00 80.19  ?  196 LEU E CB  1 
ATOM   3662  C  CG  . LEU C  3 168 ? 92.276  60.715  140.310 1.00 80.19  ?  196 LEU E CG  1 
ATOM   3663  C  CD1 . LEU C  3 168 ? 92.134  62.159  139.867 1.00 80.19  ?  196 LEU E CD1 1 
ATOM   3664  C  CD2 . LEU C  3 168 ? 90.950  60.185  140.831 1.00 80.19  ?  196 LEU E CD2 1 
ATOM   3665  N  N   . CYS C  3 169 ? 94.298  56.586  138.492 1.00 87.32  ?  197 CYS E N   1 
ATOM   3666  C  CA  . CYS C  3 169 ? 94.405  55.449  137.580 1.00 87.32  ?  197 CYS E CA  1 
ATOM   3667  C  C   . CYS C  3 169 ? 94.892  54.243  138.376 1.00 87.32  ?  197 CYS E C   1 
ATOM   3668  O  O   . CYS C  3 169 ? 96.056  53.845  138.246 1.00 87.32  ?  197 CYS E O   1 
ATOM   3669  C  CB  . CYS C  3 169 ? 95.355  55.736  136.413 1.00 87.32  ?  197 CYS E CB  1 
ATOM   3670  S  SG  . CYS C  3 169 ? 94.798  56.969  135.204 1.00 87.32  ?  197 CYS E SG  1 
ATOM   3671  N  N   . PRO C  3 170 ? 94.034  53.631  139.200 1.00 90.12  ?  198 PRO E N   1 
ATOM   3672  C  CA  . PRO C  3 170 ? 94.523  52.680  140.210 1.00 90.12  ?  198 PRO E CA  1 
ATOM   3673  C  C   . PRO C  3 170 ? 94.919  51.314  139.674 1.00 90.12  ?  198 PRO E C   1 
ATOM   3674  O  O   . PRO C  3 170 ? 95.600  50.569  140.392 1.00 90.12  ?  198 PRO E O   1 
ATOM   3675  C  CB  . PRO C  3 170 ? 93.332  52.557  141.166 1.00 90.12  ?  198 PRO E CB  1 
ATOM   3676  C  CG  . PRO C  3 170 ? 92.149  52.797  140.294 1.00 90.12  ?  198 PRO E CG  1 
ATOM   3677  C  CD  . PRO C  3 170 ? 92.574  53.813  139.274 1.00 90.12  ?  198 PRO E CD  1 
ATOM   3678  N  N   . ASN C  3 171 ? 94.522  50.952  138.457 1.00 94.26  ?  199 ASN E N   1 
ATOM   3679  C  CA  . ASN C  3 171 ? 94.817  49.631  137.903 1.00 94.26  ?  199 ASN E CA  1 
ATOM   3680  C  C   . ASN C  3 171 ? 96.003  49.659  136.947 1.00 94.26  ?  199 ASN E C   1 
ATOM   3681  O  O   . ASN C  3 171 ? 96.033  48.922  135.959 1.00 94.26  ?  199 ASN E O   1 
ATOM   3682  C  CB  . ASN C  3 171 ? 93.583  49.057  137.213 1.00 94.26  ?  199 ASN E CB  1 
ATOM   3683  C  CG  . ASN C  3 171 ? 92.521  48.606  138.198 1.00 94.26  ?  199 ASN E CG  1 
ATOM   3684  O  OD1 . ASN C  3 171 ? 92.823  47.980  139.214 1.00 94.26  ?  199 ASN E OD1 1 
ATOM   3685  N  ND2 . ASN C  3 171 ? 91.267  48.925  137.902 1.00 94.26  ?  199 ASN E ND2 1 
ATOM   3686  N  N   . ILE C  3 172 ? 96.994  50.505  137.219 1.00 95.97  ?  200 ILE E N   1 
ATOM   3687  C  CA  . ILE C  3 172 ? 98.210  50.590  136.420 1.00 95.97  ?  200 ILE E CA  1 
ATOM   3688  C  C   . ILE C  3 172 ? 99.408  50.433  137.346 1.00 95.97  ?  200 ILE E C   1 
ATOM   3689  O  O   . ILE C  3 172 ? 99.538  51.160  138.337 1.00 95.97  ?  200 ILE E O   1 
ATOM   3690  C  CB  . ILE C  3 172 ? 98.297  51.923  135.642 1.00 95.97  ?  200 ILE E CB  1 
ATOM   3691  C  CG1 . ILE C  3 172 ? 97.153  52.039  134.635 1.00 95.97  ?  200 ILE E CG1 1 
ATOM   3692  C  CG2 . ILE C  3 172 ? 99.628  52.044  134.923 1.00 95.97  ?  200 ILE E CG2 1 
ATOM   3693  C  CD1 . ILE C  3 172 ? 97.041  53.404  134.004 1.00 95.97  ?  200 ILE E CD1 1 
ATOM   3694  N  N   . SER C  3 173 ? 100.280 49.481  137.028 1.00 96.67  ?  201 SER E N   1 
ATOM   3695  C  CA  . SER C  3 173 ? 101.513 49.262  137.768 1.00 96.67  ?  201 SER E CA  1 
ATOM   3696  C  C   . SER C  3 173 ? 102.671 49.870  136.991 1.00 96.67  ?  201 SER E C   1 
ATOM   3697  O  O   . SER C  3 173 ? 102.863 49.561  135.811 1.00 96.67  ?  201 SER E O   1 
ATOM   3698  C  CB  . SER C  3 173 ? 101.756 47.770  138.008 1.00 96.67  ?  201 SER E CB  1 
ATOM   3699  O  OG  . SER C  3 173 ? 101.996 47.090  136.789 1.00 96.67  ?  201 SER E OG  1 
ATOM   3700  N  N   . VAL C  3 174 ? 103.430 50.741  137.652 1.00 91.60  ?  202 VAL E N   1 
ATOM   3701  C  CA  . VAL C  3 174 ? 104.530 51.476  137.037 1.00 91.60  ?  202 VAL E CA  1 
ATOM   3702  C  C   . VAL C  3 174 ? 105.803 51.176  137.819 1.00 91.60  ?  202 VAL E C   1 
ATOM   3703  O  O   . VAL C  3 174 ? 105.808 51.226  139.054 1.00 91.60  ?  202 VAL E O   1 
ATOM   3704  C  CB  . VAL C  3 174 ? 104.235 52.990  137.009 1.00 91.60  ?  202 VAL E CB  1 
ATOM   3705  C  CG1 . VAL C  3 174 ? 105.383 53.750  136.409 1.00 91.60  ?  202 VAL E CG1 1 
ATOM   3706  C  CG2 . VAL C  3 174 ? 102.966 53.282  136.229 1.00 91.60  ?  202 VAL E CG2 1 
ATOM   3707  N  N   . ALA C  3 175 ? 106.880 50.856  137.101 1.00 87.03  ?  203 ALA E N   1 
ATOM   3708  C  CA  . ALA C  3 175 ? 108.160 50.514  137.708 1.00 87.03  ?  203 ALA E CA  1 
ATOM   3709  C  C   . ALA C  3 175 ? 109.197 51.571  137.356 1.00 87.03  ?  203 ALA E C   1 
ATOM   3710  O  O   . ALA C  3 175 ? 109.163 52.141  136.262 1.00 87.03  ?  203 ALA E O   1 
ATOM   3711  C  CB  . ALA C  3 175 ? 108.635 49.134  137.250 1.00 87.03  ?  203 ALA E CB  1 
ATOM   3712  N  N   . TYR C  3 176 ? 110.114 51.833  138.286 1.00 80.16  ?  204 TYR E N   1 
ATOM   3713  C  CA  . TYR C  3 176 ? 111.149 52.847  138.117 1.00 80.16  ?  204 TYR E CA  1 
ATOM   3714  C  C   . TYR C  3 176 ? 112.504 52.264  138.485 1.00 80.16  ?  204 TYR E C   1 
ATOM   3715  O  O   . TYR C  3 176 ? 112.645 51.652  139.549 1.00 80.16  ?  204 TYR E O   1 
ATOM   3716  C  CB  . TYR C  3 176 ? 110.868 54.070  138.993 1.00 80.16  ?  204 TYR E CB  1 
ATOM   3717  C  CG  . TYR C  3 176 ? 109.676 54.899  138.581 1.00 80.16  ?  204 TYR E CG  1 
ATOM   3718  C  CD1 . TYR C  3 176 ? 109.782 55.850  137.576 1.00 80.16  ?  204 TYR E CD1 1 
ATOM   3719  C  CD2 . TYR C  3 176 ? 108.449 54.742  139.208 1.00 80.16  ?  204 TYR E CD2 1 
ATOM   3720  C  CE1 . TYR C  3 176 ? 108.700 56.621  137.208 1.00 80.16  ?  204 TYR E CE1 1 
ATOM   3721  C  CE2 . TYR C  3 176 ? 107.361 55.509  138.846 1.00 80.16  ?  204 TYR E CE2 1 
ATOM   3722  C  CZ  . TYR C  3 176 ? 107.492 56.444  137.840 1.00 80.16  ?  204 TYR E CZ  1 
ATOM   3723  O  OH  . TYR C  3 176 ? 106.417 57.214  137.465 1.00 80.16  ?  204 TYR E OH  1 
ATOM   3724  N  N   . ARG C  3 177 ? 113.502 52.468  137.622 1.00 81.94  ?  205 ARG E N   1 
ATOM   3725  C  CA  . ARG C  3 177 ? 114.866 52.049  137.928 1.00 81.94  ?  205 ARG E CA  1 
ATOM   3726  C  C   . ARG C  3 177 ? 115.863 53.082  137.421 1.00 81.94  ?  205 ARG E C   1 
ATOM   3727  O  O   . ARG C  3 177 ? 115.668 53.695  136.370 1.00 81.94  ?  205 ARG E O   1 
ATOM   3728  C  CB  . ARG C  3 177 ? 115.212 50.683  137.321 1.00 81.94  ?  205 ARG E CB  1 
ATOM   3729  C  CG  . ARG C  3 177 ? 114.580 49.489  138.015 1.00 81.94  ?  205 ARG E CG  1 
ATOM   3730  C  CD  . ARG C  3 177 ? 115.141 48.187  137.483 1.00 81.94  ?  205 ARG E CD  1 
ATOM   3731  N  NE  . ARG C  3 177 ? 114.834 48.011  136.068 1.00 81.94  ?  205 ARG E NE  1 
ATOM   3732  C  CZ  . ARG C  3 177 ? 113.720 47.451  135.612 1.00 81.94  ?  205 ARG E CZ  1 
ATOM   3733  N  NH1 . ARG C  3 177 ? 112.803 47.009  136.460 1.00 81.94  ?  205 ARG E NH1 1 
ATOM   3734  N  NH2 . ARG C  3 177 ? 113.522 47.333  134.306 1.00 81.94  ?  205 ARG E NH2 1 
ATOM   3735  N  N   . LEU C  3 178 ? 116.944 53.256  138.174 1.00 82.20  ?  206 LEU E N   1 
ATOM   3736  C  CA  . LEU C  3 178 ? 118.047 54.081  137.706 1.00 82.20  ?  206 LEU E CA  1 
ATOM   3737  C  C   . LEU C  3 178 ? 118.853 53.338  136.648 1.00 82.20  ?  206 LEU E C   1 
ATOM   3738  O  O   . LEU C  3 178 ? 118.891 52.106  136.615 1.00 82.20  ?  206 LEU E O   1 
ATOM   3739  C  CB  . LEU C  3 178 ? 118.955 54.478  138.869 1.00 82.20  ?  206 LEU E CB  1 
ATOM   3740  C  CG  . LEU C  3 178 ? 118.391 55.498  139.853 1.00 82.20  ?  206 LEU E CG  1 
ATOM   3741  C  CD1 . LEU C  3 178 ? 119.310 55.652  141.049 1.00 82.20  ?  206 LEU E CD1 1 
ATOM   3742  C  CD2 . LEU C  3 178 ? 118.223 56.825  139.146 1.00 82.20  ?  206 LEU E CD2 1 
ATOM   3743  N  N   . LEU C  3 179 ? 119.500 54.102  135.776 1.00 79.88  ?  207 LEU E N   1 
ATOM   3744  C  CA  . LEU C  3 179 ? 120.310 53.514  134.718 1.00 79.88  ?  207 LEU E CA  1 
ATOM   3745  C  C   . LEU C  3 179 ? 121.650 53.067  135.292 1.00 79.88  ?  207 LEU E C   1 
ATOM   3746  O  O   . LEU C  3 179 ? 122.535 53.885  135.531 1.00 79.88  ?  207 LEU E O   1 
ATOM   3747  C  CB  . LEU C  3 179 ? 120.501 54.513  133.571 1.00 79.88  ?  207 LEU E CB  1 
ATOM   3748  C  CG  . LEU C  3 179 ? 121.093 54.075  132.227 1.00 79.88  ?  207 LEU E CG  1 
ATOM   3749  C  CD1 . LEU C  3 179 ? 120.449 54.879  131.115 1.00 79.88  ?  207 LEU E CD1 1 
ATOM   3750  C  CD2 . LEU C  3 179 ? 122.604 54.261  132.169 1.00 79.88  ?  207 LEU E CD2 1 
ATOM   3751  N  N   . GLY C  3 183 ? 128.381 52.043  141.072 1.00 85.50  ?  211 GLY E N   1 
ATOM   3752  C  CA  . GLY C  3 183 ? 129.544 52.902  141.203 1.00 85.50  ?  211 GLY E CA  1 
ATOM   3753  C  C   . GLY C  3 183 ? 129.193 54.316  141.619 1.00 85.50  ?  211 GLY E C   1 
ATOM   3754  O  O   . GLY C  3 183 ? 129.789 54.864  142.546 1.00 85.50  ?  211 GLY E O   1 
ATOM   3755  N  N   . LEU C  3 184 ? 128.227 54.906  140.920 1.00 81.88  ?  212 LEU E N   1 
ATOM   3756  C  CA  . LEU C  3 184 ? 127.762 56.243  141.260 1.00 81.88  ?  212 LEU E CA  1 
ATOM   3757  C  C   . LEU C  3 184 ? 126.978 56.203  142.572 1.00 81.88  ?  212 LEU E C   1 
ATOM   3758  O  O   . LEU C  3 184 ? 126.276 55.223  142.844 1.00 81.88  ?  212 LEU E O   1 
ATOM   3759  C  CB  . LEU C  3 184 ? 126.903 56.801  140.126 1.00 81.88  ?  212 LEU E CB  1 
ATOM   3760  C  CG  . LEU C  3 184 ? 127.707 57.079  138.856 1.00 81.88  ?  212 LEU E CG  1 
ATOM   3761  C  CD1 . LEU C  3 184 ? 126.812 57.491  137.708 1.00 81.88  ?  212 LEU E CD1 1 
ATOM   3762  C  CD2 . LEU C  3 184 ? 128.754 58.145  139.122 1.00 81.88  ?  212 LEU E CD2 1 
ATOM   3763  N  N   . PRO C  3 185 ? 127.072 57.256  143.411 1.00 75.16  ?  213 PRO E N   1 
ATOM   3764  C  CA  . PRO C  3 185 ? 126.565 57.153  144.790 1.00 75.16  ?  213 PRO E CA  1 
ATOM   3765  C  C   . PRO C  3 185 ? 125.052 57.185  144.940 1.00 75.16  ?  213 PRO E C   1 
ATOM   3766  O  O   . PRO C  3 185 ? 124.546 57.117  146.063 1.00 75.16  ?  213 PRO E O   1 
ATOM   3767  C  CB  . PRO C  3 185 ? 127.195 58.369  145.477 1.00 75.16  ?  213 PRO E CB  1 
ATOM   3768  C  CG  . PRO C  3 185 ? 127.407 59.338  144.390 1.00 75.16  ?  213 PRO E CG  1 
ATOM   3769  C  CD  . PRO C  3 185 ? 127.756 58.539  143.178 1.00 75.16  ?  213 PRO E CD  1 
ATOM   3770  N  N   . PHE C  3 186 ? 124.322 57.285  143.839 1.00 73.74  ?  214 PHE E N   1 
ATOM   3771  C  CA  . PHE C  3 186 ? 122.872 57.377  143.874 1.00 73.74  ?  214 PHE E CA  1 
ATOM   3772  C  C   . PHE C  3 186 ? 122.251 55.992  143.739 1.00 73.74  ?  214 PHE E C   1 
ATOM   3773  O  O   . PHE C  3 186 ? 122.620 55.204  142.866 1.00 73.74  ?  214 PHE E O   1 
ATOM   3774  C  CB  . PHE C  3 186 ? 122.377 58.291  142.756 1.00 73.74  ?  214 PHE E CB  1 
ATOM   3775  C  CG  . PHE C  3 186 ? 122.902 59.694  142.850 1.00 73.74  ?  214 PHE E CG  1 
ATOM   3776  C  CD1 . PHE C  3 186 ? 122.333 60.604  143.724 1.00 73.74  ?  214 PHE E CD1 1 
ATOM   3777  C  CD2 . PHE C  3 186 ? 123.977 60.098  142.073 1.00 73.74  ?  214 PHE E CD2 1 
ATOM   3778  C  CE1 . PHE C  3 186 ? 122.818 61.891  143.815 1.00 73.74  ?  214 PHE E CE1 1 
ATOM   3779  C  CE2 . PHE C  3 186 ? 124.463 61.384  142.156 1.00 73.74  ?  214 PHE E CE2 1 
ATOM   3780  C  CZ  . PHE C  3 186 ? 123.884 62.281  143.031 1.00 73.74  ?  214 PHE E CZ  1 
ATOM   3781  N  N   . ARG C  3 187 ? 121.292 55.701  144.617 1.00 77.51  ?  215 ARG E N   1 
ATOM   3782  C  CA  . ARG C  3 187 ? 120.635 54.400  144.601 1.00 77.51  ?  215 ARG E CA  1 
ATOM   3783  C  C   . ARG C  3 187 ? 119.130 54.582  144.736 1.00 77.51  ?  215 ARG E C   1 
ATOM   3784  O  O   . ARG C  3 187 ? 118.664 55.503  145.415 1.00 77.51  ?  215 ARG E O   1 
ATOM   3785  C  CB  . ARG C  3 187 ? 121.177 53.483  145.707 1.00 77.51  ?  215 ARG E CB  1 
ATOM   3786  C  CG  . ARG C  3 187 ? 120.898 53.927  147.131 1.00 77.51  ?  215 ARG E CG  1 
ATOM   3787  C  CD  . ARG C  3 187 ? 121.504 52.965  148.141 1.00 77.51  ?  215 ARG E CD  1 
ATOM   3788  N  NE  . ARG C  3 187 ? 120.892 51.641  148.082 1.00 77.51  ?  215 ARG E NE  1 
ATOM   3789  C  CZ  . ARG C  3 187 ? 119.792 51.291  148.742 1.00 77.51  ?  215 ARG E CZ  1 
ATOM   3790  N  NH1 . ARG C  3 187 ? 119.176 52.166  149.524 1.00 77.51  ?  215 ARG E NH1 1 
ATOM   3791  N  NH2 . ARG C  3 187 ? 119.309 50.062  148.624 1.00 77.51  ?  215 ARG E NH2 1 
ATOM   3792  N  N   . CYS C  3 188 ? 118.376 53.714  144.064 1.00 81.93  ?  216 CYS E N   1 
ATOM   3793  C  CA  . CYS C  3 188 ? 116.914 53.764  144.054 1.00 81.93  ?  216 CYS E CA  1 
ATOM   3794  C  C   . CYS C  3 188 ? 116.384 52.503  144.726 1.00 81.93  ?  216 CYS E C   1 
ATOM   3795  O  O   . CYS C  3 188 ? 116.380 51.419  144.143 1.00 81.93  ?  216 CYS E O   1 
ATOM   3796  C  CB  . CYS C  3 188 ? 116.387 53.899  142.632 1.00 81.93  ?  216 CYS E CB  1 
ATOM   3797  S  SG  . CYS C  3 188 ? 114.592 53.980  142.523 1.00 81.93  ?  216 CYS E SG  1 
ATOM   3798  N  N   . ALA C  3 189 ? 115.931 52.650  145.965 1.00 90.53  ?  217 ALA E N   1 
ATOM   3799  C  CA  . ALA C  3 189 ? 115.368 51.518  146.683 1.00 90.53  ?  217 ALA E CA  1 
ATOM   3800  C  C   . ALA C  3 189 ? 113.948 51.239  146.194 1.00 90.53  ?  217 ALA E C   1 
ATOM   3801  O  O   . ALA C  3 189 ? 113.085 52.119  146.262 1.00 90.53  ?  217 ALA E O   1 
ATOM   3802  C  CB  . ALA C  3 189 ? 115.360 51.786  148.186 1.00 90.53  ?  217 ALA E CB  1 
ATOM   3803  N  N   . PRO C  3 190 ? 113.675 50.037  145.698 1.00 95.18  ?  218 PRO E N   1 
ATOM   3804  C  CA  . PRO C  3 190 ? 112.331 49.707  145.221 1.00 95.18  ?  218 PRO E CA  1 
ATOM   3805  C  C   . PRO C  3 190 ? 111.351 49.534  146.377 1.00 95.18  ?  218 PRO E C   1 
ATOM   3806  O  O   . PRO C  3 190 ? 111.740 49.403  147.540 1.00 95.18  ?  218 PRO E O   1 
ATOM   3807  C  CB  . PRO C  3 190 ? 112.541 48.384  144.475 1.00 95.18  ?  218 PRO E CB  1 
ATOM   3808  C  CG  . PRO C  3 190 ? 113.720 47.773  145.137 1.00 95.18  ?  218 PRO E CG  1 
ATOM   3809  C  CD  . PRO C  3 190 ? 114.614 48.915  145.524 1.00 95.18  ?  218 PRO E CD  1 
ATOM   3810  N  N   . ASP C  3 191 ? 110.061 49.599  146.026 1.00 96.36  ?  219 ASP E N   1 
ATOM   3811  C  CA  . ASP C  3 191 ? 108.861 49.526  146.870 1.00 96.36  ?  219 ASP E CA  1 
ATOM   3812  C  C   . ASP C  3 191 ? 108.690 50.734  147.789 1.00 96.36  ?  219 ASP E C   1 
ATOM   3813  O  O   . ASP C  3 191 ? 107.670 50.829  148.483 1.00 96.36  ?  219 ASP E O   1 
ATOM   3814  C  CB  . ASP C  3 191 ? 108.794 48.237  147.705 1.00 96.36  ?  219 ASP E CB  1 
ATOM   3815  C  CG  . ASP C  3 191 ? 108.600 47.004  146.849 1.00 96.36  ?  219 ASP E CG  1 
ATOM   3816  O  OD1 . ASP C  3 191 ? 107.973 47.118  145.775 1.00 96.36  ?  219 ASP E OD1 1 
ATOM   3817  O  OD2 . ASP C  3 191 ? 109.082 45.923  147.243 1.00 96.36  ?  219 ASP E OD2 1 
ATOM   3818  N  N   . SER C  3 192 ? 109.651 51.658  147.819 1.00 93.53  ?  220 SER E N   1 
ATOM   3819  C  CA  . SER C  3 192 ? 109.454 52.992  148.376 1.00 93.53  ?  220 SER E CA  1 
ATOM   3820  C  C   . SER C  3 192 ? 110.343 53.894  147.522 1.00 93.53  ?  220 SER E C   1 
ATOM   3821  O  O   . SER C  3 192 ? 111.525 54.067  147.830 1.00 93.53  ?  220 SER E O   1 
ATOM   3822  C  CB  . SER C  3 192 ? 109.827 53.052  149.848 1.00 93.53  ?  220 SER E CB  1 
ATOM   3823  O  OG  . SER C  3 192 ? 111.217 52.844  150.031 1.00 93.53  ?  220 SER E OG  1 
ATOM   3824  N  N   . LEU C  3 193 ? 109.761 54.470  146.472 1.00 79.20  ?  221 LEU E N   1 
ATOM   3825  C  CA  . LEU C  3 193 ? 110.514 54.930  145.305 1.00 79.20  ?  221 LEU E CA  1 
ATOM   3826  C  C   . LEU C  3 193 ? 111.315 56.192  145.562 1.00 79.20  ?  221 LEU E C   1 
ATOM   3827  O  O   . LEU C  3 193 ? 111.018 57.258  145.018 1.00 79.20  ?  221 LEU E O   1 
ATOM   3828  C  CB  . LEU C  3 193 ? 109.555 55.119  144.139 1.00 79.20  ?  221 LEU E CB  1 
ATOM   3829  C  CG  . LEU C  3 193 ? 108.952 53.783  143.715 1.00 79.20  ?  221 LEU E CG  1 
ATOM   3830  C  CD1 . LEU C  3 193 ? 107.875 53.979  142.679 1.00 79.20  ?  221 LEU E CD1 1 
ATOM   3831  C  CD2 . LEU C  3 193 ? 110.040 52.864  143.189 1.00 79.20  ?  221 LEU E CD2 1 
ATOM   3832  N  N   . GLU C  3 194 ? 112.356 56.085  146.376 1.00 76.83  ?  222 GLU E N   1 
ATOM   3833  C  CA  . GLU C  3 194 ? 113.190 57.223  146.709 1.00 76.83  ?  222 GLU E CA  1 
ATOM   3834  C  C   . GLU C  3 194 ? 114.546 57.119  146.023 1.00 76.83  ?  222 GLU E C   1 
ATOM   3835  O  O   . GLU C  3 194 ? 114.996 56.026  145.672 1.00 76.83  ?  222 GLU E O   1 
ATOM   3836  C  CB  . GLU C  3 194 ? 113.372 57.298  148.220 1.00 76.83  ?  222 GLU E CB  1 
ATOM   3837  C  CG  . GLU C  3 194 ? 112.119 57.684  148.984 1.00 76.83  ?  222 GLU E CG  1 
ATOM   3838  C  CD  . GLU C  3 194 ? 112.361 57.786  150.476 1.00 76.83  ?  222 GLU E CD  1 
ATOM   3839  O  OE1 . GLU C  3 194 ? 113.467 57.424  150.927 1.00 76.83  ?  222 GLU E OE1 1 
ATOM   3840  O  OE2 . GLU C  3 194 ? 111.449 58.234  151.200 1.00 76.83  ?  222 GLU E OE2 1 
ATOM   3841  N  N   . VAL C  3 195 ? 115.192 58.266  145.824 1.00 65.79  ?  223 VAL E N   1 
ATOM   3842  C  CA  . VAL C  3 195 ? 116.564 58.335  145.328 1.00 65.79  ?  223 VAL E CA  1 
ATOM   3843  C  C   . VAL C  3 195 ? 117.433 58.822  146.478 1.00 65.79  ?  223 VAL E C   1 
ATOM   3844  O  O   . VAL C  3 195 ? 117.290 59.962  146.934 1.00 65.79  ?  223 VAL E O   1 
ATOM   3845  C  CB  . VAL C  3 195 ? 116.697 59.259  144.113 1.00 65.79  ?  223 VAL E CB  1 
ATOM   3846  C  CG1 . VAL C  3 195 ? 118.146 59.354  143.699 1.00 65.79  ?  223 VAL E CG1 1 
ATOM   3847  C  CG2 . VAL C  3 195 ? 115.861 58.755  142.970 1.00 65.79  ?  223 VAL E CG2 1 
ATOM   3848  N  N   . SER C  3 196 ? 118.331 57.967  146.953 1.00 71.36  ?  224 SER E N   1 
ATOM   3849  C  CA  . SER C  3 196 ? 119.143 58.276  148.117 1.00 71.36  ?  224 SER E CA  1 
ATOM   3850  C  C   . SER C  3 196 ? 120.626 58.199  147.763 1.00 71.36  ?  224 SER E C   1 
ATOM   3851  O  O   . SER C  3 196 ? 121.009 57.739  146.681 1.00 71.36  ?  224 SER E O   1 
ATOM   3852  C  CB  . SER C  3 196 ? 118.776 57.337  149.269 1.00 71.36  ?  224 SER E CB  1 
ATOM   3853  O  OG  . SER C  3 196 ? 119.093 55.995  148.961 1.00 71.36  ?  224 SER E OG  1 
ATOM   3854  N  N   . THR C  3 197 ? 121.466 58.661  148.686 1.00 75.35  ?  225 THR E N   1 
ATOM   3855  C  CA  . THR C  3 197 ? 122.911 58.650  148.512 1.00 75.35  ?  225 THR E CA  1 
ATOM   3856  C  C   . THR C  3 197 ? 123.545 57.852  149.641 1.00 75.35  ?  225 THR E C   1 
ATOM   3857  O  O   . THR C  3 197 ? 123.053 57.872  150.773 1.00 75.35  ?  225 THR E O   1 
ATOM   3858  C  CB  . THR C  3 197 ? 123.490 60.073  148.488 1.00 75.35  ?  225 THR E CB  1 
ATOM   3859  O  OG1 . THR C  3 197 ? 123.170 60.745  149.712 1.00 75.35  ?  225 THR E OG1 1 
ATOM   3860  C  CG2 . THR C  3 197 ? 122.924 60.866  147.325 1.00 75.35  ?  225 THR E CG2 1 
ATOM   3861  N  N   . ARG C  3 198 ? 124.623 57.133  149.328 1.00 78.28  ?  226 ARG E N   1 
ATOM   3862  C  CA  . ARG C  3 198 ? 125.328 56.368  150.358 1.00 78.28  ?  226 ARG E CA  1 
ATOM   3863  C  C   . ARG C  3 198 ? 126.328 57.245  151.108 1.00 78.28  ?  226 ARG E C   1 
ATOM   3864  O  O   . ARG C  3 198 ? 126.208 57.450  152.319 1.00 78.28  ?  226 ARG E O   1 
ATOM   3865  C  CB  . ARG C  3 198 ? 126.032 55.162  149.730 1.00 78.28  ?  226 ARG E CB  1 
ATOM   3866  C  CG  . ARG C  3 198 ? 125.102 54.098  149.188 1.00 78.28  ?  226 ARG E CG  1 
ATOM   3867  C  CD  . ARG C  3 198 ? 125.896 52.942  148.603 1.00 78.28  ?  226 ARG E CD  1 
ATOM   3868  N  NE  . ARG C  3 198 ? 125.030 51.893  148.079 1.00 78.28  ?  226 ARG E NE  1 
ATOM   3869  C  CZ  . ARG C  3 198 ? 124.594 51.844  146.825 1.00 78.28  ?  226 ARG E CZ  1 
ATOM   3870  N  NH1 . ARG C  3 198 ? 124.942 52.790  145.963 1.00 78.28  ?  226 ARG E NH1 1 
ATOM   3871  N  NH2 . ARG C  3 198 ? 123.806 50.852  146.434 1.00 78.28  ?  226 ARG E NH2 1 
ATOM   3872  N  N   . TRP C  3 199 ? 127.318 57.771  150.397 1.00 75.39  ?  227 TRP E N   1 
ATOM   3873  C  CA  . TRP C  3 199 ? 128.369 58.577  150.996 1.00 75.39  ?  227 TRP E CA  1 
ATOM   3874  C  C   . TRP C  3 199 ? 128.236 60.037  150.578 1.00 75.39  ?  227 TRP E C   1 
ATOM   3875  O  O   . TRP C  3 199 ? 127.537 60.379  149.622 1.00 75.39  ?  227 TRP E O   1 
ATOM   3876  C  CB  . TRP C  3 199 ? 129.750 58.032  150.614 1.00 75.39  ?  227 TRP E CB  1 
ATOM   3877  C  CG  . TRP C  3 199 ? 130.009 57.972  149.136 1.00 75.39  ?  227 TRP E CG  1 
ATOM   3878  C  CD1 . TRP C  3 199 ? 130.483 58.976  148.347 1.00 75.39  ?  227 TRP E CD1 1 
ATOM   3879  C  CD2 . TRP C  3 199 ? 129.838 56.838  148.280 1.00 75.39  ?  227 TRP E CD2 1 
ATOM   3880  N  NE1 . TRP C  3 199 ? 130.602 58.546  147.050 1.00 75.39  ?  227 TRP E NE1 1 
ATOM   3881  C  CE2 . TRP C  3 199 ? 130.214 57.235  146.982 1.00 75.39  ?  227 TRP E CE2 1 
ATOM   3882  C  CE3 . TRP C  3 199 ? 129.399 55.528  148.483 1.00 75.39  ?  227 TRP E CE3 1 
ATOM   3883  C  CZ2 . TRP C  3 199 ? 130.164 56.369  145.893 1.00 75.39  ?  227 TRP E CZ2 1 
ATOM   3884  C  CZ3 . TRP C  3 199 ? 129.346 54.670  147.399 1.00 75.39  ?  227 TRP E CZ3 1 
ATOM   3885  C  CH2 . TRP C  3 199 ? 129.727 55.094  146.121 1.00 75.39  ?  227 TRP E CH2 1 
ATOM   3886  N  N   . ALA C  3 200 ? 128.930 60.899  151.316 1.00 70.86  ?  228 ALA E N   1 
ATOM   3887  C  CA  . ALA C  3 200 ? 128.904 62.330  151.061 1.00 70.86  ?  228 ALA E CA  1 
ATOM   3888  C  C   . ALA C  3 200 ? 129.634 62.651  149.758 1.00 70.86  ?  228 ALA E C   1 
ATOM   3889  O  O   . ALA C  3 200 ? 130.530 61.928  149.319 1.00 70.86  ?  228 ALA E O   1 
ATOM   3890  C  CB  . ALA C  3 200 ? 129.527 63.083  152.232 1.00 70.86  ?  228 ALA E CB  1 
ATOM   3891  N  N   . LEU C  3 201 ? 129.249 63.758  149.135 1.00 63.53  ?  229 LEU E N   1 
ATOM   3892  C  CA  . LEU C  3 201 ? 129.797 64.168  147.853 1.00 63.53  ?  229 LEU E CA  1 
ATOM   3893  C  C   . LEU C  3 201 ? 130.900 65.198  148.037 1.00 63.53  ?  229 LEU E C   1 
ATOM   3894  O  O   . LEU C  3 201 ? 130.958 65.901  149.049 1.00 63.53  ?  229 LEU E O   1 
ATOM   3895  C  CB  . LEU C  3 201 ? 128.708 64.747  146.950 1.00 63.53  ?  229 LEU E CB  1 
ATOM   3896  C  CG  . LEU C  3 201 ? 127.693 63.740  146.425 1.00 63.53  ?  229 LEU E CG  1 
ATOM   3897  C  CD1 . LEU C  3 201 ? 126.540 64.445  145.754 1.00 63.53  ?  229 LEU E CD1 1 
ATOM   3898  C  CD2 . LEU C  3 201 ? 128.378 62.813  145.448 1.00 63.53  ?  229 LEU E CD2 1 
ATOM   3899  N  N   . ASP C  3 202 ? 131.778 65.274  147.041 1.00 63.28  ?  230 ASP E N   1 
ATOM   3900  C  CA  . ASP C  3 202 ? 132.820 66.286  146.965 1.00 63.28  ?  230 ASP E CA  1 
ATOM   3901  C  C   . ASP C  3 202 ? 132.814 66.861  145.559 1.00 63.28  ?  230 ASP E C   1 
ATOM   3902  O  O   . ASP C  3 202 ? 132.902 66.113  144.580 1.00 63.28  ?  230 ASP E O   1 
ATOM   3903  C  CB  . ASP C  3 202 ? 134.194 65.694  147.303 1.00 63.28  ?  230 ASP E CB  1 
ATOM   3904  C  CG  . ASP C  3 202 ? 135.266 66.758  147.540 1.00 63.28  ?  230 ASP E CG  1 
ATOM   3905  O  OD1 . ASP C  3 202 ? 134.985 67.970  147.416 1.00 63.28  ?  230 ASP E OD1 1 
ATOM   3906  O  OD2 . ASP C  3 202 ? 136.405 66.372  147.871 1.00 63.28  ?  230 ASP E OD2 1 
ATOM   3907  N  N   . ARG C  3 203 ? 132.701 68.188  145.461 1.00 59.93  ?  231 ARG E N   1 
ATOM   3908  C  CA  . ARG C  3 203 ? 132.790 68.833  144.157 1.00 59.93  ?  231 ARG E CA  1 
ATOM   3909  C  C   . ARG C  3 203 ? 134.199 68.717  143.596 1.00 59.93  ?  231 ARG E C   1 
ATOM   3910  O  O   . ARG C  3 203 ? 134.386 68.661  142.376 1.00 59.93  ?  231 ARG E O   1 
ATOM   3911  C  CB  . ARG C  3 203 ? 132.383 70.302  144.260 1.00 59.93  ?  231 ARG E CB  1 
ATOM   3912  C  CG  . ARG C  3 203 ? 132.252 70.996  142.915 1.00 59.93  ?  231 ARG E CG  1 
ATOM   3913  C  CD  . ARG C  3 203 ? 132.117 72.486  143.050 1.00 59.93  ?  231 ARG E CD  1 
ATOM   3914  N  NE  . ARG C  3 203 ? 133.325 73.067  143.606 1.00 59.93  ?  231 ARG E NE  1 
ATOM   3915  C  CZ  . ARG C  3 203 ? 134.398 73.399  142.901 1.00 59.93  ?  231 ARG E CZ  1 
ATOM   3916  N  NH1 . ARG C  3 203 ? 134.420 73.221  141.587 1.00 59.93  ?  231 ARG E NH1 1 
ATOM   3917  N  NH2 . ARG C  3 203 ? 135.446 73.925  143.516 1.00 59.93  ?  231 ARG E NH2 1 
ATOM   3918  N  N   . GLU C  3 204 ? 135.198 68.624  144.476 1.00 62.11  ?  232 GLU E N   1 
ATOM   3919  C  CA  . GLU C  3 204 ? 136.600 68.609  144.077 1.00 62.11  ?  232 GLU E CA  1 
ATOM   3920  C  C   . GLU C  3 204 ? 136.990 67.338  143.323 1.00 62.11  ?  232 GLU E C   1 
ATOM   3921  O  O   . GLU C  3 204 ? 138.059 67.289  142.707 1.00 62.11  ?  232 GLU E O   1 
ATOM   3922  C  CB  . GLU C  3 204 ? 137.496 68.807  145.305 1.00 62.11  ?  232 GLU E CB  1 
ATOM   3923  C  CG  . GLU C  3 204 ? 137.479 70.227  145.894 1.00 62.11  ?  232 GLU E CG  1 
ATOM   3924  C  CD  . GLU C  3 204 ? 136.400 70.450  146.942 1.00 62.11  ?  232 GLU E CD  1 
ATOM   3925  O  OE1 . GLU C  3 204 ? 135.712 69.477  147.309 1.00 62.11  ?  232 GLU E OE1 1 
ATOM   3926  O  OE2 . GLU C  3 204 ? 136.243 71.602  147.401 1.00 62.11  ?  232 GLU E OE2 1 
ATOM   3927  N  N   . GLN C  3 205 ? 136.137 66.312  143.350 1.00 65.94  ?  233 GLN E N   1 
ATOM   3928  C  CA  . GLN C  3 205 ? 136.287 65.142  142.494 1.00 65.94  ?  233 GLN E CA  1 
ATOM   3929  C  C   . GLN C  3 205 ? 135.430 65.241  141.239 1.00 65.94  ?  233 GLN E C   1 
ATOM   3930  O  O   . GLN C  3 205 ? 135.949 65.133  140.125 1.00 65.94  ?  233 GLN E O   1 
ATOM   3931  C  CB  . GLN C  3 205 ? 135.938 63.868  143.271 1.00 65.94  ?  233 GLN E CB  1 
ATOM   3932  C  CG  . GLN C  3 205 ? 136.909 63.539  144.382 1.00 65.94  ?  233 GLN E CG  1 
ATOM   3933  C  CD  . GLN C  3 205 ? 136.518 62.288  145.135 1.00 65.94  ?  233 GLN E CD  1 
ATOM   3934  O  OE1 . GLN C  3 205 ? 135.473 61.693  144.871 1.00 65.94  ?  233 GLN E OE1 1 
ATOM   3935  N  NE2 . GLN C  3 205 ? 137.356 61.878  146.079 1.00 65.94  ?  233 GLN E NE2 1 
ATOM   3936  N  N   . ARG C  3 206 ? 134.123 65.445  141.391 1.00 65.98  ?  234 ARG E N   1 
ATOM   3937  C  CA  . ARG C  3 206 ? 133.201 65.550  140.269 1.00 65.98  ?  234 ARG E CA  1 
ATOM   3938  C  C   . ARG C  3 206 ? 132.037 66.438  140.683 1.00 65.98  ?  234 ARG E C   1 
ATOM   3939  O  O   . ARG C  3 206 ? 131.582 66.383  141.827 1.00 65.98  ?  234 ARG E O   1 
ATOM   3940  C  CB  . ARG C  3 206 ? 132.706 64.164  139.827 1.00 65.98  ?  234 ARG E CB  1 
ATOM   3941  C  CG  . ARG C  3 206 ? 131.821 64.158  138.592 1.00 65.98  ?  234 ARG E CG  1 
ATOM   3942  C  CD  . ARG C  3 206 ? 131.486 62.745  138.153 1.00 65.98  ?  234 ARG E CD  1 
ATOM   3943  N  NE  . ARG C  3 206 ? 130.526 62.732  137.054 1.00 65.98  ?  234 ARG E NE  1 
ATOM   3944  C  CZ  . ARG C  3 206 ? 130.857 62.831  135.772 1.00 65.98  ?  234 ARG E CZ  1 
ATOM   3945  N  NH1 . ARG C  3 206 ? 132.129 62.950  135.421 1.00 65.98  ?  234 ARG E NH1 1 
ATOM   3946  N  NH2 . ARG C  3 206 ? 129.915 62.811  134.838 1.00 65.98  ?  234 ARG E NH2 1 
ATOM   3947  N  N   . GLU C  3 207 ? 131.557 67.261  139.747 1.00 63.02  ?  235 GLU E N   1 
ATOM   3948  C  CA  . GLU C  3 207 ? 130.565 68.281  140.067 1.00 63.02  ?  235 GLU E CA  1 
ATOM   3949  C  C   . GLU C  3 207 ? 129.194 68.089  139.434 1.00 63.02  ?  235 GLU E C   1 
ATOM   3950  O  O   . GLU C  3 207 ? 128.213 68.572  140.009 1.00 63.02  ?  235 GLU E O   1 
ATOM   3951  C  CB  . GLU C  3 207 ? 131.083 69.674  139.677 1.00 63.02  ?  235 GLU E CB  1 
ATOM   3952  C  CG  . GLU C  3 207 ? 131.332 69.870  138.193 1.00 63.02  ?  235 GLU E CG  1 
ATOM   3953  C  CD  . GLU C  3 207 ? 131.826 71.263  137.872 1.00 63.02  ?  235 GLU E CD  1 
ATOM   3954  O  OE1 . GLU C  3 207 ? 131.970 72.072  138.812 1.00 63.02  ?  235 GLU E OE1 1 
ATOM   3955  O  OE2 . GLU C  3 207 ? 132.069 71.548  136.682 1.00 63.02  ?  235 GLU E OE2 1 
ATOM   3956  N  N   . LYS C  3 208 ? 129.078 67.418  138.290 1.00 64.10  ?  236 LYS E N   1 
ATOM   3957  C  CA  . LYS C  3 208 ? 127.819 67.329  137.554 1.00 64.10  ?  236 LYS E CA  1 
ATOM   3958  C  C   . LYS C  3 208 ? 127.465 65.865  137.337 1.00 64.10  ?  236 LYS E C   1 
ATOM   3959  O  O   . LYS C  3 208 ? 128.004 65.221  136.433 1.00 64.10  ?  236 LYS E O   1 
ATOM   3960  C  CB  . LYS C  3 208 ? 127.914 68.056  136.215 1.00 64.10  ?  236 LYS E CB  1 
ATOM   3961  C  CG  . LYS C  3 208 ? 128.048 69.558  136.324 1.00 64.10  ?  236 LYS E CG  1 
ATOM   3962  C  CD  . LYS C  3 208 ? 128.121 70.186  134.943 1.00 64.10  ?  236 LYS E CD  1 
ATOM   3963  C  CE  . LYS C  3 208 ? 128.290 71.693  135.021 1.00 64.10  ?  236 LYS E CE  1 
ATOM   3964  N  NZ  . LYS C  3 208 ? 128.388 72.303  133.667 1.00 64.10  ?  236 LYS E NZ  1 
ATOM   3965  N  N   . TYR C  3 209 ? 126.556 65.341  138.150 1.00 63.85  ?  237 TYR E N   1 
ATOM   3966  C  CA  . TYR C  3 209 ? 126.066 63.980  137.988 1.00 63.85  ?  237 TYR E CA  1 
ATOM   3967  C  C   . TYR C  3 209 ? 124.793 64.047  137.158 1.00 63.85  ?  237 TYR E C   1 
ATOM   3968  O  O   . TYR C  3 209 ? 123.720 64.355  137.684 1.00 63.85  ?  237 TYR E O   1 
ATOM   3969  C  CB  . TYR C  3 209 ? 125.820 63.323  139.342 1.00 63.85  ?  237 TYR E CB  1 
ATOM   3970  C  CG  . TYR C  3 209 ? 127.082 63.099  140.134 1.00 63.85  ?  237 TYR E CG  1 
ATOM   3971  C  CD1 . TYR C  3 209 ? 127.892 61.998  139.890 1.00 63.85  ?  237 TYR E CD1 1 
ATOM   3972  C  CD2 . TYR C  3 209 ? 127.473 63.996  141.117 1.00 63.85  ?  237 TYR E CD2 1 
ATOM   3973  C  CE1 . TYR C  3 209 ? 129.052 61.790  140.613 1.00 63.85  ?  237 TYR E CE1 1 
ATOM   3974  C  CE2 . TYR C  3 209 ? 128.632 63.799  141.845 1.00 63.85  ?  237 TYR E CE2 1 
ATOM   3975  C  CZ  . TYR C  3 209 ? 129.418 62.697  141.586 1.00 63.85  ?  237 TYR E CZ  1 
ATOM   3976  O  OH  . TYR C  3 209 ? 130.571 62.500  142.308 1.00 63.85  ?  237 TYR E OH  1 
ATOM   3977  N  N   . GLU C  3 210 ? 124.914 63.792  135.861 1.00 67.46  ?  238 GLU E N   1 
ATOM   3978  C  CA  . GLU C  3 210 ? 123.766 63.793  134.960 1.00 67.46  ?  238 GLU E CA  1 
ATOM   3979  C  C   . GLU C  3 210 ? 123.283 62.357  134.801 1.00 67.46  ?  238 GLU E C   1 
ATOM   3980  O  O   . GLU C  3 210 ? 123.719 61.645  133.892 1.00 67.46  ?  238 GLU E O   1 
ATOM   3981  C  CB  . GLU C  3 210 ? 124.139 64.406  133.614 1.00 67.46  ?  238 GLU E CB  1 
ATOM   3982  C  CG  . GLU C  3 210 ? 122.979 64.566  132.648 1.00 67.46  ?  238 GLU E CG  1 
ATOM   3983  C  CD  . GLU C  3 210 ? 123.401 65.207  131.343 1.00 67.46  ?  238 GLU E CD  1 
ATOM   3984  O  OE1 . GLU C  3 210 ? 124.604 65.503  131.190 1.00 67.46  ?  238 GLU E OE1 1 
ATOM   3985  O  OE2 . GLU C  3 210 ? 122.532 65.415  130.471 1.00 67.46  ?  238 GLU E OE2 1 
ATOM   3986  N  N   . LEU C  3 211 ? 122.398 61.924  135.691 1.00 70.21  ?  239 LEU E N   1 
ATOM   3987  C  CA  . LEU C  3 211 ? 121.870 60.571  135.666 1.00 70.21  ?  239 LEU E CA  1 
ATOM   3988  C  C   . LEU C  3 211 ? 120.729 60.483  134.667 1.00 70.21  ?  239 LEU E C   1 
ATOM   3989  O  O   . LEU C  3 211 ? 120.280 61.500  134.132 1.00 70.21  ?  239 LEU E O   1 
ATOM   3990  C  CB  . LEU C  3 211 ? 121.359 60.153  137.038 1.00 70.21  ?  239 LEU E CB  1 
ATOM   3991  C  CG  . LEU C  3 211 ? 122.365 60.101  138.176 1.00 70.21  ?  239 LEU E CG  1 
ATOM   3992  C  CD1 . LEU C  3 211 ? 121.624 59.740  139.431 1.00 70.21  ?  239 LEU E CD1 1 
ATOM   3993  C  CD2 . LEU C  3 211 ? 123.443 59.090  137.880 1.00 70.21  ?  239 LEU E CD2 1 
ATOM   3994  N  N   . VAL C  3 212 ? 120.271 59.262  134.410 1.00 77.20  ?  240 VAL E N   1 
ATOM   3995  C  CA  . VAL C  3 212 ? 119.056 59.007  133.646 1.00 77.20  ?  240 VAL E CA  1 
ATOM   3996  C  C   . VAL C  3 212 ? 118.211 58.027  134.447 1.00 77.20  ?  240 VAL E C   1 
ATOM   3997  O  O   . VAL C  3 212 ? 118.712 56.986  134.887 1.00 77.20  ?  240 VAL E O   1 
ATOM   3998  C  CB  . VAL C  3 212 ? 119.362 58.453  132.242 1.00 77.20  ?  240 VAL E CB  1 
ATOM   3999  C  CG1 . VAL C  3 212 ? 118.078 58.098  131.521 1.00 77.20  ?  240 VAL E CG1 1 
ATOM   4000  C  CG2 . VAL C  3 212 ? 120.154 59.451  131.409 1.00 77.20  ?  240 VAL E CG2 1 
ATOM   4001  N  N   . ALA C  3 213 ? 116.944 58.365  134.657 1.00 79.06  ?  241 ALA E N   1 
ATOM   4002  C  CA  . ALA C  3 213 ? 116.001 57.475  135.315 1.00 79.06  ?  241 ALA E CA  1 
ATOM   4003  C  C   . ALA C  3 213 ? 115.075 56.870  134.270 1.00 79.06  ?  241 ALA E C   1 
ATOM   4004  O  O   . ALA C  3 213 ? 114.715 57.532  133.292 1.00 79.06  ?  241 ALA E O   1 
ATOM   4005  C  CB  . ALA C  3 213 ? 115.189 58.214  136.378 1.00 79.06  ?  241 ALA E CB  1 
ATOM   4006  N  N   . VAL C  3 214 ? 114.682 55.615  134.478 1.00 84.79  ?  242 VAL E N   1 
ATOM   4007  C  CA  . VAL C  3 214 ? 113.894 54.866  133.512 1.00 84.79  ?  242 VAL E CA  1 
ATOM   4008  C  C   . VAL C  3 214 ? 112.569 54.481  134.150 1.00 84.79  ?  242 VAL E C   1 
ATOM   4009  O  O   . VAL C  3 214 ? 112.539 53.784  135.173 1.00 84.79  ?  242 VAL E O   1 
ATOM   4010  C  CB  . VAL C  3 214 ? 114.644 53.618  133.018 1.00 84.79  ?  242 VAL E CB  1 
ATOM   4011  C  CG1 . VAL C  3 214 ? 113.752 52.804  132.107 1.00 84.79  ?  242 VAL E CG1 1 
ATOM   4012  C  CG2 . VAL C  3 214 ? 115.916 54.020  132.296 1.00 84.79  ?  242 VAL E CG2 1 
ATOM   4013  N  N   . CYS C  3 215 ? 111.484 54.942  133.538 1.00 89.24  ?  243 CYS E N   1 
ATOM   4014  C  CA  . CYS C  3 215 ? 110.116 54.617  133.895 1.00 89.24  ?  243 CYS E CA  1 
ATOM   4015  C  C   . CYS C  3 215 ? 109.578 53.525  132.982 1.00 89.24  ?  243 CYS E C   1 
ATOM   4016  O  O   . CYS C  3 215 ? 110.000 53.395  131.829 1.00 89.24  ?  243 CYS E O   1 
ATOM   4017  C  CB  . CYS C  3 215 ? 109.223 55.850  133.777 1.00 89.24  ?  243 CYS E CB  1 
ATOM   4018  S  SG  . CYS C  3 215 ? 107.481 55.508  134.017 1.00 89.24  ?  243 CYS E SG  1 
ATOM   4019  N  N   . THR C  3 216 ? 108.624 52.755  133.501 1.00 92.20  ?  244 THR E N   1 
ATOM   4020  C  CA  . THR C  3 216 ? 107.948 51.727  132.721 1.00 92.20  ?  244 THR E CA  1 
ATOM   4021  C  C   . THR C  3 216 ? 106.497 51.651  133.162 1.00 92.20  ?  244 THR E C   1 
ATOM   4022  O  O   . THR C  3 216 ? 106.211 51.290  134.307 1.00 92.20  ?  244 THR E O   1 
ATOM   4023  C  CB  . THR C  3 216 ? 108.624 50.365  132.883 1.00 92.20  ?  244 THR E CB  1 
ATOM   4024  O  OG1 . THR C  3 216 ? 109.977 50.444  132.418 1.00 92.20  ?  244 THR E OG1 1 
ATOM   4025  C  CG2 . THR C  3 216 ? 107.879 49.309  132.082 1.00 92.20  ?  244 THR E CG2 1 
ATOM   4026  N  N   . VAL C  3 217 ? 105.590 52.000  132.253 1.00 99.14  ?  245 VAL E N   1 
ATOM   4027  C  CA  . VAL C  3 217 ? 104.156 51.845  132.465 1.00 99.14  ?  245 VAL E CA  1 
ATOM   4028  C  C   . VAL C  3 217 ? 103.836 50.395  132.119 1.00 99.14  ?  245 VAL E C   1 
ATOM   4029  O  O   . VAL C  3 217 ? 104.541 49.790  131.302 1.00 99.14  ?  245 VAL E O   1 
ATOM   4030  C  CB  . VAL C  3 217 ? 103.373 52.860  131.604 1.00 99.14  ?  245 VAL E CB  1 
ATOM   4031  C  CG1 . VAL C  3 217 ? 101.871 52.846  131.898 1.00 99.14  ?  245 VAL E CG1 1 
ATOM   4032  C  CG2 . VAL C  3 217 ? 103.944 54.256  131.793 1.00 99.14  ?  245 VAL E CG2 1 
ATOM   4033  N  N   . HIS C  3 218 ? 102.807 49.828  132.763 1.00 103.95 ?  246 HIS E N   1 
ATOM   4034  C  CA  . HIS C  3 218 ? 102.358 48.432  132.613 1.00 103.95 ?  246 HIS E CA  1 
ATOM   4035  C  C   . HIS C  3 218 ? 103.464 47.440  132.968 1.00 103.95 ?  246 HIS E C   1 
ATOM   4036  O  O   . HIS C  3 218 ? 103.288 46.229  132.843 1.00 103.95 ?  246 HIS E O   1 
ATOM   4037  C  CB  . HIS C  3 218 ? 101.840 48.148  131.192 1.00 103.95 ?  246 HIS E CB  1 
ATOM   4038  C  CG  . HIS C  3 218 ? 100.654 48.971  130.800 1.00 103.95 ?  246 HIS E CG  1 
ATOM   4039  N  ND1 . HIS C  3 218 ? 99.382  48.714  131.264 1.00 103.95 ?  246 HIS E ND1 1 
ATOM   4040  C  CD2 . HIS C  3 218 ? 100.547 50.046  129.984 1.00 103.95 ?  246 HIS E CD2 1 
ATOM   4041  C  CE1 . HIS C  3 218 ? 98.543  49.596  130.751 1.00 103.95 ?  246 HIS E CE1 1 
ATOM   4042  N  NE2 . HIS C  3 218 ? 99.224  50.416  129.972 1.00 103.95 ?  246 HIS E NE2 1 
ATOM   4043  N  N   . GLU C  3 224 ? 105.195 51.540  128.906 1.00 90.05  ?  252 GLU E N   1 
ATOM   4044  C  CA  . GLU C  3 224 ? 106.238 51.841  127.935 1.00 90.05  ?  252 GLU E CA  1 
ATOM   4045  C  C   . GLU C  3 224 ? 107.515 52.255  128.657 1.00 90.05  ?  252 GLU E C   1 
ATOM   4046  O  O   . GLU C  3 224 ? 107.465 52.977  129.649 1.00 90.05  ?  252 GLU E O   1 
ATOM   4047  C  CB  . GLU C  3 224 ? 105.776 52.941  126.974 1.00 90.05  ?  252 GLU E CB  1 
ATOM   4048  C  CG  . GLU C  3 224 ? 106.733 53.235  125.827 1.00 90.05  ?  252 GLU E CG  1 
ATOM   4049  C  CD  . GLU C  3 224 ? 106.194 54.282  124.875 1.00 90.05  ?  252 GLU E CD  1 
ATOM   4050  O  OE1 . GLU C  3 224 ? 105.084 54.796  125.124 1.00 90.05  ?  252 GLU E OE1 1 
ATOM   4051  O  OE2 . GLU C  3 224 ? 106.877 54.590  123.876 1.00 90.05  ?  252 GLU E OE2 1 
ATOM   4052  N  N   . VAL C  3 225 ? 108.656 51.790  128.161 1.00 89.03  ?  253 VAL E N   1 
ATOM   4053  C  CA  . VAL C  3 225 ? 109.950 52.112  128.748 1.00 89.03  ?  253 VAL E CA  1 
ATOM   4054  C  C   . VAL C  3 225 ? 110.377 53.490  128.256 1.00 89.03  ?  253 VAL E C   1 
ATOM   4055  O  O   . VAL C  3 225 ? 110.674 53.673  127.071 1.00 89.03  ?  253 VAL E O   1 
ATOM   4056  C  CB  . VAL C  3 225 ? 110.998 51.047  128.396 1.00 89.03  ?  253 VAL E CB  1 
ATOM   4057  C  CG1 . VAL C  3 225 ? 112.368 51.464  128.890 1.00 89.03  ?  253 VAL E CG1 1 
ATOM   4058  C  CG2 . VAL C  3 225 ? 110.603 49.712  128.997 1.00 89.03  ?  253 VAL E CG2 1 
ATOM   4059  N  N   . VAL C  3 226 ? 110.390 54.462  129.168 1.00 86.77  ?  254 VAL E N   1 
ATOM   4060  C  CA  . VAL C  3 226 ? 110.781 55.835  128.876 1.00 86.77  ?  254 VAL E CA  1 
ATOM   4061  C  C   . VAL C  3 226 ? 112.000 56.156  129.731 1.00 86.77  ?  254 VAL E C   1 
ATOM   4062  O  O   . VAL C  3 226 ? 112.105 55.712  130.876 1.00 86.77  ?  254 VAL E O   1 
ATOM   4063  C  CB  . VAL C  3 226 ? 109.616 56.820  129.154 1.00 86.77  ?  254 VAL E CB  1 
ATOM   4064  C  CG1 . VAL C  3 226 ? 109.970 58.250  128.763 1.00 86.77  ?  254 VAL E CG1 1 
ATOM   4065  C  CG2 . VAL C  3 226 ? 108.353 56.379  128.438 1.00 86.77  ?  254 VAL E CG2 1 
ATOM   4066  N  N   . MET C  3 227 ? 112.945 56.904  129.164 1.00 86.37  ?  255 MET E N   1 
ATOM   4067  C  CA  . MET C  3 227 ? 114.117 57.319  129.920 1.00 86.37  ?  255 MET E CA  1 
ATOM   4068  C  C   . MET C  3 227 ? 114.205 58.839  129.918 1.00 86.37  ?  255 MET E C   1 
ATOM   4069  O  O   . MET C  3 227 ? 113.968 59.486  128.894 1.00 86.37  ?  255 MET E O   1 
ATOM   4070  C  CB  . MET C  3 227 ? 115.396 56.673  129.368 1.00 86.37  ?  255 MET E CB  1 
ATOM   4071  C  CG  . MET C  3 227 ? 115.699 56.939  127.902 1.00 86.37  ?  255 MET E CG  1 
ATOM   4072  S  SD  . MET C  3 227 ? 117.204 56.097  127.378 1.00 86.37  ?  255 MET E SD  1 
ATOM   4073  C  CE  . MET C  3 227 ? 116.659 54.392  127.400 1.00 86.37  ?  255 MET E CE  1 
ATOM   4074  N  N   . VAL C  3 228 ? 114.501 59.402  131.086 1.00 79.59  ?  256 VAL E N   1 
ATOM   4075  C  CA  . VAL C  3 228 ? 114.456 60.847  131.315 1.00 79.59  ?  256 VAL E CA  1 
ATOM   4076  C  C   . VAL C  3 228 ? 115.732 61.273  132.026 1.00 79.59  ?  256 VAL E C   1 
ATOM   4077  O  O   . VAL C  3 228 ? 116.172 60.622  132.985 1.00 79.59  ?  256 VAL E O   1 
ATOM   4078  C  CB  . VAL C  3 228 ? 113.214 61.255  132.146 1.00 79.59  ?  256 VAL E CB  1 
ATOM   4079  C  CG1 . VAL C  3 228 ? 113.247 62.724  132.542 1.00 79.59  ?  256 VAL E CG1 1 
ATOM   4080  C  CG2 . VAL C  3 228 ? 111.924 60.975  131.379 1.00 79.59  ?  256 VAL E CG2 1 
ATOM   4081  N  N   . PRO C  3 229 ? 116.370 62.353  131.552 1.00 75.78  ?  257 PRO E N   1 
ATOM   4082  C  CA  . PRO C  3 229 ? 117.559 62.886  132.234 1.00 75.78  ?  257 PRO E CA  1 
ATOM   4083  C  C   . PRO C  3 229 ? 117.260 63.394  133.638 1.00 75.78  ?  257 PRO E C   1 
ATOM   4084  O  O   . PRO C  3 229 ? 116.112 63.604  134.032 1.00 75.78  ?  257 PRO E O   1 
ATOM   4085  C  CB  . PRO C  3 229 ? 118.010 64.030  131.319 1.00 75.78  ?  257 PRO E CB  1 
ATOM   4086  C  CG  . PRO C  3 229 ? 117.474 63.668  129.983 1.00 75.78  ?  257 PRO E CG  1 
ATOM   4087  C  CD  . PRO C  3 229 ? 116.153 63.007  130.250 1.00 75.78  ?  257 PRO E CD  1 
ATOM   4088  N  N   . PHE C  3 230 ? 118.334 63.609  134.396 1.00 67.34  ?  258 PHE E N   1 
ATOM   4089  C  CA  . PHE C  3 230 ? 118.253 63.691  135.854 1.00 67.34  ?  258 PHE E CA  1 
ATOM   4090  C  C   . PHE C  3 230 ? 119.483 64.437  136.360 1.00 67.34  ?  258 PHE E C   1 
ATOM   4091  O  O   . PHE C  3 230 ? 120.475 63.823  136.766 1.00 67.34  ?  258 PHE E O   1 
ATOM   4092  C  CB  . PHE C  3 230 ? 118.187 62.274  136.421 1.00 67.34  ?  258 PHE E CB  1 
ATOM   4093  C  CG  . PHE C  3 230 ? 117.839 62.177  137.869 1.00 67.34  ?  258 PHE E CG  1 
ATOM   4094  C  CD1 . PHE C  3 230 ? 116.526 62.297  138.286 1.00 67.34  ?  258 PHE E CD1 1 
ATOM   4095  C  CD2 . PHE C  3 230 ? 118.816 61.881  138.806 1.00 67.34  ?  258 PHE E CD2 1 
ATOM   4096  C  CE1 . PHE C  3 230 ? 116.198 62.162  139.618 1.00 67.34  ?  258 PHE E CE1 1 
ATOM   4097  C  CE2 . PHE C  3 230 ? 118.502 61.747  140.139 1.00 67.34  ?  258 PHE E CE2 1 
ATOM   4098  C  CZ  . PHE C  3 230 ? 117.191 61.889  140.549 1.00 67.34  ?  258 PHE E CZ  1 
ATOM   4099  N  N   . PRO C  3 231 ? 119.479 65.772  136.294 1.00 60.78  ?  259 PRO E N   1 
ATOM   4100  C  CA  . PRO C  3 231 ? 120.702 66.523  136.628 1.00 60.78  ?  259 PRO E CA  1 
ATOM   4101  C  C   . PRO C  3 231 ? 120.855 66.696  138.131 1.00 60.78  ?  259 PRO E C   1 
ATOM   4102  O  O   . PRO C  3 231 ? 119.883 66.962  138.838 1.00 60.78  ?  259 PRO E O   1 
ATOM   4103  C  CB  . PRO C  3 231 ? 120.492 67.871  135.930 1.00 60.78  ?  259 PRO E CB  1 
ATOM   4104  C  CG  . PRO C  3 231 ? 119.414 67.630  134.938 1.00 60.78  ?  259 PRO E CG  1 
ATOM   4105  C  CD  . PRO C  3 231 ? 118.516 66.640  135.602 1.00 60.78  ?  259 PRO E CD  1 
ATOM   4106  N  N   . VAL C  3 232 ? 122.084 66.541  138.618 1.00 55.94  ?  260 VAL E N   1 
ATOM   4107  C  CA  . VAL C  3 232 ? 122.440 66.810  140.005 1.00 55.94  ?  260 VAL E CA  1 
ATOM   4108  C  C   . VAL C  3 232 ? 123.704 67.653  140.011 1.00 55.94  ?  260 VAL E C   1 
ATOM   4109  O  O   . VAL C  3 232 ? 124.740 67.233  139.479 1.00 55.94  ?  260 VAL E O   1 
ATOM   4110  C  CB  . VAL C  3 232 ? 122.651 65.514  140.806 1.00 55.94  ?  260 VAL E CB  1 
ATOM   4111  C  CG1 . VAL C  3 232 ? 123.237 65.836  142.156 1.00 55.94  ?  260 VAL E CG1 1 
ATOM   4112  C  CG2 . VAL C  3 232 ? 121.346 64.763  140.981 1.00 55.94  ?  260 VAL E CG2 1 
ATOM   4113  N  N   . THR C  3 233 ? 123.620 68.837  140.609 1.00 53.66  ?  261 THR E N   1 
ATOM   4114  C  CA  . THR C  3 233 ? 124.742 69.757  140.724 1.00 53.66  ?  261 THR E CA  1 
ATOM   4115  C  C   . THR C  3 233 ? 125.168 69.840  142.181 1.00 53.66  ?  261 THR E C   1 
ATOM   4116  O  O   . THR C  3 233 ? 124.339 70.097  143.058 1.00 53.66  ?  261 THR E O   1 
ATOM   4117  C  CB  . THR C  3 233 ? 124.369 71.144  140.199 1.00 53.66  ?  261 THR E CB  1 
ATOM   4118  O  OG1 . THR C  3 233 ? 123.998 71.045  138.820 1.00 53.66  ?  261 THR E OG1 1 
ATOM   4119  C  CG2 . THR C  3 233 ? 125.538 72.101  140.327 1.00 53.66  ?  261 THR E CG2 1 
ATOM   4120  N  N   . VAL C  3 234 ? 126.451 69.616  142.435 1.00 54.84  ?  262 VAL E N   1 
ATOM   4121  C  CA  . VAL C  3 234 ? 126.981 69.607  143.791 1.00 54.84  ?  262 VAL E CA  1 
ATOM   4122  C  C   . VAL C  3 234 ? 127.461 71.009  144.125 1.00 54.84  ?  262 VAL E C   1 
ATOM   4123  O  O   . VAL C  3 234 ? 128.303 71.566  143.414 1.00 54.84  ?  262 VAL E O   1 
ATOM   4124  C  CB  . VAL C  3 234 ? 128.123 68.595  143.931 1.00 54.84  ?  262 VAL E CB  1 
ATOM   4125  C  CG1 . VAL C  3 234 ? 128.671 68.621  145.344 1.00 54.84  ?  262 VAL E CG1 1 
ATOM   4126  C  CG2 . VAL C  3 234 ? 127.644 67.216  143.560 1.00 54.84  ?  262 VAL E CG2 1 
ATOM   4127  N  N   . TYR C  3 235 ? 126.940 71.585  145.204 1.00 51.79  ?  263 TYR E N   1 
ATOM   4128  C  CA  . TYR C  3 235 ? 127.363 72.924  145.584 1.00 51.79  ?  263 TYR E CA  1 
ATOM   4129  C  C   . TYR C  3 235 ? 128.544 72.864  146.534 1.00 51.79  ?  263 TYR E C   1 
ATOM   4130  O  O   . TYR C  3 235 ? 128.816 71.825  147.139 1.00 51.79  ?  263 TYR E O   1 
ATOM   4131  C  CB  . TYR C  3 235 ? 126.225 73.737  146.196 1.00 51.79  ?  263 TYR E CB  1 
ATOM   4132  C  CG  . TYR C  3 235 ? 125.297 74.331  145.164 1.00 51.79  ?  263 TYR E CG  1 
ATOM   4133  C  CD1 . TYR C  3 235 ? 125.481 74.078  143.813 1.00 51.79  ?  263 TYR E CD1 1 
ATOM   4134  C  CD2 . TYR C  3 235 ? 124.313 75.235  145.527 1.00 51.79  ?  263 TYR E CD2 1 
ATOM   4135  C  CE1 . TYR C  3 235 ? 124.665 74.628  142.868 1.00 51.79  ?  263 TYR E CE1 1 
ATOM   4136  C  CE2 . TYR C  3 235 ? 123.501 75.811  144.576 1.00 51.79  ?  263 TYR E CE2 1 
ATOM   4137  C  CZ  . TYR C  3 235 ? 123.682 75.496  143.249 1.00 51.79  ?  263 TYR E CZ  1 
ATOM   4138  O  OH  . TYR C  3 235 ? 122.882 76.048  142.283 1.00 51.79  ?  263 TYR E OH  1 
ATOM   4139  N  N   . ASP C  3 236 ? 129.235 73.990  146.660 1.00 56.50  ?  264 ASP E N   1 
ATOM   4140  C  CA  . ASP C  3 236 ? 130.599 74.046  147.153 1.00 56.50  ?  264 ASP E CA  1 
ATOM   4141  C  C   . ASP C  3 236 ? 130.677 74.825  148.463 1.00 56.50  ?  264 ASP E C   1 
ATOM   4142  O  O   . ASP C  3 236 ? 129.824 75.651  148.789 1.00 56.50  ?  264 ASP E O   1 
ATOM   4143  C  CB  . ASP C  3 236 ? 131.486 74.674  146.070 1.00 56.50  ?  264 ASP E CB  1 
ATOM   4144  C  CG  . ASP C  3 236 ? 132.981 74.557  146.352 1.00 56.50  ?  264 ASP E CG  1 
ATOM   4145  O  OD1 . ASP C  3 236 ? 133.390 74.006  147.394 1.00 56.50  ?  264 ASP E OD1 1 
ATOM   4146  O  OD2 . ASP C  3 236 ? 133.758 75.026  145.499 1.00 56.50  ?  264 ASP E OD2 1 
ATOM   4147  N  N   . GLU C  3 237 ? 131.731 74.536  149.219 1.00 62.18  ?  265 GLU E N   1 
ATOM   4148  C  CA  . GLU C  3 237 ? 132.145 75.333  150.361 1.00 62.18  ?  265 GLU E CA  1 
ATOM   4149  C  C   . GLU C  3 237 ? 133.655 75.495  150.274 1.00 62.18  ?  265 GLU E C   1 
ATOM   4150  O  O   . GLU C  3 237 ? 134.329 74.740  149.566 1.00 62.18  ?  265 GLU E O   1 
ATOM   4151  C  CB  . GLU C  3 237 ? 131.725 74.682  151.678 1.00 62.18  ?  265 GLU E CB  1 
ATOM   4152  C  CG  . GLU C  3 237 ? 132.376 73.349  151.936 1.00 62.18  ?  265 GLU E CG  1 
ATOM   4153  C  CD  . GLU C  3 237 ? 131.871 72.708  153.205 1.00 62.18  ?  265 GLU E CD  1 
ATOM   4154  O  OE1 . GLU C  3 237 ? 130.965 73.287  153.841 1.00 62.18  ?  265 GLU E OE1 1 
ATOM   4155  O  OE2 . GLU C  3 237 ? 132.388 71.634  153.576 1.00 62.18  ?  265 GLU E OE2 1 
ATOM   4156  N  N   . ASP C  3 238 ? 134.184 76.493  150.983 1.00 56.79  ?  266 ASP E N   1 
ATOM   4157  C  CA  . ASP C  3 238 ? 135.615 76.789  150.919 1.00 56.79  ?  266 ASP E CA  1 
ATOM   4158  C  C   . ASP C  3 238 ? 136.342 75.792  151.817 1.00 56.79  ?  266 ASP E C   1 
ATOM   4159  O  O   . ASP C  3 238 ? 136.732 76.086  152.948 1.00 56.79  ?  266 ASP E O   1 
ATOM   4160  C  CB  . ASP C  3 238 ? 135.901 78.227  151.339 1.00 56.79  ?  266 ASP E CB  1 
ATOM   4161  C  CG  . ASP C  3 238 ? 137.287 78.703  150.912 1.00 56.79  ?  266 ASP E CG  1 
ATOM   4162  O  OD1 . ASP C  3 238 ? 137.446 79.104  149.744 1.00 56.79  ?  266 ASP E OD1 1 
ATOM   4163  O  OD2 . ASP C  3 238 ? 138.233 78.661  151.723 1.00 56.79  ?  266 ASP E OD2 1 
ATOM   4164  N  N   . ASP C  3 239 ? 136.510 74.575  151.302 1.00 60.20  ?  267 ASP E N   1 
ATOM   4165  C  CA  . ASP C  3 239 ? 137.217 73.514  152.005 1.00 60.20  ?  267 ASP E CA  1 
ATOM   4166  C  C   . ASP C  3 239 ? 138.653 73.372  151.513 1.00 60.20  ?  267 ASP E C   1 
ATOM   4167  O  O   . ASP C  3 239 ? 139.223 72.280  151.546 1.00 60.20  ?  267 ASP E O   1 
ATOM   4168  C  CB  . ASP C  3 239 ? 136.472 72.185  151.877 1.00 60.20  ?  267 ASP E CB  1 
ATOM   4169  C  CG  . ASP C  3 239 ? 136.220 71.781  150.429 1.00 60.20  ?  267 ASP E CG  1 
ATOM   4170  O  OD1 . ASP C  3 239 ? 136.461 72.593  149.510 1.00 60.20  ?  267 ASP E OD1 1 
ATOM   4171  O  OD2 . ASP C  3 239 ? 135.791 70.631  150.208 1.00 60.20  ?  267 ASP E OD2 1 
ATOM   4172  N  N   . SER C  3 240 ? 139.243 74.468  151.048 1.00 55.93  ?  268 SER E N   1 
ATOM   4173  C  CA  . SER C  3 240 ? 140.591 74.437  150.503 1.00 55.93  ?  268 SER E CA  1 
ATOM   4174  C  C   . SER C  3 240 ? 141.311 75.734  150.828 1.00 55.93  ?  268 SER E C   1 
ATOM   4175  O  O   . SER C  3 240 ? 140.810 76.824  150.530 1.00 55.93  ?  268 SER E O   1 
ATOM   4176  C  CB  . SER C  3 240 ? 140.566 74.212  148.991 1.00 55.93  ?  268 SER E CB  1 
ATOM   4177  O  OG  . SER C  3 240 ? 140.031 72.938  148.689 1.00 55.93  ?  268 SER E OG  1 
ATOM   4178  N  N   . ALA C  3 241 ? 142.469 75.603  151.426 1.00 51.96  ?  269 ALA E N   1 
ATOM   4179  C  CA  . ALA C  3 241 ? 143.494 76.571  151.762 1.00 51.96  ?  269 ALA E CA  1 
ATOM   4180  C  C   . ALA C  3 241 ? 144.322 76.902  150.526 1.00 51.96  ?  269 ALA E C   1 
ATOM   4181  O  O   . ALA C  3 241 ? 144.577 76.027  149.694 1.00 51.96  ?  269 ALA E O   1 
ATOM   4182  C  CB  . ALA C  3 241 ? 144.402 76.019  152.855 1.00 51.96  ?  269 ALA E CB  1 
ATOM   4183  N  N   . PRO C  3 242 ? 144.745 78.154  150.365 1.00 50.42  ?  270 PRO E N   1 
ATOM   4184  C  CA  . PRO C  3 242 ? 145.484 78.523  149.156 1.00 50.42  ?  270 PRO E CA  1 
ATOM   4185  C  C   . PRO C  3 242 ? 146.908 77.994  149.190 1.00 50.42  ?  270 PRO E C   1 
ATOM   4186  O  O   . PRO C  3 242 ? 147.551 77.931  150.240 1.00 50.42  ?  270 PRO E O   1 
ATOM   4187  C  CB  . PRO C  3 242 ? 145.454 80.052  149.181 1.00 50.42  ?  270 PRO E CB  1 
ATOM   4188  C  CG  . PRO C  3 242 ? 145.340 80.388  150.613 1.00 50.42  ?  270 PRO E CG  1 
ATOM   4189  C  CD  . PRO C  3 242 ? 144.504 79.317  151.234 1.00 50.42  ?  270 PRO E CD  1 
ATOM   4190  N  N   . THR C  3 243 ? 147.396 77.597  148.017 1.00 51.87  ?  271 THR E N   1 
ATOM   4191  C  CA  . THR C  3 243 ? 148.682 76.927  147.907 1.00 51.87  ?  271 THR E CA  1 
ATOM   4192  C  C   . THR C  3 243 ? 149.369 77.431  146.643 1.00 51.87  ?  271 THR E C   1 
ATOM   4193  O  O   . THR C  3 243 ? 148.702 77.740  145.654 1.00 51.87  ?  271 THR E O   1 
ATOM   4194  C  CB  . THR C  3 243 ? 148.494 75.398  147.879 1.00 51.87  ?  271 THR E CB  1 
ATOM   4195  O  OG1 . THR C  3 243 ? 147.708 74.997  149.006 1.00 51.87  ?  271 THR E OG1 1 
ATOM   4196  C  CG2 . THR C  3 243 ? 149.820 74.658  147.972 1.00 51.87  ?  271 THR E CG2 1 
ATOM   4197  N  N   . PHE C  3 244 ? 150.696 77.550  146.705 1.00 56.09  ?  272 PHE E N   1 
ATOM   4198  C  CA  . PHE C  3 244 ? 151.523 77.962  145.583 1.00 56.09  ?  272 PHE E CA  1 
ATOM   4199  C  C   . PHE C  3 244 ? 151.409 76.986  144.413 1.00 56.09  ?  272 PHE E C   1 
ATOM   4200  O  O   . PHE C  3 244 ? 151.097 75.809  144.602 1.00 56.09  ?  272 PHE E O   1 
ATOM   4201  C  CB  . PHE C  3 244 ? 152.977 78.039  146.033 1.00 56.09  ?  272 PHE E CB  1 
ATOM   4202  C  CG  . PHE C  3 244 ? 153.258 79.154  146.987 1.00 56.09  ?  272 PHE E CG  1 
ATOM   4203  C  CD1 . PHE C  3 244 ? 152.492 80.304  146.979 1.00 56.09  ?  272 PHE E CD1 1 
ATOM   4204  C  CD2 . PHE C  3 244 ? 154.259 79.026  147.933 1.00 56.09  ?  272 PHE E CD2 1 
ATOM   4205  C  CE1 . PHE C  3 244 ? 152.751 81.324  147.866 1.00 56.09  ?  272 PHE E CE1 1 
ATOM   4206  C  CE2 . PHE C  3 244 ? 154.513 80.041  148.831 1.00 56.09  ?  272 PHE E CE2 1 
ATOM   4207  C  CZ  . PHE C  3 244 ? 153.757 81.191  148.796 1.00 56.09  ?  272 PHE E CZ  1 
ATOM   4208  N  N   . PRO C  3 245 ? 151.660 77.453  143.189 1.00 56.57  ?  273 PRO E N   1 
ATOM   4209  C  CA  . PRO C  3 245 ? 151.783 76.511  142.056 1.00 56.57  ?  273 PRO E CA  1 
ATOM   4210  C  C   . PRO C  3 245 ? 153.145 75.825  142.034 1.00 56.57  ?  273 PRO E C   1 
ATOM   4211  O  O   . PRO C  3 245 ? 154.045 76.177  141.258 1.00 56.57  ?  273 PRO E O   1 
ATOM   4212  C  CB  . PRO C  3 245 ? 151.554 77.422  140.846 1.00 56.57  ?  273 PRO E CB  1 
ATOM   4213  C  CG  . PRO C  3 245 ? 152.002 78.759  141.294 1.00 56.57  ?  273 PRO E CG  1 
ATOM   4214  C  CD  . PRO C  3 245 ? 151.647 78.854  142.741 1.00 56.57  ?  273 PRO E CD  1 
ATOM   4215  N  N   . ALA C  3 246 ? 153.282 74.830  142.919 1.00 59.23  ?  274 ALA E N   1 
ATOM   4216  C  CA  . ALA C  3 246 ? 154.468 73.982  143.093 1.00 59.23  ?  274 ALA E CA  1 
ATOM   4217  C  C   . ALA C  3 246 ? 155.712 74.812  143.437 1.00 59.23  ?  274 ALA E C   1 
ATOM   4218  O  O   . ALA C  3 246 ? 156.699 74.854  142.703 1.00 59.23  ?  274 ALA E O   1 
ATOM   4219  C  CB  . ALA C  3 246 ? 154.711 73.094  141.865 1.00 59.23  ?  274 ALA E CB  1 
ATOM   4220  N  N   . GLY C  3 247 ? 155.621 75.478  144.586 1.00 58.60  ?  275 GLY E N   1 
ATOM   4221  C  CA  . GLY C  3 247 ? 156.777 76.034  145.265 1.00 58.60  ?  275 GLY E CA  1 
ATOM   4222  C  C   . GLY C  3 247 ? 157.519 77.175  144.601 1.00 58.60  ?  275 GLY E C   1 
ATOM   4223  O  O   . GLY C  3 247 ? 158.711 77.051  144.306 1.00 58.60  ?  275 GLY E O   1 
ATOM   4224  N  N   . VAL C  3 248 ? 156.837 78.291  144.357 1.00 59.41  ?  276 VAL E N   1 
ATOM   4225  C  CA  . VAL C  3 248 ? 157.474 79.536  143.922 1.00 59.41  ?  276 VAL E CA  1 
ATOM   4226  C  C   . VAL C  3 248 ? 156.994 80.608  144.897 1.00 59.41  ?  276 VAL E C   1 
ATOM   4227  O  O   . VAL C  3 248 ? 155.876 81.119  144.783 1.00 59.41  ?  276 VAL E O   1 
ATOM   4228  C  CB  . VAL C  3 248 ? 157.138 79.909  142.475 1.00 59.41  ?  276 VAL E CB  1 
ATOM   4229  C  CG1 . VAL C  3 248 ? 157.780 81.238  142.111 1.00 59.41  ?  276 VAL E CG1 1 
ATOM   4230  C  CG2 . VAL C  3 248 ? 157.594 78.828  141.514 1.00 59.41  ?  276 VAL E CG2 1 
ATOM   4231  N  N   . ASP C  3 249 ? 157.831 80.942  145.878 1.00 60.92  ?  277 ASP E N   1 
ATOM   4232  C  CA  . ASP C  3 249 ? 157.460 81.879  146.931 1.00 60.92  ?  277 ASP E CA  1 
ATOM   4233  C  C   . ASP C  3 249 ? 158.090 83.252  146.748 1.00 60.92  ?  277 ASP E C   1 
ATOM   4234  O  O   . ASP C  3 249 ? 157.909 84.134  147.593 1.00 60.92  ?  277 ASP E O   1 
ATOM   4235  C  CB  . ASP C  3 249 ? 157.830 81.306  148.298 1.00 60.92  ?  277 ASP E CB  1 
ATOM   4236  C  CG  . ASP C  3 249 ? 159.294 80.910  148.396 1.00 60.92  ?  277 ASP E CG  1 
ATOM   4237  O  OD1 . ASP C  3 249 ? 159.999 80.927  147.363 1.00 60.92  ?  277 ASP E OD1 1 
ATOM   4238  O  OD2 . ASP C  3 249 ? 159.748 80.591  149.516 1.00 60.92  ?  277 ASP E OD2 1 
ATOM   4239  N  N   . THR C  3 250 ? 158.841 83.451  145.667 1.00 65.83  ?  278 THR E N   1 
ATOM   4240  C  CA  . THR C  3 250 ? 159.574 84.696  145.477 1.00 65.83  ?  278 THR E CA  1 
ATOM   4241  C  C   . THR C  3 250 ? 159.809 84.997  144.004 1.00 65.83  ?  278 THR E C   1 
ATOM   4242  O  O   . THR C  3 250 ? 160.422 84.196  143.292 1.00 65.83  ?  278 THR E O   1 
ATOM   4243  C  CB  . THR C  3 250 ? 160.927 84.646  146.196 1.00 65.83  ?  278 THR E CB  1 
ATOM   4244  O  OG1 . THR C  3 250 ? 160.735 84.511  147.609 1.00 65.83  ?  278 THR E OG1 1 
ATOM   4245  C  CG2 . THR C  3 250 ? 161.723 85.910  145.926 1.00 65.83  ?  278 THR E CG2 1 
ATOM   4246  N  N   . ALA C  3 251 ? 159.332 86.144  143.538 1.00 58.69  ?  279 ALA E N   1 
ATOM   4247  C  CA  . ALA C  3 251 ? 159.776 86.702  142.274 1.00 58.69  ?  279 ALA E CA  1 
ATOM   4248  C  C   . ALA C  3 251 ? 160.538 87.985  142.555 1.00 58.69  ?  279 ALA E C   1 
ATOM   4249  O  O   . ALA C  3 251 ? 160.172 88.762  143.440 1.00 58.69  ?  279 ALA E O   1 
ATOM   4250  C  CB  . ALA C  3 251 ? 158.615 86.982  141.320 1.00 58.69  ?  279 ALA E CB  1 
ATOM   4251  N  N   . SER C  3 252 ? 161.608 88.194  141.799 1.00 58.23  ?  280 SER E N   1 
ATOM   4252  C  CA  . SER C  3 252 ? 162.486 89.333  141.995 1.00 58.23  ?  280 SER E CA  1 
ATOM   4253  C  C   . SER C  3 252 ? 162.633 90.082  140.685 1.00 58.23  ?  280 SER E C   1 
ATOM   4254  O  O   . SER C  3 252 ? 162.735 89.469  139.619 1.00 58.23  ?  280 SER E O   1 
ATOM   4255  C  CB  . SER C  3 252 ? 163.858 88.893  142.499 1.00 58.23  ?  280 SER E CB  1 
ATOM   4256  O  OG  . SER C  3 252 ? 164.534 88.129  141.517 1.00 58.23  ?  280 SER E OG  1 
ATOM   4257  N  N   . ALA C  3 253 ? 162.640 91.407  140.767 1.00 54.94  ?  281 ALA E N   1 
ATOM   4258  C  CA  . ALA C  3 253 ? 162.773 92.235  139.580 1.00 54.94  ?  281 ALA E CA  1 
ATOM   4259  C  C   . ALA C  3 253 ? 163.541 93.498  139.924 1.00 54.94  ?  281 ALA E C   1 
ATOM   4260  O  O   . ALA C  3 253 ? 163.367 94.060  141.009 1.00 54.94  ?  281 ALA E O   1 
ATOM   4261  C  CB  . ALA C  3 253 ? 161.407 92.588  138.994 1.00 54.94  ?  281 ALA E CB  1 
ATOM   4262  N  N   . VAL C  3 254 ? 164.378 93.938  138.993 1.00 50.36  ?  282 VAL E N   1 
ATOM   4263  C  CA  . VAL C  3 254 ? 165.268 95.073  139.189 1.00 50.36  ?  282 VAL E CA  1 
ATOM   4264  C  C   . VAL C  3 254 ? 164.712 96.254  138.408 1.00 50.36  ?  282 VAL E C   1 
ATOM   4265  O  O   . VAL C  3 254 ? 164.668 96.224  137.172 1.00 50.36  ?  282 VAL E O   1 
ATOM   4266  C  CB  . VAL C  3 254 ? 166.696 94.735  138.741 1.00 50.36  ?  282 VAL E CB  1 
ATOM   4267  C  CG1 . VAL C  3 254 ? 167.583 95.950  138.841 1.00 50.36  ?  282 VAL E CG1 1 
ATOM   4268  C  CG2 . VAL C  3 254 ? 167.248 93.593  139.574 1.00 50.36  ?  282 VAL E CG2 1 
ATOM   4269  N  N   . VAL C  3 255 ? 164.285 97.293  139.123 1.00 46.90  ?  283 VAL E N   1 
ATOM   4270  C  CA  . VAL C  3 255 ? 163.746 98.499  138.503 1.00 46.90  ?  283 VAL E CA  1 
ATOM   4271  C  C   . VAL C  3 255 ? 164.941 99.331  138.058 1.00 46.90  ?  283 VAL E C   1 
ATOM   4272  O  O   . VAL C  3 255 ? 165.614 99.957  138.876 1.00 46.90  ?  283 VAL E O   1 
ATOM   4273  C  CB  . VAL C  3 255 ? 162.847 99.277  139.462 1.00 46.90  ?  283 VAL E CB  1 
ATOM   4274  C  CG1 . VAL C  3 255 ? 162.342 100.542 138.794 1.00 46.90  ?  283 VAL E CG1 1 
ATOM   4275  C  CG2 . VAL C  3 255 ? 161.697 98.412  139.926 1.00 46.90  ?  283 VAL E CG2 1 
ATOM   4276  N  N   . GLU C  3 256 ? 165.211 99.338  136.755 1.00 45.03  ?  284 GLU E N   1 
ATOM   4277  C  CA  . GLU C  3 256 ? 166.412 99.972  136.226 1.00 45.03  ?  284 GLU E CA  1 
ATOM   4278  C  C   . GLU C  3 256 ? 166.079 101.167 135.340 1.00 45.03  ?  284 GLU E C   1 
ATOM   4279  O  O   . GLU C  3 256 ? 166.538 102.276 135.613 1.00 45.03  ?  284 GLU E O   1 
ATOM   4280  C  CB  . GLU C  3 256 ? 167.256 98.949  135.466 1.00 45.03  ?  284 GLU E CB  1 
ATOM   4281  C  CG  . GLU C  3 256 ? 168.589 99.477  134.988 1.00 45.03  ?  284 GLU E CG  1 
ATOM   4282  C  CD  . GLU C  3 256 ? 169.410 98.416  134.290 1.00 45.03  ?  284 GLU E CD  1 
ATOM   4283  O  OE1 . GLU C  3 256 ? 168.908 97.281  134.146 1.00 45.03  ?  284 GLU E OE1 1 
ATOM   4284  O  OE2 . GLU C  3 256 ? 170.553 98.707  133.888 1.00 45.03  ?  284 GLU E OE2 1 
ATOM   4285  N  N   . PHE C  3 257 ? 165.285 100.981 134.289 1.00 44.66  ?  285 PHE E N   1 
ATOM   4286  C  CA  . PHE C  3 257 ? 165.145 102.001 133.262 1.00 44.66  ?  285 PHE E CA  1 
ATOM   4287  C  C   . PHE C  3 257 ? 163.721 102.485 133.023 1.00 44.66  ?  285 PHE E C   1 
ATOM   4288  O  O   . PHE C  3 257 ? 163.549 103.517 132.369 1.00 44.66  ?  285 PHE E O   1 
ATOM   4289  C  CB  . PHE C  3 257 ? 165.714 101.484 131.934 1.00 44.66  ?  285 PHE E CB  1 
ATOM   4290  C  CG  . PHE C  3 257 ? 167.215 101.433 131.886 1.00 44.66  ?  285 PHE E CG  1 
ATOM   4291  C  CD1 . PHE C  3 257 ? 167.980 102.209 132.739 1.00 44.66  ?  285 PHE E CD1 1 
ATOM   4292  C  CD2 . PHE C  3 257 ? 167.861 100.596 130.991 1.00 44.66  ?  285 PHE E CD2 1 
ATOM   4293  C  CE1 . PHE C  3 257 ? 169.358 102.157 132.692 1.00 44.66  ?  285 PHE E CE1 1 
ATOM   4294  C  CE2 . PHE C  3 257 ? 169.237 100.541 130.938 1.00 44.66  ?  285 PHE E CE2 1 
ATOM   4295  C  CZ  . PHE C  3 257 ? 169.985 101.319 131.793 1.00 44.66  ?  285 PHE E CZ  1 
ATOM   4296  N  N   . LYS C  3 258 ? 162.700 101.790 133.526 1.00 43.90  ?  286 LYS E N   1 
ATOM   4297  C  CA  . LYS C  3 258 ? 161.331 102.125 133.132 1.00 43.90  ?  286 LYS E CA  1 
ATOM   4298  C  C   . LYS C  3 258 ? 160.779 103.310 133.921 1.00 43.90  ?  286 LYS E C   1 
ATOM   4299  O  O   . LYS C  3 258 ? 160.513 104.373 133.352 1.00 43.90  ?  286 LYS E O   1 
ATOM   4300  C  CB  . LYS C  3 258 ? 160.437 100.894 133.286 1.00 43.90  ?  286 LYS E CB  1 
ATOM   4301  C  CG  . LYS C  3 258 ? 160.859 99.758  132.387 1.00 43.90  ?  286 LYS E CG  1 
ATOM   4302  C  CD  . LYS C  3 258 ? 160.688 100.153 130.935 1.00 43.90  ?  286 LYS E CD  1 
ATOM   4303  C  CE  . LYS C  3 258 ? 161.060 99.023  130.005 1.00 43.90  ?  286 LYS E CE  1 
ATOM   4304  N  NZ  . LYS C  3 258 ? 160.943 99.438  128.587 1.00 43.90  ?  286 LYS E NZ  1 
ATOM   4305  N  N   . ARG C  3 259 ? 160.591 103.134 135.229 1.00 47.54  ?  287 ARG E N   1 
ATOM   4306  C  CA  . ARG C  3 259 ? 160.311 104.180 136.214 1.00 47.54  ?  287 ARG E CA  1 
ATOM   4307  C  C   . ARG C  3 259 ? 159.045 104.994 135.941 1.00 47.54  ?  287 ARG E C   1 
ATOM   4308  O  O   . ARG C  3 259 ? 158.889 106.078 136.510 1.00 47.54  ?  287 ARG E O   1 
ATOM   4309  C  CB  . ARG C  3 259 ? 161.499 105.134 136.348 1.00 47.54  ?  287 ARG E CB  1 
ATOM   4310  C  CG  . ARG C  3 259 ? 162.750 104.469 136.851 1.00 47.54  ?  287 ARG E CG  1 
ATOM   4311  C  CD  . ARG C  3 259 ? 163.899 105.439 136.900 1.00 47.54  ?  287 ARG E CD  1 
ATOM   4312  N  NE  . ARG C  3 259 ? 165.137 104.767 137.261 1.00 47.54  ?  287 ARG E NE  1 
ATOM   4313  C  CZ  . ARG C  3 259 ? 165.567 104.630 138.507 1.00 47.54  ?  287 ARG E CZ  1 
ATOM   4314  N  NH1 . ARG C  3 259 ? 164.863 105.130 139.510 1.00 47.54  ?  287 ARG E NH1 1 
ATOM   4315  N  NH2 . ARG C  3 259 ? 166.703 104.001 138.751 1.00 47.54  ?  287 ARG E NH2 1 
ATOM   4316  N  N   . LYS C  3 260 ? 158.138 104.521 135.089 1.00 53.22  ?  288 LYS E N   1 
ATOM   4317  C  CA  . LYS C  3 260 ? 156.907 105.258 134.841 1.00 53.22  ?  288 LYS E CA  1 
ATOM   4318  C  C   . LYS C  3 260 ? 155.969 105.085 136.040 1.00 53.22  ?  288 LYS E C   1 
ATOM   4319  O  O   . LYS C  3 260 ? 156.132 104.178 136.857 1.00 53.22  ?  288 LYS E O   1 
ATOM   4320  C  CB  . LYS C  3 260 ? 156.264 104.781 133.535 1.00 53.22  ?  288 LYS E CB  1 
ATOM   4321  C  CG  . LYS C  3 260 ? 155.222 105.719 132.924 1.00 53.22  ?  288 LYS E CG  1 
ATOM   4322  C  CD  . LYS C  3 260 ? 154.547 105.110 131.718 1.00 53.22  ?  288 LYS E CD  1 
ATOM   4323  C  CE  . LYS C  3 260 ? 155.470 105.103 130.523 1.00 53.22  ?  288 LYS E CE  1 
ATOM   4324  N  NZ  . LYS C  3 260 ? 154.771 104.629 129.299 1.00 53.22  ?  288 LYS E NZ  1 
ATOM   4325  N  N   . GLU C  3 261 ? 154.968 105.967 136.144 1.00 58.52  ?  289 GLU E N   1 
ATOM   4326  C  CA  . GLU C  3 261 ? 154.134 106.078 137.339 1.00 58.52  ?  289 GLU E CA  1 
ATOM   4327  C  C   . GLU C  3 261 ? 153.209 104.888 137.577 1.00 58.52  ?  289 GLU E C   1 
ATOM   4328  O  O   . GLU C  3 261 ? 152.519 104.885 138.600 1.00 58.52  ?  289 GLU E O   1 
ATOM   4329  C  CB  . GLU C  3 261 ? 153.291 107.351 137.268 1.00 58.52  ?  289 GLU E CB  1 
ATOM   4330  C  CG  . GLU C  3 261 ? 152.242 107.327 136.169 1.00 58.52  ?  289 GLU E CG  1 
ATOM   4331  C  CD  . GLU C  3 261 ? 151.463 108.626 136.069 1.00 58.52  ?  289 GLU E CD  1 
ATOM   4332  O  OE1 . GLU C  3 261 ? 151.772 109.572 136.824 1.00 58.52  ?  289 GLU E OE1 1 
ATOM   4333  O  OE2 . GLU C  3 261 ? 150.533 108.700 135.239 1.00 58.52  ?  289 GLU E OE2 1 
ATOM   4334  N  N   . ASP C  3 262 ? 153.145 103.915 136.666 1.00 58.17  ?  290 ASP E N   1 
ATOM   4335  C  CA  . ASP C  3 262 ? 152.418 102.663 136.891 1.00 58.17  ?  290 ASP E CA  1 
ATOM   4336  C  C   . ASP C  3 262 ? 152.997 101.571 136.000 1.00 58.17  ?  290 ASP E C   1 
ATOM   4337  O  O   . ASP C  3 262 ? 152.690 101.505 134.806 1.00 58.17  ?  290 ASP E O   1 
ATOM   4338  C  CB  . ASP C  3 262 ? 150.908 102.845 136.654 1.00 58.17  ?  290 ASP E CB  1 
ATOM   4339  C  CG  . ASP C  3 262 ? 150.590 103.609 135.380 1.00 58.17  ?  290 ASP E CG  1 
ATOM   4340  O  OD1 . ASP C  3 262 ? 151.528 104.101 134.715 1.00 58.17  ?  290 ASP E OD1 1 
ATOM   4341  O  OD2 . ASP C  3 262 ? 149.391 103.718 135.048 1.00 58.17  ?  290 ASP E OD2 1 
ATOM   4342  N  N   . THR C  3 263 ? 153.826 100.703 136.575 1.00 53.64  ?  291 THR E N   1 
ATOM   4343  C  CA  . THR C  3 263 ? 154.565 99.719  135.801 1.00 53.64  ?  291 THR E CA  1 
ATOM   4344  C  C   . THR C  3 263 ? 154.581 98.393  136.547 1.00 53.64  ?  291 THR E C   1 
ATOM   4345  O  O   . THR C  3 263 ? 154.779 98.351  137.763 1.00 53.64  ?  291 THR E O   1 
ATOM   4346  C  CB  . THR C  3 263 ? 155.999 100.200 135.529 1.00 53.64  ?  291 THR E CB  1 
ATOM   4347  O  OG1 . THR C  3 263 ? 155.949 101.486 134.907 1.00 53.64  ?  291 THR E OG1 1 
ATOM   4348  C  CG2 . THR C  3 263 ? 156.730 99.256  134.594 1.00 53.64  ?  291 THR E CG2 1 
ATOM   4349  N  N   . VAL C  3 264 ? 154.340 97.310  135.808 1.00 54.29  ?  292 VAL E N   1 
ATOM   4350  C  CA  . VAL C  3 264 ? 154.382 95.963  136.361 1.00 54.29  ?  292 VAL E CA  1 
ATOM   4351  C  C   . VAL C  3 264 ? 155.821 95.600  136.695 1.00 54.29  ?  292 VAL E C   1 
ATOM   4352  O  O   . VAL C  3 264 ? 156.680 95.534  135.809 1.00 54.29  ?  292 VAL E O   1 
ATOM   4353  C  CB  . VAL C  3 264 ? 153.781 94.943  135.382 1.00 54.29  ?  292 VAL E CB  1 
ATOM   4354  C  CG1 . VAL C  3 264 ? 153.852 93.552  135.974 1.00 54.29  ?  292 VAL E CG1 1 
ATOM   4355  C  CG2 . VAL C  3 264 ? 152.354 95.322  135.029 1.00 54.29  ?  292 VAL E CG2 1 
ATOM   4356  N  N   . VAL C  3 265 ? 156.095 95.356  137.971 1.00 52.05  ?  293 VAL E N   1 
ATOM   4357  C  CA  . VAL C  3 265 ? 157.447 95.028  138.402 1.00 52.05  ?  293 VAL E CA  1 
ATOM   4358  C  C   . VAL C  3 265 ? 157.613 93.514  138.479 1.00 52.05  ?  293 VAL E C   1 
ATOM   4359  O  O   . VAL C  3 265 ? 158.403 92.932  137.730 1.00 52.05  ?  293 VAL E O   1 
ATOM   4360  C  CB  . VAL C  3 265 ? 157.767 95.701  139.747 1.00 52.05  ?  293 VAL E CB  1 
ATOM   4361  C  CG1 . VAL C  3 265 ? 159.126 95.282  140.235 1.00 52.05  ?  293 VAL E CG1 1 
ATOM   4362  C  CG2 . VAL C  3 265 ? 157.710 97.205  139.600 1.00 52.05  ?  293 VAL E CG2 1 
ATOM   4363  N  N   . ALA C  3 266 ? 156.852 92.860  139.355 1.00 53.40  ?  294 ALA E N   1 
ATOM   4364  C  CA  . ALA C  3 266 ? 156.967 91.420  139.532 1.00 53.40  ?  294 ALA E CA  1 
ATOM   4365  C  C   . ALA C  3 266 ? 155.596 90.848  139.850 1.00 53.40  ?  294 ALA E C   1 
ATOM   4366  O  O   . ALA C  3 266 ? 154.711 91.563  140.319 1.00 53.40  ?  294 ALA E O   1 
ATOM   4367  C  CB  . ALA C  3 266 ? 157.966 91.067  140.634 1.00 53.40  ?  294 ALA E CB  1 
ATOM   4368  N  N   . THR C  3 267 ? 155.429 89.549  139.598 1.00 48.97  ?  295 THR E N   1 
ATOM   4369  C  CA  . THR C  3 267 ? 154.117 88.917  139.591 1.00 48.97  ?  295 THR E CA  1 
ATOM   4370  C  C   . THR C  3 267 ? 154.200 87.525  140.201 1.00 48.97  ?  295 THR E C   1 
ATOM   4371  O  O   . THR C  3 267 ? 155.076 86.734  139.847 1.00 48.97  ?  295 THR E O   1 
ATOM   4372  C  CB  . THR C  3 267 ? 153.580 88.822  138.154 1.00 48.97  ?  295 THR E CB  1 
ATOM   4373  O  OG1 . THR C  3 267 ? 153.528 90.129  137.573 1.00 48.97  ?  295 THR E OG1 1 
ATOM   4374  C  CG2 . THR C  3 267 ? 152.195 88.209  138.117 1.00 48.97  ?  295 THR E CG2 1 
ATOM   4375  N  N   . LEU C  3 268 ? 153.280 87.222  141.116 1.00 50.38  ?  296 LEU E N   1 
ATOM   4376  C  CA  . LEU C  3 268 ? 153.122 85.861  141.609 1.00 50.38  ?  296 LEU E CA  1 
ATOM   4377  C  C   . LEU C  3 268 ? 151.689 85.392  141.420 1.00 50.38  ?  296 LEU E C   1 
ATOM   4378  O  O   . LEU C  3 268 ? 150.769 86.186  141.212 1.00 50.38  ?  296 LEU E O   1 
ATOM   4379  C  CB  . LEU C  3 268 ? 153.497 85.700  143.086 1.00 50.38  ?  296 LEU E CB  1 
ATOM   4380  C  CG  . LEU C  3 268 ? 154.984 85.556  143.399 1.00 50.38  ?  296 LEU E CG  1 
ATOM   4381  C  CD1 . LEU C  3 268 ? 155.640 86.902  143.498 1.00 50.38  ?  296 LEU E CD1 1 
ATOM   4382  C  CD2 . LEU C  3 268 ? 155.215 84.757  144.655 1.00 50.38  ?  296 LEU E CD2 1 
ATOM   4383  N  N   . ARG C  3 269 ? 151.516 84.077  141.505 1.00 47.46  ?  297 ARG E N   1 
ATOM   4384  C  CA  . ARG C  3 269 ? 150.228 83.428  141.346 1.00 47.46  ?  297 ARG E CA  1 
ATOM   4385  C  C   . ARG C  3 269 ? 149.947 82.563  142.563 1.00 47.46  ?  297 ARG E C   1 
ATOM   4386  O  O   . ARG C  3 269 ? 150.861 81.999  143.165 1.00 47.46  ?  297 ARG E O   1 
ATOM   4387  C  CB  . ARG C  3 269 ? 150.199 82.573  140.082 1.00 47.46  ?  297 ARG E CB  1 
ATOM   4388  C  CG  . ARG C  3 269 ? 150.337 83.382  138.817 1.00 47.46  ?  297 ARG E CG  1 
ATOM   4389  C  CD  . ARG C  3 269 ? 150.400 82.508  137.590 1.00 47.46  ?  297 ARG E CD  1 
ATOM   4390  N  NE  . ARG C  3 269 ? 149.165 81.773  137.350 1.00 47.46  ?  297 ARG E NE  1 
ATOM   4391  C  CZ  . ARG C  3 269 ? 149.031 80.857  136.399 1.00 47.46  ?  297 ARG E CZ  1 
ATOM   4392  N  NH1 . ARG C  3 269 ? 150.052 80.576  135.603 1.00 47.46  ?  297 ARG E NH1 1 
ATOM   4393  N  NH2 . ARG C  3 269 ? 147.880 80.223  136.235 1.00 47.46  ?  297 ARG E NH2 1 
ATOM   4394  N  N   . VAL C  3 270 ? 148.676 82.486  142.938 1.00 44.99  ?  298 VAL E N   1 
ATOM   4395  C  CA  . VAL C  3 270 ? 148.214 81.681  144.062 1.00 44.99  ?  298 VAL E CA  1 
ATOM   4396  C  C   . VAL C  3 270 ? 147.116 80.764  143.545 1.00 44.99  ?  298 VAL E C   1 
ATOM   4397  O  O   . VAL C  3 270 ? 146.281 81.187  142.741 1.00 44.99  ?  298 VAL E O   1 
ATOM   4398  C  CB  . VAL C  3 270 ? 147.703 82.571  145.218 1.00 44.99  ?  298 VAL E CB  1 
ATOM   4399  C  CG1 . VAL C  3 270 ? 147.168 81.747  146.367 1.00 44.99  ?  298 VAL E CG1 1 
ATOM   4400  C  CG2 . VAL C  3 270 ? 148.794 83.494  145.715 1.00 44.99  ?  298 VAL E CG2 1 
ATOM   4401  N  N   . PHE C  3 271 ? 147.124 79.507  143.975 1.00 50.39  ?  299 PHE E N   1 
ATOM   4402  C  CA  . PHE C  3 271 ? 146.123 78.538  143.556 1.00 50.39  ?  299 PHE E CA  1 
ATOM   4403  C  C   . PHE C  3 271 ? 145.206 78.216  144.729 1.00 50.39  ?  299 PHE E C   1 
ATOM   4404  O  O   . PHE C  3 271 ? 145.678 77.956  145.839 1.00 50.39  ?  299 PHE E O   1 
ATOM   4405  C  CB  . PHE C  3 271 ? 146.803 77.273  143.034 1.00 50.39  ?  299 PHE E CB  1 
ATOM   4406  C  CG  . PHE C  3 271 ? 145.867 76.262  142.459 1.00 50.39  ?  299 PHE E CG  1 
ATOM   4407  C  CD1 . PHE C  3 271 ? 145.361 76.416  141.181 1.00 50.39  ?  299 PHE E CD1 1 
ATOM   4408  C  CD2 . PHE C  3 271 ? 145.509 75.144  143.190 1.00 50.39  ?  299 PHE E CD2 1 
ATOM   4409  C  CE1 . PHE C  3 271 ? 144.507 75.475  140.646 1.00 50.39  ?  299 PHE E CE1 1 
ATOM   4410  C  CE2 . PHE C  3 271 ? 144.654 74.202  142.665 1.00 50.39  ?  299 PHE E CE2 1 
ATOM   4411  C  CZ  . PHE C  3 271 ? 144.152 74.368  141.391 1.00 50.39  ?  299 PHE E CZ  1 
ATOM   4412  N  N   . ASP C  3 272 ? 143.896 78.247  144.484 1.00 51.63  ?  300 ASP E N   1 
ATOM   4413  C  CA  . ASP C  3 272 ? 142.890 77.888  145.481 1.00 51.63  ?  300 ASP E CA  1 
ATOM   4414  C  C   . ASP C  3 272 ? 141.911 76.969  144.772 1.00 51.63  ?  300 ASP E C   1 
ATOM   4415  O  O   . ASP C  3 272 ? 141.567 77.214  143.612 1.00 51.63  ?  300 ASP E O   1 
ATOM   4416  C  CB  . ASP C  3 272 ? 142.200 79.147  146.038 1.00 51.63  ?  300 ASP E CB  1 
ATOM   4417  C  CG  . ASP C  3 272 ? 141.291 78.884  147.257 1.00 51.63  ?  300 ASP E CG  1 
ATOM   4418  O  OD1 . ASP C  3 272 ? 141.103 77.739  147.709 1.00 51.63  ?  300 ASP E OD1 1 
ATOM   4419  O  OD2 . ASP C  3 272 ? 140.749 79.875  147.784 1.00 51.63  ?  300 ASP E OD2 1 
ATOM   4420  N  N   . ALA C  3 273 ? 141.492 75.896  145.435 1.00 56.09  ?  301 ALA E N   1 
ATOM   4421  C  CA  . ALA C  3 273 ? 140.624 74.914  144.797 1.00 56.09  ?  301 ALA E CA  1 
ATOM   4422  C  C   . ALA C  3 273 ? 139.143 75.212  144.991 1.00 56.09  ?  301 ALA E C   1 
ATOM   4423  O  O   . ALA C  3 273 ? 138.332 74.282  144.970 1.00 56.09  ?  301 ALA E O   1 
ATOM   4424  C  CB  . ALA C  3 273 ? 140.945 73.512  145.315 1.00 56.09  ?  301 ALA E CB  1 
ATOM   4425  N  N   . ASP C  3 274 ? 138.772 76.471  145.173 1.00 55.62  ?  302 ASP E N   1 
ATOM   4426  C  CA  . ASP C  3 274 ? 137.416 76.849  145.523 1.00 55.62  ?  302 ASP E CA  1 
ATOM   4427  C  C   . ASP C  3 274 ? 136.774 77.656  144.400 1.00 55.62  ?  302 ASP E C   1 
ATOM   4428  O  O   . ASP C  3 274 ? 137.384 77.931  143.368 1.00 55.62  ?  302 ASP E O   1 
ATOM   4429  C  CB  . ASP C  3 274 ? 137.429 77.646  146.821 1.00 55.62  ?  302 ASP E CB  1 
ATOM   4430  C  CG  . ASP C  3 274 ? 137.826 76.808  148.006 1.00 55.62  ?  302 ASP E CG  1 
ATOM   4431  O  OD1 . ASP C  3 274 ? 137.483 75.605  148.016 1.00 55.62  ?  302 ASP E OD1 1 
ATOM   4432  O  OD2 . ASP C  3 274 ? 138.497 77.348  148.913 1.00 55.62  ?  302 ASP E OD2 1 
ATOM   4433  N  N   . VAL C  3 275 ? 135.499 77.994  144.592 1.00 49.94  ?  303 VAL E N   1 
ATOM   4434  C  CA  . VAL C  3 275 ? 134.779 78.942  143.747 1.00 49.94  ?  303 VAL E CA  1 
ATOM   4435  C  C   . VAL C  3 275 ? 134.118 79.966  144.668 1.00 49.94  ?  303 VAL E C   1 
ATOM   4436  O  O   . VAL C  3 275 ? 133.961 81.138  144.304 1.00 49.94  ?  303 VAL E O   1 
ATOM   4437  C  CB  . VAL C  3 275 ? 133.745 78.216  142.853 1.00 49.94  ?  303 VAL E CB  1 
ATOM   4438  C  CG1 . VAL C  3 275 ? 132.895 79.180  142.045 1.00 49.94  ?  303 VAL E CG1 1 
ATOM   4439  C  CG2 . VAL C  3 275 ? 134.425 77.258  141.895 1.00 49.94  ?  303 VAL E CG2 1 
ATOM   4440  N  N   . VAL C  3 276 ? 133.861 79.556  145.909 1.00 52.19  ?  304 VAL E N   1 
ATOM   4441  C  CA  . VAL C  3 276 ? 132.771 80.058  146.752 1.00 52.19  ?  304 VAL E CA  1 
ATOM   4442  C  C   . VAL C  3 276 ? 132.834 81.555  147.060 1.00 52.19  ?  304 VAL E C   1 
ATOM   4443  O  O   . VAL C  3 276 ? 131.792 82.217  146.934 1.00 52.19  ?  304 VAL E O   1 
ATOM   4444  C  CB  . VAL C  3 276 ? 132.668 79.213  148.034 1.00 52.19  ?  304 VAL E CB  1 
ATOM   4445  C  CG1 . VAL C  3 276 ? 131.603 79.744  148.988 1.00 52.19  ?  304 VAL E CG1 1 
ATOM   4446  C  CG2 . VAL C  3 276 ? 132.362 77.818  147.661 1.00 52.19  ?  304 VAL E CG2 1 
ATOM   4447  N  N   . PRO C  3 277 ? 133.985 82.178  147.425 1.00 50.99  ?  305 PRO E N   1 
ATOM   4448  C  CA  . PRO C  3 277 ? 133.964 83.645  147.424 1.00 50.99  ?  305 PRO E CA  1 
ATOM   4449  C  C   . PRO C  3 277 ? 133.961 84.163  145.997 1.00 50.99  ?  305 PRO E C   1 
ATOM   4450  O  O   . PRO C  3 277 ? 135.002 84.212  145.338 1.00 50.99  ?  305 PRO E O   1 
ATOM   4451  C  CB  . PRO C  3 277 ? 135.243 84.023  148.178 1.00 50.99  ?  305 PRO E CB  1 
ATOM   4452  C  CG  . PRO C  3 277 ? 135.577 82.829  148.973 1.00 50.99  ?  305 PRO E CG  1 
ATOM   4453  C  CD  . PRO C  3 277 ? 135.213 81.692  148.082 1.00 50.99  ?  305 PRO E CD  1 
ATOM   4454  N  N   . ALA C  3 278 ? 132.786 84.570  145.522 1.00 52.50  ?  306 ALA E N   1 
ATOM   4455  C  CA  . ALA C  3 278 ? 132.627 84.978  144.137 1.00 52.50  ?  306 ALA E CA  1 
ATOM   4456  C  C   . ALA C  3 278 ? 132.824 86.483  144.021 1.00 52.50  ?  306 ALA E C   1 
ATOM   4457  O  O   . ALA C  3 278 ? 132.956 87.194  145.020 1.00 52.50  ?  306 ALA E O   1 
ATOM   4458  C  CB  . ALA C  3 278 ? 131.261 84.557  143.610 1.00 52.50  ?  306 ALA E CB  1 
ATOM   4459  N  N   . SER C  3 279 ? 132.779 86.979  142.778 1.00 54.92  ?  307 SER E N   1 
ATOM   4460  C  CA  . SER C  3 279 ? 133.322 88.300  142.464 1.00 54.92  ?  307 SER E CA  1 
ATOM   4461  C  C   . SER C  3 279 ? 132.498 89.439  143.058 1.00 54.92  ?  307 SER E C   1 
ATOM   4462  O  O   . SER C  3 279 ? 132.949 90.588  143.087 1.00 54.92  ?  307 SER E O   1 
ATOM   4463  C  CB  . SER C  3 279 ? 133.438 88.465  140.951 1.00 54.92  ?  307 SER E CB  1 
ATOM   4464  O  OG  . SER C  3 279 ? 133.963 89.737  140.620 1.00 54.92  ?  307 SER E OG  1 
ATOM   4465  N  N   . GLY C  3 280 ? 131.291 89.144  143.538 1.00 53.29  ?  308 GLY E N   1 
ATOM   4466  C  CA  . GLY C  3 280 ? 130.578 90.123  144.337 1.00 53.29  ?  308 GLY E CA  1 
ATOM   4467  C  C   . GLY C  3 280 ? 131.174 90.277  145.723 1.00 53.29  ?  308 GLY E C   1 
ATOM   4468  O  O   . GLY C  3 280 ? 131.475 91.390  146.159 1.00 53.29  ?  308 GLY E O   1 
ATOM   4469  N  N   . GLU C  3 281 ? 131.363 89.165  146.429 1.00 57.95  ?  309 GLU E N   1 
ATOM   4470  C  CA  . GLU C  3 281 ? 131.908 89.166  147.779 1.00 57.95  ?  309 GLU E CA  1 
ATOM   4471  C  C   . GLU C  3 281 ? 133.406 88.906  147.815 1.00 57.95  ?  309 GLU E C   1 
ATOM   4472  O  O   . GLU C  3 281 ? 133.891 88.291  148.769 1.00 57.95  ?  309 GLU E O   1 
ATOM   4473  C  CB  . GLU C  3 281 ? 131.200 88.118  148.639 1.00 57.95  ?  309 GLU E CB  1 
ATOM   4474  C  CG  . GLU C  3 281 ? 129.748 88.410  148.933 1.00 57.95  ?  309 GLU E CG  1 
ATOM   4475  C  CD  . GLU C  3 281 ? 129.126 87.354  149.819 1.00 57.95  ?  309 GLU E CD  1 
ATOM   4476  O  OE1 . GLU C  3 281 ? 129.805 86.344  150.101 1.00 57.95  ?  309 GLU E OE1 1 
ATOM   4477  O  OE2 . GLU C  3 281 ? 127.963 87.532  150.235 1.00 57.95  ?  309 GLU E OE2 1 
ATOM   4478  N  N   . LEU C  3 282 ? 134.147 89.355  146.805 1.00 56.02  ?  310 LEU E N   1 
ATOM   4479  C  CA  . LEU C  3 282 ? 135.532 88.920  146.665 1.00 56.02  ?  310 LEU E CA  1 
ATOM   4480  C  C   . LEU C  3 282 ? 136.508 89.926  147.257 1.00 56.02  ?  310 LEU E C   1 
ATOM   4481  O  O   . LEU C  3 282 ? 137.548 89.540  147.801 1.00 56.02  ?  310 LEU E O   1 
ATOM   4482  C  CB  . LEU C  3 282 ? 135.830 88.672  145.194 1.00 56.02  ?  310 LEU E CB  1 
ATOM   4483  C  CG  . LEU C  3 282 ? 137.135 88.037  144.770 1.00 56.02  ?  310 LEU E CG  1 
ATOM   4484  C  CD1 . LEU C  3 282 ? 136.795 87.073  143.671 1.00 56.02  ?  310 LEU E CD1 1 
ATOM   4485  C  CD2 . LEU C  3 282 ? 138.070 89.110  144.254 1.00 56.02  ?  310 LEU E CD2 1 
ATOM   4486  N  N   . VAL C  3 283 ? 136.208 91.219  147.130 1.00 56.42  ?  311 VAL E N   1 
ATOM   4487  C  CA  . VAL C  3 283 ? 137.087 92.245  147.677 1.00 56.42  ?  311 VAL E CA  1 
ATOM   4488  C  C   . VAL C  3 283 ? 137.025 92.228  149.199 1.00 56.42  ?  311 VAL E C   1 
ATOM   4489  O  O   . VAL C  3 283 ? 138.011 92.540  149.879 1.00 56.42  ?  311 VAL E O   1 
ATOM   4490  C  CB  . VAL C  3 283 ? 136.696 93.612  147.081 1.00 56.42  ?  311 VAL E CB  1 
ATOM   4491  C  CG1 . VAL C  3 283 ? 137.619 94.727  147.551 1.00 56.42  ?  311 VAL E CG1 1 
ATOM   4492  C  CG2 . VAL C  3 283 ? 136.686 93.536  145.567 1.00 56.42  ?  311 VAL E CG2 1 
ATOM   4493  N  N   . ARG C  3 284 ? 135.900 91.801  149.758 1.00 57.48  ?  312 ARG E N   1 
ATOM   4494  C  CA  . ARG C  3 284 ? 135.711 91.808  151.198 1.00 57.48  ?  312 ARG E CA  1 
ATOM   4495  C  C   . ARG C  3 284 ? 136.181 90.530  151.879 1.00 57.48  ?  312 ARG E C   1 
ATOM   4496  O  O   . ARG C  3 284 ? 136.138 90.455  153.112 1.00 57.48  ?  312 ARG E O   1 
ATOM   4497  C  CB  . ARG C  3 284 ? 134.234 92.044  151.515 1.00 57.48  ?  312 ARG E CB  1 
ATOM   4498  C  CG  . ARG C  3 284 ? 133.740 93.403  151.065 1.00 57.48  ?  312 ARG E CG  1 
ATOM   4499  C  CD  . ARG C  3 284 ? 132.281 93.612  151.402 1.00 57.48  ?  312 ARG E CD  1 
ATOM   4500  N  NE  . ARG C  3 284 ? 131.809 94.901  150.911 1.00 57.48  ?  312 ARG E NE  1 
ATOM   4501  C  CZ  . ARG C  3 284 ? 131.888 96.033  151.601 1.00 57.48  ?  312 ARG E CZ  1 
ATOM   4502  N  NH1 . ARG C  3 284 ? 132.419 96.036  152.816 1.00 57.48  ?  312 ARG E NH1 1 
ATOM   4503  N  NH2 . ARG C  3 284 ? 131.435 97.165  151.078 1.00 57.48  ?  312 ARG E NH2 1 
ATOM   4504  N  N   . ARG C  3 285 ? 136.618 89.525  151.124 1.00 57.57  ?  313 ARG E N   1 
ATOM   4505  C  CA  . ARG C  3 285 ? 137.004 88.239  151.696 1.00 57.57  ?  313 ARG E CA  1 
ATOM   4506  C  C   . ARG C  3 285 ? 138.385 87.762  151.275 1.00 57.57  ?  313 ARG E C   1 
ATOM   4507  O  O   . ARG C  3 285 ? 138.934 86.857  151.904 1.00 57.57  ?  313 ARG E O   1 
ATOM   4508  C  CB  . ARG C  3 285 ? 135.971 87.169  151.329 1.00 57.57  ?  313 ARG E CB  1 
ATOM   4509  C  CG  . ARG C  3 285 ? 134.589 87.431  151.889 1.00 57.57  ?  313 ARG E CG  1 
ATOM   4510  C  CD  . ARG C  3 285 ? 134.583 87.300  153.398 1.00 57.57  ?  313 ARG E CD  1 
ATOM   4511  N  NE  . ARG C  3 285 ? 133.271 87.600  153.959 1.00 57.57  ?  313 ARG E NE  1 
ATOM   4512  C  CZ  . ARG C  3 285 ? 132.298 86.707  154.099 1.00 57.57  ?  313 ARG E CZ  1 
ATOM   4513  N  NH1 . ARG C  3 285 ? 132.484 85.454  153.712 1.00 57.57  ?  313 ARG E NH1 1 
ATOM   4514  N  NH2 . ARG C  3 285 ? 131.135 87.068  154.621 1.00 57.57  ?  313 ARG E NH2 1 
ATOM   4515  N  N   . TYR C  3 286 ? 138.957 88.333  150.219 1.00 59.13  ?  314 TYR E N   1 
ATOM   4516  C  CA  . TYR C  3 286 ? 140.333 88.049  149.814 1.00 59.13  ?  314 TYR E CA  1 
ATOM   4517  C  C   . TYR C  3 286 ? 141.156 89.298  150.065 1.00 59.13  ?  314 TYR E C   1 
ATOM   4518  O  O   . TYR C  3 286 ? 141.289 90.158  149.195 1.00 59.13  ?  314 TYR E O   1 
ATOM   4519  C  CB  . TYR C  3 286 ? 140.399 87.663  148.348 1.00 59.13  ?  314 TYR E CB  1 
ATOM   4520  C  CG  . TYR C  3 286 ? 139.840 86.318  148.028 1.00 59.13  ?  314 TYR E CG  1 
ATOM   4521  C  CD1 . TYR C  3 286 ? 139.773 85.321  148.986 1.00 59.13  ?  314 TYR E CD1 1 
ATOM   4522  C  CD2 . TYR C  3 286 ? 139.342 86.056  146.768 1.00 59.13  ?  314 TYR E CD2 1 
ATOM   4523  C  CE1 . TYR C  3 286 ? 139.247 84.086  148.675 1.00 59.13  ?  314 TYR E CE1 1 
ATOM   4524  C  CE2 . TYR C  3 286 ? 138.801 84.842  146.453 1.00 59.13  ?  314 TYR E CE2 1 
ATOM   4525  C  CZ  . TYR C  3 286 ? 138.763 83.853  147.399 1.00 59.13  ?  314 TYR E CZ  1 
ATOM   4526  O  OH  . TYR C  3 286 ? 138.224 82.637  147.053 1.00 59.13  ?  314 TYR E OH  1 
ATOM   4527  N  N   . THR C  3 287 ? 141.729 89.411  151.253 1.00 54.97  ?  315 THR E N   1 
ATOM   4528  C  CA  . THR C  3 287 ? 142.427 90.644  151.591 1.00 54.97  ?  315 THR E CA  1 
ATOM   4529  C  C   . THR C  3 287 ? 143.928 90.460  151.418 1.00 54.97  ?  315 THR E C   1 
ATOM   4530  O  O   . THR C  3 287 ? 144.521 89.538  151.991 1.00 54.97  ?  315 THR E O   1 
ATOM   4531  C  CB  . THR C  3 287 ? 142.095 91.125  153.005 1.00 54.97  ?  315 THR E CB  1 
ATOM   4532  O  OG1 . THR C  3 287 ? 142.564 90.187  153.968 1.00 54.97  ?  315 THR E OG1 1 
ATOM   4533  C  CG2 . THR C  3 287 ? 140.598 91.286  153.165 1.00 54.97  ?  315 THR E CG2 1 
ATOM   4534  N  N   . SER C  3 288 ? 144.521 91.322  150.594 1.00 50.80  ?  316 SER E N   1 
ATOM   4535  C  CA  . SER C  3 288 ? 145.961 91.377  150.388 1.00 50.80  ?  316 SER E CA  1 
ATOM   4536  C  C   . SER C  3 288 ? 146.509 92.584  151.133 1.00 50.80  ?  316 SER E C   1 
ATOM   4537  O  O   . SER C  3 288 ? 146.153 93.725  150.823 1.00 50.80  ?  316 SER E O   1 
ATOM   4538  C  CB  . SER C  3 288 ? 146.300 91.478  148.906 1.00 50.80  ?  316 SER E CB  1 
ATOM   4539  O  OG  . SER C  3 288 ? 145.876 92.718  148.380 1.00 50.80  ?  316 SER E OG  1 
ATOM   4540  N  N   . THR C  3 289 ? 147.381 92.330  152.101 1.00 56.02  ?  317 THR E N   1 
ATOM   4541  C  CA  . THR C  3 289 ? 147.920 93.368  152.972 1.00 56.02  ?  317 THR E CA  1 
ATOM   4542  C  C   . THR C  3 289 ? 149.407 93.519  152.687 1.00 56.02  ?  317 THR E C   1 
ATOM   4543  O  O   . THR C  3 289 ? 150.170 92.559  152.828 1.00 56.02  ?  317 THR E O   1 
ATOM   4544  C  CB  . THR C  3 289 ? 147.687 93.027  154.442 1.00 56.02  ?  317 THR E CB  1 
ATOM   4545  O  OG1 . THR C  3 289 ? 146.282 92.882  154.683 1.00 56.02  ?  317 THR E OG1 1 
ATOM   4546  C  CG2 . THR C  3 289 ? 148.232 94.129  155.330 1.00 56.02  ?  317 THR E CG2 1 
ATOM   4547  N  N   . LEU C  3 290 ? 149.814 94.714  152.275 1.00 56.29  ?  318 LEU E N   1 
ATOM   4548  C  CA  . LEU C  3 290 ? 151.232 95.017  152.124 1.00 56.29  ?  318 LEU E CA  1 
ATOM   4549  C  C   . LEU C  3 290 ? 151.811 95.325  153.497 1.00 56.29  ?  318 LEU E C   1 
ATOM   4550  O  O   . LEU C  3 290 ? 151.385 96.279  154.156 1.00 56.29  ?  318 LEU E O   1 
ATOM   4551  C  CB  . LEU C  3 290 ? 151.417 96.181  151.158 1.00 56.29  ?  318 LEU E CB  1 
ATOM   4552  C  CG  . LEU C  3 290 ? 152.842 96.643  150.878 1.00 56.29  ?  318 LEU E CG  1 
ATOM   4553  C  CD1 . LEU C  3 290 ? 153.678 95.494  150.374 1.00 56.29  ?  318 LEU E CD1 1 
ATOM   4554  C  CD2 . LEU C  3 290 ? 152.806 97.745  149.844 1.00 56.29  ?  318 LEU E CD2 1 
ATOM   4555  N  N   . LEU C  3 291 ? 152.765 94.508  153.938 1.00 58.16  ?  319 LEU E N   1 
ATOM   4556  C  CA  . LEU C  3 291 ? 153.266 94.606  155.298 1.00 58.16  ?  319 LEU E CA  1 
ATOM   4557  C  C   . LEU C  3 291 ? 154.136 95.852  155.464 1.00 58.16  ?  319 LEU E C   1 
ATOM   4558  O  O   . LEU C  3 291 ? 154.853 96.245  154.539 1.00 58.16  ?  319 LEU E O   1 
ATOM   4559  C  CB  . LEU C  3 291 ? 154.054 93.350  155.660 1.00 58.16  ?  319 LEU E CB  1 
ATOM   4560  C  CG  . LEU C  3 291 ? 153.187 92.098  155.776 1.00 58.16  ?  319 LEU E CG  1 
ATOM   4561  C  CD1 . LEU C  3 291 ? 154.037 90.877  156.051 1.00 58.16  ?  319 LEU E CD1 1 
ATOM   4562  C  CD2 . LEU C  3 291 ? 152.148 92.276  156.865 1.00 58.16  ?  319 LEU E CD2 1 
ATOM   4563  N  N   . PRO C  3 292 ? 154.077 96.505  156.628 1.00 65.00  ?  320 PRO E N   1 
ATOM   4564  C  CA  . PRO C  3 292 ? 154.792 97.779  156.804 1.00 65.00  ?  320 PRO E CA  1 
ATOM   4565  C  C   . PRO C  3 292 ? 156.295 97.577  156.923 1.00 65.00  ?  320 PRO E C   1 
ATOM   4566  O  O   . PRO C  3 292 ? 156.772 96.781  157.735 1.00 65.00  ?  320 PRO E O   1 
ATOM   4567  C  CB  . PRO C  3 292 ? 154.191 98.346  158.095 1.00 65.00  ?  320 PRO E CB  1 
ATOM   4568  C  CG  . PRO C  3 292 ? 153.706 97.159  158.836 1.00 65.00  ?  320 PRO E CG  1 
ATOM   4569  C  CD  . PRO C  3 292 ? 153.237 96.187  157.796 1.00 65.00  ?  320 PRO E CD  1 
ATOM   4570  N  N   . GLY C  3 293 ? 157.035 98.305  156.101 1.00 71.98  ?  321 GLY E N   1 
ATOM   4571  C  CA  . GLY C  3 293 ? 158.489 98.338  156.180 1.00 71.98  ?  321 GLY E CA  1 
ATOM   4572  C  C   . GLY C  3 293 ? 158.954 99.764  156.136 1.00 71.98  ?  321 GLY E C   1 
ATOM   4573  O  O   . GLY C  3 293 ? 158.534 100.586 156.963 1.00 71.98  ?  321 GLY E O   1 
ATOM   4574  N  N   . ASP C  3 294 ? 159.823 100.075 155.179 1.00 72.06  ?  322 ASP E N   1 
ATOM   4575  C  CA  . ASP C  3 294 ? 160.197 101.462 154.945 1.00 72.06  ?  322 ASP E CA  1 
ATOM   4576  C  C   . ASP C  3 294 ? 159.023 102.227 154.351 1.00 72.06  ?  322 ASP E C   1 
ATOM   4577  O  O   . ASP C  3 294 ? 158.265 101.696 153.537 1.00 72.06  ?  322 ASP E O   1 
ATOM   4578  C  CB  . ASP C  3 294 ? 161.400 101.539 154.009 1.00 72.06  ?  322 ASP E CB  1 
ATOM   4579  C  CG  . ASP C  3 294 ? 162.672 101.045 154.657 1.00 72.06  ?  322 ASP E CG  1 
ATOM   4580  O  OD1 . ASP C  3 294 ? 162.791 101.156 155.895 1.00 72.06  ?  322 ASP E OD1 1 
ATOM   4581  O  OD2 . ASP C  3 294 ? 163.557 100.552 153.928 1.00 72.06  ?  322 ASP E OD2 1 
ATOM   4582  N  N   . THR C  3 295 ? 158.877 103.491 154.754 1.00 67.26  ?  323 THR E N   1 
ATOM   4583  C  CA  . THR C  3 295 ? 157.767 104.299 154.262 1.00 67.26  ?  323 THR E CA  1 
ATOM   4584  C  C   . THR C  3 295 ? 157.963 104.770 152.829 1.00 67.26  ?  323 THR E C   1 
ATOM   4585  O  O   . THR C  3 295 ? 157.036 105.353 152.258 1.00 67.26  ?  323 THR E O   1 
ATOM   4586  C  CB  . THR C  3 295 ? 157.549 105.513 155.161 1.00 67.26  ?  323 THR E CB  1 
ATOM   4587  O  OG1 . THR C  3 295 ? 156.360 106.198 154.748 1.00 67.26  ?  323 THR E OG1 1 
ATOM   4588  C  CG2 . THR C  3 295 ? 158.732 106.461 155.067 1.00 67.26  ?  323 THR E CG2 1 
ATOM   4589  N  N   . TRP C  3 296 ? 159.136 104.545 152.240 1.00 66.89  ?  324 TRP E N   1 
ATOM   4590  C  CA  . TRP C  3 296 ? 159.321 104.822 150.825 1.00 66.89  ?  324 TRP E CA  1 
ATOM   4591  C  C   . TRP C  3 296 ? 158.692 103.741 149.960 1.00 66.89  ?  324 TRP E C   1 
ATOM   4592  O  O   . TRP C  3 296 ? 158.413 103.986 148.784 1.00 66.89  ?  324 TRP E O   1 
ATOM   4593  C  CB  . TRP C  3 296 ? 160.812 104.958 150.524 1.00 66.89  ?  324 TRP E CB  1 
ATOM   4594  C  CG  . TRP C  3 296 ? 161.154 105.395 149.133 1.00 66.89  ?  324 TRP E CG  1 
ATOM   4595  C  CD1 . TRP C  3 296 ? 160.870 106.597 148.562 1.00 66.89  ?  324 TRP E CD1 1 
ATOM   4596  C  CD2 . TRP C  3 296 ? 161.868 104.643 148.149 1.00 66.89  ?  324 TRP E CD2 1 
ATOM   4597  N  NE1 . TRP C  3 296 ? 161.353 106.638 147.280 1.00 66.89  ?  324 TRP E NE1 1 
ATOM   4598  C  CE2 . TRP C  3 296 ? 161.971 105.450 147.002 1.00 66.89  ?  324 TRP E CE2 1 
ATOM   4599  C  CE3 . TRP C  3 296 ? 162.422 103.363 148.122 1.00 66.89  ?  324 TRP E CE3 1 
ATOM   4600  C  CZ2 . TRP C  3 296 ? 162.604 105.021 145.844 1.00 66.89  ?  324 TRP E CZ2 1 
ATOM   4601  C  CZ3 . TRP C  3 296 ? 163.056 102.941 146.969 1.00 66.89  ?  324 TRP E CZ3 1 
ATOM   4602  C  CH2 . TRP C  3 296 ? 163.139 103.767 145.846 1.00 66.89  ?  324 TRP E CH2 1 
ATOM   4603  N  N   . ALA C  3 297 ? 158.453 102.557 150.521 1.00 63.12  ?  325 ALA E N   1 
ATOM   4604  C  CA  . ALA C  3 297 ? 157.751 101.494 149.816 1.00 63.12  ?  325 ALA E CA  1 
ATOM   4605  C  C   . ALA C  3 297 ? 156.298 101.847 149.541 1.00 63.12  ?  325 ALA E C   1 
ATOM   4606  O  O   . ALA C  3 297 ? 155.868 101.850 148.382 1.00 63.12  ?  325 ALA E O   1 
ATOM   4607  C  CB  . ALA C  3 297 ? 157.810 100.198 150.626 1.00 63.12  ?  325 ALA E CB  1 
ATOM   4608  N  N   . GLN C  3 298 ? 155.544 102.177 150.593 1.00 61.91  ?  326 GLN E N   1 
ATOM   4609  C  CA  . GLN C  3 298 ? 154.101 102.338 150.467 1.00 61.91  ?  326 GLN E CA  1 
ATOM   4610  C  C   . GLN C  3 298 ? 153.727 103.646 149.787 1.00 61.91  ?  326 GLN E C   1 
ATOM   4611  O  O   . GLN C  3 298 ? 152.562 103.841 149.427 1.00 61.91  ?  326 GLN E O   1 
ATOM   4612  C  CB  . GLN C  3 298 ? 153.455 102.250 151.845 1.00 61.91  ?  326 GLN E CB  1 
ATOM   4613  C  CG  . GLN C  3 298 ? 153.663 100.907 152.510 1.00 61.91  ?  326 GLN E CG  1 
ATOM   4614  C  CD  . GLN C  3 298 ? 153.031 100.832 153.877 1.00 61.91  ?  326 GLN E CD  1 
ATOM   4615  O  OE1 . GLN C  3 298 ? 152.468 101.809 154.369 1.00 61.91  ?  326 GLN E OE1 1 
ATOM   4616  N  NE2 . GLN C  3 298 ? 153.119 99.667  154.503 1.00 61.91  ?  326 GLN E NE2 1 
ATOM   4617  N  N   . GLN C  3 299 ? 154.685 104.551 149.612 1.00 64.06  ?  327 GLN E N   1 
ATOM   4618  C  CA  . GLN C  3 299 ? 154.453 105.752 148.825 1.00 64.06  ?  327 GLN E CA  1 
ATOM   4619  C  C   . GLN C  3 299 ? 154.898 105.598 147.381 1.00 64.06  ?  327 GLN E C   1 
ATOM   4620  O  O   . GLN C  3 299 ? 154.681 106.516 146.585 1.00 64.06  ?  327 GLN E O   1 
ATOM   4621  C  CB  . GLN C  3 299 ? 155.173 106.942 149.456 1.00 64.06  ?  327 GLN E CB  1 
ATOM   4622  C  CG  . GLN C  3 299 ? 154.593 107.381 150.784 1.00 64.06  ?  327 GLN E CG  1 
ATOM   4623  C  CD  . GLN C  3 299 ? 155.373 108.518 151.402 1.00 64.06  ?  327 GLN E CD  1 
ATOM   4624  O  OE1 . GLN C  3 299 ? 156.411 108.925 150.884 1.00 64.06  ?  327 GLN E OE1 1 
ATOM   4625  N  NE2 . GLN C  3 299 ? 154.874 109.042 152.514 1.00 64.06  ?  327 GLN E NE2 1 
ATOM   4626  N  N   . THR C  3 300 ? 155.518 104.475 147.025 1.00 60.99  ?  328 THR E N   1 
ATOM   4627  C  CA  . THR C  3 300 ? 155.963 104.229 145.660 1.00 60.99  ?  328 THR E CA  1 
ATOM   4628  C  C   . THR C  3 300 ? 155.432 102.941 145.054 1.00 60.99  ?  328 THR E C   1 
ATOM   4629  O  O   . THR C  3 300 ? 155.397 102.825 143.828 1.00 60.99  ?  328 THR E O   1 
ATOM   4630  C  CB  . THR C  3 300 ? 157.494 104.200 145.593 1.00 60.99  ?  328 THR E CB  1 
ATOM   4631  O  OG1 . THR C  3 300 ? 157.991 103.236 146.529 1.00 60.99  ?  328 THR E OG1 1 
ATOM   4632  C  CG2 . THR C  3 300 ? 158.081 105.571 145.897 1.00 60.99  ?  328 THR E CG2 1 
ATOM   4633  N  N   . PHE C  3 301 ? 155.022 101.972 145.868 1.00 58.88  ?  329 PHE E N   1 
ATOM   4634  C  CA  . PHE C  3 301 ? 154.553 100.687 145.374 1.00 58.88  ?  329 PHE E CA  1 
ATOM   4635  C  C   . PHE C  3 301 ? 153.160 100.382 145.904 1.00 58.88  ?  329 PHE E C   1 
ATOM   4636  O  O   . PHE C  3 301 ? 152.856 100.631 147.073 1.00 58.88  ?  329 PHE E O   1 
ATOM   4637  C  CB  . PHE C  3 301 ? 155.504 99.557  145.779 1.00 58.88  ?  329 PHE E CB  1 
ATOM   4638  C  CG  . PHE C  3 301 ? 156.828 99.595  145.078 1.00 58.88  ?  329 PHE E CG  1 
ATOM   4639  C  CD1 . PHE C  3 301 ? 156.956 99.106  143.789 1.00 58.88  ?  329 PHE E CD1 1 
ATOM   4640  C  CD2 . PHE C  3 301 ? 157.947 100.103 145.711 1.00 58.88  ?  329 PHE E CD2 1 
ATOM   4641  C  CE1 . PHE C  3 301 ? 158.174 99.130  143.142 1.00 58.88  ?  329 PHE E CE1 1 
ATOM   4642  C  CE2 . PHE C  3 301 ? 159.169 100.133 145.065 1.00 58.88  ?  329 PHE E CE2 1 
ATOM   4643  C  CZ  . PHE C  3 301 ? 159.280 99.648  143.779 1.00 58.88  ?  329 PHE E CZ  1 
ATOM   4644  N  N   . ARG C  3 302 ? 152.312 99.832  145.033 1.00 50.98  ?  330 ARG E N   1 
ATOM   4645  C  CA  . ARG C  3 302 ? 151.021 99.305  145.452 1.00 50.98  ?  330 ARG E CA  1 
ATOM   4646  C  C   . ARG C  3 302 ? 150.887 97.867  144.977 1.00 50.98  ?  330 ARG E C   1 
ATOM   4647  O  O   . ARG C  3 302 ? 151.446 97.486  143.943 1.00 50.98  ?  330 ARG E O   1 
ATOM   4648  C  CB  . ARG C  3 302 ? 149.846 100.151 144.936 1.00 50.98  ?  330 ARG E CB  1 
ATOM   4649  C  CG  . ARG C  3 302 ? 149.652 100.183 143.430 1.00 50.98  ?  330 ARG E CG  1 
ATOM   4650  C  CD  . ARG C  3 302 ? 148.438 101.030 143.083 1.00 50.98  ?  330 ARG E CD  1 
ATOM   4651  N  NE  . ARG C  3 302 ? 148.128 101.013 141.659 1.00 50.98  ?  330 ARG E NE  1 
ATOM   4652  C  CZ  . ARG C  3 302 ? 148.564 101.913 140.786 1.00 50.98  ?  330 ARG E CZ  1 
ATOM   4653  N  NH1 . ARG C  3 302 ? 149.318 102.922 141.192 1.00 50.98  ?  330 ARG E NH1 1 
ATOM   4654  N  NH2 . ARG C  3 302 ? 148.230 101.814 139.508 1.00 50.98  ?  330 ARG E NH2 1 
ATOM   4655  N  N   . VAL C  3 303 ? 150.159 97.066  145.750 1.00 48.64  ?  331 VAL E N   1 
ATOM   4656  C  CA  . VAL C  3 303 ? 150.010 95.643  145.475 1.00 48.64  ?  331 VAL E CA  1 
ATOM   4657  C  C   . VAL C  3 303 ? 148.645 95.451  144.827 1.00 48.64  ?  331 VAL E C   1 
ATOM   4658  O  O   . VAL C  3 303 ? 147.612 95.497  145.493 1.00 48.64  ?  331 VAL E O   1 
ATOM   4659  C  CB  . VAL C  3 303 ? 150.152 94.804  146.743 1.00 48.64  ?  331 VAL E CB  1 
ATOM   4660  C  CG1 . VAL C  3 303 ? 149.963 93.334  146.425 1.00 48.64  ?  331 VAL E CG1 1 
ATOM   4661  C  CG2 . VAL C  3 303 ? 151.500 95.046  147.371 1.00 48.64  ?  331 VAL E CG2 1 
ATOM   4662  N  N   . GLU C  3 304 ? 148.643 95.228  143.521 1.00 50.02  ?  332 GLU E N   1 
ATOM   4663  C  CA  . GLU C  3 304 ? 147.410 95.090  142.765 1.00 50.02  ?  332 GLU E CA  1 
ATOM   4664  C  C   . GLU C  3 304 ? 147.086 93.611  142.595 1.00 50.02  ?  332 GLU E C   1 
ATOM   4665  O  O   . GLU C  3 304 ? 147.918 92.835  142.107 1.00 50.02  ?  332 GLU E O   1 
ATOM   4666  C  CB  . GLU C  3 304 ? 147.534 95.793  141.420 1.00 50.02  ?  332 GLU E CB  1 
ATOM   4667  C  CG  . GLU C  3 304 ? 146.258 95.823  140.643 1.00 50.02  ?  332 GLU E CG  1 
ATOM   4668  C  CD  . GLU C  3 304 ? 146.347 96.718  139.432 1.00 50.02  ?  332 GLU E CD  1 
ATOM   4669  O  OE1 . GLU C  3 304 ? 147.417 97.321  139.217 1.00 50.02  ?  332 GLU E OE1 1 
ATOM   4670  O  OE2 . GLU C  3 304 ? 145.343 96.826  138.697 1.00 50.02  ?  332 GLU E OE2 1 
ATOM   4671  N  N   . HIS C  3 305 ? 145.879 93.234  143.009 1.00 48.88  ?  333 HIS E N   1 
ATOM   4672  C  CA  . HIS C  3 305 ? 145.414 91.854  143.075 1.00 48.88  ?  333 HIS E CA  1 
ATOM   4673  C  C   . HIS C  3 305 ? 144.187 91.639  142.210 1.00 48.88  ?  333 HIS E C   1 
ATOM   4674  O  O   . HIS C  3 305 ? 143.222 92.401  142.308 1.00 48.88  ?  333 HIS E O   1 
ATOM   4675  C  CB  . HIS C  3 305 ? 145.065 91.475  144.509 1.00 48.88  ?  333 HIS E CB  1 
ATOM   4676  C  CG  . HIS C  3 305 ? 144.111 90.326  144.605 1.00 48.88  ?  333 HIS E CG  1 
ATOM   4677  N  ND1 . HIS C  3 305 ? 144.440 89.045  144.228 1.00 48.88  ?  333 HIS E ND1 1 
ATOM   4678  C  CD2 . HIS C  3 305 ? 142.829 90.271  145.037 1.00 48.88  ?  333 HIS E CD2 1 
ATOM   4679  C  CE1 . HIS C  3 305 ? 143.404 88.250  144.423 1.00 48.88  ?  333 HIS E CE1 1 
ATOM   4680  N  NE2 . HIS C  3 305 ? 142.411 88.970  144.911 1.00 48.88  ?  333 HIS E NE2 1 
ATOM   4681  N  N   . TRP C  3 306 ? 144.204 90.573  141.404 1.00 50.23  ?  334 TRP E N   1 
ATOM   4682  C  CA  . TRP C  3 306 ? 142.936 90.159  140.822 1.00 50.23  ?  334 TRP E CA  1 
ATOM   4683  C  C   . TRP C  3 306 ? 142.865 88.662  140.579 1.00 50.23  ?  334 TRP E C   1 
ATOM   4684  O  O   . TRP C  3 306 ? 143.883 88.047  140.238 1.00 50.23  ?  334 TRP E O   1 
ATOM   4685  C  CB  . TRP C  3 306 ? 142.621 90.887  139.514 1.00 50.23  ?  334 TRP E CB  1 
ATOM   4686  C  CG  . TRP C  3 306 ? 143.600 90.759  138.432 1.00 50.23  ?  334 TRP E CG  1 
ATOM   4687  C  CD1 . TRP C  3 306 ? 143.764 89.702  137.587 1.00 50.23  ?  334 TRP E CD1 1 
ATOM   4688  C  CD2 . TRP C  3 306 ? 144.476 91.780  137.975 1.00 50.23  ?  334 TRP E CD2 1 
ATOM   4689  N  NE1 . TRP C  3 306 ? 144.740 89.981  136.671 1.00 50.23  ?  334 TRP E NE1 1 
ATOM   4690  C  CE2 . TRP C  3 306 ? 145.190 91.258  136.884 1.00 50.23  ?  334 TRP E CE2 1 
ATOM   4691  C  CE3 . TRP C  3 306 ? 144.745 93.080  138.399 1.00 50.23  ?  334 TRP E CE3 1 
ATOM   4692  C  CZ2 . TRP C  3 306 ? 146.151 91.992  136.207 1.00 50.23  ?  334 TRP E CZ2 1 
ATOM   4693  C  CZ3 . TRP C  3 306 ? 145.703 93.803  137.732 1.00 50.23  ?  334 TRP E CZ3 1 
ATOM   4694  C  CH2 . TRP C  3 306 ? 146.399 93.259  136.648 1.00 50.23  ?  334 TRP E CH2 1 
ATOM   4695  N  N   . PRO C  3 307 ? 141.698 88.055  140.738 1.00 45.90  ?  335 PRO E N   1 
ATOM   4696  C  CA  . PRO C  3 307 ? 141.581 86.617  140.510 1.00 45.90  ?  335 PRO E CA  1 
ATOM   4697  C  C   . PRO C  3 307 ? 141.200 86.264  139.090 1.00 45.90  ?  335 PRO E C   1 
ATOM   4698  O  O   . PRO C  3 307 ? 141.017 87.131  138.233 1.00 45.90  ?  335 PRO E O   1 
ATOM   4699  C  CB  . PRO C  3 307 ? 140.458 86.217  141.458 1.00 45.90  ?  335 PRO E CB  1 
ATOM   4700  C  CG  . PRO C  3 307 ? 139.602 87.389  141.420 1.00 45.90  ?  335 PRO E CG  1 
ATOM   4701  C  CD  . PRO C  3 307 ? 140.488 88.585  141.373 1.00 45.90  ?  335 PRO E CD  1 
ATOM   4702  N  N   . ASN C  3 308 ? 141.051 84.963  138.863 1.00 55.66  ?  336 ASN E N   1 
ATOM   4703  C  CA  . ASN C  3 308 ? 140.466 84.372  137.673 1.00 55.66  ?  336 ASN E CA  1 
ATOM   4704  C  C   . ASN C  3 308 ? 140.058 82.969  138.083 1.00 55.66  ?  336 ASN E C   1 
ATOM   4705  O  O   . ASN C  3 308 ? 140.479 82.502  139.140 1.00 55.66  ?  336 ASN E O   1 
ATOM   4706  C  CB  . ASN C  3 308 ? 141.475 84.329  136.526 1.00 55.66  ?  336 ASN E CB  1 
ATOM   4707  C  CG  . ASN C  3 308 ? 140.819 84.226  135.180 1.00 55.66  ?  336 ASN E CG  1 
ATOM   4708  O  OD1 . ASN C  3 308 ? 139.597 84.204  135.072 1.00 55.66  ?  336 ASN E OD1 1 
ATOM   4709  N  ND2 . ASN C  3 308 ? 141.631 84.164  134.138 1.00 55.66  ?  336 ASN E ND2 1 
ATOM   4710  N  N   . GLU C  3 309 ? 139.259 82.293  137.270 1.00 59.90  ?  337 GLU E N   1 
ATOM   4711  C  CA  . GLU C  3 309 ? 138.927 80.904  137.554 1.00 59.90  ?  337 GLU E CA  1 
ATOM   4712  C  C   . GLU C  3 309 ? 139.029 80.064  136.289 1.00 59.90  ?  337 GLU E C   1 
ATOM   4713  O  O   . GLU C  3 309 ? 138.623 80.497  135.205 1.00 59.90  ?  337 GLU E O   1 
ATOM   4714  C  CB  . GLU C  3 309 ? 137.547 80.779  138.210 1.00 59.90  ?  337 GLU E CB  1 
ATOM   4715  C  CG  . GLU C  3 309 ? 136.341 81.216  137.398 1.00 59.90  ?  337 GLU E CG  1 
ATOM   4716  C  CD  . GLU C  3 309 ? 135.056 81.138  138.209 1.00 59.90  ?  337 GLU E CD  1 
ATOM   4717  O  OE1 . GLU C  3 309 ? 135.130 80.783  139.404 1.00 59.90  ?  337 GLU E OE1 1 
ATOM   4718  O  OE2 . GLU C  3 309 ? 133.974 81.431  137.655 1.00 59.90  ?  337 GLU E OE2 1 
ATOM   4719  N  N   . THR C  3 310 ? 139.598 78.872  136.438 1.00 66.11  ?  338 THR E N   1 
ATOM   4720  C  CA  . THR C  3 310 ? 139.901 77.990  135.324 1.00 66.11  ?  338 THR E CA  1 
ATOM   4721  C  C   . THR C  3 310 ? 139.555 76.562  135.730 1.00 66.11  ?  338 THR E C   1 
ATOM   4722  O  O   . THR C  3 310 ? 138.952 76.327  136.782 1.00 66.11  ?  338 THR E O   1 
ATOM   4723  C  CB  . THR C  3 310 ? 141.369 78.143  134.907 1.00 66.11  ?  338 THR E CB  1 
ATOM   4724  O  OG1 . THR C  3 310 ? 141.628 77.326  133.759 1.00 66.11  ?  338 THR E OG1 1 
ATOM   4725  C  CG2 . THR C  3 310 ? 142.300 77.743  136.045 1.00 66.11  ?  338 THR E CG2 1 
ATOM   4726  N  N   . SER C  3 311 ? 139.940 75.604  134.891 1.00 68.62  ?  339 SER E N   1 
ATOM   4727  C  CA  . SER C  3 311 ? 139.546 74.211  135.046 1.00 68.62  ?  339 SER E CA  1 
ATOM   4728  C  C   . SER C  3 311 ? 140.765 73.337  135.306 1.00 68.62  ?  339 SER E C   1 
ATOM   4729  O  O   . SER C  3 311 ? 141.775 73.448  134.604 1.00 68.62  ?  339 SER E O   1 
ATOM   4730  C  CB  . SER C  3 311 ? 138.816 73.724  133.796 1.00 68.62  ?  339 SER E CB  1 
ATOM   4731  O  OG  . SER C  3 311 ? 139.694 73.703  132.685 1.00 68.62  ?  339 SER E OG  1 
ATOM   4732  N  N   . VAL C  3 312 ? 140.664 72.462  136.308 1.00 73.27  ?  340 VAL E N   1 
ATOM   4733  C  CA  . VAL C  3 312 ? 141.679 71.463  136.595 1.00 73.27  ?  340 VAL E CA  1 
ATOM   4734  C  C   . VAL C  3 312 ? 140.965 70.116  136.569 1.00 73.27  ?  340 VAL E C   1 
ATOM   4735  O  O   . VAL C  3 312 ? 139.737 70.043  136.648 1.00 73.27  ?  340 VAL E O   1 
ATOM   4736  C  CB  . VAL C  3 312 ? 142.378 71.723  137.954 1.00 73.27  ?  340 VAL E CB  1 
ATOM   4737  C  CG1 . VAL C  3 312 ? 141.481 71.335  139.121 1.00 73.27  ?  340 VAL E CG1 1 
ATOM   4738  C  CG2 . VAL C  3 312 ? 143.765 71.072  138.034 1.00 73.27  ?  340 VAL E CG2 1 
ATOM   4739  N  N   . GLN C  3 313 ? 141.738 69.042  136.425 1.00 81.84  ?  341 GLN E N   1 
ATOM   4740  C  CA  . GLN C  3 313 ? 141.186 67.710  136.238 1.00 81.84  ?  341 GLN E CA  1 
ATOM   4741  C  C   . GLN C  3 313 ? 141.365 66.870  137.493 1.00 81.84  ?  341 GLN E C   1 
ATOM   4742  O  O   . GLN C  3 313 ? 142.363 66.994  138.208 1.00 81.84  ?  341 GLN E O   1 
ATOM   4743  C  CB  . GLN C  3 313 ? 141.847 67.000  135.059 1.00 81.84  ?  341 GLN E CB  1 
ATOM   4744  C  CG  . GLN C  3 313 ? 141.585 67.646  133.720 1.00 81.84  ?  341 GLN E CG  1 
ATOM   4745  C  CD  . GLN C  3 313 ? 142.255 66.896  132.593 1.00 81.84  ?  341 GLN E CD  1 
ATOM   4746  O  OE1 . GLN C  3 313 ? 142.963 65.916  132.824 1.00 81.84  ?  341 GLN E OE1 1 
ATOM   4747  N  NE2 . GLN C  3 313 ? 142.039 67.349  131.365 1.00 81.84  ?  341 GLN E NE2 1 
ATOM   4748  N  N   . ALA C  3 314 ? 140.377 66.014  137.756 1.00 83.49  ?  342 ALA E N   1 
ATOM   4749  C  CA  . ALA C  3 314 ? 140.464 65.045  138.841 1.00 83.49  ?  342 ALA E CA  1 
ATOM   4750  C  C   . ALA C  3 314 ? 140.443 63.609  138.332 1.00 83.49  ?  342 ALA E C   1 
ATOM   4751  O  O   . ALA C  3 314 ? 141.385 62.856  138.594 1.00 83.49  ?  342 ALA E O   1 
ATOM   4752  C  CB  . ALA C  3 314 ? 139.326 65.279  139.842 1.00 83.49  ?  342 ALA E CB  1 
ATOM   4753  N  N   . ASN C  3 315 ? 139.394 63.201  137.622 1.00 88.72  ?  343 ASN E N   1 
ATOM   4754  C  CA  . ASN C  3 315 ? 139.301 61.850  137.074 1.00 88.72  ?  343 ASN E CA  1 
ATOM   4755  C  C   . ASN C  3 315 ? 138.675 61.905  135.683 1.00 88.72  ?  343 ASN E C   1 
ATOM   4756  O  O   . ASN C  3 315 ? 137.785 61.126  135.338 1.00 88.72  ?  343 ASN E O   1 
ATOM   4757  C  CB  . ASN C  3 315 ? 138.518 60.939  138.018 1.00 88.72  ?  343 ASN E CB  1 
ATOM   4758  C  CG  . ASN C  3 315 ? 138.749 59.462  137.737 1.00 88.72  ?  343 ASN E CG  1 
ATOM   4759  O  OD1 . ASN C  3 315 ? 139.498 59.098  136.831 1.00 88.72  ?  343 ASN E OD1 1 
ATOM   4760  N  ND2 . ASN C  3 315 ? 138.102 58.604  138.517 1.00 88.72  ?  343 ASN E ND2 1 
ATOM   4761  N  N   . GLY C  3 316 ? 139.124 62.853  134.868 1.00 90.76  ?  344 GLY E N   1 
ATOM   4762  C  CA  . GLY C  3 316 ? 138.570 63.059  133.547 1.00 90.76  ?  344 GLY E CA  1 
ATOM   4763  C  C   . GLY C  3 316 ? 137.520 64.145  133.471 1.00 90.76  ?  344 GLY E C   1 
ATOM   4764  O  O   . GLY C  3 316 ? 137.156 64.557  132.362 1.00 90.76  ?  344 GLY E O   1 
ATOM   4765  N  N   . SER C  3 317 ? 137.029 64.619  134.610 1.00 84.17  ?  345 SER E N   1 
ATOM   4766  C  CA  . SER C  3 317 ? 136.102 65.737  134.650 1.00 84.17  ?  345 SER E CA  1 
ATOM   4767  C  C   . SER C  3 317 ? 136.893 67.042  134.653 1.00 84.17  ?  345 SER E C   1 
ATOM   4768  O  O   . SER C  3 317 ? 138.106 67.063  134.429 1.00 84.17  ?  345 SER E O   1 
ATOM   4769  C  CB  . SER C  3 317 ? 135.188 65.621  135.867 1.00 84.17  ?  345 SER E CB  1 
ATOM   4770  O  OG  . SER C  3 317 ? 135.926 65.761  137.068 1.00 84.17  ?  345 SER E OG  1 
ATOM   4771  N  N   . PHE C  3 318 ? 136.212 68.154  134.911 1.00 78.56  ?  346 PHE E N   1 
ATOM   4772  C  CA  . PHE C  3 318 ? 136.866 69.455  134.978 1.00 78.56  ?  346 PHE E CA  1 
ATOM   4773  C  C   . PHE C  3 318 ? 136.307 70.207  136.173 1.00 78.56  ?  346 PHE E C   1 
ATOM   4774  O  O   . PHE C  3 318 ? 135.330 70.950  136.043 1.00 78.56  ?  346 PHE E O   1 
ATOM   4775  C  CB  . PHE C  3 318 ? 136.660 70.243  133.688 1.00 78.56  ?  346 PHE E CB  1 
ATOM   4776  C  CG  . PHE C  3 318 ? 137.367 69.654  132.509 1.00 78.56  ?  346 PHE E CG  1 
ATOM   4777  C  CD1 . PHE C  3 318 ? 138.711 69.909  132.293 1.00 78.56  ?  346 PHE E CD1 1 
ATOM   4778  C  CD2 . PHE C  3 318 ? 136.691 68.832  131.623 1.00 78.56  ?  346 PHE E CD2 1 
ATOM   4779  C  CE1 . PHE C  3 318 ? 139.367 69.365  131.207 1.00 78.56  ?  346 PHE E CE1 1 
ATOM   4780  C  CE2 . PHE C  3 318 ? 137.340 68.283  130.536 1.00 78.56  ?  346 PHE E CE2 1 
ATOM   4781  C  CZ  . PHE C  3 318 ? 138.681 68.551  130.327 1.00 78.56  ?  346 PHE E CZ  1 
ATOM   4782  N  N   . VAL C  3 319 ? 136.927 70.015  137.327 1.00 67.22  ?  347 VAL E N   1 
ATOM   4783  C  CA  . VAL C  3 319 ? 136.580 70.738  138.540 1.00 67.22  ?  347 VAL E CA  1 
ATOM   4784  C  C   . VAL C  3 319 ? 137.158 72.137  138.398 1.00 67.22  ?  347 VAL E C   1 
ATOM   4785  O  O   . VAL C  3 319 ? 138.335 72.300  138.060 1.00 67.22  ?  347 VAL E O   1 
ATOM   4786  C  CB  . VAL C  3 319 ? 137.115 70.024  139.785 1.00 67.22  ?  347 VAL E CB  1 
ATOM   4787  C  CG1 . VAL C  3 319 ? 136.794 70.818  141.032 1.00 67.22  ?  347 VAL E CG1 1 
ATOM   4788  C  CG2 . VAL C  3 319 ? 136.541 68.626  139.866 1.00 67.22  ?  347 VAL E CG2 1 
ATOM   4789  N  N   . ARG C  3 320 ? 136.333 73.153  138.627 1.00 62.74  ?  348 ARG E N   1 
ATOM   4790  C  CA  . ARG C  3 320 ? 136.795 74.523  138.468 1.00 62.74  ?  348 ARG E CA  1 
ATOM   4791  C  C   . ARG C  3 320 ? 137.459 75.007  139.750 1.00 62.74  ?  348 ARG E C   1 
ATOM   4792  O  O   . ARG C  3 320 ? 137.047 74.642  140.853 1.00 62.74  ?  348 ARG E O   1 
ATOM   4793  C  CB  . ARG C  3 320 ? 135.623 75.425  138.082 1.00 62.74  ?  348 ARG E CB  1 
ATOM   4794  C  CG  . ARG C  3 320 ? 135.020 75.057  136.736 1.00 62.74  ?  348 ARG E CG  1 
ATOM   4795  C  CD  . ARG C  3 320 ? 133.833 75.928  136.352 1.00 62.74  ?  348 ARG E CD  1 
ATOM   4796  N  NE  . ARG C  3 320 ? 134.223 77.295  136.025 1.00 62.74  ?  348 ARG E NE  1 
ATOM   4797  C  CZ  . ARG C  3 320 ? 133.362 78.271  135.759 1.00 62.74  ?  348 ARG E CZ  1 
ATOM   4798  N  NH1 . ARG C  3 320 ? 132.060 78.028  135.776 1.00 62.74  ?  348 ARG E NH1 1 
ATOM   4799  N  NH2 . ARG C  3 320 ? 133.801 79.487  135.470 1.00 62.74  ?  348 ARG E NH2 1 
ATOM   4800  N  N   . ALA C  3 321 ? 138.504 75.812  139.597 1.00 57.70  ?  349 ALA E N   1 
ATOM   4801  C  CA  . ALA C  3 321 ? 139.262 76.363  140.709 1.00 57.70  ?  349 ALA E CA  1 
ATOM   4802  C  C   . ALA C  3 321 ? 139.698 77.784  140.379 1.00 57.70  ?  349 ALA E C   1 
ATOM   4803  O  O   . ALA C  3 321 ? 139.549 78.248  139.247 1.00 57.70  ?  349 ALA E O   1 
ATOM   4804  C  CB  . ALA C  3 321 ? 140.478 75.489  141.023 1.00 57.70  ?  349 ALA E CB  1 
ATOM   4805  N  N   . THR C  3 322 ? 140.227 78.488  141.378 1.00 51.90  ?  350 THR E N   1 
ATOM   4806  C  CA  . THR C  3 322 ? 140.582 79.893  141.228 1.00 51.90  ?  350 THR E CA  1 
ATOM   4807  C  C   . THR C  3 322 ? 142.093 80.072  141.225 1.00 51.90  ?  350 THR E C   1 
ATOM   4808  O  O   . THR C  3 322 ? 142.806 79.450  142.023 1.00 51.90  ?  350 THR E O   1 
ATOM   4809  C  CB  . THR C  3 322 ? 139.958 80.748  142.330 1.00 51.90  ?  350 THR E CB  1 
ATOM   4810  O  OG1 . THR C  3 322 ? 140.316 80.221  143.609 1.00 51.90  ?  350 THR E OG1 1 
ATOM   4811  C  CG2 . THR C  3 322 ? 138.455 80.795  142.192 1.00 51.90  ?  350 THR E CG2 1 
ATOM   4812  N  N   . VAL C  3 323 ? 142.563 80.929  140.327 1.00 46.54  ?  351 VAL E N   1 
ATOM   4813  C  CA  . VAL C  3 323 ? 143.959 81.326  140.224 1.00 46.54  ?  351 VAL E CA  1 
ATOM   4814  C  C   . VAL C  3 323 ? 144.031 82.829  140.446 1.00 46.54  ?  351 VAL E C   1 
ATOM   4815  O  O   . VAL C  3 323 ? 143.464 83.604  139.671 1.00 46.54  ?  351 VAL E O   1 
ATOM   4816  C  CB  . VAL C  3 323 ? 144.543 80.947  138.857 1.00 46.54  ?  351 VAL E CB  1 
ATOM   4817  C  CG1 . VAL C  3 323 ? 145.932 81.518  138.704 1.00 46.54  ?  351 VAL E CG1 1 
ATOM   4818  C  CG2 . VAL C  3 323 ? 144.563 79.443  138.700 1.00 46.54  ?  351 VAL E CG2 1 
ATOM   4819  N  N   . HIS C  3 324 ? 144.730 83.243  141.495 1.00 42.39  ?  352 HIS E N   1 
ATOM   4820  C  CA  . HIS C  3 324 ? 144.848 84.640  141.882 1.00 42.39  ?  352 HIS E CA  1 
ATOM   4821  C  C   . HIS C  3 324 ? 146.173 85.183  141.376 1.00 42.39  ?  352 HIS E C   1 
ATOM   4822  O  O   . HIS C  3 324 ? 147.202 84.519  141.513 1.00 42.39  ?  352 HIS E O   1 
ATOM   4823  C  CB  . HIS C  3 324 ? 144.794 84.770  143.399 1.00 42.39  ?  352 HIS E CB  1 
ATOM   4824  C  CG  . HIS C  3 324 ? 143.574 84.168  144.012 1.00 42.39  ?  352 HIS E CG  1 
ATOM   4825  N  ND1 . HIS C  3 324 ? 142.363 84.817  144.054 1.00 42.39  ?  352 HIS E ND1 1 
ATOM   4826  C  CD2 . HIS C  3 324 ? 143.375 82.962  144.591 1.00 42.39  ?  352 HIS E CD2 1 
ATOM   4827  C  CE1 . HIS C  3 324 ? 141.474 84.043  144.648 1.00 42.39  ?  352 HIS E CE1 1 
ATOM   4828  N  NE2 . HIS C  3 324 ? 142.062 82.912  144.985 1.00 42.39  ?  352 HIS E NE2 1 
ATOM   4829  N  N   . ASP C  3 325 ? 146.159 86.380  140.805 1.00 45.92  ?  353 ASP E N   1 
ATOM   4830  C  CA  . ASP C  3 325 ? 147.380 87.062  140.417 1.00 45.92  ?  353 ASP E CA  1 
ATOM   4831  C  C   . ASP C  3 325 ? 147.634 88.223  141.363 1.00 45.92  ?  353 ASP E C   1 
ATOM   4832  O  O   . ASP C  3 325 ? 146.719 88.988  141.687 1.00 45.92  ?  353 ASP E O   1 
ATOM   4833  C  CB  . ASP C  3 325 ? 147.290 87.582  138.988 1.00 45.92  ?  353 ASP E CB  1 
ATOM   4834  C  CG  . ASP C  3 325 ? 147.264 86.478  137.975 1.00 45.92  ?  353 ASP E CG  1 
ATOM   4835  O  OD1 . ASP C  3 325 ? 147.871 85.426  138.236 1.00 45.92  ?  353 ASP E OD1 1 
ATOM   4836  O  OD2 . ASP C  3 325 ? 146.625 86.653  136.920 1.00 45.92  ?  353 ASP E OD2 1 
ATOM   4837  N  N   . TYR C  3 326 ? 148.882 88.350  141.798 1.00 45.80  ?  354 TYR E N   1 
ATOM   4838  C  CA  . TYR C  3 326 ? 149.329 89.447  142.639 1.00 45.80  ?  354 TYR E CA  1 
ATOM   4839  C  C   . TYR C  3 326 ? 150.507 90.108  141.956 1.00 45.80  ?  354 TYR E C   1 
ATOM   4840  O  O   . TYR C  3 326 ? 151.391 89.416  141.442 1.00 45.80  ?  354 TYR E O   1 
ATOM   4841  C  CB  . TYR C  3 326 ? 149.739 88.948  144.017 1.00 45.80  ?  354 TYR E CB  1 
ATOM   4842  C  CG  . TYR C  3 326 ? 148.583 88.515  144.858 1.00 45.80  ?  354 TYR E CG  1 
ATOM   4843  C  CD1 . TYR C  3 326 ? 147.901 89.427  145.637 1.00 45.80  ?  354 TYR E CD1 1 
ATOM   4844  C  CD2 . TYR C  3 326 ? 148.143 87.202  144.844 1.00 45.80  ?  354 TYR E CD2 1 
ATOM   4845  C  CE1 . TYR C  3 326 ? 146.843 89.040  146.409 1.00 45.80  ?  354 TYR E CE1 1 
ATOM   4846  C  CE2 . TYR C  3 326 ? 147.074 86.807  145.611 1.00 45.80  ?  354 TYR E CE2 1 
ATOM   4847  C  CZ  . TYR C  3 326 ? 146.429 87.736  146.388 1.00 45.80  ?  354 TYR E CZ  1 
ATOM   4848  O  OH  . TYR C  3 326 ? 145.358 87.368  147.154 1.00 45.80  ?  354 TYR E OH  1 
ATOM   4849  N  N   . ARG C  3 327 ? 150.529 91.434  141.943 1.00 49.16  ?  355 ARG E N   1 
ATOM   4850  C  CA  . ARG C  3 327 ? 151.624 92.126  141.290 1.00 49.16  ?  355 ARG E CA  1 
ATOM   4851  C  C   . ARG C  3 327 ? 151.924 93.452  141.968 1.00 49.16  ?  355 ARG E C   1 
ATOM   4852  O  O   . ARG C  3 327 ? 151.092 94.021  142.673 1.00 49.16  ?  355 ARG E O   1 
ATOM   4853  C  CB  . ARG C  3 327 ? 151.324 92.323  139.808 1.00 49.16  ?  355 ARG E CB  1 
ATOM   4854  C  CG  . ARG C  3 327 ? 150.072 93.092  139.540 1.00 49.16  ?  355 ARG E CG  1 
ATOM   4855  C  CD  . ARG C  3 327 ? 149.795 93.076  138.068 1.00 49.16  ?  355 ARG E CD  1 
ATOM   4856  N  NE  . ARG C  3 327 ? 149.537 91.722  137.605 1.00 49.16  ?  355 ARG E NE  1 
ATOM   4857  C  CZ  . ARG C  3 327 ? 149.417 91.387  136.328 1.00 49.16  ?  355 ARG E CZ  1 
ATOM   4858  N  NH1 . ARG C  3 327 ? 149.512 92.320  135.394 1.00 49.16  ?  355 ARG E NH1 1 
ATOM   4859  N  NH2 . ARG C  3 327 ? 149.174 90.131  135.987 1.00 49.16  ?  355 ARG E NH2 1 
ATOM   4860  N  N   . LEU C  3 328 ? 153.154 93.918  141.769 1.00 52.08  ?  356 LEU E N   1 
ATOM   4861  C  CA  . LEU C  3 328 ? 153.602 95.215  142.249 1.00 52.08  ?  356 LEU E CA  1 
ATOM   4862  C  C   . LEU C  3 328 ? 153.491 96.223  141.121 1.00 52.08  ?  356 LEU E C   1 
ATOM   4863  O  O   . LEU C  3 328 ? 153.891 95.939  139.988 1.00 52.08  ?  356 LEU E O   1 
ATOM   4864  C  CB  . LEU C  3 328 ? 155.045 95.165  142.740 1.00 52.08  ?  356 LEU E CB  1 
ATOM   4865  C  CG  . LEU C  3 328 ? 155.348 94.394  144.011 1.00 52.08  ?  356 LEU E CG  1 
ATOM   4866  C  CD1 . LEU C  3 328 ? 156.831 94.453  144.265 1.00 52.08  ?  356 LEU E CD1 1 
ATOM   4867  C  CD2 . LEU C  3 328 ? 154.587 95.003  145.157 1.00 52.08  ?  356 LEU E CD2 1 
ATOM   4868  N  N   . VAL C  3 329 ? 152.944 97.394  141.427 1.00 51.51  ?  357 VAL E N   1 
ATOM   4869  C  CA  . VAL C  3 329 ? 152.829 98.480  140.467 1.00 51.51  ?  357 VAL E CA  1 
ATOM   4870  C  C   . VAL C  3 329 ? 153.451 99.721  141.090 1.00 51.51  ?  357 VAL E C   1 
ATOM   4871  O  O   . VAL C  3 329 ? 153.188 100.035 142.257 1.00 51.51  ?  357 VAL E O   1 
ATOM   4872  C  CB  . VAL C  3 329 ? 151.357 98.723  140.066 1.00 51.51  ?  357 VAL E CB  1 
ATOM   4873  C  CG1 . VAL C  3 329 ? 151.234 99.901  139.138 1.00 51.51  ?  357 VAL E CG1 1 
ATOM   4874  C  CG2 . VAL C  3 329 ? 150.779 97.503  139.384 1.00 51.51  ?  357 VAL E CG2 1 
ATOM   4875  N  N   . LEU C  3 330 ? 154.319 100.394 140.328 1.00 52.48  ?  358 LEU E N   1 
ATOM   4876  C  CA  . LEU C  3 330 ? 154.855 101.691 140.727 1.00 52.48  ?  358 LEU E CA  1 
ATOM   4877  C  C   . LEU C  3 330 ? 153.735 102.706 140.898 1.00 52.48  ?  358 LEU E C   1 
ATOM   4878  O  O   . LEU C  3 330 ? 152.692 102.624 140.251 1.00 52.48  ?  358 LEU E O   1 
ATOM   4879  C  CB  . LEU C  3 330 ? 155.850 102.206 139.689 1.00 52.48  ?  358 LEU E CB  1 
ATOM   4880  C  CG  . LEU C  3 330 ? 157.222 101.550 139.660 1.00 52.48  ?  358 LEU E CG  1 
ATOM   4881  C  CD1 . LEU C  3 330 ? 158.014 102.005 138.459 1.00 52.48  ?  358 LEU E CD1 1 
ATOM   4882  C  CD2 . LEU C  3 330 ? 157.944 101.932 140.922 1.00 52.48  ?  358 LEU E CD2 1 
ATOM   4883  N  N   . ASN C  3 331 ? 153.955 103.672 141.784 1.00 56.14  ?  359 ASN E N   1 
ATOM   4884  C  CA  . ASN C  3 331 ? 152.912 104.639 142.085 1.00 56.14  ?  359 ASN E CA  1 
ATOM   4885  C  C   . ASN C  3 331 ? 153.194 106.021 141.507 1.00 56.14  ?  359 ASN E C   1 
ATOM   4886  O  O   . ASN C  3 331 ? 152.253 106.706 141.094 1.00 56.14  ?  359 ASN E O   1 
ATOM   4887  C  CB  . ASN C  3 331 ? 152.723 104.742 143.601 1.00 56.14  ?  359 ASN E CB  1 
ATOM   4888  C  CG  . ASN C  3 331 ? 151.370 105.285 143.983 1.00 56.14  ?  359 ASN E CG  1 
ATOM   4889  O  OD1 . ASN C  3 331 ? 150.539 105.579 143.124 1.00 56.14  ?  359 ASN E OD1 1 
ATOM   4890  N  ND2 . ASN C  3 331 ? 151.131 105.410 145.281 1.00 56.14  ?  359 ASN E ND2 1 
ATOM   4891  N  N   . ARG C  3 332 ? 154.459 106.434 141.451 1.00 57.15  ?  360 ARG E N   1 
ATOM   4892  C  CA  . ARG C  3 332 ? 154.845 107.722 140.893 1.00 57.15  ?  360 ARG E CA  1 
ATOM   4893  C  C   . ARG C  3 332 ? 156.054 107.511 139.999 1.00 57.15  ?  360 ARG E C   1 
ATOM   4894  O  O   . ARG C  3 332 ? 156.595 106.409 139.906 1.00 57.15  ?  360 ARG E O   1 
ATOM   4895  C  CB  . ARG C  3 332 ? 155.188 108.724 141.990 1.00 57.15  ?  360 ARG E CB  1 
ATOM   4896  C  CG  . ARG C  3 332 ? 156.438 108.321 142.733 1.00 57.15  ?  360 ARG E CG  1 
ATOM   4897  C  CD  . ARG C  3 332 ? 156.785 109.269 143.853 1.00 57.15  ?  360 ARG E CD  1 
ATOM   4898  N  NE  . ARG C  3 332 ? 158.013 108.845 144.514 1.00 57.15  ?  360 ARG E NE  1 
ATOM   4899  C  CZ  . ARG C  3 332 ? 158.579 109.493 145.523 1.00 57.15  ?  360 ARG E CZ  1 
ATOM   4900  N  NH1 . ARG C  3 332 ? 158.027 110.600 145.995 1.00 57.15  ?  360 ARG E NH1 1 
ATOM   4901  N  NH2 . ARG C  3 332 ? 159.697 109.031 146.059 1.00 57.15  ?  360 ARG E NH2 1 
ATOM   4902  N  N   . ASN C  3 333 ? 156.483 108.580 139.339 1.00 54.39  ?  361 ASN E N   1 
ATOM   4903  C  CA  . ASN C  3 333 ? 157.742 108.525 138.613 1.00 54.39  ?  361 ASN E CA  1 
ATOM   4904  C  C   . ASN C  3 333 ? 158.895 108.535 139.608 1.00 54.39  ?  361 ASN E C   1 
ATOM   4905  O  O   . ASN C  3 333 ? 159.027 109.468 140.403 1.00 54.39  ?  361 ASN E O   1 
ATOM   4906  C  CB  . ASN C  3 333 ? 157.866 109.709 137.657 1.00 54.39  ?  361 ASN E CB  1 
ATOM   4907  C  CG  . ASN C  3 333 ? 156.888 109.642 136.506 1.00 54.39  ?  361 ASN E CG  1 
ATOM   4908  O  OD1 . ASN C  3 333 ? 156.594 108.568 135.989 1.00 54.39  ?  361 ASN E OD1 1 
ATOM   4909  N  ND2 . ASN C  3 333 ? 156.394 110.800 136.084 1.00 54.39  ?  361 ASN E ND2 1 
ATOM   4910  N  N   . LEU C  3 334 ? 159.726 107.498 139.579 1.00 54.56  ?  362 LEU E N   1 
ATOM   4911  C  CA  . LEU C  3 334 ? 160.888 107.467 140.456 1.00 54.56  ?  362 LEU E CA  1 
ATOM   4912  C  C   . LEU C  3 334 ? 162.000 108.340 139.895 1.00 54.56  ?  362 LEU E C   1 
ATOM   4913  O  O   . LEU C  3 334 ? 162.243 108.362 138.686 1.00 54.56  ?  362 LEU E O   1 
ATOM   4914  C  CB  . LEU C  3 334 ? 161.404 106.043 140.651 1.00 54.56  ?  362 LEU E CB  1 
ATOM   4915  C  CG  . LEU C  3 334 ? 160.556 105.070 141.466 1.00 54.56  ?  362 LEU E CG  1 
ATOM   4916  C  CD1 . LEU C  3 334 ? 161.244 103.722 141.536 1.00 54.56  ?  362 LEU E CD1 1 
ATOM   4917  C  CD2 . LEU C  3 334 ? 160.294 105.608 142.854 1.00 54.56  ?  362 LEU E CD2 1 
ATOM   4918  N  N   . SER C  3 335 ? 162.675 109.059 140.785 1.00 55.48  ?  363 SER E N   1 
ATOM   4919  C  CA  . SER C  3 335 ? 163.777 109.916 140.387 1.00 55.48  ?  363 SER E CA  1 
ATOM   4920  C  C   . SER C  3 335 ? 165.019 109.083 140.092 1.00 55.48  ?  363 SER E C   1 
ATOM   4921  O  O   . SER C  3 335 ? 165.143 107.932 140.518 1.00 55.48  ?  363 SER E O   1 
ATOM   4922  C  CB  . SER C  3 335 ? 164.079 110.943 141.475 1.00 55.48  ?  363 SER E CB  1 
ATOM   4923  O  OG  . SER C  3 335 ? 162.977 111.811 141.670 1.00 55.48  ?  363 SER E OG  1 
ATOM   4924  N  N   . ILE C  3 336 ? 165.951 109.694 139.356 1.00 53.55  ?  364 ILE E N   1 
ATOM   4925  C  CA  . ILE C  3 336 ? 167.128 108.976 138.879 1.00 53.55  ?  364 ILE E CA  1 
ATOM   4926  C  C   . ILE C  3 336 ? 168.082 108.676 140.026 1.00 53.55  ?  364 ILE E C   1 
ATOM   4927  O  O   . ILE C  3 336 ? 168.634 107.573 140.120 1.00 53.55  ?  364 ILE E O   1 
ATOM   4928  C  CB  . ILE C  3 336 ? 167.832 109.787 137.782 1.00 53.55  ?  364 ILE E CB  1 
ATOM   4929  C  CG1 . ILE C  3 336 ? 166.887 110.093 136.638 1.00 53.55  ?  364 ILE E CG1 1 
ATOM   4930  C  CG2 . ILE C  3 336 ? 168.988 109.021 137.227 1.00 53.55  ?  364 ILE E CG2 1 
ATOM   4931  C  CD1 . ILE C  3 336 ? 167.499 111.053 135.672 1.00 53.55  ?  364 ILE E CD1 1 
ATOM   4932  N  N   . SER C  3 337 ? 168.261 109.639 140.935 1.00 60.74  ?  365 SER E N   1 
ATOM   4933  C  CA  . SER C  3 337 ? 169.255 109.572 142.004 1.00 60.74  ?  365 SER E CA  1 
ATOM   4934  C  C   . SER C  3 337 ? 168.988 108.471 143.023 1.00 60.74  ?  365 SER E C   1 
ATOM   4935  O  O   . SER C  3 337 ? 169.874 108.178 143.831 1.00 60.74  ?  365 SER E O   1 
ATOM   4936  C  CB  . SER C  3 337 ? 169.316 110.912 142.733 1.00 60.74  ?  365 SER E CB  1 
ATOM   4937  O  OG  . SER C  3 337 ? 169.709 111.949 141.859 1.00 60.74  ?  365 SER E OG  1 
ATOM   4938  N  N   . GLU C  3 338 ? 167.804 107.871 143.007 1.00 61.82  ?  366 GLU E N   1 
ATOM   4939  C  CA  . GLU C  3 338 ? 167.436 106.853 143.977 1.00 61.82  ?  366 GLU E CA  1 
ATOM   4940  C  C   . GLU C  3 338 ? 168.201 105.563 143.704 1.00 61.82  ?  366 GLU E C   1 
ATOM   4941  O  O   . GLU C  3 338 ? 168.322 105.130 142.555 1.00 61.82  ?  366 GLU E O   1 
ATOM   4942  C  CB  . GLU C  3 338 ? 165.929 106.649 143.922 1.00 61.82  ?  366 GLU E CB  1 
ATOM   4943  C  CG  . GLU C  3 338 ? 165.193 107.891 144.401 1.00 61.82  ?  366 GLU E CG  1 
ATOM   4944  C  CD  . GLU C  3 338 ? 163.714 107.855 144.118 1.00 61.82  ?  366 GLU E CD  1 
ATOM   4945  O  OE1 . GLU C  3 338 ? 163.282 106.962 143.365 1.00 61.82  ?  366 GLU E OE1 1 
ATOM   4946  O  OE2 . GLU C  3 338 ? 162.984 108.719 144.647 1.00 61.82  ?  366 GLU E OE2 1 
ATOM   4947  N  N   . ASN C  3 339 ? 168.732 104.970 144.769 1.00 71.75  ?  367 ASN E N   1 
ATOM   4948  C  CA  . ASN C  3 339 ? 169.722 103.896 144.696 1.00 71.75  ?  367 ASN E CA  1 
ATOM   4949  C  C   . ASN C  3 339 ? 169.507 103.024 145.929 1.00 71.75  ?  367 ASN E C   1 
ATOM   4950  O  O   . ASN C  3 339 ? 170.140 103.257 146.963 1.00 71.75  ?  367 ASN E O   1 
ATOM   4951  C  CB  . ASN C  3 339 ? 171.119 104.512 144.680 1.00 71.75  ?  367 ASN E CB  1 
ATOM   4952  C  CG  . ASN C  3 339 ? 172.253 103.492 144.668 1.00 71.75  ?  367 ASN E CG  1 
ATOM   4953  O  OD1 . ASN C  3 339 ? 172.062 102.295 144.435 1.00 71.75  ?  367 ASN E OD1 1 
ATOM   4954  N  ND2 . ASN C  3 339 ? 173.456 103.996 144.976 1.00 71.75  ?  367 ASN E ND2 1 
ATOM   4955  N  N   . ARG C  3 340 ? 168.642 102.014 145.828 1.00 69.80  ?  368 ARG E N   1 
ATOM   4956  C  CA  . ARG C  3 340 ? 168.301 101.246 147.023 1.00 69.80  ?  368 ARG E CA  1 
ATOM   4957  C  C   . ARG C  3 340 ? 168.050 99.787  146.675 1.00 69.80  ?  368 ARG E C   1 
ATOM   4958  O  O   . ARG C  3 340 ? 167.970 99.405  145.507 1.00 69.80  ?  368 ARG E O   1 
ATOM   4959  C  CB  . ARG C  3 340 ? 167.069 101.808 147.757 1.00 69.80  ?  368 ARG E CB  1 
ATOM   4960  C  CG  . ARG C  3 340 ? 167.295 103.111 148.510 1.00 69.80  ?  368 ARG E CG  1 
ATOM   4961  C  CD  . ARG C  3 340 ? 166.084 103.585 149.260 1.00 69.80  ?  368 ARG E CD  1 
ATOM   4962  N  NE  . ARG C  3 340 ? 165.748 102.687 150.353 1.00 69.80  ?  368 ARG E NE  1 
ATOM   4963  C  CZ  . ARG C  3 340 ? 164.718 102.872 151.166 1.00 69.80  ?  368 ARG E CZ  1 
ATOM   4964  N  NH1 . ARG C  3 340 ? 163.949 103.940 151.021 1.00 69.80  ?  368 ARG E NH1 1 
ATOM   4965  N  NH2 . ARG C  3 340 ? 164.472 102.008 152.137 1.00 69.80  ?  368 ARG E NH2 1 
ATOM   4966  N  N   . THR C  3 341 ? 167.920 98.975  147.722 1.00 69.40  ?  369 THR E N   1 
ATOM   4967  C  CA  . THR C  3 341 ? 167.533 97.572  147.619 1.00 69.40  ?  369 THR E CA  1 
ATOM   4968  C  C   . THR C  3 341 ? 166.434 97.314  148.642 1.00 69.40  ?  369 THR E C   1 
ATOM   4969  O  O   . THR C  3 341 ? 166.425 97.927  149.716 1.00 69.40  ?  369 THR E O   1 
ATOM   4970  C  CB  . THR C  3 341 ? 168.741 96.647  147.820 1.00 69.40  ?  369 THR E CB  1 
ATOM   4971  O  OG1 . THR C  3 341 ? 168.331 95.278  147.718 1.00 69.40  ?  369 THR E OG1 1 
ATOM   4972  C  CG2 . THR C  3 341 ? 169.440 96.895  149.155 1.00 69.40  ?  369 THR E CG2 1 
ATOM   4973  N  N   . MET C  3 342 ? 165.477 96.450  148.293 1.00 69.62  ?  370 MET E N   1 
ATOM   4974  C  CA  . MET C  3 342 ? 164.212 96.354  149.006 1.00 69.62  ?  370 MET E CA  1 
ATOM   4975  C  C   . MET C  3 342 ? 163.703 94.921  149.049 1.00 69.62  ?  370 MET E C   1 
ATOM   4976  O  O   . MET C  3 342 ? 163.787 94.181  148.063 1.00 69.62  ?  370 MET E O   1 
ATOM   4977  C  CB  . MET C  3 342 ? 163.128 97.219  148.345 1.00 69.62  ?  370 MET E CB  1 
ATOM   4978  C  CG  . MET C  3 342 ? 163.301 98.713  148.480 1.00 69.62  ?  370 MET E CG  1 
ATOM   4979  S  SD  . MET C  3 342 ? 162.052 99.576  147.532 1.00 69.62  ?  370 MET E SD  1 
ATOM   4980  C  CE  . MET C  3 342 ? 160.610 99.132  148.480 1.00 69.62  ?  370 MET E CE  1 
ATOM   4981  N  N   . GLN C  3 343 ? 163.120 94.566  150.193 1.00 65.32  ?  371 GLN E N   1 
ATOM   4982  C  CA  . GLN C  3 343 ? 162.426 93.301  150.397 1.00 65.32  ?  371 GLN E CA  1 
ATOM   4983  C  C   . GLN C  3 343 ? 161.003 93.596  150.852 1.00 65.32  ?  371 GLN E C   1 
ATOM   4984  O  O   . GLN C  3 343 ? 160.801 94.181  151.921 1.00 65.32  ?  371 GLN E O   1 
ATOM   4985  C  CB  . GLN C  3 343 ? 163.151 92.440  151.431 1.00 65.32  ?  371 GLN E CB  1 
ATOM   4986  C  CG  . GLN C  3 343 ? 162.476 91.111  151.702 1.00 65.32  ?  371 GLN E CG  1 
ATOM   4987  C  CD  . GLN C  3 343 ? 163.247 90.264  152.689 1.00 65.32  ?  371 GLN E CD  1 
ATOM   4988  O  OE1 . GLN C  3 343 ? 164.298 90.670  153.181 1.00 65.32  ?  371 GLN E OE1 1 
ATOM   4989  N  NE2 . GLN C  3 343 ? 162.722 89.084  152.994 1.00 65.32  ?  371 GLN E NE2 1 
ATOM   4990  N  N   . LEU C  3 344 ? 160.025 93.183  150.050 1.00 56.63  ?  372 LEU E N   1 
ATOM   4991  C  CA  . LEU C  3 344 ? 158.614 93.446  150.308 1.00 56.63  ?  372 LEU E CA  1 
ATOM   4992  C  C   . LEU C  3 344 ? 157.910 92.133  150.615 1.00 56.63  ?  372 LEU E C   1 
ATOM   4993  O  O   . LEU C  3 344 ? 158.175 91.120  149.961 1.00 56.63  ?  372 LEU E O   1 
ATOM   4994  C  CB  . LEU C  3 344 ? 157.964 94.128  149.107 1.00 56.63  ?  372 LEU E CB  1 
ATOM   4995  C  CG  . LEU C  3 344 ? 158.512 95.516  148.797 1.00 56.63  ?  372 LEU E CG  1 
ATOM   4996  C  CD1 . LEU C  3 344 ? 157.898 96.071  147.526 1.00 56.63  ?  372 LEU E CD1 1 
ATOM   4997  C  CD2 . LEU C  3 344 ? 158.251 96.439  149.965 1.00 56.63  ?  372 LEU E CD2 1 
ATOM   4998  N  N   . ALA C  3 345 ? 157.014 92.148  151.599 1.00 55.02  ?  373 ALA E N   1 
ATOM   4999  C  CA  . ALA C  3 345 ? 156.262 90.964  152.000 1.00 55.02  ?  373 ALA E CA  1 
ATOM   5000  C  C   . ALA C  3 345 ? 154.770 91.261  151.913 1.00 55.02  ?  373 ALA E C   1 
ATOM   5001  O  O   . ALA C  3 345 ? 154.298 92.251  152.483 1.00 55.02  ?  373 ALA E O   1 
ATOM   5002  C  CB  . ALA C  3 345 ? 156.646 90.527  153.411 1.00 55.02  ?  373 ALA E CB  1 
ATOM   5003  N  N   . VAL C  3 346 ? 154.031 90.398  151.214 1.00 51.07  ?  374 VAL E N   1 
ATOM   5004  C  CA  . VAL C  3 346 ? 152.612 90.602  150.926 1.00 51.07  ?  374 VAL E CA  1 
ATOM   5005  C  C   . VAL C  3 346 ? 151.820 89.459  151.552 1.00 51.07  ?  374 VAL E C   1 
ATOM   5006  O  O   . VAL C  3 346 ? 152.144 88.289  151.336 1.00 51.07  ?  374 VAL E O   1 
ATOM   5007  C  CB  . VAL C  3 346 ? 152.354 90.680  149.408 1.00 51.07  ?  374 VAL E CB  1 
ATOM   5008  C  CG1 . VAL C  3 346 ? 150.879 90.823  149.120 1.00 51.07  ?  374 VAL E CG1 1 
ATOM   5009  C  CG2 . VAL C  3 346 ? 153.124 91.833  148.785 1.00 51.07  ?  374 VAL E CG2 1 
ATOM   5010  N  N   . LEU C  3 347 ? 150.780 89.789  152.314 1.00 50.77  ?  375 LEU E N   1 
ATOM   5011  C  CA  . LEU C  3 347 ? 150.002 88.804  153.057 1.00 50.77  ?  375 LEU E CA  1 
ATOM   5012  C  C   . LEU C  3 347 ? 148.689 88.552  152.327 1.00 50.77  ?  375 LEU E C   1 
ATOM   5013  O  O   . LEU C  3 347 ? 148.004 89.506  151.950 1.00 50.77  ?  375 LEU E O   1 
ATOM   5014  C  CB  . LEU C  3 347 ? 149.728 89.299  154.472 1.00 50.77  ?  375 LEU E CB  1 
ATOM   5015  C  CG  . LEU C  3 347 ? 149.177 88.250  155.422 1.00 50.77  ?  375 LEU E CG  1 
ATOM   5016  C  CD1 . LEU C  3 347 ? 150.269 87.239  155.706 1.00 50.77  ?  375 LEU E CD1 1 
ATOM   5017  C  CD2 . LEU C  3 347 ? 148.674 88.897  156.691 1.00 50.77  ?  375 LEU E CD2 1 
ATOM   5018  N  N   . VAL C  3 348 ? 148.330 87.280  152.153 1.00 50.67  ?  376 VAL E N   1 
ATOM   5019  C  CA  . VAL C  3 348 ? 147.122 86.868  151.440 1.00 50.67  ?  376 VAL E CA  1 
ATOM   5020  C  C   . VAL C  3 348 ? 146.193 86.185  152.434 1.00 50.67  ?  376 VAL E C   1 
ATOM   5021  O  O   . VAL C  3 348 ? 146.572 85.192  153.067 1.00 50.67  ?  376 VAL E O   1 
ATOM   5022  C  CB  . VAL C  3 348 ? 147.454 85.928  150.272 1.00 50.67  ?  376 VAL E CB  1 
ATOM   5023  C  CG1 . VAL C  3 348 ? 146.196 85.358  149.667 1.00 50.67  ?  376 VAL E CG1 1 
ATOM   5024  C  CG2 . VAL C  3 348 ? 148.239 86.662  149.223 1.00 50.67  ?  376 VAL E CG2 1 
ATOM   5025  N  N   . ASN C  3 349 ? 144.973 86.698  152.560 1.00 54.49  ?  377 ASN E N   1 
ATOM   5026  C  CA  . ASN C  3 349 ? 143.998 86.173  153.504 1.00 54.49  ?  377 ASN E CA  1 
ATOM   5027  C  C   . ASN C  3 349 ? 142.781 85.712  152.714 1.00 54.49  ?  377 ASN E C   1 
ATOM   5028  O  O   . ASN C  3 349 ? 142.056 86.545  152.150 1.00 54.49  ?  377 ASN E O   1 
ATOM   5029  C  CB  . ASN C  3 349 ? 143.637 87.249  154.525 1.00 54.49  ?  377 ASN E CB  1 
ATOM   5030  C  CG  . ASN C  3 349 ? 143.002 86.704  155.784 1.00 54.49  ?  377 ASN E CG  1 
ATOM   5031  O  OD1 . ASN C  3 349 ? 142.799 85.502  155.929 1.00 54.49  ?  377 ASN E OD1 1 
ATOM   5032  N  ND2 . ASN C  3 349 ? 142.689 87.618  156.713 1.00 54.49  ?  377 ASN E ND2 1 
ATOM   5033  N  N   . ASP C  3 350 ? 142.600 84.385  152.652 1.00 56.10  ?  378 ASP E N   1 
ATOM   5034  C  CA  . ASP C  3 350 ? 141.518 83.690  151.939 1.00 56.10  ?  378 ASP E CA  1 
ATOM   5035  C  C   . ASP C  3 350 ? 140.469 83.308  152.979 1.00 56.10  ?  378 ASP E C   1 
ATOM   5036  O  O   . ASP C  3 350 ? 140.408 82.179  153.463 1.00 56.10  ?  378 ASP E O   1 
ATOM   5037  C  CB  . ASP C  3 350 ? 142.107 82.476  151.183 1.00 56.10  ?  378 ASP E CB  1 
ATOM   5038  C  CG  . ASP C  3 350 ? 141.071 81.600  150.413 1.00 56.10  ?  378 ASP E CG  1 
ATOM   5039  O  OD1 . ASP C  3 350 ? 139.839 81.644  150.593 1.00 56.10  ?  378 ASP E OD1 1 
ATOM   5040  O  OD2 . ASP C  3 350 ? 141.535 80.819  149.556 1.00 56.10  ?  378 ASP E OD2 1 
ATOM   5041  N  N   . SER C  3 351 ? 139.618 84.271  153.307 1.00 53.21  ?  379 SER E N   1 
ATOM   5042  C  CA  . SER C  3 351 ? 138.567 84.047  154.284 1.00 53.21  ?  379 SER E CA  1 
ATOM   5043  C  C   . SER C  3 351 ? 137.388 83.306  153.666 1.00 53.21  ?  379 SER E C   1 
ATOM   5044  O  O   . SER C  3 351 ? 136.807 82.413  154.284 1.00 53.21  ?  379 SER E O   1 
ATOM   5045  C  CB  . SER C  3 351 ? 138.101 85.374  154.872 1.00 53.21  ?  379 SER E CB  1 
ATOM   5046  O  OG  . SER C  3 351 ? 137.069 85.165  155.817 1.00 53.21  ?  379 SER E OG  1 
ATOM   5047  N  N   . GLY C  3 359 ? 144.753 79.269  156.372 1.00 54.16  ?  387 GLY E N   1 
ATOM   5048  C  CA  . GLY C  3 359 ? 144.222 79.927  155.193 1.00 54.16  ?  387 GLY E CA  1 
ATOM   5049  C  C   . GLY C  3 359 ? 144.890 81.258  154.918 1.00 54.16  ?  387 GLY E C   1 
ATOM   5050  O  O   . GLY C  3 359 ? 144.369 82.091  154.180 1.00 54.16  ?  387 GLY E O   1 
ATOM   5051  N  N   . VAL C  3 360 ? 146.050 81.454  155.527 1.00 52.09  ?  388 VAL E N   1 
ATOM   5052  C  CA  . VAL C  3 360 ? 146.824 82.681  155.397 1.00 52.09  ?  388 VAL E CA  1 
ATOM   5053  C  C   . VAL C  3 360 ? 148.140 82.335  154.719 1.00 52.09  ?  388 VAL E C   1 
ATOM   5054  O  O   . VAL C  3 360 ? 148.804 81.361  155.093 1.00 52.09  ?  388 VAL E O   1 
ATOM   5055  C  CB  . VAL C  3 360 ? 147.048 83.328  156.778 1.00 52.09  ?  388 VAL E CB  1 
ATOM   5056  C  CG1 . VAL C  3 360 ? 147.869 84.589  156.666 1.00 52.09  ?  388 VAL E CG1 1 
ATOM   5057  C  CG2 . VAL C  3 360 ? 145.716 83.624  157.449 1.00 52.09  ?  388 VAL E CG2 1 
ATOM   5058  N  N   . LEU C  3 361 ? 148.516 83.115  153.710 1.00 51.30  ?  389 LEU E N   1 
ATOM   5059  C  CA  . LEU C  3 361 ? 149.690 82.819  152.903 1.00 51.30  ?  389 LEU E CA  1 
ATOM   5060  C  C   . LEU C  3 361 ? 150.564 84.065  152.811 1.00 51.30  ?  389 LEU E C   1 
ATOM   5061  O  O   . LEU C  3 361 ? 150.098 85.180  153.049 1.00 51.30  ?  389 LEU E O   1 
ATOM   5062  C  CB  . LEU C  3 361 ? 149.255 82.319  151.521 1.00 51.30  ?  389 LEU E CB  1 
ATOM   5063  C  CG  . LEU C  3 361 ? 150.228 81.721  150.512 1.00 51.30  ?  389 LEU E CG  1 
ATOM   5064  C  CD1 . LEU C  3 361 ? 150.889 80.500  151.092 1.00 51.30  ?  389 LEU E CD1 1 
ATOM   5065  C  CD2 . LEU C  3 361 ? 149.461 81.345  149.281 1.00 51.30  ?  389 LEU E CD2 1 
ATOM   5066  N  N   . LEU C  3 362 ? 151.839 83.872  152.481 1.00 52.54  ?  390 LEU E N   1 
ATOM   5067  C  CA  . LEU C  3 362 ? 152.811 84.956  152.437 1.00 52.54  ?  390 LEU E CA  1 
ATOM   5068  C  C   . LEU C  3 362 ? 153.563 84.946  151.111 1.00 52.54  ?  390 LEU E C   1 
ATOM   5069  O  O   . LEU C  3 362 ? 153.889 83.881  150.581 1.00 52.54  ?  390 LEU E O   1 
ATOM   5070  C  CB  . LEU C  3 362 ? 153.791 84.838  153.606 1.00 52.54  ?  390 LEU E CB  1 
ATOM   5071  C  CG  . LEU C  3 362 ? 154.793 85.965  153.839 1.00 52.54  ?  390 LEU E CG  1 
ATOM   5072  C  CD1 . LEU C  3 362 ? 154.064 87.248  154.173 1.00 52.54  ?  390 LEU E CD1 1 
ATOM   5073  C  CD2 . LEU C  3 362 ? 155.752 85.593  154.953 1.00 52.54  ?  390 LEU E CD2 1 
ATOM   5074  N  N   . LEU C  3 363 ? 153.838 86.138  150.582 1.00 56.14  ?  391 LEU E N   1 
ATOM   5075  C  CA  . LEU C  3 363 ? 154.521 86.310  149.305 1.00 56.14  ?  391 LEU E CA  1 
ATOM   5076  C  C   . LEU C  3 363 ? 155.718 87.218  149.526 1.00 56.14  ?  391 LEU E C   1 
ATOM   5077  O  O   . LEU C  3 363 ? 155.673 88.094  150.396 1.00 56.14  ?  391 LEU E O   1 
ATOM   5078  C  CB  . LEU C  3 363 ? 153.602 86.932  148.249 1.00 56.14  ?  391 LEU E CB  1 
ATOM   5079  C  CG  . LEU C  3 363 ? 152.310 86.250  147.811 1.00 56.14  ?  391 LEU E CG  1 
ATOM   5080  C  CD1 . LEU C  3 363 ? 151.606 87.123  146.791 1.00 56.14  ?  391 LEU E CD1 1 
ATOM   5081  C  CD2 . LEU C  3 363 ? 152.572 84.881  147.247 1.00 56.14  ?  391 LEU E CD2 1 
ATOM   5082  N  N   . HIS C  3 364 ? 156.754 87.048  148.709 1.00 57.45  ?  392 HIS E N   1 
ATOM   5083  C  CA  . HIS C  3 364 ? 157.947 87.872  148.799 1.00 57.45  ?  392 HIS E CA  1 
ATOM   5084  C  C   . HIS C  3 364 ? 158.222 88.598  147.489 1.00 57.45  ?  392 HIS E C   1 
ATOM   5085  O  O   . HIS C  3 364 ? 157.774 88.187  146.417 1.00 57.45  ?  392 HIS E O   1 
ATOM   5086  C  CB  . HIS C  3 364 ? 159.159 87.025  149.172 1.00 57.45  ?  392 HIS E CB  1 
ATOM   5087  C  CG  . HIS C  3 364 ? 159.061 86.397  150.524 1.00 57.45  ?  392 HIS E CG  1 
ATOM   5088  N  ND1 . HIS C  3 364 ? 159.196 87.118  151.689 1.00 57.45  ?  392 HIS E ND1 1 
ATOM   5089  C  CD2 . HIS C  3 364 ? 158.851 85.113  150.896 1.00 57.45  ?  392 HIS E CD2 1 
ATOM   5090  C  CE1 . HIS C  3 364 ? 159.068 86.306  152.723 1.00 57.45  ?  392 HIS E CE1 1 
ATOM   5091  N  NE2 . HIS C  3 364 ? 158.859 85.084  152.269 1.00 57.45  ?  392 HIS E NE2 1 
ATOM   5092  N  N   . PHE C  3 365 ? 158.975 89.689  147.594 1.00 55.13  ?  393 PHE E N   1 
ATOM   5093  C  CA  . PHE C  3 365 ? 159.430 90.455  146.436 1.00 55.13  ?  393 PHE E CA  1 
ATOM   5094  C  C   . PHE C  3 365 ? 160.809 91.012  146.762 1.00 55.13  ?  393 PHE E C   1 
ATOM   5095  O  O   . PHE C  3 365 ? 160.985 91.645  147.806 1.00 55.13  ?  393 PHE E O   1 
ATOM   5096  C  CB  . PHE C  3 365 ? 158.467 91.591  146.106 1.00 55.13  ?  393 PHE E CB  1 
ATOM   5097  C  CG  . PHE C  3 365 ? 157.170 91.155  145.496 1.00 55.13  ?  393 PHE E CG  1 
ATOM   5098  C  CD1 . PHE C  3 365 ? 157.092 90.866  144.147 1.00 55.13  ?  393 PHE E CD1 1 
ATOM   5099  C  CD2 . PHE C  3 365 ? 156.020 91.080  146.259 1.00 55.13  ?  393 PHE E CD2 1 
ATOM   5100  C  CE1 . PHE C  3 365 ? 155.896 90.493  143.571 1.00 55.13  ?  393 PHE E CE1 1 
ATOM   5101  C  CE2 . PHE C  3 365 ? 154.820 90.698  145.689 1.00 55.13  ?  393 PHE E CE2 1 
ATOM   5102  C  CZ  . PHE C  3 365 ? 154.761 90.403  144.344 1.00 55.13  ?  393 PHE E CZ  1 
ATOM   5103  N  N   . ASN C  3 366 ? 161.781 90.783  145.884 1.00 61.08  ?  394 ASN E N   1 
ATOM   5104  C  CA  . ASN C  3 366 ? 163.060 91.478  145.949 1.00 61.08  ?  394 ASN E CA  1 
ATOM   5105  C  C   . ASN C  3 366 ? 163.107 92.517  144.838 1.00 61.08  ?  394 ASN E C   1 
ATOM   5106  O  O   . ASN C  3 366 ? 163.019 92.169  143.656 1.00 61.08  ?  394 ASN E O   1 
ATOM   5107  C  CB  . ASN C  3 366 ? 164.245 90.526  145.797 1.00 61.08  ?  394 ASN E CB  1 
ATOM   5108  C  CG  . ASN C  3 366 ? 164.412 89.591  146.971 1.00 61.08  ?  394 ASN E CG  1 
ATOM   5109  O  OD1 . ASN C  3 366 ? 164.058 89.916  148.103 1.00 61.08  ?  394 ASN E OD1 1 
ATOM   5110  N  ND2 . ASN C  3 366 ? 164.999 88.429  146.706 1.00 61.08  ?  394 ASN E ND2 1 
ATOM   5111  N  N   . VAL C  3 367 ? 163.235 93.787  145.212 1.00 61.20  ?  395 VAL E N   1 
ATOM   5112  C  CA  . VAL C  3 367 ? 163.275 94.868  144.231 1.00 61.20  ?  395 VAL E CA  1 
ATOM   5113  C  C   . VAL C  3 367 ? 164.459 95.769  144.545 1.00 61.20  ?  395 VAL E C   1 
ATOM   5114  O  O   . VAL C  3 367 ? 164.531 96.370  145.618 1.00 61.20  ?  395 VAL E O   1 
ATOM   5115  C  CB  . VAL C  3 367 ? 161.956 95.672  144.201 1.00 61.20  ?  395 VAL E CB  1 
ATOM   5116  C  CG1 . VAL C  3 367 ? 162.123 96.925  143.381 1.00 61.20  ?  395 VAL E CG1 1 
ATOM   5117  C  CG2 . VAL C  3 367 ? 160.838 94.842  143.604 1.00 61.20  ?  395 VAL E CG2 1 
ATOM   5118  N  N   . SER C  3 368 ? 165.391 95.864  143.603 1.00 60.42  ?  396 SER E N   1 
ATOM   5119  C  CA  . SER C  3 368 ? 166.549 96.736  143.729 1.00 60.42  ?  396 SER E CA  1 
ATOM   5120  C  C   . SER C  3 368 ? 166.444 97.848  142.701 1.00 60.42  ?  396 SER E C   1 
ATOM   5121  O  O   . SER C  3 368 ? 166.460 97.584  141.495 1.00 60.42  ?  396 SER E O   1 
ATOM   5122  C  CB  . SER C  3 368 ? 167.852 95.961  143.536 1.00 60.42  ?  396 SER E CB  1 
ATOM   5123  O  OG  . SER C  3 368 ? 168.024 95.001  144.560 1.00 60.42  ?  396 SER E OG  1 
ATOM   5124  N  N   . VAL C  3 369 ? 166.331 99.082  143.174 1.00 60.28  ?  397 VAL E N   1 
ATOM   5125  C  CA  . VAL C  3 369 ? 166.299 100.249 142.306 1.00 60.28  ?  397 VAL E CA  1 
ATOM   5126  C  C   . VAL C  3 369 ? 167.744 100.690 142.083 1.00 60.28  ?  397 VAL E C   1 
ATOM   5127  O  O   . VAL C  3 369 ? 168.387 101.291 142.954 1.00 60.28  ?  397 VAL E O   1 
ATOM   5128  C  CB  . VAL C  3 369 ? 165.404 101.358 142.869 1.00 60.28  ?  397 VAL E CB  1 
ATOM   5129  C  CG1 . VAL C  3 369 ? 163.962 101.026 142.589 1.00 60.28  ?  397 VAL E CG1 1 
ATOM   5130  C  CG2 . VAL C  3 369 ? 165.548 101.465 144.375 1.00 60.28  ?  397 VAL E CG2 1 
ATOM   5131  N  N   . LEU C  3 370 ? 168.270 100.337 140.914 1.00 54.96  ?  398 LEU E N   1 
ATOM   5132  C  CA  . LEU C  3 370 ? 169.587 100.795 140.512 1.00 54.96  ?  398 LEU E CA  1 
ATOM   5133  C  C   . LEU C  3 370 ? 169.502 102.240 140.034 1.00 54.96  ?  398 LEU E C   1 
ATOM   5134  O  O   . LEU C  3 370 ? 168.525 102.623 139.387 1.00 54.96  ?  398 LEU E O   1 
ATOM   5135  C  CB  . LEU C  3 370 ? 170.143 99.926  139.387 1.00 54.96  ?  398 LEU E CB  1 
ATOM   5136  C  CG  . LEU C  3 370 ? 170.464 98.465  139.687 1.00 54.96  ?  398 LEU E CG  1 
ATOM   5137  C  CD1 . LEU C  3 370 ? 170.883 97.757  138.410 1.00 54.96  ?  398 LEU E CD1 1 
ATOM   5138  C  CD2 . LEU C  3 370 ? 171.550 98.367  140.738 1.00 54.96  ?  398 LEU E CD2 1 
ATOM   5139  N  N   . PRO C  3 371 ? 170.500 103.061 140.327 1.00 55.86  ?  399 PRO E N   1 
ATOM   5140  C  CA  . PRO C  3 371 ? 170.535 104.409 139.765 1.00 55.86  ?  399 PRO E CA  1 
ATOM   5141  C  C   . PRO C  3 371 ? 170.982 104.365 138.312 1.00 55.86  ?  399 PRO E C   1 
ATOM   5142  O  O   . PRO C  3 371 ? 171.448 103.348 137.801 1.00 55.86  ?  399 PRO E O   1 
ATOM   5143  C  CB  . PRO C  3 371 ? 171.560 105.129 140.642 1.00 55.86  ?  399 PRO E CB  1 
ATOM   5144  C  CG  . PRO C  3 371 ? 172.473 104.051 141.077 1.00 55.86  ?  399 PRO E CG  1 
ATOM   5145  C  CD  . PRO C  3 371 ? 171.628 102.818 141.238 1.00 55.86  ?  399 PRO E CD  1 
ATOM   5146  N  N   . VAL C  3 372 ? 170.821 105.500 137.647 1.00 49.68  ?  400 VAL E N   1 
ATOM   5147  C  CA  . VAL C  3 372 ? 171.219 105.654 136.257 1.00 49.68  ?  400 VAL E CA  1 
ATOM   5148  C  C   . VAL C  3 372 ? 172.242 106.775 136.176 1.00 49.68  ?  400 VAL E C   1 
ATOM   5149  O  O   . VAL C  3 372 ? 172.004 107.882 136.666 1.00 49.68  ?  400 VAL E O   1 
ATOM   5150  C  CB  . VAL C  3 372 ? 170.007 105.950 135.349 1.00 49.68  ?  400 VAL E CB  1 
ATOM   5151  C  CG1 . VAL C  3 372 ? 170.453 106.227 133.928 1.00 49.68  ?  400 VAL E CG1 1 
ATOM   5152  C  CG2 . VAL C  3 372 ? 169.036 104.797 135.378 1.00 49.68  ?  400 VAL E CG2 1 
ATOM   5153  N  N   . SER C  3 373 ? 173.388 106.485 135.577 1.00 49.80  ?  401 SER E N   1 
ATOM   5154  C  CA  . SER C  3 373 ? 174.363 107.511 135.243 1.00 49.80  ?  401 SER E CA  1 
ATOM   5155  C  C   . SER C  3 373 ? 173.981 108.060 133.880 1.00 49.80  ?  401 SER E C   1 
ATOM   5156  O  O   . SER C  3 373 ? 173.850 107.300 132.917 1.00 49.80  ?  401 SER E O   1 
ATOM   5157  C  CB  . SER C  3 373 ? 175.784 106.951 135.232 1.00 49.80  ?  401 SER E CB  1 
ATOM   5158  O  OG  . SER C  3 373 ? 175.952 106.012 134.188 1.00 49.80  ?  401 SER E OG  1 
ATOM   5159  N  N   . LEU C  3 374 ? 173.795 109.373 133.798 1.00 47.43  ?  402 LEU E N   1 
ATOM   5160  C  CA  . LEU C  3 374 ? 173.373 110.003 132.550 1.00 47.43  ?  402 LEU E CA  1 
ATOM   5161  C  C   . LEU C  3 374 ? 174.585 110.390 131.704 1.00 47.43  ?  402 LEU E C   1 
ATOM   5162  O  O   . LEU C  3 374 ? 174.687 111.501 131.203 1.00 47.43  ?  402 LEU E O   1 
ATOM   5163  C  CB  . LEU C  3 374 ? 172.513 111.224 132.848 1.00 47.43  ?  402 LEU E CB  1 
ATOM   5164  C  CG  . LEU C  3 374 ? 171.167 111.033 133.539 1.00 47.43  ?  402 LEU E CG  1 
ATOM   5165  C  CD1 . LEU C  3 374 ? 170.578 112.380 133.898 1.00 47.43  ?  402 LEU E CD1 1 
ATOM   5166  C  CD2 . LEU C  3 374 ? 170.219 110.270 132.643 1.00 47.43  ?  402 LEU E CD2 1 
ATOM   5167  N  N   . HIS C  3 375 ? 175.499 109.446 131.513 1.00 51.96  ?  403 HIS E N   1 
ATOM   5168  C  CA  . HIS C  3 375 ? 176.755 109.765 130.858 1.00 51.96  ?  403 HIS E CA  1 
ATOM   5169  C  C   . HIS C  3 375 ? 176.577 109.693 129.350 1.00 51.96  ?  403 HIS E C   1 
ATOM   5170  O  O   . HIS C  3 375 ? 175.994 108.742 128.822 1.00 51.96  ?  403 HIS E O   1 
ATOM   5171  C  CB  . HIS C  3 375 ? 177.893 108.857 131.335 1.00 51.96  ?  403 HIS E CB  1 
ATOM   5172  C  CG  . HIS C  3 375 ? 177.708 107.411 131.010 1.00 51.96  ?  403 HIS E CG  1 
ATOM   5173  N  ND1 . HIS C  3 375 ? 176.940 106.567 131.782 1.00 51.96  ?  403 HIS E ND1 1 
ATOM   5174  C  CD2 . HIS C  3 375 ? 178.202 106.656 130.002 1.00 51.96  ?  403 HIS E CD2 1 
ATOM   5175  C  CE1 . HIS C  3 375 ? 176.964 105.354 131.259 1.00 51.96  ?  403 HIS E CE1 1 
ATOM   5176  N  NE2 . HIS C  3 375 ? 177.722 105.381 130.178 1.00 51.96  ?  403 HIS E NE2 1 
ATOM   5177  N  N   . LEU C  3 376 ? 177.058 110.717 128.675 1.00 56.81  ?  404 LEU E N   1 
ATOM   5178  C  CA  . LEU C  3 376 ? 176.898 110.948 127.256 1.00 56.81  ?  404 LEU E CA  1 
ATOM   5179  C  C   . LEU C  3 376 ? 178.247 110.757 126.573 1.00 56.81  ?  404 LEU E C   1 
ATOM   5180  O  O   . LEU C  3 376 ? 179.287 110.788 127.240 1.00 56.81  ?  404 LEU E O   1 
ATOM   5181  C  CB  . LEU C  3 376 ? 176.367 112.377 127.053 1.00 56.81  ?  404 LEU E CB  1 
ATOM   5182  C  CG  . LEU C  3 376 ? 175.771 112.964 125.775 1.00 56.81  ?  404 LEU E CG  1 
ATOM   5183  C  CD1 . LEU C  3 376 ? 174.519 112.231 125.423 1.00 56.81  ?  404 LEU E CD1 1 
ATOM   5184  C  CD2 . LEU C  3 376 ? 175.427 114.403 125.999 1.00 56.81  ?  404 LEU E CD2 1 
ATOM   5185  N  N   . PRO C  3 377 ? 178.272 110.481 125.266 1.00 62.85  ?  405 PRO E N   1 
ATOM   5186  C  CA  . PRO C  3 377 ? 179.552 110.406 124.550 1.00 62.85  ?  405 PRO E CA  1 
ATOM   5187  C  C   . PRO C  3 377 ? 180.324 111.717 124.585 1.00 62.85  ?  405 PRO E C   1 
ATOM   5188  O  O   . PRO C  3 377 ? 179.745 112.802 124.654 1.00 62.85  ?  405 PRO E O   1 
ATOM   5189  C  CB  . PRO C  3 377 ? 179.133 110.039 123.124 1.00 62.85  ?  405 PRO E CB  1 
ATOM   5190  C  CG  . PRO C  3 377 ? 177.910 109.250 123.315 1.00 62.85  ?  405 PRO E CG  1 
ATOM   5191  C  CD  . PRO C  3 377 ? 177.190 109.855 124.484 1.00 62.85  ?  405 PRO E CD  1 
ATOM   5192  N  N   . SER C  3 378 ? 181.650 111.598 124.542 1.00 66.92  ?  406 SER E N   1 
ATOM   5193  C  CA  . SER C  3 378 ? 182.523 112.731 124.822 1.00 66.92  ?  406 SER E CA  1 
ATOM   5194  C  C   . SER C  3 378 ? 182.537 113.726 123.670 1.00 66.92  ?  406 SER E C   1 
ATOM   5195  O  O   . SER C  3 378 ? 182.561 114.943 123.881 1.00 66.92  ?  406 SER E O   1 
ATOM   5196  C  CB  . SER C  3 378 ? 183.935 112.230 125.119 1.00 66.92  ?  406 SER E CB  1 
ATOM   5197  O  OG  . SER C  3 378 ? 183.947 111.421 126.281 1.00 66.92  ?  406 SER E OG  1 
ATOM   5198  N  N   . THR C  3 379 ? 182.530 113.227 122.438 1.00 68.37  ?  407 THR E N   1 
ATOM   5199  C  CA  . THR C  3 379 ? 182.645 114.099 121.279 1.00 68.37  ?  407 THR E CA  1 
ATOM   5200  C  C   . THR C  3 379 ? 181.813 113.563 120.127 1.00 68.37  ?  407 THR E C   1 
ATOM   5201  O  O   . THR C  3 379 ? 182.042 112.445 119.657 1.00 68.37  ?  407 THR E O   1 
ATOM   5202  C  CB  . THR C  3 379 ? 184.106 114.242 120.845 1.00 68.37  ?  407 THR E CB  1 
ATOM   5203  O  OG1 . THR C  3 379 ? 184.864 114.851 121.897 1.00 68.37  ?  407 THR E OG1 1 
ATOM   5204  C  CG2 . THR C  3 379 ? 184.200 115.097 119.605 1.00 68.37  ?  407 THR E CG2 1 
ATOM   5205  N  N   . TYR C  3 380 ? 180.857 114.367 119.672 1.00 64.85  ?  408 TYR E N   1 
ATOM   5206  C  CA  . TYR C  3 380 ? 180.083 114.065 118.479 1.00 64.85  ?  408 TYR E CA  1 
ATOM   5207  C  C   . TYR C  3 380 ? 180.744 114.713 117.273 1.00 64.85  ?  408 TYR E C   1 
ATOM   5208  O  O   . TYR C  3 380 ? 181.251 115.834 117.364 1.00 64.85  ?  408 TYR E O   1 
ATOM   5209  C  CB  . TYR C  3 380 ? 178.651 114.571 118.624 1.00 64.85  ?  408 TYR E CB  1 
ATOM   5210  C  CG  . TYR C  3 380 ? 177.819 113.803 119.615 1.00 64.85  ?  408 TYR E CG  1 
ATOM   5211  C  CD1 . TYR C  3 380 ? 177.205 112.615 119.253 1.00 64.85  ?  408 TYR E CD1 1 
ATOM   5212  C  CD2 . TYR C  3 380 ? 177.646 114.265 120.912 1.00 64.85  ?  408 TYR E CD2 1 
ATOM   5213  C  CE1 . TYR C  3 380 ? 176.441 111.908 120.149 1.00 64.85  ?  408 TYR E CE1 1 
ATOM   5214  C  CE2 . TYR C  3 380 ? 176.882 113.563 121.818 1.00 64.85  ?  408 TYR E CE2 1 
ATOM   5215  C  CZ  . TYR C  3 380 ? 176.284 112.385 121.428 1.00 64.85  ?  408 TYR E CZ  1 
ATOM   5216  O  OH  . TYR C  3 380 ? 175.519 111.671 122.313 1.00 64.85  ?  408 TYR E OH  1 
ATOM   5217  N  N   . SER C  3 381 ? 180.732 114.011 116.146 1.00 72.30  ?  409 SER E N   1 
ATOM   5218  C  CA  . SER C  3 381 ? 181.315 114.501 114.900 1.00 72.30  ?  409 SER E CA  1 
ATOM   5219  C  C   . SER C  3 381 ? 180.220 114.463 113.843 1.00 72.30  ?  409 SER E C   1 
ATOM   5220  O  O   . SER C  3 381 ? 179.930 113.409 113.274 1.00 72.30  ?  409 SER E O   1 
ATOM   5221  C  CB  . SER C  3 381 ? 182.519 113.669 114.482 1.00 72.30  ?  409 SER E CB  1 
ATOM   5222  O  OG  . SER C  3 381 ? 182.123 112.356 114.125 1.00 72.30  ?  409 SER E OG  1 
ATOM   5223  N  N   . LEU C  3 382 ? 179.614 115.616 113.583 1.00 69.39  ?  410 LEU E N   1 
ATOM   5224  C  CA  . LEU C  3 382 ? 178.544 115.737 112.608 1.00 69.39  ?  410 LEU E CA  1 
ATOM   5225  C  C   . LEU C  3 382 ? 178.988 116.646 111.475 1.00 69.39  ?  410 LEU E C   1 
ATOM   5226  O  O   . LEU C  3 382 ? 179.952 117.405 111.607 1.00 69.39  ?  410 LEU E O   1 
ATOM   5227  C  CB  . LEU C  3 382 ? 177.273 116.290 113.250 1.00 69.39  ?  410 LEU E CB  1 
ATOM   5228  C  CG  . LEU C  3 382 ? 176.682 115.391 114.331 1.00 69.39  ?  410 LEU E CG  1 
ATOM   5229  C  CD1 . LEU C  3 382 ? 175.505 116.061 114.999 1.00 69.39  ?  410 LEU E CD1 1 
ATOM   5230  C  CD2 . LEU C  3 382 ? 176.273 114.059 113.740 1.00 69.39  ?  410 LEU E CD2 1 
ATOM   5231  N  N   . SER C  3 383 ? 178.279 116.564 110.357 1.00 72.91  ?  411 SER E N   1 
ATOM   5232  C  CA  . SER C  3 383 ? 178.552 117.397 109.197 1.00 72.91  ?  411 SER E CA  1 
ATOM   5233  C  C   . SER C  3 383 ? 177.247 117.974 108.676 1.00 72.91  ?  411 SER E C   1 
ATOM   5234  O  O   . SER C  3 383 ? 176.230 117.276 108.625 1.00 72.91  ?  411 SER E O   1 
ATOM   5235  C  CB  . SER C  3 383 ? 179.262 116.602 108.100 1.00 72.91  ?  411 SER E CB  1 
ATOM   5236  O  OG  . SER C  3 383 ? 178.423 115.586 107.583 1.00 72.91  ?  411 SER E OG  1 
ATOM   5237  N  N   . VAL C  3 384 ? 177.279 119.243 108.298 1.00 71.84  ?  412 VAL E N   1 
ATOM   5238  C  CA  . VAL C  3 384 ? 176.115 119.949 107.788 1.00 71.84  ?  412 VAL E CA  1 
ATOM   5239  C  C   . VAL C  3 384 ? 176.413 120.397 106.369 1.00 71.84  ?  412 VAL E C   1 
ATOM   5240  O  O   . VAL C  3 384 ? 177.460 120.991 106.096 1.00 71.84  ?  412 VAL E O   1 
ATOM   5241  C  CB  . VAL C  3 384 ? 175.765 121.161 108.673 1.00 71.84  ?  412 VAL E CB  1 
ATOM   5242  C  CG1 . VAL C  3 384 ? 174.560 121.901 108.132 1.00 71.84  ?  412 VAL E CG1 1 
ATOM   5243  C  CG2 . VAL C  3 384 ? 175.529 120.723 110.087 1.00 71.84  ?  412 VAL E CG2 1 
ATOM   5244  N  N   . SER C  3 385 ? 175.494 120.102 105.458 1.00 72.16  ?  413 SER E N   1 
ATOM   5245  C  CA  . SER C  3 385 ? 175.570 120.646 104.113 1.00 72.16  ?  413 SER E CA  1 
ATOM   5246  C  C   . SER C  3 385 ? 175.300 122.142 104.179 1.00 72.16  ?  413 SER E C   1 
ATOM   5247  O  O   . SER C  3 385 ? 174.410 122.584 104.911 1.00 72.16  ?  413 SER E O   1 
ATOM   5248  C  CB  . SER C  3 385 ? 174.572 119.958 103.185 1.00 72.16  ?  413 SER E CB  1 
ATOM   5249  O  OG  . SER C  3 385 ? 174.896 118.589 103.021 1.00 72.16  ?  413 SER E OG  1 
ATOM   5250  N  N   . ARG C  3 386 ? 176.090 122.921 103.437 1.00 79.26  ?  414 ARG E N   1 
ATOM   5251  C  CA  . ARG C  3 386 ? 175.915 124.368 103.445 1.00 79.26  ?  414 ARG E CA  1 
ATOM   5252  C  C   . ARG C  3 386 ? 174.602 124.781 102.794 1.00 79.26  ?  414 ARG E C   1 
ATOM   5253  O  O   . ARG C  3 386 ? 173.986 125.765 103.219 1.00 79.26  ?  414 ARG E O   1 
ATOM   5254  C  CB  . ARG C  3 386 ? 177.104 125.046 102.754 1.00 79.26  ?  414 ARG E CB  1 
ATOM   5255  C  CG  . ARG C  3 386 ? 177.072 126.569 102.793 1.00 79.26  ?  414 ARG E CG  1 
ATOM   5256  C  CD  . ARG C  3 386 ? 178.325 127.193 102.217 1.00 79.26  ?  414 ARG E CD  1 
ATOM   5257  N  NE  . ARG C  3 386 ? 179.479 126.975 103.080 1.00 79.26  ?  414 ARG E NE  1 
ATOM   5258  C  CZ  . ARG C  3 386 ? 180.722 127.313 102.761 1.00 79.26  ?  414 ARG E CZ  1 
ATOM   5259  N  NH1 . ARG C  3 386 ? 180.973 127.891 101.595 1.00 79.26  ?  414 ARG E NH1 1 
ATOM   5260  N  NH2 . ARG C  3 386 ? 181.713 127.076 103.608 1.00 79.26  ?  414 ARG E NH2 1 
ATOM   5261  N  N   . ARG C  3 387 ? 174.125 124.018 101.819 1.00 74.65  ?  415 ARG E N   1 
ATOM   5262  C  CA  . ARG C  3 387 ? 172.879 124.330 101.141 1.00 74.65  ?  415 ARG E CA  1 
ATOM   5263  C  C   . ARG C  3 387 ? 171.642 123.820 101.872 1.00 74.65  ?  415 ARG E C   1 
ATOM   5264  O  O   . ARG C  3 387 ? 170.566 123.779 101.269 1.00 74.65  ?  415 ARG E O   1 
ATOM   5265  C  CB  . ARG C  3 387 ? 172.914 123.762 99.718  1.00 74.65  ?  415 ARG E CB  1 
ATOM   5266  C  CG  . ARG C  3 387 ? 173.065 122.256 99.661  1.00 74.65  ?  415 ARG E CG  1 
ATOM   5267  C  CD  . ARG C  3 387 ? 173.154 121.777 98.230  1.00 74.65  ?  415 ARG E CD  1 
ATOM   5268  N  NE  . ARG C  3 387 ? 171.936 122.095 97.498  1.00 74.65  ?  415 ARG E NE  1 
ATOM   5269  C  CZ  . ARG C  3 387 ? 171.813 122.019 96.179  1.00 74.65  ?  415 ARG E CZ  1 
ATOM   5270  N  NH1 . ARG C  3 387 ? 172.835 121.619 95.436  1.00 74.65  ?  415 ARG E NH1 1 
ATOM   5271  N  NH2 . ARG C  3 387 ? 170.664 122.339 95.603  1.00 74.65  ?  415 ARG E NH2 1 
ATOM   5272  N  N   . ALA C  3 388 ? 171.760 123.441 103.145 1.00 68.69  ?  416 ALA E N   1 
ATOM   5273  C  CA  . ALA C  3 388 ? 170.616 122.929 103.888 1.00 68.69  ?  416 ALA E CA  1 
ATOM   5274  C  C   . ALA C  3 388 ? 169.650 124.053 104.245 1.00 68.69  ?  416 ALA E C   1 
ATOM   5275  O  O   . ALA C  3 388 ? 169.982 125.238 104.166 1.00 68.69  ?  416 ALA E O   1 
ATOM   5276  C  CB  . ALA C  3 388 ? 171.076 122.218 105.158 1.00 68.69  ?  416 ALA E CB  1 
ATOM   5277  N  N   . ARG C  3 389 ? 168.441 123.666 104.645 1.00 59.54  ?  417 ARG E N   1 
ATOM   5278  C  CA  . ARG C  3 389 ? 167.370 124.610 104.920 1.00 59.54  ?  417 ARG E CA  1 
ATOM   5279  C  C   . ARG C  3 389 ? 166.992 124.570 106.400 1.00 59.54  ?  417 ARG E C   1 
ATOM   5280  O  O   . ARG C  3 389 ? 167.514 123.768 107.177 1.00 59.54  ?  417 ARG E O   1 
ATOM   5281  C  CB  . ARG C  3 389 ? 166.170 124.309 104.031 1.00 59.54  ?  417 ARG E CB  1 
ATOM   5282  C  CG  . ARG C  3 389 ? 166.422 124.472 102.553 1.00 59.54  ?  417 ARG E CG  1 
ATOM   5283  C  CD  . ARG C  3 389 ? 166.614 125.930 102.206 1.00 59.54  ?  417 ARG E CD  1 
ATOM   5284  N  NE  . ARG C  3 389 ? 165.450 126.734 102.567 1.00 59.54  ?  417 ARG E NE  1 
ATOM   5285  C  CZ  . ARG C  3 389 ? 164.389 126.910 101.787 1.00 59.54  ?  417 ARG E CZ  1 
ATOM   5286  N  NH1 . ARG C  3 389 ? 164.336 126.339 100.593 1.00 59.54  ?  417 ARG E NH1 1 
ATOM   5287  N  NH2 . ARG C  3 389 ? 163.379 127.660 102.204 1.00 59.54  ?  417 ARG E NH2 1 
ATOM   5288  N  N   . ARG C  3 390 ? 166.068 125.440 106.796 1.00 49.02  ?  418 ARG E N   1 
ATOM   5289  C  CA  . ARG C  3 390 ? 165.653 125.552 108.185 1.00 49.02  ?  418 ARG E CA  1 
ATOM   5290  C  C   . ARG C  3 390 ? 164.804 124.346 108.576 1.00 49.02  ?  418 ARG E C   1 
ATOM   5291  O  O   . ARG C  3 390 ? 164.056 123.811 107.756 1.00 49.02  ?  418 ARG E O   1 
ATOM   5292  C  CB  . ARG C  3 390 ? 164.872 126.853 108.395 1.00 49.02  ?  418 ARG E CB  1 
ATOM   5293  C  CG  . ARG C  3 390 ? 164.564 127.178 109.844 1.00 49.02  ?  418 ARG E CG  1 
ATOM   5294  C  CD  . ARG C  3 390 ? 163.794 128.463 110.024 1.00 49.02  ?  418 ARG E CD  1 
ATOM   5295  N  NE  . ARG C  3 390 ? 163.426 128.635 111.425 1.00 49.02  ?  418 ARG E NE  1 
ATOM   5296  C  CZ  . ARG C  3 390 ? 162.710 129.648 111.894 1.00 49.02  ?  418 ARG E CZ  1 
ATOM   5297  N  NH1 . ARG C  3 390 ? 162.277 130.589 111.071 1.00 49.02  ?  418 ARG E NH1 1 
ATOM   5298  N  NH2 . ARG C  3 390 ? 162.420 129.716 113.185 1.00 49.02  ?  418 ARG E NH2 1 
ATOM   5299  N  N   . PHE C  3 391 ? 164.940 123.923 109.841 1.00 48.01  ?  419 PHE E N   1 
ATOM   5300  C  CA  . PHE C  3 391 ? 164.293 122.732 110.410 1.00 48.01  ?  419 PHE E CA  1 
ATOM   5301  C  C   . PHE C  3 391 ? 164.655 121.479 109.620 1.00 48.01  ?  419 PHE E C   1 
ATOM   5302  O  O   . PHE C  3 391 ? 163.804 120.827 109.017 1.00 48.01  ?  419 PHE E O   1 
ATOM   5303  C  CB  . PHE C  3 391 ? 162.774 122.881 110.500 1.00 48.01  ?  419 PHE E CB  1 
ATOM   5304  C  CG  . PHE C  3 391 ? 162.315 123.920 111.463 1.00 48.01  ?  419 PHE E CG  1 
ATOM   5305  C  CD1 . PHE C  3 391 ? 162.340 123.681 112.823 1.00 48.01  ?  419 PHE E CD1 1 
ATOM   5306  C  CD2 . PHE C  3 391 ? 161.806 125.120 111.006 1.00 48.01  ?  419 PHE E CD2 1 
ATOM   5307  C  CE1 . PHE C  3 391 ? 161.900 124.636 113.715 1.00 48.01  ?  419 PHE E CE1 1 
ATOM   5308  C  CE2 . PHE C  3 391 ? 161.362 126.079 111.891 1.00 48.01  ?  419 PHE E CE2 1 
ATOM   5309  C  CZ  . PHE C  3 391 ? 161.408 125.836 113.248 1.00 48.01  ?  419 PHE E CZ  1 
ATOM   5310  N  N   . ALA C  3 392 ? 165.935 121.150 109.618 1.00 49.22  ?  420 ALA E N   1 
ATOM   5311  C  CA  . ALA C  3 392 ? 166.452 119.997 108.895 1.00 49.22  ?  420 ALA E CA  1 
ATOM   5312  C  C   . ALA C  3 392 ? 167.184 119.112 109.890 1.00 49.22  ?  420 ALA E C   1 
ATOM   5313  O  O   . ALA C  3 392 ? 168.166 119.541 110.498 1.00 49.22  ?  420 ALA E O   1 
ATOM   5314  C  CB  . ALA C  3 392 ? 167.372 120.439 107.763 1.00 49.22  ?  420 ALA E CB  1 
ATOM   5315  N  N   . GLN C  3 393 ? 166.709 117.883 110.057 1.00 48.63  ?  421 GLN E N   1 
ATOM   5316  C  CA  . GLN C  3 393 ? 167.272 116.997 111.066 1.00 48.63  ?  421 GLN E CA  1 
ATOM   5317  C  C   . GLN C  3 393 ? 168.644 116.498 110.637 1.00 48.63  ?  421 GLN E C   1 
ATOM   5318  O  O   . GLN C  3 393 ? 168.789 115.897 109.568 1.00 48.63  ?  421 GLN E O   1 
ATOM   5319  C  CB  . GLN C  3 393 ? 166.335 115.823 111.329 1.00 48.63  ?  421 GLN E CB  1 
ATOM   5320  C  CG  . GLN C  3 393 ? 164.967 116.242 111.824 1.00 48.63  ?  421 GLN E CG  1 
ATOM   5321  C  CD  . GLN C  3 393 ? 164.105 115.062 112.196 1.00 48.63  ?  421 GLN E CD  1 
ATOM   5322  O  OE1 . GLN C  3 393 ? 164.516 113.912 112.056 1.00 48.63  ?  421 GLN E OE1 1 
ATOM   5323  N  NE2 . GLN C  3 393 ? 162.902 115.337 112.673 1.00 48.63  ?  421 GLN E NE2 1 
ATOM   5324  N  N   . ILE C  3 394 ? 169.655 116.753 111.462 1.00 51.36  ?  422 ILE E N   1 
ATOM   5325  C  CA  . ILE C  3 394 ? 171.033 116.425 111.124 1.00 51.36  ?  422 ILE E CA  1 
ATOM   5326  C  C   . ILE C  3 394 ? 171.442 115.147 111.833 1.00 51.36  ?  422 ILE E C   1 
ATOM   5327  O  O   . ILE C  3 394 ? 171.821 114.161 111.194 1.00 51.36  ?  422 ILE E O   1 
ATOM   5328  C  CB  . ILE C  3 394 ? 171.976 117.573 111.505 1.00 51.36  ?  422 ILE E CB  1 
ATOM   5329  C  CG1 . ILE C  3 394 ? 171.568 118.847 110.782 1.00 51.36  ?  422 ILE E CG1 1 
ATOM   5330  C  CG2 . ILE C  3 394 ? 173.405 117.209 111.177 1.00 51.36  ?  422 ILE E CG2 1 
ATOM   5331  C  CD1 . ILE C  3 394 ? 172.154 120.073 111.395 1.00 51.36  ?  422 ILE E CD1 1 
ATOM   5332  N  N   . GLY C  3 395 ? 171.382 115.163 113.159 1.00 46.96  ?  423 GLY E N   1 
ATOM   5333  C  CA  . GLY C  3 395 ? 171.753 113.999 113.932 1.00 46.96  ?  423 GLY E CA  1 
ATOM   5334  C  C   . GLY C  3 395 ? 170.781 113.722 115.054 1.00 46.96  ?  423 GLY E C   1 
ATOM   5335  O  O   . GLY C  3 395 ? 169.627 114.152 115.005 1.00 46.96  ?  423 GLY E O   1 
ATOM   5336  N  N   . LYS C  3 396 ? 171.235 113.001 116.071 1.00 42.31  ?  424 LYS E N   1 
ATOM   5337  C  CA  . LYS C  3 396 ? 170.397 112.709 117.224 1.00 42.31  ?  424 LYS E CA  1 
ATOM   5338  C  C   . LYS C  3 396 ? 171.296 112.542 118.433 1.00 42.31  ?  424 LYS E C   1 
ATOM   5339  O  O   . LYS C  3 396 ? 172.057 111.575 118.506 1.00 42.31  ?  424 LYS E O   1 
ATOM   5340  C  CB  . LYS C  3 396 ? 169.563 111.450 117.000 1.00 42.31  ?  424 LYS E CB  1 
ATOM   5341  C  CG  . LYS C  3 396 ? 168.605 111.140 118.139 1.00 42.31  ?  424 LYS E CG  1 
ATOM   5342  C  CD  . LYS C  3 396 ? 167.871 109.829 117.914 1.00 42.31  ?  424 LYS E CD  1 
ATOM   5343  C  CE  . LYS C  3 396 ? 166.816 109.964 116.833 1.00 42.31  ?  424 LYS E CE  1 
ATOM   5344  N  NZ  . LYS C  3 396 ? 166.016 108.718 116.685 1.00 42.31  ?  424 LYS E NZ  1 
ATOM   5345  N  N   . VAL C  3 397 ? 171.210 113.471 119.374 1.00 47.15  ?  425 VAL E N   1 
ATOM   5346  C  CA  . VAL C  3 397 ? 171.932 113.364 120.632 1.00 47.15  ?  425 VAL E CA  1 
ATOM   5347  C  C   . VAL C  3 397 ? 171.092 112.460 121.519 1.00 47.15  ?  425 VAL E C   1 
ATOM   5348  O  O   . VAL C  3 397 ? 169.862 112.576 121.540 1.00 47.15  ?  425 VAL E O   1 
ATOM   5349  C  CB  . VAL C  3 397 ? 172.165 114.738 121.272 1.00 47.15  ?  425 VAL E CB  1 
ATOM   5350  C  CG1 . VAL C  3 397 ? 172.958 114.611 122.562 1.00 47.15  ?  425 VAL E CG1 1 
ATOM   5351  C  CG2 . VAL C  3 397 ? 172.877 115.644 120.303 1.00 47.15  ?  425 VAL E CG2 1 
ATOM   5352  N  N   . CYS C  3 398 ? 171.732 111.534 122.228 1.00 48.45  ?  426 CYS E N   1 
ATOM   5353  C  CA  . CYS C  3 398 ? 170.982 110.585 123.028 1.00 48.45  ?  426 CYS E CA  1 
ATOM   5354  C  C   . CYS C  3 398 ? 171.857 110.074 124.160 1.00 48.45  ?  426 CYS E C   1 
ATOM   5355  O  O   . CYS C  3 398 ? 173.015 109.706 123.957 1.00 48.45  ?  426 CYS E O   1 
ATOM   5356  C  CB  . CYS C  3 398 ? 170.476 109.428 122.167 1.00 48.45  ?  426 CYS E CB  1 
ATOM   5357  S  SG  . CYS C  3 398 ? 169.308 108.375 123.009 1.00 48.45  ?  426 CYS E SG  1 
ATOM   5358  N  N   . VAL C  3 399 ? 171.286 110.072 125.365 1.00 48.65  ?  427 VAL E N   1 
ATOM   5359  C  CA  . VAL C  3 399 ? 171.880 109.368 126.494 1.00 48.65  ?  427 VAL E CA  1 
ATOM   5360  C  C   . VAL C  3 399 ? 171.972 107.883 126.152 1.00 48.65  ?  427 VAL E C   1 
ATOM   5361  O  O   . VAL C  3 399 ? 171.072 107.333 125.519 1.00 48.65  ?  427 VAL E O   1 
ATOM   5362  C  CB  . VAL C  3 399 ? 171.043 109.617 127.764 1.00 48.65  ?  427 VAL E CB  1 
ATOM   5363  C  CG1 . VAL C  3 399 ? 171.665 108.984 128.999 1.00 48.65  ?  427 VAL E CG1 1 
ATOM   5364  C  CG2 . VAL C  3 399 ? 170.837 111.100 127.971 1.00 48.65  ?  427 VAL E CG2 1 
ATOM   5365  N  N   . GLU C  3 400 ? 173.067 107.241 126.598 1.00 52.88  ?  428 GLU E N   1 
ATOM   5366  C  CA  . GLU C  3 400 ? 173.586 106.007 125.992 1.00 52.88  ?  428 GLU E CA  1 
ATOM   5367  C  C   . GLU C  3 400 ? 172.566 104.868 125.982 1.00 52.88  ?  428 GLU E C   1 
ATOM   5368  O  O   . GLU C  3 400 ? 172.450 104.136 124.994 1.00 52.88  ?  428 GLU E O   1 
ATOM   5369  C  CB  . GLU C  3 400 ? 174.851 105.568 126.730 1.00 52.88  ?  428 GLU E CB  1 
ATOM   5370  C  CG  . GLU C  3 400 ? 175.517 104.332 126.146 1.00 52.88  ?  428 GLU E CG  1 
ATOM   5371  C  CD  . GLU C  3 400 ? 176.745 103.907 126.923 1.00 52.88  ?  428 GLU E CD  1 
ATOM   5372  O  OE1 . GLU C  3 400 ? 177.061 104.556 127.941 1.00 52.88  ?  428 GLU E OE1 1 
ATOM   5373  O  OE2 . GLU C  3 400 ? 177.395 102.921 126.517 1.00 52.88  ?  428 GLU E OE2 1 
ATOM   5374  N  N   . ASN C  3 401 ? 171.795 104.726 127.052 1.00 53.46  ?  429 ASN E N   1 
ATOM   5375  C  CA  . ASN C  3 401 ? 170.758 103.704 127.128 1.00 53.46  ?  429 ASN E CA  1 
ATOM   5376  C  C   . ASN C  3 401 ? 169.434 104.305 126.665 1.00 53.46  ?  429 ASN E C   1 
ATOM   5377  O  O   . ASN C  3 401 ? 168.496 104.460 127.444 1.00 53.46  ?  429 ASN E O   1 
ATOM   5378  C  CB  . ASN C  3 401 ? 170.671 103.162 128.545 1.00 53.46  ?  429 ASN E CB  1 
ATOM   5379  C  CG  . ASN C  3 401 ? 171.893 102.363 128.928 1.00 53.46  ?  429 ASN E CG  1 
ATOM   5380  O  OD1 . ASN C  3 401 ? 172.368 101.532 128.156 1.00 53.46  ?  429 ASN E OD1 1 
ATOM   5381  N  ND2 . ASN C  3 401 ? 172.436 102.635 130.108 1.00 53.46  ?  429 ASN E ND2 1 
ATOM   5382  N  N   . CYS C  3 402 ? 169.364 104.597 125.359 1.00 58.64  ?  430 CYS E N   1 
ATOM   5383  C  CA  . CYS C  3 402 ? 168.359 105.469 124.748 1.00 58.64  ?  430 CYS E CA  1 
ATOM   5384  C  C   . CYS C  3 402 ? 166.904 105.089 124.970 1.00 58.64  ?  430 CYS E C   1 
ATOM   5385  O  O   . CYS C  3 402 ? 166.186 105.772 125.705 1.00 58.64  ?  430 CYS E O   1 
ATOM   5386  C  CB  . CYS C  3 402 ? 168.569 105.520 123.231 1.00 58.64  ?  430 CYS E CB  1 
ATOM   5387  S  SG  . CYS C  3 402 ? 169.954 106.490 122.642 1.00 58.64  ?  430 CYS E SG  1 
ATOM   5388  N  N   . GLN C  3 403 ? 166.474 103.984 124.373 1.00 62.12  ?  431 GLN E N   1 
ATOM   5389  C  CA  . GLN C  3 403 ? 165.050 103.742 124.200 1.00 62.12  ?  431 GLN E CA  1 
ATOM   5390  C  C   . GLN C  3 403 ? 164.415 103.022 125.375 1.00 62.12  ?  431 GLN E C   1 
ATOM   5391  O  O   . GLN C  3 403 ? 163.212 102.747 125.331 1.00 62.12  ?  431 GLN E O   1 
ATOM   5392  C  CB  . GLN C  3 403 ? 164.807 102.948 122.917 1.00 62.12  ?  431 GLN E CB  1 
ATOM   5393  C  CG  . GLN C  3 403 ? 165.177 103.707 121.660 1.00 62.12  ?  431 GLN E CG  1 
ATOM   5394  C  CD  . GLN C  3 403 ? 164.920 102.909 120.402 1.00 62.12  ?  431 GLN E CD  1 
ATOM   5395  O  OE1 . GLN C  3 403 ? 164.513 101.749 120.460 1.00 62.12  ?  431 GLN E OE1 1 
ATOM   5396  N  NE2 . GLN C  3 403 ? 165.157 103.527 119.252 1.00 62.12  ?  431 GLN E NE2 1 
ATOM   5397  N  N   . ALA C  3 404 ? 165.174 102.716 126.415 1.00 53.09  ?  432 ALA E N   1 
ATOM   5398  C  CA  . ALA C  3 404 ? 164.615 102.056 127.580 1.00 53.09  ?  432 ALA E CA  1 
ATOM   5399  C  C   . ALA C  3 404 ? 164.095 103.034 128.622 1.00 53.09  ?  432 ALA E C   1 
ATOM   5400  O  O   . ALA C  3 404 ? 163.570 102.595 129.647 1.00 53.09  ?  432 ALA E O   1 
ATOM   5401  C  CB  . ALA C  3 404 ? 165.654 101.130 128.207 1.00 53.09  ?  432 ALA E CB  1 
ATOM   5402  N  N   . PHE C  3 405 ? 164.219 104.339 128.390 1.00 51.36  ?  433 PHE E N   1 
ATOM   5403  C  CA  . PHE C  3 405 ? 163.678 105.320 129.321 1.00 51.36  ?  433 PHE E CA  1 
ATOM   5404  C  C   . PHE C  3 405 ? 162.176 105.456 129.127 1.00 51.36  ?  433 PHE E C   1 
ATOM   5405  O  O   . PHE C  3 405 ? 161.700 105.617 128.000 1.00 51.36  ?  433 PHE E O   1 
ATOM   5406  C  CB  . PHE C  3 405 ? 164.337 106.686 129.137 1.00 51.36  ?  433 PHE E CB  1 
ATOM   5407  C  CG  . PHE C  3 405 ? 165.760 106.746 129.595 1.00 51.36  ?  433 PHE E CG  1 
ATOM   5408  C  CD1 . PHE C  3 405 ? 166.060 106.672 130.940 1.00 51.36  ?  433 PHE E CD1 1 
ATOM   5409  C  CD2 . PHE C  3 405 ? 166.788 106.946 128.695 1.00 51.36  ?  433 PHE E CD2 1 
ATOM   5410  C  CE1 . PHE C  3 405 ? 167.363 106.741 131.383 1.00 51.36  ?  433 PHE E CE1 1 
ATOM   5411  C  CE2 . PHE C  3 405 ? 168.093 107.031 129.135 1.00 51.36  ?  433 PHE E CE2 1 
ATOM   5412  C  CZ  . PHE C  3 405 ? 168.380 106.919 130.479 1.00 51.36  ?  433 PHE E CZ  1 
ATOM   5413  N  N   . SER C  3 406 ? 161.435 105.393 130.219 1.00 52.85  ?  434 SER E N   1 
ATOM   5414  C  CA  . SER C  3 406 ? 160.007 105.669 130.141 1.00 52.85  ?  434 SER E CA  1 
ATOM   5415  C  C   . SER C  3 406 ? 159.544 106.730 131.127 1.00 52.85  ?  434 SER E C   1 
ATOM   5416  O  O   . SER C  3 406 ? 158.716 107.570 130.768 1.00 52.85  ?  434 SER E O   1 
ATOM   5417  C  CB  . SER C  3 406 ? 159.207 104.379 130.359 1.00 52.85  ?  434 SER E CB  1 
ATOM   5418  O  OG  . SER C  3 406 ? 159.446 103.452 129.318 1.00 52.85  ?  434 SER E OG  1 
ATOM   5419  N  N   . GLY C  3 407 ? 160.059 106.725 132.352 1.00 51.36  ?  435 GLY E N   1 
ATOM   5420  C  CA  . GLY C  3 407 ? 159.580 107.650 133.358 1.00 51.36  ?  435 GLY E CA  1 
ATOM   5421  C  C   . GLY C  3 407 ? 160.582 108.709 133.760 1.00 51.36  ?  435 GLY E C   1 
ATOM   5422  O  O   . GLY C  3 407 ? 160.580 109.178 134.901 1.00 51.36  ?  435 GLY E O   1 
ATOM   5423  N  N   . ILE C  3 408 ? 161.444 109.105 132.833 1.00 52.34  ?  436 ILE E N   1 
ATOM   5424  C  CA  . ILE C  3 408 ? 162.518 110.045 133.112 1.00 52.34  ?  436 ILE E CA  1 
ATOM   5425  C  C   . ILE C  3 408 ? 162.461 111.175 132.093 1.00 52.34  ?  436 ILE E C   1 
ATOM   5426  O  O   . ILE C  3 408 ? 162.445 110.924 130.882 1.00 52.34  ?  436 ILE E O   1 
ATOM   5427  C  CB  . ILE C  3 408 ? 163.891 109.346 133.092 1.00 52.34  ?  436 ILE E CB  1 
ATOM   5428  C  CG1 . ILE C  3 408 ? 164.033 108.422 134.296 1.00 52.34  ?  436 ILE E CG1 1 
ATOM   5429  C  CG2 . ILE C  3 408 ? 165.000 110.339 133.079 1.00 52.34  ?  436 ILE E CG2 1 
ATOM   5430  C  CD1 . ILE C  3 408 ? 165.288 107.614 134.281 1.00 52.34  ?  436 ILE E CD1 1 
ATOM   5431  N  N   . ASN C  3 409 ? 162.418 112.415 132.584 1.00 54.56  ?  437 ASN E N   1 
ATOM   5432  C  CA  . ASN C  3 409 ? 162.373 113.606 131.743 1.00 54.56  ?  437 ASN E CA  1 
ATOM   5433  C  C   . ASN C  3 409 ? 163.791 114.124 131.544 1.00 54.56  ?  437 ASN E C   1 
ATOM   5434  O  O   . ASN C  3 409 ? 164.427 114.595 132.490 1.00 54.56  ?  437 ASN E O   1 
ATOM   5435  C  CB  . ASN C  3 409 ? 161.491 114.676 132.374 1.00 54.56  ?  437 ASN E CB  1 
ATOM   5436  C  CG  . ASN C  3 409 ? 160.025 114.323 132.321 1.00 54.56  ?  437 ASN E CG  1 
ATOM   5437  O  OD1 . ASN C  3 409 ? 159.522 113.872 131.293 1.00 54.56  ?  437 ASN E OD1 1 
ATOM   5438  N  ND2 . ASN C  3 409 ? 159.329 114.511 133.437 1.00 54.56  ?  437 ASN E ND2 1 
ATOM   5439  N  N   . VAL C  3 410 ? 164.280 114.045 130.313 1.00 46.86  ?  438 VAL E N   1 
ATOM   5440  C  CA  . VAL C  3 410 ? 165.623 114.478 129.957 1.00 46.86  ?  438 VAL E CA  1 
ATOM   5441  C  C   . VAL C  3 410 ? 165.499 115.490 128.835 1.00 46.86  ?  438 VAL E C   1 
ATOM   5442  O  O   . VAL C  3 410 ? 164.961 115.172 127.769 1.00 46.86  ?  438 VAL E O   1 
ATOM   5443  C  CB  . VAL C  3 410 ? 166.504 113.297 129.532 1.00 46.86  ?  438 VAL E CB  1 
ATOM   5444  C  CG1 . VAL C  3 410 ? 167.768 113.787 128.918 1.00 46.86  ?  438 VAL E CG1 1 
ATOM   5445  C  CG2 . VAL C  3 410 ? 166.847 112.454 130.724 1.00 46.86  ?  438 VAL E CG2 1 
ATOM   5446  N  N   . GLN C  3 411 ? 165.994 116.701 129.064 1.00 47.64  ?  439 GLN E N   1 
ATOM   5447  C  CA  . GLN C  3 411 ? 165.895 117.769 128.081 1.00 47.64  ?  439 GLN E CA  1 
ATOM   5448  C  C   . GLN C  3 411 ? 167.279 118.249 127.682 1.00 47.64  ?  439 GLN E C   1 
ATOM   5449  O  O   . GLN C  3 411 ? 168.230 118.178 128.462 1.00 47.64  ?  439 GLN E O   1 
ATOM   5450  C  CB  . GLN C  3 411 ? 165.075 118.939 128.613 1.00 47.64  ?  439 GLN E CB  1 
ATOM   5451  C  CG  . GLN C  3 411 ? 163.608 118.621 128.752 1.00 47.64  ?  439 GLN E CG  1 
ATOM   5452  C  CD  . GLN C  3 411 ? 162.825 119.766 129.332 1.00 47.64  ?  439 GLN E CD  1 
ATOM   5453  O  OE1 . GLN C  3 411 ? 163.393 120.781 129.731 1.00 47.64  ?  439 GLN E OE1 1 
ATOM   5454  N  NE2 . GLN C  3 411 ? 161.508 119.617 129.377 1.00 47.64  ?  439 GLN E NE2 1 
ATOM   5455  N  N   . TYR C  3 412 ? 167.397 118.732 126.453 1.00 47.81  ?  440 TYR E N   1 
ATOM   5456  C  CA  . TYR C  3 412 ? 168.691 119.122 125.917 1.00 47.81  ?  440 TYR E CA  1 
ATOM   5457  C  C   . TYR C  3 412 ? 168.704 120.602 125.576 1.00 47.81  ?  440 TYR E C   1 
ATOM   5458  O  O   . TYR C  3 412 ? 167.778 121.113 124.941 1.00 47.81  ?  440 TYR E O   1 
ATOM   5459  C  CB  . TYR C  3 412 ? 169.050 118.344 124.659 1.00 47.81  ?  440 TYR E CB  1 
ATOM   5460  C  CG  . TYR C  3 412 ? 169.299 116.870 124.825 1.00 47.81  ?  440 TYR E CG  1 
ATOM   5461  C  CD1 . TYR C  3 412 ? 169.471 116.295 126.068 1.00 47.81  ?  440 TYR E CD1 1 
ATOM   5462  C  CD2 . TYR C  3 412 ? 169.390 116.058 123.720 1.00 47.81  ?  440 TYR E CD2 1 
ATOM   5463  C  CE1 . TYR C  3 412 ? 169.688 114.953 126.195 1.00 47.81  ?  440 TYR E CE1 1 
ATOM   5464  C  CE2 . TYR C  3 412 ? 169.605 114.717 123.844 1.00 47.81  ?  440 TYR E CE2 1 
ATOM   5465  C  CZ  . TYR C  3 412 ? 169.760 114.169 125.084 1.00 47.81  ?  440 TYR E CZ  1 
ATOM   5466  O  OH  . TYR C  3 412 ? 169.985 112.825 125.225 1.00 47.81  ?  440 TYR E OH  1 
ATOM   5467  N  N   . LYS C  3 413 ? 169.771 121.277 125.988 1.00 50.52  ?  441 LYS E N   1 
ATOM   5468  C  CA  . LYS C  3 413 ? 170.057 122.640 125.578 1.00 50.52  ?  441 LYS E CA  1 
ATOM   5469  C  C   . LYS C  3 413 ? 171.317 122.637 124.728 1.00 50.52  ?  441 LYS E C   1 
ATOM   5470  O  O   . LYS C  3 413 ? 172.121 121.702 124.787 1.00 50.52  ?  441 LYS E O   1 
ATOM   5471  C  CB  . LYS C  3 413 ? 170.237 123.562 126.783 1.00 50.52  ?  441 LYS E CB  1 
ATOM   5472  C  CG  . LYS C  3 413 ? 169.019 123.649 127.681 1.00 50.52  ?  441 LYS E CG  1 
ATOM   5473  C  CD  . LYS C  3 413 ? 167.838 124.247 126.948 1.00 50.52  ?  441 LYS E CD  1 
ATOM   5474  C  CE  . LYS C  3 413 ? 168.092 125.704 126.612 1.00 50.52  ?  441 LYS E CE  1 
ATOM   5475  N  NZ  . LYS C  3 413 ? 168.229 126.531 127.841 1.00 50.52  ?  441 LYS E NZ  1 
ATOM   5476  N  N   . LEU C  3 414 ? 171.493 123.699 123.950 1.00 54.57  ?  442 LEU E N   1 
ATOM   5477  C  CA  . LEU C  3 414 ? 172.595 123.802 122.998 1.00 54.57  ?  442 LEU E CA  1 
ATOM   5478  C  C   . LEU C  3 414 ? 173.276 125.154 123.185 1.00 54.57  ?  442 LEU E C   1 
ATOM   5479  O  O   . LEU C  3 414 ? 172.861 126.148 122.583 1.00 54.57  ?  442 LEU E O   1 
ATOM   5480  C  CB  . LEU C  3 414 ? 172.087 123.640 121.574 1.00 54.57  ?  442 LEU E CB  1 
ATOM   5481  C  CG  . LEU C  3 414 ? 173.167 123.519 120.508 1.00 54.57  ?  442 LEU E CG  1 
ATOM   5482  C  CD1 . LEU C  3 414 ? 173.914 122.242 120.739 1.00 54.57  ?  442 LEU E CD1 1 
ATOM   5483  C  CD2 . LEU C  3 414 ? 172.578 123.530 119.122 1.00 54.57  ?  442 LEU E CD2 1 
ATOM   5484  N  N   . HIS C  3 415 ? 174.315 125.204 124.014 1.00 62.33  ?  443 HIS E N   1 
ATOM   5485  C  CA  . HIS C  3 415 ? 175.029 126.452 124.225 1.00 62.33  ?  443 HIS E CA  1 
ATOM   5486  C  C   . HIS C  3 415 ? 176.152 126.600 123.211 1.00 62.33  ?  443 HIS E C   1 
ATOM   5487  O  O   . HIS C  3 415 ? 176.656 125.616 122.666 1.00 62.33  ?  443 HIS E O   1 
ATOM   5488  C  CB  . HIS C  3 415 ? 175.602 126.526 125.638 1.00 62.33  ?  443 HIS E CB  1 
ATOM   5489  C  CG  . HIS C  3 415 ? 174.558 126.551 126.704 1.00 62.33  ?  443 HIS E CG  1 
ATOM   5490  N  ND1 . HIS C  3 415 ? 173.725 127.631 126.900 1.00 62.33  ?  443 HIS E ND1 1 
ATOM   5491  C  CD2 . HIS C  3 415 ? 174.218 125.638 127.643 1.00 62.33  ?  443 HIS E CD2 1 
ATOM   5492  C  CE1 . HIS C  3 415 ? 172.908 127.376 127.906 1.00 62.33  ?  443 HIS E CE1 1 
ATOM   5493  N  NE2 . HIS C  3 415 ? 173.188 126.174 128.375 1.00 62.33  ?  443 HIS E NE2 1 
ATOM   5494  N  N   . SER C  3 416 ? 176.535 127.844 122.956 1.00 64.90  ?  444 SER E N   1 
ATOM   5495  C  CA  . SER C  3 416 ? 177.696 128.133 122.136 1.00 64.90  ?  444 SER E CA  1 
ATOM   5496  C  C   . SER C  3 416 ? 178.848 128.570 123.032 1.00 64.90  ?  444 SER E C   1 
ATOM   5497  O  O   . SER C  3 416 ? 178.706 128.711 124.249 1.00 64.90  ?  444 SER E O   1 
ATOM   5498  C  CB  . SER C  3 416 ? 177.371 129.197 121.089 1.00 64.90  ?  444 SER E CB  1 
ATOM   5499  O  OG  . SER C  3 416 ? 178.518 129.503 120.317 1.00 64.90  ?  444 SER E OG  1 
ATOM   5500  N  N   . SER C  3 417 ? 180.005 128.790 122.420 1.00 66.74  ?  445 SER E N   1 
ATOM   5501  C  CA  . SER C  3 417 ? 181.184 129.218 123.159 1.00 66.74  ?  445 SER E CA  1 
ATOM   5502  C  C   . SER C  3 417 ? 182.124 130.017 122.265 1.00 66.74  ?  445 SER E C   1 
ATOM   5503  O  O   . SER C  3 417 ? 182.369 131.197 122.508 1.00 66.74  ?  445 SER E O   1 
ATOM   5504  C  CB  . SER C  3 417 ? 181.915 128.011 123.751 1.00 66.74  ?  445 SER E CB  1 
ATOM   5505  O  OG  . SER C  3 417 ? 182.452 127.190 122.729 1.00 66.74  ?  445 SER E OG  1 
ATOM   5506  N  N   . CYS C  3 421 ? 177.762 133.463 116.086 1.00 84.28  ?  449 CYS E N   1 
ATOM   5507  C  CA  . CYS C  3 421 ? 176.814 132.770 115.222 1.00 84.28  ?  449 CYS E CA  1 
ATOM   5508  C  C   . CYS C  3 421 ? 175.806 131.949 116.019 1.00 84.28  ?  449 CYS E C   1 
ATOM   5509  O  O   . CYS C  3 421 ? 176.159 131.279 116.988 1.00 84.28  ?  449 CYS E O   1 
ATOM   5510  C  CB  . CYS C  3 421 ? 177.555 131.865 114.231 1.00 84.28  ?  449 CYS E CB  1 
ATOM   5511  S  SG  . CYS C  3 421 ? 178.463 132.745 112.937 1.00 84.28  ?  449 CYS E SG  1 
ATOM   5512  N  N   . SER C  3 422 ? 174.541 132.015 115.597 1.00 72.26  ?  450 SER E N   1 
ATOM   5513  C  CA  . SER C  3 422 ? 173.459 131.209 116.170 1.00 72.26  ?  450 SER E CA  1 
ATOM   5514  C  C   . SER C  3 422 ? 172.832 130.432 115.015 1.00 72.26  ?  450 SER E C   1 
ATOM   5515  O  O   . SER C  3 422 ? 171.942 130.934 114.324 1.00 72.26  ?  450 SER E O   1 
ATOM   5516  C  CB  . SER C  3 422 ? 172.438 132.075 116.893 1.00 72.26  ?  450 SER E CB  1 
ATOM   5517  O  OG  . SER C  3 422 ? 171.378 131.285 117.401 1.00 72.26  ?  450 SER E OG  1 
ATOM   5518  N  N   . THR C  3 423 ? 173.298 129.201 114.817 1.00 61.62  ?  451 THR E N   1 
ATOM   5519  C  CA  . THR C  3 423 ? 172.916 128.405 113.662 1.00 61.62  ?  451 THR E CA  1 
ATOM   5520  C  C   . THR C  3 423 ? 172.064 127.191 113.990 1.00 61.62  ?  451 THR E C   1 
ATOM   5521  O  O   . THR C  3 423 ? 170.987 127.047 113.404 1.00 61.62  ?  451 THR E O   1 
ATOM   5522  C  CB  . THR C  3 423 ? 174.170 127.940 112.905 1.00 61.62  ?  451 THR E CB  1 
ATOM   5523  O  OG1 . THR C  3 423 ? 174.891 129.084 112.433 1.00 61.62  ?  451 THR E OG1 1 
ATOM   5524  C  CG2 . THR C  3 423 ? 173.802 127.072 111.727 1.00 61.62  ?  451 THR E CG2 1 
ATOM   5525  N  N   . LEU C  3 424 ? 172.487 126.332 114.912 1.00 53.96  ?  452 LEU E N   1 
ATOM   5526  C  CA  . LEU C  3 424 ? 171.800 125.077 115.171 1.00 53.96  ?  452 LEU E CA  1 
ATOM   5527  C  C   . LEU C  3 424 ? 170.955 125.205 116.432 1.00 53.96  ?  452 LEU E C   1 
ATOM   5528  O  O   . LEU C  3 424 ? 171.106 126.143 117.216 1.00 53.96  ?  452 LEU E O   1 
ATOM   5529  C  CB  . LEU C  3 424 ? 172.799 123.924 115.307 1.00 53.96  ?  452 LEU E CB  1 
ATOM   5530  C  CG  . LEU C  3 424 ? 173.706 123.737 114.089 1.00 53.96  ?  452 LEU E CG  1 
ATOM   5531  C  CD1 . LEU C  3 424 ? 174.693 122.604 114.309 1.00 53.96  ?  452 LEU E CD1 1 
ATOM   5532  C  CD2 . LEU C  3 424 ? 172.902 123.517 112.827 1.00 53.96  ?  452 LEU E CD2 1 
ATOM   5533  N  N   . GLY C  3 425 ? 170.052 124.246 116.620 1.00 51.21  ?  453 GLY E N   1 
ATOM   5534  C  CA  . GLY C  3 425 ? 169.196 124.228 117.794 1.00 51.21  ?  453 GLY E CA  1 
ATOM   5535  C  C   . GLY C  3 425 ? 168.671 122.841 118.108 1.00 51.21  ?  453 GLY E C   1 
ATOM   5536  O  O   . GLY C  3 425 ? 168.467 122.044 117.192 1.00 51.21  ?  453 GLY E O   1 
ATOM   5537  N  N   . VAL C  3 426 ? 168.436 122.525 119.379 1.00 45.23  ?  454 VAL E N   1 
ATOM   5538  C  CA  . VAL C  3 426 ? 168.107 121.163 119.783 1.00 45.23  ?  454 VAL E CA  1 
ATOM   5539  C  C   . VAL C  3 426 ? 166.721 121.153 120.409 1.00 45.23  ?  454 VAL E C   1 
ATOM   5540  O  O   . VAL C  3 426 ? 166.445 121.941 121.320 1.00 45.23  ?  454 VAL E O   1 
ATOM   5541  C  CB  . VAL C  3 426 ? 169.136 120.590 120.768 1.00 45.23  ?  454 VAL E CB  1 
ATOM   5542  C  CG1 . VAL C  3 426 ? 168.761 119.189 121.146 1.00 45.23  ?  454 VAL E CG1 1 
ATOM   5543  C  CG2 . VAL C  3 426 ? 170.511 120.598 120.161 1.00 45.23  ?  454 VAL E CG2 1 
ATOM   5544  N  N   . VAL C  3 427 ? 165.860 120.254 119.933 1.00 41.95  ?  455 VAL E N   1 
ATOM   5545  C  CA  . VAL C  3 427 ? 164.535 120.034 120.502 1.00 41.95  ?  455 VAL E CA  1 
ATOM   5546  C  C   . VAL C  3 427 ? 164.434 118.591 120.980 1.00 41.95  ?  455 VAL E C   1 
ATOM   5547  O  O   . VAL C  3 427 ? 164.720 117.657 120.223 1.00 41.95  ?  455 VAL E O   1 
ATOM   5548  C  CB  . VAL C  3 427 ? 163.431 120.365 119.487 1.00 41.95  ?  455 VAL E CB  1 
ATOM   5549  C  CG1 . VAL C  3 427 ? 162.112 119.855 119.965 1.00 41.95  ?  455 VAL E CG1 1 
ATOM   5550  C  CG2 . VAL C  3 427 ? 163.315 121.853 119.340 1.00 41.95  ?  455 VAL E CG2 1 
ATOM   5551  N  N   . THR C  3 428 ? 164.051 118.416 122.243 1.00 40.66  ?  456 THR E N   1 
ATOM   5552  C  CA  . THR C  3 428 ? 163.829 117.090 122.799 1.00 40.66  ?  456 THR E CA  1 
ATOM   5553  C  C   . THR C  3 428 ? 162.563 116.473 122.222 1.00 40.66  ?  456 THR E C   1 
ATOM   5554  O  O   . THR C  3 428 ? 161.497 117.091 122.251 1.00 40.66  ?  456 THR E O   1 
ATOM   5555  C  CB  . THR C  3 428 ? 163.712 117.183 124.317 1.00 40.66  ?  456 THR E CB  1 
ATOM   5556  O  OG1 . THR C  3 428 ? 164.939 117.676 124.861 1.00 40.66  ?  456 THR E OG1 1 
ATOM   5557  C  CG2 . THR C  3 428 ? 163.396 115.836 124.922 1.00 40.66  ?  456 THR E CG2 1 
ATOM   5558  N  N   . SER C  3 429 ? 162.675 115.252 121.698 1.00 44.55  ?  457 SER E N   1 
ATOM   5559  C  CA  . SER C  3 429 ? 161.525 114.458 121.271 1.00 44.55  ?  457 SER E CA  1 
ATOM   5560  C  C   . SER C  3 429 ? 161.284 113.429 122.371 1.00 44.55  ?  457 SER E C   1 
ATOM   5561  O  O   . SER C  3 429 ? 162.060 112.486 122.529 1.00 44.55  ?  457 SER E O   1 
ATOM   5562  C  CB  . SER C  3 429 ? 161.769 113.796 119.927 1.00 44.55  ?  457 SER E CB  1 
ATOM   5563  O  OG  . SER C  3 429 ? 162.778 112.811 120.028 1.00 44.55  ?  457 SER E OG  1 
ATOM   5564  N  N   . ALA C  3 430 ? 160.191 113.599 123.116 1.00 46.72  ?  458 ALA E N   1 
ATOM   5565  C  CA  . ALA C  3 430 ? 159.974 112.862 124.357 1.00 46.72  ?  458 ALA E CA  1 
ATOM   5566  C  C   . ALA C  3 430 ? 159.525 111.421 124.146 1.00 46.72  ?  458 ALA E C   1 
ATOM   5567  O  O   . ALA C  3 430 ? 159.289 110.698 125.119 1.00 46.72  ?  458 ALA E O   1 
ATOM   5568  C  CB  . ALA C  3 430 ? 158.948 113.591 125.226 1.00 46.72  ?  458 ALA E CB  1 
ATOM   5569  N  N   . GLU C  3 431 ? 159.389 110.994 122.891 1.00 51.86  ?  459 GLU E N   1 
ATOM   5570  C  CA  . GLU C  3 431 ? 159.084 109.595 122.616 1.00 51.86  ?  459 GLU E CA  1 
ATOM   5571  C  C   . GLU C  3 431 ? 160.278 108.698 122.911 1.00 51.86  ?  459 GLU E C   1 
ATOM   5572  O  O   . GLU C  3 431 ? 160.149 107.704 123.633 1.00 51.86  ?  459 GLU E O   1 
ATOM   5573  C  CB  . GLU C  3 431 ? 158.649 109.427 121.164 1.00 51.86  ?  459 GLU E CB  1 
ATOM   5574  C  CG  . GLU C  3 431 ? 158.267 108.009 120.811 1.00 51.86  ?  459 GLU E CG  1 
ATOM   5575  C  CD  . GLU C  3 431 ? 157.825 107.874 119.375 1.00 51.86  ?  459 GLU E CD  1 
ATOM   5576  O  OE1 . GLU C  3 431 ? 157.852 108.889 118.652 1.00 51.86  ?  459 GLU E OE1 1 
ATOM   5577  O  OE2 . GLU C  3 431 ? 157.450 106.755 118.968 1.00 51.86  ?  459 GLU E OE2 1 
ATOM   5578  N  N   . ASP C  3 432 ? 161.444 109.034 122.365 1.00 52.83  ?  460 ASP E N   1 
ATOM   5579  C  CA  . ASP C  3 432 ? 162.663 108.276 122.600 1.00 52.83  ?  460 ASP E CA  1 
ATOM   5580  C  C   . ASP C  3 432 ? 163.495 108.827 123.747 1.00 52.83  ?  460 ASP E C   1 
ATOM   5581  O  O   . ASP C  3 432 ? 164.500 108.206 124.106 1.00 52.83  ?  460 ASP E O   1 
ATOM   5582  C  CB  . ASP C  3 432 ? 163.522 108.254 121.332 1.00 52.83  ?  460 ASP E CB  1 
ATOM   5583  C  CG  . ASP C  3 432 ? 162.860 107.516 120.198 1.00 52.83  ?  460 ASP E CG  1 
ATOM   5584  O  OD1 . ASP C  3 432 ? 162.059 106.601 120.474 1.00 52.83  ?  460 ASP E OD1 1 
ATOM   5585  O  OD2 . ASP C  3 432 ? 163.136 107.851 119.029 1.00 52.83  ?  460 ASP E OD2 1 
ATOM   5586  N  N   . THR C  3 433 ? 163.083 109.956 124.331 1.00 47.65  ?  461 THR E N   1 
ATOM   5587  C  CA  . THR C  3 433 ? 163.858 110.768 125.277 1.00 47.65  ?  461 THR E CA  1 
ATOM   5588  C  C   . THR C  3 433 ? 165.258 111.059 124.740 1.00 47.65  ?  461 THR E C   1 
ATOM   5589  O  O   . THR C  3 433 ? 166.264 110.964 125.439 1.00 47.65  ?  461 THR E O   1 
ATOM   5590  C  CB  . THR C  3 433 ? 163.924 110.128 126.667 1.00 47.65  ?  461 THR E CB  1 
ATOM   5591  O  OG1 . THR C  3 433 ? 164.644 108.892 126.602 1.00 47.65  ?  461 THR E OG1 1 
ATOM   5592  C  CG2 . THR C  3 433 ? 162.526 109.872 127.199 1.00 47.65  ?  461 THR E CG2 1 
ATOM   5593  N  N   . SER C  3 434 ? 165.296 111.417 123.463 1.00 44.16  ?  462 SER E N   1 
ATOM   5594  C  CA  . SER C  3 434 ? 166.505 111.870 122.802 1.00 44.16  ?  462 SER E CA  1 
ATOM   5595  C  C   . SER C  3 434 ? 166.219 113.237 122.213 1.00 44.16  ?  462 SER E C   1 
ATOM   5596  O  O   . SER C  3 434 ? 165.071 113.685 122.193 1.00 44.16  ?  462 SER E O   1 
ATOM   5597  C  CB  . SER C  3 434 ? 166.952 110.911 121.701 1.00 44.16  ?  462 SER E CB  1 
ATOM   5598  O  OG  . SER C  3 434 ? 166.028 110.908 120.631 1.00 44.16  ?  462 SER E OG  1 
ATOM   5599  N  N   . GLY C  3 435 ? 167.266 113.910 121.747 1.00 40.09  ?  463 GLY E N   1 
ATOM   5600  C  CA  . GLY C  3 435 ? 167.128 115.241 121.202 1.00 40.09  ?  463 GLY E CA  1 
ATOM   5601  C  C   . GLY C  3 435 ? 167.547 115.279 119.747 1.00 40.09  ?  463 GLY E C   1 
ATOM   5602  O  O   . GLY C  3 435 ? 168.529 114.648 119.351 1.00 40.09  ?  463 GLY E O   1 
ATOM   5603  N  N   . ILE C  3 436 ? 166.795 116.023 118.968 1.00 41.02  ?  464 ILE E N   1 
ATOM   5604  C  CA  . ILE C  3 436 ? 167.103 116.201 117.567 1.00 41.02  ?  464 ILE E CA  1 
ATOM   5605  C  C   . ILE C  3 436 ? 167.621 117.617 117.366 1.00 41.02  ?  464 ILE E C   1 
ATOM   5606  O  O   . ILE C  3 436 ? 167.022 118.597 117.814 1.00 41.02  ?  464 ILE E O   1 
ATOM   5607  C  CB  . ILE C  3 436 ? 165.868 115.924 116.698 1.00 41.02  ?  464 ILE E CB  1 
ATOM   5608  C  CG1 . ILE C  3 436 ? 165.338 114.522 116.980 1.00 41.02  ?  464 ILE E CG1 1 
ATOM   5609  C  CG2 . ILE C  3 436 ? 166.226 116.022 115.247 1.00 41.02  ?  464 ILE E CG2 1 
ATOM   5610  C  CD1 . ILE C  3 436 ? 163.990 114.252 116.373 1.00 41.02  ?  464 ILE E CD1 1 
ATOM   5611  N  N   . LEU C  3 437 ? 168.764 117.729 116.701 1.00 44.04  ?  465 LEU E N   1 
ATOM   5612  C  CA  . LEU C  3 437 ? 169.350 119.029 116.432 1.00 44.04  ?  465 LEU E CA  1 
ATOM   5613  C  C   . LEU C  3 437 ? 169.123 119.372 114.970 1.00 44.04  ?  465 LEU E C   1 
ATOM   5614  O  O   . LEU C  3 437 ? 169.217 118.505 114.099 1.00 44.04  ?  465 LEU E O   1 
ATOM   5615  C  CB  . LEU C  3 437 ? 170.839 119.052 116.810 1.00 44.04  ?  465 LEU E CB  1 
ATOM   5616  C  CG  . LEU C  3 437 ? 171.875 118.091 116.226 1.00 44.04  ?  465 LEU E CG  1 
ATOM   5617  C  CD1 . LEU C  3 437 ? 172.530 118.649 114.987 1.00 44.04  ?  465 LEU E CD1 1 
ATOM   5618  C  CD2 . LEU C  3 437 ? 172.927 117.795 117.268 1.00 44.04  ?  465 LEU E CD2 1 
ATOM   5619  N  N   . PHE C  3 438 ? 168.821 120.639 114.711 1.00 46.35  ?  466 PHE E N   1 
ATOM   5620  C  CA  . PHE C  3 438 ? 168.399 121.074 113.393 1.00 46.35  ?  466 PHE E CA  1 
ATOM   5621  C  C   . PHE C  3 438 ? 168.975 122.444 113.079 1.00 46.35  ?  466 PHE E C   1 
ATOM   5622  O  O   . PHE C  3 438 ? 169.312 123.224 113.972 1.00 46.35  ?  466 PHE E O   1 
ATOM   5623  C  CB  . PHE C  3 438 ? 166.867 121.101 113.270 1.00 46.35  ?  466 PHE E CB  1 
ATOM   5624  C  CG  . PHE C  3 438 ? 166.187 122.004 114.260 1.00 46.35  ?  466 PHE E CG  1 
ATOM   5625  C  CD1 . PHE C  3 438 ? 165.837 121.530 115.507 1.00 46.35  ?  466 PHE E CD1 1 
ATOM   5626  C  CD2 . PHE C  3 438 ? 165.855 123.308 113.931 1.00 46.35  ?  466 PHE E CD2 1 
ATOM   5627  C  CE1 . PHE C  3 438 ? 165.219 122.341 116.416 1.00 46.35  ?  466 PHE E CE1 1 
ATOM   5628  C  CE2 . PHE C  3 438 ? 165.225 124.125 114.847 1.00 46.35  ?  466 PHE E CE2 1 
ATOM   5629  C  CZ  . PHE C  3 438 ? 164.904 123.636 116.089 1.00 46.35  ?  466 PHE E CZ  1 
ATOM   5630  N  N   . VAL C  3 439 ? 169.075 122.718 111.781 1.00 49.90  ?  467 VAL E N   1 
ATOM   5631  C  CA  . VAL C  3 439 ? 169.460 124.033 111.288 1.00 49.90  ?  467 VAL E CA  1 
ATOM   5632  C  C   . VAL C  3 439 ? 168.351 125.020 111.617 1.00 49.90  ?  467 VAL E C   1 
ATOM   5633  O  O   . VAL C  3 439 ? 167.250 124.946 111.063 1.00 49.90  ?  467 VAL E O   1 
ATOM   5634  C  CB  . VAL C  3 439 ? 169.720 123.988 109.780 1.00 49.90  ?  467 VAL E CB  1 
ATOM   5635  C  CG1 . VAL C  3 439 ? 170.058 125.368 109.265 1.00 49.90  ?  467 VAL E CG1 1 
ATOM   5636  C  CG2 . VAL C  3 439 ? 170.818 122.999 109.462 1.00 49.90  ?  467 VAL E CG2 1 
ATOM   5637  N  N   . ASN C  3 440 ? 168.637 125.956 112.512 1.00 54.66  ?  468 ASN E N   1 
ATOM   5638  C  CA  . ASN C  3 440 ? 167.636 126.907 112.971 1.00 54.66  ?  468 ASN E CA  1 
ATOM   5639  C  C   . ASN C  3 440 ? 167.660 128.191 112.161 1.00 54.66  ?  468 ASN E C   1 
ATOM   5640  O  O   . ASN C  3 440 ? 166.608 128.797 111.936 1.00 54.66  ?  468 ASN E O   1 
ATOM   5641  C  CB  . ASN C  3 440 ? 167.870 127.217 114.449 1.00 54.66  ?  468 ASN E CB  1 
ATOM   5642  C  CG  . ASN C  3 440 ? 166.662 127.799 115.128 1.00 54.66  ?  468 ASN E CG  1 
ATOM   5643  O  OD1 . ASN C  3 440 ? 165.598 127.947 114.533 1.00 54.66  ?  468 ASN E OD1 1 
ATOM   5644  N  ND2 . ASN C  3 440 ? 166.837 128.135 116.402 1.00 54.66  ?  468 ASN E ND2 1 
ATOM   5645  N  N   . ASP C  3 441 ? 168.839 128.626 111.724 1.00 63.40  ?  469 ASP E N   1 
ATOM   5646  C  CA  . ASP C  3 441 ? 168.979 129.798 110.871 1.00 63.40  ?  469 ASP E CA  1 
ATOM   5647  C  C   . ASP C  3 441 ? 169.792 129.434 109.639 1.00 63.40  ?  469 ASP E C   1 
ATOM   5648  O  O   . ASP C  3 441 ? 170.736 128.643 109.724 1.00 63.40  ?  469 ASP E O   1 
ATOM   5649  C  CB  . ASP C  3 441 ? 169.647 130.943 111.625 1.00 63.40  ?  469 ASP E CB  1 
ATOM   5650  C  CG  . ASP C  3 441 ? 168.728 131.582 112.630 1.00 63.40  ?  469 ASP E CG  1 
ATOM   5651  O  OD1 . ASP C  3 441 ? 167.509 131.606 112.369 1.00 63.40  ?  469 ASP E OD1 1 
ATOM   5652  O  OD2 . ASP C  3 441 ? 169.220 132.049 113.676 1.00 63.40  ?  469 ASP E OD2 1 
ATOM   5653  N  N   . THR C  3 442 ? 169.424 130.007 108.496 1.00 71.07  ?  470 THR E N   1 
ATOM   5654  C  CA  . THR C  3 442 ? 170.175 129.842 107.261 1.00 71.07  ?  470 THR E CA  1 
ATOM   5655  C  C   . THR C  3 442 ? 171.140 131.007 107.041 1.00 71.07  ?  470 THR E C   1 
ATOM   5656  O  O   . THR C  3 442 ? 172.202 130.844 106.426 1.00 71.07  ?  470 THR E O   1 
ATOM   5657  C  CB  . THR C  3 442 ? 169.205 129.698 106.086 1.00 71.07  ?  470 THR E CB  1 
ATOM   5658  O  OG1 . THR C  3 442 ? 168.208 128.726 106.414 1.00 71.07  ?  470 THR E OG1 1 
ATOM   5659  C  CG2 . THR C  3 442 ? 169.921 129.202 104.842 1.00 71.07  ?  470 THR E CG2 1 
ATOM   5660  N  N   . LYS C  3 443 ? 170.816 132.173 107.595 1.00 76.44  ?  471 LYS E N   1 
ATOM   5661  C  CA  . LYS C  3 443 ? 171.655 133.355 107.484 1.00 76.44  ?  471 LYS E CA  1 
ATOM   5662  C  C   . LYS C  3 443 ? 172.925 133.282 108.318 1.00 76.44  ?  471 LYS E C   1 
ATOM   5663  O  O   . LYS C  3 443 ? 173.927 133.885 107.932 1.00 76.44  ?  471 LYS E O   1 
ATOM   5664  C  CB  . LYS C  3 443 ? 170.862 134.616 107.876 1.00 76.44  ?  471 LYS E CB  1 
ATOM   5665  C  CG  . LYS C  3 443 ? 170.370 134.638 109.320 1.00 76.44  ?  471 LYS E CG  1 
ATOM   5666  C  CD  . LYS C  3 443 ? 169.596 135.897 109.651 1.00 76.44  ?  471 LYS E CD  1 
ATOM   5667  C  CE  . LYS C  3 443 ? 169.164 135.877 111.107 1.00 76.44  ?  471 LYS E CE  1 
ATOM   5668  N  NZ  . LYS C  3 443 ? 168.407 137.097 111.492 1.00 76.44  ?  471 LYS E NZ  1 
ATOM   5669  N  N   . ALA C  3 444 ? 172.918 132.557 109.437 1.00 75.63  ?  472 ALA E N   1 
ATOM   5670  C  CA  . ALA C  3 444 ? 174.115 132.399 110.248 1.00 75.63  ?  472 ALA E CA  1 
ATOM   5671  C  C   . ALA C  3 444 ? 174.987 131.246 109.783 1.00 75.63  ?  472 ALA E C   1 
ATOM   5672  O  O   . ALA C  3 444 ? 176.135 131.134 110.224 1.00 75.63  ?  472 ALA E O   1 
ATOM   5673  C  CB  . ALA C  3 444 ? 173.740 132.193 111.717 1.00 75.63  ?  472 ALA E CB  1 
ATOM   5674  N  N   . LEU C  3 445 ? 174.467 130.390 108.908 1.00 77.49  ?  473 LEU E N   1 
ATOM   5675  C  CA  . LEU C  3 445 ? 175.230 129.265 108.392 1.00 77.49  ?  473 LEU E CA  1 
ATOM   5676  C  C   . LEU C  3 445 ? 176.031 129.639 107.153 1.00 77.49  ?  473 LEU E C   1 
ATOM   5677  O  O   . LEU C  3 445 ? 177.050 129.001 106.872 1.00 77.49  ?  473 LEU E O   1 
ATOM   5678  C  CB  . LEU C  3 445 ? 174.270 128.105 108.097 1.00 77.49  ?  473 LEU E CB  1 
ATOM   5679  C  CG  . LEU C  3 445 ? 174.732 126.678 107.785 1.00 77.49  ?  473 LEU E CG  1 
ATOM   5680  C  CD1 . LEU C  3 445 ? 173.702 125.690 108.284 1.00 77.49  ?  473 LEU E CD1 1 
ATOM   5681  C  CD2 . LEU C  3 445 ? 174.922 126.472 106.305 1.00 77.49  ?  473 LEU E CD2 1 
ATOM   5682  N  N   . ARG C  3 446 ? 175.596 130.655 106.411 1.00 85.26  ?  474 ARG E N   1 
ATOM   5683  C  CA  . ARG C  3 446 ? 176.270 131.029 105.176 1.00 85.26  ?  474 ARG E CA  1 
ATOM   5684  C  C   . ARG C  3 446 ? 177.461 131.950 105.404 1.00 85.26  ?  474 ARG E C   1 
ATOM   5685  O  O   . ARG C  3 446 ? 178.191 132.241 104.450 1.00 85.26  ?  474 ARG E O   1 
ATOM   5686  C  CB  . ARG C  3 446 ? 175.272 131.695 104.226 1.00 85.26  ?  474 ARG E CB  1 
ATOM   5687  C  CG  . ARG C  3 446 ? 174.185 130.756 103.730 1.00 85.26  ?  474 ARG E CG  1 
ATOM   5688  C  CD  . ARG C  3 446 ? 173.194 131.484 102.846 1.00 85.26  ?  474 ARG E CD  1 
ATOM   5689  N  NE  . ARG C  3 446 ? 172.117 130.609 102.397 1.00 85.26  ?  474 ARG E NE  1 
ATOM   5690  C  CZ  . ARG C  3 446 ? 171.072 131.022 101.689 1.00 85.26  ?  474 ARG E CZ  1 
ATOM   5691  N  NH1 . ARG C  3 446 ? 170.963 132.298 101.348 1.00 85.26  ?  474 ARG E NH1 1 
ATOM   5692  N  NH2 . ARG C  3 446 ? 170.135 130.159 101.318 1.00 85.26  ?  474 ARG E NH2 1 
ATOM   5693  N  N   . ARG C  3 447 ? 177.666 132.415 106.633 1.00 89.78  ?  475 ARG E N   1 
ATOM   5694  C  CA  . ARG C  3 447 ? 178.803 133.272 106.928 1.00 89.78  ?  475 ARG E CA  1 
ATOM   5695  C  C   . ARG C  3 447 ? 180.092 132.455 106.899 1.00 89.78  ?  475 ARG E C   1 
ATOM   5696  O  O   . ARG C  3 447 ? 180.169 131.393 107.528 1.00 89.78  ?  475 ARG E O   1 
ATOM   5697  C  CB  . ARG C  3 447 ? 178.634 133.928 108.298 1.00 89.78  ?  475 ARG E CB  1 
ATOM   5698  C  CG  . ARG C  3 447 ? 177.491 134.917 108.372 1.00 89.78  ?  475 ARG E CG  1 
ATOM   5699  C  CD  . ARG C  3 447 ? 177.305 135.437 109.786 1.00 89.78  ?  475 ARG E CD  1 
ATOM   5700  N  NE  . ARG C  3 447 ? 176.174 136.353 109.883 1.00 89.78  ?  475 ARG E NE  1 
ATOM   5701  C  CZ  . ARG C  3 447 ? 175.715 136.857 111.024 1.00 89.78  ?  475 ARG E CZ  1 
ATOM   5702  N  NH1 . ARG C  3 447 ? 176.285 136.527 112.174 1.00 89.78  ?  475 ARG E NH1 1 
ATOM   5703  N  NH2 . ARG C  3 447 ? 174.680 137.686 111.016 1.00 89.78  ?  475 ARG E NH2 1 
ATOM   5704  N  N   . PRO C  3 448 ? 181.128 132.920 106.193 1.00 94.89  ?  476 PRO E N   1 
ATOM   5705  C  CA  . PRO C  3 448 ? 182.383 132.157 106.131 1.00 94.89  ?  476 PRO E CA  1 
ATOM   5706  C  C   . PRO C  3 448 ? 183.238 132.263 107.382 1.00 94.89  ?  476 PRO E C   1 
ATOM   5707  O  O   . PRO C  3 448 ? 184.297 131.622 107.439 1.00 94.89  ?  476 PRO E O   1 
ATOM   5708  C  CB  . PRO C  3 448 ? 183.102 132.776 104.927 1.00 94.89  ?  476 PRO E CB  1 
ATOM   5709  C  CG  . PRO C  3 448 ? 182.595 134.175 104.883 1.00 94.89  ?  476 PRO E CG  1 
ATOM   5710  C  CD  . PRO C  3 448 ? 181.164 134.118 105.336 1.00 94.89  ?  476 PRO E CD  1 
ATOM   5711  N  N   . LYS C  3 449 ? 182.822 133.039 108.376 1.00 95.47  ?  477 LYS E N   1 
ATOM   5712  C  CA  . LYS C  3 449 ? 183.569 133.197 109.614 1.00 95.47  ?  477 LYS E CA  1 
ATOM   5713  C  C   . LYS C  3 449 ? 183.175 132.180 110.676 1.00 95.47  ?  477 LYS E C   1 
ATOM   5714  O  O   . LYS C  3 449 ? 183.762 132.180 111.763 1.00 95.47  ?  477 LYS E O   1 
ATOM   5715  C  CB  . LYS C  3 449 ? 183.377 134.615 110.156 1.00 95.47  ?  477 LYS E CB  1 
ATOM   5716  C  CG  . LYS C  3 449 ? 183.964 135.693 109.261 1.00 95.47  ?  477 LYS E CG  1 
ATOM   5717  C  CD  . LYS C  3 449 ? 183.761 137.075 109.855 1.00 95.47  ?  477 LYS E CD  1 
ATOM   5718  C  CE  . LYS C  3 449 ? 184.328 138.153 108.949 1.00 95.47  ?  477 LYS E CE  1 
ATOM   5719  N  NZ  . LYS C  3 449 ? 184.129 139.512 109.523 1.00 95.47  ?  477 LYS E NZ  1 
ATOM   5720  N  N   . CYS C  3 450 ? 182.195 131.322 110.393 1.00 90.52  ?  478 CYS E N   1 
ATOM   5721  C  CA  . CYS C  3 450 ? 181.769 130.290 111.330 1.00 90.52  ?  478 CYS E CA  1 
ATOM   5722  C  C   . CYS C  3 450 ? 181.763 128.922 110.661 1.00 90.52  ?  478 CYS E C   1 
ATOM   5723  O  O   . CYS C  3 450 ? 180.789 128.174 110.780 1.00 90.52  ?  478 CYS E O   1 
ATOM   5724  C  CB  . CYS C  3 450 ? 180.387 130.617 111.900 1.00 90.52  ?  478 CYS E CB  1 
ATOM   5725  S  SG  . CYS C  3 450 ? 180.359 132.024 113.040 1.00 90.52  ?  478 CYS E SG  1 
ATOM   5726  N  N   . ALA C  3 451 ? 182.848 128.588 109.958 1.00 83.95  ?  479 ALA E N   1 
ATOM   5727  C  CA  . ALA C  3 451 ? 182.899 127.347 109.191 1.00 83.95  ?  479 ALA E CA  1 
ATOM   5728  C  C   . ALA C  3 451 ? 183.073 126.125 110.084 1.00 83.95  ?  479 ALA E C   1 
ATOM   5729  O  O   . ALA C  3 451 ? 182.760 125.004 109.671 1.00 83.95  ?  479 ALA E O   1 
ATOM   5730  C  CB  . ALA C  3 451 ? 184.027 127.414 108.163 1.00 83.95  ?  479 ALA E CB  1 
ATOM   5731  N  N   . GLU C  3 452 ? 183.583 126.315 111.295 1.00 81.17  ?  480 GLU E N   1 
ATOM   5732  C  CA  . GLU C  3 452 ? 183.709 125.248 112.281 1.00 81.17  ?  480 GLU E CA  1 
ATOM   5733  C  C   . GLU C  3 452 ? 183.055 125.733 113.564 1.00 81.17  ?  480 GLU E C   1 
ATOM   5734  O  O   . GLU C  3 452 ? 183.518 126.704 114.172 1.00 81.17  ?  480 GLU E O   1 
ATOM   5735  C  CB  . GLU C  3 452 ? 185.170 124.878 112.520 1.00 81.17  ?  480 GLU E CB  1 
ATOM   5736  C  CG  . GLU C  3 452 ? 185.842 124.206 111.343 1.00 81.17  ?  480 GLU E CG  1 
ATOM   5737  C  CD  . GLU C  3 452 ? 187.300 123.901 111.613 1.00 81.17  ?  480 GLU E CD  1 
ATOM   5738  O  OE1 . GLU C  3 452 ? 187.815 124.344 112.661 1.00 81.17  ?  480 GLU E OE1 1 
ATOM   5739  O  OE2 . GLU C  3 452 ? 187.932 123.217 110.781 1.00 81.17  ?  480 GLU E OE2 1 
ATOM   5740  N  N   . LEU C  3 453 ? 181.983 125.066 113.973 1.00 74.12  ?  481 LEU E N   1 
ATOM   5741  C  CA  . LEU C  3 453 ? 181.232 125.479 115.143 1.00 74.12  ?  481 LEU E CA  1 
ATOM   5742  C  C   . LEU C  3 453 ? 181.465 124.502 116.282 1.00 74.12  ?  481 LEU E C   1 
ATOM   5743  O  O   . LEU C  3 453 ? 181.569 123.287 116.072 1.00 74.12  ?  481 LEU E O   1 
ATOM   5744  C  CB  . LEU C  3 453 ? 179.744 125.582 114.825 1.00 74.12  ?  481 LEU E CB  1 
ATOM   5745  C  CG  . LEU C  3 453 ? 179.374 126.691 113.845 1.00 74.12  ?  481 LEU E CG  1 
ATOM   5746  C  CD1 . LEU C  3 453 ? 177.918 126.581 113.439 1.00 74.12  ?  481 LEU E CD1 1 
ATOM   5747  C  CD2 . LEU C  3 453 ? 179.649 128.039 114.482 1.00 74.12  ?  481 LEU E CD2 1 
ATOM   5748  N  N   . HIS C  3 454 ? 181.556 125.050 117.488 1.00 71.35  ?  482 HIS E N   1 
ATOM   5749  C  CA  . HIS C  3 454 ? 181.870 124.288 118.690 1.00 71.35  ?  482 HIS E CA  1 
ATOM   5750  C  C   . HIS C  3 454 ? 180.707 124.501 119.651 1.00 71.35  ?  482 HIS E C   1 
ATOM   5751  O  O   . HIS C  3 454 ? 180.639 125.532 120.326 1.00 71.35  ?  482 HIS E O   1 
ATOM   5752  C  CB  . HIS C  3 454 ? 183.181 124.754 119.306 1.00 71.35  ?  482 HIS E CB  1 
ATOM   5753  C  CG  . HIS C  3 454 ? 184.345 124.698 118.368 1.00 71.35  ?  482 HIS E CG  1 
ATOM   5754  N  ND1 . HIS C  3 454 ? 184.948 123.519 117.995 1.00 71.35  ?  482 HIS E ND1 1 
ATOM   5755  C  CD2 . HIS C  3 454 ? 185.026 125.681 117.734 1.00 71.35  ?  482 HIS E CD2 1 
ATOM   5756  C  CE1 . HIS C  3 454 ? 185.945 123.774 117.168 1.00 71.35  ?  482 HIS E CE1 1 
ATOM   5757  N  NE2 . HIS C  3 454 ? 186.015 125.080 116.993 1.00 71.35  ?  482 HIS E NE2 1 
ATOM   5758  N  N   . TYR C  3 455 ? 179.793 123.542 119.715 1.00 61.68  ?  483 TYR E N   1 
ATOM   5759  C  CA  . TYR C  3 455 ? 178.634 123.643 120.586 1.00 61.68  ?  483 TYR E CA  1 
ATOM   5760  C  C   . TYR C  3 455 ? 178.845 122.800 121.832 1.00 61.68  ?  483 TYR E C   1 
ATOM   5761  O  O   . TYR C  3 455 ? 179.606 121.829 121.816 1.00 61.68  ?  483 TYR E O   1 
ATOM   5762  C  CB  . TYR C  3 455 ? 177.362 123.196 119.873 1.00 61.68  ?  483 TYR E CB  1 
ATOM   5763  C  CG  . TYR C  3 455 ? 176.860 124.161 118.829 1.00 61.68  ?  483 TYR E CG  1 
ATOM   5764  C  CD1 . TYR C  3 455 ? 176.103 125.269 119.186 1.00 61.68  ?  483 TYR E CD1 1 
ATOM   5765  C  CD2 . TYR C  3 455 ? 177.136 123.961 117.485 1.00 61.68  ?  483 TYR E CD2 1 
ATOM   5766  C  CE1 . TYR C  3 455 ? 175.638 126.149 118.235 1.00 61.68  ?  483 TYR E CE1 1 
ATOM   5767  C  CE2 . TYR C  3 455 ? 176.676 124.833 116.529 1.00 61.68  ?  483 TYR E CE2 1 
ATOM   5768  C  CZ  . TYR C  3 455 ? 175.930 125.926 116.909 1.00 61.68  ?  483 TYR E CZ  1 
ATOM   5769  O  OH  . TYR C  3 455 ? 175.469 126.801 115.956 1.00 61.68  ?  483 TYR E OH  1 
ATOM   5770  N  N   . MET C  3 456 ? 178.170 123.178 122.904 1.00 60.04  ?  484 MET E N   1 
ATOM   5771  C  CA  . MET C  3 456 ? 178.181 122.429 124.149 1.00 60.04  ?  484 MET E CA  1 
ATOM   5772  C  C   . MET C  3 456 ? 176.758 121.929 124.354 1.00 60.04  ?  484 MET E C   1 
ATOM   5773  O  O   . MET C  3 456 ? 175.840 122.729 124.569 1.00 60.04  ?  484 MET E O   1 
ATOM   5774  C  CB  . MET C  3 456 ? 178.631 123.311 125.309 1.00 60.04  ?  484 MET E CB  1 
ATOM   5775  C  CG  . MET C  3 456 ? 179.203 122.572 126.501 1.00 60.04  ?  484 MET E CG  1 
ATOM   5776  S  SD  . MET C  3 456 ? 180.860 121.978 126.087 1.00 60.04  ?  484 MET E SD  1 
ATOM   5777  C  CE  . MET C  3 456 ? 181.116 120.691 127.316 1.00 60.04  ?  484 MET E CE  1 
ATOM   5778  N  N   . VAL C  3 457 ? 176.570 120.621 124.242 1.00 51.54  ?  485 VAL E N   1 
ATOM   5779  C  CA  . VAL C  3 457 ? 175.258 120.005 124.391 1.00 51.54  ?  485 VAL E CA  1 
ATOM   5780  C  C   . VAL C  3 457 ? 175.058 119.671 125.857 1.00 51.54  ?  485 VAL E C   1 
ATOM   5781  O  O   . VAL C  3 457 ? 175.869 118.952 126.449 1.00 51.54  ?  485 VAL E O   1 
ATOM   5782  C  CB  . VAL C  3 457 ? 175.140 118.743 123.524 1.00 51.54  ?  485 VAL E CB  1 
ATOM   5783  C  CG1 . VAL C  3 457 ? 173.800 118.099 123.736 1.00 51.54  ?  485 VAL E CG1 1 
ATOM   5784  C  CG2 . VAL C  3 457 ? 175.346 119.078 122.068 1.00 51.54  ?  485 VAL E CG2 1 
ATOM   5785  N  N   . VAL C  3 458 ? 173.988 120.193 126.447 1.00 49.27  ?  486 VAL E N   1 
ATOM   5786  C  CA  . VAL C  3 458 ? 173.739 120.067 127.876 1.00 49.27  ?  486 VAL E CA  1 
ATOM   5787  C  C   . VAL C  3 458 ? 172.493 119.221 128.074 1.00 49.27  ?  486 VAL E C   1 
ATOM   5788  O  O   . VAL C  3 458 ? 171.386 119.638 127.718 1.00 49.27  ?  486 VAL E O   1 
ATOM   5789  C  CB  . VAL C  3 458 ? 173.585 121.441 128.542 1.00 49.27  ?  486 VAL E CB  1 
ATOM   5790  C  CG1 . VAL C  3 458 ? 173.270 121.282 130.008 1.00 49.27  ?  486 VAL E CG1 1 
ATOM   5791  C  CG2 . VAL C  3 458 ? 174.850 122.245 128.362 1.00 49.27  ?  486 VAL E CG2 1 
ATOM   5792  N  N   . ALA C  3 459 ? 172.674 118.039 128.648 1.00 49.76  ?  487 ALA E N   1 
ATOM   5793  C  CA  . ALA C  3 459 ? 171.606 117.102 128.950 1.00 49.76  ?  487 ALA E CA  1 
ATOM   5794  C  C   . ALA C  3 459 ? 171.234 117.277 130.410 1.00 49.76  ?  487 ALA E C   1 
ATOM   5795  O  O   . ALA C  3 459 ? 172.070 117.050 131.288 1.00 49.76  ?  487 ALA E O   1 
ATOM   5796  C  CB  . ALA C  3 459 ? 172.069 115.672 128.694 1.00 49.76  ?  487 ALA E CB  1 
ATOM   5797  N  N   . THR C  3 460 ? 169.996 117.677 130.670 1.00 50.73  ?  488 THR E N   1 
ATOM   5798  C  CA  . THR C  3 460 ? 169.542 117.942 132.022 1.00 50.73  ?  488 THR E CA  1 
ATOM   5799  C  C   . THR C  3 460 ? 168.388 117.024 132.386 1.00 50.73  ?  488 THR E C   1 
ATOM   5800  O  O   . THR C  3 460 ? 167.461 116.814 131.597 1.00 50.73  ?  488 THR E O   1 
ATOM   5801  C  CB  . THR C  3 460 ? 169.082 119.395 132.195 1.00 50.73  ?  488 THR E CB  1 
ATOM   5802  O  OG1 . THR C  3 460 ? 167.978 119.656 131.322 1.00 50.73  ?  488 THR E OG1 1 
ATOM   5803  C  CG2 . THR C  3 460 ? 170.199 120.356 131.875 1.00 50.73  ?  488 THR E CG2 1 
ATOM   5804  N  N   . ASP C  3 461 ? 168.460 116.480 133.592 1.00 55.10  ?  489 ASP E N   1 
ATOM   5805  C  CA  . ASP C  3 461 ? 167.289 115.947 134.261 1.00 55.10  ?  489 ASP E CA  1 
ATOM   5806  C  C   . ASP C  3 461 ? 166.356 117.103 134.591 1.00 55.10  ?  489 ASP E C   1 
ATOM   5807  O  O   . ASP C  3 461 ? 166.790 118.243 134.771 1.00 55.10  ?  489 ASP E O   1 
ATOM   5808  C  CB  . ASP C  3 461 ? 167.685 115.209 135.541 1.00 55.10  ?  489 ASP E CB  1 
ATOM   5809  C  CG  . ASP C  3 461 ? 166.539 114.422 136.154 1.00 55.10  ?  489 ASP E CG  1 
ATOM   5810  O  OD1 . ASP C  3 461 ? 165.440 114.374 135.567 1.00 55.10  ?  489 ASP E OD1 1 
ATOM   5811  O  OD2 . ASP C  3 461 ? 166.734 113.859 137.249 1.00 55.10  ?  489 ASP E OD2 1 
ATOM   5812  N  N   . GLN C  3 462 ? 165.067 116.802 134.675 1.00 60.12  ?  490 GLN E N   1 
ATOM   5813  C  CA  . GLN C  3 462 ? 164.091 117.807 135.050 1.00 60.12  ?  490 GLN E CA  1 
ATOM   5814  C  C   . GLN C  3 462 ? 163.713 117.734 136.522 1.00 60.12  ?  490 GLN E C   1 
ATOM   5815  O  O   . GLN C  3 462 ? 163.559 118.780 137.157 1.00 60.12  ?  490 GLN E O   1 
ATOM   5816  C  CB  . GLN C  3 462 ? 162.843 117.683 134.174 1.00 60.12  ?  490 GLN E CB  1 
ATOM   5817  C  CG  . GLN C  3 462 ? 161.836 118.794 134.391 1.00 60.12  ?  490 GLN E CG  1 
ATOM   5818  C  CD  . GLN C  3 462 ? 160.673 118.733 133.429 1.00 60.12  ?  490 GLN E CD  1 
ATOM   5819  O  OE1 . GLN C  3 462 ? 160.594 117.840 132.587 1.00 60.12  ?  490 GLN E OE1 1 
ATOM   5820  N  NE2 . GLN C  3 462 ? 159.759 119.687 133.548 1.00 60.12  ?  490 GLN E NE2 1 
ATOM   5821  N  N   . GLN C  3 463 ? 163.605 116.539 137.098 1.00 60.08  ?  491 GLN E N   1 
ATOM   5822  C  CA  . GLN C  3 463 ? 163.271 116.419 138.508 1.00 60.08  ?  491 GLN E CA  1 
ATOM   5823  C  C   . GLN C  3 463 ? 164.475 116.567 139.424 1.00 60.08  ?  491 GLN E C   1 
ATOM   5824  O  O   . GLN C  3 463 ? 164.297 116.642 140.644 1.00 60.08  ?  491 GLN E O   1 
ATOM   5825  C  CB  . GLN C  3 463 ? 162.580 115.079 138.786 1.00 60.08  ?  491 GLN E CB  1 
ATOM   5826  C  CG  . GLN C  3 463 ? 161.220 114.969 138.136 1.00 60.08  ?  491 GLN E CG  1 
ATOM   5827  C  CD  . GLN C  3 463 ? 160.533 113.658 138.436 1.00 60.08  ?  491 GLN E CD  1 
ATOM   5828  O  OE1 . GLN C  3 463 ? 161.084 112.798 139.121 1.00 60.08  ?  491 GLN E OE1 1 
ATOM   5829  N  NE2 . GLN C  3 463 ? 159.323 113.494 137.917 1.00 60.08  ?  491 GLN E NE2 1 
ATOM   5830  N  N   . THR C  3 464 ? 165.683 116.611 138.877 1.00 62.34  ?  492 THR E N   1 
ATOM   5831  C  CA  . THR C  3 464 ? 166.877 116.969 139.634 1.00 62.34  ?  492 THR E CA  1 
ATOM   5832  C  C   . THR C  3 464 ? 167.628 117.956 138.740 1.00 62.34  ?  492 THR E C   1 
ATOM   5833  O  O   . THR C  3 464 ? 167.122 118.378 137.695 1.00 62.34  ?  492 THR E O   1 
ATOM   5834  C  CB  . THR C  3 464 ? 167.659 115.696 140.020 1.00 62.34  ?  492 THR E CB  1 
ATOM   5835  O  OG1 . THR C  3 464 ? 166.735 114.678 140.414 1.00 62.34  ?  492 THR E OG1 1 
ATOM   5836  C  CG2 . THR C  3 464 ? 168.544 115.928 141.244 1.00 62.34  ?  492 THR E CG2 1 
ATOM   5837  N  N   . SER C  3 465 ? 168.834 118.360 139.134 1.00 61.40  ?  493 SER E N   1 
ATOM   5838  C  CA  . SER C  3 465 ? 169.668 119.208 138.297 1.00 61.40  ?  493 SER E CA  1 
ATOM   5839  C  C   . SER C  3 465 ? 170.858 118.454 137.721 1.00 61.40  ?  493 SER E C   1 
ATOM   5840  O  O   . SER C  3 465 ? 171.794 119.093 137.228 1.00 61.40  ?  493 SER E O   1 
ATOM   5841  C  CB  . SER C  3 465 ? 170.163 120.424 139.084 1.00 61.40  ?  493 SER E CB  1 
ATOM   5842  O  OG  . SER C  3 465 ? 171.047 120.029 140.118 1.00 61.40  ?  493 SER E OG  1 
ATOM   5843  N  N   . ARG C  3 466 ? 170.850 117.121 137.778 1.00 58.40  ?  494 ARG E N   1 
ATOM   5844  C  CA  . ARG C  3 466 ? 171.976 116.315 137.325 1.00 58.40  ?  494 ARG E CA  1 
ATOM   5845  C  C   . ARG C  3 466 ? 172.139 116.398 135.818 1.00 58.40  ?  494 ARG E C   1 
ATOM   5846  O  O   . ARG C  3 466 ? 171.362 115.805 135.066 1.00 58.40  ?  494 ARG E O   1 
ATOM   5847  C  CB  . ARG C  3 466 ? 171.802 114.861 137.753 1.00 58.40  ?  494 ARG E CB  1 
ATOM   5848  C  CG  . ARG C  3 466 ? 171.889 114.660 139.243 1.00 58.40  ?  494 ARG E CG  1 
ATOM   5849  C  CD  . ARG C  3 466 ? 171.692 113.213 139.598 1.00 58.40  ?  494 ARG E CD  1 
ATOM   5850  N  NE  . ARG C  3 466 ? 172.747 112.378 139.046 1.00 58.40  ?  494 ARG E NE  1 
ATOM   5851  C  CZ  . ARG C  3 466 ? 172.740 111.052 139.089 1.00 58.40  ?  494 ARG E CZ  1 
ATOM   5852  N  NH1 . ARG C  3 466 ? 171.734 110.414 139.670 1.00 58.40  ?  494 ARG E NH1 1 
ATOM   5853  N  NH2 . ARG C  3 466 ? 173.740 110.364 138.559 1.00 58.40  ?  494 ARG E NH2 1 
ATOM   5854  N  N   . GLN C  3 467 ? 173.147 117.134 135.375 1.00 55.70  ?  495 GLN E N   1 
ATOM   5855  C  CA  . GLN C  3 467 ? 173.387 117.353 133.963 1.00 55.70  ?  495 GLN E CA  1 
ATOM   5856  C  C   . GLN C  3 467 ? 174.621 116.589 133.510 1.00 55.70  ?  495 GLN E C   1 
ATOM   5857  O  O   . GLN C  3 467 ? 175.406 116.082 134.314 1.00 55.70  ?  495 GLN E O   1 
ATOM   5858  C  CB  . GLN C  3 467 ? 173.571 118.843 133.660 1.00 55.70  ?  495 GLN E CB  1 
ATOM   5859  C  CG  . GLN C  3 467 ? 174.815 119.454 134.280 1.00 55.70  ?  495 GLN E CG  1 
ATOM   5860  C  CD  . GLN C  3 467 ? 174.956 120.928 133.962 1.00 55.70  ?  495 GLN E CD  1 
ATOM   5861  O  OE1 . GLN C  3 467 ? 174.147 121.496 133.232 1.00 55.70  ?  495 GLN E OE1 1 
ATOM   5862  N  NE2 . GLN C  3 467 ? 175.990 121.555 134.508 1.00 55.70  ?  495 GLN E NE2 1 
ATOM   5863  N  N   . ALA C  3 468 ? 174.769 116.514 132.197 1.00 51.78  ?  496 ALA E N   1 
ATOM   5864  C  CA  . ALA C  3 468 ? 175.976 115.998 131.575 1.00 51.78  ?  496 ALA E CA  1 
ATOM   5865  C  C   . ALA C  3 468 ? 176.124 116.673 130.230 1.00 51.78  ?  496 ALA E C   1 
ATOM   5866  O  O   . ALA C  3 468 ? 175.130 116.933 129.556 1.00 51.78  ?  496 ALA E O   1 
ATOM   5867  C  CB  . ALA C  3 468 ? 175.928 114.484 131.408 1.00 51.78  ?  496 ALA E CB  1 
ATOM   5868  N  N   . GLN C  3 469 ? 177.357 116.942 129.832 1.00 55.49  ?  497 GLN E N   1 
ATOM   5869  C  CA  . GLN C  3 469 ? 177.621 117.803 128.692 1.00 55.49  ?  497 GLN E CA  1 
ATOM   5870  C  C   . GLN C  3 469 ? 178.564 117.135 127.706 1.00 55.49  ?  497 GLN E C   1 
ATOM   5871  O  O   . GLN C  3 469 ? 179.440 116.359 128.096 1.00 55.49  ?  497 GLN E O   1 
ATOM   5872  C  CB  . GLN C  3 469 ? 178.167 119.146 129.166 1.00 55.49  ?  497 GLN E CB  1 
ATOM   5873  C  CG  . GLN C  3 469 ? 179.338 119.030 130.105 1.00 55.49  ?  497 GLN E CG  1 
ATOM   5874  C  CD  . GLN C  3 469 ? 179.789 120.374 130.607 1.00 55.49  ?  497 GLN E CD  1 
ATOM   5875  O  OE1 . GLN C  3 469 ? 179.252 121.407 130.206 1.00 55.49  ?  497 GLN E OE1 1 
ATOM   5876  N  NE2 . GLN C  3 469 ? 180.786 120.376 131.483 1.00 55.49  ?  497 GLN E NE2 1 
ATOM   5877  N  N   . ALA C  3 470 ? 178.356 117.431 126.430 1.00 59.80  ?  498 ALA E N   1 
ATOM   5878  C  CA  . ALA C  3 470 ? 179.189 116.957 125.338 1.00 59.80  ?  498 ALA E CA  1 
ATOM   5879  C  C   . ALA C  3 470 ? 179.630 118.129 124.476 1.00 59.80  ?  498 ALA E C   1 
ATOM   5880  O  O   . ALA C  3 470 ? 179.088 119.233 124.557 1.00 59.80  ?  498 ALA E O   1 
ATOM   5881  C  CB  . ALA C  3 470 ? 178.450 115.932 124.476 1.00 59.80  ?  498 ALA E CB  1 
ATOM   5882  N  N   . GLN C  3 471 ? 180.614 117.866 123.624 1.00 64.83  ?  499 GLN E N   1 
ATOM   5883  C  CA  . GLN C  3 471 ? 181.137 118.861 122.703 1.00 64.83  ?  499 GLN E CA  1 
ATOM   5884  C  C   . GLN C  3 471 ? 180.835 118.446 121.274 1.00 64.83  ?  499 GLN E C   1 
ATOM   5885  O  O   . GLN C  3 471 ? 181.325 117.419 120.796 1.00 64.83  ?  499 GLN E O   1 
ATOM   5886  C  CB  . GLN C  3 471 ? 182.640 119.049 122.880 1.00 64.83  ?  499 GLN E CB  1 
ATOM   5887  C  CG  . GLN C  3 471 ? 183.028 119.692 124.190 1.00 64.83  ?  499 GLN E CG  1 
ATOM   5888  C  CD  . GLN C  3 471 ? 184.522 119.850 124.320 1.00 64.83  ?  499 GLN E CD  1 
ATOM   5889  O  OE1 . GLN C  3 471 ? 185.278 119.403 123.459 1.00 64.83  ?  499 GLN E OE1 1 
ATOM   5890  N  NE2 . GLN C  3 471 ? 184.959 120.491 125.395 1.00 64.83  ?  499 GLN E NE2 1 
ATOM   5891  N  N   . LEU C  3 472 ? 180.025 119.250 120.601 1.00 66.84  ?  500 LEU E N   1 
ATOM   5892  C  CA  . LEU C  3 472 ? 179.716 119.063 119.193 1.00 66.84  ?  500 LEU E CA  1 
ATOM   5893  C  C   . LEU C  3 472 ? 180.718 119.867 118.380 1.00 66.84  ?  500 LEU E C   1 
ATOM   5894  O  O   . LEU C  3 472 ? 180.712 121.101 118.423 1.00 66.84  ?  500 LEU E O   1 
ATOM   5895  C  CB  . LEU C  3 472 ? 178.289 119.499 118.885 1.00 66.84  ?  500 LEU E CB  1 
ATOM   5896  C  CG  . LEU C  3 472 ? 177.907 119.447 117.410 1.00 66.84  ?  500 LEU E CG  1 
ATOM   5897  C  CD1 . LEU C  3 472 ? 178.032 118.045 116.866 1.00 66.84  ?  500 LEU E CD1 1 
ATOM   5898  C  CD2 . LEU C  3 472 ? 176.501 119.964 117.223 1.00 66.84  ?  500 LEU E CD2 1 
ATOM   5899  N  N   . LEU C  3 473 ? 181.581 119.165 117.656 1.00 73.29  ?  501 LEU E N   1 
ATOM   5900  C  CA  . LEU C  3 473 ? 182.570 119.779 116.777 1.00 73.29  ?  501 LEU E CA  1 
ATOM   5901  C  C   . LEU C  3 473 ? 182.019 119.666 115.362 1.00 73.29  ?  501 LEU E C   1 
ATOM   5902  O  O   . LEU C  3 473 ? 182.416 118.780 114.602 1.00 73.29  ?  501 LEU E O   1 
ATOM   5903  C  CB  . LEU C  3 473 ? 183.917 119.076 116.907 1.00 73.29  ?  501 LEU E CB  1 
ATOM   5904  C  CG  . LEU C  3 473 ? 184.566 118.969 118.293 1.00 73.29  ?  501 LEU E CG  1 
ATOM   5905  C  CD1 . LEU C  3 473 ? 185.846 118.151 118.219 1.00 73.29  ?  501 LEU E CD1 1 
ATOM   5906  C  CD2 . LEU C  3 473 ? 184.850 120.321 118.914 1.00 73.29  ?  501 LEU E CD2 1 
ATOM   5907  N  N   . VAL C  3 474 ? 181.106 120.560 114.999 1.00 74.43  ?  502 VAL E N   1 
ATOM   5908  C  CA  . VAL C  3 474 ? 180.330 120.398 113.775 1.00 74.43  ?  502 VAL E CA  1 
ATOM   5909  C  C   . VAL C  3 474 ? 180.956 121.266 112.686 1.00 74.43  ?  502 VAL E C   1 
ATOM   5910  O  O   . VAL C  3 474 ? 181.449 122.371 112.954 1.00 74.43  ?  502 VAL E O   1 
ATOM   5911  C  CB  . VAL C  3 474 ? 178.837 120.698 114.006 1.00 74.43  ?  502 VAL E CB  1 
ATOM   5912  C  CG1 . VAL C  3 474 ? 178.585 122.135 114.394 1.00 74.43  ?  502 VAL E CG1 1 
ATOM   5913  C  CG2 . VAL C  3 474 ? 178.004 120.304 112.801 1.00 74.43  ?  502 VAL E CG2 1 
ATOM   5914  N  N   . THR C  3 475 ? 181.020 120.720 111.474 1.00 76.25  ?  503 THR E N   1 
ATOM   5915  C  CA  . THR C  3 475 ? 181.679 121.375 110.355 1.00 76.25  ?  503 THR E CA  1 
ATOM   5916  C  C   . THR C  3 475 ? 180.680 121.645 109.240 1.00 76.25  ?  503 THR E C   1 
ATOM   5917  O  O   . THR C  3 475 ? 180.119 120.708 108.664 1.00 76.25  ?  503 THR E O   1 
ATOM   5918  C  CB  . THR C  3 475 ? 182.821 120.510 109.823 1.00 76.25  ?  503 THR E CB  1 
ATOM   5919  O  OG1 . THR C  3 475 ? 182.290 119.272 109.337 1.00 76.25  ?  503 THR E OG1 1 
ATOM   5920  C  CG2 . THR C  3 475 ? 183.833 120.220 110.918 1.00 76.25  ?  503 THR E CG2 1 
ATOM   5921  N  N   . VAL C  3 476 ? 180.458 122.920 108.942 1.00 75.16  ?  504 VAL E N   1 
ATOM   5922  C  CA  . VAL C  3 476 ? 179.644 123.324 107.803 1.00 75.16  ?  504 VAL E CA  1 
ATOM   5923  C  C   . VAL C  3 476 ? 180.417 122.960 106.543 1.00 75.16  ?  504 VAL E C   1 
ATOM   5924  O  O   . VAL C  3 476 ? 181.453 123.557 106.243 1.00 75.16  ?  504 VAL E O   1 
ATOM   5925  C  CB  . VAL C  3 476 ? 179.312 124.819 107.848 1.00 75.16  ?  504 VAL E CB  1 
ATOM   5926  C  CG1 . VAL C  3 476 ? 178.584 125.235 106.584 1.00 75.16  ?  504 VAL E CG1 1 
ATOM   5927  C  CG2 . VAL C  3 476 ? 178.471 125.128 109.073 1.00 75.16  ?  504 VAL E CG2 1 
ATOM   5928  N  N   . GLU C  3 477 ? 179.915 121.975 105.809 1.00 76.86  ?  505 GLU E N   1 
ATOM   5929  C  CA  . GLU C  3 477 ? 180.649 121.356 104.719 1.00 76.86  ?  505 GLU E CA  1 
ATOM   5930  C  C   . GLU C  3 477 ? 179.900 121.521 103.406 1.00 76.86  ?  505 GLU E C   1 
ATOM   5931  O  O   . GLU C  3 477 ? 178.727 121.163 103.293 1.00 76.86  ?  505 GLU E O   1 
ATOM   5932  C  CB  . GLU C  3 477 ? 180.874 119.869 105.001 1.00 76.86  ?  505 GLU E CB  1 
ATOM   5933  C  CG  . GLU C  3 477 ? 181.695 119.147 103.955 1.00 76.86  ?  505 GLU E CG  1 
ATOM   5934  C  CD  . GLU C  3 477 ? 181.932 117.696 104.318 1.00 76.86  ?  505 GLU E CD  1 
ATOM   5935  O  OE1 . GLU C  3 477 ? 181.420 117.258 105.369 1.00 76.86  ?  505 GLU E OE1 1 
ATOM   5936  O  OE2 . GLU C  3 477 ? 182.634 116.997 103.557 1.00 76.86  ?  505 GLU E OE2 1 
ATOM   5937  N  N   . GLY C  3 478 ? 180.592 122.062 102.411 1.00 79.66  ?  506 GLY E N   1 
ATOM   5938  C  CA  . GLY C  3 478 ? 180.013 122.179 101.090 1.00 79.66  ?  506 GLY E CA  1 
ATOM   5939  C  C   . GLY C  3 478 ? 179.961 123.601 100.580 1.00 79.66  ?  506 GLY E C   1 
ATOM   5940  O  O   . GLY C  3 478 ? 180.140 124.552 101.345 1.00 79.66  ?  506 GLY E O   1 
ATOM   5941  N  N   . SER C  3 479 ? 179.718 123.756 99.285  1.00 85.92  ?  507 SER E N   1 
ATOM   5942  C  CA  . SER C  3 479 ? 179.589 125.068 98.676  1.00 85.92  ?  507 SER E CA  1 
ATOM   5943  C  C   . SER C  3 479 ? 178.130 125.514 98.747  1.00 85.92  ?  507 SER E C   1 
ATOM   5944  O  O   . SER C  3 479 ? 177.304 124.905 99.430  1.00 85.92  ?  507 SER E O   1 
ATOM   5945  C  CB  . SER C  3 479 ? 180.109 125.035 97.242  1.00 85.92  ?  507 SER E CB  1 
ATOM   5946  O  OG  . SER C  3 479 ? 181.491 124.726 97.211  1.00 85.92  ?  507 SER E OG  1 
ATOM   5947  N  N   . TYR C  3 480 ? 177.796 126.586 98.036  1.00 89.44  ?  508 TYR E N   1 
ATOM   5948  C  CA  . TYR C  3 480 ? 176.427 127.078 97.994  1.00 89.44  ?  508 TYR E CA  1 
ATOM   5949  C  C   . TYR C  3 480 ? 175.991 127.243 96.548  1.00 89.44  ?  508 TYR E C   1 
ATOM   5950  O  O   . TYR C  3 480 ? 176.680 127.895 95.760  1.00 89.44  ?  508 TYR E O   1 
ATOM   5951  C  CB  . TYR C  3 480 ? 176.286 128.411 98.740  1.00 89.44  ?  508 TYR E CB  1 
ATOM   5952  C  CG  . TYR C  3 480 ? 174.879 128.960 98.711  1.00 89.44  ?  508 TYR E CG  1 
ATOM   5953  C  CD1 . TYR C  3 480 ? 173.884 128.412 99.508  1.00 89.44  ?  508 TYR E CD1 1 
ATOM   5954  C  CD2 . TYR C  3 480 ? 174.545 130.025 97.879  1.00 89.44  ?  508 TYR E CD2 1 
ATOM   5955  C  CE1 . TYR C  3 480 ? 172.595 128.906 99.477  1.00 89.44  ?  508 TYR E CE1 1 
ATOM   5956  C  CE2 . TYR C  3 480 ? 173.260 130.525 97.841  1.00 89.44  ?  508 TYR E CE2 1 
ATOM   5957  C  CZ  . TYR C  3 480 ? 172.290 129.965 98.642  1.00 89.44  ?  508 TYR E CZ  1 
ATOM   5958  O  OH  . TYR C  3 480 ? 171.010 130.468 98.600  1.00 89.44  ?  508 TYR E OH  1 
ATOM   5959  N  N   . VAL C  3 481 ? 174.851 126.649 96.209  1.00 90.16  ?  509 VAL E N   1 
ATOM   5960  C  CA  . VAL C  3 481 ? 174.194 126.853 94.925  1.00 90.16  ?  509 VAL E CA  1 
ATOM   5961  C  C   . VAL C  3 481 ? 172.857 127.524 95.206  1.00 90.16  ?  509 VAL E C   1 
ATOM   5962  O  O   . VAL C  3 481 ? 172.119 127.088 96.096  1.00 90.16  ?  509 VAL E O   1 
ATOM   5963  C  CB  . VAL C  3 481 ? 174.007 125.527 94.161  1.00 90.16  ?  509 VAL E CB  1 
ATOM   5964  C  CG1 . VAL C  3 481 ? 173.308 125.757 92.826  1.00 90.16  ?  509 VAL E CG1 1 
ATOM   5965  C  CG2 . VAL C  3 481 ? 175.347 124.836 93.955  1.00 90.16  ?  509 VAL E CG2 1 
ATOM   5966  N  N   . ALA C  3 482 ? 172.561 128.592 94.469  1.00 93.14  ?  510 ALA E N   1 
ATOM   5967  C  CA  . ALA C  3 482 ? 171.349 129.360 94.705  1.00 93.14  ?  510 ALA E CA  1 
ATOM   5968  C  C   . ALA C  3 482 ? 170.108 128.574 94.288  1.00 93.14  ?  510 ALA E C   1 
ATOM   5969  O  O   . ALA C  3 482 ? 170.179 127.579 93.562  1.00 93.14  ?  510 ALA E O   1 
ATOM   5970  C  CB  . ALA C  3 482 ? 171.402 130.689 93.953  1.00 93.14  ?  510 ALA E CB  1 
ATOM   5971  N  N   . GLU C  3 483 ? 168.958 129.043 94.759  1.00 90.28  ?  511 GLU E N   1 
ATOM   5972  C  CA  . GLU C  3 483 ? 167.689 128.357 94.577  1.00 90.28  ?  511 GLU E CA  1 
ATOM   5973  C  C   . GLU C  3 483 ? 166.950 128.886 93.356  1.00 90.28  ?  511 GLU E C   1 
ATOM   5974  O  O   . GLU C  3 483 ? 167.356 129.871 92.736  1.00 90.28  ?  511 GLU E O   1 
ATOM   5975  C  CB  . GLU C  3 483 ? 166.802 128.522 95.809  1.00 90.28  ?  511 GLU E CB  1 
ATOM   5976  C  CG  . GLU C  3 483 ? 167.324 127.843 97.049  1.00 90.28  ?  511 GLU E CG  1 
ATOM   5977  C  CD  . GLU C  3 483 ? 166.431 128.085 98.241  1.00 90.28  ?  511 GLU E CD  1 
ATOM   5978  O  OE1 . GLU C  3 483 ? 165.481 128.886 98.121  1.00 90.28  ?  511 GLU E OE1 1 
ATOM   5979  O  OE2 . GLU C  3 483 ? 166.680 127.474 99.297  1.00 90.28  ?  511 GLU E OE2 1 
ATOM   5980  N  N   . GLU C  3 484 ? 165.855 128.213 93.021  1.00 98.58  ?  512 GLU E N   1 
ATOM   5981  C  CA  . GLU C  3 484 ? 164.984 128.664 91.948  1.00 98.58  ?  512 GLU E CA  1 
ATOM   5982  C  C   . GLU C  3 484 ? 163.780 129.401 92.519  1.00 98.58  ?  512 GLU E C   1 
ATOM   5983  O  O   . GLU C  3 484 ? 163.302 129.086 93.613  1.00 98.58  ?  512 GLU E O   1 
ATOM   5984  C  CB  . GLU C  3 484 ? 164.521 127.477 91.105  1.00 98.58  ?  512 GLU E CB  1 
ATOM   5985  C  CG  . GLU C  3 484 ? 165.640 126.787 90.350  1.00 98.58  ?  512 GLU E CG  1 
ATOM   5986  C  CD  . GLU C  3 484 ? 165.144 125.622 89.524  1.00 98.58  ?  512 GLU E CD  1 
ATOM   5987  O  OE1 . GLU C  3 484 ? 163.946 125.286 89.628  1.00 98.58  ?  512 GLU E OE1 1 
ATOM   5988  O  OE2 . GLU C  3 484 ? 165.952 125.041 88.770  1.00 98.58  ?  512 GLU E OE2 1 
ATOM   5989  N  N   . ALA C  3 485 ? 163.291 130.390 91.770  1.00 100.07 ?  513 ALA E N   1 
ATOM   5990  C  CA  . ALA C  3 485 ? 162.103 131.133 92.172  1.00 100.07 ?  513 ALA E CA  1 
ATOM   5991  C  C   . ALA C  3 485 ? 160.808 130.433 91.786  1.00 100.07 ?  513 ALA E C   1 
ATOM   5992  O  O   . ALA C  3 485 ? 159.729 130.931 92.126  1.00 100.07 ?  513 ALA E O   1 
ATOM   5993  C  CB  . ALA C  3 485 ? 162.128 132.538 91.565  1.00 100.07 ?  513 ALA E CB  1 
ATOM   5994  N  N   . GLY C  3 486 ? 160.886 129.307 91.084  1.00 96.14  ?  514 GLY E N   1 
ATOM   5995  C  CA  . GLY C  3 486 ? 159.737 128.495 90.752  1.00 96.14  ?  514 GLY E CA  1 
ATOM   5996  C  C   . GLY C  3 486 ? 159.451 127.379 91.731  1.00 96.14  ?  514 GLY E C   1 
ATOM   5997  O  O   . GLY C  3 486 ? 158.611 126.519 91.445  1.00 96.14  ?  514 GLY E O   1 
ATOM   5998  N  N   . CYS C  3 487 ? 160.125 127.363 92.879  1.00 86.10  ?  515 CYS E N   1 
ATOM   5999  C  CA  . CYS C  3 487 ? 160.004 126.376 93.944  1.00 86.10  ?  515 CYS E CA  1 
ATOM   6000  C  C   . CYS C  3 487 ? 159.033 126.842 95.023  1.00 86.10  ?  515 CYS E C   1 
ATOM   6001  O  O   . CYS C  3 487 ? 159.053 128.013 95.415  1.00 86.10  ?  515 CYS E O   1 
ATOM   6002  C  CB  . CYS C  3 487 ? 161.355 126.089 94.582  1.00 86.10  ?  515 CYS E CB  1 
ATOM   6003  S  SG  . CYS C  3 487 ? 162.393 124.964 93.650  1.00 86.10  ?  515 CYS E SG  1 
ATOM   6004  N  N   . PRO C  3 488 ? 158.195 125.934 95.509  1.00 69.86  ?  516 PRO E N   1 
ATOM   6005  C  CA  . PRO C  3 488 ? 157.324 126.240 96.643  1.00 69.86  ?  516 PRO E CA  1 
ATOM   6006  C  C   . PRO C  3 488 ? 158.109 126.157 97.944  1.00 69.86  ?  516 PRO E C   1 
ATOM   6007  O  O   . PRO C  3 488 ? 159.300 125.856 97.970  1.00 69.86  ?  516 PRO E O   1 
ATOM   6008  C  CB  . PRO C  3 488 ? 156.259 125.150 96.567  1.00 69.86  ?  516 PRO E CB  1 
ATOM   6009  C  CG  . PRO C  3 488 ? 156.970 124.005 95.957  1.00 69.86  ?  516 PRO E CG  1 
ATOM   6010  C  CD  . PRO C  3 488 ? 157.934 124.589 94.969  1.00 69.86  ?  516 PRO E CD  1 
ATOM   6011  N  N   . LEU C  3 489 ? 157.411 126.413 99.037  1.00 57.05  ?  517 LEU E N   1 
ATOM   6012  C  CA  . LEU C  3 489 ? 158.062 126.440 100.331 1.00 57.05  ?  517 LEU E CA  1 
ATOM   6013  C  C   . LEU C  3 489 ? 158.233 125.044 100.915 1.00 57.05  ?  517 LEU E C   1 
ATOM   6014  O  O   . LEU C  3 489 ? 159.044 124.865 101.827 1.00 57.05  ?  517 LEU E O   1 
ATOM   6015  C  CB  . LEU C  3 489 ? 157.265 127.349 101.275 1.00 57.05  ?  517 LEU E CB  1 
ATOM   6016  C  CG  . LEU C  3 489 ? 157.907 127.968 102.520 1.00 57.05  ?  517 LEU E CG  1 
ATOM   6017  C  CD1 . LEU C  3 489 ? 157.298 129.336 102.764 1.00 57.05  ?  517 LEU E CD1 1 
ATOM   6018  C  CD2 . LEU C  3 489 ? 157.725 127.126 103.759 1.00 57.05  ?  517 LEU E CD2 1 
ATOM   6019  N  N   . SER C  3 490 ? 157.534 124.045 100.377 1.00 52.52  ?  518 SER E N   1 
ATOM   6020  C  CA  . SER C  3 490 ? 157.592 122.678 100.871 1.00 52.52  ?  518 SER E CA  1 
ATOM   6021  C  C   . SER C  3 490 ? 157.939 121.703 99.754  1.00 52.52  ?  518 SER E C   1 
ATOM   6022  O  O   . SER C  3 490 ? 157.893 122.037 98.568  1.00 52.52  ?  518 SER E O   1 
ATOM   6023  C  CB  . SER C  3 490 ? 156.264 122.260 101.501 1.00 52.52  ?  518 SER E CB  1 
ATOM   6024  O  OG  . SER C  3 490 ? 156.026 122.976 102.698 1.00 52.52  ?  518 SER E OG  1 
ATOM   6025  N  N   . CYS C  3 491 ? 158.293 120.480 100.157 1.00 51.85  ?  519 CYS E N   1 
ATOM   6026  C  CA  . CYS C  3 491 ? 158.469 119.404 99.190  1.00 51.85  ?  519 CYS E CA  1 
ATOM   6027  C  C   . CYS C  3 491 ? 157.135 118.787 98.799  1.00 51.85  ?  519 CYS E C   1 
ATOM   6028  O  O   . CYS C  3 491 ? 156.943 118.409 97.638  1.00 51.85  ?  519 CYS E O   1 
ATOM   6029  C  CB  . CYS C  3 491 ? 159.375 118.309 99.755  1.00 51.85  ?  519 CYS E CB  1 
ATOM   6030  S  SG  . CYS C  3 491 ? 161.091 118.747 100.115 1.00 51.85  ?  519 CYS E SG  1 
ATOM   6031  N  N   . ALA C  3 492 ? 156.196 118.699 99.746  1.00 44.86  ?  520 ALA E N   1 
ATOM   6032  C  CA  . ALA C  3 492 ? 154.978 117.915 99.572  1.00 44.86  ?  520 ALA E CA  1 
ATOM   6033  C  C   . ALA C  3 492 ? 153.934 118.595 98.699  1.00 44.86  ?  520 ALA E C   1 
ATOM   6034  O  O   . ALA C  3 492 ? 152.834 118.059 98.552  1.00 44.86  ?  520 ALA E O   1 
ATOM   6035  C  CB  . ALA C  3 492 ? 154.375 117.588 100.935 1.00 44.86  ?  520 ALA E CB  1 
ATOM   6036  N  N   . VAL C  3 493 ? 154.241 119.755 98.123  1.00 39.59  ?  521 VAL E N   1 
ATOM   6037  C  CA  . VAL C  3 493 ? 153.352 120.344 97.135  1.00 39.59  ?  521 VAL E CA  1 
ATOM   6038  C  C   . VAL C  3 493 ? 153.549 119.649 95.791  1.00 39.59  ?  521 VAL E C   1 
ATOM   6039  O  O   . VAL C  3 493 ? 152.659 119.663 94.931  1.00 39.59  ?  521 VAL E O   1 
ATOM   6040  C  CB  . VAL C  3 493 ? 153.616 121.862 97.086  1.00 39.59  ?  521 VAL E CB  1 
ATOM   6041  C  CG1 . VAL C  3 493 ? 152.655 122.598 96.165  1.00 39.59  ?  521 VAL E CG1 1 
ATOM   6042  C  CG2 . VAL C  3 493 ? 153.546 122.439 98.487  1.00 39.59  ?  521 VAL E CG2 1 
ATOM   6043  N  N   . SER C  3 494 ? 154.680 118.971 95.618  1.00 45.20  ?  522 SER E N   1 
ATOM   6044  C  CA  . SER C  3 494 ? 155.008 118.333 94.352  1.00 45.20  ?  522 SER E CA  1 
ATOM   6045  C  C   . SER C  3 494 ? 154.145 117.101 94.104  1.00 45.20  ?  522 SER E C   1 
ATOM   6046  O  O   . SER C  3 494 ? 153.582 116.508 95.026  1.00 45.20  ?  522 SER E O   1 
ATOM   6047  C  CB  . SER C  3 494 ? 156.481 117.945 94.334  1.00 45.20  ?  522 SER E CB  1 
ATOM   6048  O  OG  . SER C  3 494 ? 157.300 119.093 94.457  1.00 45.20  ?  522 SER E OG  1 
ATOM   6049  N  N   . LYS C  3 495 ? 154.054 116.717 92.836  1.00 51.76  ?  523 LYS E N   1 
ATOM   6050  C  CA  . LYS C  3 495 ? 153.180 115.646 92.375  1.00 51.76  ?  523 LYS E CA  1 
ATOM   6051  C  C   . LYS C  3 495 ? 153.922 114.510 91.700  1.00 51.76  ?  523 LYS E C   1 
ATOM   6052  O  O   . LYS C  3 495 ? 153.491 113.360 91.790  1.00 51.76  ?  523 LYS E O   1 
ATOM   6053  C  CB  . LYS C  3 495 ? 152.152 116.199 91.382  1.00 51.76  ?  523 LYS E CB  1 
ATOM   6054  C  CG  . LYS C  3 495 ? 151.218 117.219 91.964  1.00 51.76  ?  523 LYS E CG  1 
ATOM   6055  C  CD  . LYS C  3 495 ? 150.142 117.619 90.973  1.00 51.76  ?  523 LYS E CD  1 
ATOM   6056  C  CE  . LYS C  3 495 ? 150.704 118.534 89.901  1.00 51.76  ?  523 LYS E CE  1 
ATOM   6057  N  NZ  . LYS C  3 495 ? 149.640 119.043 88.995  1.00 51.76  ?  523 LYS E NZ  1 
ATOM   6058  N  N   . ARG C  3 496 ? 155.005 114.806 90.995  1.00 67.43  ?  524 ARG E N   1 
ATOM   6059  C  CA  . ARG C  3 496 ? 155.707 113.826 90.190  1.00 67.43  ?  524 ARG E CA  1 
ATOM   6060  C  C   . ARG C  3 496 ? 157.141 113.666 90.684  1.00 67.43  ?  524 ARG E C   1 
ATOM   6061  O  O   . ARG C  3 496 ? 157.571 114.302 91.647  1.00 67.43  ?  524 ARG E O   1 
ATOM   6062  C  CB  . ARG C  3 496 ? 155.670 114.237 88.718  1.00 67.43  ?  524 ARG E CB  1 
ATOM   6063  C  CG  . ARG C  3 496 ? 154.292 114.169 88.092  1.00 67.43  ?  524 ARG E CG  1 
ATOM   6064  C  CD  . ARG C  3 496 ? 154.328 114.640 86.649  1.00 67.43  ?  524 ARG E CD  1 
ATOM   6065  N  NE  . ARG C  3 496 ? 153.014 114.567 86.015  1.00 67.43  ?  524 ARG E NE  1 
ATOM   6066  C  CZ  . ARG C  3 496 ? 152.752 114.997 84.784  1.00 67.43  ?  524 ARG E CZ  1 
ATOM   6067  N  NH1 . ARG C  3 496 ? 153.712 115.542 84.049  1.00 67.43  ?  524 ARG E NH1 1 
ATOM   6068  N  NH2 . ARG C  3 496 ? 151.527 114.887 84.288  1.00 67.43  ?  524 ARG E NH2 1 
ATOM   6069  N  N   . ARG C  3 497 ? 157.896 112.806 89.998  1.00 70.48  ?  525 ARG E N   1 
ATOM   6070  C  CA  . ARG C  3 497 ? 159.267 112.527 90.411  1.00 70.48  ?  525 ARG E CA  1 
ATOM   6071  C  C   . ARG C  3 497 ? 160.233 113.614 89.960  1.00 70.48  ?  525 ARG E C   1 
ATOM   6072  O  O   . ARG C  3 497 ? 161.032 114.105 90.763  1.00 70.48  ?  525 ARG E O   1 
ATOM   6073  C  CB  . ARG C  3 497 ? 159.721 111.176 89.865  1.00 70.48  ?  525 ARG E CB  1 
ATOM   6074  C  CG  . ARG C  3 497 ? 161.126 110.797 90.290  1.00 70.48  ?  525 ARG E CG  1 
ATOM   6075  C  CD  . ARG C  3 497 ? 161.493 109.405 89.825  1.00 70.48  ?  525 ARG E CD  1 
ATOM   6076  N  NE  . ARG C  3 497 ? 162.848 109.047 90.229  1.00 70.48  ?  525 ARG E NE  1 
ATOM   6077  C  CZ  . ARG C  3 497 ? 163.420 107.878 89.965  1.00 70.48  ?  525 ARG E CZ  1 
ATOM   6078  N  NH1 . ARG C  3 497 ? 162.753 106.949 89.294  1.00 70.48  ?  525 ARG E NH1 1 
ATOM   6079  N  NH2 . ARG C  3 497 ? 164.660 107.636 90.370  1.00 70.48  ?  525 ARG E NH2 1 
ATOM   6080  N  N   . LEU C  3 498 ? 160.172 114.005 88.685  1.00 75.15  ?  526 LEU E N   1 
ATOM   6081  C  CA  . LEU C  3 498 ? 161.149 114.951 88.153  1.00 75.15  ?  526 LEU E CA  1 
ATOM   6082  C  C   . LEU C  3 498 ? 160.904 116.370 88.649  1.00 75.15  ?  526 LEU E C   1 
ATOM   6083  O  O   . LEU C  3 498 ? 161.773 117.234 88.494  1.00 75.15  ?  526 LEU E O   1 
ATOM   6084  C  CB  . LEU C  3 498 ? 161.139 114.912 86.627  1.00 75.15  ?  526 LEU E CB  1 
ATOM   6085  C  CG  . LEU C  3 498 ? 161.620 113.595 86.017  1.00 75.15  ?  526 LEU E CG  1 
ATOM   6086  C  CD1 . LEU C  3 498 ? 161.443 113.600 84.510  1.00 75.15  ?  526 LEU E CD1 1 
ATOM   6087  C  CD2 . LEU C  3 498 ? 163.070 113.337 86.385  1.00 75.15  ?  526 LEU E CD2 1 
ATOM   6088  N  N   . GLU C  3 499 ? 159.739 116.634 89.234  1.00 76.82  ?  527 GLU E N   1 
ATOM   6089  C  CA  . GLU C  3 499 ? 159.483 117.924 89.856  1.00 76.82  ?  527 GLU E CA  1 
ATOM   6090  C  C   . GLU C  3 499 ? 159.755 117.916 91.352  1.00 76.82  ?  527 GLU E C   1 
ATOM   6091  O  O   . GLU C  3 499 ? 159.701 118.977 91.980  1.00 76.82  ?  527 GLU E O   1 
ATOM   6092  C  CB  . GLU C  3 499 ? 158.041 118.352 89.586  1.00 76.82  ?  527 GLU E CB  1 
ATOM   6093  C  CG  . GLU C  3 499 ? 157.767 118.637 88.119  1.00 76.82  ?  527 GLU E CG  1 
ATOM   6094  C  CD  . GLU C  3 499 ? 156.326 119.016 87.851  1.00 76.82  ?  527 GLU E CD  1 
ATOM   6095  O  OE1 . GLU C  3 499 ? 155.499 118.918 88.782  1.00 76.82  ?  527 GLU E OE1 1 
ATOM   6096  O  OE2 . GLU C  3 499 ? 156.022 119.418 86.707  1.00 76.82  ?  527 GLU E OE2 1 
ATOM   6097  N  N   . CYS C  3 500 ? 160.043 116.751 91.929  1.00 68.55  ?  528 CYS E N   1 
ATOM   6098  C  CA  . CYS C  3 500 ? 160.379 116.620 93.340  1.00 68.55  ?  528 CYS E CA  1 
ATOM   6099  C  C   . CYS C  3 500 ? 161.880 116.715 93.585  1.00 68.55  ?  528 CYS E C   1 
ATOM   6100  O  O   . CYS C  3 500 ? 162.327 117.507 94.419  1.00 68.55  ?  528 CYS E O   1 
ATOM   6101  C  CB  . CYS C  3 500 ? 159.854 115.290 93.881  1.00 68.55  ?  528 CYS E CB  1 
ATOM   6102  S  SG  . CYS C  3 500 ? 160.303 114.967 95.592  1.00 68.55  ?  528 CYS E SG  1 
ATOM   6103  N  N   . GLU C  3 501 ? 162.667 115.917 92.864  1.00 74.02  ?  529 GLU E N   1 
ATOM   6104  C  CA  . GLU C  3 501 ? 164.102 115.837 93.098  1.00 74.02  ?  529 GLU E CA  1 
ATOM   6105  C  C   . GLU C  3 501 ? 164.878 117.001 92.499  1.00 74.02  ?  529 GLU E C   1 
ATOM   6106  O  O   . GLU C  3 501 ? 166.066 117.148 92.801  1.00 74.02  ?  529 GLU E O   1 
ATOM   6107  C  CB  . GLU C  3 501 ? 164.650 114.522 92.542  1.00 74.02  ?  529 GLU E CB  1 
ATOM   6108  C  CG  . GLU C  3 501 ? 164.163 113.291 93.284  1.00 74.02  ?  529 GLU E CG  1 
ATOM   6109  C  CD  . GLU C  3 501 ? 164.701 112.002 92.697  1.00 74.02  ?  529 GLU E CD  1 
ATOM   6110  O  OE1 . GLU C  3 501 ? 165.359 112.060 91.638  1.00 74.02  ?  529 GLU E OE1 1 
ATOM   6111  O  OE2 . GLU C  3 501 ? 164.463 110.931 93.293  1.00 74.02  ?  529 GLU E OE2 1 
ATOM   6112  N  N   . GLU C  3 502 ? 164.251 117.825 91.663  1.00 80.75  ?  530 GLU E N   1 
ATOM   6113  C  CA  . GLU C  3 502 ? 164.919 118.965 91.054  1.00 80.75  ?  530 GLU E CA  1 
ATOM   6114  C  C   . GLU C  3 502 ? 164.668 120.258 91.816  1.00 80.75  ?  530 GLU E C   1 
ATOM   6115  O  O   . GLU C  3 502 ? 164.874 121.346 91.267  1.00 80.75  ?  530 GLU E O   1 
ATOM   6116  C  CB  . GLU C  3 502 ? 164.486 119.110 89.596  1.00 80.75  ?  530 GLU E CB  1 
ATOM   6117  C  CG  . GLU C  3 502 ? 165.014 118.010 88.690  1.00 80.75  ?  530 GLU E CG  1 
ATOM   6118  C  CD  . GLU C  3 502 ? 164.524 118.145 87.262  1.00 80.75  ?  530 GLU E CD  1 
ATOM   6119  O  OE1 . GLU C  3 502 ? 163.646 118.999 87.013  1.00 80.75  ?  530 GLU E OE1 1 
ATOM   6120  O  OE2 . GLU C  3 502 ? 165.017 117.401 86.388  1.00 80.75  ?  530 GLU E OE2 1 
ATOM   6121  N  N   . CYS C  3 503 ? 164.238 120.160 93.069  1.00 79.78  ?  531 CYS E N   1 
ATOM   6122  C  CA  . CYS C  3 503 ? 163.978 121.335 93.886  1.00 79.78  ?  531 CYS E CA  1 
ATOM   6123  C  C   . CYS C  3 503 ? 164.080 120.960 95.353  1.00 79.78  ?  531 CYS E C   1 
ATOM   6124  O  O   . CYS C  3 503 ? 163.901 119.800 95.732  1.00 79.78  ?  531 CYS E O   1 
ATOM   6125  C  CB  . CYS C  3 503 ? 162.605 121.938 93.595  1.00 79.78  ?  531 CYS E CB  1 
ATOM   6126  S  SG  . CYS C  3 503 ? 162.198 123.261 94.732  1.00 79.78  ?  531 CYS E SG  1 
ATOM   6127  N  N   . GLY C  3 504 ? 164.363 121.969 96.176  1.00 71.88  ?  532 GLY E N   1 
ATOM   6128  C  CA  . GLY C  3 504 ? 164.480 121.801 97.604  1.00 71.88  ?  532 GLY E CA  1 
ATOM   6129  C  C   . GLY C  3 504 ? 163.364 122.506 98.358  1.00 71.88  ?  532 GLY E C   1 
ATOM   6130  O  O   . GLY C  3 504 ? 162.982 123.636 98.063  1.00 71.88  ?  532 GLY E O   1 
ATOM   6131  N  N   . GLY C  3 505 ? 162.851 121.807 99.363  1.00 62.32  ?  533 GLY E N   1 
ATOM   6132  C  CA  . GLY C  3 505 ? 161.758 122.296 100.181 1.00 62.32  ?  533 GLY E CA  1 
ATOM   6133  C  C   . GLY C  3 505 ? 162.277 122.886 101.475 1.00 62.32  ?  533 GLY E C   1 
ATOM   6134  O  O   . GLY C  3 505 ? 163.237 123.653 101.497 1.00 62.32  ?  533 GLY E O   1 
ATOM   6135  N  N   . LEU C  3 506 ? 161.621 122.521 102.574 1.00 52.16  ?  534 LEU E N   1 
ATOM   6136  C  CA  . LEU C  3 506 ? 161.946 123.109 103.862 1.00 52.16  ?  534 LEU E CA  1 
ATOM   6137  C  C   . LEU C  3 506 ? 162.707 122.154 104.772 1.00 52.16  ?  534 LEU E C   1 
ATOM   6138  O  O   . LEU C  3 506 ? 163.778 122.498 105.263 1.00 52.16  ?  534 LEU E O   1 
ATOM   6139  C  CB  . LEU C  3 506 ? 160.676 123.594 104.561 1.00 52.16  ?  534 LEU E CB  1 
ATOM   6140  C  CG  . LEU C  3 506 ? 160.949 124.453 105.792 1.00 52.16  ?  534 LEU E CG  1 
ATOM   6141  C  CD1 . LEU C  3 506 ? 161.650 125.721 105.360 1.00 52.16  ?  534 LEU E CD1 1 
ATOM   6142  C  CD2 . LEU C  3 506 ? 159.678 124.790 106.537 1.00 52.16  ?  534 LEU E CD2 1 
ATOM   6143  N  N   . GLY C  3 507 ? 162.200 120.955 104.997 1.00 48.79  ?  535 GLY E N   1 
ATOM   6144  C  CA  . GLY C  3 507 ? 162.865 120.111 105.968 1.00 48.79  ?  535 GLY E CA  1 
ATOM   6145  C  C   . GLY C  3 507 ? 164.065 119.326 105.492 1.00 48.79  ?  535 GLY E C   1 
ATOM   6146  O  O   . GLY C  3 507 ? 164.572 118.494 106.248 1.00 48.79  ?  535 GLY E O   1 
ATOM   6147  N  N   . SER C  3 508 ? 164.550 119.563 104.275 1.00 59.27  ?  536 SER E N   1 
ATOM   6148  C  CA  . SER C  3 508 ? 165.583 118.716 103.691 1.00 59.27  ?  536 SER E CA  1 
ATOM   6149  C  C   . SER C  3 508 ? 166.945 119.014 104.312 1.00 59.27  ?  536 SER E C   1 
ATOM   6150  O  O   . SER C  3 508 ? 167.363 120.172 104.357 1.00 59.27  ?  536 SER E O   1 
ATOM   6151  C  CB  . SER C  3 508 ? 165.659 118.928 102.186 1.00 59.27  ?  536 SER E CB  1 
ATOM   6152  O  OG  . SER C  3 508 ? 166.131 120.229 101.889 1.00 59.27  ?  536 SER E OG  1 
ATOM   6153  N  N   . PRO C  3 509 ? 167.661 117.992 104.787 1.00 58.01  ?  537 PRO E N   1 
ATOM   6154  C  CA  . PRO C  3 509 ? 169.010 118.212 105.314 1.00 58.01  ?  537 PRO E CA  1 
ATOM   6155  C  C   . PRO C  3 509 ? 170.074 118.412 104.250 1.00 58.01  ?  537 PRO E C   1 
ATOM   6156  O  O   . PRO C  3 509 ? 171.159 118.907 104.579 1.00 58.01  ?  537 PRO E O   1 
ATOM   6157  C  CB  . PRO C  3 509 ? 169.278 116.927 106.110 1.00 58.01  ?  537 PRO E CB  1 
ATOM   6158  C  CG  . PRO C  3 509 ? 168.474 115.904 105.428 1.00 58.01  ?  537 PRO E CG  1 
ATOM   6159  C  CD  . PRO C  3 509 ? 167.230 116.595 104.951 1.00 58.01  ?  537 PRO E CD  1 
ATOM   6160  N  N   . THR C  3 510 ? 169.804 118.051 102.998 1.00 62.58  ?  538 THR E N   1 
ATOM   6161  C  CA  . THR C  3 510 ? 170.789 118.184 101.939 1.00 62.58  ?  538 THR E CA  1 
ATOM   6162  C  C   . THR C  3 510 ? 170.388 119.156 100.844 1.00 62.58  ?  538 THR E C   1 
ATOM   6163  O  O   . THR C  3 510 ? 171.080 119.220 99.822  1.00 62.58  ?  538 THR E O   1 
ATOM   6164  C  CB  . THR C  3 510 ? 171.080 116.820 101.296 1.00 62.58  ?  538 THR E CB  1 
ATOM   6165  O  OG1 . THR C  3 510 ? 169.885 116.307 100.699 1.00 62.58  ?  538 THR E OG1 1 
ATOM   6166  C  CG2 . THR C  3 510 ? 171.578 115.836 102.338 1.00 62.58  ?  538 THR E CG2 1 
ATOM   6167  N  N   . GLY C  3 511 ? 169.299 119.901 101.010 1.00 65.62  ?  539 GLY E N   1 
ATOM   6168  C  CA  . GLY C  3 511 ? 168.883 120.908 100.058 1.00 65.62  ?  539 GLY E CA  1 
ATOM   6169  C  C   . GLY C  3 511 ? 168.066 120.383 98.898  1.00 65.62  ?  539 GLY E C   1 
ATOM   6170  O  O   . GLY C  3 511 ? 167.703 121.168 98.013  1.00 65.62  ?  539 GLY E O   1 
ATOM   6171  N  N   . ARG C  3 512 ? 167.780 119.085 98.861  1.00 68.87  ?  540 ARG E N   1 
ATOM   6172  C  CA  . ARG C  3 512 ? 166.945 118.494 97.827  1.00 68.87  ?  540 ARG E CA  1 
ATOM   6173  C  C   . ARG C  3 512 ? 165.875 117.608 98.452  1.00 68.87  ?  540 ARG E C   1 
ATOM   6174  O  O   . ARG C  3 512 ? 166.063 117.027 99.525  1.00 68.87  ?  540 ARG E O   1 
ATOM   6175  C  CB  . ARG C  3 512 ? 167.769 117.670 96.832  1.00 68.87  ?  540 ARG E CB  1 
ATOM   6176  C  CG  . ARG C  3 512 ? 168.768 118.471 96.029  1.00 68.87  ?  540 ARG E CG  1 
ATOM   6177  C  CD  . ARG C  3 512 ? 168.070 119.429 95.085  1.00 68.87  ?  540 ARG E CD  1 
ATOM   6178  N  NE  . ARG C  3 512 ? 169.023 120.128 94.230  1.00 68.87  ?  540 ARG E NE  1 
ATOM   6179  C  CZ  . ARG C  3 512 ? 168.698 121.099 93.384  1.00 68.87  ?  540 ARG E CZ  1 
ATOM   6180  N  NH1 . ARG C  3 512 ? 167.438 121.497 93.280  1.00 68.87  ?  540 ARG E NH1 1 
ATOM   6181  N  NH2 . ARG C  3 512 ? 169.635 121.677 92.647  1.00 68.87  ?  540 ARG E NH2 1 
ATOM   6182  N  N   . CYS C  3 513 ? 164.751 117.500 97.755  1.00 65.47  ?  541 CYS E N   1 
ATOM   6183  C  CA  . CYS C  3 513 ? 163.638 116.679 98.198  1.00 65.47  ?  541 CYS E CA  1 
ATOM   6184  C  C   . CYS C  3 513 ? 163.801 115.259 97.665  1.00 65.47  ?  541 CYS E C   1 
ATOM   6185  O  O   . CYS C  3 513 ? 164.427 115.027 96.629  1.00 65.47  ?  541 CYS E O   1 
ATOM   6186  C  CB  . CYS C  3 513 ? 162.311 117.276 97.727  1.00 65.47  ?  541 CYS E CB  1 
ATOM   6187  S  SG  . CYS C  3 513 ? 161.980 118.965 98.303  1.00 65.47  ?  541 CYS E SG  1 
ATOM   6188  N  N   . GLU C  3 514 ? 163.227 114.303 98.388  1.00 56.17  ?  542 GLU E N   1 
ATOM   6189  C  CA  . GLU C  3 514 ? 163.373 112.889 98.068  1.00 56.17  ?  542 GLU E CA  1 
ATOM   6190  C  C   . GLU C  3 514 ? 162.035 112.304 97.636  1.00 56.17  ?  542 GLU E C   1 
ATOM   6191  O  O   . GLU C  3 514 ? 161.037 112.424 98.353  1.00 56.17  ?  542 GLU E O   1 
ATOM   6192  C  CB  . GLU C  3 514 ? 163.932 112.120 99.266  1.00 56.17  ?  542 GLU E CB  1 
ATOM   6193  C  CG  . GLU C  3 514 ? 165.371 112.471 99.596  1.00 56.17  ?  542 GLU E CG  1 
ATOM   6194  C  CD  . GLU C  3 514 ? 165.909 111.690 100.776 1.00 56.17  ?  542 GLU E CD  1 
ATOM   6195  O  OE1 . GLU C  3 514 ? 165.126 110.971 101.425 1.00 56.17  ?  542 GLU E OE1 1 
ATOM   6196  O  OE2 . GLU C  3 514 ? 167.121 111.792 101.056 1.00 56.17  -1 542 GLU E OE2 1 
ATOM   6197  N  N   . TRP C  3 515 ? 162.020 111.658 96.474  1.00 54.49  ?  543 TRP E N   1 
ATOM   6198  C  CA  . TRP C  3 515 ? 160.804 111.091 95.902  1.00 54.49  ?  543 TRP E CA  1 
ATOM   6199  C  C   . TRP C  3 515 ? 160.652 109.644 96.351  1.00 54.49  ?  543 TRP E C   1 
ATOM   6200  O  O   . TRP C  3 515 ? 161.302 108.747 95.807  1.00 54.49  ?  543 TRP E O   1 
ATOM   6201  C  CB  . TRP C  3 515 ? 160.828 111.181 94.381  1.00 54.49  ?  543 TRP E CB  1 
ATOM   6202  C  CG  . TRP C  3 515 ? 159.642 110.548 93.755  1.00 54.49  ?  543 TRP E CG  1 
ATOM   6203  C  CD1 . TRP C  3 515 ? 159.599 109.342 93.128  1.00 54.49  ?  543 TRP E CD1 1 
ATOM   6204  C  CD2 . TRP C  3 515 ? 158.314 111.071 93.710  1.00 54.49  ?  543 TRP E CD2 1 
ATOM   6205  N  NE1 . TRP C  3 515 ? 158.328 109.084 92.684  1.00 54.49  ?  543 TRP E NE1 1 
ATOM   6206  C  CE2 . TRP C  3 515 ? 157.519 110.132 93.030  1.00 54.49  ?  543 TRP E CE2 1 
ATOM   6207  C  CE3 . TRP C  3 515 ? 157.720 112.245 94.173  1.00 54.49  ?  543 TRP E CE3 1 
ATOM   6208  C  CZ2 . TRP C  3 515 ? 156.165 110.329 92.804  1.00 54.49  ?  543 TRP E CZ2 1 
ATOM   6209  C  CZ3 . TRP C  3 515 ? 156.374 112.437 93.953  1.00 54.49  ?  543 TRP E CZ3 1 
ATOM   6210  C  CH2 . TRP C  3 515 ? 155.612 111.486 93.273  1.00 54.49  ?  543 TRP E CH2 1 
ATOM   6211  N  N   . ARG C  3 516 ? 159.780 109.419 97.326  1.00 43.66  ?  544 ARG E N   1 
ATOM   6212  C  CA  . ARG C  3 516 ? 159.477 108.087 97.826  1.00 43.66  ?  544 ARG E CA  1 
ATOM   6213  C  C   . ARG C  3 516 ? 158.461 107.455 96.886  1.00 43.66  ?  544 ARG E C   1 
ATOM   6214  O  O   . ARG C  3 516 ? 157.544 108.136 96.416  1.00 43.66  ?  544 ARG E O   1 
ATOM   6215  C  CB  . ARG C  3 516 ? 158.932 108.177 99.255  1.00 43.66  ?  544 ARG E CB  1 
ATOM   6216  C  CG  . ARG C  3 516 ? 158.710 106.873 100.011 1.00 43.66  ?  544 ARG E CG  1 
ATOM   6217  C  CD  . ARG C  3 516 ? 157.276 106.396 99.934  1.00 43.66  ?  544 ARG E CD  1 
ATOM   6218  N  NE  . ARG C  3 516 ? 157.014 105.307 100.861 1.00 43.66  ?  544 ARG E NE  1 
ATOM   6219  C  CZ  . ARG C  3 516 ? 156.496 105.481 102.069 1.00 43.66  ?  544 ARG E CZ  1 
ATOM   6220  N  NH1 . ARG C  3 516 ? 156.159 106.693 102.464 1.00 43.66  ?  544 ARG E NH1 1 
ATOM   6221  N  NH2 . ARG C  3 516 ? 156.286 104.448 102.869 1.00 43.66  ?  544 ARG E NH2 1 
ATOM   6222  N  N   . GLN C  3 517 ? 158.619 106.164 96.614  1.00 49.81  ?  545 GLN E N   1 
ATOM   6223  C  CA  . GLN C  3 517 ? 157.735 105.449 95.703  1.00 49.81  ?  545 GLN E CA  1 
ATOM   6224  C  C   . GLN C  3 517 ? 157.207 104.190 96.375  1.00 49.81  ?  545 GLN E C   1 
ATOM   6225  O  O   . GLN C  3 517 ? 157.962 103.471 97.035  1.00 49.81  ?  545 GLN E O   1 
ATOM   6226  C  CB  . GLN C  3 517 ? 158.455 105.093 94.404  1.00 49.81  ?  545 GLN E CB  1 
ATOM   6227  C  CG  . GLN C  3 517 ? 157.543 104.495 93.353  1.00 49.81  ?  545 GLN E CG  1 
ATOM   6228  C  CD  . GLN C  3 517 ? 158.258 104.203 92.059  1.00 49.81  ?  545 GLN E CD  1 
ATOM   6229  O  OE1 . GLN C  3 517 ? 159.466 104.407 91.942  1.00 49.81  ?  545 GLN E OE1 1 
ATOM   6230  N  NE2 . GLN C  3 517 ? 157.514 103.722 91.072  1.00 49.81  ?  545 GLN E NE2 1 
ATOM   6231  N  N   . GLY C  3 518 ? 155.913 103.928 96.203  1.00 47.71  ?  546 GLY E N   1 
ATOM   6232  C  CA  . GLY C  3 518 ? 155.286 102.781 96.826  1.00 47.71  ?  546 GLY E CA  1 
ATOM   6233  C  C   . GLY C  3 518 ? 154.983 101.641 95.878  1.00 47.71  ?  546 GLY E C   1 
ATOM   6234  O  O   . GLY C  3 518 ? 155.850 101.214 95.111  1.00 47.71  ?  546 GLY E O   1 
ATOM   6235  N  N   . ASP C  3 519 ? 153.750 101.154 95.912  1.00 49.04  ?  547 ASP E N   1 
ATOM   6236  C  CA  . ASP C  3 519 ? 153.341 99.969  95.165  1.00 49.04  ?  547 ASP E CA  1 
ATOM   6237  C  C   . ASP C  3 519 ? 151.958 100.228 94.578  1.00 49.04  ?  547 ASP E C   1 
ATOM   6238  O  O   . ASP C  3 519 ? 151.438 101.346 94.638  1.00 49.04  ?  547 ASP E O   1 
ATOM   6239  C  CB  . ASP C  3 519 ? 153.365 98.728  96.057  1.00 49.04  ?  547 ASP E CB  1 
ATOM   6240  C  CG  . ASP C  3 519 ? 152.578 98.916  97.346  1.00 49.04  ?  547 ASP E CG  1 
ATOM   6241  O  OD1 . ASP C  3 519 ? 152.137 100.049 97.627  1.00 49.04  ?  547 ASP E OD1 1 
ATOM   6242  O  OD2 . ASP C  3 519 ? 152.394 97.927  98.084  1.00 49.04  ?  547 ASP E OD2 1 
ATOM   6243  N  N   . GLY C  3 520 ? 151.363 99.182  94.010  1.00 53.51  ?  548 GLY E N   1 
ATOM   6244  C  CA  . GLY C  3 520 ? 150.046 99.305  93.415  1.00 53.51  ?  548 GLY E CA  1 
ATOM   6245  C  C   . GLY C  3 520 ? 149.026 98.325  93.959  1.00 53.51  ?  548 GLY E C   1 
ATOM   6246  O  O   . GLY C  3 520 ? 148.221 97.779  93.200  1.00 53.51  ?  548 GLY E O   1 
ATOM   6247  N  N   . LYS C  3 521 ? 149.037 98.097  95.272  1.00 50.54  ?  549 LYS E N   1 
ATOM   6248  C  CA  . LYS C  3 521 ? 148.188 97.090  95.895  1.00 50.54  ?  549 LYS E CA  1 
ATOM   6249  C  C   . LYS C  3 521 ? 146.921 97.688  96.501  1.00 50.54  ?  549 LYS E C   1 
ATOM   6250  O  O   . LYS C  3 521 ? 146.475 97.247  97.565  1.00 50.54  ?  549 LYS E O   1 
ATOM   6251  C  CB  . LYS C  3 521 ? 148.971 96.322  96.959  1.00 50.54  ?  549 LYS E CB  1 
ATOM   6252  C  CG  . LYS C  3 521 ? 150.102 95.464  96.423  1.00 50.54  ?  549 LYS E CG  1 
ATOM   6253  C  CD  . LYS C  3 521 ? 150.798 94.723  97.555  1.00 50.54  ?  549 LYS E CD  1 
ATOM   6254  C  CE  . LYS C  3 521 ? 151.962 93.893  97.042  1.00 50.54  ?  549 LYS E CE  1 
ATOM   6255  N  NZ  . LYS C  3 521 ? 152.668 93.184  98.145  1.00 50.54  ?  549 LYS E NZ  1 
ATOM   6256  N  N   . GLY C  3 522 ? 146.339 98.693  95.853  1.00 40.50  ?  550 GLY E N   1 
ATOM   6257  C  CA  . GLY C  3 522 ? 145.129 99.300  96.374  1.00 40.50  ?  550 GLY E CA  1 
ATOM   6258  C  C   . GLY C  3 522 ? 145.441 100.386 97.389  1.00 40.50  ?  550 GLY E C   1 
ATOM   6259  O  O   . GLY C  3 522 ? 146.459 101.071 97.308  1.00 40.50  ?  550 GLY E O   1 
ATOM   6260  N  N   . ILE C  3 523 ? 144.538 100.547 98.354  1.00 37.70  ?  551 ILE E N   1 
ATOM   6261  C  CA  . ILE C  3 523 ? 144.753 101.465 99.469  1.00 37.70  ?  551 ILE E CA  1 
ATOM   6262  C  C   . ILE C  3 523 ? 145.841 100.851 100.344 1.00 37.70  ?  551 ILE E C   1 
ATOM   6263  O  O   . ILE C  3 523 ? 145.626 99.827  100.992 1.00 37.70  ?  551 ILE E O   1 
ATOM   6264  C  CB  . ILE C  3 523 ? 143.465 101.722 100.251 1.00 37.70  ?  551 ILE E CB  1 
ATOM   6265  C  CG1 . ILE C  3 523 ? 142.481 102.491 99.379  1.00 37.70  ?  551 ILE E CG1 1 
ATOM   6266  C  CG2 . ILE C  3 523 ? 143.742 102.487 101.516 1.00 37.70  ?  551 ILE E CG2 1 
ATOM   6267  C  CD1 . ILE C  3 523 ? 141.123 102.626 99.980  1.00 37.70  ?  551 ILE E CD1 1 
ATOM   6268  N  N   . THR C  3 524 ? 147.027 101.456 100.338 1.00 37.32  ?  552 THR E N   1 
ATOM   6269  C  CA  . THR C  3 524 ? 148.205 100.888 100.977 1.00 37.32  ?  552 THR E CA  1 
ATOM   6270  C  C   . THR C  3 524 ? 148.858 101.903 101.899 1.00 37.32  ?  552 THR E C   1 
ATOM   6271  O  O   . THR C  3 524 ? 148.732 103.115 101.720 1.00 37.32  ?  552 THR E O   1 
ATOM   6272  C  CB  . THR C  3 524 ? 149.245 100.431 99.949  1.00 37.32  ?  552 THR E CB  1 
ATOM   6273  O  OG1 . THR C  3 524 ? 149.613 101.540 99.122  1.00 37.32  ?  552 THR E OG1 1 
ATOM   6274  C  CG2 . THR C  3 524 ? 148.712 99.311  99.093  1.00 37.32  ?  552 THR E CG2 1 
ATOM   6275  N  N   . ARG C  3 525 ? 149.593 101.383 102.879 1.00 37.47  ?  553 ARG E N   1 
ATOM   6276  C  CA  . ARG C  3 525 ? 150.453 102.201 103.719 1.00 37.47  ?  553 ARG E CA  1 
ATOM   6277  C  C   . ARG C  3 525 ? 151.702 102.673 102.992 1.00 37.47  ?  553 ARG E C   1 
ATOM   6278  O  O   . ARG C  3 525 ? 152.362 103.601 103.467 1.00 37.47  ?  553 ARG E O   1 
ATOM   6279  C  CB  . ARG C  3 525 ? 150.867 101.416 104.961 1.00 37.47  ?  553 ARG E CB  1 
ATOM   6280  C  CG  . ARG C  3 525 ? 149.738 101.113 105.919 1.00 37.47  ?  553 ARG E CG  1 
ATOM   6281  C  CD  . ARG C  3 525 ? 150.243 100.283 107.083 1.00 37.47  ?  553 ARG E CD  1 
ATOM   6282  N  NE  . ARG C  3 525 ? 149.178 99.925  108.012 1.00 37.47  ?  553 ARG E NE  1 
ATOM   6283  C  CZ  . ARG C  3 525 ? 148.845 100.645 109.078 1.00 37.47  ?  553 ARG E CZ  1 
ATOM   6284  N  NH1 . ARG C  3 525 ? 149.503 101.762 109.357 1.00 37.47  ?  553 ARG E NH1 1 
ATOM   6285  N  NH2 . ARG C  3 525 ? 147.861 100.245 109.871 1.00 37.47  ?  553 ARG E NH2 1 
ATOM   6286  N  N   . ASN C  3 526 ? 152.046 102.053 101.873 1.00 40.57  ?  554 ASN E N   1 
ATOM   6287  C  CA  . ASN C  3 526 ? 153.233 102.391 101.098 1.00 40.57  ?  554 ASN E CA  1 
ATOM   6288  C  C   . ASN C  3 526 ? 152.773 103.211 99.898  1.00 40.57  ?  554 ASN E C   1 
ATOM   6289  O  O   . ASN C  3 526 ? 152.594 102.675 98.802  1.00 40.57  ?  554 ASN E O   1 
ATOM   6290  C  CB  . ASN C  3 526 ? 153.967 101.123 100.671 1.00 40.57  ?  554 ASN E CB  1 
ATOM   6291  C  CG  . ASN C  3 526 ? 155.351 101.399 100.125 1.00 40.57  ?  554 ASN E CG  1 
ATOM   6292  O  OD1 . ASN C  3 526 ? 155.791 102.544 100.057 1.00 40.57  ?  554 ASN E OD1 1 
ATOM   6293  N  ND2 . ASN C  3 526 ? 156.050 100.342 99.735  1.00 40.57  ?  554 ASN E ND2 1 
ATOM   6294  N  N   . PHE C  3 527 ? 152.587 104.506 100.103 1.00 33.66  ?  555 PHE E N   1 
ATOM   6295  C  CA  . PHE C  3 527 ? 152.091 105.405 99.072  1.00 33.66  ?  555 PHE E CA  1 
ATOM   6296  C  C   . PHE C  3 527 ? 153.202 106.356 98.644  1.00 33.66  ?  555 PHE E C   1 
ATOM   6297  O  O   . PHE C  3 527 ? 153.962 106.868 99.464  1.00 33.66  ?  555 PHE E O   1 
ATOM   6298  C  CB  . PHE C  3 527 ? 150.846 106.159 99.560  1.00 33.66  ?  555 PHE E CB  1 
ATOM   6299  C  CG  . PHE C  3 527 ? 151.068 107.009 100.787 1.00 33.66  ?  555 PHE E CG  1 
ATOM   6300  C  CD1 . PHE C  3 527 ? 150.931 106.471 102.052 1.00 33.66  ?  555 PHE E CD1 1 
ATOM   6301  C  CD2 . PHE C  3 527 ? 151.354 108.355 100.672 1.00 33.66  ?  555 PHE E CD2 1 
ATOM   6302  C  CE1 . PHE C  3 527 ? 151.118 107.247 103.170 1.00 33.66  ?  555 PHE E CE1 1 
ATOM   6303  C  CE2 . PHE C  3 527 ? 151.540 109.132 101.790 1.00 33.66  ?  555 PHE E CE2 1 
ATOM   6304  C  CZ  . PHE C  3 527 ? 151.420 108.577 103.038 1.00 33.66  ?  555 PHE E CZ  1 
ATOM   6305  N  N   . SER C  3 528 ? 153.286 106.592 97.343  1.00 39.05  ?  556 SER E N   1 
ATOM   6306  C  CA  . SER C  3 528 ? 154.348 107.399 96.766  1.00 39.05  ?  556 SER E CA  1 
ATOM   6307  C  C   . SER C  3 528 ? 154.116 108.875 97.050  1.00 39.05  ?  556 SER E C   1 
ATOM   6308  O  O   . SER C  3 528 ? 153.000 109.380 96.923  1.00 39.05  ?  556 SER E O   1 
ATOM   6309  C  CB  . SER C  3 528 ? 154.438 107.168 95.261  1.00 39.05  ?  556 SER E CB  1 
ATOM   6310  O  OG  . SER C  3 528 ? 153.259 107.607 94.623  1.00 39.05  ?  556 SER E OG  1 
ATOM   6311  N  N   . THR C  3 529 ? 155.190 109.567 97.422  1.00 40.81  ?  557 THR E N   1 
ATOM   6312  C  CA  . THR C  3 529 ? 155.104 110.959 97.847  1.00 40.81  ?  557 THR E CA  1 
ATOM   6313  C  C   . THR C  3 529 ? 156.446 111.642 97.605  1.00 40.81  ?  557 THR E C   1 
ATOM   6314  O  O   . THR C  3 529 ? 157.391 111.038 97.093  1.00 40.81  ?  557 THR E O   1 
ATOM   6315  C  CB  . THR C  3 529 ? 154.688 111.058 99.315  1.00 40.81  ?  557 THR E CB  1 
ATOM   6316  O  OG1 . THR C  3 529 ? 154.560 112.433 99.677  1.00 40.81  ?  557 THR E OG1 1 
ATOM   6317  C  CG2 . THR C  3 529 ? 155.716 110.410 100.204 1.00 40.81  ?  557 THR E CG2 1 
ATOM   6318  N  N   . CYS C  3 530 ? 156.522 112.915 97.986  1.00 49.18  ?  558 CYS E N   1 
ATOM   6319  C  CA  . CYS C  3 530 ? 157.728 113.733 97.859  1.00 49.18  ?  558 CYS E CA  1 
ATOM   6320  C  C   . CYS C  3 530 ? 158.055 114.317 99.227  1.00 49.18  ?  558 CYS E C   1 
ATOM   6321  O  O   . CYS C  3 530 ? 157.513 115.358 99.607  1.00 49.18  ?  558 CYS E O   1 
ATOM   6322  C  CB  . CYS C  3 530 ? 157.532 114.835 96.826  1.00 49.18  ?  558 CYS E CB  1 
ATOM   6323  S  SG  . CYS C  3 530 ? 158.918 115.982 96.669  1.00 49.18  ?  558 CYS E SG  1 
ATOM   6324  N  N   . SER C  3 531 ? 158.955 113.668 99.956  1.00 49.59  ?  559 SER E N   1 
ATOM   6325  C  CA  . SER C  3 531 ? 159.241 114.034 101.331 1.00 49.59  ?  559 SER E CA  1 
ATOM   6326  C  C   . SER C  3 531 ? 160.704 114.420 101.480 1.00 49.59  ?  559 SER E C   1 
ATOM   6327  O  O   . SER C  3 531 ? 161.556 113.926 100.736 1.00 49.59  ?  559 SER E O   1 
ATOM   6328  C  CB  . SER C  3 531 ? 158.916 112.873 102.280 1.00 49.59  ?  559 SER E CB  1 
ATOM   6329  O  OG  . SER C  3 531 ? 159.793 111.785 102.069 1.00 49.59  ?  559 SER E OG  1 
ATOM   6330  N  N   . PRO C  3 532 ? 161.021 115.325 102.416 1.00 48.89  ?  560 PRO E N   1 
ATOM   6331  C  CA  . PRO C  3 532 ? 162.422 115.713 102.628 1.00 48.89  ?  560 PRO E CA  1 
ATOM   6332  C  C   . PRO C  3 532 ? 163.319 114.583 103.113 1.00 48.89  ?  560 PRO E C   1 
ATOM   6333  O  O   . PRO C  3 532 ? 164.320 114.264 102.466 1.00 48.89  ?  560 PRO E O   1 
ATOM   6334  C  CB  . PRO C  3 532 ? 162.313 116.817 103.684 1.00 48.89  ?  560 PRO E CB  1 
ATOM   6335  C  CG  . PRO C  3 532 ? 160.945 117.349 103.534 1.00 48.89  ?  560 PRO E CG  1 
ATOM   6336  C  CD  . PRO C  3 532 ? 160.099 116.181 103.182 1.00 48.89  ?  560 PRO E CD  1 
ATOM   6337  N  N   . SER C  3 533 ? 162.968 113.962 104.236 1.00 50.71  ?  561 SER E N   1 
ATOM   6338  C  CA  . SER C  3 533 ? 163.750 112.869 104.813 1.00 50.71  ?  561 SER E CA  1 
ATOM   6339  C  C   . SER C  3 533 ? 162.875 111.624 104.837 1.00 50.71  ?  561 SER E C   1 
ATOM   6340  O  O   . SER C  3 533 ? 162.014 111.479 105.709 1.00 50.71  ?  561 SER E O   1 
ATOM   6341  C  CB  . SER C  3 533 ? 164.232 113.223 106.215 1.00 50.71  ?  561 SER E CB  1 
ATOM   6342  O  OG  . SER C  3 533 ? 165.114 114.327 106.194 1.00 50.71  ?  561 SER E OG  1 
ATOM   6343  N  N   . THR C  3 534 ? 163.115 110.708 103.893 1.00 52.22  ?  562 THR E N   1 
ATOM   6344  C  CA  . THR C  3 534 ? 162.309 109.495 103.777 1.00 52.22  ?  562 THR E CA  1 
ATOM   6345  C  C   . THR C  3 534 ? 162.495 108.535 104.937 1.00 52.22  ?  562 THR E C   1 
ATOM   6346  O  O   . THR C  3 534 ? 161.697 107.603 105.072 1.00 52.22  ?  562 THR E O   1 
ATOM   6347  C  CB  . THR C  3 534 ? 162.615 108.759 102.473 1.00 52.22  ?  562 THR E CB  1 
ATOM   6348  O  OG1 . THR C  3 534 ? 164.021 108.499 102.384 1.00 52.22  ?  562 THR E OG1 1 
ATOM   6349  C  CG2 . THR C  3 534 ? 162.149 109.561 101.272 1.00 52.22  ?  562 THR E CG2 1 
ATOM   6350  N  N   . LYS C  3 535 ? 163.514 108.721 105.765 1.00 48.69  ?  563 LYS E N   1 
ATOM   6351  C  CA  . LYS C  3 535 ? 163.601 107.996 107.017 1.00 48.69  ?  563 LYS E CA  1 
ATOM   6352  C  C   . LYS C  3 535 ? 162.742 108.613 108.106 1.00 48.69  ?  563 LYS E C   1 
ATOM   6353  O  O   . LYS C  3 535 ? 162.497 107.956 109.122 1.00 48.69  ?  563 LYS E O   1 
ATOM   6354  C  CB  . LYS C  3 535 ? 165.054 107.931 107.495 1.00 48.69  ?  563 LYS E CB  1 
ATOM   6355  C  CG  . LYS C  3 535 ? 165.637 109.276 107.874 1.00 48.69  ?  563 LYS E CG  1 
ATOM   6356  C  CD  . LYS C  3 535 ? 167.062 109.133 108.368 1.00 48.69  ?  563 LYS E CD  1 
ATOM   6357  C  CE  . LYS C  3 535 ? 168.009 108.828 107.222 1.00 48.69  ?  563 LYS E CE  1 
ATOM   6358  N  NZ  . LYS C  3 535 ? 168.106 109.973 106.277 1.00 48.69  ?  563 LYS E NZ  1 
ATOM   6359  N  N   . THR C  3 536 ? 162.282 109.851 107.924 1.00 45.87  ?  564 THR E N   1 
ATOM   6360  C  CA  . THR C  3 536 ? 161.571 110.560 108.978 1.00 45.87  ?  564 THR E CA  1 
ATOM   6361  C  C   . THR C  3 536 ? 160.237 111.162 108.553 1.00 45.87  ?  564 THR E C   1 
ATOM   6362  O  O   . THR C  3 536 ? 159.271 111.049 109.317 1.00 45.87  ?  564 THR E O   1 
ATOM   6363  C  CB  . THR C  3 536 ? 162.468 111.672 109.550 1.00 45.87  ?  564 THR E CB  1 
ATOM   6364  O  OG1 . THR C  3 536 ? 163.714 111.102 109.961 1.00 45.87  ?  564 THR E OG1 1 
ATOM   6365  C  CG2 . THR C  3 536 ? 161.838 112.331 110.764 1.00 45.87  ?  564 THR E CG2 1 
ATOM   6366  N  N   . CYS C  3 537 ? 160.122 111.755 107.366 1.00 46.65  ?  565 CYS E N   1 
ATOM   6367  C  CA  . CYS C  3 537 ? 158.857 112.436 107.107 1.00 46.65  ?  565 CYS E CA  1 
ATOM   6368  C  C   . CYS C  3 537 ? 157.713 111.428 106.935 1.00 46.65  ?  565 CYS E C   1 
ATOM   6369  O  O   . CYS C  3 537 ? 156.827 111.412 107.802 1.00 46.65  ?  565 CYS E O   1 
ATOM   6370  C  CB  . CYS C  3 537 ? 158.987 113.428 105.937 1.00 46.65  ?  565 CYS E CB  1 
ATOM   6371  S  SG  . CYS C  3 537 ? 157.457 114.234 105.370 1.00 46.65  ?  565 CYS E SG  1 
ATOM   6372  N  N   . PRO C  3 538 ? 157.673 110.534 105.890 1.00 43.17  ?  566 PRO E N   1 
ATOM   6373  C  CA  . PRO C  3 538 ? 156.422 109.750 105.799 1.00 43.17  ?  566 PRO E CA  1 
ATOM   6374  C  C   . PRO C  3 538 ? 156.484 108.475 106.633 1.00 43.17  ?  566 PRO E C   1 
ATOM   6375  O  O   . PRO C  3 538 ? 156.495 107.342 106.147 1.00 43.17  ?  566 PRO E O   1 
ATOM   6376  C  CB  . PRO C  3 538 ? 156.321 109.479 104.299 1.00 43.17  ?  566 PRO E CB  1 
ATOM   6377  C  CG  . PRO C  3 538 ? 157.739 109.313 103.895 1.00 43.17  ?  566 PRO E CG  1 
ATOM   6378  C  CD  . PRO C  3 538 ? 158.583 110.172 104.786 1.00 43.17  ?  566 PRO E CD  1 
ATOM   6379  N  N   . ASP C  3 539 ? 156.506 108.665 107.947 1.00 46.96  ?  567 ASP E N   1 
ATOM   6380  C  CA  . ASP C  3 539 ? 156.808 107.615 108.904 1.00 46.96  ?  567 ASP E CA  1 
ATOM   6381  C  C   . ASP C  3 539 ? 155.633 107.219 109.781 1.00 46.96  ?  567 ASP E C   1 
ATOM   6382  O  O   . ASP C  3 539 ? 155.800 106.368 110.658 1.00 46.96  ?  567 ASP E O   1 
ATOM   6383  C  CB  . ASP C  3 539 ? 157.967 108.075 109.795 1.00 46.96  ?  567 ASP E CB  1 
ATOM   6384  C  CG  . ASP C  3 539 ? 157.736 109.473 110.356 1.00 46.96  ?  567 ASP E CG  1 
ATOM   6385  O  OD1 . ASP C  3 539 ? 156.713 110.093 109.993 1.00 46.96  ?  567 ASP E OD1 1 
ATOM   6386  O  OD2 . ASP C  3 539 ? 158.578 109.978 111.128 1.00 46.96  -1 567 ASP E OD2 1 
ATOM   6387  N  N   . GLY C  3 540 ? 154.467 107.823 109.591 1.00 45.07  ?  568 GLY E N   1 
ATOM   6388  C  CA  . GLY C  3 540 ? 153.348 107.579 110.472 1.00 45.07  ?  568 GLY E CA  1 
ATOM   6389  C  C   . GLY C  3 540 ? 153.444 108.242 111.825 1.00 45.07  ?  568 GLY E C   1 
ATOM   6390  O  O   . GLY C  3 540 ? 152.603 107.973 112.689 1.00 45.07  ?  568 GLY E O   1 
ATOM   6391  N  N   . HIS C  3 541 ? 154.436 109.100 112.043 1.00 46.91  ?  569 HIS E N   1 
ATOM   6392  C  CA  . HIS C  3 541 ? 154.605 109.770 113.322 1.00 46.91  ?  569 HIS E CA  1 
ATOM   6393  C  C   . HIS C  3 541 ? 155.059 111.203 113.098 1.00 46.91  ?  569 HIS E C   1 
ATOM   6394  O  O   . HIS C  3 541 ? 155.864 111.488 112.206 1.00 46.91  ?  569 HIS E O   1 
ATOM   6395  C  CB  . HIS C  3 541 ? 155.608 109.040 114.215 1.00 46.91  ?  569 HIS E CB  1 
ATOM   6396  C  CG  . HIS C  3 541 ? 155.833 109.710 115.531 1.00 46.91  ?  569 HIS E CG  1 
ATOM   6397  N  ND1 . HIS C  3 541 ? 154.880 109.732 116.524 1.00 46.91  ?  569 HIS E ND1 1 
ATOM   6398  C  CD2 . HIS C  3 541 ? 156.897 110.392 116.014 1.00 46.91  ?  569 HIS E CD2 1 
ATOM   6399  C  CE1 . HIS C  3 541 ? 155.347 110.398 117.565 1.00 46.91  ?  569 HIS E CE1 1 
ATOM   6400  N  NE2 . HIS C  3 541 ? 156.571 110.806 117.282 1.00 46.91  ?  569 HIS E NE2 1 
ATOM   6401  N  N   . CYS C  3 542 ? 154.534 112.102 113.923 1.00 46.42  ?  570 CYS E N   1 
ATOM   6402  C  CA  . CYS C  3 542 ? 154.805 113.532 113.831 1.00 46.42  ?  570 CYS E CA  1 
ATOM   6403  C  C   . CYS C  3 542 ? 155.642 113.931 115.041 1.00 46.42  ?  570 CYS E C   1 
ATOM   6404  O  O   . CYS C  3 542 ? 155.100 114.314 116.081 1.00 46.42  ?  570 CYS E O   1 
ATOM   6405  C  CB  . CYS C  3 542 ? 153.501 114.315 113.771 1.00 46.42  ?  570 CYS E CB  1 
ATOM   6406  S  SG  . CYS C  3 542 ? 153.687 116.072 113.486 1.00 46.42  ?  570 CYS E SG  1 
ATOM   6407  N  N   . ASP C  3 543 ? 156.963 113.848 114.898 1.00 44.74  ?  571 ASP E N   1 
ATOM   6408  C  CA  . ASP C  3 543 ? 157.880 114.174 115.979 1.00 44.74  ?  571 ASP E CA  1 
ATOM   6409  C  C   . ASP C  3 543 ? 157.985 115.690 116.135 1.00 44.74  ?  571 ASP E C   1 
ATOM   6410  O  O   . ASP C  3 543 ? 157.398 116.459 115.371 1.00 44.74  ?  571 ASP E O   1 
ATOM   6411  C  CB  . ASP C  3 543 ? 159.236 113.511 115.743 1.00 44.74  ?  571 ASP E CB  1 
ATOM   6412  C  CG  . ASP C  3 543 ? 159.800 113.815 114.380 1.00 44.74  ?  571 ASP E CG  1 
ATOM   6413  O  OD1 . ASP C  3 543 ? 159.076 114.415 113.573 1.00 44.74  ?  571 ASP E OD1 1 
ATOM   6414  O  OD2 . ASP C  3 543 ? 160.965 113.456 114.116 1.00 44.74  ?  571 ASP E OD2 1 
ATOM   6415  N  N   . VAL C  3 544 ? 158.770 116.135 117.112 1.00 43.01  ?  572 VAL E N   1 
ATOM   6416  C  CA  . VAL C  3 544 ? 158.600 117.494 117.600 1.00 43.01  ?  572 VAL E CA  1 
ATOM   6417  C  C   . VAL C  3 544 ? 159.311 118.497 116.686 1.00 43.01  ?  572 VAL E C   1 
ATOM   6418  O  O   . VAL C  3 544 ? 159.034 119.700 116.736 1.00 43.01  ?  572 VAL E O   1 
ATOM   6419  C  CB  . VAL C  3 544 ? 159.075 117.547 119.063 1.00 43.01  ?  572 VAL E CB  1 
ATOM   6420  C  CG1 . VAL C  3 544 ? 158.593 118.809 119.775 1.00 43.01  ?  572 VAL E CG1 1 
ATOM   6421  C  CG2 . VAL C  3 544 ? 158.599 116.316 119.806 1.00 43.01  ?  572 VAL E CG2 1 
ATOM   6422  N  N   . VAL C  3 545 ? 160.181 118.025 115.795 1.00 41.62  ?  573 VAL E N   1 
ATOM   6423  C  CA  . VAL C  3 545 ? 160.771 118.913 114.797 1.00 41.62  ?  573 VAL E CA  1 
ATOM   6424  C  C   . VAL C  3 545 ? 159.750 119.245 113.714 1.00 41.62  ?  573 VAL E C   1 
ATOM   6425  O  O   . VAL C  3 545 ? 159.624 120.399 113.287 1.00 41.62  ?  573 VAL E O   1 
ATOM   6426  C  CB  . VAL C  3 545 ? 162.036 118.275 114.202 1.00 41.62  ?  573 VAL E CB  1 
ATOM   6427  C  CG1 . VAL C  3 545 ? 162.631 119.152 113.122 1.00 41.62  ?  573 VAL E CG1 1 
ATOM   6428  C  CG2 . VAL C  3 545 ? 163.041 118.015 115.289 1.00 41.62  ?  573 VAL E CG2 1 
ATOM   6429  N  N   . GLU C  3 546 ? 158.985 118.241 113.276 1.00 44.08  ?  574 GLU E N   1 
ATOM   6430  C  CA  . GLU C  3 546 ? 158.056 118.396 112.160 1.00 44.08  ?  574 GLU E CA  1 
ATOM   6431  C  C   . GLU C  3 546 ? 156.823 119.219 112.507 1.00 44.08  ?  574 GLU E C   1 
ATOM   6432  O  O   . GLU C  3 546 ? 156.121 119.664 111.595 1.00 44.08  ?  574 GLU E O   1 
ATOM   6433  C  CB  . GLU C  3 546 ? 157.613 117.020 111.661 1.00 44.08  ?  574 GLU E CB  1 
ATOM   6434  C  CG  . GLU C  3 546 ? 158.669 116.245 110.898 1.00 44.08  ?  574 GLU E CG  1 
ATOM   6435  C  CD  . GLU C  3 546 ? 158.267 114.800 110.662 1.00 44.08  ?  574 GLU E CD  1 
ATOM   6436  O  OE1 . GLU C  3 546 ? 157.257 114.358 111.243 1.00 44.08  ?  574 GLU E OE1 1 
ATOM   6437  O  OE2 . GLU C  3 546 ? 158.974 114.090 109.927 1.00 44.08  ?  574 GLU E OE2 1 
ATOM   6438  N  N   . THR C  3 547 ? 156.532 119.425 113.788 1.00 41.18  ?  575 THR E N   1 
ATOM   6439  C  CA  . THR C  3 547 ? 155.320 120.121 114.197 1.00 41.18  ?  575 THR E CA  1 
ATOM   6440  C  C   . THR C  3 547 ? 155.571 121.554 114.641 1.00 41.18  ?  575 THR E C   1 
ATOM   6441  O  O   . THR C  3 547 ? 154.663 122.184 115.192 1.00 41.18  ?  575 THR E O   1 
ATOM   6442  C  CB  . THR C  3 547 ? 154.621 119.352 115.319 1.00 41.18  ?  575 THR E CB  1 
ATOM   6443  O  OG1 . THR C  3 547 ? 153.380 119.990 115.632 1.00 41.18  ?  575 THR E OG1 1 
ATOM   6444  C  CG2 . THR C  3 547 ? 155.488 119.304 116.561 1.00 41.18  ?  575 THR E CG2 1 
ATOM   6445  N  N   . GLN C  3 548 ? 156.773 122.085 114.412 1.00 45.59  ?  576 GLN E N   1 
ATOM   6446  C  CA  . GLN C  3 548 ? 157.054 123.472 114.767 1.00 45.59  ?  576 GLN E CA  1 
ATOM   6447  C  C   . GLN C  3 548 ? 156.316 124.424 113.837 1.00 45.59  ?  576 GLN E C   1 
ATOM   6448  O  O   . GLN C  3 548 ? 155.476 125.217 114.275 1.00 45.59  ?  576 GLN E O   1 
ATOM   6449  C  CB  . GLN C  3 548 ? 158.559 123.730 114.717 1.00 45.59  ?  576 GLN E CB  1 
ATOM   6450  C  CG  . GLN C  3 548 ? 159.386 122.905 115.692 1.00 45.59  ?  576 GLN E CG  1 
ATOM   6451  C  CD  . GLN C  3 548 ? 159.148 123.285 117.135 1.00 45.59  ?  576 GLN E CD  1 
ATOM   6452  O  OE1 . GLN C  3 548 ? 158.967 124.458 117.457 1.00 45.59  ?  576 GLN E OE1 1 
ATOM   6453  N  NE2 . GLN C  3 548 ? 159.161 122.295 118.018 1.00 45.59  ?  576 GLN E NE2 1 
ATOM   6454  N  N   . ASP C  3 549 ? 156.614 124.356 112.546 1.00 47.39  ?  577 ASP E N   1 
ATOM   6455  C  CA  . ASP C  3 549 ? 155.861 125.070 111.528 1.00 47.39  ?  577 ASP E CA  1 
ATOM   6456  C  C   . ASP C  3 549 ? 155.302 124.050 110.555 1.00 47.39  ?  577 ASP E C   1 
ATOM   6457  O  O   . ASP C  3 549 ? 156.023 123.150 110.115 1.00 47.39  ?  577 ASP E O   1 
ATOM   6458  C  CB  . ASP C  3 549 ? 156.729 126.082 110.781 1.00 47.39  ?  577 ASP E CB  1 
ATOM   6459  C  CG  . ASP C  3 549 ? 157.123 127.259 111.645 1.00 47.39  ?  577 ASP E CG  1 
ATOM   6460  O  OD1 . ASP C  3 549 ? 156.366 127.588 112.580 1.00 47.39  ?  577 ASP E OD1 1 
ATOM   6461  O  OD2 . ASP C  3 549 ? 158.186 127.861 111.385 1.00 47.39  ?  577 ASP E OD2 1 
ATOM   6462  N  N   . ILE C  3 550 ? 154.022 124.183 110.214 1.00 44.27  ?  578 ILE E N   1 
ATOM   6463  C  CA  . ILE C  3 550 ? 153.410 123.166 109.371 1.00 44.27  ?  578 ILE E CA  1 
ATOM   6464  C  C   . ILE C  3 550 ? 153.650 123.560 107.922 1.00 44.27  ?  578 ILE E C   1 
ATOM   6465  O  O   . ILE C  3 550 ? 152.780 124.123 107.252 1.00 44.27  ?  578 ILE E O   1 
ATOM   6466  C  CB  . ILE C  3 550 ? 151.914 123.001 109.684 1.00 44.27  ?  578 ILE E CB  1 
ATOM   6467  C  CG1 . ILE C  3 550 ? 151.725 122.764 111.181 1.00 44.27  ?  578 ILE E CG1 1 
ATOM   6468  C  CG2 . ILE C  3 550 ? 151.342 121.789 108.960 1.00 44.27  ?  578 ILE E CG2 1 
ATOM   6469  C  CD1 . ILE C  3 550 ? 150.290 122.849 111.638 1.00 44.27  ?  578 ILE E CD1 1 
ATOM   6470  N  N   . ASN C  3 551 ? 154.868 123.305 107.466 1.00 41.38  ?  579 ASN E N   1 
ATOM   6471  C  CA  . ASN C  3 551 ? 155.235 123.232 106.068 1.00 41.38  ?  579 ASN E CA  1 
ATOM   6472  C  C   . ASN C  3 551 ? 156.229 122.116 105.827 1.00 41.38  ?  579 ASN E C   1 
ATOM   6473  O  O   . ASN C  3 551 ? 156.521 121.804 104.671 1.00 41.38  ?  579 ASN E O   1 
ATOM   6474  C  CB  . ASN C  3 551 ? 155.842 124.555 105.590 1.00 41.38  ?  579 ASN E CB  1 
ATOM   6475  C  CG  . ASN C  3 551 ? 154.810 125.641 105.413 1.00 41.38  ?  579 ASN E CG  1 
ATOM   6476  O  OD1 . ASN C  3 551 ? 153.745 125.413 104.848 1.00 41.38  ?  579 ASN E OD1 1 
ATOM   6477  N  ND2 . ASN C  3 551 ? 155.117 126.834 105.904 1.00 41.38  ?  579 ASN E ND2 1 
ATOM   6478  N  N   . ILE C  3 552 ? 156.769 121.526 106.891 1.00 40.23  ?  580 ILE E N   1 
ATOM   6479  C  CA  . ILE C  3 552 ? 157.864 120.573 106.774 1.00 40.23  ?  580 ILE E CA  1 
ATOM   6480  C  C   . ILE C  3 552 ? 157.352 119.250 106.233 1.00 40.23  ?  580 ILE E C   1 
ATOM   6481  O  O   . ILE C  3 552 ? 157.775 118.780 105.171 1.00 40.23  ?  580 ILE E O   1 
ATOM   6482  C  CB  . ILE C  3 552 ? 158.530 120.377 108.144 1.00 40.23  ?  580 ILE E CB  1 
ATOM   6483  C  CG1 . ILE C  3 552 ? 158.919 121.723 108.735 1.00 40.23  ?  580 ILE E CG1 1 
ATOM   6484  C  CG2 . ILE C  3 552 ? 159.749 119.499 108.018 1.00 40.23  ?  580 ILE E CG2 1 
ATOM   6485  C  CD1 . ILE C  3 552 ? 159.217 121.650 110.193 1.00 40.23  ?  580 ILE E CD1 1 
ATOM   6486  N  N   . CYS C  3 553 ? 156.428 118.640 106.959 1.00 39.76  ?  581 CYS E N   1 
ATOM   6487  C  CA  . CYS C  3 553 ? 155.938 117.300 106.646 1.00 39.76  ?  581 CYS E CA  1 
ATOM   6488  C  C   . CYS C  3 553 ? 154.447 117.292 106.938 1.00 39.76  ?  581 CYS E C   1 
ATOM   6489  O  O   . CYS C  3 553 ? 154.022 116.878 108.026 1.00 39.76  ?  581 CYS E O   1 
ATOM   6490  C  CB  . CYS C  3 553 ? 156.671 116.247 107.470 1.00 39.76  ?  581 CYS E CB  1 
ATOM   6491  S  SG  . CYS C  3 553 ? 156.331 114.560 107.026 1.00 39.76  ?  581 CYS E SG  1 
ATOM   6492  N  N   . PRO C  3 554 ? 153.617 117.765 106.003 1.00 37.36  ?  582 PRO E N   1 
ATOM   6493  C  CA  . PRO C  3 554 ? 152.182 117.890 106.287 1.00 37.36  ?  582 PRO E CA  1 
ATOM   6494  C  C   . PRO C  3 554 ? 151.467 116.550 106.277 1.00 37.36  ?  582 PRO E C   1 
ATOM   6495  O  O   . PRO C  3 554 ? 150.529 116.325 107.047 1.00 37.36  ?  582 PRO E O   1 
ATOM   6496  C  CB  . PRO C  3 554 ? 151.685 118.802 105.161 1.00 37.36  ?  582 PRO E CB  1 
ATOM   6497  C  CG  . PRO C  3 554 ? 152.625 118.563 104.051 1.00 37.36  ?  582 PRO E CG  1 
ATOM   6498  C  CD  . PRO C  3 554 ? 153.961 118.286 104.668 1.00 37.36  ?  582 PRO E CD  1 
ATOM   6499  N  N   . GLN C  3 555 ? 151.959 115.625 105.454 1.00 36.66  ?  583 GLN E N   1 
ATOM   6500  C  CA  . GLN C  3 555 ? 151.392 114.299 105.253 1.00 36.66  ?  583 GLN E CA  1 
ATOM   6501  C  C   . GLN C  3 555 ? 151.701 113.338 106.390 1.00 36.66  ?  583 GLN E C   1 
ATOM   6502  O  O   . GLN C  3 555 ? 151.538 112.125 106.231 1.00 36.66  ?  583 GLN E O   1 
ATOM   6503  C  CB  . GLN C  3 555 ? 151.902 113.743 103.931 1.00 36.66  ?  583 GLN E CB  1 
ATOM   6504  C  CG  . GLN C  3 555 ? 153.402 113.725 103.875 1.00 36.66  ?  583 GLN E CG  1 
ATOM   6505  C  CD  . GLN C  3 555 ? 153.920 113.444 102.498 1.00 36.66  ?  583 GLN E CD  1 
ATOM   6506  O  OE1 . GLN C  3 555 ? 153.156 113.181 101.578 1.00 36.66  ?  583 GLN E OE1 1 
ATOM   6507  N  NE2 . GLN C  3 555 ? 155.227 113.517 102.336 1.00 36.66  ?  583 GLN E NE2 1 
ATOM   6508  N  N   . ASP C  3 556 ? 152.177 113.851 107.514 1.00 43.39  ?  584 ASP E N   1 
ATOM   6509  C  CA  . ASP C  3 556 ? 152.365 113.089 108.728 1.00 43.39  ?  584 ASP E CA  1 
ATOM   6510  C  C   . ASP C  3 556 ? 151.861 113.961 109.869 1.00 43.39  ?  584 ASP E C   1 
ATOM   6511  O  O   . ASP C  3 556 ? 151.843 113.533 111.024 1.00 43.39  ?  584 ASP E O   1 
ATOM   6512  C  CB  . ASP C  3 556 ? 153.844 112.734 108.894 1.00 43.39  ?  584 ASP E CB  1 
ATOM   6513  C  CG  . ASP C  3 556 ? 154.090 111.633 109.901 1.00 43.39  ?  584 ASP E CG  1 
ATOM   6514  O  OD1 . ASP C  3 556 ? 153.117 111.059 110.426 1.00 43.39  ?  584 ASP E OD1 1 
ATOM   6515  O  OD2 . ASP C  3 556 ? 155.279 111.352 110.182 1.00 43.39  -1 584 ASP E OD2 1 
ATOM   6516  N  N   . CYS C  3 557 ? 151.448 115.202 109.564 1.00 44.04  ?  585 CYS E N   1 
ATOM   6517  C  CA  . CYS C  3 557 ? 151.193 116.138 110.654 1.00 44.04  ?  585 CYS E CA  1 
ATOM   6518  C  C   . CYS C  3 557 ? 149.986 117.058 110.468 1.00 44.04  ?  585 CYS E C   1 
ATOM   6519  O  O   . CYS C  3 557 ? 149.766 117.925 111.321 1.00 44.04  ?  585 CYS E O   1 
ATOM   6520  C  CB  . CYS C  3 557 ? 152.414 117.033 110.900 1.00 44.04  ?  585 CYS E CB  1 
ATOM   6521  S  SG  . CYS C  3 557 ? 153.910 116.204 111.475 1.00 44.04  ?  585 CYS E SG  1 
ATOM   6522  N  N   . LEU C  3 558 ? 149.194 116.926 109.405 1.00 39.01  ?  586 LEU E N   1 
ATOM   6523  C  CA  . LEU C  3 558 ? 148.167 117.934 109.171 1.00 39.01  ?  586 LEU E CA  1 
ATOM   6524  C  C   . LEU C  3 558 ? 146.883 117.597 109.918 1.00 39.01  ?  586 LEU E C   1 
ATOM   6525  O  O   . LEU C  3 558 ? 146.637 116.453 110.306 1.00 39.01  ?  586 LEU E O   1 
ATOM   6526  C  CB  . LEU C  3 558 ? 147.831 118.106 107.687 1.00 39.01  ?  586 LEU E CB  1 
ATOM   6527  C  CG  . LEU C  3 558 ? 146.736 117.216 107.097 1.00 39.01  ?  586 LEU E CG  1 
ATOM   6528  C  CD1 . LEU C  3 558 ? 146.127 117.905 105.905 1.00 39.01  ?  586 LEU E CD1 1 
ATOM   6529  C  CD2 . LEU C  3 558 ? 147.255 115.860 106.703 1.00 39.01  ?  586 LEU E CD2 1 
ATOM   6530  N  N   . ARG C  3 559 ? 146.064 118.626 110.114 1.00 42.62  ?  587 ARG E N   1 
ATOM   6531  C  CA  . ARG C  3 559 ? 144.720 118.511 110.670 1.00 42.62  ?  587 ARG E CA  1 
ATOM   6532  C  C   . ARG C  3 559 ? 143.780 119.131 109.647 1.00 42.62  ?  587 ARG E C   1 
ATOM   6533  O  O   . ARG C  3 559 ? 143.438 120.311 109.742 1.00 42.62  ?  587 ARG E O   1 
ATOM   6534  C  CB  . ARG C  3 559 ? 144.615 119.210 112.014 1.00 42.62  ?  587 ARG E CB  1 
ATOM   6535  C  CG  . ARG C  3 559 ? 145.442 118.562 113.087 1.00 42.62  ?  587 ARG E CG  1 
ATOM   6536  C  CD  . ARG C  3 559 ? 145.328 119.267 114.416 1.00 42.62  ?  587 ARG E CD  1 
ATOM   6537  N  NE  . ARG C  3 559 ? 146.171 118.625 115.419 1.00 42.62  ?  587 ARG E NE  1 
ATOM   6538  C  CZ  . ARG C  3 559 ? 146.316 119.060 116.665 1.00 42.62  ?  587 ARG E CZ  1 
ATOM   6539  N  NH1 . ARG C  3 559 ? 145.670 120.144 117.069 1.00 42.62  ?  587 ARG E NH1 1 
ATOM   6540  N  NH2 . ARG C  3 559 ? 147.106 118.412 117.509 1.00 42.62  ?  587 ARG E NH2 1 
ATOM   6541  N  N   . GLY C  3 560 ? 143.363 118.341 108.667 1.00 35.07  ?  588 GLY E N   1 
ATOM   6542  C  CA  . GLY C  3 560 ? 142.552 118.896 107.605 1.00 35.07  ?  588 GLY E CA  1 
ATOM   6543  C  C   . GLY C  3 560 ? 141.654 117.899 106.914 1.00 35.07  ?  588 GLY E C   1 
ATOM   6544  O  O   . GLY C  3 560 ? 141.045 117.042 107.557 1.00 35.07  ?  588 GLY E O   1 
ATOM   6545  N  N   . SER C  3 561 ? 141.567 118.006 105.594 1.00 32.23  ?  589 SER E N   1 
ATOM   6546  C  CA  . SER C  3 561 ? 140.686 117.163 104.808 1.00 32.23  ?  589 SER E CA  1 
ATOM   6547  C  C   . SER C  3 561 ? 141.492 116.450 103.737 1.00 32.23  ?  589 SER E C   1 
ATOM   6548  O  O   . SER C  3 561 ? 142.383 117.038 103.115 1.00 32.23  ?  589 SER E O   1 
ATOM   6549  C  CB  . SER C  3 561 ? 139.567 117.982 104.163 1.00 32.23  ?  589 SER E CB  1 
ATOM   6550  O  OG  . SER C  3 561 ? 140.091 118.882 103.206 1.00 32.23  ?  589 SER E OG  1 
ATOM   6551  N  N   . ILE C  3 562 ? 141.178 115.179 103.533 1.00 26.76  ?  590 ILE E N   1 
ATOM   6552  C  CA  . ILE C  3 562 ? 141.836 114.361 102.530 1.00 26.76  ?  590 ILE E CA  1 
ATOM   6553  C  C   . ILE C  3 562 ? 140.820 114.076 101.439 1.00 26.76  ?  590 ILE E C   1 
ATOM   6554  O  O   . ILE C  3 562 ? 139.769 113.485 101.701 1.00 26.76  ?  590 ILE E O   1 
ATOM   6555  C  CB  . ILE C  3 562 ? 142.394 113.050 103.112 1.00 26.76  ?  590 ILE E CB  1 
ATOM   6556  C  CG1 . ILE C  3 562 ? 143.410 113.306 104.228 1.00 26.76  ?  590 ILE E CG1 1 
ATOM   6557  C  CG2 . ILE C  3 562 ? 143.077 112.269 102.029 1.00 26.76  ?  590 ILE E CG2 1 
ATOM   6558  C  CD1 . ILE C  3 562 ? 142.855 113.214 105.637 1.00 26.76  ?  590 ILE E CD1 1 
ATOM   6559  N  N   . VAL C  3 563 ? 141.127 114.502 100.226 1.00 27.98  ?  591 VAL E N   1 
ATOM   6560  C  CA  . VAL C  3 563 ? 140.249 114.315 99.084  1.00 27.98  ?  591 VAL E CA  1 
ATOM   6561  C  C   . VAL C  3 563 ? 140.799 113.153 98.274  1.00 27.98  ?  591 VAL E C   1 
ATOM   6562  O  O   . VAL C  3 563 ? 141.950 113.183 97.825  1.00 27.98  ?  591 VAL E O   1 
ATOM   6563  C  CB  . VAL C  3 563 ? 140.148 115.588 98.241  1.00 27.98  ?  591 VAL E CB  1 
ATOM   6564  C  CG1 . VAL C  3 563 ? 139.290 115.342 97.036  1.00 27.98  ?  591 VAL E CG1 1 
ATOM   6565  C  CG2 . VAL C  3 563 ? 139.571 116.704 99.068  1.00 27.98  ?  591 VAL E CG2 1 
ATOM   6566  N  N   . GLY C  3 564 ? 139.975 112.134 98.079  1.00 28.72  ?  592 GLY E N   1 
ATOM   6567  C  CA  . GLY C  3 564 ? 140.380 110.919 97.404  1.00 28.72  ?  592 GLY E CA  1 
ATOM   6568  C  C   . GLY C  3 564 ? 140.333 109.727 98.337  1.00 28.72  ?  592 GLY E C   1 
ATOM   6569  O  O   . GLY C  3 564 ? 140.171 109.850 99.549  1.00 28.72  ?  592 GLY E O   1 
ATOM   6570  N  N   . GLY C  3 565 ? 140.473 108.552 97.729  1.00 30.63  ?  593 GLY E N   1 
ATOM   6571  C  CA  . GLY C  3 565 ? 140.389 107.299 98.454  1.00 30.63  ?  593 GLY E CA  1 
ATOM   6572  C  C   . GLY C  3 565 ? 141.514 107.114 99.443  1.00 30.63  ?  593 GLY E C   1 
ATOM   6573  O  O   . GLY C  3 565 ? 142.677 106.991 99.055  1.00 30.63  ?  593 GLY E O   1 
ATOM   6574  N  N   . HIS C  3 566 ? 141.186 107.093 100.727 1.00 28.57  ?  594 HIS E N   1 
ATOM   6575  C  CA  . HIS C  3 566 ? 142.218 107.156 101.739 1.00 28.57  ?  594 HIS E CA  1 
ATOM   6576  C  C   . HIS C  3 566 ? 141.778 106.370 102.962 1.00 28.57  ?  594 HIS E C   1 
ATOM   6577  O  O   . HIS C  3 566 ? 140.772 105.658 102.946 1.00 28.57  ?  594 HIS E O   1 
ATOM   6578  C  CB  . HIS C  3 566 ? 142.498 108.610 102.107 1.00 28.57  ?  594 HIS E CB  1 
ATOM   6579  C  CG  . HIS C  3 566 ? 141.362 109.266 102.821 1.00 28.57  ?  594 HIS E CG  1 
ATOM   6580  N  ND1 . HIS C  3 566 ? 140.256 109.758 102.166 1.00 28.57  ?  594 HIS E ND1 1 
ATOM   6581  C  CD2 . HIS C  3 566 ? 141.157 109.503 104.137 1.00 28.57  ?  594 HIS E CD2 1 
ATOM   6582  C  CE1 . HIS C  3 566 ? 139.419 110.274 103.048 1.00 28.57  ?  594 HIS E CE1 1 
ATOM   6583  N  NE2 . HIS C  3 566 ? 139.942 110.132 104.251 1.00 28.57  ?  594 HIS E NE2 1 
ATOM   6584  N  N   . GLU C  3 567 ? 142.555 106.501 104.013 1.00 31.47  ?  595 GLU E N   1 
ATOM   6585  C  CA  . GLU C  3 567 ? 142.255 106.066 105.360 1.00 31.47  ?  595 GLU E CA  1 
ATOM   6586  C  C   . GLU C  3 567 ? 143.093 106.953 106.265 1.00 31.47  ?  595 GLU E C   1 
ATOM   6587  O  O   . GLU C  3 567 ? 144.328 106.933 106.170 1.00 31.47  ?  595 GLU E O   1 
ATOM   6588  C  CB  . GLU C  3 567 ? 142.578 104.590 105.566 1.00 31.47  ?  595 GLU E CB  1 
ATOM   6589  C  CG  . GLU C  3 567 ? 142.179 104.082 106.936 1.00 31.47  ?  595 GLU E CG  1 
ATOM   6590  C  CD  . GLU C  3 567 ? 142.458 102.606 107.124 1.00 31.47  ?  595 GLU E CD  1 
ATOM   6591  O  OE1 . GLU C  3 567 ? 143.003 101.977 106.193 1.00 31.47  ?  595 GLU E OE1 1 
ATOM   6592  O  OE2 . GLU C  3 567 ? 142.127 102.073 108.204 1.00 31.47  -1 595 GLU E OE2 1 
ATOM   6593  N  N   . PRO C  3 568 ? 142.466 107.756 107.122 1.00 30.71  ?  596 PRO E N   1 
ATOM   6594  C  CA  . PRO C  3 568 ? 143.208 108.799 107.838 1.00 30.71  ?  596 PRO E CA  1 
ATOM   6595  C  C   . PRO C  3 568 ? 144.092 108.233 108.934 1.00 30.71  ?  596 PRO E C   1 
ATOM   6596  O  O   . PRO C  3 568 ? 143.847 107.146 109.457 1.00 30.71  ?  596 PRO E O   1 
ATOM   6597  C  CB  . PRO C  3 568 ? 142.099 109.671 108.435 1.00 30.71  ?  596 PRO E CB  1 
ATOM   6598  C  CG  . PRO C  3 568 ? 140.887 109.353 107.641 1.00 30.71  ?  596 PRO E CG  1 
ATOM   6599  C  CD  . PRO C  3 568 ? 141.017 107.909 107.299 1.00 30.71  ?  596 PRO E CD  1 
ATOM   6600  N  N   . GLY C  3 569 ? 145.119 108.996 109.288 1.00 36.91  ?  597 GLY E N   1 
ATOM   6601  C  CA  . GLY C  3 569 ? 145.973 108.651 110.400 1.00 36.91  ?  597 GLY E CA  1 
ATOM   6602  C  C   . GLY C  3 569 ? 145.243 108.816 111.715 1.00 36.91  ?  597 GLY E C   1 
ATOM   6603  O  O   . GLY C  3 569 ? 144.149 109.375 111.795 1.00 36.91  ?  597 GLY E O   1 
ATOM   6604  N  N   . GLU C  3 570 ? 145.881 108.320 112.784 1.00 47.10  ?  598 GLU E N   1 
ATOM   6605  C  CA  . GLU C  3 570 ? 145.146 108.168 114.040 1.00 47.10  ?  598 GLU E CA  1 
ATOM   6606  C  C   . GLU C  3 570 ? 144.978 109.501 114.769 1.00 47.10  ?  598 GLU E C   1 
ATOM   6607  O  O   . GLU C  3 570 ? 143.842 109.820 115.165 1.00 47.10  ?  598 GLU E O   1 
ATOM   6608  C  CB  . GLU C  3 570 ? 145.777 107.059 114.892 1.00 47.10  ?  598 GLU E CB  1 
ATOM   6609  C  CG  . GLU C  3 570 ? 145.711 105.678 114.285 1.00 47.10  ?  598 GLU E CG  1 
ATOM   6610  C  CD  . GLU C  3 570 ? 146.483 104.666 115.101 1.00 47.10  ?  598 GLU E CD  1 
ATOM   6611  O  OE1 . GLU C  3 570 ? 147.158 105.076 116.069 1.00 47.10  ?  598 GLU E OE1 1 
ATOM   6612  O  OE2 . GLU C  3 570 ? 146.430 103.466 114.769 1.00 47.10  -1 598 GLU E OE2 1 
ATOM   6613  N  N   . PRO C  3 571 ? 146.037 110.339 114.992 1.00 44.74  ?  599 PRO E N   1 
ATOM   6614  C  CA  . PRO C  3 571 ? 145.711 111.727 115.335 1.00 44.74  ?  599 PRO E CA  1 
ATOM   6615  C  C   . PRO C  3 571 ? 145.624 112.625 114.114 1.00 44.74  ?  599 PRO E C   1 
ATOM   6616  O  O   . PRO C  3 571 ? 144.783 113.526 114.048 1.00 44.74  ?  599 PRO E O   1 
ATOM   6617  C  CB  . PRO C  3 571 ? 146.878 112.153 116.237 1.00 44.74  ?  599 PRO E CB  1 
ATOM   6618  C  CG  . PRO C  3 571 ? 147.607 110.898 116.577 1.00 44.74  ?  599 PRO E CG  1 
ATOM   6619  C  CD  . PRO C  3 571 ? 147.445 110.077 115.348 1.00 44.74  ?  599 PRO E CD  1 
ATOM   6620  N  N   . ARG C  3 572 ? 146.466 112.350 113.119 1.00 42.80  ?  600 ARG E N   1 
ATOM   6621  C  CA  . ARG C  3 572 ? 146.823 113.307 112.078 1.00 42.80  ?  600 ARG E CA  1 
ATOM   6622  C  C   . ARG C  3 572 ? 147.383 112.559 110.883 1.00 42.80  ?  600 ARG E C   1 
ATOM   6623  O  O   . ARG C  3 572 ? 147.799 111.407 111.006 1.00 42.80  ?  600 ARG E O   1 
ATOM   6624  C  CB  . ARG C  3 572 ? 147.871 114.325 112.563 1.00 42.80  ?  600 ARG E CB  1 
ATOM   6625  C  CG  . ARG C  3 572 ? 147.348 115.471 113.410 1.00 42.80  ?  600 ARG E CG  1 
ATOM   6626  C  CD  . ARG C  3 572 ? 148.439 116.375 113.943 1.00 42.80  ?  600 ARG E CD  1 
ATOM   6627  N  NE  . ARG C  3 572 ? 149.210 115.734 115.001 1.00 42.80  ?  600 ARG E NE  1 
ATOM   6628  C  CZ  . ARG C  3 572 ? 150.258 116.289 115.595 1.00 42.80  ?  600 ARG E CZ  1 
ATOM   6629  N  NH1 . ARG C  3 572 ? 150.656 117.502 115.239 1.00 42.80  ?  600 ARG E NH1 1 
ATOM   6630  N  NH2 . ARG C  3 572 ? 150.903 115.635 116.549 1.00 42.80  ?  600 ARG E NH2 1 
ATOM   6631  N  N   . GLY C  3 573 ? 147.403 113.221 109.740 1.00 33.37  ?  601 GLY E N   1 
ATOM   6632  C  CA  . GLY C  3 573 ? 148.126 112.706 108.602 1.00 33.37  ?  601 GLY E CA  1 
ATOM   6633  C  C   . GLY C  3 573 ? 147.315 111.729 107.778 1.00 33.37  ?  601 GLY E C   1 
ATOM   6634  O  O   . GLY C  3 573 ? 146.084 111.723 107.781 1.00 33.37  ?  601 GLY E O   1 
ATOM   6635  N  N   . ILE C  3 574 ? 148.040 110.886 107.051 1.00 28.89  ?  602 ILE E N   1 
ATOM   6636  C  CA  . ILE C  3 574 ? 147.458 109.912 106.139 1.00 28.89  ?  602 ILE E CA  1 
ATOM   6637  C  C   . ILE C  3 574 ? 147.997 108.544 106.525 1.00 28.89  ?  602 ILE E C   1 
ATOM   6638  O  O   . ILE C  3 574 ? 149.184 108.262 106.323 1.00 28.89  ?  602 ILE E O   1 
ATOM   6639  C  CB  . ILE C  3 574 ? 147.786 110.229 104.678 1.00 28.89  ?  602 ILE E CB  1 
ATOM   6640  C  CG1 . ILE C  3 574 ? 147.224 111.585 104.280 1.00 28.89  ?  602 ILE E CG1 1 
ATOM   6641  C  CG2 . ILE C  3 574 ? 147.201 109.186 103.781 1.00 28.89  ?  602 ILE E CG2 1 
ATOM   6642  C  CD1 . ILE C  3 574 ? 147.733 112.069 102.955 1.00 28.89  ?  602 ILE E CD1 1 
ATOM   6643  N  N   . LYS C  3 575 ? 147.134 107.693 107.085 1.00 30.05  ?  603 LYS E N   1 
ATOM   6644  C  CA  . LYS C  3 575 ? 147.542 106.321 107.365 1.00 30.05  ?  603 LYS E CA  1 
ATOM   6645  C  C   . LYS C  3 575 ? 147.725 105.537 106.077 1.00 30.05  ?  603 LYS E C   1 
ATOM   6646  O  O   . LYS C  3 575 ? 148.680 104.766 105.943 1.00 30.05  ?  603 LYS E O   1 
ATOM   6647  C  CB  . LYS C  3 575 ? 146.518 105.627 108.257 1.00 30.05  ?  603 LYS E CB  1 
ATOM   6648  C  CG  . LYS C  3 575 ? 146.916 104.228 108.695 1.00 30.05  ?  603 LYS E CG  1 
ATOM   6649  C  CD  . LYS C  3 575 ? 145.781 103.533 109.432 1.00 30.05  ?  603 LYS E CD  1 
ATOM   6650  C  CE  . LYS C  3 575 ? 145.572 104.117 110.816 1.00 30.05  ?  603 LYS E CE  1 
ATOM   6651  N  NZ  . LYS C  3 575 ? 144.528 103.381 111.576 1.00 30.05  ?  603 LYS E NZ  1 
ATOM   6652  N  N   . ALA C  3 576 ? 146.828 105.728 105.116 1.00 30.97  ?  604 ALA E N   1 
ATOM   6653  C  CA  . ALA C  3 576 ? 146.940 105.039 103.839 1.00 30.97  ?  604 ALA E CA  1 
ATOM   6654  C  C   . ALA C  3 576 ? 146.239 105.872 102.783 1.00 30.97  ?  604 ALA E C   1 
ATOM   6655  O  O   . ALA C  3 576 ? 145.242 106.527 103.082 1.00 30.97  ?  604 ALA E O   1 
ATOM   6656  C  CB  . ALA C  3 576 ? 146.326 103.641 103.915 1.00 30.97  ?  604 ALA E CB  1 
ATOM   6657  N  N   . GLY C  3 577 ? 146.754 105.860 101.571 1.00 32.85  ?  605 GLY E N   1 
ATOM   6658  C  CA  . GLY C  3 577 ? 146.162 106.627 100.488 1.00 32.85  ?  605 GLY E CA  1 
ATOM   6659  C  C   . GLY C  3 577 ? 146.463 106.003 99.146  1.00 32.85  ?  605 GLY E C   1 
ATOM   6660  O  O   . GLY C  3 577 ? 147.616 105.731 98.822  1.00 32.85  ?  605 GLY E O   1 
ATOM   6661  N  N   . TYR C  3 578 ? 145.412 105.782 98.367  1.00 31.26  ?  606 TYR E N   1 
ATOM   6662  C  CA  . TYR C  3 578 ? 145.554 105.138 97.071  1.00 31.26  ?  606 TYR E CA  1 
ATOM   6663  C  C   . TYR C  3 578 ? 146.188 106.096 96.075  1.00 31.26  ?  606 TYR E C   1 
ATOM   6664  O  O   . TYR C  3 578 ? 145.600 107.128 95.741  1.00 31.26  ?  606 TYR E O   1 
ATOM   6665  C  CB  . TYR C  3 578 ? 144.200 104.659 96.571  1.00 31.26  ?  606 TYR E CB  1 
ATOM   6666  C  CG  . TYR C  3 578 ? 144.241 104.124 95.168  1.00 31.26  ?  606 TYR E CG  1 
ATOM   6667  C  CD1 . TYR C  3 578 ? 144.938 102.965 94.871  1.00 31.26  ?  606 TYR E CD1 1 
ATOM   6668  C  CD2 . TYR C  3 578 ? 143.551 104.758 94.146  1.00 31.26  ?  606 TYR E CD2 1 
ATOM   6669  C  CE1 . TYR C  3 578 ? 144.973 102.469 93.587  1.00 31.26  ?  606 TYR E CE1 1 
ATOM   6670  C  CE2 . TYR C  3 578 ? 143.573 104.268 92.862  1.00 31.26  ?  606 TYR E CE2 1 
ATOM   6671  C  CZ  . TYR C  3 578 ? 144.284 103.124 92.589  1.00 31.26  ?  606 TYR E CZ  1 
ATOM   6672  O  OH  . TYR C  3 578 ? 144.308 102.631 91.307  1.00 31.26  ?  606 TYR E OH  1 
ATOM   6673  N  N   . GLY C  3 579 ? 147.383 105.753 95.598  1.00 33.51  ?  607 GLY E N   1 
ATOM   6674  C  CA  . GLY C  3 579 ? 148.070 106.569 94.615  1.00 33.51  ?  607 GLY E CA  1 
ATOM   6675  C  C   . GLY C  3 579 ? 148.939 107.636 95.243  1.00 33.51  ?  607 GLY E C   1 
ATOM   6676  O  O   . GLY C  3 579 ? 149.254 107.557 96.433  1.00 33.51  ?  607 GLY E O   1 
ATOM   6677  N  N   . THR C  3 580 ? 149.331 108.639 94.462  1.00 36.01  ?  608 THR E N   1 
ATOM   6678  C  CA  . THR C  3 580 ? 150.179 109.719 94.946  1.00 36.01  ?  608 THR E CA  1 
ATOM   6679  C  C   . THR C  3 580 ? 149.371 110.628 95.858  1.00 36.01  ?  608 THR E C   1 
ATOM   6680  O  O   . THR C  3 580 ? 148.243 111.005 95.528  1.00 36.01  ?  608 THR E O   1 
ATOM   6681  C  CB  . THR C  3 580 ? 150.743 110.537 93.787  1.00 36.01  ?  608 THR E CB  1 
ATOM   6682  O  OG1 . THR C  3 580 ? 149.670 111.209 93.123  1.00 36.01  ?  608 THR E OG1 1 
ATOM   6683  C  CG2 . THR C  3 580 ? 151.428 109.634 92.787  1.00 36.01  ?  608 THR E CG2 1 
ATOM   6684  N  N   . CYS C  3 581 ? 149.947 110.976 97.005  1.00 32.31  ?  609 CYS E N   1 
ATOM   6685  C  CA  . CYS C  3 581 ? 149.277 111.818 97.990  1.00 32.31  ?  609 CYS E CA  1 
ATOM   6686  C  C   . CYS C  3 581 ? 150.096 113.078 98.220  1.00 32.31  ?  609 CYS E C   1 
ATOM   6687  O  O   . CYS C  3 581 ? 151.032 113.075 99.026  1.00 32.31  ?  609 CYS E O   1 
ATOM   6688  C  CB  . CYS C  3 581 ? 149.060 111.074 99.303  1.00 32.31  ?  609 CYS E CB  1 
ATOM   6689  S  SG  . CYS C  3 581 ? 147.803 109.791 99.226  1.00 32.31  ?  609 CYS E SG  1 
ATOM   6690  N  N   . ASN C  3 582 ? 149.725 114.157 97.538  1.00 33.69  ?  610 ASN E N   1 
ATOM   6691  C  CA  . ASN C  3 582 ? 150.329 115.464 97.765  1.00 33.69  ?  610 ASN E CA  1 
ATOM   6692  C  C   . ASN C  3 582 ? 149.441 116.266 98.699  1.00 33.69  ?  610 ASN E C   1 
ATOM   6693  O  O   . ASN C  3 582 ? 148.258 115.957 98.853  1.00 33.69  ?  610 ASN E O   1 
ATOM   6694  C  CB  . ASN C  3 582 ? 150.542 116.236 96.467  1.00 33.69  ?  610 ASN E CB  1 
ATOM   6695  C  CG  . ASN C  3 582 ? 149.288 116.341 95.647  1.00 33.69  ?  610 ASN E CG  1 
ATOM   6696  O  OD1 . ASN C  3 582 ? 148.296 115.694 95.937  1.00 33.69  ?  610 ASN E OD1 1 
ATOM   6697  N  ND2 . ASN C  3 582 ? 149.303 117.207 94.653  1.00 33.69  ?  610 ASN E ND2 1 
ATOM   6698  N  N   . CYS C  3 583 ? 150.003 117.289 99.325  1.00 33.15  ?  611 CYS E N   1 
ATOM   6699  C  CA  . CYS C  3 583 ? 149.264 118.064 100.307 1.00 33.15  ?  611 CYS E CA  1 
ATOM   6700  C  C   . CYS C  3 583 ? 149.569 119.547 100.164 1.00 33.15  ?  611 CYS E C   1 
ATOM   6701  O  O   . CYS C  3 583 ? 150.720 119.939 99.960  1.00 33.15  ?  611 CYS E O   1 
ATOM   6702  C  CB  . CYS C  3 583 ? 149.588 117.595 101.726 1.00 33.15  ?  611 CYS E CB  1 
ATOM   6703  S  SG  . CYS C  3 583 ? 149.059 115.904 102.095 1.00 33.15  ?  611 CYS E SG  1 
ATOM   6704  N  N   . PHE C  3 584 ? 148.523 120.364 100.266 1.00 38.20  ?  612 PHE E N   1 
ATOM   6705  C  CA  . PHE C  3 584 ? 148.640 121.809 100.349 1.00 38.20  ?  612 PHE E CA  1 
ATOM   6706  C  C   . PHE C  3 584 ? 148.391 122.197 101.793 1.00 38.20  ?  612 PHE E C   1 
ATOM   6707  O  O   . PHE C  3 584 ? 147.246 122.099 102.269 1.00 38.20  ?  612 PHE E O   1 
ATOM   6708  C  CB  . PHE C  3 584 ? 147.633 122.488 99.424  1.00 38.20  ?  612 PHE E CB  1 
ATOM   6709  C  CG  . PHE C  3 584 ? 147.895 122.245 97.979  1.00 38.20  ?  612 PHE E CG  1 
ATOM   6710  C  CD1 . PHE C  3 584 ? 148.771 123.049 97.277  1.00 38.20  ?  612 PHE E CD1 1 
ATOM   6711  C  CD2 . PHE C  3 584 ? 147.290 121.189 97.326  1.00 38.20  ?  612 PHE E CD2 1 
ATOM   6712  C  CE1 . PHE C  3 584 ? 149.020 122.820 95.941  1.00 38.20  ?  612 PHE E CE1 1 
ATOM   6713  C  CE2 . PHE C  3 584 ? 147.538 120.949 95.992  1.00 38.20  ?  612 PHE E CE2 1 
ATOM   6714  C  CZ  . PHE C  3 584 ? 148.404 121.765 95.298  1.00 38.20  ?  612 PHE E CZ  1 
ATOM   6715  N  N   . PRO C  3 585 ? 149.419 122.603 102.542 1.00 41.07  ?  613 PRO E N   1 
ATOM   6716  C  CA  . PRO C  3 585 ? 149.235 122.840 103.980 1.00 41.07  ?  613 PRO E CA  1 
ATOM   6717  C  C   . PRO C  3 585 ? 148.742 124.232 104.313 1.00 41.07  ?  613 PRO E C   1 
ATOM   6718  O  O   . PRO C  3 585 ? 148.253 124.443 105.429 1.00 41.07  ?  613 PRO E O   1 
ATOM   6719  C  CB  . PRO C  3 585 ? 150.634 122.602 104.549 1.00 41.07  ?  613 PRO E CB  1 
ATOM   6720  C  CG  . PRO C  3 585 ? 151.532 122.984 103.436 1.00 41.07  ?  613 PRO E CG  1 
ATOM   6721  C  CD  . PRO C  3 585 ? 150.840 122.598 102.165 1.00 41.07  ?  613 PRO E CD  1 
ATOM   6722  N  N   . GLU C  3 586 ? 148.861 125.190 103.398 1.00 52.55  ?  614 GLU E N   1 
ATOM   6723  C  CA  . GLU C  3 586 ? 148.299 126.514 103.628 1.00 52.55  ?  614 GLU E CA  1 
ATOM   6724  C  C   . GLU C  3 586 ? 146.780 126.523 103.528 1.00 52.55  ?  614 GLU E C   1 
ATOM   6725  O  O   . GLU C  3 586 ? 146.140 127.423 104.080 1.00 52.55  ?  614 GLU E O   1 
ATOM   6726  C  CB  . GLU C  3 586 ? 148.901 127.513 102.638 1.00 52.55  ?  614 GLU E CB  1 
ATOM   6727  C  CG  . GLU C  3 586 ? 148.604 127.192 101.184 1.00 52.55  ?  614 GLU E CG  1 
ATOM   6728  C  CD  . GLU C  3 586 ? 149.280 128.144 100.226 1.00 52.55  ?  614 GLU E CD  1 
ATOM   6729  O  OE1 . GLU C  3 586 ? 150.002 129.048 100.695 1.00 52.55  ?  614 GLU E OE1 1 
ATOM   6730  O  OE2 . GLU C  3 586 ? 149.091 127.989 99.002  1.00 52.55  -1 614 GLU E OE2 1 
ATOM   6731  N  N   . GLU C  3 587 ? 146.195 125.542 102.840 1.00 50.18  ?  615 GLU E N   1 
ATOM   6732  C  CA  . GLU C  3 587 ? 144.755 125.368 102.776 1.00 50.18  ?  615 GLU E CA  1 
ATOM   6733  C  C   . GLU C  3 587 ? 144.277 124.084 103.427 1.00 50.18  ?  615 GLU E C   1 
ATOM   6734  O  O   . GLU C  3 587 ? 143.061 123.875 103.501 1.00 50.18  ?  615 GLU E O   1 
ATOM   6735  C  CB  . GLU C  3 587 ? 144.278 125.379 101.318 1.00 50.18  ?  615 GLU E CB  1 
ATOM   6736  C  CG  . GLU C  3 587 ? 144.435 126.713 100.628 1.00 50.18  ?  615 GLU E CG  1 
ATOM   6737  C  CD  . GLU C  3 587 ? 143.987 126.668 99.184  1.00 50.18  ?  615 GLU E CD  1 
ATOM   6738  O  OE1 . GLU C  3 587 ? 143.713 125.557 98.683  1.00 50.18  ?  615 GLU E OE1 1 
ATOM   6739  O  OE2 . GLU C  3 587 ? 143.897 127.743 98.553  1.00 50.18  -1 615 GLU E OE2 1 
ATOM   6740  N  N   . GLU C  3 588 ? 145.198 123.224 103.875 1.00 42.95  ?  616 GLU E N   1 
ATOM   6741  C  CA  . GLU C  3 588 ? 144.951 121.945 104.535 1.00 42.95  ?  616 GLU E CA  1 
ATOM   6742  C  C   . GLU C  3 588 ? 144.119 121.004 103.677 1.00 42.95  ?  616 GLU E C   1 
ATOM   6743  O  O   . GLU C  3 588 ? 143.014 120.621 104.066 1.00 42.95  ?  616 GLU E O   1 
ATOM   6744  C  CB  . GLU C  3 588 ? 144.287 122.169 105.894 1.00 42.95  ?  616 GLU E CB  1 
ATOM   6745  C  CG  . GLU C  3 588 ? 145.176 122.923 106.856 1.00 42.95  ?  616 GLU E CG  1 
ATOM   6746  C  CD  . GLU C  3 588 ? 144.501 123.210 108.173 1.00 42.95  ?  616 GLU E CD  1 
ATOM   6747  O  OE1 . GLU C  3 588 ? 143.294 122.923 108.297 1.00 42.95  ?  616 GLU E OE1 1 
ATOM   6748  O  OE2 . GLU C  3 588 ? 145.177 123.731 109.083 1.00 42.95  -1 616 GLU E OE2 1 
ATOM   6749  N  N   . LYS C  3 589 ? 144.634 120.627 102.508 1.00 36.57  ?  617 LYS E N   1 
ATOM   6750  C  CA  . LYS C  3 589 ? 143.946 119.685 101.630 1.00 36.57  ?  617 LYS E CA  1 
ATOM   6751  C  C   . LYS C  3 589 ? 144.950 118.697 101.067 1.00 36.57  ?  617 LYS E C   1 
ATOM   6752  O  O   . LYS C  3 589 ? 145.920 119.104 100.424 1.00 36.57  ?  617 LYS E O   1 
ATOM   6753  C  CB  . LYS C  3 589 ? 143.232 120.397 100.475 1.00 36.57  ?  617 LYS E CB  1 
ATOM   6754  C  CG  . LYS C  3 589 ? 142.034 121.234 100.875 1.00 36.57  ?  617 LYS E CG  1 
ATOM   6755  C  CD  . LYS C  3 589 ? 141.351 121.832 99.661  1.00 36.57  ?  617 LYS E CD  1 
ATOM   6756  C  CE  . LYS C  3 589 ? 140.209 122.742 100.075 1.00 36.57  ?  617 LYS E CE  1 
ATOM   6757  N  NZ  . LYS C  3 589 ? 139.097 121.982 100.714 1.00 36.57  ?  617 LYS E NZ  1 
ATOM   6758  N  N   . CYS C  3 590 ? 144.720 117.407 101.289 1.00 30.38  ?  618 CYS E N   1 
ATOM   6759  C  CA  . CYS C  3 590 ? 145.605 116.376 100.763 1.00 30.38  ?  618 CYS E CA  1 
ATOM   6760  C  C   . CYS C  3 590 ? 144.906 115.598 99.664  1.00 30.38  ?  618 CYS E C   1 
ATOM   6761  O  O   . CYS C  3 590 ? 143.960 114.855 99.929  1.00 30.38  ?  618 CYS E O   1 
ATOM   6762  C  CB  . CYS C  3 590 ? 146.074 115.416 101.855 1.00 30.38  ?  618 CYS E CB  1 
ATOM   6763  S  SG  . CYS C  3 590 ? 147.259 116.117 103.007 1.00 30.38  ?  618 CYS E SG  1 
ATOM   6764  N  N   . PHE C  3 591 ? 145.388 115.750 98.441  1.00 32.76  ?  619 PHE E N   1 
ATOM   6765  C  CA  . PHE C  3 591 ? 144.871 115.009 97.305  1.00 32.76  ?  619 PHE E CA  1 
ATOM   6766  C  C   . PHE C  3 591 ? 145.567 113.661 97.220  1.00 32.76  ?  619 PHE E C   1 
ATOM   6767  O  O   . PHE C  3 591 ? 146.801 113.588 97.183  1.00 32.76  ?  619 PHE E O   1 
ATOM   6768  C  CB  . PHE C  3 591 ? 145.085 115.773 96.002  1.00 32.76  ?  619 PHE E CB  1 
ATOM   6769  C  CG  . PHE C  3 591 ? 144.312 117.041 95.910  1.00 32.76  ?  619 PHE E CG  1 
ATOM   6770  C  CD1 . PHE C  3 591 ? 143.011 117.032 95.457  1.00 32.76  ?  619 PHE E CD1 1 
ATOM   6771  C  CD2 . PHE C  3 591 ? 144.885 118.245 96.284  1.00 32.76  ?  619 PHE E CD2 1 
ATOM   6772  C  CE1 . PHE C  3 591 ? 142.298 118.197 95.367  1.00 32.76  ?  619 PHE E CE1 1 
ATOM   6773  C  CE2 . PHE C  3 591 ? 144.171 119.418 96.200  1.00 32.76  ?  619 PHE E CE2 1 
ATOM   6774  C  CZ  . PHE C  3 591 ? 142.875 119.393 95.743  1.00 32.76  ?  619 PHE E CZ  1 
ATOM   6775  N  N   . CYS C  3 592 ? 144.773 112.595 97.178  1.00 30.84  ?  620 CYS E N   1 
ATOM   6776  C  CA  . CYS C  3 592 ? 145.305 111.247 97.005  1.00 30.84  ?  620 CYS E CA  1 
ATOM   6777  C  C   . CYS C  3 592 ? 144.684 110.636 95.761  1.00 30.84  ?  620 CYS E C   1 
ATOM   6778  O  O   . CYS C  3 592 ? 143.497 110.301 95.764  1.00 30.84  ?  620 CYS E O   1 
ATOM   6779  C  CB  . CYS C  3 592 ? 145.034 110.379 98.230  1.00 30.84  ?  620 CYS E CB  1 
ATOM   6780  S  SG  . CYS C  3 592 ? 146.062 110.756 99.647  1.00 30.84  ?  620 CYS E SG  1 
ATOM   6781  N  N   . GLU C  3 593 ? 145.489 110.466 94.719  1.00 37.71  ?  621 GLU E N   1 
ATOM   6782  C  CA  . GLU C  3 593 ? 145.017 109.927 93.452  1.00 37.71  ?  621 GLU E CA  1 
ATOM   6783  C  C   . GLU C  3 593 ? 146.235 109.514 92.635  1.00 37.71  ?  621 GLU E C   1 
ATOM   6784  O  O   . GLU C  3 593 ? 147.331 110.047 92.843  1.00 37.71  ?  621 GLU E O   1 
ATOM   6785  C  CB  . GLU C  3 593 ? 144.171 110.972 92.695  1.00 37.71  ?  621 GLU E CB  1 
ATOM   6786  C  CG  . GLU C  3 593 ? 143.320 110.451 91.546  1.00 37.71  ?  621 GLU E CG  1 
ATOM   6787  C  CD  . GLU C  3 593 ? 142.415 111.507 90.952  1.00 37.71  ?  621 GLU E CD  1 
ATOM   6788  O  OE1 . GLU C  3 593 ? 142.493 112.675 91.392  1.00 37.71  ?  621 GLU E OE1 1 
ATOM   6789  O  OE2 . GLU C  3 593 ? 141.619 111.166 90.054  1.00 37.71  -1 621 GLU E OE2 1 
ATOM   6790  N  N   . PRO C  3 594 ? 146.095 108.528 91.734  1.00 35.64  ?  622 PRO E N   1 
ATOM   6791  C  CA  . PRO C  3 594 ? 147.216 108.324 90.812  1.00 35.64  ?  622 PRO E CA  1 
ATOM   6792  C  C   . PRO C  3 594 ? 147.227 109.329 89.666  1.00 35.64  ?  622 PRO E C   1 
ATOM   6793  O  O   . PRO C  3 594 ? 148.130 109.267 88.831  1.00 35.64  ?  622 PRO E O   1 
ATOM   6794  C  CB  . PRO C  3 594 ? 146.985 106.908 90.286  1.00 35.64  ?  622 PRO E CB  1 
ATOM   6795  C  CG  . PRO C  3 594 ? 145.532 106.675 90.457  1.00 35.64  ?  622 PRO E CG  1 
ATOM   6796  C  CD  . PRO C  3 594 ? 145.162 107.389 91.716  1.00 35.64  ?  622 PRO E CD  1 
ATOM   6797  N  N   . ASP D  1 28  ? 155.483 127.843 89.328  1.00 103.31 ?  201 ASP B N   1 
ATOM   6798  C  CA  . ASP D  1 28  ? 154.071 128.149 89.512  1.00 103.31 ?  201 ASP B CA  1 
ATOM   6799  C  C   . ASP D  1 28  ? 153.323 126.811 89.545  1.00 103.31 ?  201 ASP B C   1 
ATOM   6800  O  O   . ASP D  1 28  ? 153.950 125.755 89.501  1.00 103.31 ?  201 ASP B O   1 
ATOM   6801  C  CB  . ASP D  1 28  ? 153.572 129.073 88.390  1.00 103.31 ?  201 ASP B CB  1 
ATOM   6802  C  CG  . ASP D  1 28  ? 152.280 129.797 88.744  1.00 103.31 ?  201 ASP B CG  1 
ATOM   6803  O  OD1 . ASP D  1 28  ? 152.334 130.741 89.560  1.00 103.31 ?  201 ASP B OD1 1 
ATOM   6804  O  OD2 . ASP D  1 28  ? 151.217 129.419 88.211  1.00 103.31 -1 201 ASP B OD2 1 
ATOM   6805  N  N   . HIS D  1 29  ? 151.992 126.846 89.625  1.00 98.73  ?  202 HIS B N   1 
ATOM   6806  C  CA  . HIS D  1 29  ? 151.200 125.632 89.767  1.00 98.73  ?  202 HIS B CA  1 
ATOM   6807  C  C   . HIS D  1 29  ? 150.007 125.559 88.823  1.00 98.73  ?  202 HIS B C   1 
ATOM   6808  O  O   . HIS D  1 29  ? 149.287 124.557 88.841  1.00 98.73  ?  202 HIS B O   1 
ATOM   6809  C  CB  . HIS D  1 29  ? 150.716 125.492 91.215  1.00 98.73  ?  202 HIS B CB  1 
ATOM   6810  C  CG  . HIS D  1 29  ? 149.995 126.699 91.725  1.00 98.73  ?  202 HIS B CG  1 
ATOM   6811  N  ND1 . HIS D  1 29  ? 148.653 126.917 91.501  1.00 98.73  ?  202 HIS B ND1 1 
ATOM   6812  C  CD2 . HIS D  1 29  ? 150.433 127.756 92.449  1.00 98.73  ?  202 HIS B CD2 1 
ATOM   6813  C  CE1 . HIS D  1 29  ? 148.295 128.057 92.063  1.00 98.73  ?  202 HIS B CE1 1 
ATOM   6814  N  NE2 . HIS D  1 29  ? 149.355 128.586 92.647  1.00 98.73  ?  202 HIS B NE2 1 
ATOM   6815  N  N   . CYS D  1 30  ? 149.778 126.574 88.003  1.00 96.31  ?  203 CYS B N   1 
ATOM   6816  C  CA  . CYS D  1 30  ? 148.701 126.500 87.025  1.00 96.31  ?  203 CYS B CA  1 
ATOM   6817  C  C   . CYS D  1 30  ? 149.172 125.723 85.802  1.00 96.31  ?  203 CYS B C   1 
ATOM   6818  O  O   . CYS D  1 30  ? 150.189 126.086 85.199  1.00 96.31  ?  203 CYS B O   1 
ATOM   6819  C  CB  . CYS D  1 30  ? 148.240 127.897 86.622  1.00 96.31  ?  203 CYS B CB  1 
ATOM   6820  S  SG  . CYS D  1 30  ? 146.912 127.944 85.388  1.00 96.31  ?  203 CYS B SG  1 
ATOM   6821  N  N   . PRO D  1 31  ? 148.477 124.653 85.411  1.00 91.13  ?  204 PRO B N   1 
ATOM   6822  C  CA  . PRO D  1 31  ? 148.973 123.816 84.309  1.00 91.13  ?  204 PRO B CA  1 
ATOM   6823  C  C   . PRO D  1 31  ? 148.798 124.439 82.936  1.00 91.13  ?  204 PRO B C   1 
ATOM   6824  O  O   . PRO D  1 31  ? 149.428 123.983 81.976  1.00 91.13  ?  204 PRO B O   1 
ATOM   6825  C  CB  . PRO D  1 31  ? 148.136 122.536 84.439  1.00 91.13  ?  204 PRO B CB  1 
ATOM   6826  C  CG  . PRO D  1 31  ? 147.620 122.551 85.839  1.00 91.13  ?  204 PRO B CG  1 
ATOM   6827  C  CD  . PRO D  1 31  ? 147.389 123.994 86.149  1.00 91.13  ?  204 PRO B CD  1 
ATOM   6828  N  N   . LEU D  1 32  ? 147.964 125.469 82.810  1.00 93.33  ?  205 LEU B N   1 
ATOM   6829  C  CA  . LEU D  1 32  ? 147.651 126.041 81.509  1.00 93.33  ?  205 LEU B CA  1 
ATOM   6830  C  C   . LEU D  1 32  ? 148.272 127.413 81.294  1.00 93.33  ?  205 LEU B C   1 
ATOM   6831  O  O   . LEU D  1 32  ? 147.766 128.185 80.470  1.00 93.33  ?  205 LEU B O   1 
ATOM   6832  C  CB  . LEU D  1 32  ? 146.135 126.121 81.319  1.00 93.33  ?  205 LEU B CB  1 
ATOM   6833  C  CG  . LEU D  1 32  ? 145.424 124.771 81.243  1.00 93.33  ?  205 LEU B CG  1 
ATOM   6834  C  CD1 . LEU D  1 32  ? 143.918 124.959 81.188  1.00 93.33  ?  205 LEU B CD1 1 
ATOM   6835  C  CD2 . LEU D  1 32  ? 145.915 123.982 80.041  1.00 93.33  ?  205 LEU B CD2 1 
ATOM   6836  N  N   . GLY D  1 33  ? 149.354 127.736 81.996  1.00 93.43  ?  206 GLY B N   1 
ATOM   6837  C  CA  . GLY D  1 33  ? 149.959 129.043 81.905  1.00 93.43  ?  206 GLY B CA  1 
ATOM   6838  C  C   . GLY D  1 33  ? 149.591 129.888 83.105  1.00 93.43  ?  206 GLY B C   1 
ATOM   6839  O  O   . GLY D  1 33  ? 148.412 130.036 83.438  1.00 93.43  ?  206 GLY B O   1 
ATOM   6840  N  N   . PRO D  1 34  ? 150.600 130.446 83.787  1.00 93.97  ?  207 PRO B N   1 
ATOM   6841  C  CA  . PRO D  1 34  ? 150.346 131.174 85.041  1.00 93.97  ?  207 PRO B CA  1 
ATOM   6842  C  C   . PRO D  1 34  ? 149.537 132.446 84.837  1.00 93.97  ?  207 PRO B C   1 
ATOM   6843  O  O   . PRO D  1 34  ? 149.942 133.355 84.109  1.00 93.97  ?  207 PRO B O   1 
ATOM   6844  C  CB  . PRO D  1 34  ? 151.757 131.489 85.555  1.00 93.97  ?  207 PRO B CB  1 
ATOM   6845  C  CG  . PRO D  1 34  ? 152.636 130.477 84.897  1.00 93.97  ?  207 PRO B CG  1 
ATOM   6846  C  CD  . PRO D  1 34  ? 152.040 130.270 83.539  1.00 93.97  ?  207 PRO B CD  1 
ATOM   6847  N  N   . GLY D  1 35  ? 148.380 132.498 85.490  1.00 88.67  ?  208 GLY B N   1 
ATOM   6848  C  CA  . GLY D  1 35  ? 147.441 133.588 85.319  1.00 88.67  ?  208 GLY B CA  1 
ATOM   6849  C  C   . GLY D  1 35  ? 146.126 133.168 84.700  1.00 88.67  ?  208 GLY B C   1 
ATOM   6850  O  O   . GLY D  1 35  ? 145.181 133.965 84.677  1.00 88.67  ?  208 GLY B O   1 
ATOM   6851  N  N   . ARG D  1 36  ? 146.037 131.937 84.199  1.00 88.33  ?  209 ARG B N   1 
ATOM   6852  C  CA  . ARG D  1 36  ? 144.856 131.455 83.496  1.00 88.33  ?  209 ARG B CA  1 
ATOM   6853  C  C   . ARG D  1 36  ? 144.045 130.454 84.309  1.00 88.33  ?  209 ARG B C   1 
ATOM   6854  O  O   . ARG D  1 36  ? 143.156 129.798 83.752  1.00 88.33  ?  209 ARG B O   1 
ATOM   6855  C  CB  . ARG D  1 36  ? 145.272 130.836 82.161  1.00 88.33  ?  209 ARG B CB  1 
ATOM   6856  C  CG  . ARG D  1 36  ? 145.878 131.836 81.193  1.00 88.33  ?  209 ARG B CG  1 
ATOM   6857  C  CD  . ARG D  1 36  ? 146.407 131.160 79.939  1.00 88.33  ?  209 ARG B CD  1 
ATOM   6858  N  NE  . ARG D  1 36  ? 145.348 130.579 79.120  1.00 88.33  ?  209 ARG B NE  1 
ATOM   6859  C  CZ  . ARG D  1 36  ? 145.567 129.795 78.069  1.00 88.33  ?  209 ARG B CZ  1 
ATOM   6860  N  NH1 . ARG D  1 36  ? 144.546 129.310 77.376  1.00 88.33  ?  209 ARG B NH1 1 
ATOM   6861  N  NH2 . ARG D  1 36  ? 146.808 129.493 77.713  1.00 88.33  ?  209 ARG B NH2 1 
ATOM   6862  N  N   . CYS D  1 37  ? 144.323 130.315 85.604  1.00 85.31  ?  210 CYS B N   1 
ATOM   6863  C  CA  . CYS D  1 37  ? 143.585 129.395 86.459  1.00 85.31  ?  210 CYS B CA  1 
ATOM   6864  C  C   . CYS D  1 37  ? 142.663 130.175 87.393  1.00 85.31  ?  210 CYS B C   1 
ATOM   6865  O  O   . CYS D  1 37  ? 142.531 131.399 87.304  1.00 85.31  ?  210 CYS B O   1 
ATOM   6866  C  CB  . CYS D  1 37  ? 144.539 128.491 87.244  1.00 85.31  ?  210 CYS B CB  1 
ATOM   6867  S  SG  . CYS D  1 37  ? 145.291 127.131 86.306  1.00 85.31  ?  210 CYS B SG  1 
ATOM   6868  N  N   . CYS D  1 38  ? 142.019 129.448 88.305  1.00 76.65  ?  211 CYS B N   1 
ATOM   6869  C  CA  . CYS D  1 38  ? 141.046 130.002 89.240  1.00 76.65  ?  211 CYS B CA  1 
ATOM   6870  C  C   . CYS D  1 38  ? 141.755 130.836 90.300  1.00 76.65  ?  211 CYS B C   1 
ATOM   6871  O  O   . CYS D  1 38  ? 142.178 130.312 91.334  1.00 76.65  ?  211 CYS B O   1 
ATOM   6872  C  CB  . CYS D  1 38  ? 140.241 128.866 89.871  1.00 76.65  ?  211 CYS B CB  1 
ATOM   6873  S  SG  . CYS D  1 38  ? 139.040 129.299 91.155  1.00 76.65  ?  211 CYS B SG  1 
ATOM   6874  N  N   . ARG D  1 39  ? 141.876 132.137 90.046  1.00 78.90  ?  212 ARG B N   1 
ATOM   6875  C  CA  . ARG D  1 39  ? 142.491 133.075 90.976  1.00 78.90  ?  212 ARG B CA  1 
ATOM   6876  C  C   . ARG D  1 39  ? 141.616 134.319 91.055  1.00 78.90  ?  212 ARG B C   1 
ATOM   6877  O  O   . ARG D  1 39  ? 140.587 134.407 90.378  1.00 78.90  ?  212 ARG B O   1 
ATOM   6878  C  CB  . ARG D  1 39  ? 143.910 133.428 90.531  1.00 78.90  ?  212 ARG B CB  1 
ATOM   6879  C  CG  . ARG D  1 39  ? 143.953 134.193 89.222  1.00 78.90  ?  212 ARG B CG  1 
ATOM   6880  C  CD  . ARG D  1 39  ? 145.370 134.535 88.821  1.00 78.90  ?  212 ARG B CD  1 
ATOM   6881  N  NE  . ARG D  1 39  ? 145.414 135.232 87.542  1.00 78.90  ?  212 ARG B NE  1 
ATOM   6882  C  CZ  . ARG D  1 39  ? 145.318 136.549 87.411  1.00 78.90  ?  212 ARG B CZ  1 
ATOM   6883  N  NH1 . ARG D  1 39  ? 145.366 137.102 86.208  1.00 78.90  ?  212 ARG B NH1 1 
ATOM   6884  N  NH2 . ARG D  1 39  ? 145.180 137.315 88.483  1.00 78.90  ?  212 ARG B NH2 1 
ATOM   6885  N  N   . LEU D  1 40  ? 142.017 135.288 91.867  1.00 79.59  ?  213 LEU B N   1 
ATOM   6886  C  CA  . LEU D  1 40  ? 141.227 136.498 92.032  1.00 79.59  ?  213 LEU B CA  1 
ATOM   6887  C  C   . LEU D  1 40  ? 141.502 137.492 90.912  1.00 79.59  ?  213 LEU B C   1 
ATOM   6888  O  O   . LEU D  1 40  ? 142.496 137.396 90.190  1.00 79.59  ?  213 LEU B O   1 
ATOM   6889  C  CB  . LEU D  1 40  ? 141.503 137.170 93.377  1.00 79.59  ?  213 LEU B CB  1 
ATOM   6890  C  CG  . LEU D  1 40  ? 140.799 136.659 94.633  1.00 79.59  ?  213 LEU B CG  1 
ATOM   6891  C  CD1 . LEU D  1 40  ? 141.431 135.386 95.162  1.00 79.59  ?  213 LEU B CD1 1 
ATOM   6892  C  CD2 . LEU D  1 40  ? 140.795 137.738 95.690  1.00 79.59  ?  213 LEU B CD2 1 
ATOM   6893  N  N   . HIS D  1 41  ? 140.598 138.460 90.785  1.00 87.11  ?  214 HIS B N   1 
ATOM   6894  C  CA  . HIS D  1 41  ? 140.723 139.595 89.889  1.00 87.11  ?  214 HIS B CA  1 
ATOM   6895  C  C   . HIS D  1 41  ? 139.972 140.756 90.513  1.00 87.11  ?  214 HIS B C   1 
ATOM   6896  O  O   . HIS D  1 41  ? 138.990 140.562 91.236  1.00 87.11  ?  214 HIS B O   1 
ATOM   6897  C  CB  . HIS D  1 41  ? 140.139 139.322 88.498  1.00 87.11  ?  214 HIS B CB  1 
ATOM   6898  C  CG  . HIS D  1 41  ? 140.922 138.343 87.686  1.00 87.11  ?  214 HIS B CG  1 
ATOM   6899  N  ND1 . HIS D  1 41  ? 140.698 136.985 87.740  1.00 87.11  ?  214 HIS B ND1 1 
ATOM   6900  C  CD2 . HIS D  1 41  ? 141.920 138.525 86.791  1.00 87.11  ?  214 HIS B CD2 1 
ATOM   6901  C  CE1 . HIS D  1 41  ? 141.529 136.371 86.917  1.00 87.11  ?  214 HIS B CE1 1 
ATOM   6902  N  NE2 . HIS D  1 41  ? 142.281 137.283 86.329  1.00 87.11  ?  214 HIS B NE2 1 
ATOM   6903  N  N   . THR D  1 42  ? 140.432 141.967 90.225  1.00 99.35  ?  215 THR B N   1 
ATOM   6904  C  CA  . THR D  1 42  ? 139.742 143.175 90.645  1.00 99.35  ?  215 THR B CA  1 
ATOM   6905  C  C   . THR D  1 42  ? 139.201 143.879 89.412  1.00 99.35  ?  215 THR B C   1 
ATOM   6906  O  O   . THR D  1 42  ? 139.970 144.277 88.532  1.00 99.35  ?  215 THR B O   1 
ATOM   6907  C  CB  . THR D  1 42  ? 140.665 144.104 91.431  1.00 99.35  ?  215 THR B CB  1 
ATOM   6908  O  OG1 . THR D  1 42  ? 141.095 143.446 92.628  1.00 99.35  ?  215 THR B OG1 1 
ATOM   6909  C  CG2 . THR D  1 42  ? 139.934 145.380 91.797  1.00 99.35  ?  215 THR B CG2 1 
ATOM   6910  N  N   . VAL D  1 43  ? 137.882 144.014 89.348  1.00 105.86 ?  216 VAL B N   1 
ATOM   6911  C  CA  . VAL D  1 43  ? 137.200 144.687 88.253  1.00 105.86 ?  216 VAL B CA  1 
ATOM   6912  C  C   . VAL D  1 43  ? 136.632 145.988 88.799  1.00 105.86 ?  216 VAL B C   1 
ATOM   6913  O  O   . VAL D  1 43  ? 136.034 146.008 89.881  1.00 105.86 ?  216 VAL B O   1 
ATOM   6914  C  CB  . VAL D  1 43  ? 136.102 143.797 87.640  1.00 105.86 ?  216 VAL B CB  1 
ATOM   6915  C  CG1 . VAL D  1 43  ? 135.350 144.525 86.537  1.00 105.86 ?  216 VAL B CG1 1 
ATOM   6916  C  CG2 . VAL D  1 43  ? 136.714 142.523 87.091  1.00 105.86 ?  216 VAL B CG2 1 
ATOM   6917  N  N   . ARG D  1 44  ? 136.850 147.072 88.068  1.00 117.86 ?  217 ARG B N   1 
ATOM   6918  C  CA  . ARG D  1 44  ? 136.443 148.401 88.486  1.00 117.86 ?  217 ARG B CA  1 
ATOM   6919  C  C   . ARG D  1 44  ? 135.139 148.768 87.793  1.00 117.86 ?  217 ARG B C   1 
ATOM   6920  O  O   . ARG D  1 44  ? 134.989 148.546 86.587  1.00 117.86 ?  217 ARG B O   1 
ATOM   6921  C  CB  . ARG D  1 44  ? 137.545 149.400 88.145  1.00 117.86 ?  217 ARG B CB  1 
ATOM   6922  C  CG  . ARG D  1 44  ? 137.294 150.824 88.557  1.00 117.86 ?  217 ARG B CG  1 
ATOM   6923  C  CD  . ARG D  1 44  ? 138.497 151.662 88.172  1.00 117.86 ?  217 ARG B CD  1 
ATOM   6924  N  NE  . ARG D  1 44  ? 138.741 151.618 86.733  1.00 117.86 ?  217 ARG B NE  1 
ATOM   6925  C  CZ  . ARG D  1 44  ? 138.112 152.371 85.837  1.00 117.86 ?  217 ARG B CZ  1 
ATOM   6926  N  NH1 . ARG D  1 44  ? 137.193 153.243 86.223  1.00 117.86 ?  217 ARG B NH1 1 
ATOM   6927  N  NH2 . ARG D  1 44  ? 138.407 152.251 84.551  1.00 117.86 ?  217 ARG B NH2 1 
ATOM   6928  N  N   . ALA D  1 45  ? 134.195 149.322 88.552  1.00 120.88 ?  218 ALA B N   1 
ATOM   6929  C  CA  . ALA D  1 45  ? 132.894 149.656 87.994  1.00 120.88 ?  218 ALA B CA  1 
ATOM   6930  C  C   . ALA D  1 45  ? 132.378 150.942 88.620  1.00 120.88 ?  218 ALA B C   1 
ATOM   6931  O  O   . ALA D  1 45  ? 132.911 151.423 89.622  1.00 120.88 ?  218 ALA B O   1 
ATOM   6932  C  CB  . ALA D  1 45  ? 131.889 148.521 88.211  1.00 120.88 ?  218 ALA B CB  1 
ATOM   6933  N  N   . SER D  1 46  ? 131.347 151.508 88.003  1.00 124.51 ?  219 SER B N   1 
ATOM   6934  C  CA  . SER D  1 46  ? 130.669 152.666 88.558  1.00 124.51 ?  219 SER B CA  1 
ATOM   6935  C  C   . SER D  1 46  ? 129.263 152.281 89.005  1.00 124.51 ?  219 SER B C   1 
ATOM   6936  O  O   . SER D  1 46  ? 128.798 151.162 88.786  1.00 124.51 ?  219 SER B O   1 
ATOM   6937  C  CB  . SER D  1 46  ? 130.612 153.800 87.538  1.00 124.51 ?  219 SER B CB  1 
ATOM   6938  O  OG  . SER D  1 46  ? 129.784 153.453 86.445  1.00 124.51 ?  219 SER B OG  1 
ATOM   6939  N  N   . LEU D  1 47  ? 128.579 153.231 89.641  1.00 127.07 ?  220 LEU B N   1 
ATOM   6940  C  CA  . LEU D  1 47  ? 127.263 152.933 90.189  1.00 127.07 ?  220 LEU B CA  1 
ATOM   6941  C  C   . LEU D  1 47  ? 126.186 152.861 89.115  1.00 127.07 ?  220 LEU B C   1 
ATOM   6942  O  O   . LEU D  1 47  ? 125.192 152.153 89.302  1.00 127.07 ?  220 LEU B O   1 
ATOM   6943  C  CB  . LEU D  1 47  ? 126.889 153.970 91.242  1.00 127.07 ?  220 LEU B CB  1 
ATOM   6944  C  CG  . LEU D  1 47  ? 127.803 153.963 92.465  1.00 127.07 ?  220 LEU B CG  1 
ATOM   6945  C  CD1 . LEU D  1 47  ? 127.419 155.079 93.414  1.00 127.07 ?  220 LEU B CD1 1 
ATOM   6946  C  CD2 . LEU D  1 47  ? 127.758 152.618 93.161  1.00 127.07 ?  220 LEU B CD2 1 
ATOM   6947  N  N   . GLU D  1 48  ? 126.354 153.571 88.000  1.00 127.39 ?  221 GLU B N   1 
ATOM   6948  C  CA  . GLU D  1 48  ? 125.434 153.404 86.883  1.00 127.39 ?  221 GLU B CA  1 
ATOM   6949  C  C   . GLU D  1 48  ? 125.669 152.096 86.150  1.00 127.39 ?  221 GLU B C   1 
ATOM   6950  O  O   . GLU D  1 48  ? 124.750 151.588 85.498  1.00 127.39 ?  221 GLU B O   1 
ATOM   6951  C  CB  . GLU D  1 48  ? 125.554 154.564 85.891  1.00 127.39 ?  221 GLU B CB  1 
ATOM   6952  C  CG  . GLU D  1 48  ? 125.088 155.908 86.418  1.00 127.39 ?  221 GLU B CG  1 
ATOM   6953  C  CD  . GLU D  1 48  ? 126.187 156.672 87.125  1.00 127.39 ?  221 GLU B CD  1 
ATOM   6954  O  OE1 . GLU D  1 48  ? 127.336 156.185 87.136  1.00 127.39 ?  221 GLU B OE1 1 
ATOM   6955  O  OE2 . GLU D  1 48  ? 125.902 157.760 87.666  1.00 127.39 -1 221 GLU B OE2 1 
ATOM   6956  N  N   . ASP D  1 49  ? 126.888 151.557 86.227  1.00 123.58 ?  222 ASP B N   1 
ATOM   6957  C  CA  . ASP D  1 49  ? 127.161 150.242 85.664  1.00 123.58 ?  222 ASP B CA  1 
ATOM   6958  C  C   . ASP D  1 49  ? 126.409 149.161 86.424  1.00 123.58 ?  222 ASP B C   1 
ATOM   6959  O  O   . ASP D  1 49  ? 125.830 148.253 85.818  1.00 123.58 ?  222 ASP B O   1 
ATOM   6960  C  CB  . ASP D  1 49  ? 128.662 149.967 85.690  1.00 123.58 ?  222 ASP B CB  1 
ATOM   6961  C  CG  . ASP D  1 49  ? 129.434 150.864 84.749  1.00 123.58 ?  222 ASP B CG  1 
ATOM   6962  O  OD1 . ASP D  1 49  ? 128.866 151.273 83.717  1.00 123.58 ?  222 ASP B OD1 1 
ATOM   6963  O  OD2 . ASP D  1 49  ? 130.607 151.170 85.049  1.00 123.58 -1 222 ASP B OD2 1 
ATOM   6964  N  N   . LEU D  1 50  ? 126.400 149.248 87.752  1.00 125.16 ?  223 LEU B N   1 
ATOM   6965  C  CA  . LEU D  1 50  ? 125.599 148.353 88.568  1.00 125.16 ?  223 LEU B CA  1 
ATOM   6966  C  C   . LEU D  1 50  ? 124.138 148.766 88.610  1.00 125.16 ?  223 LEU B C   1 
ATOM   6967  O  O   . LEU D  1 50  ? 123.294 147.957 89.005  1.00 125.16 ?  223 LEU B O   1 
ATOM   6968  C  CB  . LEU D  1 50  ? 126.148 148.303 89.994  1.00 125.16 ?  223 LEU B CB  1 
ATOM   6969  C  CG  . LEU D  1 50  ? 127.591 147.828 90.141  1.00 125.16 ?  223 LEU B CG  1 
ATOM   6970  C  CD1 . LEU D  1 50  ? 128.026 147.898 91.592  1.00 125.16 ?  223 LEU B CD1 1 
ATOM   6971  C  CD2 . LEU D  1 50  ? 127.761 146.431 89.585  1.00 125.16 ?  223 LEU B CD2 1 
ATOM   6972  N  N   . GLY D  1 51  ? 123.823 149.993 88.207  1.00 126.58 ?  224 GLY B N   1 
ATOM   6973  C  CA  . GLY D  1 51  ? 122.475 150.505 88.343  1.00 126.58 ?  224 GLY B CA  1 
ATOM   6974  C  C   . GLY D  1 51  ? 122.117 150.796 89.781  1.00 126.58 ?  224 GLY B C   1 
ATOM   6975  O  O   . GLY D  1 51  ? 120.999 150.501 90.214  1.00 126.58 ?  224 GLY B O   1 
ATOM   6976  N  N   . TRP D  1 52  ? 123.052 151.365 90.542  1.00 130.59 ?  225 TRP B N   1 
ATOM   6977  C  CA  . TRP D  1 52  ? 122.851 151.574 91.970  1.00 130.59 ?  225 TRP B CA  1 
ATOM   6978  C  C   . TRP D  1 52  ? 122.788 153.051 92.334  1.00 130.59 ?  225 TRP B C   1 
ATOM   6979  O  O   . TRP D  1 52  ? 122.929 153.401 93.510  1.00 130.59 ?  225 TRP B O   1 
ATOM   6980  C  CB  . TRP D  1 52  ? 123.965 150.915 92.782  1.00 130.59 ?  225 TRP B CB  1 
ATOM   6981  C  CG  . TRP D  1 52  ? 124.007 149.424 92.749  1.00 130.59 ?  225 TRP B CG  1 
ATOM   6982  C  CD1 . TRP D  1 52  ? 123.190 148.584 92.055  1.00 130.59 ?  225 TRP B CD1 1 
ATOM   6983  C  CD2 . TRP D  1 52  ? 124.890 148.592 93.502  1.00 130.59 ?  225 TRP B CD2 1 
ATOM   6984  N  NE1 . TRP D  1 52  ? 123.535 147.280 92.302  1.00 130.59 ?  225 TRP B NE1 1 
ATOM   6985  C  CE2 . TRP D  1 52  ? 124.574 147.260 93.194  1.00 130.59 ?  225 TRP B CE2 1 
ATOM   6986  C  CE3 . TRP D  1 52  ? 125.927 148.847 94.404  1.00 130.59 ?  225 TRP B CE3 1 
ATOM   6987  C  CZ2 . TRP D  1 52  ? 125.254 146.188 93.752  1.00 130.59 ?  225 TRP B CZ2 1 
ATOM   6988  C  CZ3 . TRP D  1 52  ? 126.601 147.785 94.954  1.00 130.59 ?  225 TRP B CZ3 1 
ATOM   6989  C  CH2 . TRP D  1 52  ? 126.265 146.472 94.627  1.00 130.59 ?  225 TRP B CH2 1 
ATOM   6990  N  N   . ALA D  1 53  ? 122.572 153.926 91.350  1.00 139.11 ?  226 ALA B N   1 
ATOM   6991  C  CA  . ALA D  1 53  ? 122.642 155.364 91.589  1.00 139.11 ?  226 ALA B CA  1 
ATOM   6992  C  C   . ALA D  1 53  ? 121.467 155.883 92.410  1.00 139.11 ?  226 ALA B C   1 
ATOM   6993  O  O   . ALA D  1 53  ? 121.551 156.978 92.977  1.00 139.11 ?  226 ALA B O   1 
ATOM   6994  C  CB  . ALA D  1 53  ? 122.717 156.117 90.258  1.00 139.11 ?  226 ALA B CB  1 
ATOM   6995  N  N   . ASP D  1 54  ? 120.376 155.124 92.491  1.00 143.01 ?  227 ASP B N   1 
ATOM   6996  C  CA  . ASP D  1 54  ? 119.200 155.593 93.210  1.00 143.01 ?  227 ASP B CA  1 
ATOM   6997  C  C   . ASP D  1 54  ? 119.297 155.371 94.713  1.00 143.01 ?  227 ASP B C   1 
ATOM   6998  O  O   . ASP D  1 54  ? 118.513 155.964 95.461  1.00 143.01 ?  227 ASP B O   1 
ATOM   6999  C  CB  . ASP D  1 54  ? 117.948 154.902 92.669  1.00 143.01 ?  227 ASP B CB  1 
ATOM   7000  C  CG  . ASP D  1 54  ? 117.592 155.358 91.271  1.00 143.01 ?  227 ASP B CG  1 
ATOM   7001  O  OD1 . ASP D  1 54  ? 117.892 156.521 90.930  1.00 143.01 ?  227 ASP B OD1 1 
ATOM   7002  O  OD2 . ASP D  1 54  ? 117.015 154.554 90.511  1.00 143.01 -1 227 ASP B OD2 1 
ATOM   7003  N  N   . TRP D  1 55  ? 120.222 154.533 95.178  1.00 140.87 ?  228 TRP B N   1 
ATOM   7004  C  CA  . TRP D  1 55  ? 120.296 154.214 96.595  1.00 140.87 ?  228 TRP B CA  1 
ATOM   7005  C  C   . TRP D  1 55  ? 121.707 154.100 97.151  1.00 140.87 ?  228 TRP B C   1 
ATOM   7006  O  O   . TRP D  1 55  ? 121.855 153.665 98.297  1.00 140.87 ?  228 TRP B O   1 
ATOM   7007  C  CB  . TRP D  1 55  ? 119.536 152.911 96.884  1.00 140.87 ?  228 TRP B CB  1 
ATOM   7008  C  CG  . TRP D  1 55  ? 120.084 151.724 96.167  1.00 140.87 ?  228 TRP B CG  1 
ATOM   7009  C  CD1 . TRP D  1 55  ? 119.851 151.374 94.872  1.00 140.87 ?  228 TRP B CD1 1 
ATOM   7010  C  CD2 . TRP D  1 55  ? 120.910 150.694 96.716  1.00 140.87 ?  228 TRP B CD2 1 
ATOM   7011  N  NE1 . TRP D  1 55  ? 120.508 150.210 94.569  1.00 140.87 ?  228 TRP B NE1 1 
ATOM   7012  C  CE2 . TRP D  1 55  ? 121.163 149.770 95.687  1.00 140.87 ?  228 TRP B CE2 1 
ATOM   7013  C  CE3 . TRP D  1 55  ? 121.469 150.469 97.975  1.00 140.87 ?  228 TRP B CE3 1 
ATOM   7014  C  CZ2 . TRP D  1 55  ? 121.951 148.642 95.876  1.00 140.87 ?  228 TRP B CZ2 1 
ATOM   7015  C  CZ3 . TRP D  1 55  ? 122.254 149.351 98.159  1.00 140.87 ?  228 TRP B CZ3 1 
ATOM   7016  C  CH2 . TRP D  1 55  ? 122.486 148.451 97.117  1.00 140.87 ?  228 TRP B CH2 1 
ATOM   7017  N  N   . VAL D  1 56  ? 122.740 154.465 96.393  1.00 144.38 ?  229 VAL B N   1 
ATOM   7018  C  CA  . VAL D  1 56  ? 124.122 154.432 96.869  1.00 144.38 ?  229 VAL B CA  1 
ATOM   7019  C  C   . VAL D  1 56  ? 124.728 155.814 96.668  1.00 144.38 ?  229 VAL B C   1 
ATOM   7020  O  O   . VAL D  1 56  ? 124.768 156.323 95.542  1.00 144.38 ?  229 VAL B O   1 
ATOM   7021  C  CB  . VAL D  1 56  ? 124.964 153.368 96.147  1.00 144.38 ?  229 VAL B CB  1 
ATOM   7022  C  CG1 . VAL D  1 56  ? 126.395 153.416 96.633  1.00 144.38 ?  229 VAL B CG1 1 
ATOM   7023  C  CG2 . VAL D  1 56  ? 124.385 151.987 96.359  1.00 144.38 ?  229 VAL B CG2 1 
ATOM   7024  N  N   . LEU D  1 57  ? 125.209 156.419 97.756  1.00 150.70 ?  230 LEU B N   1 
ATOM   7025  C  CA  . LEU D  1 57  ? 125.832 157.736 97.661  1.00 150.70 ?  230 LEU B CA  1 
ATOM   7026  C  C   . LEU D  1 57  ? 127.348 157.637 97.542  1.00 150.70 ?  230 LEU B C   1 
ATOM   7027  O  O   . LEU D  1 57  ? 127.956 158.326 96.714  1.00 150.70 ?  230 LEU B O   1 
ATOM   7028  C  CB  . LEU D  1 57  ? 125.449 158.586 98.873  1.00 150.70 ?  230 LEU B CB  1 
ATOM   7029  C  CG  . LEU D  1 57  ? 126.005 160.009 98.886  1.00 150.70 ?  230 LEU B CG  1 
ATOM   7030  C  CD1 . LEU D  1 57  ? 125.481 160.795 97.698  1.00 150.70 ?  230 LEU B CD1 1 
ATOM   7031  C  CD2 . LEU D  1 57  ? 125.656 160.708 100.188 1.00 150.70 ?  230 LEU B CD2 1 
ATOM   7032  N  N   . SER D  1 58  ? 127.974 156.792 98.355  1.00 146.32 ?  231 SER B N   1 
ATOM   7033  C  CA  . SER D  1 58  ? 129.421 156.635 98.354  1.00 146.32 ?  231 SER B CA  1 
ATOM   7034  C  C   . SER D  1 58  ? 129.743 155.172 98.618  1.00 146.32 ?  231 SER B C   1 
ATOM   7035  O  O   . SER D  1 58  ? 129.094 154.536 99.457  1.00 146.32 ?  231 SER B O   1 
ATOM   7036  C  CB  . SER D  1 58  ? 130.077 157.537 99.409  1.00 146.32 ?  231 SER B CB  1 
ATOM   7037  O  OG  . SER D  1 58  ? 131.483 157.376 99.437  1.00 146.32 ?  231 SER B OG  1 
ATOM   7038  N  N   . PRO D  1 59  ? 130.755 154.606 97.936  1.00 135.56 ?  232 PRO B N   1 
ATOM   7039  C  CA  . PRO D  1 59  ? 131.743 155.173 97.011  1.00 135.56 ?  232 PRO B CA  1 
ATOM   7040  C  C   . PRO D  1 59  ? 131.210 155.462 95.619  1.00 135.56 ?  232 PRO B C   1 
ATOM   7041  O  O   . PRO D  1 59  ? 130.244 154.845 95.185  1.00 135.56 ?  232 PRO B O   1 
ATOM   7042  C  CB  . PRO D  1 59  ? 132.807 154.082 96.939  1.00 135.56 ?  232 PRO B CB  1 
ATOM   7043  C  CG  . PRO D  1 59  ? 132.053 152.839 97.141  1.00 135.56 ?  232 PRO B CG  1 
ATOM   7044  C  CD  . PRO D  1 59  ? 130.957 153.160 98.112  1.00 135.56 ?  232 PRO B CD  1 
ATOM   7045  N  N   . ARG D  1 60  ? 131.849 156.408 94.932  1.00 135.16 ?  233 ARG B N   1 
ATOM   7046  C  CA  . ARG D  1 60  ? 131.426 156.748 93.580  1.00 135.16 ?  233 ARG B CA  1 
ATOM   7047  C  C   . ARG D  1 60  ? 132.001 155.780 92.556  1.00 135.16 ?  233 ARG B C   1 
ATOM   7048  O  O   . ARG D  1 60  ? 131.559 155.757 91.402  1.00 135.16 ?  233 ARG B O   1 
ATOM   7049  C  CB  . ARG D  1 60  ? 131.834 158.183 93.254  1.00 135.16 ?  233 ARG B CB  1 
ATOM   7050  C  CG  . ARG D  1 60  ? 131.112 159.230 94.087  1.00 135.16 ?  233 ARG B CG  1 
ATOM   7051  C  CD  . ARG D  1 60  ? 131.580 160.631 93.735  1.00 135.16 ?  233 ARG B CD  1 
ATOM   7052  N  NE  . ARG D  1 60  ? 131.216 160.998 92.370  1.00 135.16 ?  233 ARG B NE  1 
ATOM   7053  C  CZ  . ARG D  1 60  ? 131.652 162.088 91.749  1.00 135.16 ?  233 ARG B CZ  1 
ATOM   7054  N  NH1 . ARG D  1 60  ? 132.472 162.925 92.369  1.00 135.16 ?  233 ARG B NH1 1 
ATOM   7055  N  NH2 . ARG D  1 60  ? 131.270 162.341 90.505  1.00 135.16 ?  233 ARG B NH2 1 
ATOM   7056  N  N   . GLU D  1 61  ? 132.987 154.980 92.952  1.00 129.07 ?  234 GLU B N   1 
ATOM   7057  C  CA  . GLU D  1 61  ? 133.634 154.033 92.059  1.00 129.07 ?  234 GLU B CA  1 
ATOM   7058  C  C   . GLU D  1 61  ? 134.038 152.808 92.868  1.00 129.07 ?  234 GLU B C   1 
ATOM   7059  O  O   . GLU D  1 61  ? 134.701 152.930 93.902  1.00 129.07 ?  234 GLU B O   1 
ATOM   7060  C  CB  . GLU D  1 61  ? 134.842 154.687 91.386  1.00 129.07 ?  234 GLU B CB  1 
ATOM   7061  C  CG  . GLU D  1 61  ? 135.392 153.963 90.180  1.00 129.07 ?  234 GLU B CG  1 
ATOM   7062  C  CD  . GLU D  1 61  ? 136.450 154.788 89.469  1.00 129.07 ?  234 GLU B CD  1 
ATOM   7063  O  OE1 . GLU D  1 61  ? 136.832 155.850 90.004  1.00 129.07 ?  234 GLU B OE1 1 
ATOM   7064  O  OE2 . GLU D  1 61  ? 136.864 154.406 88.359  1.00 129.07 -1 234 GLU B OE2 1 
ATOM   7065  N  N   . VAL D  1 62  ? 133.633 151.629 92.400  1.00 123.69 ?  235 VAL B N   1 
ATOM   7066  C  CA  . VAL D  1 62  ? 133.626 150.417 93.212  1.00 123.69 ?  235 VAL B CA  1 
ATOM   7067  C  C   . VAL D  1 62  ? 134.650 149.439 92.644  1.00 123.69 ?  235 VAL B C   1 
ATOM   7068  O  O   . VAL D  1 62  ? 134.621 149.107 91.451  1.00 123.69 ?  235 VAL B O   1 
ATOM   7069  C  CB  . VAL D  1 62  ? 132.230 149.783 93.266  1.00 123.69 ?  235 VAL B CB  1 
ATOM   7070  C  CG1 . VAL D  1 62  ? 132.239 148.551 94.144  1.00 123.69 ?  235 VAL B CG1 1 
ATOM   7071  C  CG2 . VAL D  1 62  ? 131.213 150.788 93.766  1.00 123.69 ?  235 VAL B CG2 1 
ATOM   7072  N  N   . GLN D  1 63  ? 135.557 148.981 93.507  1.00 117.67 ?  236 GLN B N   1 
ATOM   7073  C  CA  . GLN D  1 63  ? 136.502 147.921 93.176  1.00 117.67 ?  236 GLN B CA  1 
ATOM   7074  C  C   . GLN D  1 63  ? 135.919 146.597 93.655  1.00 117.67 ?  236 GLN B C   1 
ATOM   7075  O  O   . GLN D  1 63  ? 135.703 146.415 94.857  1.00 117.67 ?  236 GLN B O   1 
ATOM   7076  C  CB  . GLN D  1 63  ? 137.846 148.179 93.852  1.00 117.67 ?  236 GLN B CB  1 
ATOM   7077  C  CG  . GLN D  1 63  ? 138.484 149.528 93.556  1.00 117.67 ?  236 GLN B CG  1 
ATOM   7078  C  CD  . GLN D  1 63  ? 138.901 149.690 92.112  1.00 117.67 ?  236 GLN B CD  1 
ATOM   7079  O  OE1 . GLN D  1 63  ? 139.345 148.740 91.470  1.00 117.67 ?  236 GLN B OE1 1 
ATOM   7080  N  NE2 . GLN D  1 63  ? 138.784 150.908 91.598  1.00 117.67 ?  236 GLN B NE2 1 
ATOM   7081  N  N   . VAL D  1 64  ? 135.672 145.664 92.736  1.00 106.19 ?  237 VAL B N   1 
ATOM   7082  C  CA  . VAL D  1 64  ? 135.037 144.396 93.069  1.00 106.19 ?  237 VAL B CA  1 
ATOM   7083  C  C   . VAL D  1 64  ? 136.043 143.273 92.864  1.00 106.19 ?  237 VAL B C   1 
ATOM   7084  O  O   . VAL D  1 64  ? 136.686 143.192 91.815  1.00 106.19 ?  237 VAL B O   1 
ATOM   7085  C  CB  . VAL D  1 64  ? 133.774 144.163 92.217  1.00 106.19 ?  237 VAL B CB  1 
ATOM   7086  C  CG1 . VAL D  1 64  ? 133.120 142.840 92.567  1.00 106.19 ?  237 VAL B CG1 1 
ATOM   7087  C  CG2 . VAL D  1 64  ? 132.800 145.296 92.410  1.00 106.19 ?  237 VAL B CG2 1 
ATOM   7088  N  N   . THR D  1 65  ? 136.179 142.407 93.866  1.00 97.73  ?  238 THR B N   1 
ATOM   7089  C  CA  . THR D  1 65  ? 137.039 141.235 93.775  1.00 97.73  ?  238 THR B CA  1 
ATOM   7090  C  C   . THR D  1 65  ? 136.194 140.034 93.374  1.00 97.73  ?  238 THR B C   1 
ATOM   7091  O  O   . THR D  1 65  ? 135.377 139.557 94.166  1.00 97.73  ?  238 THR B O   1 
ATOM   7092  C  CB  . THR D  1 65  ? 137.743 140.960 95.100  1.00 97.73  ?  238 THR B CB  1 
ATOM   7093  O  OG1 . THR D  1 65  ? 136.766 140.673 96.105  1.00 97.73  ?  238 THR B OG1 1 
ATOM   7094  C  CG2 . THR D  1 65  ? 138.559 142.163 95.523  1.00 97.73  ?  238 THR B CG2 1 
ATOM   7095  N  N   . MET D  1 66  ? 136.396 139.547 92.153  1.00 93.91  ?  239 MET B N   1 
ATOM   7096  C  CA  . MET D  1 66  ? 135.695 138.368 91.666  1.00 93.91  ?  239 MET B CA  1 
ATOM   7097  C  C   . MET D  1 66  ? 136.686 137.466 90.951  1.00 93.91  ?  239 MET B C   1 
ATOM   7098  O  O   . MET D  1 66  ? 137.821 137.859 90.688  1.00 93.91  ?  239 MET B O   1 
ATOM   7099  C  CB  . MET D  1 66  ? 134.562 138.725 90.716  1.00 93.91  ?  239 MET B CB  1 
ATOM   7100  C  CG  . MET D  1 66  ? 135.046 139.311 89.420  1.00 93.91  ?  239 MET B CG  1 
ATOM   7101  S  SD  . MET D  1 66  ? 133.670 139.696 88.349  1.00 93.91  ?  239 MET B SD  1 
ATOM   7102  C  CE  . MET D  1 66  ? 132.979 141.086 89.221  1.00 93.91  ?  239 MET B CE  1 
ATOM   7103  N  N   . CYS D  1 67  ? 136.248 136.261 90.608  1.00 86.20  ?  240 CYS B N   1 
ATOM   7104  C  CA  . CYS D  1 67  ? 137.167 135.241 90.131  1.00 86.20  ?  240 CYS B CA  1 
ATOM   7105  C  C   . CYS D  1 67  ? 136.858 134.822 88.705  1.00 86.20  ?  240 CYS B C   1 
ATOM   7106  O  O   . CYS D  1 67  ? 135.713 134.511 88.368  1.00 86.20  ?  240 CYS B O   1 
ATOM   7107  C  CB  . CYS D  1 67  ? 137.142 134.044 91.066  1.00 86.20  ?  240 CYS B CB  1 
ATOM   7108  S  SG  . CYS D  1 67  ? 137.815 134.547 92.638  1.00 86.20  ?  240 CYS B SG  1 
ATOM   7109  N  N   . ILE D  1 68  ? 137.900 134.815 87.877  1.00 86.87  ?  241 ILE B N   1 
ATOM   7110  C  CA  . ILE D  1 68  ? 137.804 134.561 86.447  1.00 86.87  ?  241 ILE B CA  1 
ATOM   7111  C  C   . ILE D  1 68  ? 138.735 133.399 86.134  1.00 86.87  ?  241 ILE B C   1 
ATOM   7112  O  O   . ILE D  1 68  ? 139.813 133.278 86.722  1.00 86.87  ?  241 ILE B O   1 
ATOM   7113  C  CB  . ILE D  1 68  ? 138.199 135.823 85.636  1.00 86.87  ?  241 ILE B CB  1 
ATOM   7114  C  CG1 . ILE D  1 68  ? 137.338 137.021 86.032  1.00 86.87  ?  241 ILE B CG1 1 
ATOM   7115  C  CG2 . ILE D  1 68  ? 138.058 135.615 84.133  1.00 86.87  ?  241 ILE B CG2 1 
ATOM   7116  C  CD1 . ILE D  1 68  ? 137.853 138.333 85.491  1.00 86.87  ?  241 ILE B CD1 1 
ATOM   7117  N  N   . GLY D  1 69  ? 138.312 132.524 85.229  1.00 85.05  ?  242 GLY B N   1 
ATOM   7118  C  CA  . GLY D  1 69  ? 139.236 131.557 84.684  1.00 85.05  ?  242 GLY B CA  1 
ATOM   7119  C  C   . GLY D  1 69  ? 138.581 130.227 84.403  1.00 85.05  ?  242 GLY B C   1 
ATOM   7120  O  O   . GLY D  1 69  ? 137.378 130.147 84.153  1.00 85.05  ?  242 GLY B O   1 
ATOM   7121  N  N   . ALA D  1 70  ? 139.394 129.176 84.433  1.00 82.79  ?  243 ALA B N   1 
ATOM   7122  C  CA  . ALA D  1 70  ? 138.941 127.819 84.186  1.00 82.79  ?  243 ALA B CA  1 
ATOM   7123  C  C   . ALA D  1 70  ? 139.503 126.901 85.258  1.00 82.79  ?  243 ALA B C   1 
ATOM   7124  O  O   . ALA D  1 70  ? 140.364 127.293 86.050  1.00 82.79  ?  243 ALA B O   1 
ATOM   7125  C  CB  . ALA D  1 70  ? 139.368 127.330 82.798  1.00 82.79  ?  243 ALA B CB  1 
ATOM   7126  N  N   . CYS D  1 71  ? 139.002 125.670 85.277  1.00 77.08  ?  244 CYS B N   1 
ATOM   7127  C  CA  . CYS D  1 71  ? 139.444 124.651 86.227  1.00 77.08  ?  244 CYS B CA  1 
ATOM   7128  C  C   . CYS D  1 71  ? 139.902 123.412 85.474  1.00 77.08  ?  244 CYS B C   1 
ATOM   7129  O  O   . CYS D  1 71  ? 139.073 122.704 84.875  1.00 77.08  ?  244 CYS B O   1 
ATOM   7130  C  CB  . CYS D  1 71  ? 138.329 124.302 87.206  1.00 77.08  ?  244 CYS B CB  1 
ATOM   7131  S  SG  . CYS D  1 71  ? 137.916 125.635 88.325  1.00 77.08  ?  244 CYS B SG  1 
ATOM   7132  N  N   . PRO D  1 72  ? 141.194 123.108 85.470  1.00 69.34  ?  245 PRO B N   1 
ATOM   7133  C  CA  . PRO D  1 72  ? 141.653 121.852 84.869  1.00 69.34  ?  245 PRO B CA  1 
ATOM   7134  C  C   . PRO D  1 72  ? 141.502 120.691 85.835  1.00 69.34  ?  245 PRO B C   1 
ATOM   7135  O  O   . PRO D  1 72  ? 140.930 120.851 86.918  1.00 69.34  ?  245 PRO B O   1 
ATOM   7136  C  CB  . PRO D  1 72  ? 143.123 122.136 84.553  1.00 69.34  ?  245 PRO B CB  1 
ATOM   7137  C  CG  . PRO D  1 72  ? 143.523 123.112 85.595  1.00 69.34  ?  245 PRO B CG  1 
ATOM   7138  C  CD  . PRO D  1 72  ? 142.319 123.971 85.865  1.00 69.34  ?  245 PRO B CD  1 
ATOM   7139  N  N   . SER D  1 73  ? 142.005 119.521 85.453  1.00 60.78  ?  246 SER B N   1 
ATOM   7140  C  CA  . SER D  1 73  ? 141.898 118.346 86.305  1.00 60.78  ?  246 SER B CA  1 
ATOM   7141  C  C   . SER D  1 73  ? 142.802 118.473 87.523  1.00 60.78  ?  246 SER B C   1 
ATOM   7142  O  O   . SER D  1 73  ? 143.935 118.953 87.425  1.00 60.78  ?  246 SER B O   1 
ATOM   7143  C  CB  . SER D  1 73  ? 142.255 117.090 85.514  1.00 60.78  ?  246 SER B CB  1 
ATOM   7144  O  OG  . SER D  1 73  ? 141.333 116.879 84.461  1.00 60.78  ?  246 SER B OG  1 
ATOM   7145  N  N   . GLN D  1 74  ? 142.268 118.078 88.679  1.00 57.89  ?  247 GLN B N   1 
ATOM   7146  C  CA  . GLN D  1 74  ? 142.938 117.987 89.975  1.00 57.89  ?  247 GLN B CA  1 
ATOM   7147  C  C   . GLN D  1 74  ? 143.443 119.325 90.505  1.00 57.89  ?  247 GLN B C   1 
ATOM   7148  O  O   . GLN D  1 74  ? 144.266 119.337 91.426  1.00 57.89  ?  247 GLN B O   1 
ATOM   7149  C  CB  . GLN D  1 74  ? 144.105 116.988 89.952  1.00 57.89  ?  247 GLN B CB  1 
ATOM   7150  C  CG  . GLN D  1 74  ? 143.700 115.542 89.729  1.00 57.89  ?  247 GLN B CG  1 
ATOM   7151  C  CD  . GLN D  1 74  ? 144.897 114.612 89.684  1.00 57.89  ?  247 GLN B CD  1 
ATOM   7152  O  OE1 . GLN D  1 74  ? 146.043 115.055 89.757  1.00 57.89  ?  247 GLN B OE1 1 
ATOM   7153  N  NE2 . GLN D  1 74  ? 144.637 113.318 89.560  1.00 57.89  ?  247 GLN B NE2 1 
ATOM   7154  N  N   . PHE D  1 75  ? 142.983 120.450 89.966  1.00 60.16  ?  248 PHE B N   1 
ATOM   7155  C  CA  . PHE D  1 75  ? 143.452 121.749 90.431  1.00 60.16  ?  248 PHE B CA  1 
ATOM   7156  C  C   . PHE D  1 75  ? 142.547 122.272 91.536  1.00 60.16  ?  248 PHE B C   1 
ATOM   7157  O  O   . PHE D  1 75  ? 141.502 122.867 91.250  1.00 60.16  ?  248 PHE B O   1 
ATOM   7158  C  CB  . PHE D  1 75  ? 143.517 122.756 89.286  1.00 60.16  ?  248 PHE B CB  1 
ATOM   7159  C  CG  . PHE D  1 75  ? 144.044 124.100 89.700  1.00 60.16  ?  248 PHE B CG  1 
ATOM   7160  C  CD1 . PHE D  1 75  ? 145.392 124.277 89.953  1.00 60.16  ?  248 PHE B CD1 1 
ATOM   7161  C  CD2 . PHE D  1 75  ? 143.192 125.184 89.844  1.00 60.16  ?  248 PHE B CD2 1 
ATOM   7162  C  CE1 . PHE D  1 75  ? 145.882 125.510 90.342  1.00 60.16  ?  248 PHE B CE1 1 
ATOM   7163  C  CE2 . PHE D  1 75  ? 143.676 126.417 90.234  1.00 60.16  ?  248 PHE B CE2 1 
ATOM   7164  C  CZ  . PHE D  1 75  ? 145.023 126.580 90.481  1.00 60.16  ?  248 PHE B CZ  1 
ATOM   7165  N  N   . ARG D  1 76  ? 142.954 122.033 92.786  1.00 54.92  ?  249 ARG B N   1 
ATOM   7166  C  CA  . ARG D  1 76  ? 142.337 122.589 93.997  1.00 54.92  ?  249 ARG B CA  1 
ATOM   7167  C  C   . ARG D  1 76  ? 140.867 122.171 94.107  1.00 54.92  ?  249 ARG B C   1 
ATOM   7168  O  O   . ARG D  1 76  ? 139.976 122.970 94.398  1.00 54.92  ?  249 ARG B O   1 
ATOM   7169  C  CB  . ARG D  1 76  ? 142.505 124.114 94.046  1.00 54.92  ?  249 ARG B CB  1 
ATOM   7170  C  CG  . ARG D  1 76  ? 142.401 124.741 95.437  1.00 54.92  ?  249 ARG B CG  1 
ATOM   7171  C  CD  . ARG D  1 76  ? 142.536 126.249 95.369  1.00 54.92  ?  249 ARG B CD  1 
ATOM   7172  N  NE  . ARG D  1 76  ? 143.844 126.662 94.879  1.00 54.92  ?  249 ARG B NE  1 
ATOM   7173  C  CZ  . ARG D  1 76  ? 144.163 127.916 94.586  1.00 54.92  ?  249 ARG B CZ  1 
ATOM   7174  N  NH1 . ARG D  1 76  ? 143.269 128.880 94.743  1.00 54.92  ?  249 ARG B NH1 1 
ATOM   7175  N  NH2 . ARG D  1 76  ? 145.376 128.208 94.142  1.00 54.92  ?  249 ARG B NH2 1 
ATOM   7176  N  N   . ALA D  1 77  ? 140.608 120.898 93.828  1.00 43.30  ?  250 ALA B N   1 
ATOM   7177  C  CA  . ALA D  1 77  ? 139.268 120.341 93.962  1.00 43.30  ?  250 ALA B CA  1 
ATOM   7178  C  C   . ALA D  1 77  ? 138.942 120.224 95.444  1.00 43.30  ?  250 ALA B C   1 
ATOM   7179  O  O   . ALA D  1 77  ? 139.462 119.343 96.132  1.00 43.30  ?  250 ALA B O   1 
ATOM   7180  C  CB  . ALA D  1 77  ? 139.182 118.987 93.267  1.00 43.30  ?  250 ALA B CB  1 
ATOM   7181  N  N   . ALA D  1 78  ? 138.077 121.109 95.940  1.00 41.81  ?  251 ALA B N   1 
ATOM   7182  C  CA  . ALA D  1 78  ? 137.885 121.220 97.382  1.00 41.81  ?  251 ALA B CA  1 
ATOM   7183  C  C   . ALA D  1 78  ? 137.010 120.112 97.954  1.00 41.81  ?  251 ALA B C   1 
ATOM   7184  O  O   . ALA D  1 78  ? 136.837 120.038 99.176  1.00 41.81  ?  251 ALA B O   1 
ATOM   7185  C  CB  . ALA D  1 78  ? 137.287 122.581 97.728  1.00 41.81  ?  251 ALA B CB  1 
ATOM   7186  N  N   . ASN D  1 79  ? 136.445 119.257 97.110  1.00 38.32  ?  252 ASN B N   1 
ATOM   7187  C  CA  . ASN D  1 79  ? 135.673 118.118 97.587  1.00 38.32  ?  252 ASN B CA  1 
ATOM   7188  C  C   . ASN D  1 79  ? 135.800 116.974 96.587  1.00 38.32  ?  252 ASN B C   1 
ATOM   7189  O  O   . ASN D  1 79  ? 136.259 117.156 95.456  1.00 38.32  ?  252 ASN B O   1 
ATOM   7190  C  CB  . ASN D  1 79  ? 134.213 118.509 97.843  1.00 38.32  ?  252 ASN B CB  1 
ATOM   7191  C  CG  . ASN D  1 79  ? 133.533 119.111 96.624  1.00 38.32  ?  252 ASN B CG  1 
ATOM   7192  O  OD1 . ASN D  1 79  ? 134.126 119.252 95.555  1.00 38.32  ?  252 ASN B OD1 1 
ATOM   7193  N  ND2 . ASN D  1 79  ? 132.263 119.453 96.783  1.00 38.32  ?  252 ASN B ND2 1 
ATOM   7194  N  N   . MET D  1 80  ? 135.366 115.784 97.005  1.00 33.08  ?  253 MET B N   1 
ATOM   7195  C  CA  . MET D  1 80  ? 135.375 114.637 96.108  1.00 33.08  ?  253 MET B CA  1 
ATOM   7196  C  C   . MET D  1 80  ? 134.304 114.732 95.038  1.00 33.08  ?  253 MET B C   1 
ATOM   7197  O  O   . MET D  1 80  ? 134.407 114.052 94.010  1.00 33.08  ?  253 MET B O   1 
ATOM   7198  C  CB  . MET D  1 80  ? 135.187 113.337 96.890  1.00 33.08  ?  253 MET B CB  1 
ATOM   7199  C  CG  . MET D  1 80  ? 136.326 113.005 97.822  1.00 33.08  ?  253 MET B CG  1 
ATOM   7200  S  SD  . MET D  1 80  ? 136.088 111.409 98.609  1.00 33.08  ?  253 MET B SD  1 
ATOM   7201  C  CE  . MET D  1 80  ? 136.348 110.339 97.200  1.00 33.08  ?  253 MET B CE  1 
ATOM   7202  N  N   . HIS D  1 81  ? 133.277 115.560 95.259  1.00 35.87  ?  254 HIS B N   1 
ATOM   7203  C  CA  . HIS D  1 81  ? 132.254 115.763 94.242  1.00 35.87  ?  254 HIS B CA  1 
ATOM   7204  C  C   . HIS D  1 81  ? 132.834 116.440 93.010  1.00 35.87  ?  254 HIS B C   1 
ATOM   7205  O  O   . HIS D  1 81  ? 132.382 116.184 91.889  1.00 35.87  ?  254 HIS B O   1 
ATOM   7206  C  CB  . HIS D  1 81  ? 131.099 116.586 94.806  1.00 35.87  ?  254 HIS B CB  1 
ATOM   7207  C  CG  . HIS D  1 81  ? 129.956 116.742 93.855  1.00 35.87  ?  254 HIS B CG  1 
ATOM   7208  N  ND1 . HIS D  1 81  ? 129.049 115.735 93.612  1.00 35.87  ?  254 HIS B ND1 1 
ATOM   7209  C  CD2 . HIS D  1 81  ? 129.586 117.778 93.066  1.00 35.87  ?  254 HIS B CD2 1 
ATOM   7210  C  CE1 . HIS D  1 81  ? 128.162 116.147 92.725  1.00 35.87  ?  254 HIS B CE1 1 
ATOM   7211  N  NE2 . HIS D  1 81  ? 128.465 117.384 92.378  1.00 35.87  ?  254 HIS B NE2 1 
ATOM   7212  N  N   . ALA D  1 82  ? 133.859 117.273 93.195  1.00 40.67  ?  255 ALA B N   1 
ATOM   7213  C  CA  . ALA D  1 82  ? 134.544 117.869 92.056  1.00 40.67  ?  255 ALA B CA  1 
ATOM   7214  C  C   . ALA D  1 82  ? 135.315 116.823 91.264  1.00 40.67  ?  255 ALA B C   1 
ATOM   7215  O  O   . ALA D  1 82  ? 135.354 116.881 90.032  1.00 40.67  ?  255 ALA B O   1 
ATOM   7216  C  CB  . ALA D  1 82  ? 135.480 118.977 92.526  1.00 40.67  ?  255 ALA B CB  1 
ATOM   7217  N  N   . GLN D  1 83  ? 135.915 115.847 91.948  1.00 39.34  ?  256 GLN B N   1 
ATOM   7218  C  CA  . GLN D  1 83  ? 136.631 114.783 91.250  1.00 39.34  ?  256 GLN B CA  1 
ATOM   7219  C  C   . GLN D  1 83  ? 135.679 113.875 90.485  1.00 39.34  ?  256 GLN B C   1 
ATOM   7220  O  O   . GLN D  1 83  ? 135.969 113.480 89.347  1.00 39.34  ?  256 GLN B O   1 
ATOM   7221  C  CB  . GLN D  1 83  ? 137.461 113.967 92.238  1.00 39.34  ?  256 GLN B CB  1 
ATOM   7222  C  CG  . GLN D  1 83  ? 138.663 114.700 92.785  1.00 39.34  ?  256 GLN B CG  1 
ATOM   7223  C  CD  . GLN D  1 83  ? 139.479 113.844 93.728  1.00 39.34  ?  256 GLN B CD  1 
ATOM   7224  O  OE1 . GLN D  1 83  ? 139.078 112.735 94.079  1.00 39.34  ?  256 GLN B OE1 1 
ATOM   7225  N  NE2 . GLN D  1 83  ? 140.644 114.342 94.122  1.00 39.34  ?  256 GLN B NE2 1 
ATOM   7226  N  N   . ILE D  1 84  ? 134.537 113.543 91.093  1.00 39.04  ?  257 ILE B N   1 
ATOM   7227  C  CA  . ILE D  1 84  ? 133.524 112.740 90.415  1.00 39.04  ?  257 ILE B CA  1 
ATOM   7228  C  C   . ILE D  1 84  ? 132.963 113.496 89.223  1.00 39.04  ?  257 ILE B C   1 
ATOM   7229  O  O   . ILE D  1 84  ? 132.741 112.921 88.150  1.00 39.04  ?  257 ILE B O   1 
ATOM   7230  C  CB  . ILE D  1 84  ? 132.417 112.352 91.409  1.00 39.04  ?  257 ILE B CB  1 
ATOM   7231  C  CG1 . ILE D  1 84  ? 132.996 111.504 92.526  1.00 39.04  ?  257 ILE B CG1 1 
ATOM   7232  C  CG2 . ILE D  1 84  ? 131.305 111.582 90.727  1.00 39.04  ?  257 ILE B CG2 1 
ATOM   7233  C  CD1 . ILE D  1 84  ? 132.057 111.329 93.654  1.00 39.04  ?  257 ILE B CD1 1 
ATOM   7234  N  N   . LYS D  1 85  ? 132.770 114.804 89.380  1.00 48.07  ?  258 LYS B N   1 
ATOM   7235  C  CA  . LYS D  1 85  ? 132.232 115.615 88.301  1.00 48.07  ?  258 LYS B CA  1 
ATOM   7236  C  C   . LYS D  1 85  ? 133.242 115.759 87.172  1.00 48.07  ?  258 LYS B C   1 
ATOM   7237  O  O   . LYS D  1 85  ? 132.859 115.748 85.999  1.00 48.07  ?  258 LYS B O   1 
ATOM   7238  C  CB  . LYS D  1 85  ? 131.810 116.969 88.870  1.00 48.07  ?  258 LYS B CB  1 
ATOM   7239  C  CG  . LYS D  1 85  ? 130.900 117.795 87.995  1.00 48.07  ?  258 LYS B CG  1 
ATOM   7240  C  CD  . LYS D  1 85  ? 130.390 118.999 88.770  1.00 48.07  ?  258 LYS B CD  1 
ATOM   7241  C  CE  . LYS D  1 85  ? 129.414 119.813 87.949  1.00 48.07  ?  258 LYS B CE  1 
ATOM   7242  N  NZ  . LYS D  1 85  ? 128.912 120.990 88.703  1.00 48.07  ?  258 LYS B NZ  1 
ATOM   7243  N  N   . THR D  1 86  ? 134.534 115.803 87.509  1.00 46.76  ?  259 THR B N   1 
ATOM   7244  C  CA  . THR D  1 86  ? 135.584 115.831 86.496  1.00 46.76  ?  259 THR B CA  1 
ATOM   7245  C  C   . THR D  1 86  ? 135.635 114.518 85.725  1.00 46.76  ?  259 THR B C   1 
ATOM   7246  O  O   . THR D  1 86  ? 135.715 114.514 84.490  1.00 46.76  ?  259 THR B O   1 
ATOM   7247  C  CB  . THR D  1 86  ? 136.933 116.113 87.157  1.00 46.76  ?  259 THR B CB  1 
ATOM   7248  O  OG1 . THR D  1 86  ? 136.865 117.346 87.881  1.00 46.76  ?  259 THR B OG1 1 
ATOM   7249  C  CG2 . THR D  1 86  ? 138.028 116.220 86.113  1.00 46.76  ?  259 THR B CG2 1 
ATOM   7250  N  N   . SER D  1 87  ? 135.565 113.392 86.441  1.00 50.29  ?  260 SER B N   1 
ATOM   7251  C  CA  . SER D  1 87  ? 135.640 112.087 85.788  1.00 50.29  ?  260 SER B CA  1 
ATOM   7252  C  C   . SER D  1 87  ? 134.418 111.827 84.915  1.00 50.29  ?  260 SER B C   1 
ATOM   7253  O  O   . SER D  1 87  ? 134.540 111.286 83.810  1.00 50.29  ?  260 SER B O   1 
ATOM   7254  C  CB  . SER D  1 87  ? 135.793 110.987 86.836  1.00 50.29  ?  260 SER B CB  1 
ATOM   7255  O  OG  . SER D  1 87  ? 137.012 111.124 87.542  1.00 50.29  ?  260 SER B OG  1 
ATOM   7256  N  N   . LEU D  1 88  ? 133.236 112.232 85.376  1.00 54.47  ?  261 LEU B N   1 
ATOM   7257  C  CA  . LEU D  1 88  ? 132.040 112.046 84.571  1.00 54.47  ?  261 LEU B CA  1 
ATOM   7258  C  C   . LEU D  1 88  ? 131.939 113.063 83.445  1.00 54.47  ?  261 LEU B C   1 
ATOM   7259  O  O   . LEU D  1 88  ? 131.247 112.802 82.457  1.00 54.47  ?  261 LEU B O   1 
ATOM   7260  C  CB  . LEU D  1 88  ? 130.802 112.092 85.462  1.00 54.47  ?  261 LEU B CB  1 
ATOM   7261  C  CG  . LEU D  1 88  ? 130.714 110.866 86.371  1.00 54.47  ?  261 LEU B CG  1 
ATOM   7262  C  CD1 . LEU D  1 88  ? 129.609 110.995 87.387  1.00 54.47  ?  261 LEU B CD1 1 
ATOM   7263  C  CD2 . LEU D  1 88  ? 130.498 109.628 85.526  1.00 54.47  ?  261 LEU B CD2 1 
ATOM   7264  N  N   . HIS D  1 89  ? 132.612 114.210 83.562  1.00 59.60  ?  262 HIS B N   1 
ATOM   7265  C  CA  . HIS D  1 89  ? 132.738 115.095 82.413  1.00 59.60  ?  262 HIS B CA  1 
ATOM   7266  C  C   . HIS D  1 89  ? 133.701 114.521 81.386  1.00 59.60  ?  262 HIS B C   1 
ATOM   7267  O  O   . HIS D  1 89  ? 133.521 114.736 80.182  1.00 59.60  ?  262 HIS B O   1 
ATOM   7268  C  CB  . HIS D  1 89  ? 133.196 116.483 82.863  1.00 59.60  ?  262 HIS B CB  1 
ATOM   7269  C  CG  . HIS D  1 89  ? 133.317 117.472 81.747  1.00 59.60  ?  262 HIS B CG  1 
ATOM   7270  N  ND1 . HIS D  1 89  ? 132.221 118.011 81.108  1.00 59.60  ?  262 HIS B ND1 1 
ATOM   7271  C  CD2 . HIS D  1 89  ? 134.404 118.026 81.160  1.00 59.60  ?  262 HIS B CD2 1 
ATOM   7272  C  CE1 . HIS D  1 89  ? 132.628 118.850 80.172  1.00 59.60  ?  262 HIS B CE1 1 
ATOM   7273  N  NE2 . HIS D  1 89  ? 133.948 118.878 80.184  1.00 59.60  ?  262 HIS B NE2 1 
ATOM   7274  N  N   . ARG D  1 90  ? 134.723 113.794 81.843  1.00 62.87  ?  263 ARG B N   1 
ATOM   7275  C  CA  . ARG D  1 90  ? 135.609 113.096 80.917  1.00 62.87  ?  263 ARG B CA  1 
ATOM   7276  C  C   . ARG D  1 90  ? 134.901 111.930 80.241  1.00 62.87  ?  263 ARG B C   1 
ATOM   7277  O  O   . ARG D  1 90  ? 135.181 111.624 79.076  1.00 62.87  ?  263 ARG B O   1 
ATOM   7278  C  CB  . ARG D  1 90  ? 136.861 112.608 81.646  1.00 62.87  ?  263 ARG B CB  1 
ATOM   7279  C  CG  . ARG D  1 90  ? 137.796 113.719 82.090  1.00 62.87  ?  263 ARG B CG  1 
ATOM   7280  C  CD  . ARG D  1 90  ? 138.968 113.175 82.889  1.00 62.87  ?  263 ARG B CD  1 
ATOM   7281  N  NE  . ARG D  1 90  ? 139.843 112.335 82.078  1.00 62.87  ?  263 ARG B NE  1 
ATOM   7282  C  CZ  . ARG D  1 90  ? 140.865 112.796 81.363  1.00 62.87  ?  263 ARG B CZ  1 
ATOM   7283  N  NH1 . ARG D  1 90  ? 141.612 111.960 80.654  1.00 62.87  ?  263 ARG B NH1 1 
ATOM   7284  N  NH2 . ARG D  1 90  ? 141.141 114.093 81.357  1.00 62.87  ?  263 ARG B NH2 1 
ATOM   7285  N  N   . LEU D  1 91  ? 133.987 111.267 80.949  1.00 62.31  ?  264 LEU B N   1 
ATOM   7286  C  CA  . LEU D  1 91  ? 133.208 110.194 80.334  1.00 62.31  ?  264 LEU B CA  1 
ATOM   7287  C  C   . LEU D  1 91  ? 132.088 110.752 79.461  1.00 62.31  ?  264 LEU B C   1 
ATOM   7288  O  O   . LEU D  1 91  ? 132.071 110.548 78.243  1.00 62.31  ?  264 LEU B O   1 
ATOM   7289  C  CB  . LEU D  1 91  ? 132.632 109.277 81.413  1.00 62.31  ?  264 LEU B CB  1 
ATOM   7290  C  CG  . LEU D  1 91  ? 131.746 108.166 80.850  1.00 62.31  ?  264 LEU B CG  1 
ATOM   7291  C  CD1 . LEU D  1 91  ? 132.548 107.196 79.997  1.00 62.31  ?  264 LEU B CD1 1 
ATOM   7292  C  CD2 . LEU D  1 91  ? 131.017 107.446 81.963  1.00 62.31  ?  264 LEU B CD2 1 
ATOM   7293  N  N   . LYS D  1 92  ? 131.141 111.460 80.073  1.00 67.77  ?  265 LYS B N   1 
ATOM   7294  C  CA  . LYS D  1 92  ? 129.990 112.008 79.364  1.00 67.77  ?  265 LYS B CA  1 
ATOM   7295  C  C   . LYS D  1 92  ? 130.128 113.521 79.309  1.00 67.77  ?  265 LYS B C   1 
ATOM   7296  O  O   . LYS D  1 92  ? 129.854 114.201 80.312  1.00 67.77  ?  265 LYS B O   1 
ATOM   7297  C  CB  . LYS D  1 92  ? 128.689 111.607 80.055  1.00 67.77  ?  265 LYS B CB  1 
ATOM   7298  C  CG  . LYS D  1 92  ? 128.433 110.106 80.050  1.00 67.77  ?  265 LYS B CG  1 
ATOM   7299  C  CD  . LYS D  1 92  ? 127.092 109.756 80.678  1.00 67.77  ?  265 LYS B CD  1 
ATOM   7300  C  CE  . LYS D  1 92  ? 127.115 109.917 82.188  1.00 67.77  ?  265 LYS B CE  1 
ATOM   7301  N  NZ  . LYS D  1 92  ? 128.003 108.917 82.838  1.00 67.77  ?  265 LYS B NZ  1 
ATOM   7302  N  N   . PRO D  1 93  ? 130.543 114.092 78.177  1.00 69.95  ?  266 PRO B N   1 
ATOM   7303  C  CA  . PRO D  1 93  ? 130.920 115.514 78.175  1.00 69.95  ?  266 PRO B CA  1 
ATOM   7304  C  C   . PRO D  1 93  ? 129.744 116.476 78.222  1.00 69.95  ?  266 PRO B C   1 
ATOM   7305  O  O   . PRO D  1 93  ? 129.821 117.497 78.914  1.00 69.95  ?  266 PRO B O   1 
ATOM   7306  C  CB  . PRO D  1 93  ? 131.713 115.656 76.868  1.00 69.95  ?  266 PRO B CB  1 
ATOM   7307  C  CG  . PRO D  1 93  ? 131.176 114.584 75.985  1.00 69.95  ?  266 PRO B CG  1 
ATOM   7308  C  CD  . PRO D  1 93  ? 130.817 113.438 76.887  1.00 69.95  ?  266 PRO B CD  1 
ATOM   7309  N  N   . ASP D  1 94  ? 128.654 116.179 77.518  1.00 78.00  ?  267 ASP B N   1 
ATOM   7310  C  CA  . ASP D  1 94  ? 127.565 117.132 77.350  1.00 78.00  ?  267 ASP B CA  1 
ATOM   7311  C  C   . ASP D  1 94  ? 126.414 116.902 78.321  1.00 78.00  ?  267 ASP B C   1 
ATOM   7312  O  O   . ASP D  1 94  ? 125.438 117.656 78.307  1.00 78.00  ?  267 ASP B O   1 
ATOM   7313  C  CB  . ASP D  1 94  ? 127.047 117.100 75.911  1.00 78.00  ?  267 ASP B CB  1 
ATOM   7314  C  CG  . ASP D  1 94  ? 128.050 117.663 74.922  1.00 78.00  ?  267 ASP B CG  1 
ATOM   7315  O  OD1 . ASP D  1 94  ? 128.856 118.529 75.321  1.00 78.00  ?  267 ASP B OD1 1 
ATOM   7316  O  OD2 . ASP D  1 94  ? 128.034 117.241 73.747  1.00 78.00  -1 267 ASP B OD2 1 
ATOM   7317  N  N   . THR D  1 95  ? 126.502 115.879 79.166  1.00 71.55  ?  268 THR B N   1 
ATOM   7318  C  CA  . THR D  1 95  ? 125.504 115.695 80.209  1.00 71.55  ?  268 THR B CA  1 
ATOM   7319  C  C   . THR D  1 95  ? 126.000 116.310 81.508  1.00 71.55  ?  268 THR B C   1 
ATOM   7320  O  O   . THR D  1 95  ? 125.306 117.120 82.129  1.00 71.55  ?  268 THR B O   1 
ATOM   7321  C  CB  . THR D  1 95  ? 125.186 114.214 80.405  1.00 71.55  ?  268 THR B CB  1 
ATOM   7322  O  OG1 . THR D  1 95  ? 124.674 113.670 79.182  1.00 71.55  ?  268 THR B OG1 1 
ATOM   7323  C  CG2 . THR D  1 95  ? 124.152 114.036 81.505  1.00 71.55  ?  268 THR B CG2 1 
ATOM   7324  N  N   . VAL D  1 96  ? 127.209 115.943 81.914  1.00 64.62  ?  269 VAL B N   1 
ATOM   7325  C  CA  . VAL D  1 96  ? 127.803 116.451 83.145  1.00 64.62  ?  269 VAL B CA  1 
ATOM   7326  C  C   . VAL D  1 96  ? 128.661 117.665 82.812  1.00 64.62  ?  269 VAL B C   1 
ATOM   7327  O  O   . VAL D  1 96  ? 129.512 117.591 81.914  1.00 64.62  ?  269 VAL B O   1 
ATOM   7328  C  CB  . VAL D  1 96  ? 128.629 115.364 83.845  1.00 64.62  ?  269 VAL B CB  1 
ATOM   7329  C  CG1 . VAL D  1 96  ? 129.304 115.922 85.084  1.00 64.62  ?  269 VAL B CG1 1 
ATOM   7330  C  CG2 . VAL D  1 96  ? 127.749 114.177 84.185  1.00 64.62  ?  269 VAL B CG2 1 
ATOM   7331  N  N   . PRO D  1 97  ? 128.473 118.795 83.485  1.00 61.02  ?  270 PRO B N   1 
ATOM   7332  C  CA  . PRO D  1 97  ? 129.302 119.969 83.206  1.00 61.02  ?  270 PRO B CA  1 
ATOM   7333  C  C   . PRO D  1 97  ? 130.615 119.940 83.969  1.00 61.02  ?  270 PRO B C   1 
ATOM   7334  O  O   . PRO D  1 97  ? 130.762 119.257 84.984  1.00 61.02  ?  270 PRO B O   1 
ATOM   7335  C  CB  . PRO D  1 97  ? 128.421 121.130 83.681  1.00 61.02  ?  270 PRO B CB  1 
ATOM   7336  C  CG  . PRO D  1 97  ? 127.620 120.537 84.783  1.00 61.02  ?  270 PRO B CG  1 
ATOM   7337  C  CD  . PRO D  1 97  ? 127.361 119.107 84.398  1.00 61.02  ?  270 PRO B CD  1 
ATOM   7338  N  N   . ALA D  1 98  ? 131.582 120.693 83.451  1.00 60.32  ?  271 ALA B N   1 
ATOM   7339  C  CA  . ALA D  1 98  ? 132.843 120.893 84.139  1.00 60.32  ?  271 ALA B CA  1 
ATOM   7340  C  C   . ALA D  1 98  ? 132.617 121.730 85.398  1.00 60.32  ?  271 ALA B C   1 
ATOM   7341  O  O   . ALA D  1 98  ? 131.680 122.529 85.453  1.00 60.32  ?  271 ALA B O   1 
ATOM   7342  C  CB  . ALA D  1 98  ? 133.839 121.585 83.209  1.00 60.32  ?  271 ALA B CB  1 
ATOM   7343  N  N   . PRO D  1 99  ? 133.444 121.553 86.431  1.00 58.10  ?  272 PRO B N   1 
ATOM   7344  C  CA  . PRO D  1 99  ? 133.271 122.353 87.649  1.00 58.10  ?  272 PRO B CA  1 
ATOM   7345  C  C   . PRO D  1 99  ? 133.661 123.809 87.434  1.00 58.10  ?  272 PRO B C   1 
ATOM   7346  O  O   . PRO D  1 99  ? 134.519 124.138 86.613  1.00 58.10  ?  272 PRO B O   1 
ATOM   7347  C  CB  . PRO D  1 99  ? 134.195 121.664 88.657  1.00 58.10  ?  272 PRO B CB  1 
ATOM   7348  C  CG  . PRO D  1 99  ? 135.198 120.981 87.838  1.00 58.10  ?  272 PRO B CG  1 
ATOM   7349  C  CD  . PRO D  1 99  ? 134.488 120.529 86.607  1.00 58.10  ?  272 PRO B CD  1 
ATOM   7350  N  N   . CYS D  1 100 ? 133.006 124.689 88.186  1.00 61.55  ?  273 CYS B N   1 
ATOM   7351  C  CA  . CYS D  1 100 ? 133.200 126.128 88.082  1.00 61.55  ?  273 CYS B CA  1 
ATOM   7352  C  C   . CYS D  1 100 ? 134.078 126.650 89.214  1.00 61.55  ?  273 CYS B C   1 
ATOM   7353  O  O   . CYS D  1 100 ? 134.180 126.053 90.288  1.00 61.55  ?  273 CYS B O   1 
ATOM   7354  C  CB  . CYS D  1 100 ? 131.857 126.864 88.098  1.00 61.55  ?  273 CYS B CB  1 
ATOM   7355  S  SG  . CYS D  1 100 ? 130.832 126.665 86.624  1.00 61.55  ?  273 CYS B SG  1 
ATOM   7356  N  N   . CYS D  1 101 ? 134.707 127.793 88.953  1.00 65.43  ?  274 CYS B N   1 
ATOM   7357  C  CA  . CYS D  1 101 ? 135.521 128.511 89.926  1.00 65.43  ?  274 CYS B CA  1 
ATOM   7358  C  C   . CYS D  1 101 ? 134.633 129.462 90.716  1.00 65.43  ?  274 CYS B C   1 
ATOM   7359  O  O   . CYS D  1 101 ? 134.184 130.481 90.188  1.00 65.43  ?  274 CYS B O   1 
ATOM   7360  C  CB  . CYS D  1 101 ? 136.640 129.276 89.218  1.00 65.43  ?  274 CYS B CB  1 
ATOM   7361  S  SG  . CYS D  1 101 ? 137.608 130.419 90.238  1.00 65.43  ?  274 CYS B SG  1 
ATOM   7362  N  N   . VAL D  1 102 ? 134.369 129.127 91.976  1.00 59.42  ?  275 VAL B N   1 
ATOM   7363  C  CA  . VAL D  1 102 ? 133.461 129.926 92.796  1.00 59.42  ?  275 VAL B CA  1 
ATOM   7364  C  C   . VAL D  1 102 ? 134.196 130.401 94.048  1.00 59.42  ?  275 VAL B C   1 
ATOM   7365  O  O   . VAL D  1 102 ? 135.244 129.835 94.397  1.00 59.42  ?  275 VAL B O   1 
ATOM   7366  C  CB  . VAL D  1 102 ? 132.200 129.131 93.168  1.00 59.42  ?  275 VAL B CB  1 
ATOM   7367  C  CG1 . VAL D  1 102 ? 131.494 128.605 91.930  1.00 59.42  ?  275 VAL B CG1 1 
ATOM   7368  C  CG2 . VAL D  1 102 ? 132.524 128.045 94.149  1.00 59.42  ?  275 VAL B CG2 1 
ATOM   7369  N  N   . PRO D  1 103 ? 133.711 131.443 94.730  1.00 67.50  ?  276 PRO B N   1 
ATOM   7370  C  CA  . PRO D  1 103 ? 134.370 131.870 95.969  1.00 67.50  ?  276 PRO B CA  1 
ATOM   7371  C  C   . PRO D  1 103 ? 134.125 130.920 97.125  1.00 67.50  ?  276 PRO B C   1 
ATOM   7372  O  O   . PRO D  1 103 ? 133.143 130.178 97.151  1.00 67.50  ?  276 PRO B O   1 
ATOM   7373  C  CB  . PRO D  1 103 ? 133.745 133.239 96.241  1.00 67.50  ?  276 PRO B CB  1 
ATOM   7374  C  CG  . PRO D  1 103 ? 133.312 133.712 94.926  1.00 67.50  ?  276 PRO B CG  1 
ATOM   7375  C  CD  . PRO D  1 103 ? 132.846 132.510 94.200  1.00 67.50  ?  276 PRO B CD  1 
ATOM   7376  N  N   . ALA D  1 104 ? 135.038 130.965 98.095  1.00 76.64  ?  277 ALA B N   1 
ATOM   7377  C  CA  . ALA D  1 104 ? 134.947 130.192 99.325  1.00 76.64  ?  277 ALA B CA  1 
ATOM   7378  C  C   . ALA D  1 104 ? 134.435 131.023 100.492 1.00 76.64  ?  277 ALA B C   1 
ATOM   7379  O  O   . ALA D  1 104 ? 133.444 130.657 101.129 1.00 76.64  ?  277 ALA B O   1 
ATOM   7380  C  CB  . ALA D  1 104 ? 136.317 129.609 99.681  1.00 76.64  ?  277 ALA B CB  1 
ATOM   7381  N  N   . SER D  1 105 ? 135.106 132.129 100.792 1.00 88.38  ?  278 SER B N   1 
ATOM   7382  C  CA  . SER D  1 105 ? 134.690 133.047 101.838 1.00 88.38  ?  278 SER B CA  1 
ATOM   7383  C  C   . SER D  1 105 ? 134.606 134.448 101.255 1.00 88.38  ?  278 SER B C   1 
ATOM   7384  O  O   . SER D  1 105 ? 135.215 134.747 100.226 1.00 88.38  ?  278 SER B O   1 
ATOM   7385  C  CB  . SER D  1 105 ? 135.655 133.020 103.027 1.00 88.38  ?  278 SER B CB  1 
ATOM   7386  O  OG  . SER D  1 105 ? 136.934 133.494 102.648 1.00 88.38  ?  278 SER B OG  1 
ATOM   7387  N  N   . TYR D  1 106 ? 133.847 135.310 101.920 1.00 93.24  ?  279 TYR B N   1 
ATOM   7388  C  CA  . TYR D  1 106 ? 133.556 136.634 101.395 1.00 93.24  ?  279 TYR B CA  1 
ATOM   7389  C  C   . TYR D  1 106 ? 134.019 137.719 102.356 1.00 93.24  ?  279 TYR B C   1 
ATOM   7390  O  O   . TYR D  1 106 ? 134.043 137.524 103.574 1.00 93.24  ?  279 TYR B O   1 
ATOM   7391  C  CB  . TYR D  1 106 ? 132.062 136.790 101.113 1.00 93.24  ?  279 TYR B CB  1 
ATOM   7392  C  CG  . TYR D  1 106 ? 131.575 135.957 99.955  1.00 93.24  ?  279 TYR B CG  1 
ATOM   7393  C  CD1 . TYR D  1 106 ? 131.796 136.364 98.648  1.00 93.24  ?  279 TYR B CD1 1 
ATOM   7394  C  CD2 . TYR D  1 106 ? 130.883 134.775 100.166 1.00 93.24  ?  279 TYR B CD2 1 
ATOM   7395  C  CE1 . TYR D  1 106 ? 131.351 135.617 97.588  1.00 93.24  ?  279 TYR B CE1 1 
ATOM   7396  C  CE2 . TYR D  1 106 ? 130.434 134.019 99.108  1.00 93.24  ?  279 TYR B CE2 1 
ATOM   7397  C  CZ  . TYR D  1 106 ? 130.676 134.447 97.824  1.00 93.24  ?  279 TYR B CZ  1 
ATOM   7398  O  OH  . TYR D  1 106 ? 130.235 133.707 96.760  1.00 93.24  ?  279 TYR B OH  1 
ATOM   7399  N  N   . ASN D  1 107 ? 134.385 138.869 101.789 1.00 101.05 ?  280 ASN B N   1 
ATOM   7400  C  CA  . ASN D  1 107 ? 134.717 140.060 102.556 1.00 101.05 ?  280 ASN B CA  1 
ATOM   7401  C  C   . ASN D  1 107 ? 133.560 141.047 102.503 1.00 101.05 ?  280 ASN B C   1 
ATOM   7402  O  O   . ASN D  1 107 ? 132.998 141.279 101.428 1.00 101.05 ?  280 ASN B O   1 
ATOM   7403  C  CB  . ASN D  1 107 ? 135.981 140.736 102.025 1.00 101.05 ?  280 ASN B CB  1 
ATOM   7404  C  CG  . ASN D  1 107 ? 137.237 139.985 102.389 1.00 101.05 ?  280 ASN B CG  1 
ATOM   7405  O  OD1 . ASN D  1 107 ? 137.378 139.499 103.510 1.00 101.05 ?  280 ASN B OD1 1 
ATOM   7406  N  ND2 . ASN D  1 107 ? 138.164 139.890 101.446 1.00 101.05 ?  280 ASN B ND2 1 
ATOM   7407  N  N   . PRO D  1 108 ? 133.181 141.640 103.631 1.00 109.53 ?  281 PRO B N   1 
ATOM   7408  C  CA  . PRO D  1 108 ? 132.090 142.618 103.623 1.00 109.53 ?  281 PRO B CA  1 
ATOM   7409  C  C   . PRO D  1 108 ? 132.510 143.933 102.988 1.00 109.53 ?  281 PRO B C   1 
ATOM   7410  O  O   . PRO D  1 108 ? 133.692 144.184 102.749 1.00 109.53 ?  281 PRO B O   1 
ATOM   7411  C  CB  . PRO D  1 108 ? 131.771 142.797 105.111 1.00 109.53 ?  281 PRO B CB  1 
ATOM   7412  C  CG  . PRO D  1 108 ? 133.042 142.479 105.798 1.00 109.53 ?  281 PRO B CG  1 
ATOM   7413  C  CD  . PRO D  1 108 ? 133.697 141.401 104.989 1.00 109.53 ?  281 PRO B CD  1 
ATOM   7414  N  N   . MET D  1 109 ? 131.524 144.777 102.699 1.00 118.01 ?  282 MET B N   1 
ATOM   7415  C  CA  . MET D  1 109 ? 131.806 146.100 102.162 1.00 118.01 ?  282 MET B CA  1 
ATOM   7416  C  C   . MET D  1 109 ? 130.763 147.078 102.680 1.00 118.01 ?  282 MET B C   1 
ATOM   7417  O  O   . MET D  1 109 ? 129.583 146.744 102.803 1.00 118.01 ?  282 MET B O   1 
ATOM   7418  C  CB  . MET D  1 109 ? 131.839 146.089 100.628 1.00 118.01 ?  282 MET B CB  1 
ATOM   7419  C  CG  . MET D  1 109 ? 132.302 147.394 99.997  1.00 118.01 ?  282 MET B CG  1 
ATOM   7420  S  SD  . MET D  1 109 ? 132.504 147.307 98.212  1.00 118.01 ?  282 MET B SD  1 
ATOM   7421  C  CE  . MET D  1 109 ? 132.943 148.996 97.825  1.00 118.01 ?  282 MET B CE  1 
ATOM   7422  N  N   . VAL D  1 110 ? 131.212 148.289 102.997 1.00 129.83 ?  283 VAL B N   1 
ATOM   7423  C  CA  . VAL D  1 110 ? 130.363 149.335 103.554 1.00 129.83 ?  283 VAL B CA  1 
ATOM   7424  C  C   . VAL D  1 110 ? 129.957 150.270 102.429 1.00 129.83 ?  283 VAL B C   1 
ATOM   7425  O  O   . VAL D  1 110 ? 130.808 150.752 101.673 1.00 129.83 ?  283 VAL B O   1 
ATOM   7426  C  CB  . VAL D  1 110 ? 131.075 150.100 104.678 1.00 129.83 ?  283 VAL B CB  1 
ATOM   7427  C  CG1 . VAL D  1 110 ? 130.272 151.310 105.106 1.00 129.83 ?  283 VAL B CG1 1 
ATOM   7428  C  CG2 . VAL D  1 110 ? 131.260 149.196 105.849 1.00 129.83 ?  283 VAL B CG2 1 
ATOM   7429  N  N   . LEU D  1 111 ? 128.658 150.516 102.313 1.00 140.36 ?  284 LEU B N   1 
ATOM   7430  C  CA  . LEU D  1 111 ? 128.113 151.449 101.343 1.00 140.36 ?  284 LEU B CA  1 
ATOM   7431  C  C   . LEU D  1 111 ? 127.343 152.535 102.078 1.00 140.36 ?  284 LEU B C   1 
ATOM   7432  O  O   . LEU D  1 111 ? 126.957 152.365 103.240 1.00 140.36 ?  284 LEU B O   1 
ATOM   7433  C  CB  . LEU D  1 111 ? 127.208 150.735 100.332 1.00 140.36 ?  284 LEU B CB  1 
ATOM   7434  C  CG  . LEU D  1 111 ? 127.843 150.032 99.125  1.00 140.36 ?  284 LEU B CG  1 
ATOM   7435  C  CD1 . LEU D  1 111 ? 128.586 148.757 99.485  1.00 140.36 ?  284 LEU B CD1 1 
ATOM   7436  C  CD2 . LEU D  1 111 ? 126.780 149.726 98.097  1.00 140.36 ?  284 LEU B CD2 1 
ATOM   7437  N  N   . ILE D  1 112 ? 127.138 153.661 101.400 1.00 152.93 ?  285 ILE B N   1 
ATOM   7438  C  CA  . ILE D  1 112 ? 126.405 154.784 101.971 1.00 152.93 ?  285 ILE B CA  1 
ATOM   7439  C  C   . ILE D  1 112 ? 125.110 154.962 101.193 1.00 152.93 ?  285 ILE B C   1 
ATOM   7440  O  O   . ILE D  1 112 ? 125.124 155.155 99.970  1.00 152.93 ?  285 ILE B O   1 
ATOM   7441  C  CB  . ILE D  1 112 ? 127.258 156.057 101.971 1.00 152.93 ?  285 ILE B CB  1 
ATOM   7442  C  CG1 . ILE D  1 112 ? 128.363 155.936 103.019 1.00 152.93 ?  285 ILE B CG1 1 
ATOM   7443  C  CG2 . ILE D  1 112 ? 126.420 157.275 102.228 1.00 152.93 ?  285 ILE B CG2 1 
ATOM   7444  C  CD1 . ILE D  1 112 ? 129.336 157.081 103.021 1.00 152.93 ?  285 ILE B CD1 1 
ATOM   7445  N  N   . GLN D  1 113 ? 123.987 154.904 101.902 1.00 161.14 ?  286 GLN B N   1 
ATOM   7446  C  CA  . GLN D  1 113 ? 122.666 154.815 101.302 1.00 161.14 ?  286 GLN B CA  1 
ATOM   7447  C  C   . GLN D  1 113 ? 121.867 156.089 101.535 1.00 161.14 ?  286 GLN B C   1 
ATOM   7448  O  O   . GLN D  1 113 ? 121.867 156.648 102.638 1.00 161.14 ?  286 GLN B O   1 
ATOM   7449  C  CB  . GLN D  1 113 ? 121.900 153.633 101.885 1.00 161.14 ?  286 GLN B CB  1 
ATOM   7450  C  CG  . GLN D  1 113 ? 122.494 152.294 101.566 1.00 161.14 ?  286 GLN B CG  1 
ATOM   7451  C  CD  . GLN D  1 113 ? 121.766 151.181 102.269 1.00 161.14 ?  286 GLN B CD  1 
ATOM   7452  O  OE1 . GLN D  1 113 ? 120.843 151.423 103.045 1.00 161.14 ?  286 GLN B OE1 1 
ATOM   7453  N  NE2 . GLN D  1 113 ? 122.188 149.952 102.020 1.00 161.14 ?  286 GLN B NE2 1 
ATOM   7454  N  N   . LYS D  1 114 ? 121.173 156.528 100.488 1.00 171.52 ?  287 LYS B N   1 
ATOM   7455  C  CA  . LYS D  1 114 ? 120.221 157.632 100.576 1.00 171.52 ?  287 LYS B CA  1 
ATOM   7456  C  C   . LYS D  1 114 ? 118.857 157.081 100.976 1.00 171.52 ?  287 LYS B C   1 
ATOM   7457  O  O   . LYS D  1 114 ? 118.019 156.771 100.129 1.00 171.52 ?  287 LYS B O   1 
ATOM   7458  C  CB  . LYS D  1 114 ? 120.140 158.376 99.249  1.00 171.52 ?  287 LYS B CB  1 
ATOM   7459  C  CG  . LYS D  1 114 ? 121.379 159.162 98.888  1.00 171.52 ?  287 LYS B CG  1 
ATOM   7460  C  CD  . LYS D  1 114 ? 121.242 159.744 97.494  1.00 171.52 ?  287 LYS B CD  1 
ATOM   7461  C  CE  . LYS D  1 114 ? 120.183 160.834 97.464  1.00 171.52 ?  287 LYS B CE  1 
ATOM   7462  N  NZ  . LYS D  1 114 ? 120.088 161.483 96.129  1.00 171.52 ?  287 LYS B NZ  1 
ATOM   7463  N  N   . THR D  1 115 ? 118.634 156.965 102.279 1.00 179.69 ?  288 THR B N   1 
ATOM   7464  C  CA  . THR D  1 115 ? 117.394 156.403 102.782 1.00 179.69 ?  288 THR B CA  1 
ATOM   7465  C  C   . THR D  1 115 ? 116.295 157.464 102.793 1.00 179.69 ?  288 THR B C   1 
ATOM   7466  O  O   . THR D  1 115 ? 116.441 158.563 102.251 1.00 179.69 ?  288 THR B O   1 
ATOM   7467  C  CB  . THR D  1 115 ? 117.600 155.823 104.180 1.00 179.69 ?  288 THR B CB  1 
ATOM   7468  O  OG1 . THR D  1 115 ? 117.957 156.874 105.084 1.00 179.69 ?  288 THR B OG1 1 
ATOM   7469  C  CG2 . THR D  1 115 ? 118.707 154.790 104.166 1.00 179.69 ?  288 THR B CG2 1 
ATOM   7470  N  N   . ASP D  1 116 ? 115.172 157.124 103.426 1.00 188.55 ?  289 ASP B N   1 
ATOM   7471  C  CA  . ASP D  1 116 ? 114.054 158.056 103.498 1.00 188.55 ?  289 ASP B CA  1 
ATOM   7472  C  C   . ASP D  1 116 ? 114.324 159.157 104.517 1.00 188.55 ?  289 ASP B C   1 
ATOM   7473  O  O   . ASP D  1 116 ? 113.972 160.320 104.288 1.00 188.55 ?  289 ASP B O   1 
ATOM   7474  C  CB  . ASP D  1 116 ? 112.774 157.292 103.844 1.00 188.55 ?  289 ASP B CB  1 
ATOM   7475  C  CG  . ASP D  1 116 ? 111.509 158.078 103.538 1.00 188.55 ?  289 ASP B CG  1 
ATOM   7476  O  OD1 . ASP D  1 116 ? 111.600 159.222 103.045 1.00 188.55 ?  289 ASP B OD1 1 
ATOM   7477  O  OD2 . ASP D  1 116 ? 110.410 157.539 103.787 1.00 188.55 -1 289 ASP B OD2 1 
ATOM   7478  N  N   . THR D  1 117 ? 114.966 158.817 105.632 1.00 188.23 ?  290 THR B N   1 
ATOM   7479  C  CA  . THR D  1 117 ? 115.249 159.763 106.704 1.00 188.23 ?  290 THR B CA  1 
ATOM   7480  C  C   . THR D  1 117 ? 116.613 160.428 106.556 1.00 188.23 ?  290 THR B C   1 
ATOM   7481  O  O   . THR D  1 117 ? 117.140 160.978 107.527 1.00 188.23 ?  290 THR B O   1 
ATOM   7482  C  CB  . THR D  1 117 ? 115.164 159.070 108.062 1.00 188.23 ?  290 THR B CB  1 
ATOM   7483  O  OG1 . THR D  1 117 ? 116.152 158.035 108.133 1.00 188.23 ?  290 THR B OG1 1 
ATOM   7484  C  CG2 . THR D  1 117 ? 113.787 158.461 108.262 1.00 188.23 ?  290 THR B CG2 1 
ATOM   7485  N  N   . GLY D  1 118 ? 117.204 160.387 105.368 1.00 180.91 ?  291 GLY B N   1 
ATOM   7486  C  CA  . GLY D  1 118 ? 118.466 161.054 105.142 1.00 180.91 ?  291 GLY B CA  1 
ATOM   7487  C  C   . GLY D  1 118 ? 119.505 160.120 104.559 1.00 180.91 ?  291 GLY B C   1 
ATOM   7488  O  O   . GLY D  1 118 ? 119.278 159.473 103.537 1.00 180.91 ?  291 GLY B O   1 
ATOM   7489  N  N   . VAL D  1 119 ? 120.661 160.060 105.215 1.00 173.16 ?  292 VAL B N   1 
ATOM   7490  C  CA  . VAL D  1 119 ? 121.837 159.353 104.713 1.00 173.16 ?  292 VAL B CA  1 
ATOM   7491  C  C   . VAL D  1 119 ? 122.347 158.440 105.822 1.00 173.16 ?  292 VAL B C   1 
ATOM   7492  O  O   . VAL D  1 119 ? 122.514 158.880 106.964 1.00 173.16 ?  292 VAL B O   1 
ATOM   7493  C  CB  . VAL D  1 119 ? 122.923 160.347 104.258 1.00 173.16 ?  292 VAL B CB  1 
ATOM   7494  C  CG1 . VAL D  1 119 ? 124.219 159.645 103.966 1.00 173.16 ?  292 VAL B CG1 1 
ATOM   7495  C  CG2 . VAL D  1 119 ? 122.473 161.117 103.021 1.00 173.16 ?  292 VAL B CG2 1 
ATOM   7496  N  N   . SER D  1 120 ? 122.591 157.169 105.499 1.00 165.90 ?  293 SER B N   1 
ATOM   7497  C  CA  . SER D  1 120 ? 123.041 156.199 106.492 1.00 165.90 ?  293 SER B CA  1 
ATOM   7498  C  C   . SER D  1 120 ? 124.137 155.313 105.911 1.00 165.90 ?  293 SER B C   1 
ATOM   7499  O  O   . SER D  1 120 ? 124.375 155.310 104.701 1.00 165.90 ?  293 SER B O   1 
ATOM   7500  C  CB  . SER D  1 120 ? 121.878 155.340 106.995 1.00 165.90 ?  293 SER B CB  1 
ATOM   7501  O  OG  . SER D  1 120 ? 122.324 154.404 107.960 1.00 165.90 ?  293 SER B OG  1 
ATOM   7502  N  N   . LEU D  1 121 ? 124.822 154.579 106.786 1.00 157.32 ?  294 LEU B N   1 
ATOM   7503  C  CA  . LEU D  1 121 ? 125.902 153.680 106.393 1.00 157.32 ?  294 LEU B CA  1 
ATOM   7504  C  C   . LEU D  1 121 ? 125.490 152.238 106.663 1.00 157.32 ?  294 LEU B C   1 
ATOM   7505  O  O   . LEU D  1 121 ? 125.136 151.891 107.795 1.00 157.32 ?  294 LEU B O   1 
ATOM   7506  C  CB  . LEU D  1 121 ? 127.191 154.007 107.147 1.00 157.32 ?  294 LEU B CB  1 
ATOM   7507  C  CG  . LEU D  1 121 ? 128.122 155.121 106.661 1.00 157.32 ?  294 LEU B CG  1 
ATOM   7508  C  CD1 . LEU D  1 121 ? 127.565 156.508 106.918 1.00 157.32 ?  294 LEU B CD1 1 
ATOM   7509  C  CD2 . LEU D  1 121 ? 129.482 154.971 107.315 1.00 157.32 ?  294 LEU B CD2 1 
ATOM   7510  N  N   . GLN D  1 122 ? 125.549 151.396 105.634 1.00 143.40 ?  295 GLN B N   1 
ATOM   7511  C  CA  . GLN D  1 122 ? 125.247 149.980 105.775 1.00 143.40 ?  295 GLN B CA  1 
ATOM   7512  C  C   . GLN D  1 122 ? 126.461 149.126 105.437 1.00 143.40 ?  295 GLN B C   1 
ATOM   7513  O  O   . GLN D  1 122 ? 127.370 149.551 104.720 1.00 143.40 ?  295 GLN B O   1 
ATOM   7514  C  CB  . GLN D  1 122 ? 124.067 149.565 104.890 1.00 143.40 ?  295 GLN B CB  1 
ATOM   7515  C  CG  . GLN D  1 122 ? 122.706 149.974 105.423 1.00 143.40 ?  295 GLN B CG  1 
ATOM   7516  C  CD  . GLN D  1 122 ? 122.342 149.249 106.701 1.00 143.40 ?  295 GLN B CD  1 
ATOM   7517  O  OE1 . GLN D  1 122 ? 122.306 149.842 107.777 1.00 143.40 ?  295 GLN B OE1 1 
ATOM   7518  N  NE2 . GLN D  1 122 ? 122.073 147.955 106.589 1.00 143.40 ?  295 GLN B NE2 1 
ATOM   7519  N  N   . THR D  1 123 ? 126.458 147.908 105.973 1.00 132.54 ?  296 THR B N   1 
ATOM   7520  C  CA  . THR D  1 123 ? 127.496 146.914 105.736 1.00 132.54 ?  296 THR B CA  1 
ATOM   7521  C  C   . THR D  1 123 ? 126.857 145.689 105.100 1.00 132.54 ?  296 THR B C   1 
ATOM   7522  O  O   . THR D  1 123 ? 125.981 145.062 105.705 1.00 132.54 ?  296 THR B O   1 
ATOM   7523  C  CB  . THR D  1 123 ? 128.192 146.525 107.041 1.00 132.54 ?  296 THR B CB  1 
ATOM   7524  O  OG1 . THR D  1 123 ? 128.805 147.681 107.621 1.00 132.54 ?  296 THR B OG1 1 
ATOM   7525  C  CG2 . THR D  1 123 ? 129.245 145.465 106.782 1.00 132.54 ?  296 THR B CG2 1 
ATOM   7526  N  N   . TYR D  1 124 ? 127.293 145.345 103.893 1.00 126.43 ?  297 TYR B N   1 
ATOM   7527  C  CA  . TYR D  1 124 ? 126.768 144.190 103.175 1.00 126.43 ?  297 TYR B CA  1 
ATOM   7528  C  C   . TYR D  1 124 ? 127.754 143.038 103.309 1.00 126.43 ?  297 TYR B C   1 
ATOM   7529  O  O   . TYR D  1 124 ? 128.957 143.215 103.090 1.00 126.43 ?  297 TYR B O   1 
ATOM   7530  C  CB  . TYR D  1 124 ? 126.503 144.529 101.712 1.00 126.43 ?  297 TYR B CB  1 
ATOM   7531  C  CG  . TYR D  1 124 ? 125.298 145.419 101.509 1.00 126.43 ?  297 TYR B CG  1 
ATOM   7532  C  CD1 . TYR D  1 124 ? 124.371 145.612 102.527 1.00 126.43 ?  297 TYR B CD1 1 
ATOM   7533  C  CD2 . TYR D  1 124 ? 125.081 146.055 100.299 1.00 126.43 ?  297 TYR B CD2 1 
ATOM   7534  C  CE1 . TYR D  1 124 ? 123.271 146.417 102.345 1.00 126.43 ?  297 TYR B CE1 1 
ATOM   7535  C  CE2 . TYR D  1 124 ? 123.977 146.863 100.106 1.00 126.43 ?  297 TYR B CE2 1 
ATOM   7536  C  CZ  . TYR D  1 124 ? 123.079 147.037 101.133 1.00 126.43 ?  297 TYR B CZ  1 
ATOM   7537  O  OH  . TYR D  1 124 ? 121.981 147.839 100.954 1.00 126.43 ?  297 TYR B OH  1 
ATOM   7538  N  N   . ASP D  1 125 ? 127.231 141.857 103.653 1.00 119.87 ?  298 ASP B N   1 
ATOM   7539  C  CA  . ASP D  1 125 ? 128.045 140.766 104.176 1.00 119.87 ?  298 ASP B CA  1 
ATOM   7540  C  C   . ASP D  1 125 ? 128.553 139.818 103.102 1.00 119.87 ?  298 ASP B C   1 
ATOM   7541  O  O   . ASP D  1 125 ? 129.318 138.902 103.419 1.00 119.87 ?  298 ASP B O   1 
ATOM   7542  C  CB  . ASP D  1 125 ? 127.236 139.976 105.204 1.00 119.87 ?  298 ASP B CB  1 
ATOM   7543  C  CG  . ASP D  1 125 ? 126.925 140.785 106.445 1.00 119.87 ?  298 ASP B CG  1 
ATOM   7544  O  OD1 . ASP D  1 125 ? 127.736 141.664 106.803 1.00 119.87 ?  298 ASP B OD1 1 
ATOM   7545  O  OD2 . ASP D  1 125 ? 125.867 140.545 107.060 1.00 119.87 -1 298 ASP B OD2 1 
ATOM   7546  N  N   . ASP D  1 126 ? 128.136 139.993 101.854 1.00 108.19 ?  299 ASP B N   1 
ATOM   7547  C  CA  . ASP D  1 126 ? 128.444 139.008 100.827 1.00 108.19 ?  299 ASP B CA  1 
ATOM   7548  C  C   . ASP D  1 126 ? 128.839 139.658 99.510  1.00 108.19 ?  299 ASP B C   1 
ATOM   7549  O  O   . ASP D  1 126 ? 128.374 139.235 98.447  1.00 108.19 ?  299 ASP B O   1 
ATOM   7550  C  CB  . ASP D  1 126 ? 127.243 138.076 100.642 1.00 108.19 ?  299 ASP B CB  1 
ATOM   7551  C  CG  . ASP D  1 126 ? 125.935 138.833 100.404 1.00 108.19 ?  299 ASP B CG  1 
ATOM   7552  O  OD1 . ASP D  1 126 ? 125.937 140.081 100.411 1.00 108.19 ?  299 ASP B OD1 1 
ATOM   7553  O  OD2 . ASP D  1 126 ? 124.889 138.176 100.240 1.00 108.19 -1 299 ASP B OD2 1 
ATOM   7554  N  N   . LEU D  1 127 ? 129.688 140.679 99.554  1.00 102.91 ?  300 LEU B N   1 
ATOM   7555  C  CA  . LEU D  1 127 ? 129.820 141.530 98.383  1.00 102.91 ?  300 LEU B CA  1 
ATOM   7556  C  C   . LEU D  1 127 ? 131.174 141.376 97.701  1.00 102.91 ?  300 LEU B C   1 
ATOM   7557  O  O   . LEU D  1 127 ? 131.279 141.593 96.490  1.00 102.91 ?  300 LEU B O   1 
ATOM   7558  C  CB  . LEU D  1 127 ? 129.565 142.982 98.794  1.00 102.91 ?  300 LEU B CB  1 
ATOM   7559  C  CG  . LEU D  1 127 ? 129.109 144.009 97.758  1.00 102.91 ?  300 LEU B CG  1 
ATOM   7560  C  CD1 . LEU D  1 127 ? 128.240 145.054 98.431  1.00 102.91 ?  300 LEU B CD1 1 
ATOM   7561  C  CD2 . LEU D  1 127 ? 130.251 144.683 97.029  1.00 102.91 ?  300 LEU B CD2 1 
ATOM   7562  N  N   . LEU D  1 128 ? 132.215 140.997 98.437  1.00 98.15  ?  301 LEU B N   1 
ATOM   7563  C  CA  . LEU D  1 128 ? 133.556 140.876 97.883  1.00 98.15  ?  301 LEU B CA  1 
ATOM   7564  C  C   . LEU D  1 128 ? 134.138 139.507 98.197  1.00 98.15  ?  301 LEU B C   1 
ATOM   7565  O  O   . LEU D  1 128 ? 134.169 139.094 99.358  1.00 98.15  ?  301 LEU B O   1 
ATOM   7566  C  CB  . LEU D  1 128 ? 134.482 141.959 98.432  1.00 98.15  ?  301 LEU B CB  1 
ATOM   7567  C  CG  . LEU D  1 128 ? 134.130 143.387 98.034  1.00 98.15  ?  301 LEU B CG  1 
ATOM   7568  C  CD1 . LEU D  1 128 ? 135.101 144.372 98.659  1.00 98.15  ?  301 LEU B CD1 1 
ATOM   7569  C  CD2 . LEU D  1 128 ? 134.119 143.512 96.533  1.00 98.15  ?  301 LEU B CD2 1 
ATOM   7570  N  N   . ALA D  1 129 ? 134.623 138.822 97.165  1.00 92.87  ?  302 ALA B N   1 
ATOM   7571  C  CA  . ALA D  1 129 ? 135.235 137.512 97.330  1.00 92.87  ?  302 ALA B CA  1 
ATOM   7572  C  C   . ALA D  1 129 ? 136.611 137.636 97.965  1.00 92.87  ?  302 ALA B C   1 
ATOM   7573  O  O   . ALA D  1 129 ? 137.267 138.675 97.861  1.00 92.87  ?  302 ALA B O   1 
ATOM   7574  C  CB  . ALA D  1 129 ? 135.355 136.799 95.985  1.00 92.87  ?  302 ALA B CB  1 
ATOM   7575  N  N   . LYS D  1 130 ? 137.050 136.562 98.615  1.00 85.84  ?  303 LYS B N   1 
ATOM   7576  C  CA  . LYS D  1 130 ? 138.346 136.515 99.279  1.00 85.84  ?  303 LYS B CA  1 
ATOM   7577  C  C   . LYS D  1 130 ? 139.301 135.516 98.649  1.00 85.84  ?  303 LYS B C   1 
ATOM   7578  O  O   . LYS D  1 130 ? 140.463 135.844 98.407  1.00 85.84  ?  303 LYS B O   1 
ATOM   7579  C  CB  . LYS D  1 130 ? 138.158 136.181 100.763 1.00 85.84  ?  303 LYS B CB  1 
ATOM   7580  C  CG  . LYS D  1 130 ? 139.427 136.237 101.585 1.00 85.84  ?  303 LYS B CG  1 
ATOM   7581  C  CD  . LYS D  1 130 ? 139.126 135.983 103.051 1.00 85.84  ?  303 LYS B CD  1 
ATOM   7582  C  CE  . LYS D  1 130 ? 140.367 136.143 103.911 1.00 85.84  ?  303 LYS B CE  1 
ATOM   7583  N  NZ  . LYS D  1 130 ? 141.371 135.078 103.643 1.00 85.84  ?  303 LYS B NZ  1 
ATOM   7584  N  N   . ASP D  1 131 ? 138.837 134.300 98.374  1.00 82.93  ?  304 ASP B N   1 
ATOM   7585  C  CA  . ASP D  1 131 ? 139.643 133.278 97.718  1.00 82.93  ?  304 ASP B CA  1 
ATOM   7586  C  C   . ASP D  1 131 ? 138.712 132.344 96.963  1.00 82.93  ?  304 ASP B C   1 
ATOM   7587  O  O   . ASP D  1 131 ? 137.563 132.155 97.367  1.00 82.93  ?  304 ASP B O   1 
ATOM   7588  C  CB  . ASP D  1 131 ? 140.510 132.513 98.724  1.00 82.93  ?  304 ASP B CB  1 
ATOM   7589  C  CG  . ASP D  1 131 ? 139.720 131.979 99.909  1.00 82.93  ?  304 ASP B CG  1 
ATOM   7590  O  OD1 . ASP D  1 131 ? 138.521 132.299 100.048 1.00 82.93  ?  304 ASP B OD1 1 
ATOM   7591  O  OD2 . ASP D  1 131 ? 140.312 131.232 100.717 1.00 82.93  -1 304 ASP B OD2 1 
ATOM   7592  N  N   . CYS D  1 132 ? 139.182 131.798 95.851  1.00 70.68  ?  305 CYS B N   1 
ATOM   7593  C  CA  . CYS D  1 132 ? 138.312 131.025 94.981  1.00 70.68  ?  305 CYS B CA  1 
ATOM   7594  C  C   . CYS D  1 132 ? 138.896 129.659 94.671  1.00 70.68  ?  305 CYS B C   1 
ATOM   7595  O  O   . CYS D  1 132 ? 140.100 129.514 94.448  1.00 70.68  ?  305 CYS B O   1 
ATOM   7596  C  CB  . CYS D  1 132 ? 138.041 131.774 93.686  1.00 70.68  ?  305 CYS B CB  1 
ATOM   7597  S  SG  . CYS D  1 132 ? 137.035 133.225 93.938  1.00 70.68  ?  305 CYS B SG  1 
ATOM   7598  N  N   . HIS D  1 133 ? 138.016 128.660 94.638  1.00 56.31  ?  306 HIS B N   1 
ATOM   7599  C  CA  . HIS D  1 133 ? 138.401 127.293 94.333  1.00 56.31  ?  306 HIS B CA  1 
ATOM   7600  C  C   . HIS D  1 133 ? 137.396 126.703 93.359  1.00 56.31  ?  306 HIS B C   1 
ATOM   7601  O  O   . HIS D  1 133 ? 136.348 127.291 93.081  1.00 56.31  ?  306 HIS B O   1 
ATOM   7602  C  CB  . HIS D  1 133 ? 138.483 126.439 95.596  1.00 56.31  ?  306 HIS B CB  1 
ATOM   7603  C  CG  . HIS D  1 133 ? 137.184 126.312 96.321  1.00 56.31  ?  306 HIS B CG  1 
ATOM   7604  N  ND1 . HIS D  1 133 ? 136.240 125.360 96.005  1.00 56.31  ?  306 HIS B ND1 1 
ATOM   7605  C  CD2 . HIS D  1 133 ? 136.676 127.012 97.361  1.00 56.31  ?  306 HIS B CD2 1 
ATOM   7606  C  CE1 . HIS D  1 133 ? 135.204 125.483 96.815  1.00 56.31  ?  306 HIS B CE1 1 
ATOM   7607  N  NE2 . HIS D  1 133 ? 135.445 126.478 97.648  1.00 56.31  ?  306 HIS B NE2 1 
ATOM   7608  N  N   . CYS D  1 134 ? 137.710 125.513 92.865  1.00 52.97  ?  307 CYS B N   1 
ATOM   7609  C  CA  . CYS D  1 134 ? 136.885 124.832 91.881  1.00 52.97  ?  307 CYS B CA  1 
ATOM   7610  C  C   . CYS D  1 134 ? 135.939 123.867 92.578  1.00 52.97  ?  307 CYS B C   1 
ATOM   7611  O  O   . CYS D  1 134 ? 136.346 123.136 93.485  1.00 52.97  ?  307 CYS B O   1 
ATOM   7612  C  CB  . CYS D  1 134 ? 137.763 124.076 90.888  1.00 52.97  ?  307 CYS B CB  1 
ATOM   7613  S  SG  . CYS D  1 134 ? 138.914 125.136 90.014  1.00 52.97  ?  307 CYS B SG  1 
ATOM   7614  N  N   . ILE D  1 135 ? 134.678 123.865 92.153  1.00 47.61  ?  308 ILE B N   1 
ATOM   7615  C  CA  . ILE D  1 135 ? 133.694 122.954 92.726  1.00 47.61  ?  308 ILE B CA  1 
ATOM   7616  C  C   . ILE D  1 135 ? 132.593 122.713 91.705  1.00 47.61  ?  308 ILE B C   1 
ATOM   7617  O  O   . ILE D  1 135 ? 132.459 123.462 90.742  1.00 47.61  ?  308 ILE B O   1 
ATOM   7618  C  CB  . ILE D  1 135 ? 133.123 123.499 94.052  1.00 47.61  ?  308 ILE B CB  1 
ATOM   7619  C  CG1 . ILE D  1 135 ? 132.558 122.376 94.910  1.00 47.61  ?  308 ILE B CG1 1 
ATOM   7620  C  CG2 . ILE D  1 135 ? 131.986 124.446 93.800  1.00 47.61  ?  308 ILE B CG2 1 
ATOM   7621  C  CD1 . ILE D  1 135 ? 132.277 122.820 96.323  1.00 47.61  ?  308 ILE B CD1 1 
ATOM   7622  O  OXT . ILE D  1 135 ? 131.815 121.769 91.809  1.00 47.61  -1 308 ILE B OXT 1 
ATOM   7623  N  N   . TRP E  2 110 ? 135.829 171.365 107.034 1.00 73.17  ?  129 TRP D N   1 
ATOM   7624  C  CA  . TRP E  2 110 ? 136.045 170.023 106.507 1.00 73.17  ?  129 TRP D CA  1 
ATOM   7625  C  C   . TRP E  2 110 ? 135.034 169.069 107.133 1.00 73.17  ?  129 TRP D C   1 
ATOM   7626  O  O   . TRP E  2 110 ? 135.239 168.562 108.234 1.00 73.17  ?  129 TRP D O   1 
ATOM   7627  C  CB  . TRP E  2 110 ? 137.481 169.573 106.774 1.00 73.17  ?  129 TRP D CB  1 
ATOM   7628  C  CG  . TRP E  2 110 ? 137.851 168.298 106.100 1.00 73.17  ?  129 TRP D CG  1 
ATOM   7629  C  CD1 . TRP E  2 110 ? 138.057 167.089 106.690 1.00 73.17  ?  129 TRP D CD1 1 
ATOM   7630  C  CD2 . TRP E  2 110 ? 138.042 168.096 104.694 1.00 73.17  ?  129 TRP D CD2 1 
ATOM   7631  N  NE1 . TRP E  2 110 ? 138.379 166.148 105.743 1.00 73.17  ?  129 TRP D NE1 1 
ATOM   7632  C  CE2 . TRP E  2 110 ? 138.373 166.741 104.508 1.00 73.17  ?  129 TRP D CE2 1 
ATOM   7633  C  CE3 . TRP E  2 110 ? 137.968 168.931 103.576 1.00 73.17  ?  129 TRP D CE3 1 
ATOM   7634  C  CZ2 . TRP E  2 110 ? 138.628 166.202 103.250 1.00 73.17  ?  129 TRP D CZ2 1 
ATOM   7635  C  CZ3 . TRP E  2 110 ? 138.223 168.395 102.330 1.00 73.17  ?  129 TRP D CZ3 1 
ATOM   7636  C  CH2 . TRP E  2 110 ? 138.550 167.044 102.177 1.00 73.17  ?  129 TRP D CH2 1 
ATOM   7637  N  N   . SER E  2 111 ? 133.941 168.828 106.413 1.00 70.67  ?  130 SER D N   1 
ATOM   7638  C  CA  . SER E  2 111 ? 132.766 168.205 107.000 1.00 70.67  ?  130 SER D CA  1 
ATOM   7639  C  C   . SER E  2 111 ? 132.914 166.690 107.083 1.00 70.67  ?  130 SER D C   1 
ATOM   7640  O  O   . SER E  2 111 ? 133.781 166.083 106.448 1.00 70.67  ?  130 SER D O   1 
ATOM   7641  C  CB  . SER E  2 111 ? 131.518 168.555 106.193 1.00 70.67  ?  130 SER D CB  1 
ATOM   7642  O  OG  . SER E  2 111 ? 130.372 167.938 106.749 1.00 70.67  ?  130 SER D OG  1 
ATOM   7643  N  N   . CYS E  2 112 ? 132.028 166.078 107.875 1.00 67.72  ?  131 CYS D N   1 
ATOM   7644  C  CA  . CYS E  2 112 ? 132.088 164.638 108.100 1.00 67.72  ?  131 CYS D CA  1 
ATOM   7645  C  C   . CYS E  2 112 ? 131.578 163.852 106.904 1.00 67.72  ?  131 CYS D C   1 
ATOM   7646  O  O   . CYS E  2 112 ? 131.925 162.677 106.748 1.00 67.72  ?  131 CYS D O   1 
ATOM   7647  C  CB  . CYS E  2 112 ? 131.288 164.269 109.345 1.00 67.72  ?  131 CYS D CB  1 
ATOM   7648  S  SG  . CYS E  2 112 ? 131.904 165.007 110.866 1.00 67.72  ?  131 CYS D SG  1 
ATOM   7649  N  N   . LEU E  2 113 ? 130.747 164.474 106.066 1.00 65.99  ?  132 LEU D N   1 
ATOM   7650  C  CA  . LEU E  2 113 ? 130.273 163.799 104.864 1.00 65.99  ?  132 LEU D CA  1 
ATOM   7651  C  C   . LEU E  2 113 ? 131.410 163.570 103.883 1.00 65.99  ?  132 LEU D C   1 
ATOM   7652  O  O   . LEU E  2 113 ? 131.504 162.499 103.273 1.00 65.99  ?  132 LEU D O   1 
ATOM   7653  C  CB  . LEU E  2 113 ? 129.161 164.609 104.206 1.00 65.99  ?  132 LEU D CB  1 
ATOM   7654  C  CG  . LEU E  2 113 ? 128.538 163.970 102.971 1.00 65.99  ?  132 LEU D CG  1 
ATOM   7655  C  CD1 . LEU E  2 113 ? 127.912 162.650 103.346 1.00 65.99  ?  132 LEU D CD1 1 
ATOM   7656  C  CD2 . LEU E  2 113 ? 127.507 164.897 102.363 1.00 65.99  ?  132 LEU D CD2 1 
ATOM   7657  N  N   . GLU E  2 114 ? 132.298 164.555 103.735 1.00 67.15  ?  133 GLU D N   1 
ATOM   7658  C  CA  . GLU E  2 114 ? 133.464 164.370 102.882 1.00 67.15  ?  133 GLU D CA  1 
ATOM   7659  C  C   . GLU E  2 114 ? 134.436 163.360 103.467 1.00 67.15  ?  133 GLU D C   1 
ATOM   7660  O  O   . GLU E  2 114 ? 135.085 162.634 102.709 1.00 67.15  ?  133 GLU D O   1 
ATOM   7661  C  CB  . GLU E  2 114 ? 134.167 165.704 102.651 1.00 67.15  ?  133 GLU D CB  1 
ATOM   7662  C  CG  . GLU E  2 114 ? 133.315 166.703 101.893 1.00 67.15  ?  133 GLU D CG  1 
ATOM   7663  C  CD  . GLU E  2 114 ? 133.006 166.257 100.475 1.00 67.15  ?  133 GLU D CD  1 
ATOM   7664  O  OE1 . GLU E  2 114 ? 133.868 165.605 99.846  1.00 67.15  ?  133 GLU D OE1 1 
ATOM   7665  O  OE2 . GLU E  2 114 ? 131.892 166.550 99.992  1.00 67.15  -1 133 GLU D OE2 1 
ATOM   7666  N  N   . VAL E  2 115 ? 134.507 163.265 104.794 1.00 61.00  ?  134 VAL D N   1 
ATOM   7667  C  CA  . VAL E  2 115 ? 135.325 162.240 105.429 1.00 61.00  ?  134 VAL D CA  1 
ATOM   7668  C  C   . VAL E  2 115 ? 134.757 160.849 105.159 1.00 61.00  ?  134 VAL D C   1 
ATOM   7669  O  O   . VAL E  2 115 ? 135.503 159.909 104.850 1.00 61.00  ?  134 VAL D O   1 
ATOM   7670  C  CB  . VAL E  2 115 ? 135.437 162.539 106.932 1.00 61.00  ?  134 VAL D CB  1 
ATOM   7671  C  CG1 . VAL E  2 115 ? 136.089 161.405 107.645 1.00 61.00  ?  134 VAL D CG1 1 
ATOM   7672  C  CG2 . VAL E  2 115 ? 136.240 163.801 107.140 1.00 61.00  ?  134 VAL D CG2 1 
ATOM   7673  N  N   . ALA E  2 116 ? 133.432 160.705 105.236 1.00 60.14  ?  135 ALA D N   1 
ATOM   7674  C  CA  . ALA E  2 116 ? 132.801 159.419 104.949 1.00 60.14  ?  135 ALA D CA  1 
ATOM   7675  C  C   . ALA E  2 116 ? 132.942 159.052 103.480 1.00 60.14  ?  135 ALA D C   1 
ATOM   7676  O  O   . ALA E  2 116 ? 133.104 157.879 103.138 1.00 60.14  ?  135 ALA D O   1 
ATOM   7677  C  CB  . ALA E  2 116 ? 131.327 159.450 105.347 1.00 60.14  ?  135 ALA D CB  1 
ATOM   7678  N  N   . GLU E  2 117 ? 132.895 160.045 102.597 1.00 58.25  ?  136 GLU D N   1 
ATOM   7679  C  CA  . GLU E  2 117 ? 133.106 159.767 101.185 1.00 58.25  ?  136 GLU D CA  1 
ATOM   7680  C  C   . GLU E  2 117 ? 134.575 159.572 100.838 1.00 58.25  ?  136 GLU D C   1 
ATOM   7681  O  O   . GLU E  2 117 ? 134.871 159.076 99.746  1.00 58.25  ?  136 GLU D O   1 
ATOM   7682  C  CB  . GLU E  2 117 ? 132.508 160.891 100.340 1.00 58.25  ?  136 GLU D CB  1 
ATOM   7683  C  CG  . GLU E  2 117 ? 130.996 160.962 100.420 1.00 58.25  ?  136 GLU D CG  1 
ATOM   7684  C  CD  . GLU E  2 117 ? 130.417 162.097 99.610  1.00 58.25  ?  136 GLU D CD  1 
ATOM   7685  O  OE1 . GLU E  2 117 ? 131.199 162.909 99.074  1.00 58.25  ?  136 GLU D OE1 1 
ATOM   7686  O  OE2 . GLU E  2 117 ? 129.175 162.182 99.510  1.00 58.25  -1 136 GLU D OE2 1 
ATOM   7687  N  N   . ALA E  2 118 ? 135.496 159.941 101.728 1.00 55.93  ?  137 ALA D N   1 
ATOM   7688  C  CA  . ALA E  2 118 ? 136.920 159.772 101.482 1.00 55.93  ?  137 ALA D CA  1 
ATOM   7689  C  C   . ALA E  2 118 ? 137.504 158.526 102.134 1.00 55.93  ?  137 ALA D C   1 
ATOM   7690  O  O   . ALA E  2 118 ? 138.559 158.054 101.700 1.00 55.93  ?  137 ALA D O   1 
ATOM   7691  C  CB  . ALA E  2 118 ? 137.686 161.008 101.954 1.00 55.93  ?  137 ALA D CB  1 
ATOM   7692  N  N   . CYS E  2 119 ? 136.861 157.979 103.164 1.00 55.89  ?  138 CYS D N   1 
ATOM   7693  C  CA  . CYS E  2 119 ? 137.325 156.709 103.712 1.00 55.89  ?  138 CYS D CA  1 
ATOM   7694  C  C   . CYS E  2 119 ? 136.935 155.523 102.841 1.00 55.89  ?  138 CYS D C   1 
ATOM   7695  O  O   . CYS E  2 119 ? 137.766 154.646 102.581 1.00 55.89  ?  138 CYS D O   1 
ATOM   7696  C  CB  . CYS E  2 119 ? 136.784 156.487 105.126 1.00 55.89  ?  138 CYS D CB  1 
ATOM   7697  S  SG  . CYS E  2 119 ? 137.112 154.802 105.763 1.00 55.89  ?  138 CYS D SG  1 
ATOM   7698  N  N   . VAL E  2 120 ? 135.687 155.487 102.373 1.00 48.85  ?  139 VAL D N   1 
ATOM   7699  C  CA  . VAL E  2 120 ? 135.184 154.315 101.668 1.00 48.85  ?  139 VAL D CA  1 
ATOM   7700  C  C   . VAL E  2 120 ? 135.789 154.196 100.271 1.00 48.85  ?  139 VAL D C   1 
ATOM   7701  O  O   . VAL E  2 120 ? 135.887 153.085 99.734  1.00 48.85  ?  139 VAL D O   1 
ATOM   7702  C  CB  . VAL E  2 120 ? 133.647 154.391 101.680 1.00 48.85  ?  139 VAL D CB  1 
ATOM   7703  C  CG1 . VAL E  2 120 ? 133.018 153.155 101.097 1.00 48.85  ?  139 VAL D CG1 1 
ATOM   7704  C  CG2 . VAL E  2 120 ? 133.152 154.581 103.101 1.00 48.85  ?  139 VAL D CG2 1 
ATOM   7705  N  N   . GLY E  2 121 ? 136.270 155.301 99.695  1.00 51.80  ?  140 GLY D N   1 
ATOM   7706  C  CA  . GLY E  2 121 ? 136.977 155.220 98.426  1.00 51.80  ?  140 GLY D CA  1 
ATOM   7707  C  C   . GLY E  2 121 ? 138.306 154.495 98.518  1.00 51.80  ?  140 GLY D C   1 
ATOM   7708  O  O   . GLY E  2 121 ? 138.778 153.929 97.529  1.00 51.80  ?  140 GLY D O   1 
ATOM   7709  N  N   . ASP E  2 122 ? 138.919 154.485 99.700  1.00 54.07  ?  141 ASP D N   1 
ATOM   7710  C  CA  . ASP E  2 122 ? 140.162 153.765 99.945  1.00 54.07  ?  141 ASP D CA  1 
ATOM   7711  C  C   . ASP E  2 122 ? 139.845 152.388 100.519 1.00 54.07  ?  141 ASP D C   1 
ATOM   7712  O  O   . ASP E  2 122 ? 139.071 152.273 101.474 1.00 54.07  ?  141 ASP D O   1 
ATOM   7713  C  CB  . ASP E  2 122 ? 141.063 154.548 100.900 1.00 54.07  ?  141 ASP D CB  1 
ATOM   7714  C  CG  . ASP E  2 122 ? 142.443 153.935 101.036 1.00 54.07  ?  141 ASP D CG  1 
ATOM   7715  O  OD1 . ASP E  2 122 ? 143.252 154.073 100.094 1.00 54.07  ?  141 ASP D OD1 1 
ATOM   7716  O  OD2 . ASP E  2 122 ? 142.719 153.317 102.085 1.00 54.07  -1 141 ASP D OD2 1 
ATOM   7717  N  N   . VAL E  2 123 ? 140.468 151.354 99.946  1.00 51.23  ?  142 VAL D N   1 
ATOM   7718  C  CA  . VAL E  2 123 ? 140.044 149.974 100.168 1.00 51.23  ?  142 VAL D CA  1 
ATOM   7719  C  C   . VAL E  2 123 ? 140.404 149.498 101.572 1.00 51.23  ?  142 VAL D C   1 
ATOM   7720  O  O   . VAL E  2 123 ? 139.618 148.794 102.219 1.00 51.23  ?  142 VAL D O   1 
ATOM   7721  C  CB  . VAL E  2 123 ? 140.660 149.077 99.078  1.00 51.23  ?  142 VAL D CB  1 
ATOM   7722  C  CG1 . VAL E  2 123 ? 140.243 147.629 99.252  1.00 51.23  ?  142 VAL D CG1 1 
ATOM   7723  C  CG2 . VAL E  2 123 ? 140.269 149.584 97.708  1.00 51.23  ?  142 VAL D CG2 1 
ATOM   7724  N  N   . VAL E  2 124 ? 141.582 149.884 102.067 1.00 49.15  ?  143 VAL D N   1 
ATOM   7725  C  CA  . VAL E  2 124 ? 142.004 149.483 103.407 1.00 49.15  ?  143 VAL D CA  1 
ATOM   7726  C  C   . VAL E  2 124 ? 141.124 150.139 104.464 1.00 49.15  ?  143 VAL D C   1 
ATOM   7727  O  O   . VAL E  2 124 ? 140.680 149.483 105.419 1.00 49.15  ?  143 VAL D O   1 
ATOM   7728  C  CB  . VAL E  2 124 ? 143.490 149.825 103.611 1.00 49.15  ?  143 VAL D CB  1 
ATOM   7729  C  CG1 . VAL E  2 124 ? 143.950 149.429 105.005 1.00 49.15  ?  143 VAL D CG1 1 
ATOM   7730  C  CG2 . VAL E  2 124 ? 144.336 149.152 102.543 1.00 49.15  ?  143 VAL D CG2 1 
ATOM   7731  N  N   . CYS E  2 125 ? 140.825 151.432 104.286 1.00 52.14  ?  144 CYS D N   1 
ATOM   7732  C  CA  . CYS E  2 125 ? 139.907 152.119 105.188 1.00 52.14  ?  144 CYS D CA  1 
ATOM   7733  C  C   . CYS E  2 125 ? 138.504 151.544 105.079 1.00 52.14  ?  144 CYS D C   1 
ATOM   7734  O  O   . CYS E  2 125 ? 137.787 151.481 106.079 1.00 52.14  ?  144 CYS D O   1 
ATOM   7735  C  CB  . CYS E  2 125 ? 139.889 153.621 104.887 1.00 52.14  ?  144 CYS D CB  1 
ATOM   7736  S  SG  . CYS E  2 125 ? 139.108 154.704 106.161 1.00 52.14  ?  144 CYS D SG  1 
ATOM   7737  N  N   . ASN E  2 126 ? 138.128 151.056 103.892 1.00 45.25  ?  145 ASN D N   1 
ATOM   7738  C  CA  . ASN E  2 126 ? 136.809 150.460 103.701 1.00 45.25  ?  145 ASN D CA  1 
ATOM   7739  C  C   . ASN E  2 126 ? 136.680 149.141 104.454 1.00 45.25  ?  145 ASN D C   1 
ATOM   7740  O  O   . ASN E  2 126 ? 135.670 148.905 105.125 1.00 45.25  ?  145 ASN D O   1 
ATOM   7741  C  CB  . ASN E  2 126 ? 136.551 150.260 102.210 1.00 45.25  ?  145 ASN D CB  1 
ATOM   7742  C  CG  . ASN E  2 126 ? 135.096 150.004 101.891 1.00 45.25  ?  145 ASN D CG  1 
ATOM   7743  O  OD1 . ASN E  2 126 ? 134.246 149.971 102.775 1.00 45.25  ?  145 ASN D OD1 1 
ATOM   7744  N  ND2 . ASN E  2 126 ? 134.800 149.831 100.608 1.00 45.25  ?  145 ASN D ND2 1 
ATOM   7745  N  N   . ALA E  2 127 ? 137.697 148.280 104.382 1.00 43.47  ?  146 ALA D N   1 
ATOM   7746  C  CA  . ALA E  2 127 ? 137.615 146.994 105.070 1.00 43.47  ?  146 ALA D CA  1 
ATOM   7747  C  C   . ALA E  2 127 ? 137.734 147.158 106.582 1.00 43.47  ?  146 ALA D C   1 
ATOM   7748  O  O   . ALA E  2 127 ? 137.040 146.467 107.347 1.00 43.47  ?  146 ALA D O   1 
ATOM   7749  C  CB  . ALA E  2 127 ? 138.693 146.049 104.549 1.00 43.47  ?  146 ALA D CB  1 
ATOM   7750  N  N   . GLN E  2 128 ? 138.600 148.072 107.034 1.00 44.89  ?  147 GLN D N   1 
ATOM   7751  C  CA  . GLN E  2 128 ? 138.684 148.321 108.466 1.00 44.89  ?  147 GLN D CA  1 
ATOM   7752  C  C   . GLN E  2 128 ? 137.427 148.999 108.985 1.00 44.89  ?  147 GLN D C   1 
ATOM   7753  O  O   . GLN E  2 128 ? 136.996 148.718 110.107 1.00 44.89  ?  147 GLN D O   1 
ATOM   7754  C  CB  . GLN E  2 128 ? 139.921 149.148 108.796 1.00 44.89  ?  147 GLN D CB  1 
ATOM   7755  C  CG  . GLN E  2 128 ? 141.227 148.448 108.475 1.00 44.89  ?  147 GLN D CG  1 
ATOM   7756  C  CD  . GLN E  2 128 ? 141.422 147.171 109.265 1.00 44.89  ?  147 GLN D CD  1 
ATOM   7757  O  OE1 . GLN E  2 128 ? 141.049 147.081 110.433 1.00 44.89  ?  147 GLN D OE1 1 
ATOM   7758  N  NE2 . GLN E  2 128 ? 142.020 146.175 108.628 1.00 44.89  ?  147 GLN D NE2 1 
ATOM   7759  N  N   . LEU E  2 129 ? 136.788 149.836 108.160 1.00 44.92  ?  148 LEU D N   1 
ATOM   7760  C  CA  . LEU E  2 129 ? 135.494 150.400 108.513 1.00 44.92  ?  148 LEU D CA  1 
ATOM   7761  C  C   . LEU E  2 129 ? 134.419 149.325 108.549 1.00 44.92  ?  148 LEU D C   1 
ATOM   7762  O  O   . LEU E  2 129 ? 133.466 149.421 109.328 1.00 44.92  ?  148 LEU D O   1 
ATOM   7763  C  CB  . LEU E  2 129 ? 135.128 151.501 107.518 1.00 44.92  ?  148 LEU D CB  1 
ATOM   7764  C  CG  . LEU E  2 129 ? 133.835 152.285 107.730 1.00 44.92  ?  148 LEU D CG  1 
ATOM   7765  C  CD1 . LEU E  2 129 ? 133.893 153.065 109.022 1.00 44.92  ?  148 LEU D CD1 1 
ATOM   7766  C  CD2 . LEU E  2 129 ? 133.584 153.204 106.559 1.00 44.92  ?  148 LEU D CD2 1 
ATOM   7767  N  N   . ALA E  2 130 ? 134.561 148.287 107.720 1.00 42.69  ?  149 ALA D N   1 
ATOM   7768  C  CA  . ALA E  2 130 ? 133.597 147.193 107.729 1.00 42.69  ?  149 ALA D CA  1 
ATOM   7769  C  C   . ALA E  2 130 ? 133.662 146.407 109.024 1.00 42.69  ?  149 ALA D C   1 
ATOM   7770  O  O   . ALA E  2 130 ? 132.625 146.149 109.650 1.00 42.69  ?  149 ALA D O   1 
ATOM   7771  C  CB  . ALA E  2 130 ? 133.826 146.274 106.535 1.00 42.69  ?  149 ALA D CB  1 
ATOM   7772  N  N   . SER E  2 131 ? 134.874 146.042 109.447 1.00 44.68  ?  150 SER D N   1 
ATOM   7773  C  CA  . SER E  2 131 ? 135.027 145.382 110.743 1.00 44.68  ?  150 SER D CA  1 
ATOM   7774  C  C   . SER E  2 131 ? 134.625 146.301 111.891 1.00 44.68  ?  150 SER D C   1 
ATOM   7775  O  O   . SER E  2 131 ? 134.032 145.839 112.875 1.00 44.68  ?  150 SER D O   1 
ATOM   7776  C  CB  . SER E  2 131 ? 136.464 144.900 110.922 1.00 44.68  ?  150 SER D CB  1 
ATOM   7777  O  OG  . SER E  2 131 ? 136.788 143.909 109.963 1.00 44.68  ?  150 SER D OG  1 
ATOM   7778  N  N   . TYR E  2 132 ? 134.873 147.606 111.735 1.00 45.91  ?  151 TYR D N   1 
ATOM   7779  C  CA  . TYR E  2 132 ? 134.473 148.611 112.714 1.00 45.91  ?  151 TYR D CA  1 
ATOM   7780  C  C   . TYR E  2 132 ? 132.962 148.648 112.905 1.00 45.91  ?  151 TYR D C   1 
ATOM   7781  O  O   . TYR E  2 132 ? 132.462 148.515 114.029 1.00 45.91  ?  151 TYR D O   1 
ATOM   7782  C  CB  . TYR E  2 132 ? 134.980 149.970 112.243 1.00 45.91  ?  151 TYR D CB  1 
ATOM   7783  C  CG  . TYR E  2 132 ? 134.635 151.130 113.129 1.00 45.91  ?  151 TYR D CG  1 
ATOM   7784  C  CD1 . TYR E  2 132 ? 135.326 151.354 114.304 1.00 45.91  ?  151 TYR D CD1 1 
ATOM   7785  C  CD2 . TYR E  2 132 ? 133.632 152.021 112.776 1.00 45.91  ?  151 TYR D CD2 1 
ATOM   7786  C  CE1 . TYR E  2 132 ? 135.023 152.421 115.108 1.00 45.91  ?  151 TYR D CE1 1 
ATOM   7787  C  CE2 . TYR E  2 132 ? 133.320 153.092 113.581 1.00 45.91  ?  151 TYR D CE2 1 
ATOM   7788  C  CZ  . TYR E  2 132 ? 134.020 153.285 114.746 1.00 45.91  ?  151 TYR D CZ  1 
ATOM   7789  O  OH  . TYR E  2 132 ? 133.717 154.350 115.555 1.00 45.91  ?  151 TYR D OH  1 
ATOM   7790  N  N   . LEU E  2 133 ? 132.222 148.831 111.812 1.00 45.32  ?  152 LEU D N   1 
ATOM   7791  C  CA  . LEU E  2 133 ? 130.774 148.975 111.895 1.00 45.32  ?  152 LEU D CA  1 
ATOM   7792  C  C   . LEU E  2 133 ? 130.106 147.663 112.276 1.00 45.32  ?  152 LEU D C   1 
ATOM   7793  O  O   . LEU E  2 133 ? 129.071 147.665 112.948 1.00 45.32  ?  152 LEU D O   1 
ATOM   7794  C  CB  . LEU E  2 133 ? 130.216 149.498 110.574 1.00 45.32  ?  152 LEU D CB  1 
ATOM   7795  C  CG  . LEU E  2 133 ? 130.599 150.933 110.227 1.00 45.32  ?  152 LEU D CG  1 
ATOM   7796  C  CD1 . LEU E  2 133 ? 130.066 151.309 108.867 1.00 45.32  ?  152 LEU D CD1 1 
ATOM   7797  C  CD2 . LEU E  2 133 ? 130.072 151.874 111.281 1.00 45.32  ?  152 LEU D CD2 1 
ATOM   7798  N  N   . LYS E  2 134 ? 130.682 146.528 111.864 1.00 52.52  ?  153 LYS D N   1 
ATOM   7799  C  CA  . LYS E  2 134 ? 130.118 145.250 112.281 1.00 52.52  ?  153 LYS D CA  1 
ATOM   7800  C  C   . LYS E  2 134 ? 130.353 144.999 113.764 1.00 52.52  ?  153 LYS D C   1 
ATOM   7801  O  O   . LYS E  2 134 ? 129.507 144.394 114.429 1.00 52.52  ?  153 LYS D O   1 
ATOM   7802  C  CB  . LYS E  2 134 ? 130.701 144.117 111.436 1.00 52.52  ?  153 LYS D CB  1 
ATOM   7803  C  CG  . LYS E  2 134 ? 130.064 142.760 111.675 1.00 52.52  ?  153 LYS D CG  1 
ATOM   7804  C  CD  . LYS E  2 134 ? 130.573 141.721 110.692 1.00 52.52  ?  153 LYS D CD  1 
ATOM   7805  C  CE  . LYS E  2 134 ? 131.988 141.290 111.025 1.00 52.52  ?  153 LYS D CE  1 
ATOM   7806  N  NZ  . LYS E  2 134 ? 132.451 140.183 110.147 1.00 52.52  1  153 LYS D NZ  1 
ATOM   7807  N  N   . ALA E  2 135 ? 131.465 145.483 114.312 1.00 54.43  ?  154 ALA D N   1 
ATOM   7808  C  CA  . ALA E  2 135 ? 131.674 145.362 115.747 1.00 54.43  ?  154 ALA D CA  1 
ATOM   7809  C  C   . ALA E  2 135 ? 130.938 146.424 116.549 1.00 54.43  ?  154 ALA D C   1 
ATOM   7810  O  O   . ALA E  2 135 ? 130.784 146.257 117.761 1.00 54.43  ?  154 ALA D O   1 
ATOM   7811  C  CB  . ALA E  2 135 ? 133.166 145.419 116.066 1.00 54.43  ?  154 ALA D CB  1 
ATOM   7812  N  N   . CYS E  2 136 ? 130.480 147.505 115.918 1.00 62.78  ?  155 CYS D N   1 
ATOM   7813  C  CA  . CYS E  2 136 ? 129.832 148.595 116.646 1.00 62.78  ?  155 CYS D CA  1 
ATOM   7814  C  C   . CYS E  2 136 ? 128.459 148.906 116.065 1.00 62.78  ?  155 CYS D C   1 
ATOM   7815  O  O   . CYS E  2 136 ? 128.129 150.067 115.805 1.00 62.78  ?  155 CYS D O   1 
ATOM   7816  C  CB  . CYS E  2 136 ? 130.697 149.854 116.645 1.00 62.78  ?  155 CYS D CB  1 
ATOM   7817  S  SG  . CYS E  2 136 ? 132.261 149.714 117.525 1.00 62.78  ?  155 CYS D SG  1 
ATOM   7818  N  N   . SER E  2 137 ? 127.637 147.881 115.851 1.00 76.68  ?  156 SER D N   1 
ATOM   7819  C  CA  . SER E  2 137 ? 126.276 148.072 115.372 1.00 76.68  ?  156 SER D CA  1 
ATOM   7820  C  C   . SER E  2 137 ? 125.281 147.535 116.388 1.00 76.68  ?  156 SER D C   1 
ATOM   7821  O  O   . SER E  2 137 ? 125.615 146.692 117.225 1.00 76.68  ?  156 SER D O   1 
ATOM   7822  C  CB  . SER E  2 137 ? 126.038 147.384 114.026 1.00 76.68  ?  156 SER D CB  1 
ATOM   7823  O  OG  . SER E  2 137 ? 124.707 147.578 113.584 1.00 76.68  ?  156 SER D OG  1 
ATOM   7824  N  N   . ALA E  2 138 ? 124.050 148.032 116.302 1.00 89.40  ?  157 ALA D N   1 
ATOM   7825  C  CA  . ALA E  2 138 ? 122.997 147.593 117.205 1.00 89.40  ?  157 ALA D CA  1 
ATOM   7826  C  C   . ALA E  2 138 ? 122.382 146.290 116.710 1.00 89.40  ?  157 ALA D C   1 
ATOM   7827  O  O   . ALA E  2 138 ? 122.108 146.133 115.517 1.00 89.40  ?  157 ALA D O   1 
ATOM   7828  C  CB  . ALA E  2 138 ? 121.926 148.673 117.332 1.00 89.40  ?  157 ALA D CB  1 
ATOM   7829  N  N   . ASN E  2 139 ? 122.167 145.354 117.635 1.00 94.02  ?  158 ASN D N   1 
ATOM   7830  C  CA  . ASN E  2 139 ? 121.570 144.058 117.334 1.00 94.02  ?  158 ASN D CA  1 
ATOM   7831  C  C   . ASN E  2 139 ? 120.104 143.984 117.740 1.00 94.02  ?  158 ASN D C   1 
ATOM   7832  O  O   . ASN E  2 139 ? 119.614 142.901 118.082 1.00 94.02  ?  158 ASN D O   1 
ATOM   7833  C  CB  . ASN E  2 139 ? 122.358 142.950 118.032 1.00 94.02  ?  158 ASN D CB  1 
ATOM   7834  C  CG  . ASN E  2 139 ? 123.767 142.808 117.499 1.00 94.02  ?  158 ASN D CG  1 
ATOM   7835  O  OD1 . ASN E  2 139 ? 123.996 142.861 116.290 1.00 94.02  ?  158 ASN D OD1 1 
ATOM   7836  N  ND2 . ASN E  2 139 ? 124.726 142.635 118.402 1.00 94.02  ?  158 ASN D ND2 1 
ATOM   7837  N  N   . GLY E  2 140 ? 119.389 145.107 117.707 1.00 94.72  ?  159 GLY D N   1 
ATOM   7838  C  CA  . GLY E  2 140 ? 118.159 145.219 118.464 1.00 94.72  ?  159 GLY D CA  1 
ATOM   7839  C  C   . GLY E  2 140 ? 118.541 145.206 119.927 1.00 94.72  ?  159 GLY D C   1 
ATOM   7840  O  O   . GLY E  2 140 ? 117.879 144.592 120.769 1.00 94.72  ?  159 GLY D O   1 
ATOM   7841  N  N   . ASN E  2 141 ? 119.636 145.898 120.220 1.00 94.58  ?  160 ASN D N   1 
ATOM   7842  C  CA  . ASN E  2 141 ? 120.444 145.726 121.415 1.00 94.58  ?  160 ASN D CA  1 
ATOM   7843  C  C   . ASN E  2 141 ? 121.439 146.878 121.443 1.00 94.58  ?  160 ASN D C   1 
ATOM   7844  O  O   . ASN E  2 141 ? 121.984 147.236 120.391 1.00 94.58  ?  160 ASN D O   1 
ATOM   7845  C  CB  . ASN E  2 141 ? 121.152 144.367 121.355 1.00 94.58  ?  160 ASN D CB  1 
ATOM   7846  C  CG  . ASN E  2 141 ? 121.849 143.983 122.647 1.00 94.58  ?  160 ASN D CG  1 
ATOM   7847  O  OD1 . ASN E  2 141 ? 121.817 144.702 123.639 1.00 94.58  ?  160 ASN D OD1 1 
ATOM   7848  N  ND2 . ASN E  2 141 ? 122.500 142.829 122.629 1.00 94.58  ?  160 ASN D ND2 1 
ATOM   7849  N  N   . PRO E  2 142 ? 121.672 147.514 122.589 1.00 91.62  ?  161 PRO D N   1 
ATOM   7850  C  CA  . PRO E  2 142 ? 122.845 148.383 122.708 1.00 91.62  ?  161 PRO D CA  1 
ATOM   7851  C  C   . PRO E  2 142 ? 124.132 147.595 122.531 1.00 91.62  ?  161 PRO D C   1 
ATOM   7852  O  O   . PRO E  2 142 ? 124.221 146.415 122.884 1.00 91.62  ?  161 PRO D O   1 
ATOM   7853  C  CB  . PRO E  2 142 ? 122.721 148.953 124.125 1.00 91.62  ?  161 PRO D CB  1 
ATOM   7854  C  CG  . PRO E  2 142 ? 121.255 148.959 124.373 1.00 91.62  ?  161 PRO D CG  1 
ATOM   7855  C  CD  . PRO E  2 142 ? 120.716 147.733 123.690 1.00 91.62  ?  161 PRO D CD  1 
ATOM   7856  N  N   . CYS E  2 143 ? 125.125 148.267 121.947 1.00 85.08  ?  162 CYS D N   1 
ATOM   7857  C  CA  . CYS E  2 143 ? 126.375 147.636 121.548 1.00 85.08  ?  162 CYS D CA  1 
ATOM   7858  C  C   . CYS E  2 143 ? 127.163 147.160 122.764 1.00 85.08  ?  162 CYS D C   1 
ATOM   7859  O  O   . CYS E  2 143 ? 127.022 147.679 123.875 1.00 85.08  ?  162 CYS D O   1 
ATOM   7860  C  CB  . CYS E  2 143 ? 127.235 148.615 120.751 1.00 85.08  ?  162 CYS D CB  1 
ATOM   7861  S  SG  . CYS E  2 143 ? 126.520 149.205 119.204 1.00 85.08  ?  162 CYS D SG  1 
ATOM   7862  N  N   . ASP E  2 144 ? 127.996 146.150 122.544 1.00 73.74  ?  163 ASP D N   1 
ATOM   7863  C  CA  . ASP E  2 144 ? 128.945 145.744 123.566 1.00 73.74  ?  163 ASP D CA  1 
ATOM   7864  C  C   . ASP E  2 144 ? 130.044 146.791 123.644 1.00 73.74  ?  163 ASP D C   1 
ATOM   7865  O  O   . ASP E  2 144 ? 130.580 147.225 122.620 1.00 73.74  ?  163 ASP D O   1 
ATOM   7866  C  CB  . ASP E  2 144 ? 129.531 144.368 123.249 1.00 73.74  ?  163 ASP D CB  1 
ATOM   7867  C  CG  . ASP E  2 144 ? 130.215 143.733 124.450 1.00 73.74  ?  163 ASP D CG  1 
ATOM   7868  O  OD1 . ASP E  2 144 ? 130.211 144.342 125.539 1.00 73.74  ?  163 ASP D OD1 1 
ATOM   7869  O  OD2 . ASP E  2 144 ? 130.760 142.620 124.302 1.00 73.74  -1 163 ASP D OD2 1 
ATOM   7870  N  N   . LEU E  2 145 ? 130.373 147.203 124.867 1.00 67.04  ?  164 LEU D N   1 
ATOM   7871  C  CA  . LEU E  2 145 ? 131.221 148.375 125.049 1.00 67.04  ?  164 LEU D CA  1 
ATOM   7872  C  C   . LEU E  2 145 ? 132.677 148.072 124.716 1.00 67.04  ?  164 LEU D C   1 
ATOM   7873  O  O   . LEU E  2 145 ? 133.294 148.769 123.902 1.00 67.04  ?  164 LEU D O   1 
ATOM   7874  C  CB  . LEU E  2 145 ? 131.093 148.895 126.481 1.00 67.04  ?  164 LEU D CB  1 
ATOM   7875  C  CG  . LEU E  2 145 ? 131.827 150.204 126.751 1.00 67.04  ?  164 LEU D CG  1 
ATOM   7876  C  CD1 . LEU E  2 145 ? 131.250 151.306 125.880 1.00 67.04  ?  164 LEU D CD1 1 
ATOM   7877  C  CD2 . LEU E  2 145 ? 131.739 150.576 128.219 1.00 67.04  ?  164 LEU D CD2 1 
ATOM   7878  N  N   . LYS E  2 146 ? 133.238 147.027 125.328 1.00 65.30  ?  165 LYS D N   1 
ATOM   7879  C  CA  . LYS E  2 146 ? 134.659 146.747 125.172 1.00 65.30  ?  165 LYS D CA  1 
ATOM   7880  C  C   . LYS E  2 146 ? 135.006 146.235 123.784 1.00 65.30  ?  165 LYS D C   1 
ATOM   7881  O  O   . LYS E  2 146 ? 136.098 146.540 123.290 1.00 65.30  ?  165 LYS D O   1 
ATOM   7882  C  CB  . LYS E  2 146 ? 135.113 145.751 126.234 1.00 65.30  ?  165 LYS D CB  1 
ATOM   7883  C  CG  . LYS E  2 146 ? 135.061 146.319 127.639 1.00 65.30  ?  165 LYS D CG  1 
ATOM   7884  C  CD  . LYS E  2 146 ? 135.584 145.339 128.667 1.00 65.30  ?  165 LYS D CD  1 
ATOM   7885  C  CE  . LYS E  2 146 ? 135.460 145.916 130.066 1.00 65.30  ?  165 LYS D CE  1 
ATOM   7886  N  NZ  . LYS E  2 146 ? 136.359 147.088 130.261 1.00 65.30  1  165 LYS D NZ  1 
ATOM   7887  N  N   . GLN E  2 147 ? 134.096 145.494 123.143 1.00 65.48  ?  166 GLN D N   1 
ATOM   7888  C  CA  . GLN E  2 147 ? 134.291 145.106 121.748 1.00 65.48  ?  166 GLN D CA  1 
ATOM   7889  C  C   . GLN E  2 147 ? 134.361 146.329 120.847 1.00 65.48  ?  166 GLN D C   1 
ATOM   7890  O  O   . GLN E  2 147 ? 135.228 146.414 119.968 1.00 65.48  ?  166 GLN D O   1 
ATOM   7891  C  CB  . GLN E  2 147 ? 133.162 144.189 121.283 1.00 65.48  ?  166 GLN D CB  1 
ATOM   7892  C  CG  . GLN E  2 147 ? 133.135 142.822 121.928 1.00 65.48  ?  166 GLN D CG  1 
ATOM   7893  C  CD  . GLN E  2 147 ? 131.996 141.967 121.406 1.00 65.48  ?  166 GLN D CD  1 
ATOM   7894  O  OE1 . GLN E  2 147 ? 131.185 142.420 120.598 1.00 65.48  ?  166 GLN D OE1 1 
ATOM   7895  N  NE2 . GLN E  2 147 ? 131.931 140.724 121.866 1.00 65.48  ?  166 GLN D NE2 1 
ATOM   7896  N  N   . CYS E  2 148 ? 133.484 147.305 121.083 1.00 61.42  ?  167 CYS D N   1 
ATOM   7897  C  CA  . CYS E  2 148 ? 133.449 148.488 120.232 1.00 61.42  ?  167 CYS D CA  1 
ATOM   7898  C  C   . CYS E  2 148 ? 134.664 149.375 120.471 1.00 61.42  ?  167 CYS D C   1 
ATOM   7899  O  O   . CYS E  2 148 ? 135.219 149.938 119.523 1.00 61.42  ?  167 CYS D O   1 
ATOM   7900  C  CB  . CYS E  2 148 ? 132.156 149.262 120.471 1.00 61.42  ?  167 CYS D CB  1 
ATOM   7901  S  SG  . CYS E  2 148 ? 131.907 150.600 119.313 1.00 61.42  ?  167 CYS D SG  1 
ATOM   7902  N  N   . GLN E  2 149 ? 135.117 149.475 121.723 1.00 55.48  ?  168 GLN D N   1 
ATOM   7903  C  CA  . GLN E  2 149 ? 136.307 150.268 122.026 1.00 55.48  ?  168 GLN D CA  1 
ATOM   7904  C  C   . GLN E  2 149 ? 137.570 149.630 121.458 1.00 55.48  ?  168 GLN D C   1 
ATOM   7905  O  O   . GLN E  2 149 ? 138.448 150.333 120.932 1.00 55.48  ?  168 GLN D O   1 
ATOM   7906  C  CB  . GLN E  2 149 ? 136.435 150.449 123.533 1.00 55.48  ?  168 GLN D CB  1 
ATOM   7907  C  CG  . GLN E  2 149 ? 135.376 151.339 124.138 1.00 55.48  ?  168 GLN D CG  1 
ATOM   7908  C  CD  . GLN E  2 149 ? 135.536 151.474 125.633 1.00 55.48  ?  168 GLN D CD  1 
ATOM   7909  O  OE1 . GLN E  2 149 ? 136.412 150.852 126.229 1.00 55.48  ?  168 GLN D OE1 1 
ATOM   7910  N  NE2 . GLN E  2 149 ? 134.686 152.282 126.252 1.00 55.48  ?  168 GLN D NE2 1 
ATOM   7911  N  N   . ALA E  2 150 ? 137.677 148.300 121.550 1.00 53.59  ?  169 ALA D N   1 
ATOM   7912  C  CA  . ALA E  2 150 ? 138.782 147.602 120.908 1.00 53.59  ?  169 ALA D CA  1 
ATOM   7913  C  C   . ALA E  2 150 ? 138.722 147.742 119.395 1.00 53.59  ?  169 ALA D C   1 
ATOM   7914  O  O   . ALA E  2 150 ? 139.767 147.830 118.745 1.00 53.59  ?  169 ALA D O   1 
ATOM   7915  C  CB  . ALA E  2 150 ? 138.775 146.130 121.305 1.00 53.59  ?  169 ALA D CB  1 
ATOM   7916  N  N   . ALA E  2 151 ? 137.515 147.815 118.829 1.00 51.70  ?  170 ALA D N   1 
ATOM   7917  C  CA  . ALA E  2 151 ? 137.375 148.061 117.399 1.00 51.70  ?  170 ALA D CA  1 
ATOM   7918  C  C   . ALA E  2 151 ? 137.814 149.467 117.011 1.00 51.70  ?  170 ALA D C   1 
ATOM   7919  O  O   . ALA E  2 151 ? 138.395 149.647 115.938 1.00 51.70  ?  170 ALA D O   1 
ATOM   7920  C  CB  . ALA E  2 151 ? 135.933 147.823 116.969 1.00 51.70  ?  170 ALA D CB  1 
ATOM   7921  N  N   . ILE E  2 152 ? 137.553 150.467 117.861 1.00 50.48  ?  171 ILE D N   1 
ATOM   7922  C  CA  . ILE E  2 152 ? 138.017 151.830 117.584 1.00 50.48  ?  171 ILE D CA  1 
ATOM   7923  C  C   . ILE E  2 152 ? 139.542 151.887 117.608 1.00 50.48  ?  171 ILE D C   1 
ATOM   7924  O  O   . ILE E  2 152 ? 140.181 152.473 116.717 1.00 50.48  ?  171 ILE D O   1 
ATOM   7925  C  CB  . ILE E  2 152 ? 137.416 152.832 118.588 1.00 50.48  ?  171 ILE D CB  1 
ATOM   7926  C  CG1 . ILE E  2 152 ? 135.899 152.896 118.495 1.00 50.48  ?  171 ILE D CG1 1 
ATOM   7927  C  CG2 . ILE E  2 152 ? 137.910 154.215 118.301 1.00 50.48  ?  171 ILE D CG2 1 
ATOM   7928  C  CD1 . ILE E  2 152 ? 135.257 153.678 119.618 1.00 50.48  ?  171 ILE D CD1 1 
ATOM   7929  N  N   . ARG E  2 153 ? 140.147 151.279 118.638 1.00 51.44  ?  172 ARG D N   1 
ATOM   7930  C  CA  . ARG E  2 153 ? 141.603 151.287 118.746 1.00 51.44  ?  172 ARG D CA  1 
ATOM   7931  C  C   . ARG E  2 153 ? 142.257 150.476 117.639 1.00 51.44  ?  172 ARG D C   1 
ATOM   7932  O  O   . ARG E  2 153 ? 143.354 150.816 117.188 1.00 51.44  ?  172 ARG D O   1 
ATOM   7933  C  CB  . ARG E  2 153 ? 142.040 150.750 120.102 1.00 51.44  ?  172 ARG D CB  1 
ATOM   7934  C  CG  . ARG E  2 153 ? 141.689 151.635 121.263 1.00 51.44  ?  172 ARG D CG  1 
ATOM   7935  C  CD  . ARG E  2 153 ? 142.140 150.994 122.554 1.00 51.44  ?  172 ARG D CD  1 
ATOM   7936  N  NE  . ARG E  2 153 ? 141.408 149.758 122.815 1.00 51.44  ?  172 ARG D NE  1 
ATOM   7937  C  CZ  . ARG E  2 153 ? 141.693 148.918 123.802 1.00 51.44  ?  172 ARG D CZ  1 
ATOM   7938  N  NH1 . ARG E  2 153 ? 142.692 149.180 124.627 1.00 51.44  1  172 ARG D NH1 1 
ATOM   7939  N  NH2 . ARG E  2 153 ? 140.977 147.814 123.967 1.00 51.44  ?  172 ARG D NH2 1 
ATOM   7940  N  N   . PHE E  2 154 ? 141.601 149.414 117.180 1.00 49.50  ?  173 PHE D N   1 
ATOM   7941  C  CA  . PHE E  2 154 ? 142.112 148.644 116.060 1.00 49.50  ?  173 PHE D CA  1 
ATOM   7942  C  C   . PHE E  2 154 ? 141.877 149.346 114.730 1.00 49.50  ?  173 PHE D C   1 
ATOM   7943  O  O   . PHE E  2 154 ? 142.618 149.103 113.774 1.00 49.50  ?  173 PHE D O   1 
ATOM   7944  C  CB  . PHE E  2 154 ? 141.456 147.262 116.066 1.00 49.50  ?  173 PHE D CB  1 
ATOM   7945  C  CG  . PHE E  2 154 ? 142.022 146.307 115.063 1.00 49.50  ?  173 PHE D CG  1 
ATOM   7946  C  CD1 . PHE E  2 154 ? 143.224 145.666 115.303 1.00 49.50  ?  173 PHE D CD1 1 
ATOM   7947  C  CD2 . PHE E  2 154 ? 141.344 146.035 113.886 1.00 49.50  ?  173 PHE D CD2 1 
ATOM   7948  C  CE1 . PHE E  2 154 ? 143.742 144.774 114.386 1.00 49.50  ?  173 PHE D CE1 1 
ATOM   7949  C  CE2 . PHE E  2 154 ? 141.858 145.149 112.962 1.00 49.50  ?  173 PHE D CE2 1 
ATOM   7950  C  CZ  . PHE E  2 154 ? 143.059 144.517 113.211 1.00 49.50  ?  173 PHE D CZ  1 
ATOM   7951  N  N   . PHE E  2 155 ? 140.872 150.221 114.658 1.00 44.36  ?  174 PHE D N   1 
ATOM   7952  C  CA  . PHE E  2 155 ? 140.577 150.934 113.424 1.00 44.36  ?  174 PHE D CA  1 
ATOM   7953  C  C   . PHE E  2 155 ? 141.532 152.094 113.191 1.00 44.36  ?  174 PHE D C   1 
ATOM   7954  O  O   . PHE E  2 155 ? 141.992 152.293 112.063 1.00 44.36  ?  174 PHE D O   1 
ATOM   7955  C  CB  . PHE E  2 155 ? 139.134 151.435 113.443 1.00 44.36  ?  174 PHE D CB  1 
ATOM   7956  C  CG  . PHE E  2 155 ? 138.775 152.306 112.271 1.00 44.36  ?  174 PHE D CG  1 
ATOM   7957  C  CD1 . PHE E  2 155 ? 138.603 151.768 111.014 1.00 44.36  ?  174 PHE D CD1 1 
ATOM   7958  C  CD2 . PHE E  2 155 ? 138.590 153.667 112.436 1.00 44.36  ?  174 PHE D CD2 1 
ATOM   7959  C  CE1 . PHE E  2 155 ? 138.270 152.572 109.945 1.00 44.36  ?  174 PHE D CE1 1 
ATOM   7960  C  CE2 . PHE E  2 155 ? 138.258 154.470 111.371 1.00 44.36  ?  174 PHE D CE2 1 
ATOM   7961  C  CZ  . PHE E  2 155 ? 138.097 153.923 110.127 1.00 44.36  ?  174 PHE D CZ  1 
ATOM   7962  N  N   . TYR E  2 156 ? 141.826 152.882 114.231 1.00 44.84  ?  175 TYR D N   1 
ATOM   7963  C  CA  . TYR E  2 156 ? 142.659 154.064 114.004 1.00 44.84  ?  175 TYR D CA  1 
ATOM   7964  C  C   . TYR E  2 156 ? 144.119 153.716 113.760 1.00 44.84  ?  175 TYR D C   1 
ATOM   7965  O  O   . TYR E  2 156 ? 144.848 154.511 113.155 1.00 44.84  ?  175 TYR D O   1 
ATOM   7966  C  CB  . TYR E  2 156 ? 142.554 155.058 115.157 1.00 44.84  ?  175 TYR D CB  1 
ATOM   7967  C  CG  . TYR E  2 156 ? 141.326 155.918 115.094 1.00 44.84  ?  175 TYR D CG  1 
ATOM   7968  C  CD1 . TYR E  2 156 ? 141.204 156.904 114.129 1.00 44.84  ?  175 TYR D CD1 1 
ATOM   7969  C  CD2 . TYR E  2 156 ? 140.312 155.785 116.025 1.00 44.84  ?  175 TYR D CD2 1 
ATOM   7970  C  CE1 . TYR E  2 156 ? 140.089 157.703 114.066 1.00 44.84  ?  175 TYR D CE1 1 
ATOM   7971  C  CE2 . TYR E  2 156 ? 139.198 156.587 115.971 1.00 44.84  ?  175 TYR D CE2 1 
ATOM   7972  C  CZ  . TYR E  2 156 ? 139.090 157.539 114.992 1.00 44.84  ?  175 TYR D CZ  1 
ATOM   7973  O  OH  . TYR E  2 156 ? 137.975 158.333 114.945 1.00 44.84  ?  175 TYR D OH  1 
ATOM   7974  N  N   . GLN E  2 157 ? 144.570 152.550 114.206 1.00 47.50  ?  176 GLN D N   1 
ATOM   7975  C  CA  . GLN E  2 157 ? 145.971 152.207 114.008 1.00 47.50  ?  176 GLN D CA  1 
ATOM   7976  C  C   . GLN E  2 157 ? 146.229 151.687 112.602 1.00 47.50  ?  176 GLN D C   1 
ATOM   7977  O  O   . GLN E  2 157 ? 147.317 151.895 112.053 1.00 47.50  ?  176 GLN D O   1 
ATOM   7978  C  CB  . GLN E  2 157 ? 146.402 151.177 115.046 1.00 47.50  ?  176 GLN D CB  1 
ATOM   7979  C  CG  . GLN E  2 157 ? 146.421 151.721 116.450 1.00 47.50  ?  176 GLN D CG  1 
ATOM   7980  C  CD  . GLN E  2 157 ? 146.733 150.655 117.466 1.00 47.50  ?  176 GLN D CD  1 
ATOM   7981  O  OE1 . GLN E  2 157 ? 146.873 149.482 117.127 1.00 47.50  ?  176 GLN D OE1 1 
ATOM   7982  N  NE2 . GLN E  2 157 ? 146.837 151.053 118.727 1.00 47.50  ?  176 GLN D NE2 1 
ATOM   7983  N  N   . ASN E  2 158 ? 145.242 151.026 111.996 1.00 43.52  ?  177 ASN D N   1 
ATOM   7984  C  CA  . ASN E  2 158 ? 145.439 150.306 110.746 1.00 43.52  ?  177 ASN D CA  1 
ATOM   7985  C  C   . ASN E  2 158 ? 144.947 151.075 109.530 1.00 43.52  ?  177 ASN D C   1 
ATOM   7986  O  O   . ASN E  2 158 ? 144.541 150.462 108.537 1.00 43.52  ?  177 ASN D O   1 
ATOM   7987  C  CB  . ASN E  2 158 ? 144.749 148.949 110.829 1.00 43.52  ?  177 ASN D CB  1 
ATOM   7988  C  CG  . ASN E  2 158 ? 145.387 148.049 111.848 1.00 43.52  ?  177 ASN D CG  1 
ATOM   7989  O  OD1 . ASN E  2 158 ? 146.609 147.950 111.923 1.00 43.52  ?  177 ASN D OD1 1 
ATOM   7990  N  ND2 . ASN E  2 158 ? 144.567 147.407 112.661 1.00 43.52  ?  177 ASN D ND2 1 
ATOM   7991  N  N   . ILE E  2 159 ? 144.962 152.401 109.585 1.00 48.69  ?  178 ILE D N   1 
ATOM   7992  C  CA  . ILE E  2 159 ? 144.546 153.254 108.473 1.00 48.69  ?  178 ILE D CA  1 
ATOM   7993  C  C   . ILE E  2 159 ? 145.645 154.292 108.270 1.00 48.69  ?  178 ILE D C   1 
ATOM   7994  O  O   . ILE E  2 159 ? 146.464 154.478 109.181 1.00 48.69  ?  178 ILE D O   1 
ATOM   7995  C  CB  . ILE E  2 159 ? 143.173 153.888 108.756 1.00 48.69  ?  178 ILE D CB  1 
ATOM   7996  C  CG1 . ILE E  2 159 ? 143.182 154.619 110.096 1.00 48.69  ?  178 ILE D CG1 1 
ATOM   7997  C  CG2 . ILE E  2 159 ? 142.068 152.852 108.704 1.00 48.69  ?  178 ILE D CG2 1 
ATOM   7998  C  CD1 . ILE E  2 159 ? 141.891 155.343 110.389 1.00 48.69  ?  178 ILE D CD1 1 
ATOM   7999  N  N   . PRO E  2 160 ? 145.747 154.947 107.108 1.00 56.36  ?  179 PRO D N   1 
ATOM   8000  C  CA  . PRO E  2 160 ? 146.748 156.011 106.947 1.00 56.36  ?  179 PRO D CA  1 
ATOM   8001  C  C   . PRO E  2 160 ? 146.470 157.190 107.868 1.00 56.36  ?  179 PRO D C   1 
ATOM   8002  O  O   . PRO E  2 160 ? 145.347 157.414 108.324 1.00 56.36  ?  179 PRO D O   1 
ATOM   8003  C  CB  . PRO E  2 160 ? 146.614 156.409 105.474 1.00 56.36  ?  179 PRO D CB  1 
ATOM   8004  C  CG  . PRO E  2 160 ? 146.074 155.208 104.819 1.00 56.36  ?  179 PRO D CG  1 
ATOM   8005  C  CD  . PRO E  2 160 ? 145.146 154.586 105.813 1.00 56.36  ?  179 PRO D CD  1 
ATOM   8006  N  N   . PHE E  2 161 ? 147.530 157.948 108.151 1.00 61.09  ?  180 PHE D N   1 
ATOM   8007  C  CA  . PHE E  2 161 ? 147.458 158.952 109.206 1.00 61.09  ?  180 PHE D CA  1 
ATOM   8008  C  C   . PHE E  2 161 ? 146.632 160.167 108.803 1.00 61.09  ?  180 PHE D C   1 
ATOM   8009  O  O   . PHE E  2 161 ? 146.008 160.794 109.665 1.00 61.09  ?  180 PHE D O   1 
ATOM   8010  C  CB  . PHE E  2 161 ? 148.865 159.384 109.617 1.00 61.09  ?  180 PHE D CB  1 
ATOM   8011  C  CG  . PHE E  2 161 ? 148.886 160.350 110.762 1.00 61.09  ?  180 PHE D CG  1 
ATOM   8012  C  CD1 . PHE E  2 161 ? 148.598 159.919 112.048 1.00 61.09  ?  180 PHE D CD1 1 
ATOM   8013  C  CD2 . PHE E  2 161 ? 149.185 161.687 110.556 1.00 61.09  ?  180 PHE D CD2 1 
ATOM   8014  C  CE1 . PHE E  2 161 ? 148.608 160.803 113.108 1.00 61.09  ?  180 PHE D CE1 1 
ATOM   8015  C  CE2 . PHE E  2 161 ? 149.198 162.577 111.613 1.00 61.09  ?  180 PHE D CE2 1 
ATOM   8016  C  CZ  . PHE E  2 161 ? 148.908 162.133 112.891 1.00 61.09  ?  180 PHE D CZ  1 
ATOM   8017  N  N   . ASN E  2 162 ? 146.602 160.500 107.512 1.00 60.99  ?  181 ASN D N   1 
ATOM   8018  C  CA  . ASN E  2 162 ? 145.807 161.637 107.061 1.00 60.99  ?  181 ASN D CA  1 
ATOM   8019  C  C   . ASN E  2 162 ? 144.314 161.375 107.218 1.00 60.99  ?  181 ASN D C   1 
ATOM   8020  O  O   . ASN E  2 162 ? 143.555 162.277 107.590 1.00 60.99  ?  181 ASN D O   1 
ATOM   8021  C  CB  . ASN E  2 162 ? 146.151 161.975 105.610 1.00 60.99  ?  181 ASN D CB  1 
ATOM   8022  C  CG  . ASN E  2 162 ? 146.033 160.777 104.677 1.00 60.99  ?  181 ASN D CG  1 
ATOM   8023  O  OD1 . ASN E  2 162 ? 145.676 159.672 105.089 1.00 60.99  ?  181 ASN D OD1 1 
ATOM   8024  N  ND2 . ASN E  2 162 ? 146.328 161.000 103.403 1.00 60.99  ?  181 ASN D ND2 1 
ATOM   8025  N  N   . ILE E  2 163 ? 143.884 160.136 106.973 1.00 60.45  ?  182 ILE D N   1 
ATOM   8026  C  CA  . ILE E  2 163 ? 142.467 159.806 107.062 1.00 60.45  ?  182 ILE D CA  1 
ATOM   8027  C  C   . ILE E  2 163 ? 142.015 159.785 108.516 1.00 60.45  ?  182 ILE D C   1 
ATOM   8028  O  O   . ILE E  2 163 ? 140.930 160.276 108.844 1.00 60.45  ?  182 ILE D O   1 
ATOM   8029  C  CB  . ILE E  2 163 ? 142.194 158.475 106.341 1.00 60.45  ?  182 ILE D CB  1 
ATOM   8030  C  CG1 . ILE E  2 163 ? 142.509 158.618 104.853 1.00 60.45  ?  182 ILE D CG1 1 
ATOM   8031  C  CG2 . ILE E  2 163 ? 140.758 158.039 106.509 1.00 60.45  ?  182 ILE D CG2 1 
ATOM   8032  C  CD1 . ILE E  2 163 ? 142.528 157.312 104.101 1.00 60.45  ?  182 ILE D CD1 1 
ATOM   8033  N  N   . ALA E  2 164 ? 142.859 159.273 109.418 1.00 57.68  ?  183 ALA D N   1 
ATOM   8034  C  CA  . ALA E  2 164 ? 142.544 159.324 110.844 1.00 57.68  ?  183 ALA D CA  1 
ATOM   8035  C  C   . ALA E  2 164 ? 142.548 160.757 111.361 1.00 57.68  ?  183 ALA D C   1 
ATOM   8036  O  O   . ALA E  2 164 ? 141.719 161.119 112.207 1.00 57.68  ?  183 ALA D O   1 
ATOM   8037  C  CB  . ALA E  2 164 ? 143.533 158.472 111.632 1.00 57.68  ?  183 ALA D CB  1 
ATOM   8038  N  N   . GLN E  2 165 ? 143.449 161.591 110.833 1.00 63.40  ?  184 GLN D N   1 
ATOM   8039  C  CA  . GLN E  2 165 ? 143.482 163.005 111.199 1.00 63.40  ?  184 GLN D CA  1 
ATOM   8040  C  C   . GLN E  2 165 ? 142.217 163.730 110.758 1.00 63.40  ?  184 GLN D C   1 
ATOM   8041  O  O   . GLN E  2 165 ? 141.653 164.525 111.518 1.00 63.40  ?  184 GLN D O   1 
ATOM   8042  C  CB  . GLN E  2 165 ? 144.715 163.665 110.587 1.00 63.40  ?  184 GLN D CB  1 
ATOM   8043  C  CG  . GLN E  2 165 ? 144.837 165.146 110.866 1.00 63.40  ?  184 GLN D CG  1 
ATOM   8044  C  CD  . GLN E  2 165 ? 146.083 165.747 110.257 1.00 63.40  ?  184 GLN D CD  1 
ATOM   8045  O  OE1 . GLN E  2 165 ? 146.886 165.048 109.639 1.00 63.40  ?  184 GLN D OE1 1 
ATOM   8046  N  NE2 . GLN E  2 165 ? 146.241 167.053 110.406 1.00 63.40  ?  184 GLN D NE2 1 
ATOM   8047  N  N   . MET E  2 166 ? 141.752 163.459 109.538 1.00 61.73  ?  185 MET D N   1 
ATOM   8048  C  CA  . MET E  2 166 ? 140.534 164.097 109.050 1.00 61.73  ?  185 MET D CA  1 
ATOM   8049  C  C   . MET E  2 166 ? 139.299 163.528 109.735 1.00 61.73  ?  185 MET D C   1 
ATOM   8050  O  O   . MET E  2 166 ? 138.278 164.212 109.862 1.00 61.73  ?  185 MET D O   1 
ATOM   8051  C  CB  . MET E  2 166 ? 140.423 163.929 107.538 1.00 61.73  ?  185 MET D CB  1 
ATOM   8052  C  CG  . MET E  2 166 ? 141.478 164.664 106.753 1.00 61.73  ?  185 MET D CG  1 
ATOM   8053  S  SD  . MET E  2 166 ? 141.235 164.467 104.980 1.00 61.73  ?  185 MET D SD  1 
ATOM   8054  C  CE  . MET E  2 166 ? 141.694 162.751 104.762 1.00 61.73  ?  185 MET D CE  1 
ATOM   8055  N  N   . LEU E  2 167 ? 139.370 162.275 110.181 1.00 58.65  ?  186 LEU D N   1 
ATOM   8056  C  CA  . LEU E  2 167 ? 138.180 161.617 110.700 1.00 58.65  ?  186 LEU D CA  1 
ATOM   8057  C  C   . LEU E  2 167 ? 138.014 161.888 112.184 1.00 58.65  ?  186 LEU D C   1 
ATOM   8058  O  O   . LEU E  2 167 ? 136.913 161.757 112.729 1.00 58.65  ?  186 LEU D O   1 
ATOM   8059  C  CB  . LEU E  2 167 ? 138.255 160.120 110.407 1.00 58.65  ?  186 LEU D CB  1 
ATOM   8060  C  CG  . LEU E  2 167 ? 137.006 159.242 110.479 1.00 58.65  ?  186 LEU D CG  1 
ATOM   8061  C  CD1 . LEU E  2 167 ? 137.109 158.191 109.393 1.00 58.65  ?  186 LEU D CD1 1 
ATOM   8062  C  CD2 . LEU E  2 167 ? 136.831 158.572 111.827 1.00 58.65  ?  186 LEU D CD2 1 
ATOM   8063  N  N   . ALA E  2 168 ? 139.090 162.273 112.856 1.00 59.10  ?  187 ALA D N   1 
ATOM   8064  C  CA  . ALA E  2 168 ? 138.944 162.728 114.226 1.00 59.10  ?  187 ALA D CA  1 
ATOM   8065  C  C   . ALA E  2 168 ? 138.414 164.152 114.324 1.00 59.10  ?  187 ALA D C   1 
ATOM   8066  O  O   . ALA E  2 168 ? 137.873 164.522 115.369 1.00 59.10  ?  187 ALA D O   1 
ATOM   8067  C  CB  . ALA E  2 168 ? 140.283 162.638 114.950 1.00 59.10  ?  187 ALA D CB  1 
ATOM   8068  N  N   . PHE E  2 169 ? 138.537 164.948 113.258 1.00 60.91  ?  188 PHE D N   1 
ATOM   8069  C  CA  . PHE E  2 169 ? 138.403 166.398 113.339 1.00 60.91  ?  188 PHE D CA  1 
ATOM   8070  C  C   . PHE E  2 169 ? 137.424 166.973 112.321 1.00 60.91  ?  188 PHE D C   1 
ATOM   8071  O  O   . PHE E  2 169 ? 137.746 167.959 111.654 1.00 60.91  ?  188 PHE D O   1 
ATOM   8072  C  CB  . PHE E  2 169 ? 139.781 167.040 113.166 1.00 60.91  ?  188 PHE D CB  1 
ATOM   8073  C  CG  . PHE E  2 169 ? 140.678 166.877 114.356 1.00 60.91  ?  188 PHE D CG  1 
ATOM   8074  C  CD1 . PHE E  2 169 ? 140.147 166.750 115.627 1.00 60.91  ?  188 PHE D CD1 1 
ATOM   8075  C  CD2 . PHE E  2 169 ? 142.049 166.795 114.200 1.00 60.91  ?  188 PHE D CD2 1 
ATOM   8076  C  CE1 . PHE E  2 169 ? 140.964 166.590 116.719 1.00 60.91  ?  188 PHE D CE1 1 
ATOM   8077  C  CE2 . PHE E  2 169 ? 142.867 166.627 115.292 1.00 60.91  ?  188 PHE D CE2 1 
ATOM   8078  C  CZ  . PHE E  2 169 ? 142.325 166.525 116.552 1.00 60.91  ?  188 PHE D CZ  1 
ATOM   8079  N  N   . CYS E  2 170 ? 136.240 166.389 112.181 1.00 69.00  ?  189 CYS D N   1 
ATOM   8080  C  CA  . CYS E  2 170 ? 135.230 166.944 111.292 1.00 69.00  ?  189 CYS D CA  1 
ATOM   8081  C  C   . CYS E  2 170 ? 134.035 167.460 112.087 1.00 69.00  ?  189 CYS D C   1 
ATOM   8082  O  O   . CYS E  2 170 ? 133.734 166.974 113.178 1.00 69.00  ?  189 CYS D O   1 
ATOM   8083  C  CB  . CYS E  2 170 ? 134.772 165.901 110.275 1.00 69.00  ?  189 CYS D CB  1 
ATOM   8084  S  SG  . CYS E  2 170 ? 133.867 164.483 110.964 1.00 69.00  ?  189 CYS D SG  1 
ATOM   8085  N  N   . ASP E  2 171 ? 133.340 168.438 111.508 1.00 74.28  ?  190 ASP D N   1 
ATOM   8086  C  CA  . ASP E  2 171 ? 132.184 169.082 112.133 1.00 74.28  ?  190 ASP D CA  1 
ATOM   8087  C  C   . ASP E  2 171 ? 131.185 169.456 111.042 1.00 74.28  ?  190 ASP D C   1 
ATOM   8088  O  O   . ASP E  2 171 ? 131.441 169.258 109.851 1.00 74.28  ?  190 ASP D O   1 
ATOM   8089  C  CB  . ASP E  2 171 ? 132.618 170.307 112.943 1.00 74.28  ?  190 ASP D CB  1 
ATOM   8090  C  CG  . ASP E  2 171 ? 133.235 169.935 114.269 1.00 74.28  ?  190 ASP D CG  1 
ATOM   8091  O  OD1 . ASP E  2 171 ? 132.733 168.988 114.913 1.00 74.28  ?  190 ASP D OD1 1 
ATOM   8092  O  OD2 . ASP E  2 171 ? 134.247 170.563 114.646 1.00 74.28  -1 190 ASP D OD2 1 
ATOM   8093  N  N   . CYS E  2 172 ? 130.046 170.019 111.448 1.00 80.27  ?  191 CYS D N   1 
ATOM   8094  C  CA  . CYS E  2 172 ? 129.017 170.439 110.508 1.00 80.27  ?  191 CYS D CA  1 
ATOM   8095  C  C   . CYS E  2 172 ? 128.297 171.672 111.027 1.00 80.27  ?  191 CYS D C   1 
ATOM   8096  O  O   . CYS E  2 172 ? 128.308 171.959 112.227 1.00 80.27  ?  191 CYS D O   1 
ATOM   8097  C  CB  . CYS E  2 172 ? 127.979 169.342 110.248 1.00 80.27  ?  191 CYS D CB  1 
ATOM   8098  S  SG  . CYS E  2 172 ? 128.528 167.973 109.227 1.00 80.27  ?  191 CYS D SG  1 
ATOM   8099  N  N   . ALA E  2 173 ? 127.669 172.395 110.102 1.00 84.37  ?  192 ALA D N   1 
ATOM   8100  C  CA  . ALA E  2 173 ? 126.684 173.400 110.473 1.00 84.37  ?  192 ALA D CA  1 
ATOM   8101  C  C   . ALA E  2 173 ? 125.439 172.701 111.000 1.00 84.37  ?  192 ALA D C   1 
ATOM   8102  O  O   . ALA E  2 173 ? 125.162 171.556 110.632 1.00 84.37  ?  192 ALA D O   1 
ATOM   8103  C  CB  . ALA E  2 173 ? 126.338 174.282 109.276 1.00 84.37  ?  192 ALA D CB  1 
ATOM   8104  N  N   . GLN E  2 174 ? 124.692 173.389 111.867 1.00 86.27  ?  193 GLN D N   1 
ATOM   8105  C  CA  . GLN E  2 174 ? 123.558 172.762 112.536 1.00 86.27  ?  193 GLN D CA  1 
ATOM   8106  C  C   . GLN E  2 174 ? 122.401 172.487 111.578 1.00 86.27  ?  193 GLN D C   1 
ATOM   8107  O  O   . GLN E  2 174 ? 121.658 171.518 111.778 1.00 86.27  ?  193 GLN D O   1 
ATOM   8108  C  CB  . GLN E  2 174 ? 123.104 173.648 113.700 1.00 86.27  ?  193 GLN D CB  1 
ATOM   8109  C  CG  . GLN E  2 174 ? 122.065 173.030 114.625 1.00 86.27  ?  193 GLN D CG  1 
ATOM   8110  C  CD  . GLN E  2 174 ? 122.603 171.833 115.383 1.00 86.27  ?  193 GLN D CD  1 
ATOM   8111  O  OE1 . GLN E  2 174 ? 123.756 171.824 115.814 1.00 86.27  ?  193 GLN D OE1 1 
ATOM   8112  N  NE2 . GLN E  2 174 ? 121.765 170.819 115.561 1.00 86.27  ?  193 GLN D NE2 1 
ATOM   8113  N  N   . SER E  2 175 ? 122.259 173.284 110.520 1.00 85.21  ?  194 SER D N   1 
ATOM   8114  C  CA  . SER E  2 175 ? 121.138 173.098 109.605 1.00 85.21  ?  194 SER D CA  1 
ATOM   8115  C  C   . SER E  2 175 ? 121.397 171.954 108.631 1.00 85.21  ?  194 SER D C   1 
ATOM   8116  O  O   . SER E  2 175 ? 120.454 171.331 108.129 1.00 85.21  ?  194 SER D O   1 
ATOM   8117  C  CB  . SER E  2 175 ? 120.864 174.396 108.845 1.00 85.21  ?  194 SER D CB  1 
ATOM   8118  O  OG  . SER E  2 175 ? 121.928 174.703 107.962 1.00 85.21  ?  194 SER D OG  1 
ATOM   8119  N  N   . ASP E  2 176 ? 122.667 171.665 108.345 1.00 82.52  ?  195 ASP D N   1 
ATOM   8120  C  CA  . ASP E  2 176 ? 123.020 170.672 107.336 1.00 82.52  ?  195 ASP D CA  1 
ATOM   8121  C  C   . ASP E  2 176 ? 122.780 169.267 107.881 1.00 82.52  ?  195 ASP D C   1 
ATOM   8122  O  O   . ASP E  2 176 ? 123.591 168.749 108.655 1.00 82.52  ?  195 ASP D O   1 
ATOM   8123  C  CB  . ASP E  2 176 ? 124.479 170.854 106.909 1.00 82.52  ?  195 ASP D CB  1 
ATOM   8124  C  CG  . ASP E  2 176 ? 124.788 170.204 105.576 1.00 82.52  ?  195 ASP D CG  1 
ATOM   8125  O  OD1 . ASP E  2 176 ? 123.870 169.622 104.969 1.00 82.52  ?  195 ASP D OD1 1 
ATOM   8126  O  OD2 . ASP E  2 176 ? 125.950 170.286 105.129 1.00 82.52  -1 195 ASP D OD2 1 
ATOM   8127  N  N   . ILE E  2 177 ? 121.673 168.646 107.486 1.00 77.64  ?  196 ILE D N   1 
ATOM   8128  C  CA  . ILE E  2 177 ? 121.228 167.386 108.088 1.00 77.64  ?  196 ILE D CA  1 
ATOM   8129  C  C   . ILE E  2 177 ? 121.970 166.110 107.650 1.00 77.64  ?  196 ILE D C   1 
ATOM   8130  O  O   . ILE E  2 177 ? 122.187 165.266 108.534 1.00 77.64  ?  196 ILE D O   1 
ATOM   8131  C  CB  . ILE E  2 177 ? 119.690 167.255 107.950 1.00 77.64  ?  196 ILE D CB  1 
ATOM   8132  C  CG1 . ILE E  2 177 ? 119.125 166.132 108.831 1.00 77.64  ?  196 ILE D CG1 1 
ATOM   8133  C  CG2 . ILE E  2 177 ? 119.206 167.117 106.513 1.00 77.64  ?  196 ILE D CG2 1 
ATOM   8134  C  CD1 . ILE E  2 177 ? 119.278 166.380 110.315 1.00 77.64  ?  196 ILE D CD1 1 
ATOM   8135  N  N   . PRO E  2 178 ? 122.416 165.873 106.391 1.00 72.06  ?  197 PRO D N   1 
ATOM   8136  C  CA  . PRO E  2 178 ? 122.994 164.542 106.121 1.00 72.06  ?  197 PRO D CA  1 
ATOM   8137  C  C   . PRO E  2 178 ? 124.385 164.332 106.705 1.00 72.06  ?  197 PRO D C   1 
ATOM   8138  O  O   . PRO E  2 178 ? 124.686 163.216 107.147 1.00 72.06  ?  197 PRO D O   1 
ATOM   8139  C  CB  . PRO E  2 178 ? 123.016 164.468 104.590 1.00 72.06  ?  197 PRO D CB  1 
ATOM   8140  C  CG  . PRO E  2 178 ? 123.207 165.824 104.173 1.00 72.06  ?  197 PRO D CG  1 
ATOM   8141  C  CD  . PRO E  2 178 ? 122.473 166.680 105.148 1.00 72.06  ?  197 PRO D CD  1 
ATOM   8142  N  N   . CYS E  2 179 ? 125.236 165.360 106.749 1.00 72.78  ?  198 CYS D N   1 
ATOM   8143  C  CA  . CYS E  2 179 ? 126.552 165.184 107.353 1.00 72.78  ?  198 CYS D CA  1 
ATOM   8144  C  C   . CYS E  2 179 ? 126.446 165.094 108.866 1.00 72.78  ?  198 CYS D C   1 
ATOM   8145  O  O   . CYS E  2 179 ? 127.192 164.339 109.501 1.00 72.78  ?  198 CYS D O   1 
ATOM   8146  C  CB  . CYS E  2 179 ? 127.482 166.328 106.965 1.00 72.78  ?  198 CYS D CB  1 
ATOM   8147  S  SG  . CYS E  2 179 ? 127.118 167.876 107.771 1.00 72.78  ?  198 CYS D SG  1 
ATOM   8148  N  N   . GLN E  2 180 ? 125.516 165.854 109.448 1.00 74.91  ?  199 GLN D N   1 
ATOM   8149  C  CA  . GLN E  2 180 ? 125.198 165.707 110.863 1.00 74.91  ?  199 GLN D CA  1 
ATOM   8150  C  C   . GLN E  2 180 ? 124.684 164.310 111.173 1.00 74.91  ?  199 GLN D C   1 
ATOM   8151  O  O   . GLN E  2 180 ? 124.993 163.756 112.233 1.00 74.91  ?  199 GLN D O   1 
ATOM   8152  C  CB  . GLN E  2 180 ? 124.167 166.759 111.272 1.00 74.91  ?  199 GLN D CB  1 
ATOM   8153  C  CG  . GLN E  2 180 ? 123.785 166.739 112.740 1.00 74.91  ?  199 GLN D CG  1 
ATOM   8154  C  CD  . GLN E  2 180 ? 122.793 167.821 113.095 1.00 74.91  ?  199 GLN D CD  1 
ATOM   8155  O  OE1 . GLN E  2 180 ? 122.373 168.600 112.241 1.00 74.91  ?  199 GLN D OE1 1 
ATOM   8156  N  NE2 . GLN E  2 180 ? 122.404 167.875 114.364 1.00 74.91  ?  199 GLN D NE2 1 
ATOM   8157  N  N   . GLN E  2 181 ? 123.938 163.710 110.245 1.00 69.52  ?  200 GLN D N   1 
ATOM   8158  C  CA  . GLN E  2 181 ? 123.446 162.355 110.428 1.00 69.52  ?  200 GLN D CA  1 
ATOM   8159  C  C   . GLN E  2 181 ? 124.544 161.306 110.286 1.00 69.52  ?  200 GLN D C   1 
ATOM   8160  O  O   . GLN E  2 181 ? 124.563 160.340 111.056 1.00 69.52  ?  200 GLN D O   1 
ATOM   8161  C  CB  . GLN E  2 181 ? 122.320 162.079 109.431 1.00 69.52  ?  200 GLN D CB  1 
ATOM   8162  C  CG  . GLN E  2 181 ? 121.631 160.746 109.635 1.00 69.52  ?  200 GLN D CG  1 
ATOM   8163  C  CD  . GLN E  2 181 ? 120.906 160.672 110.964 1.00 69.52  ?  200 GLN D CD  1 
ATOM   8164  O  OE1 . GLN E  2 181 ? 120.248 161.625 111.380 1.00 69.52  ?  200 GLN D OE1 1 
ATOM   8165  N  NE2 . GLN E  2 181 ? 121.030 159.538 111.641 1.00 69.52  ?  200 GLN D NE2 1 
ATOM   8166  N  N   . SER E  2 182 ? 125.458 161.473 109.333 1.00 64.43  ?  201 SER D N   1 
ATOM   8167  C  CA  . SER E  2 182 ? 126.567 160.539 109.179 1.00 64.43  ?  201 SER D CA  1 
ATOM   8168  C  C   . SER E  2 182 ? 127.635 160.712 110.249 1.00 64.43  ?  201 SER D C   1 
ATOM   8169  O  O   . SER E  2 182 ? 128.462 159.810 110.430 1.00 64.43  ?  201 SER D O   1 
ATOM   8170  C  CB  . SER E  2 182 ? 127.205 160.687 107.796 1.00 64.43  ?  201 SER D CB  1 
ATOM   8171  O  OG  . SER E  2 182 ? 127.862 161.930 107.670 1.00 64.43  ?  201 SER D OG  1 
ATOM   8172  N  N   . LYS E  2 183 ? 127.641 161.842 110.952 1.00 66.82  ?  202 LYS D N   1 
ATOM   8173  C  CA  . LYS E  2 183 ? 128.556 162.055 112.062 1.00 66.82  ?  202 LYS D CA  1 
ATOM   8174  C  C   . LYS E  2 183 ? 128.284 161.123 113.238 1.00 66.82  ?  202 LYS D C   1 
ATOM   8175  O  O   . LYS E  2 183 ? 129.231 160.734 113.927 1.00 66.82  ?  202 LYS D O   1 
ATOM   8176  C  CB  . LYS E  2 183 ? 128.493 163.521 112.518 1.00 66.82  ?  202 LYS D CB  1 
ATOM   8177  C  CG  . LYS E  2 183 ? 129.556 163.928 113.528 1.00 66.82  ?  202 LYS D CG  1 
ATOM   8178  C  CD  . LYS E  2 183 ? 129.506 165.412 113.844 1.00 66.82  ?  202 LYS D CD  1 
ATOM   8179  C  CE  . LYS E  2 183 ? 128.324 165.749 114.737 1.00 66.82  ?  202 LYS D CE  1 
ATOM   8180  N  NZ  . LYS E  2 183 ? 128.349 167.171 115.180 1.00 66.82  1  202 LYS D NZ  1 
ATOM   8181  N  N   . GLU E  2 184 ? 127.032 160.715 113.471 1.00 68.54  ?  203 GLU D N   1 
ATOM   8182  C  CA  . GLU E  2 184 ? 126.790 159.688 114.476 1.00 68.54  ?  203 GLU D CA  1 
ATOM   8183  C  C   . GLU E  2 184 ? 127.146 158.294 113.989 1.00 68.54  ?  203 GLU D C   1 
ATOM   8184  O  O   . GLU E  2 184 ? 127.172 157.359 114.796 1.00 68.54  ?  203 GLU D O   1 
ATOM   8185  C  CB  . GLU E  2 184 ? 125.330 159.667 114.940 1.00 68.54  ?  203 GLU D CB  1 
ATOM   8186  C  CG  . GLU E  2 184 ? 124.874 160.905 115.677 1.00 68.54  ?  203 GLU D CG  1 
ATOM   8187  C  CD  . GLU E  2 184 ? 124.187 161.886 114.763 1.00 68.54  ?  203 GLU D CD  1 
ATOM   8188  O  OE1 . GLU E  2 184 ? 123.924 161.510 113.608 1.00 68.54  ?  203 GLU D OE1 1 
ATOM   8189  O  OE2 . GLU E  2 184 ? 123.912 163.024 115.196 1.00 68.54  -1 203 GLU D OE2 1 
ATOM   8190  N  N   . ALA E  2 185 ? 127.405 158.127 112.693 1.00 63.98  ?  204 ALA D N   1 
ATOM   8191  C  CA  . ALA E  2 185 ? 127.781 156.830 112.151 1.00 63.98  ?  204 ALA D CA  1 
ATOM   8192  C  C   . ALA E  2 185 ? 129.290 156.643 112.095 1.00 63.98  ?  204 ALA D C   1 
ATOM   8193  O  O   . ALA E  2 185 ? 129.783 155.549 112.388 1.00 63.98  ?  204 ALA D O   1 
ATOM   8194  C  CB  . ALA E  2 185 ? 127.185 156.648 110.755 1.00 63.98  ?  204 ALA D CB  1 
ATOM   8195  N  N   . LEU E  2 186 ? 130.036 157.683 111.714 1.00 61.14  ?  205 LEU D N   1 
ATOM   8196  C  CA  . LEU E  2 186 ? 131.490 157.553 111.659 1.00 61.14  ?  205 LEU D CA  1 
ATOM   8197  C  C   . LEU E  2 186 ? 132.092 157.488 113.052 1.00 61.14  ?  205 LEU D C   1 
ATOM   8198  O  O   . LEU E  2 186 ? 132.928 156.624 113.334 1.00 61.14  ?  205 LEU D O   1 
ATOM   8199  C  CB  . LEU E  2 186 ? 132.103 158.712 110.883 1.00 61.14  ?  205 LEU D CB  1 
ATOM   8200  C  CG  . LEU E  2 186 ? 131.819 158.791 109.390 1.00 61.14  ?  205 LEU D CG  1 
ATOM   8201  C  CD1 . LEU E  2 186 ? 132.441 160.053 108.844 1.00 61.14  ?  205 LEU D CD1 1 
ATOM   8202  C  CD2 . LEU E  2 186 ? 132.362 157.571 108.681 1.00 61.14  ?  205 LEU D CD2 1 
ATOM   8203  N  N   . HIS E  2 187 ? 131.679 158.390 113.937 1.00 65.07  ?  206 HIS D N   1 
ATOM   8204  C  CA  . HIS E  2 187 ? 132.186 158.416 115.301 1.00 65.07  ?  206 HIS D CA  1 
ATOM   8205  C  C   . HIS E  2 187 ? 131.550 157.366 116.198 1.00 65.07  ?  206 HIS D C   1 
ATOM   8206  O  O   . HIS E  2 187 ? 132.063 157.141 117.300 1.00 65.07  ?  206 HIS D O   1 
ATOM   8207  C  CB  . HIS E  2 187 ? 131.972 159.800 115.922 1.00 65.07  ?  206 HIS D CB  1 
ATOM   8208  C  CG  . HIS E  2 187 ? 132.812 160.874 115.309 1.00 65.07  ?  206 HIS D CG  1 
ATOM   8209  N  ND1 . HIS E  2 187 ? 132.409 161.596 114.206 1.00 65.07  ?  206 HIS D ND1 1 
ATOM   8210  C  CD2 . HIS E  2 187 ? 134.033 161.351 115.644 1.00 65.07  ?  206 HIS D CD2 1 
ATOM   8211  C  CE1 . HIS E  2 187 ? 133.346 162.470 113.888 1.00 65.07  ?  206 HIS D CE1 1 
ATOM   8212  N  NE2 . HIS E  2 187 ? 134.343 162.343 114.745 1.00 65.07  ?  206 HIS D NE2 1 
ATOM   8213  N  N   . SER E  2 188 ? 130.478 156.711 115.732 1.00 66.91  ?  207 SER D N   1 
ATOM   8214  C  CA  . SER E  2 188 ? 129.651 155.781 116.512 1.00 66.91  ?  207 SER D CA  1 
ATOM   8215  C  C   . SER E  2 188 ? 129.184 156.429 117.811 1.00 66.91  ?  207 SER D C   1 
ATOM   8216  O  O   . SER E  2 188 ? 129.469 155.953 118.911 1.00 66.91  ?  207 SER D O   1 
ATOM   8217  C  CB  . SER E  2 188 ? 130.378 154.464 116.787 1.00 66.91  ?  207 SER D CB  1 
ATOM   8218  O  OG  . SER E  2 188 ? 131.448 154.652 117.695 1.00 66.91  ?  207 SER D OG  1 
ATOM   8219  N  N   . LYS E  2 189 ? 128.454 157.537 117.664 1.00 70.89  ?  208 LYS D N   1 
ATOM   8220  C  CA  . LYS E  2 189 ? 128.099 158.354 118.820 1.00 70.89  ?  208 LYS D CA  1 
ATOM   8221  C  C   . LYS E  2 189 ? 127.027 157.689 119.670 1.00 70.89  ?  208 LYS D C   1 
ATOM   8222  O  O   . LYS E  2 189 ? 126.849 158.042 120.840 1.00 70.89  ?  208 LYS D O   1 
ATOM   8223  C  CB  . LYS E  2 189 ? 127.638 159.735 118.359 1.00 70.89  ?  208 LYS D CB  1 
ATOM   8224  C  CG  . LYS E  2 189 ? 128.747 160.586 117.769 1.00 70.89  ?  208 LYS D CG  1 
ATOM   8225  C  CD  . LYS E  2 189 ? 128.215 161.915 117.255 1.00 70.89  ?  208 LYS D CD  1 
ATOM   8226  C  CE  . LYS E  2 189 ? 127.805 162.835 118.394 1.00 70.89  ?  208 LYS D CE  1 
ATOM   8227  N  NZ  . LYS E  2 189 ? 128.976 163.308 119.181 1.00 70.89  1  208 LYS D NZ  1 
ATOM   8228  N  N   . THR E  2 190 ? 126.307 156.721 119.107 1.00 71.31  ?  209 THR D N   1 
ATOM   8229  C  CA  . THR E  2 190 ? 125.301 156.018 119.893 1.00 71.31  ?  209 THR D CA  1 
ATOM   8230  C  C   . THR E  2 190 ? 125.931 154.989 120.821 1.00 71.31  ?  209 THR D C   1 
ATOM   8231  O  O   . THR E  2 190 ? 125.548 154.899 121.993 1.00 71.31  ?  209 THR D O   1 
ATOM   8232  C  CB  . THR E  2 190 ? 124.290 155.346 118.967 1.00 71.31  ?  209 THR D CB  1 
ATOM   8233  O  OG1 . THR E  2 190 ? 124.959 154.369 118.162 1.00 71.31  ?  209 THR D OG1 1 
ATOM   8234  C  CG2 . THR E  2 190 ? 123.638 156.378 118.061 1.00 71.31  ?  209 THR D CG2 1 
ATOM   8235  N  N   . CYS E  2 191 ? 126.899 154.213 120.326 1.00 73.59  ?  210 CYS D N   1 
ATOM   8236  C  CA  . CYS E  2 191 ? 127.460 153.101 121.079 1.00 73.59  ?  210 CYS D CA  1 
ATOM   8237  C  C   . CYS E  2 191 ? 128.785 153.406 121.759 1.00 73.59  ?  210 CYS D C   1 
ATOM   8238  O  O   . CYS E  2 191 ? 129.245 152.587 122.560 1.00 73.59  ?  210 CYS D O   1 
ATOM   8239  C  CB  . CYS E  2 191 ? 127.649 151.879 120.166 1.00 73.59  ?  210 CYS D CB  1 
ATOM   8240  S  SG  . CYS E  2 191 ? 126.101 151.165 119.551 1.00 73.59  ?  210 CYS D SG  1 
ATOM   8241  N  N   . ALA E  2 192 ? 129.410 154.535 121.466 1.00 66.10  ?  211 ALA D N   1 
ATOM   8242  C  CA  . ALA E  2 192 ? 130.694 154.829 122.095 1.00 66.10  ?  211 ALA D CA  1 
ATOM   8243  C  C   . ALA E  2 192 ? 130.736 156.176 122.798 1.00 66.10  ?  211 ALA D C   1 
ATOM   8244  O  O   . ALA E  2 192 ? 131.339 156.281 123.867 1.00 66.10  ?  211 ALA D O   1 
ATOM   8245  C  CB  . ALA E  2 192 ? 131.815 154.760 121.051 1.00 66.10  ?  211 ALA D CB  1 
ATOM   8246  N  N   . VAL E  2 193 ? 130.114 157.208 122.232 1.00 62.98  ?  212 VAL D N   1 
ATOM   8247  C  CA  . VAL E  2 193 ? 130.256 158.558 122.764 1.00 62.98  ?  212 VAL D CA  1 
ATOM   8248  C  C   . VAL E  2 193 ? 129.146 158.871 123.758 1.00 62.98  ?  212 VAL D C   1 
ATOM   8249  O  O   . VAL E  2 193 ? 129.413 159.116 124.938 1.00 62.98  ?  212 VAL D O   1 
ATOM   8250  C  CB  . VAL E  2 193 ? 130.276 159.596 121.629 1.00 62.98  ?  212 VAL D CB  1 
ATOM   8251  C  CG1 . VAL E  2 193 ? 130.376 160.999 122.197 1.00 62.98  ?  212 VAL D CG1 1 
ATOM   8252  C  CG2 . VAL E  2 193 ? 131.422 159.315 120.679 1.00 62.98  ?  212 VAL D CG2 1 
ATOM   8253  N  N   . ASN E  2 194 ? 127.898 158.870 123.297 1.00 66.83  ?  213 ASN D N   1 
ATOM   8254  C  CA  . ASN E  2 194 ? 126.773 159.252 124.146 1.00 66.83  ?  213 ASN D CA  1 
ATOM   8255  C  C   . ASN E  2 194 ? 126.340 158.058 124.983 1.00 66.83  ?  213 ASN D C   1 
ATOM   8256  O  O   . ASN E  2 194 ? 125.464 157.290 124.575 1.00 66.83  ?  213 ASN D O   1 
ATOM   8257  C  CB  . ASN E  2 194 ? 125.606 159.768 123.310 1.00 66.83  ?  213 ASN D CB  1 
ATOM   8258  C  CG  . ASN E  2 194 ? 125.936 161.045 122.576 1.00 66.83  ?  213 ASN D CG  1 
ATOM   8259  O  OD1 . ASN E  2 194 ? 125.988 161.072 121.347 1.00 66.83  ?  213 ASN D OD1 1 
ATOM   8260  N  ND2 . ASN E  2 194 ? 126.154 162.118 123.325 1.00 66.83  ?  213 ASN D ND2 1 
ATOM   8261  N  N   . MET E  2 195 ? 126.948 157.901 126.151 1.00 66.20  ?  214 MET D N   1 
ATOM   8262  C  CA  . MET E  2 195 ? 126.463 156.978 127.162 1.00 66.20  ?  214 MET D CA  1 
ATOM   8263  C  C   . MET E  2 195 ? 125.456 157.719 128.031 1.00 66.20  ?  214 MET D C   1 
ATOM   8264  O  O   . MET E  2 195 ? 125.681 158.872 128.404 1.00 66.20  ?  214 MET D O   1 
ATOM   8265  C  CB  . MET E  2 195 ? 127.612 156.439 128.013 1.00 66.20  ?  214 MET D CB  1 
ATOM   8266  C  CG  . MET E  2 195 ? 127.203 155.372 129.006 1.00 66.20  ?  214 MET D CG  1 
ATOM   8267  S  SD  . MET E  2 195 ? 128.586 154.778 129.995 1.00 66.20  ?  214 MET D SD  1 
ATOM   8268  C  CE  . MET E  2 195 ? 129.493 153.841 128.770 1.00 66.20  ?  214 MET D CE  1 
ATOM   8269  N  N   . VAL E  2 196 ? 124.338 157.068 128.333 1.00 66.78  ?  215 VAL D N   1 
ATOM   8270  C  CA  . VAL E  2 196 ? 123.270 157.713 129.092 1.00 66.78  ?  215 VAL D CA  1 
ATOM   8271  C  C   . VAL E  2 196 ? 123.104 157.007 130.432 1.00 66.78  ?  215 VAL D C   1 
ATOM   8272  O  O   . VAL E  2 196 ? 122.900 155.786 130.460 1.00 66.78  ?  215 VAL D O   1 
ATOM   8273  C  CB  . VAL E  2 196 ? 121.954 157.721 128.300 1.00 66.78  ?  215 VAL D CB  1 
ATOM   8274  C  CG1 . VAL E  2 196 ? 120.827 158.277 129.151 1.00 66.78  ?  215 VAL D CG1 1 
ATOM   8275  C  CG2 . VAL E  2 196 ? 122.112 158.542 127.033 1.00 66.78  ?  215 VAL D CG2 1 
ATOM   8276  N  N   . PRO E  2 197 ? 123.186 157.722 131.570 1.00 66.03  ?  216 PRO D N   1 
ATOM   8277  C  CA  . PRO E  2 197 ? 123.461 159.158 131.720 1.00 66.03  ?  216 PRO D CA  1 
ATOM   8278  C  C   . PRO E  2 197 ? 124.944 159.492 131.572 1.00 66.03  ?  216 PRO D C   1 
ATOM   8279  O  O   . PRO E  2 197 ? 125.768 158.653 131.934 1.00 66.03  ?  216 PRO D O   1 
ATOM   8280  C  CB  . PRO E  2 197 ? 122.976 159.456 133.139 1.00 66.03  ?  216 PRO D CB  1 
ATOM   8281  C  CG  . PRO E  2 197 ? 123.147 158.176 133.860 1.00 66.03  ?  216 PRO D CG  1 
ATOM   8282  C  CD  . PRO E  2 197 ? 122.866 157.091 132.862 1.00 66.03  ?  216 PRO D CD  1 
ATOM   8283  N  N   . PRO E  2 198 ? 125.264 160.665 131.026 1.00 60.21  ?  217 PRO D N   1 
ATOM   8284  C  CA  . PRO E  2 198 ? 126.664 161.012 130.758 1.00 60.21  ?  217 PRO D CA  1 
ATOM   8285  C  C   . PRO E  2 198 ? 127.444 161.168 132.049 1.00 60.21  ?  217 PRO D C   1 
ATOM   8286  O  O   . PRO E  2 198 ? 126.995 161.857 132.976 1.00 60.21  ?  217 PRO D O   1 
ATOM   8287  C  CB  . PRO E  2 198 ? 126.559 162.347 130.008 1.00 60.21  ?  217 PRO D CB  1 
ATOM   8288  C  CG  . PRO E  2 198 ? 125.184 162.366 129.453 1.00 60.21  ?  217 PRO D CG  1 
ATOM   8289  C  CD  . PRO E  2 198 ? 124.343 161.675 130.480 1.00 60.21  ?  217 PRO D CD  1 
ATOM   8290  N  N   . PRO E  2 199 ? 128.603 160.526 132.155 1.00 52.77  ?  218 PRO D N   1 
ATOM   8291  C  CA  . PRO E  2 199 ? 129.364 160.584 133.405 1.00 52.77  ?  218 PRO D CA  1 
ATOM   8292  C  C   . PRO E  2 199 ? 130.080 161.912 133.549 1.00 52.77  ?  218 PRO D C   1 
ATOM   8293  O  O   . PRO E  2 199 ? 130.228 162.669 132.589 1.00 52.77  ?  218 PRO D O   1 
ATOM   8294  C  CB  . PRO E  2 199 ? 130.361 159.431 133.259 1.00 52.77  ?  218 PRO D CB  1 
ATOM   8295  C  CG  . PRO E  2 199 ? 130.572 159.337 131.791 1.00 52.77  ?  218 PRO D CG  1 
ATOM   8296  C  CD  . PRO E  2 199 ? 129.260 159.679 131.148 1.00 52.77  ?  218 PRO D CD  1 
ATOM   8297  N  N   . THR E  2 200 ? 130.516 162.198 134.771 1.00 48.95  ?  219 THR D N   1 
ATOM   8298  C  CA  . THR E  2 200 ? 131.318 163.385 135.012 1.00 48.95  ?  219 THR D CA  1 
ATOM   8299  C  C   . THR E  2 200 ? 132.707 163.201 134.415 1.00 48.95  ?  219 THR D C   1 
ATOM   8300  O  O   . THR E  2 200 ? 133.163 162.077 134.196 1.00 48.95  ?  219 THR D O   1 
ATOM   8301  C  CB  . THR E  2 200 ? 131.420 163.656 136.508 1.00 48.95  ?  219 THR D CB  1 
ATOM   8302  O  OG1 . THR E  2 200 ? 132.083 162.557 137.142 1.00 48.95  ?  219 THR D OG1 1 
ATOM   8303  C  CG2 . THR E  2 200 ? 130.040 163.796 137.105 1.00 48.95  ?  219 THR D CG2 1 
ATOM   8304  N  N   . CYS E  2 201 ? 133.384 164.320 134.140 1.00 46.22  ?  220 CYS D N   1 
ATOM   8305  C  CA  . CYS E  2 201 ? 134.719 164.239 133.556 1.00 46.22  ?  220 CYS D CA  1 
ATOM   8306  C  C   . CYS E  2 201 ? 135.740 163.743 134.568 1.00 46.22  ?  220 CYS D C   1 
ATOM   8307  O  O   . CYS E  2 201 ? 136.743 163.123 134.183 1.00 46.22  ?  220 CYS D O   1 
ATOM   8308  C  CB  . CYS E  2 201 ? 135.133 165.599 133.002 1.00 46.22  ?  220 CYS D CB  1 
ATOM   8309  S  SG  . CYS E  2 201 ? 134.050 166.227 131.698 1.00 46.22  ?  220 CYS D SG  1 
ATOM   8310  N  N   . LEU E  2 202 ? 135.493 163.999 135.857 1.00 44.66  ?  221 LEU D N   1 
ATOM   8311  C  CA  . LEU E  2 202 ? 136.340 163.448 136.907 1.00 44.66  ?  221 LEU D CA  1 
ATOM   8312  C  C   . LEU E  2 202 ? 136.314 161.928 136.894 1.00 44.66  ?  221 LEU D C   1 
ATOM   8313  O  O   . LEU E  2 202 ? 137.361 161.285 137.022 1.00 44.66  ?  221 LEU D O   1 
ATOM   8314  C  CB  . LEU E  2 202 ? 135.894 163.971 138.267 1.00 44.66  ?  221 LEU D CB  1 
ATOM   8315  C  CG  . LEU E  2 202 ? 136.109 165.457 138.510 1.00 44.66  ?  221 LEU D CG  1 
ATOM   8316  C  CD1 . LEU E  2 202 ? 135.472 165.879 139.816 1.00 44.66  ?  221 LEU D CD1 1 
ATOM   8317  C  CD2 . LEU E  2 202 ? 137.588 165.714 138.533 1.00 44.66  ?  221 LEU D CD2 1 
ATOM   8318  N  N   . SER E  2 203 ? 135.134 161.335 136.689 1.00 45.16  ?  222 SER D N   1 
ATOM   8319  C  CA  . SER E  2 203 ? 135.047 159.880 136.667 1.00 45.16  ?  222 SER D CA  1 
ATOM   8320  C  C   . SER E  2 203 ? 135.657 159.303 135.395 1.00 45.16  ?  222 SER D C   1 
ATOM   8321  O  O   . SER E  2 203 ? 136.192 158.190 135.411 1.00 45.16  ?  222 SER D O   1 
ATOM   8322  C  CB  . SER E  2 203 ? 133.599 159.438 136.830 1.00 45.16  ?  222 SER D CB  1 
ATOM   8323  O  OG  . SER E  2 203 ? 133.104 159.818 138.104 1.00 45.16  ?  222 SER D OG  1 
ATOM   8324  N  N   . VAL E  2 204 ? 135.628 160.064 134.298 1.00 43.25  ?  223 VAL D N   1 
ATOM   8325  C  CA  . VAL E  2 204 ? 136.297 159.631 133.073 1.00 43.25  ?  223 VAL D CA  1 
ATOM   8326  C  C   . VAL E  2 204 ? 137.812 159.612 133.268 1.00 43.25  ?  223 VAL D C   1 
ATOM   8327  O  O   . VAL E  2 204 ? 138.496 158.676 132.835 1.00 43.25  ?  223 VAL D O   1 
ATOM   8328  C  CB  . VAL E  2 204 ? 135.878 160.528 131.893 1.00 43.25  ?  223 VAL D CB  1 
ATOM   8329  C  CG1 . VAL E  2 204 ? 136.666 160.200 130.643 1.00 43.25  ?  223 VAL D CG1 1 
ATOM   8330  C  CG2 . VAL E  2 204 ? 134.407 160.365 131.619 1.00 43.25  ?  223 VAL D CG2 1 
ATOM   8331  N  N   . ILE E  2 205 ? 138.351 160.608 133.976 1.00 43.61  ?  224 ILE D N   1 
ATOM   8332  C  CA  . ILE E  2 205 ? 139.795 160.649 134.214 1.00 43.61  ?  224 ILE D CA  1 
ATOM   8333  C  C   . ILE E  2 205 ? 140.224 159.591 135.235 1.00 43.61  ?  224 ILE D C   1 
ATOM   8334  O  O   . ILE E  2 205 ? 141.296 158.981 135.100 1.00 43.61  ?  224 ILE D O   1 
ATOM   8335  C  CB  . ILE E  2 205 ? 140.208 162.077 134.615 1.00 43.61  ?  224 ILE D CB  1 
ATOM   8336  C  CG1 . ILE E  2 205 ? 139.987 163.007 133.427 1.00 43.61  ?  224 ILE D CG1 1 
ATOM   8337  C  CG2 . ILE E  2 205 ? 141.654 162.163 135.049 1.00 43.61  ?  224 ILE D CG2 1 
ATOM   8338  C  CD1 . ILE E  2 205 ? 140.794 162.618 132.212 1.00 43.61  ?  224 ILE D CD1 1 
ATOM   8339  N  N   . ARG E  2 206 ? 139.387 159.326 136.244 1.00 44.07  ?  225 ARG D N   1 
ATOM   8340  C  CA  . ARG E  2 206 ? 139.632 158.203 137.152 1.00 44.07  ?  225 ARG D CA  1 
ATOM   8341  C  C   . ARG E  2 206 ? 139.646 156.871 136.408 1.00 44.07  ?  225 ARG D C   1 
ATOM   8342  O  O   . ARG E  2 206 ? 140.543 156.042 136.612 1.00 44.07  ?  225 ARG D O   1 
ATOM   8343  C  CB  . ARG E  2 206 ? 138.574 158.170 138.255 1.00 44.07  ?  225 ARG D CB  1 
ATOM   8344  C  CG  . ARG E  2 206 ? 138.945 158.819 139.584 1.00 44.07  ?  225 ARG D CG  1 
ATOM   8345  C  CD  . ARG E  2 206 ? 139.154 160.301 139.458 1.00 44.07  ?  225 ARG D CD  1 
ATOM   8346  N  NE  . ARG E  2 206 ? 139.173 160.981 140.742 1.00 44.07  ?  225 ARG D NE  1 
ATOM   8347  C  CZ  . ARG E  2 206 ? 138.093 161.522 141.293 1.00 44.07  ?  225 ARG D CZ  1 
ATOM   8348  N  NH1 . ARG E  2 206 ? 138.169 162.134 142.466 1.00 44.07  1  225 ARG D NH1 1 
ATOM   8349  N  NH2 . ARG E  2 206 ? 136.931 161.464 140.654 1.00 44.07  ?  225 ARG D NH2 1 
ATOM   8350  N  N   . SER E  2 207 ? 138.670 156.666 135.517 1.00 45.70  ?  226 SER D N   1 
ATOM   8351  C  CA  . SER E  2 207 ? 138.576 155.413 134.775 1.00 45.70  ?  226 SER D CA  1 
ATOM   8352  C  C   . SER E  2 207 ? 139.732 155.256 133.800 1.00 45.70  ?  226 SER D C   1 
ATOM   8353  O  O   . SER E  2 207 ? 140.186 154.138 133.535 1.00 45.70  ?  226 SER D O   1 
ATOM   8354  C  CB  . SER E  2 207 ? 137.244 155.346 134.035 1.00 45.70  ?  226 SER D CB  1 
ATOM   8355  O  OG  . SER E  2 207 ? 137.164 154.171 133.252 1.00 45.70  ?  226 SER D OG  1 
ATOM   8356  N  N   . CYS E  2 208 ? 140.222 156.369 133.252 1.00 48.76  ?  227 CYS D N   1 
ATOM   8357  C  CA  . CYS E  2 208 ? 141.387 156.302 132.380 1.00 48.76  ?  227 CYS D CA  1 
ATOM   8358  C  C   . CYS E  2 208 ? 142.655 155.962 133.146 1.00 48.76  ?  227 CYS D C   1 
ATOM   8359  O  O   . CYS E  2 208 ? 143.392 155.061 132.742 1.00 48.76  ?  227 CYS D O   1 
ATOM   8360  C  CB  . CYS E  2 208 ? 141.582 157.618 131.645 1.00 48.76  ?  227 CYS D CB  1 
ATOM   8361  S  SG  . CYS E  2 208 ? 143.043 157.591 130.630 1.00 48.76  ?  227 CYS D SG  1 
ATOM   8362  N  N   . GLN E  2 209 ? 142.928 156.660 134.247 1.00 51.28  ?  228 GLN D N   1 
ATOM   8363  C  CA  . GLN E  2 209 ? 144.157 156.398 134.986 1.00 51.28  ?  228 GLN D CA  1 
ATOM   8364  C  C   . GLN E  2 209 ? 144.120 155.109 135.797 1.00 51.28  ?  228 GLN D C   1 
ATOM   8365  O  O   . GLN E  2 209 ? 145.166 154.699 136.310 1.00 51.28  ?  228 GLN D O   1 
ATOM   8366  C  CB  . GLN E  2 209 ? 144.489 157.569 135.907 1.00 51.28  ?  228 GLN D CB  1 
ATOM   8367  C  CG  . GLN E  2 209 ? 144.981 158.790 135.172 1.00 51.28  ?  228 GLN D CG  1 
ATOM   8368  C  CD  . GLN E  2 209 ? 145.300 159.930 136.106 1.00 51.28  ?  228 GLN D CD  1 
ATOM   8369  O  OE1 . GLN E  2 209 ? 145.065 159.843 137.311 1.00 51.28  ?  228 GLN D OE1 1 
ATOM   8370  N  NE2 . GLN E  2 209 ? 145.845 161.006 135.558 1.00 51.28  ?  228 GLN D NE2 1 
ATOM   8371  N  N   . ASN E  2 210 ? 142.967 154.457 135.931 1.00 54.42  ?  229 ASN D N   1 
ATOM   8372  C  CA  . ASN E  2 210 ? 142.950 153.119 136.507 1.00 54.42  ?  229 ASN D CA  1 
ATOM   8373  C  C   . ASN E  2 210 ? 143.139 152.020 135.467 1.00 54.42  ?  229 ASN D C   1 
ATOM   8374  O  O   . ASN E  2 210 ? 142.993 150.842 135.802 1.00 54.42  ?  229 ASN D O   1 
ATOM   8375  C  CB  . ASN E  2 210 ? 141.652 152.883 137.280 1.00 54.42  ?  229 ASN D CB  1 
ATOM   8376  C  CG  . ASN E  2 210 ? 141.602 153.665 138.573 1.00 54.42  ?  229 ASN D CG  1 
ATOM   8377  O  OD1 . ASN E  2 210 ? 142.608 153.794 139.270 1.00 54.42  ?  229 ASN D OD1 1 
ATOM   8378  N  ND2 . ASN E  2 210 ? 140.430 154.185 138.907 1.00 54.42  ?  229 ASN D ND2 1 
ATOM   8379  N  N   . ASP E  2 211 ? 143.455 152.373 134.224 1.00 60.91  ?  230 ASP D N   1 
ATOM   8380  C  CA  . ASP E  2 211 ? 143.746 151.416 133.166 1.00 60.91  ?  230 ASP D CA  1 
ATOM   8381  C  C   . ASP E  2 211 ? 145.058 151.790 132.489 1.00 60.91  ?  230 ASP D C   1 
ATOM   8382  O  O   . ASP E  2 211 ? 145.275 152.956 132.156 1.00 60.91  ?  230 ASP D O   1 
ATOM   8383  C  CB  . ASP E  2 211 ? 142.619 151.382 132.136 1.00 60.91  ?  230 ASP D CB  1 
ATOM   8384  C  CG  . ASP E  2 211 ? 142.845 150.339 131.072 1.00 60.91  ?  230 ASP D CG  1 
ATOM   8385  O  OD1 . ASP E  2 211 ? 142.684 149.141 131.375 1.00 60.91  ?  230 ASP D OD1 1 
ATOM   8386  O  OD2 . ASP E  2 211 ? 143.184 150.718 129.932 1.00 60.91  -1 230 ASP D OD2 1 
ATOM   8387  N  N   . GLU E  2 212 ? 145.916 150.791 132.259 1.00 67.70  ?  231 GLU D N   1 
ATOM   8388  C  CA  . GLU E  2 212 ? 147.313 151.056 131.914 1.00 67.70  ?  231 GLU D CA  1 
ATOM   8389  C  C   . GLU E  2 212 ? 147.499 151.609 130.504 1.00 67.70  ?  231 GLU D C   1 
ATOM   8390  O  O   . GLU E  2 212 ? 148.347 152.490 130.297 1.00 67.70  ?  231 GLU D O   1 
ATOM   8391  C  CB  . GLU E  2 212 ? 148.136 149.780 132.076 1.00 67.70  ?  231 GLU D CB  1 
ATOM   8392  C  CG  . GLU E  2 212 ? 148.250 149.307 133.510 1.00 67.70  ?  231 GLU D CG  1 
ATOM   8393  C  CD  . GLU E  2 212 ? 149.060 150.254 134.375 1.00 67.70  ?  231 GLU D CD  1 
ATOM   8394  O  OE1 . GLU E  2 212 ? 149.996 150.892 133.848 1.00 67.70  ?  231 GLU D OE1 1 
ATOM   8395  O  OE2 . GLU E  2 212 ? 148.762 150.360 135.583 1.00 67.70  -1 231 GLU D OE2 1 
ATOM   8396  N  N   . LEU E  2 213 ? 146.736 151.106 129.532 1.00 63.86  ?  232 LEU D N   1 
ATOM   8397  C  CA  . LEU E  2 213 ? 146.850 151.592 128.162 1.00 63.86  ?  232 LEU D CA  1 
ATOM   8398  C  C   . LEU E  2 213 ? 146.368 153.035 128.052 1.00 63.86  ?  232 LEU D C   1 
ATOM   8399  O  O   . LEU E  2 213 ? 147.023 153.875 127.413 1.00 63.86  ?  232 LEU D O   1 
ATOM   8400  C  CB  . LEU E  2 213 ? 146.063 150.664 127.236 1.00 63.86  ?  232 LEU D CB  1 
ATOM   8401  C  CG  . LEU E  2 213 ? 146.170 150.761 125.717 1.00 63.86  ?  232 LEU D CG  1 
ATOM   8402  C  CD1 . LEU E  2 213 ? 146.074 149.366 125.141 1.00 63.86  ?  232 LEU D CD1 1 
ATOM   8403  C  CD2 . LEU E  2 213 ? 145.063 151.624 125.136 1.00 63.86  ?  232 LEU D CD2 1 
ATOM   8404  N  N   . CYS E  2 214 ? 145.245 153.346 128.704 1.00 59.48  ?  233 CYS D N   1 
ATOM   8405  C  CA  . CYS E  2 214 ? 144.783 154.724 128.757 1.00 59.48  ?  233 CYS D CA  1 
ATOM   8406  C  C   . CYS E  2 214 ? 145.734 155.586 129.572 1.00 59.48  ?  233 CYS D C   1 
ATOM   8407  O  O   . CYS E  2 214 ? 145.878 156.775 129.285 1.00 59.48  ?  233 CYS D O   1 
ATOM   8408  C  CB  . CYS E  2 214 ? 143.372 154.793 129.342 1.00 59.48  ?  233 CYS D CB  1 
ATOM   8409  S  SG  . CYS E  2 214 ? 142.513 156.383 129.091 1.00 59.48  ?  233 CYS D SG  1 
ATOM   8410  N  N   . ARG E  2 215 ? 146.407 155.000 130.568 1.00 59.95  ?  234 ARG D N   1 
ATOM   8411  C  CA  . ARG E  2 215 ? 147.377 155.741 131.368 1.00 59.95  ?  234 ARG D CA  1 
ATOM   8412  C  C   . ARG E  2 215 ? 148.553 156.203 130.522 1.00 59.95  ?  234 ARG D C   1 
ATOM   8413  O  O   . ARG E  2 215 ? 148.926 157.381 130.566 1.00 59.95  ?  234 ARG D O   1 
ATOM   8414  C  CB  . ARG E  2 215 ? 147.859 154.876 132.527 1.00 59.95  ?  234 ARG D CB  1 
ATOM   8415  C  CG  . ARG E  2 215 ? 148.768 155.565 133.507 1.00 59.95  ?  234 ARG D CG  1 
ATOM   8416  C  CD  . ARG E  2 215 ? 149.089 154.618 134.644 1.00 59.95  ?  234 ARG D CD  1 
ATOM   8417  N  NE  . ARG E  2 215 ? 150.001 155.203 135.619 1.00 59.95  ?  234 ARG D NE  1 
ATOM   8418  C  CZ  . ARG E  2 215 ? 150.433 154.568 136.702 1.00 59.95  ?  234 ARG D CZ  1 
ATOM   8419  N  NH1 . ARG E  2 215 ? 151.263 155.170 137.540 1.00 59.95  1  234 ARG D NH1 1 
ATOM   8420  N  NH2 . ARG E  2 215 ? 150.036 153.327 136.945 1.00 59.95  ?  234 ARG D NH2 1 
ATOM   8421  N  N   . ARG E  2 216 ? 149.111 155.300 129.707 1.00 61.09  ?  235 ARG D N   1 
ATOM   8422  C  CA  . ARG E  2 216 ? 150.209 155.678 128.819 1.00 61.09  ?  235 ARG D CA  1 
ATOM   8423  C  C   . ARG E  2 216 ? 149.758 156.673 127.753 1.00 61.09  ?  235 ARG D C   1 
ATOM   8424  O  O   . ARG E  2 216 ? 150.462 157.658 127.480 1.00 61.09  ?  235 ARG D O   1 
ATOM   8425  C  CB  . ARG E  2 216 ? 150.807 154.441 128.154 1.00 61.09  ?  235 ARG D CB  1 
ATOM   8426  C  CG  . ARG E  2 216 ? 151.530 153.503 129.094 1.00 61.09  ?  235 ARG D CG  1 
ATOM   8427  C  CD  . ARG E  2 216 ? 152.209 152.384 128.318 1.00 61.09  ?  235 ARG D CD  1 
ATOM   8428  N  NE  . ARG E  2 216 ? 151.248 151.474 127.701 1.00 61.09  ?  235 ARG D NE  1 
ATOM   8429  C  CZ  . ARG E  2 216 ? 151.074 151.352 126.388 1.00 61.09  ?  235 ARG D CZ  1 
ATOM   8430  N  NH1 . ARG E  2 216 ? 151.793 152.085 125.552 1.00 61.09  1  235 ARG D NH1 1 
ATOM   8431  N  NH2 . ARG E  2 216 ? 150.179 150.498 125.915 1.00 61.09  ?  235 ARG D NH2 1 
ATOM   8432  N  N   . HIS E  2 217 ? 148.582 156.446 127.152 1.00 54.51  ?  236 HIS D N   1 
ATOM   8433  C  CA  . HIS E  2 217 ? 148.143 157.332 126.078 1.00 54.51  ?  236 HIS D CA  1 
ATOM   8434  C  C   . HIS E  2 217 ? 147.748 158.712 126.591 1.00 54.51  ?  236 HIS D C   1 
ATOM   8435  O  O   . HIS E  2 217 ? 148.021 159.720 125.928 1.00 54.51  ?  236 HIS D O   1 
ATOM   8436  C  CB  . HIS E  2 217 ? 147.004 156.679 125.312 1.00 54.51  ?  236 HIS D CB  1 
ATOM   8437  C  CG  . HIS E  2 217 ? 147.441 155.503 124.498 1.00 54.51  ?  236 HIS D CG  1 
ATOM   8438  N  ND1 . HIS E  2 217 ? 147.509 154.226 125.009 1.00 54.51  ?  236 HIS D ND1 1 
ATOM   8439  C  CD2 . HIS E  2 217 ? 147.859 155.417 123.215 1.00 54.51  ?  236 HIS D CD2 1 
ATOM   8440  C  CE1 . HIS E  2 217 ? 147.941 153.403 124.072 1.00 54.51  ?  236 HIS D CE1 1 
ATOM   8441  N  NE2 . HIS E  2 217 ? 148.156 154.100 122.972 1.00 54.51  ?  236 HIS D NE2 1 
ATOM   8442  N  N   . TYR E  2 218 ? 147.172 158.793 127.786 1.00 52.99  ?  237 TYR D N   1 
ATOM   8443  C  CA  . TYR E  2 218 ? 146.870 160.094 128.363 1.00 52.99  ?  237 TYR D CA  1 
ATOM   8444  C  C   . TYR E  2 218 ? 148.122 160.785 128.882 1.00 52.99  ?  237 TYR D C   1 
ATOM   8445  O  O   . TYR E  2 218 ? 148.179 162.018 128.883 1.00 52.99  ?  237 TYR D O   1 
ATOM   8446  C  CB  . TYR E  2 218 ? 145.830 159.941 129.470 1.00 52.99  ?  237 TYR D CB  1 
ATOM   8447  C  CG  . TYR E  2 218 ? 145.487 161.237 130.145 1.00 52.99  ?  237 TYR D CG  1 
ATOM   8448  C  CD1 . TYR E  2 218 ? 144.804 162.233 129.462 1.00 52.99  ?  237 TYR D CD1 1 
ATOM   8449  C  CD2 . TYR E  2 218 ? 145.839 161.461 131.465 1.00 52.99  ?  237 TYR D CD2 1 
ATOM   8450  C  CE1 . TYR E  2 218 ? 144.491 163.423 130.074 1.00 52.99  ?  237 TYR D CE1 1 
ATOM   8451  C  CE2 . TYR E  2 218 ? 145.530 162.646 132.088 1.00 52.99  ?  237 TYR D CE2 1 
ATOM   8452  C  CZ  . TYR E  2 218 ? 144.856 163.623 131.388 1.00 52.99  ?  237 TYR D CZ  1 
ATOM   8453  O  OH  . TYR E  2 218 ? 144.547 164.807 132.013 1.00 52.99  ?  237 TYR D OH  1 
ATOM   8454  N  N   . ARG E  2 219 ? 149.140 160.026 129.301 1.00 55.11  ?  238 ARG D N   1 
ATOM   8455  C  CA  . ARG E  2 219 ? 150.416 160.640 129.648 1.00 55.11  ?  238 ARG D CA  1 
ATOM   8456  C  C   . ARG E  2 219 ? 151.062 161.271 128.422 1.00 55.11  ?  238 ARG D C   1 
ATOM   8457  O  O   . ARG E  2 219 ? 151.611 162.379 128.492 1.00 55.11  ?  238 ARG D O   1 
ATOM   8458  C  CB  . ARG E  2 219 ? 151.346 159.603 130.270 1.00 55.11  ?  238 ARG D CB  1 
ATOM   8459  C  CG  . ARG E  2 219 ? 152.656 160.182 130.768 1.00 55.11  ?  238 ARG D CG  1 
ATOM   8460  C  CD  . ARG E  2 219 ? 153.557 159.112 131.356 1.00 55.11  ?  238 ARG D CD  1 
ATOM   8461  N  NE  . ARG E  2 219 ? 154.801 159.683 131.860 1.00 55.11  ?  238 ARG D NE  1 
ATOM   8462  C  CZ  . ARG E  2 219 ? 155.882 159.890 131.117 1.00 55.11  ?  238 ARG D CZ  1 
ATOM   8463  N  NH1 . ARG E  2 219 ? 156.972 160.414 131.657 1.00 55.11  1  238 ARG D NH1 1 
ATOM   8464  N  NH2 . ARG E  2 219 ? 155.870 159.580 129.828 1.00 55.11  ?  238 ARG D NH2 1 
ATOM   8465  N  N   . THR E  2 220 ? 150.973 160.586 127.281 1.00 52.46  ?  239 THR D N   1 
ATOM   8466  C  CA  . THR E  2 220 ? 151.450 161.161 126.026 1.00 52.46  ?  239 THR D CA  1 
ATOM   8467  C  C   . THR E  2 220 ? 150.641 162.398 125.642 1.00 52.46  ?  239 THR D C   1 
ATOM   8468  O  O   . THR E  2 220 ? 151.204 163.402 125.186 1.00 52.46  ?  239 THR D O   1 
ATOM   8469  C  CB  . THR E  2 220 ? 151.388 160.109 124.917 1.00 52.46  ?  239 THR D CB  1 
ATOM   8470  O  OG1 . THR E  2 220 ? 152.150 158.961 125.308 1.00 52.46  ?  239 THR D OG1 1 
ATOM   8471  C  CG2 . THR E  2 220 ? 151.963 160.645 123.620 1.00 52.46  ?  239 THR D CG2 1 
ATOM   8472  N  N   . PHE E  2 221 ? 149.323 162.359 125.865 1.00 52.26  ?  240 PHE D N   1 
ATOM   8473  C  CA  . PHE E  2 221 ? 148.461 163.486 125.511 1.00 52.26  ?  240 PHE D CA  1 
ATOM   8474  C  C   . PHE E  2 221 ? 148.728 164.698 126.395 1.00 52.26  ?  240 PHE D C   1 
ATOM   8475  O  O   . PHE E  2 221 ? 148.613 165.843 125.945 1.00 52.26  ?  240 PHE D O   1 
ATOM   8476  C  CB  . PHE E  2 221 ? 146.999 163.057 125.596 1.00 52.26  ?  240 PHE D CB  1 
ATOM   8477  C  CG  . PHE E  2 221 ? 146.023 164.140 125.254 1.00 52.26  ?  240 PHE D CG  1 
ATOM   8478  C  CD1 . PHE E  2 221 ? 145.891 164.585 123.952 1.00 52.26  ?  240 PHE D CD1 1 
ATOM   8479  C  CD2 . PHE E  2 221 ? 145.203 164.678 126.229 1.00 52.26  ?  240 PHE D CD2 1 
ATOM   8480  C  CE1 . PHE E  2 221 ? 144.979 165.570 123.634 1.00 52.26  ?  240 PHE D CE1 1 
ATOM   8481  C  CE2 . PHE E  2 221 ? 144.291 165.661 125.917 1.00 52.26  ?  240 PHE D CE2 1 
ATOM   8482  C  CZ  . PHE E  2 221 ? 144.178 166.108 124.618 1.00 52.26  ?  240 PHE D CZ  1 
ATOM   8483  N  N   . GLN E  2 222 ? 149.085 164.464 127.659 1.00 56.33  ?  241 GLN D N   1 
ATOM   8484  C  CA  . GLN E  2 222 ? 149.532 165.557 128.515 1.00 56.33  ?  241 GLN D CA  1 
ATOM   8485  C  C   . GLN E  2 222 ? 150.872 166.106 128.054 1.00 56.33  ?  241 GLN D C   1 
ATOM   8486  O  O   . GLN E  2 222 ? 151.067 167.324 128.009 1.00 56.33  ?  241 GLN D O   1 
ATOM   8487  C  CB  . GLN E  2 222 ? 149.636 165.091 129.965 1.00 56.33  ?  241 GLN D CB  1 
ATOM   8488  C  CG  . GLN E  2 222 ? 148.317 164.865 130.642 1.00 56.33  ?  241 GLN D CG  1 
ATOM   8489  C  CD  . GLN E  2 222 ? 147.540 166.141 130.766 1.00 56.33  ?  241 GLN D CD  1 
ATOM   8490  O  OE1 . GLN E  2 222 ? 146.523 166.329 130.107 1.00 56.33  ?  241 GLN D OE1 1 
ATOM   8491  N  NE2 . GLN E  2 222 ? 148.023 167.040 131.607 1.00 56.33  ?  241 GLN D NE2 1 
ATOM   8492  N  N   . SER E  2 223 ? 151.810 165.221 127.716 1.00 56.22  ?  242 SER D N   1 
ATOM   8493  C  CA  . SER E  2 223 ? 153.168 165.670 127.444 1.00 56.22  ?  242 SER D CA  1 
ATOM   8494  C  C   . SER E  2 223 ? 153.305 166.361 126.095 1.00 56.22  ?  242 SER D C   1 
ATOM   8495  O  O   . SER E  2 223 ? 154.233 167.153 125.911 1.00 56.22  ?  242 SER D O   1 
ATOM   8496  C  CB  . SER E  2 223 ? 154.132 164.489 127.525 1.00 56.22  ?  242 SER D CB  1 
ATOM   8497  O  OG  . SER E  2 223 ? 154.171 163.963 128.839 1.00 56.22  ?  242 SER D OG  1 
ATOM   8498  N  N   . LYS E  2 224 ? 152.409 166.091 125.145 1.00 60.62  ?  243 LYS D N   1 
ATOM   8499  C  CA  . LYS E  2 224 ? 152.586 166.704 123.832 1.00 60.62  ?  243 LYS D CA  1 
ATOM   8500  C  C   . LYS E  2 224 ? 151.766 167.978 123.675 1.00 60.62  ?  243 LYS D C   1 
ATOM   8501  O  O   . LYS E  2 224 ? 152.216 168.928 123.025 1.00 60.62  ?  243 LYS D O   1 
ATOM   8502  C  CB  . LYS E  2 224 ? 152.232 165.716 122.722 1.00 60.62  ?  243 LYS D CB  1 
ATOM   8503  C  CG  . LYS E  2 224 ? 153.063 164.449 122.728 1.00 60.62  ?  243 LYS D CG  1 
ATOM   8504  C  CD  . LYS E  2 224 ? 154.539 164.740 122.551 1.00 60.62  ?  243 LYS D CD  1 
ATOM   8505  C  CE  . LYS E  2 224 ? 155.319 163.453 122.353 1.00 60.62  ?  243 LYS D CE  1 
ATOM   8506  N  NZ  . LYS E  2 224 ? 155.318 162.618 123.583 1.00 60.62  1  243 LYS D NZ  1 
ATOM   8507  N  N   . CYS E  2 225 ? 150.568 168.026 124.255 1.00 63.13  ?  244 CYS D N   1 
ATOM   8508  C  CA  . CYS E  2 225 ? 149.643 169.117 123.962 1.00 63.13  ?  244 CYS D CA  1 
ATOM   8509  C  C   . CYS E  2 225 ? 149.771 170.273 124.949 1.00 63.13  ?  244 CYS D C   1 
ATOM   8510  O  O   . CYS E  2 225 ? 150.109 171.395 124.558 1.00 63.13  ?  244 CYS D O   1 
ATOM   8511  C  CB  . CYS E  2 225 ? 148.209 168.584 123.953 1.00 63.13  ?  244 CYS D CB  1 
ATOM   8512  S  SG  . CYS E  2 225 ? 147.895 167.366 122.672 1.00 63.13  ?  244 CYS D SG  1 
ATOM   8513  N  N   . TRP E  2 226 ? 149.513 170.016 126.226 1.00 62.77  ?  245 TRP D N   1 
ATOM   8514  C  CA  . TRP E  2 226 ? 149.470 171.065 127.244 1.00 62.77  ?  245 TRP D CA  1 
ATOM   8515  C  C   . TRP E  2 226 ? 150.772 170.967 128.030 1.00 62.77  ?  245 TRP D C   1 
ATOM   8516  O  O   . TRP E  2 226 ? 150.851 170.299 129.061 1.00 62.77  ?  245 TRP D O   1 
ATOM   8517  C  CB  . TRP E  2 226 ? 148.243 170.896 128.130 1.00 62.77  ?  245 TRP D CB  1 
ATOM   8518  C  CG  . TRP E  2 226 ? 146.986 170.892 127.331 1.00 62.77  ?  245 TRP D CG  1 
ATOM   8519  C  CD1 . TRP E  2 226 ? 146.310 169.798 126.896 1.00 62.77  ?  245 TRP D CD1 1 
ATOM   8520  C  CD2 . TRP E  2 226 ? 146.267 172.031 126.839 1.00 62.77  ?  245 TRP D CD2 1 
ATOM   8521  N  NE1 . TRP E  2 226 ? 145.208 170.175 126.174 1.00 62.77  ?  245 TRP D NE1 1 
ATOM   8522  C  CE2 . TRP E  2 226 ? 145.160 171.543 126.123 1.00 62.77  ?  245 TRP D CE2 1 
ATOM   8523  C  CE3 . TRP E  2 226 ? 146.449 173.413 126.941 1.00 62.77  ?  245 TRP D CE3 1 
ATOM   8524  C  CZ2 . TRP E  2 226 ? 144.239 172.381 125.513 1.00 62.77  ?  245 TRP D CZ2 1 
ATOM   8525  C  CZ3 . TRP E  2 226 ? 145.533 174.243 126.333 1.00 62.77  ?  245 TRP D CZ3 1 
ATOM   8526  C  CH2 . TRP E  2 226 ? 144.439 173.729 125.631 1.00 62.77  ?  245 TRP D CH2 1 
ATOM   8527  N  N   . GLN E  2 227 ? 151.806 171.644 127.529 1.00 63.56  ?  246 GLN D N   1 
ATOM   8528  C  CA  . GLN E  2 227 ? 153.148 171.409 128.048 1.00 63.56  ?  246 GLN D CA  1 
ATOM   8529  C  C   . GLN E  2 227 ? 153.411 172.194 129.323 1.00 63.56  ?  246 GLN D C   1 
ATOM   8530  O  O   . GLN E  2 227 ? 154.289 171.824 130.108 1.00 63.56  ?  246 GLN D O   1 
ATOM   8531  C  CB  . GLN E  2 227 ? 154.188 171.747 126.984 1.00 63.56  ?  246 GLN D CB  1 
ATOM   8532  C  CG  . GLN E  2 227 ? 154.176 170.792 125.810 1.00 63.56  ?  246 GLN D CG  1 
ATOM   8533  C  CD  . GLN E  2 227 ? 155.197 171.154 124.755 1.00 63.56  ?  246 GLN D CD  1 
ATOM   8534  O  OE1 . GLN E  2 227 ? 155.886 172.168 124.865 1.00 63.56  ?  246 GLN D OE1 1 
ATOM   8535  N  NE2 . GLN E  2 227 ? 155.300 170.326 123.723 1.00 63.56  ?  246 GLN D NE2 1 
ATOM   8536  N  N   . ARG E  2 228 ? 152.674 173.283 129.548 1.00 59.79  ?  247 ARG D N   1 
ATOM   8537  C  CA  . ARG E  2 228 ? 152.814 174.001 130.810 1.00 59.79  ?  247 ARG D CA  1 
ATOM   8538  C  C   . ARG E  2 228 ? 152.255 173.184 131.964 1.00 59.79  ?  247 ARG D C   1 
ATOM   8539  O  O   . ARG E  2 228 ? 152.880 173.089 133.029 1.00 59.79  ?  247 ARG D O   1 
ATOM   8540  C  CB  . ARG E  2 228 ? 152.118 175.353 130.723 1.00 59.79  ?  247 ARG D CB  1 
ATOM   8541  C  CG  . ARG E  2 228 ? 152.813 176.317 129.794 1.00 59.79  ?  247 ARG D CG  1 
ATOM   8542  C  CD  . ARG E  2 228 ? 152.095 177.647 129.737 1.00 59.79  ?  247 ARG D CD  1 
ATOM   8543  N  NE  . ARG E  2 228 ? 152.804 178.597 128.887 1.00 59.79  ?  247 ARG D NE  1 
ATOM   8544  C  CZ  . ARG E  2 228 ? 152.585 178.740 127.585 1.00 59.79  ?  247 ARG D CZ  1 
ATOM   8545  N  NH1 . ARG E  2 228 ? 151.673 177.994 126.978 1.00 59.79  1  247 ARG D NH1 1 
ATOM   8546  N  NH2 . ARG E  2 228 ? 153.279 179.629 126.890 1.00 59.79  ?  247 ARG D NH2 1 
ATOM   8547  N  N   . VAL E  2 229 ? 151.095 172.562 131.749 1.00 58.89  ?  248 VAL D N   1 
ATOM   8548  C  CA  . VAL E  2 229 ? 150.514 171.639 132.720 1.00 58.89  ?  248 VAL D CA  1 
ATOM   8549  C  C   . VAL E  2 229 ? 151.441 170.451 132.936 1.00 58.89  ?  248 VAL D C   1 
ATOM   8550  O  O   . VAL E  2 229 ? 151.575 169.936 134.055 1.00 58.89  ?  248 VAL D O   1 
ATOM   8551  C  CB  . VAL E  2 229 ? 149.128 171.190 132.229 1.00 58.89  ?  248 VAL D CB  1 
ATOM   8552  C  CG1 . VAL E  2 229 ? 148.458 170.281 133.228 1.00 58.89  ?  248 VAL D CG1 1 
ATOM   8553  C  CG2 . VAL E  2 229 ? 148.271 172.384 131.915 1.00 58.89  ?  248 VAL D CG2 1 
ATOM   8554  N  N   . THR E  2 230 ? 152.121 170.027 131.870 1.00 59.34  ?  249 THR D N   1 
ATOM   8555  C  CA  . THR E  2 230 ? 153.070 168.925 131.948 1.00 59.34  ?  249 THR D CA  1 
ATOM   8556  C  C   . THR E  2 230 ? 154.262 169.284 132.823 1.00 59.34  ?  249 THR D C   1 
ATOM   8557  O  O   . THR E  2 230 ? 154.607 168.550 133.752 1.00 59.34  ?  249 THR D O   1 
ATOM   8558  C  CB  . THR E  2 230 ? 153.537 168.549 130.546 1.00 59.34  ?  249 THR D CB  1 
ATOM   8559  O  OG1 . THR E  2 230 ? 152.400 168.236 129.738 1.00 59.34  ?  249 THR D OG1 1 
ATOM   8560  C  CG2 . THR E  2 230 ? 154.455 167.347 130.604 1.00 59.34  ?  249 THR D CG2 1 
ATOM   8561  N  N   . ARG E  2 231 ? 154.892 170.429 132.563 1.00 60.40  ?  250 ARG D N   1 
ATOM   8562  C  CA  . ARG E  2 231 ? 156.084 170.762 133.327 1.00 60.40  ?  250 ARG D CA  1 
ATOM   8563  C  C   . ARG E  2 231 ? 155.771 171.403 134.670 1.00 60.40  ?  250 ARG D C   1 
ATOM   8564  O  O   . ARG E  2 231 ? 156.707 171.738 135.400 1.00 60.40  ?  250 ARG D O   1 
ATOM   8565  C  CB  . ARG E  2 231 ? 157.006 171.670 132.517 1.00 60.40  ?  250 ARG D CB  1 
ATOM   8566  C  CG  . ARG E  2 231 ? 156.494 173.072 132.286 1.00 60.40  ?  250 ARG D CG  1 
ATOM   8567  C  CD  . ARG E  2 231 ? 157.474 173.872 131.433 1.00 60.40  ?  250 ARG D CD  1 
ATOM   8568  N  NE  . ARG E  2 231 ? 157.595 173.339 130.077 1.00 60.40  ?  250 ARG D NE  1 
ATOM   8569  C  CZ  . ARG E  2 231 ? 158.668 172.707 129.611 1.00 60.40  ?  250 ARG D CZ  1 
ATOM   8570  N  NH1 . ARG E  2 231 ? 159.722 172.521 130.393 1.00 60.40  1  250 ARG D NH1 1 
ATOM   8571  N  NH2 . ARG E  2 231 ? 158.684 172.258 128.364 1.00 60.40  ?  250 ARG D NH2 1 
ATOM   8572  N  N   . LYS E  2 232 ? 154.499 171.592 135.017 1.00 57.19  ?  251 LYS D N   1 
ATOM   8573  C  CA  . LYS E  2 232 ? 154.195 171.932 136.402 1.00 57.19  ?  251 LYS D CA  1 
ATOM   8574  C  C   . LYS E  2 232 ? 153.697 170.746 137.221 1.00 57.19  ?  251 LYS D C   1 
ATOM   8575  O  O   . LYS E  2 232 ? 154.019 170.660 138.410 1.00 57.19  ?  251 LYS D O   1 
ATOM   8576  C  CB  . LYS E  2 232 ? 153.165 173.063 136.470 1.00 57.19  ?  251 LYS D CB  1 
ATOM   8577  C  CG  . LYS E  2 232 ? 153.648 174.375 135.886 1.00 57.19  ?  251 LYS D CG  1 
ATOM   8578  C  CD  . LYS E  2 232 ? 154.748 174.991 136.715 1.00 57.19  ?  251 LYS D CD  1 
ATOM   8579  C  CE  . LYS E  2 232 ? 155.254 176.271 136.074 1.00 57.19  ?  251 LYS D CE  1 
ATOM   8580  N  NZ  . LYS E  2 232 ? 154.219 177.343 136.080 1.00 57.19  1  251 LYS D NZ  1 
ATOM   8581  N  N   . CYS E  2 233 ? 152.930 169.821 136.630 1.00 61.88  ?  252 CYS D N   1 
ATOM   8582  C  CA  . CYS E  2 233 ? 152.227 168.806 137.412 1.00 61.88  ?  252 CYS D CA  1 
ATOM   8583  C  C   . CYS E  2 233 ? 152.449 167.369 136.940 1.00 61.88  ?  252 CYS D C   1 
ATOM   8584  O  O   . CYS E  2 233 ? 152.376 166.454 137.769 1.00 61.88  ?  252 CYS D O   1 
ATOM   8585  C  CB  . CYS E  2 233 ? 150.719 169.093 137.389 1.00 61.88  ?  252 CYS D CB  1 
ATOM   8586  S  SG  . CYS E  2 233 ? 150.258 170.817 137.764 1.00 61.88  ?  252 CYS D SG  1 
ATOM   8587  N  N   . HIS E  2 234 ? 152.630 167.152 135.638 1.00 62.57  ?  253 HIS D N   1 
ATOM   8588  C  CA  . HIS E  2 234 ? 152.927 165.923 134.861 1.00 62.57  ?  253 HIS D CA  1 
ATOM   8589  C  C   . HIS E  2 234 ? 151.705 165.006 134.800 1.00 62.57  ?  253 HIS D C   1 
ATOM   8590  O  O   . HIS E  2 234 ? 151.442 164.488 133.705 1.00 62.57  ?  253 HIS D O   1 
ATOM   8591  C  CB  . HIS E  2 234 ? 154.174 165.235 135.442 1.00 62.57  ?  253 HIS D CB  1 
ATOM   8592  C  CG  . HIS E  2 234 ? 155.439 166.026 135.347 1.00 62.57  ?  253 HIS D CG  1 
ATOM   8593  N  ND1 . HIS E  2 234 ? 156.158 166.146 134.178 1.00 62.57  ?  253 HIS D ND1 1 
ATOM   8594  C  CD2 . HIS E  2 234 ? 156.139 166.699 136.290 1.00 62.57  ?  253 HIS D CD2 1 
ATOM   8595  C  CE1 . HIS E  2 234 ? 157.234 166.879 134.399 1.00 62.57  ?  253 HIS D CE1 1 
ATOM   8596  N  NE2 . HIS E  2 234 ? 157.246 167.229 135.672 1.00 62.57  ?  253 HIS D NE2 1 
ATOM   8597  N  N   . GLU E  2 235 ? 150.938 164.839 135.886 1.00 63.54  ?  254 GLU D N   1 
ATOM   8598  C  CA  . GLU E  2 235 ? 149.581 164.277 136.006 1.00 63.54  ?  254 GLU D CA  1 
ATOM   8599  C  C   . GLU E  2 235 ? 149.251 164.440 137.486 1.00 63.54  ?  254 GLU D C   1 
ATOM   8600  O  O   . GLU E  2 235 ? 149.779 163.695 138.312 1.00 63.54  ?  254 GLU D O   1 
ATOM   8601  C  CB  . GLU E  2 235 ? 149.444 162.787 135.622 1.00 63.54  ?  254 GLU D CB  1 
ATOM   8602  C  CG  . GLU E  2 235 ? 149.163 162.399 134.175 1.00 63.54  ?  254 GLU D CG  1 
ATOM   8603  C  CD  . GLU E  2 235 ? 149.250 160.897 133.966 1.00 63.54  ?  254 GLU D CD  1 
ATOM   8604  O  OE1 . GLU E  2 235 ? 149.656 160.189 134.915 1.00 63.54  ?  254 GLU D OE1 1 
ATOM   8605  O  OE2 . GLU E  2 235 ? 148.926 160.418 132.862 1.00 63.54  -1 254 GLU D OE2 1 
ATOM   8606  N  N   . ASP E  2 236 ? 148.342 165.350 137.824 1.00 58.97  ?  255 ASP D N   1 
ATOM   8607  C  CA  . ASP E  2 236 ? 147.959 165.528 139.223 1.00 58.97  ?  255 ASP D CA  1 
ATOM   8608  C  C   . ASP E  2 236 ? 146.652 166.296 139.285 1.00 58.97  ?  255 ASP D C   1 
ATOM   8609  O  O   . ASP E  2 236 ? 146.552 167.390 138.729 1.00 58.97  ?  255 ASP D O   1 
ATOM   8610  C  CB  . ASP E  2 236 ? 149.044 166.269 140.012 1.00 58.97  ?  255 ASP D CB  1 
ATOM   8611  C  CG  . ASP E  2 236 ? 148.849 166.158 141.506 1.00 58.97  ?  255 ASP D CG  1 
ATOM   8612  O  OD1 . ASP E  2 236 ? 149.104 165.064 142.049 1.00 58.97  ?  255 ASP D OD1 1 
ATOM   8613  O  OD2 . ASP E  2 236 ? 148.450 167.157 142.140 1.00 58.97  -1 255 ASP D OD2 1 
ATOM   8614  N  N   . GLU E  2 237 ? 145.660 165.730 139.964 1.00 54.42  ?  256 GLU D N   1 
ATOM   8615  C  CA  . GLU E  2 237 ? 144.383 166.404 140.145 1.00 54.42  ?  256 GLU D CA  1 
ATOM   8616  C  C   . GLU E  2 237 ? 144.545 167.630 141.029 1.00 54.42  ?  256 GLU D C   1 
ATOM   8617  O  O   . GLU E  2 237 ? 143.995 168.698 140.744 1.00 54.42  ?  256 GLU D O   1 
ATOM   8618  C  CB  . GLU E  2 237 ? 143.366 165.452 140.761 1.00 54.42  ?  256 GLU D CB  1 
ATOM   8619  C  CG  . GLU E  2 237 ? 143.037 164.260 139.902 1.00 54.42  ?  256 GLU D CG  1 
ATOM   8620  C  CD  . GLU E  2 237 ? 142.042 163.343 140.569 1.00 54.42  ?  256 GLU D CD  1 
ATOM   8621  O  OE1 . GLU E  2 237 ? 141.698 163.593 141.742 1.00 54.42  ?  256 GLU D OE1 1 
ATOM   8622  O  OE2 . GLU E  2 237 ? 141.609 162.373 139.922 1.00 54.42  -1 256 GLU D OE2 1 
ATOM   8623  N  N   . ASN E  2 238 ? 145.339 167.491 142.089 1.00 53.16  ?  257 ASN D N   1 
ATOM   8624  C  CA  . ASN E  2 238 ? 145.486 168.572 143.054 1.00 53.16  ?  257 ASN D CA  1 
ATOM   8625  C  C   . ASN E  2 238 ? 146.384 169.682 142.521 1.00 53.16  ?  257 ASN D C   1 
ATOM   8626  O  O   . ASN E  2 238 ? 146.478 170.756 143.124 1.00 53.16  ?  257 ASN D O   1 
ATOM   8627  C  CB  . ASN E  2 238 ? 146.035 168.008 144.359 1.00 53.16  ?  257 ASN D CB  1 
ATOM   8628  C  CG  . ASN E  2 238 ? 145.143 166.931 144.942 1.00 53.16  ?  257 ASN D CG  1 
ATOM   8629  O  OD1 . ASN E  2 238 ? 145.538 165.768 145.035 1.00 53.16  ?  257 ASN D OD1 1 
ATOM   8630  N  ND2 . ASN E  2 238 ? 143.931 167.309 145.328 1.00 53.16  ?  257 ASN D ND2 1 
ATOM   8631  N  N   . CYS E  2 239 ? 147.062 169.436 141.395 1.00 51.93  ?  258 CYS D N   1 
ATOM   8632  C  CA  . CYS E  2 239 ? 147.895 170.467 140.784 1.00 51.93  ?  258 CYS D CA  1 
ATOM   8633  C  C   . CYS E  2 239 ? 147.236 171.071 139.549 1.00 51.93  ?  258 CYS D C   1 
ATOM   8634  O  O   . CYS E  2 239 ? 147.467 172.244 139.240 1.00 51.93  ?  258 CYS D O   1 
ATOM   8635  C  CB  . CYS E  2 239 ? 149.270 169.889 140.453 1.00 51.93  ?  258 CYS D CB  1 
ATOM   8636  S  SG  . CYS E  2 239 ? 150.468 171.036 139.768 1.00 51.93  ?  258 CYS D SG  1 
ATOM   8637  N  N   . ILE E  2 240 ? 146.418 170.296 138.831 1.00 49.40  ?  259 ILE D N   1 
ATOM   8638  C  CA  . ILE E  2 240 ? 145.631 170.861 137.740 1.00 49.40  ?  259 ILE D CA  1 
ATOM   8639  C  C   . ILE E  2 240 ? 144.461 171.669 138.294 1.00 49.40  ?  259 ILE D C   1 
ATOM   8640  O  O   . ILE E  2 240 ? 144.046 172.671 137.697 1.00 49.40  ?  259 ILE D O   1 
ATOM   8641  C  CB  . ILE E  2 240 ? 145.197 169.732 136.782 1.00 49.40  ?  259 ILE D CB  1 
ATOM   8642  C  CG1 . ILE E  2 240 ? 146.420 169.181 136.060 1.00 49.40  ?  259 ILE D CG1 1 
ATOM   8643  C  CG2 . ILE E  2 240 ? 144.211 170.187 135.732 1.00 49.40  ?  259 ILE D CG2 1 
ATOM   8644  C  CD1 . ILE E  2 240 ? 146.145 167.951 135.248 1.00 49.40  ?  259 ILE D CD1 1 
ATOM   8645  N  N   . SER E  2 241 ? 143.992 171.335 139.502 1.00 49.98  ?  260 SER D N   1 
ATOM   8646  C  CA  . SER E  2 241 ? 142.877 172.052 140.119 1.00 49.98  ?  260 SER D CA  1 
ATOM   8647  C  C   . SER E  2 241 ? 143.224 173.467 140.570 1.00 49.98  ?  260 SER D C   1 
ATOM   8648  O  O   . SER E  2 241 ? 142.366 174.146 141.142 1.00 49.98  ?  260 SER D O   1 
ATOM   8649  C  CB  . SER E  2 241 ? 142.360 171.271 141.325 1.00 49.98  ?  260 SER D CB  1 
ATOM   8650  O  OG  . SER E  2 241 ? 141.371 172.011 142.016 1.00 49.98  ?  260 SER D OG  1 
ATOM   8651  N  N   . THR E  2 242 ? 144.453 173.923 140.348 1.00 49.81  ?  261 THR D N   1 
ATOM   8652  C  CA  . THR E  2 242 ? 144.891 175.237 140.777 1.00 49.81  ?  261 THR D CA  1 
ATOM   8653  C  C   . THR E  2 242 ? 145.104 176.194 139.618 1.00 49.81  ?  261 THR D C   1 
ATOM   8654  O  O   . THR E  2 242 ? 145.180 177.406 139.841 1.00 49.81  ?  261 THR D O   1 
ATOM   8655  C  CB  . THR E  2 242 ? 146.192 175.113 141.553 1.00 49.81  ?  261 THR D CB  1 
ATOM   8656  O  OG1 . THR E  2 242 ? 147.234 174.747 140.646 1.00 49.81  ?  261 THR D OG1 1 
ATOM   8657  C  CG2 . THR E  2 242 ? 146.062 174.012 142.566 1.00 49.81  ?  261 THR D CG2 1 
ATOM   8658  N  N   . LEU E  2 243 ? 145.196 175.686 138.397 1.00 51.48  ?  262 LEU D N   1 
ATOM   8659  C  CA  . LEU E  2 243 ? 145.519 176.512 137.244 1.00 51.48  ?  262 LEU D CA  1 
ATOM   8660  C  C   . LEU E  2 243 ? 144.302 177.325 136.816 1.00 51.48  ?  262 LEU D C   1 
ATOM   8661  O  O   . LEU E  2 243 ? 143.215 177.228 137.388 1.00 51.48  ?  262 LEU D O   1 
ATOM   8662  C  CB  . LEU E  2 243 ? 146.039 175.645 136.105 1.00 51.48  ?  262 LEU D CB  1 
ATOM   8663  C  CG  . LEU E  2 243 ? 147.402 174.996 136.316 1.00 51.48  ?  262 LEU D CG  1 
ATOM   8664  C  CD1 . LEU E  2 243 ? 147.696 174.053 135.181 1.00 51.48  ?  262 LEU D CD1 1 
ATOM   8665  C  CD2 . LEU E  2 243 ? 148.469 176.064 136.402 1.00 51.48  ?  262 LEU D CD2 1 
ATOM   8666  N  N   . SER E  2 244 ? 144.482 178.138 135.788 1.00 62.97  ?  263 SER D N   1 
ATOM   8667  C  CA  . SER E  2 244 ? 143.441 178.993 135.248 1.00 62.97  ?  263 SER D CA  1 
ATOM   8668  C  C   . SER E  2 244 ? 143.017 178.475 133.879 1.00 62.97  ?  263 SER D C   1 
ATOM   8669  O  O   . SER E  2 244 ? 143.502 177.450 133.401 1.00 62.97  ?  263 SER D O   1 
ATOM   8670  C  CB  . SER E  2 244 ? 143.939 180.432 135.151 1.00 62.97  ?  263 SER D CB  1 
ATOM   8671  O  OG  . SER E  2 244 ? 144.953 180.549 134.167 1.00 62.97  ?  263 SER D OG  1 
ATOM   8672  N  N   . LYS E  2 245 ? 142.101 179.200 133.249 1.00 64.13  ?  264 LYS D N   1 
ATOM   8673  C  CA  . LYS E  2 245 ? 141.819 179.025 131.834 1.00 64.13  ?  264 LYS D CA  1 
ATOM   8674  C  C   . LYS E  2 245 ? 142.487 180.097 130.991 1.00 64.13  ?  264 LYS D C   1 
ATOM   8675  O  O   . LYS E  2 245 ? 142.396 180.055 129.762 1.00 64.13  ?  264 LYS D O   1 
ATOM   8676  C  CB  . LYS E  2 245 ? 140.310 179.025 131.591 1.00 64.13  ?  264 LYS D CB  1 
ATOM   8677  C  CG  . LYS E  2 245 ? 139.606 177.808 132.161 1.00 64.13  ?  264 LYS D CG  1 
ATOM   8678  C  CD  . LYS E  2 245 ? 138.099 177.914 131.999 1.00 64.13  ?  264 LYS D CD  1 
ATOM   8679  C  CE  . LYS E  2 245 ? 137.682 177.773 130.546 1.00 64.13  ?  264 LYS D CE  1 
ATOM   8680  N  NZ  . LYS E  2 245 ? 137.911 176.398 130.034 1.00 64.13  1  264 LYS D NZ  1 
ATOM   8681  N  N   . GLN E  2 246 ? 143.150 181.060 131.632 1.00 72.26  ?  265 GLN D N   1 
ATOM   8682  C  CA  . GLN E  2 246 ? 143.945 182.040 130.904 1.00 72.26  ?  265 GLN D CA  1 
ATOM   8683  C  C   . GLN E  2 246 ? 145.285 181.446 130.491 1.00 72.26  ?  265 GLN D C   1 
ATOM   8684  O  O   . GLN E  2 246 ? 145.786 181.714 129.393 1.00 72.26  ?  265 GLN D O   1 
ATOM   8685  C  CB  . GLN E  2 246 ? 144.161 183.279 131.773 1.00 72.26  ?  265 GLN D CB  1 
ATOM   8686  C  CG  . GLN E  2 246 ? 142.891 184.025 132.130 1.00 72.26  ?  265 GLN D CG  1 
ATOM   8687  C  CD  . GLN E  2 246 ? 143.153 185.186 133.069 1.00 72.26  ?  265 GLN D CD  1 
ATOM   8688  O  OE1 . GLN E  2 246 ? 144.284 185.406 133.501 1.00 72.26  ?  265 GLN D OE1 1 
ATOM   8689  N  NE2 . GLN E  2 246 ? 142.105 185.931 133.395 1.00 72.26  ?  265 GLN D NE2 1 
ATOM   8690  N  N   . ASP E  2 247 ? 145.875 180.633 131.361 1.00 74.98  ?  266 ASP D N   1 
ATOM   8691  C  CA  . ASP E  2 247 ? 147.230 180.133 131.187 1.00 74.98  ?  266 ASP D CA  1 
ATOM   8692  C  C   . ASP E  2 247 ? 147.299 178.847 130.377 1.00 74.98  ?  266 ASP D C   1 
ATOM   8693  O  O   . ASP E  2 247 ? 148.357 178.209 130.350 1.00 74.98  ?  266 ASP D O   1 
ATOM   8694  C  CB  . ASP E  2 247 ? 147.873 179.918 132.555 1.00 74.98  ?  266 ASP D CB  1 
ATOM   8695  C  CG  . ASP E  2 247 ? 148.094 181.216 133.302 1.00 74.98  ?  266 ASP D CG  1 
ATOM   8696  O  OD1 . ASP E  2 247 ? 148.338 182.254 132.650 1.00 74.98  ?  266 ASP D OD1 1 
ATOM   8697  O  OD2 . ASP E  2 247 ? 148.005 181.201 134.544 1.00 74.98  -1 266 ASP D OD2 1 
ATOM   8698  N  N   . LEU E  2 248 ? 146.214 178.449 129.723 1.00 68.44  ?  267 LEU D N   1 
ATOM   8699  C  CA  . LEU E  2 248 ? 146.183 177.237 128.917 1.00 68.44  ?  267 LEU D CA  1 
ATOM   8700  C  C   . LEU E  2 248 ? 146.282 177.634 127.453 1.00 68.44  ?  267 LEU D C   1 
ATOM   8701  O  O   . LEU E  2 248 ? 145.383 178.296 126.923 1.00 68.44  ?  267 LEU D O   1 
ATOM   8702  C  CB  . LEU E  2 248 ? 144.908 176.439 129.179 1.00 68.44  ?  267 LEU D CB  1 
ATOM   8703  C  CG  . LEU E  2 248 ? 144.749 175.964 130.623 1.00 68.44  ?  267 LEU D CG  1 
ATOM   8704  C  CD1 . LEU E  2 248 ? 143.414 175.279 130.837 1.00 68.44  ?  267 LEU D CD1 1 
ATOM   8705  C  CD2 . LEU E  2 248 ? 145.878 175.047 130.992 1.00 68.44  ?  267 LEU D CD2 1 
ATOM   8706  N  N   . THR E  2 249 ? 147.374 177.238 126.807 1.00 72.78  ?  268 THR D N   1 
ATOM   8707  C  CA  . THR E  2 249 ? 147.605 177.548 125.405 1.00 72.78  ?  268 THR D CA  1 
ATOM   8708  C  C   . THR E  2 249 ? 148.012 176.270 124.696 1.00 72.78  ?  268 THR D C   1 
ATOM   8709  O  O   . THR E  2 249 ? 149.094 175.734 124.954 1.00 72.78  ?  268 THR D O   1 
ATOM   8710  C  CB  . THR E  2 249 ? 148.689 178.618 125.235 1.00 72.78  ?  268 THR D CB  1 
ATOM   8711  O  OG1 . THR E  2 249 ? 148.282 179.825 125.891 1.00 72.78  ?  268 THR D OG1 1 
ATOM   8712  C  CG2 . THR E  2 249 ? 148.929 178.904 123.764 1.00 72.78  ?  268 THR D CG2 1 
ATOM   8713  N  N   . CYS E  2 250 ? 147.152 175.796 123.805 1.00 73.44  ?  269 CYS D N   1 
ATOM   8714  C  CA  . CYS E  2 250 ? 147.360 174.531 123.123 1.00 73.44  ?  269 CYS D CA  1 
ATOM   8715  C  C   . CYS E  2 250 ? 148.495 174.640 122.119 1.00 73.44  ?  269 CYS D C   1 
ATOM   8716  O  O   . CYS E  2 250 ? 148.697 175.688 121.501 1.00 73.44  ?  269 CYS D O   1 
ATOM   8717  C  CB  . CYS E  2 250 ? 146.086 174.099 122.404 1.00 73.44  ?  269 CYS D CB  1 
ATOM   8718  S  SG  . CYS E  2 250 ? 146.195 172.467 121.664 1.00 73.44  ?  269 CYS D SG  1 
ATOM   8719  N  N   . SER E  2 251 ? 149.234 173.549 121.962 1.00 74.52  ?  270 SER D N   1 
ATOM   8720  C  CA  . SER E  2 251 ? 150.286 173.469 120.960 1.00 74.52  ?  270 SER D CA  1 
ATOM   8721  C  C   . SER E  2 251 ? 149.725 172.789 119.719 1.00 74.52  ?  270 SER D C   1 
ATOM   8722  O  O   . SER E  2 251 ? 149.174 171.687 119.805 1.00 74.52  ?  270 SER D O   1 
ATOM   8723  C  CB  . SER E  2 251 ? 151.494 172.709 121.500 1.00 74.52  ?  270 SER D CB  1 
ATOM   8724  O  OG  . SER E  2 251 ? 152.085 173.411 122.577 1.00 74.52  ?  270 SER D OG  1 
ATOM   8725  N  N   . GLY E  2 252 ? 149.864 173.445 118.571 1.00 73.82  ?  271 GLY D N   1 
ATOM   8726  C  CA  . GLY E  2 252 ? 149.292 172.932 117.343 1.00 73.82  ?  271 GLY D CA  1 
ATOM   8727  C  C   . GLY E  2 252 ? 150.186 171.985 116.571 1.00 73.82  ?  271 GLY D C   1 
ATOM   8728  O  O   . GLY E  2 252 ? 149.954 171.744 115.383 1.00 73.82  ?  271 GLY D O   1 
ATOM   8729  N  N   . SER E  2 253 ? 151.211 171.447 117.223 1.00 70.53  ?  272 SER D N   1 
ATOM   8730  C  CA  . SER E  2 253 ? 152.126 170.531 116.565 1.00 70.53  ?  272 SER D CA  1 
ATOM   8731  C  C   . SER E  2 253 ? 151.452 169.185 116.325 1.00 70.53  ?  272 SER D C   1 
ATOM   8732  O  O   . SER E  2 253 ? 150.444 168.844 116.948 1.00 70.53  ?  272 SER D O   1 
ATOM   8733  C  CB  . SER E  2 253 ? 153.389 170.338 117.399 1.00 70.53  ?  272 SER D CB  1 
ATOM   8734  O  OG  . SER E  2 253 ? 153.092 169.668 118.610 1.00 70.53  ?  272 SER D OG  1 
ATOM   8735  N  N   . ASP E  2 254 ? 152.030 168.410 115.409 1.00 68.62  ?  273 ASP D N   1 
ATOM   8736  C  CA  . ASP E  2 254 ? 151.460 167.122 115.036 1.00 68.62  ?  273 ASP D CA  1 
ATOM   8737  C  C   . ASP E  2 254 ? 151.653 166.049 116.096 1.00 68.62  ?  273 ASP D C   1 
ATOM   8738  O  O   . ASP E  2 254 ? 151.002 165.001 116.011 1.00 68.62  ?  273 ASP D O   1 
ATOM   8739  C  CB  . ASP E  2 254 ? 152.051 166.646 113.711 1.00 68.62  ?  273 ASP D CB  1 
ATOM   8740  C  CG  . ASP E  2 254 ? 151.578 167.474 112.538 1.00 68.62  ?  273 ASP D CG  1 
ATOM   8741  O  OD1 . ASP E  2 254 ? 150.465 168.034 112.615 1.00 68.62  ?  273 ASP D OD1 1 
ATOM   8742  O  OD2 . ASP E  2 254 ? 152.317 167.562 111.535 1.00 68.62  -1 273 ASP D OD2 1 
ATOM   8743  N  N   . ASP E  2 255 ? 152.527 166.274 117.080 1.00 66.96  ?  274 ASP D N   1 
ATOM   8744  C  CA  . ASP E  2 255 ? 152.608 165.365 118.217 1.00 66.96  ?  274 ASP D CA  1 
ATOM   8745  C  C   . ASP E  2 255 ? 151.319 165.391 119.027 1.00 66.96  ?  274 ASP D C   1 
ATOM   8746  O  O   . ASP E  2 255 ? 150.854 164.348 119.501 1.00 66.96  ?  274 ASP D O   1 
ATOM   8747  C  CB  . ASP E  2 255 ? 153.798 165.735 119.097 1.00 66.96  ?  274 ASP D CB  1 
ATOM   8748  C  CG  . ASP E  2 255 ? 155.122 165.458 118.428 1.00 66.96  ?  274 ASP D CG  1 
ATOM   8749  O  OD1 . ASP E  2 255 ? 155.180 164.535 117.591 1.00 66.96  ?  274 ASP D OD1 1 
ATOM   8750  O  OD2 . ASP E  2 255 ? 156.104 166.161 118.743 1.00 66.96  -1 274 ASP D OD2 1 
ATOM   8751  N  N   . CYS E  2 256 ? 150.721 166.577 119.170 1.00 62.35  ?  275 CYS D N   1 
ATOM   8752  C  CA  . CYS E  2 256 ? 149.428 166.698 119.833 1.00 62.35  ?  275 CYS D CA  1 
ATOM   8753  C  C   . CYS E  2 256 ? 148.330 166.009 119.029 1.00 62.35  ?  275 CYS D C   1 
ATOM   8754  O  O   . CYS E  2 256 ? 147.435 165.373 119.606 1.00 62.35  ?  275 CYS D O   1 
ATOM   8755  C  CB  . CYS E  2 256 ? 149.099 168.175 120.049 1.00 62.35  ?  275 CYS D CB  1 
ATOM   8756  S  SG  . CYS E  2 256 ? 147.610 168.480 121.005 1.00 62.35  ?  275 CYS D SG  1 
ATOM   8757  N  N   . LYS E  2 257 ? 148.395 166.124 117.696 1.00 57.74  ?  276 LYS D N   1 
ATOM   8758  C  CA  . LYS E  2 257 ? 147.490 165.401 116.805 1.00 57.74  ?  276 LYS D CA  1 
ATOM   8759  C  C   . LYS E  2 257 ? 147.577 163.899 117.029 1.00 57.74  ?  276 LYS D C   1 
ATOM   8760  O  O   . LYS E  2 257 ? 146.556 163.224 117.214 1.00 57.74  ?  276 LYS D O   1 
ATOM   8761  C  CB  . LYS E  2 257 ? 147.835 165.715 115.349 1.00 57.74  ?  276 LYS D CB  1 
ATOM   8762  C  CG  . LYS E  2 257 ? 147.658 167.145 114.897 1.00 57.74  ?  276 LYS D CG  1 
ATOM   8763  C  CD  . LYS E  2 257 ? 146.221 167.452 114.586 1.00 57.74  ?  276 LYS D CD  1 
ATOM   8764  C  CE  . LYS E  2 257 ? 146.071 168.847 114.032 1.00 57.74  ?  276 LYS D CE  1 
ATOM   8765  N  NZ  . LYS E  2 257 ? 146.730 169.001 112.718 1.00 57.74  1  276 LYS D NZ  1 
ATOM   8766  N  N   . ALA E  2 258 ? 148.803 163.364 117.032 1.00 55.69  ?  277 ALA D N   1 
ATOM   8767  C  CA  . ALA E  2 258 ? 148.993 161.923 117.157 1.00 55.69  ?  277 ALA D CA  1 
ATOM   8768  C  C   . ALA E  2 258 ? 148.588 161.428 118.536 1.00 55.69  ?  277 ALA D C   1 
ATOM   8769  O  O   . ALA E  2 258 ? 148.024 160.336 118.666 1.00 55.69  ?  277 ALA D O   1 
ATOM   8770  C  CB  . ALA E  2 258 ? 150.448 161.558 116.862 1.00 55.69  ?  277 ALA D CB  1 
ATOM   8771  N  N   . ALA E  2 259 ? 148.821 162.236 119.571 1.00 52.41  ?  278 ALA D N   1 
ATOM   8772  C  CA  . ALA E  2 259 ? 148.415 161.855 120.918 1.00 52.41  ?  278 ALA D CA  1 
ATOM   8773  C  C   . ALA E  2 259 ? 146.899 161.837 121.072 1.00 52.41  ?  278 ALA D C   1 
ATOM   8774  O  O   . ALA E  2 259 ? 146.346 160.912 121.685 1.00 52.41  ?  278 ALA D O   1 
ATOM   8775  C  CB  . ALA E  2 259 ? 149.039 162.805 121.933 1.00 52.41  ?  278 ALA D CB  1 
ATOM   8776  N  N   . TYR E  2 260 ? 146.209 162.831 120.502 1.00 50.83  ?  279 TYR D N   1 
ATOM   8777  C  CA  . TYR E  2 260 ? 144.755 162.850 120.612 1.00 50.83  ?  279 TYR D CA  1 
ATOM   8778  C  C   . TYR E  2 260 ? 144.115 161.755 119.766 1.00 50.83  ?  279 TYR D C   1 
ATOM   8779  O  O   . TYR E  2 260 ? 143.052 161.232 120.123 1.00 50.83  ?  279 TYR D O   1 
ATOM   8780  C  CB  . TYR E  2 260 ? 144.199 164.216 120.223 1.00 50.83  ?  279 TYR D CB  1 
ATOM   8781  C  CG  . TYR E  2 260 ? 142.700 164.262 120.347 1.00 50.83  ?  279 TYR D CG  1 
ATOM   8782  C  CD1 . TYR E  2 260 ? 142.096 164.250 121.593 1.00 50.83  ?  279 TYR D CD1 1 
ATOM   8783  C  CD2 . TYR E  2 260 ? 141.890 164.285 119.224 1.00 50.83  ?  279 TYR D CD2 1 
ATOM   8784  C  CE1 . TYR E  2 260 ? 140.728 164.273 121.720 1.00 50.83  ?  279 TYR D CE1 1 
ATOM   8785  C  CE2 . TYR E  2 260 ? 140.521 164.311 119.341 1.00 50.83  ?  279 TYR D CE2 1 
ATOM   8786  C  CZ  . TYR E  2 260 ? 139.946 164.306 120.590 1.00 50.83  ?  279 TYR D CZ  1 
ATOM   8787  O  OH  . TYR E  2 260 ? 138.580 164.332 120.710 1.00 50.83  ?  279 TYR D OH  1 
ATOM   8788  N  N   . ILE E  2 261 ? 144.735 161.389 118.643 1.00 46.60  ?  280 ILE D N   1 
ATOM   8789  C  CA  . ILE E  2 261 ? 144.206 160.257 117.890 1.00 46.60  ?  280 ILE D CA  1 
ATOM   8790  C  C   . ILE E  2 261 ? 144.468 158.953 118.635 1.00 46.60  ?  280 ILE D C   1 
ATOM   8791  O  O   . ILE E  2 261 ? 143.605 158.066 118.672 1.00 46.60  ?  280 ILE D O   1 
ATOM   8792  C  CB  . ILE E  2 261 ? 144.785 160.260 116.467 1.00 46.60  ?  280 ILE D CB  1 
ATOM   8793  C  CG1 . ILE E  2 261 ? 144.253 161.472 115.714 1.00 46.60  ?  280 ILE D CG1 1 
ATOM   8794  C  CG2 . ILE E  2 261 ? 144.407 159.015 115.708 1.00 46.60  ?  280 ILE D CG2 1 
ATOM   8795  C  CD1 . ILE E  2 261 ? 144.981 161.746 114.432 1.00 46.60  ?  280 ILE D CD1 1 
ATOM   8796  N  N   . ASP E  2 262 ? 145.615 158.839 119.307 1.00 50.20  ?  281 ASP D N   1 
ATOM   8797  C  CA  . ASP E  2 262 ? 145.903 157.648 120.094 1.00 50.20  ?  281 ASP D CA  1 
ATOM   8798  C  C   . ASP E  2 262 ? 145.029 157.507 121.334 1.00 50.20  ?  281 ASP D C   1 
ATOM   8799  O  O   . ASP E  2 262 ? 144.882 156.382 121.821 1.00 50.20  ?  281 ASP D O   1 
ATOM   8800  C  CB  . ASP E  2 262 ? 147.376 157.620 120.505 1.00 50.20  ?  281 ASP D CB  1 
ATOM   8801  C  CG  . ASP E  2 262 ? 148.295 157.225 119.365 1.00 50.20  ?  281 ASP D CG  1 
ATOM   8802  O  OD1 . ASP E  2 262 ? 147.847 156.479 118.469 1.00 50.20  ?  281 ASP D OD1 1 
ATOM   8803  O  OD2 . ASP E  2 262 ? 149.470 157.647 119.372 1.00 50.20  -1 281 ASP D OD2 1 
ATOM   8804  N  N   . ILE E  2 263 ? 144.444 158.585 121.864 1.00 46.55  ?  282 ILE D N   1 
ATOM   8805  C  CA  . ILE E  2 263 ? 143.530 158.402 122.991 1.00 46.55  ?  282 ILE D CA  1 
ATOM   8806  C  C   . ILE E  2 263 ? 142.092 158.124 122.563 1.00 46.55  ?  282 ILE D C   1 
ATOM   8807  O  O   . ILE E  2 263 ? 141.272 157.762 123.421 1.00 46.55  ?  282 ILE D O   1 
ATOM   8808  C  CB  . ILE E  2 263 ? 143.534 159.588 123.976 1.00 46.55  ?  282 ILE D CB  1 
ATOM   8809  C  CG1 . ILE E  2 263 ? 142.915 160.825 123.340 1.00 46.55  ?  282 ILE D CG1 1 
ATOM   8810  C  CG2 . ILE E  2 263 ? 144.934 159.855 124.481 1.00 46.55  ?  282 ILE D CG2 1 
ATOM   8811  C  CD1 . ILE E  2 263 ? 142.581 161.896 124.334 1.00 46.55  ?  282 ILE D CD1 1 
ATOM   8812  N  N   . LEU E  2 264 ? 141.756 158.290 121.282 1.00 43.99  ?  283 LEU D N   1 
ATOM   8813  C  CA  . LEU E  2 264 ? 140.426 157.926 120.796 1.00 43.99  ?  283 LEU D CA  1 
ATOM   8814  C  C   . LEU E  2 264 ? 140.252 156.418 120.856 1.00 43.99  ?  283 LEU D C   1 
ATOM   8815  O  O   . LEU E  2 264 ? 140.951 155.678 120.160 1.00 43.99  ?  283 LEU D O   1 
ATOM   8816  C  CB  . LEU E  2 264 ? 140.197 158.416 119.373 1.00 43.99  ?  283 LEU D CB  1 
ATOM   8817  C  CG  . LEU E  2 264 ? 139.899 159.891 119.169 1.00 43.99  ?  283 LEU D CG  1 
ATOM   8818  C  CD1 . LEU E  2 264 ? 139.782 160.187 117.698 1.00 43.99  ?  283 LEU D CD1 1 
ATOM   8819  C  CD2 . LEU E  2 264 ? 138.611 160.231 119.868 1.00 43.99  ?  283 LEU D CD2 1 
ATOM   8820  N  N   . GLY E  2 265 ? 139.318 155.961 121.678 1.00 44.25  ?  284 GLY D N   1 
ATOM   8821  C  CA  . GLY E  2 265 ? 139.047 154.545 121.764 1.00 44.25  ?  284 GLY D CA  1 
ATOM   8822  C  C   . GLY E  2 265 ? 138.965 154.080 123.192 1.00 44.25  ?  284 GLY D C   1 
ATOM   8823  O  O   . GLY E  2 265 ? 138.328 153.074 123.497 1.00 44.25  ?  284 GLY D O   1 
ATOM   8824  N  N   . THR E  2 266 ? 139.604 154.814 124.077 1.00 43.31  ?  285 THR D N   1 
ATOM   8825  C  CA  . THR E  2 266 ? 139.520 154.554 125.498 1.00 43.31  ?  285 THR D CA  1 
ATOM   8826  C  C   . THR E  2 266 ? 138.277 155.243 126.056 1.00 43.31  ?  285 THR D C   1 
ATOM   8827  O  O   . THR E  2 266 ? 137.380 155.654 125.315 1.00 43.31  ?  285 THR D O   1 
ATOM   8828  C  CB  . THR E  2 266 ? 140.810 155.003 126.178 1.00 43.31  ?  285 THR D CB  1 
ATOM   8829  O  OG1 . THR E  2 266 ? 141.054 156.382 125.881 1.00 43.31  ?  285 THR D OG1 1 
ATOM   8830  C  CG2 . THR E  2 266 ? 141.983 154.175 125.693 1.00 43.31  ?  285 THR D CG2 1 
ATOM   8831  N  N   . VAL E  2 267 ? 138.206 155.368 127.382 1.00 40.90  ?  286 VAL D N   1 
ATOM   8832  C  CA  . VAL E  2 267 ? 137.049 155.998 128.002 1.00 40.90  ?  286 VAL D CA  1 
ATOM   8833  C  C   . VAL E  2 267 ? 137.059 157.512 127.794 1.00 40.90  ?  286 VAL D C   1 
ATOM   8834  O  O   . VAL E  2 267 ? 136.043 158.174 128.020 1.00 40.90  ?  286 VAL D O   1 
ATOM   8835  C  CB  . VAL E  2 267 ? 137.011 155.613 129.496 1.00 40.90  ?  286 VAL D CB  1 
ATOM   8836  C  CG1 . VAL E  2 267 ? 138.051 156.386 130.282 1.00 40.90  ?  286 VAL D CG1 1 
ATOM   8837  C  CG2 . VAL E  2 267 ? 135.611 155.743 130.091 1.00 40.90  ?  286 VAL D CG2 1 
ATOM   8838  N  N   . LEU E  2 268 ? 138.171 158.074 127.316 1.00 38.21  ?  287 LEU D N   1 
ATOM   8839  C  CA  . LEU E  2 268 ? 138.306 159.513 127.129 1.00 38.21  ?  287 LEU D CA  1 
ATOM   8840  C  C   . LEU E  2 268 ? 137.504 160.050 125.951 1.00 38.21  ?  287 LEU D C   1 
ATOM   8841  O  O   . LEU E  2 268 ? 137.395 161.270 125.810 1.00 38.21  ?  287 LEU D O   1 
ATOM   8842  C  CB  . LEU E  2 268 ? 139.775 159.869 126.935 1.00 38.21  ?  287 LEU D CB  1 
ATOM   8843  C  CG  . LEU E  2 268 ? 140.691 159.507 128.097 1.00 38.21  ?  287 LEU D CG  1 
ATOM   8844  C  CD1 . LEU E  2 268 ? 142.120 159.836 127.745 1.00 38.21  ?  287 LEU D CD1 1 
ATOM   8845  C  CD2 . LEU E  2 268 ? 140.259 160.231 129.341 1.00 38.21  ?  287 LEU D CD2 1 
ATOM   8846  N  N   . GLN E  2 269 ? 136.957 159.186 125.098 1.00 42.38  ?  288 GLN D N   1 
ATOM   8847  C  CA  . GLN E  2 269 ? 136.107 159.649 124.011 1.00 42.38  ?  288 GLN D CA  1 
ATOM   8848  C  C   . GLN E  2 269 ? 134.703 159.994 124.498 1.00 42.38  ?  288 GLN D C   1 
ATOM   8849  O  O   . GLN E  2 269 ? 133.996 160.754 123.826 1.00 42.38  ?  288 GLN D O   1 
ATOM   8850  C  CB  . GLN E  2 269 ? 136.042 158.577 122.917 1.00 42.38  ?  288 GLN D CB  1 
ATOM   8851  C  CG  . GLN E  2 269 ? 135.465 159.036 121.589 1.00 42.38  ?  288 GLN D CG  1 
ATOM   8852  C  CD  . GLN E  2 269 ? 135.328 157.911 120.597 1.00 42.38  ?  288 GLN D CD  1 
ATOM   8853  O  OE1 . GLN E  2 269 ? 135.586 156.754 120.916 1.00 42.38  ?  288 GLN D OE1 1 
ATOM   8854  N  NE2 . GLN E  2 269 ? 134.920 158.243 119.379 1.00 42.38  ?  288 GLN D NE2 1 
ATOM   8855  N  N   . VAL E  2 270 ? 134.308 159.472 125.666 1.00 45.30  ?  289 VAL D N   1 
ATOM   8856  C  CA  . VAL E  2 270 ? 132.963 159.665 126.201 1.00 45.30  ?  289 VAL D CA  1 
ATOM   8857  C  C   . VAL E  2 270 ? 132.714 161.135 126.499 1.00 45.30  ?  289 VAL D C   1 
ATOM   8858  O  O   . VAL E  2 270 ? 133.485 161.779 127.218 1.00 45.30  ?  289 VAL D O   1 
ATOM   8859  C  CB  . VAL E  2 270 ? 132.777 158.809 127.462 1.00 45.30  ?  289 VAL D CB  1 
ATOM   8860  C  CG1 . VAL E  2 270 ? 131.455 159.113 128.133 1.00 45.30  ?  289 VAL D CG1 1 
ATOM   8861  C  CG2 . VAL E  2 270 ? 132.868 157.340 127.119 1.00 45.30  ?  289 VAL D CG2 1 
ATOM   8862  N  N   . GLN E  2 271 ? 131.638 161.674 125.928 1.00 52.16  ?  290 GLN D N   1 
ATOM   8863  C  CA  . GLN E  2 271 ? 131.276 163.078 126.099 1.00 52.16  ?  290 GLN D CA  1 
ATOM   8864  C  C   . GLN E  2 271 ? 130.795 163.296 127.524 1.00 52.16  ?  290 GLN D C   1 
ATOM   8865  O  O   . GLN E  2 271 ? 129.662 162.960 127.870 1.00 52.16  ?  290 GLN D O   1 
ATOM   8866  C  CB  . GLN E  2 271 ? 130.205 163.479 125.094 1.00 52.16  ?  290 GLN D CB  1 
ATOM   8867  C  CG  . GLN E  2 271 ? 129.854 164.951 125.134 1.00 52.16  ?  290 GLN D CG  1 
ATOM   8868  C  CD  . GLN E  2 271 ? 128.836 165.333 124.082 1.00 52.16  ?  290 GLN D CD  1 
ATOM   8869  O  OE1 . GLN E  2 271 ? 128.341 164.482 123.345 1.00 52.16  ?  290 GLN D OE1 1 
ATOM   8870  N  NE2 . GLN E  2 271 ? 128.523 166.621 124.001 1.00 52.16  ?  290 GLN D NE2 1 
ATOM   8871  N  N   . CYS E  2 272 ? 131.659 163.861 128.353 1.00 50.19  ?  291 CYS D N   1 
ATOM   8872  C  CA  . CYS E  2 272 ? 131.362 164.073 129.758 1.00 50.19  ?  291 CYS D CA  1 
ATOM   8873  C  C   . CYS E  2 272 ? 130.877 165.494 130.003 1.00 50.19  ?  291 CYS D C   1 
ATOM   8874  O  O   . CYS E  2 272 ? 131.320 166.443 129.356 1.00 50.19  ?  291 CYS D O   1 
ATOM   8875  C  CB  . CYS E  2 272 ? 132.596 163.781 130.608 1.00 50.19  ?  291 CYS D CB  1 
ATOM   8876  S  SG  . CYS E  2 272 ? 134.049 164.797 130.257 1.00 50.19  ?  291 CYS D SG  1 
ATOM   8877  N  N   . THR E  2 273 ? 129.949 165.628 130.949 1.00 54.98  ?  292 THR D N   1 
ATOM   8878  C  CA  . THR E  2 273 ? 129.350 166.911 131.290 1.00 54.98  ?  292 THR D CA  1 
ATOM   8879  C  C   . THR E  2 273 ? 129.536 167.184 132.772 1.00 54.98  ?  292 THR D C   1 
ATOM   8880  O  O   . THR E  2 273 ? 129.253 166.323 133.608 1.00 54.98  ?  292 THR D O   1 
ATOM   8881  C  CB  . THR E  2 273 ? 127.859 166.949 130.962 1.00 54.98  ?  292 THR D CB  1 
ATOM   8882  O  OG1 . THR E  2 273 ? 127.179 165.944 131.725 1.00 54.98  ?  292 THR D OG1 1 
ATOM   8883  C  CG2 . THR E  2 273 ? 127.621 166.710 129.478 1.00 54.98  ?  292 THR D CG2 1 
ATOM   8884  N  N   . CYS E  2 274 ? 130.000 168.392 133.092 1.00 58.05  ?  293 CYS D N   1 
ATOM   8885  C  CA  . CYS E  2 274 ? 130.246 168.792 134.475 1.00 58.05  ?  293 CYS D CA  1 
ATOM   8886  C  C   . CYS E  2 274 ? 128.998 169.493 134.999 1.00 58.05  ?  293 CYS D C   1 
ATOM   8887  O  O   . CYS E  2 274 ? 128.970 170.705 135.209 1.00 58.05  ?  293 CYS D O   1 
ATOM   8888  C  CB  . CYS E  2 274 ? 131.471 169.692 134.566 1.00 58.05  ?  293 CYS D CB  1 
ATOM   8889  S  SG  . CYS E  2 274 ? 133.018 168.922 134.049 1.00 58.05  ?  293 CYS D SG  1 
ATOM   8890  N  N   . ARG E  2 275 ? 127.948 168.704 135.211 1.00 58.18  ?  294 ARG D N   1 
ATOM   8891  C  CA  . ARG E  2 275 ? 126.691 169.246 135.707 1.00 58.18  ?  294 ARG D CA  1 
ATOM   8892  C  C   . ARG E  2 275 ? 126.382 168.734 137.103 1.00 58.18  ?  294 ARG D C   1 
ATOM   8893  O  O   . ARG E  2 275 ? 126.149 169.521 138.025 1.00 58.18  ?  294 ARG D O   1 
ATOM   8894  C  CB  . ARG E  2 275 ? 125.542 168.883 134.773 1.00 58.18  ?  294 ARG D CB  1 
ATOM   8895  C  CG  . ARG E  2 275 ? 125.602 169.539 133.418 1.00 58.18  ?  294 ARG D CG  1 
ATOM   8896  C  CD  . ARG E  2 275 ? 124.396 169.124 132.626 1.00 58.18  ?  294 ARG D CD  1 
ATOM   8897  N  NE  . ARG E  2 275 ? 123.184 169.583 133.289 1.00 58.18  ?  294 ARG D NE  1 
ATOM   8898  C  CZ  . ARG E  2 275 ? 121.958 169.232 132.926 1.00 58.18  ?  294 ARG D CZ  1 
ATOM   8899  N  NH1 . ARG E  2 275 ? 120.912 169.699 133.591 1.00 58.18  1  294 ARG D NH1 1 
ATOM   8900  N  NH2 . ARG E  2 275 ? 121.780 168.418 131.896 1.00 58.18  ?  294 ARG D NH2 1 
ATOM   8901  N  N   . THR E  2 276 ? 126.367 167.418 137.264 1.00 52.45  ?  295 THR D N   1 
ATOM   8902  C  CA  . THR E  2 276 ? 126.024 166.799 138.539 1.00 52.45  ?  295 THR D CA  1 
ATOM   8903  C  C   . THR E  2 276 ? 127.251 166.556 139.410 1.00 52.45  ?  295 THR D C   1 
ATOM   8904  O  O   . THR E  2 276 ? 127.449 165.483 139.979 1.00 52.45  ?  295 THR D O   1 
ATOM   8905  C  CB  . THR E  2 276 ? 125.261 165.507 138.279 1.00 52.45  ?  295 THR D CB  1 
ATOM   8906  O  OG1 . THR E  2 276 ? 125.087 164.795 139.508 1.00 52.45  ?  295 THR D OG1 1 
ATOM   8907  C  CG2 . THR E  2 276 ? 125.965 164.644 137.224 1.00 52.45  ?  295 THR D CG2 1 
ATOM   8908  N  N   . ILE E  2 277 ? 128.060 167.596 139.566 1.00 48.63  ?  296 ILE D N   1 
ATOM   8909  C  CA  . ILE E  2 277 ? 129.315 167.515 140.295 1.00 48.63  ?  296 ILE D CA  1 
ATOM   8910  C  C   . ILE E  2 277 ? 129.308 168.612 141.353 1.00 48.63  ?  296 ILE D C   1 
ATOM   8911  O  O   . ILE E  2 277 ? 128.607 169.621 141.219 1.00 48.63  ?  296 ILE D O   1 
ATOM   8912  C  CB  . ILE E  2 277 ? 130.518 167.622 139.325 1.00 48.63  ?  296 ILE D CB  1 
ATOM   8913  C  CG1 . ILE E  2 277 ? 131.789 167.050 139.951 1.00 48.63  ?  296 ILE D CG1 1 
ATOM   8914  C  CG2 . ILE E  2 277 ? 130.723 169.046 138.838 1.00 48.63  ?  296 ILE D CG2 1 
ATOM   8915  C  CD1 . ILE E  2 277 ? 131.706 165.567 140.213 1.00 48.63  ?  296 ILE D CD1 1 
ATOM   8916  N  N   . THR E  2 278 ? 130.061 168.394 142.430 1.00 49.65  ?  297 THR D N   1 
ATOM   8917  C  CA  . THR E  2 278 ? 129.936 169.215 143.623 1.00 49.65  ?  297 THR D CA  1 
ATOM   8918  C  C   . THR E  2 278 ? 130.538 170.604 143.415 1.00 49.65  ?  297 THR D C   1 
ATOM   8919  O  O   . THR E  2 278 ? 131.040 170.955 142.345 1.00 49.65  ?  297 THR D O   1 
ATOM   8920  C  CB  . THR E  2 278 ? 130.582 168.525 144.820 1.00 49.65  ?  297 THR D CB  1 
ATOM   8921  O  OG1 . THR E  2 278 ? 130.431 169.347 145.983 1.00 49.65  ?  297 THR D OG1 1 
ATOM   8922  C  CG2 . THR E  2 278 ? 132.044 168.279 144.570 1.00 49.65  ?  297 THR D CG2 1 
ATOM   8923  N  N   . GLN E  2 279 ? 130.479 171.402 144.479 1.00 48.79  ?  298 GLN D N   1 
ATOM   8924  C  CA  . GLN E  2 279 ? 130.775 172.825 144.369 1.00 48.79  ?  298 GLN D CA  1 
ATOM   8925  C  C   . GLN E  2 279 ? 132.277 173.081 144.341 1.00 48.79  ?  298 GLN D C   1 
ATOM   8926  O  O   . GLN E  2 279 ? 132.759 173.888 143.539 1.00 48.79  ?  298 GLN D O   1 
ATOM   8927  C  CB  . GLN E  2 279 ? 130.113 173.565 145.532 1.00 48.79  ?  298 GLN D CB  1 
ATOM   8928  C  CG  . GLN E  2 279 ? 130.213 175.072 145.488 1.00 48.79  ?  298 GLN D CG  1 
ATOM   8929  C  CD  . GLN E  2 279 ? 129.312 175.705 144.457 1.00 48.79  ?  298 GLN D CD  1 
ATOM   8930  O  OE1 . GLN E  2 279 ? 128.151 175.335 144.325 1.00 48.79  ?  298 GLN D OE1 1 
ATOM   8931  N  NE2 . GLN E  2 279 ? 129.840 176.670 143.719 1.00 48.79  ?  298 GLN D NE2 1 
ATOM   8932  N  N   . SER E  2 280 ? 133.033 172.390 145.193 1.00 50.98  ?  299 SER D N   1 
ATOM   8933  C  CA  . SER E  2 280 ? 134.459 172.634 145.359 1.00 50.98  ?  299 SER D CA  1 
ATOM   8934  C  C   . SER E  2 280 ? 135.318 171.855 144.374 1.00 50.98  ?  299 SER D C   1 
ATOM   8935  O  O   . SER E  2 280 ? 136.535 172.056 144.337 1.00 50.98  ?  299 SER D O   1 
ATOM   8936  C  CB  . SER E  2 280 ? 134.883 172.291 146.786 1.00 50.98  ?  299 SER D CB  1 
ATOM   8937  O  OG  . SER E  2 280 ? 134.738 170.904 147.026 1.00 50.98  ?  299 SER D OG  1 
ATOM   8938  N  N   . GLU E  2 281 ? 134.721 170.971 143.583 1.00 50.38  ?  300 GLU D N   1 
ATOM   8939  C  CA  . GLU E  2 281 ? 135.440 170.202 142.578 1.00 50.38  ?  300 GLU D CA  1 
ATOM   8940  C  C   . GLU E  2 281 ? 134.971 170.580 141.184 1.00 50.38  ?  300 GLU D C   1 
ATOM   8941  O  O   . GLU E  2 281 ? 135.015 169.770 140.261 1.00 50.38  ?  300 GLU D O   1 
ATOM   8942  C  CB  . GLU E  2 281 ? 135.263 168.706 142.814 1.00 50.38  ?  300 GLU D CB  1 
ATOM   8943  C  CG  . GLU E  2 281 ? 135.897 168.219 144.097 1.00 50.38  ?  300 GLU D CG  1 
ATOM   8944  C  CD  . GLU E  2 281 ? 135.598 166.762 144.374 1.00 50.38  ?  300 GLU D CD  1 
ATOM   8945  O  OE1 . GLU E  2 281 ? 134.759 166.182 143.654 1.00 50.38  ?  300 GLU D OE1 1 
ATOM   8946  O  OE2 . GLU E  2 281 ? 136.204 166.197 145.307 1.00 50.38  -1 300 GLU D OE2 1 
ATOM   8947  N  N   . GLU E  2 282 ? 134.510 171.814 141.028 1.00 53.61  ?  301 GLU D N   1 
ATOM   8948  C  CA  . GLU E  2 282 ? 133.958 172.269 139.764 1.00 53.61  ?  301 GLU D CA  1 
ATOM   8949  C  C   . GLU E  2 282 ? 135.010 172.829 138.825 1.00 53.61  ?  301 GLU D C   1 
ATOM   8950  O  O   . GLU E  2 282 ? 134.938 172.572 137.619 1.00 53.61  ?  301 GLU D O   1 
ATOM   8951  C  CB  . GLU E  2 282 ? 132.883 173.329 140.019 1.00 53.61  ?  301 GLU D CB  1 
ATOM   8952  C  CG  . GLU E  2 282 ? 132.139 173.783 138.781 1.00 53.61  ?  301 GLU D CG  1 
ATOM   8953  C  CD  . GLU E  2 282 ? 131.045 174.775 139.098 1.00 53.61  ?  301 GLU D CD  1 
ATOM   8954  O  OE1 . GLU E  2 282 ? 130.866 175.099 140.291 1.00 53.61  ?  301 GLU D OE1 1 
ATOM   8955  O  OE2 . GLU E  2 282 ? 130.368 175.238 138.156 1.00 53.61  -1 301 GLU D OE2 1 
ATOM   8956  N  N   . SER E  2 283 ? 135.989 173.571 139.351 1.00 48.23  ?  302 SER D N   1 
ATOM   8957  C  CA  . SER E  2 283 ? 137.028 174.154 138.506 1.00 48.23  ?  302 SER D CA  1 
ATOM   8958  C  C   . SER E  2 283 ? 137.932 173.082 137.912 1.00 48.23  ?  302 SER D C   1 
ATOM   8959  O  O   . SER E  2 283 ? 138.371 173.196 136.760 1.00 48.23  ?  302 SER D O   1 
ATOM   8960  C  CB  . SER E  2 283 ? 137.847 175.155 139.314 1.00 48.23  ?  302 SER D CB  1 
ATOM   8961  O  OG  . SER E  2 283 ? 138.530 174.499 140.365 1.00 48.23  ?  302 SER D OG  1 
ATOM   8962  N  N   . LEU E  2 284 ? 138.213 172.031 138.684 1.00 48.79  ?  303 LEU D N   1 
ATOM   8963  C  CA  . LEU E  2 284 ? 138.976 170.894 138.179 1.00 48.79  ?  303 LEU D CA  1 
ATOM   8964  C  C   . LEU E  2 284 ? 138.243 170.192 137.047 1.00 48.79  ?  303 LEU D C   1 
ATOM   8965  O  O   . LEU E  2 284 ? 138.851 169.812 136.039 1.00 48.79  ?  303 LEU D O   1 
ATOM   8966  C  CB  . LEU E  2 284 ? 139.254 169.924 139.324 1.00 48.79  ?  303 LEU D CB  1 
ATOM   8967  C  CG  . LEU E  2 284 ? 139.941 168.610 138.998 1.00 48.79  ?  303 LEU D CG  1 
ATOM   8968  C  CD1 . LEU E  2 284 ? 141.272 168.860 138.341 1.00 48.79  ?  303 LEU D CD1 1 
ATOM   8969  C  CD2 . LEU E  2 284 ? 140.119 167.828 140.282 1.00 48.79  ?  303 LEU D CD2 1 
ATOM   8970  N  N   . CYS E  2 285 ? 136.929 170.020 137.198 1.00 50.80  ?  304 CYS D N   1 
ATOM   8971  C  CA  . CYS E  2 285 ? 136.132 169.402 136.148 1.00 50.80  ?  304 CYS D CA  1 
ATOM   8972  C  C   . CYS E  2 285 ? 136.076 170.296 134.923 1.00 50.80  ?  304 CYS D C   1 
ATOM   8973  O  O   . CYS E  2 285 ? 136.088 169.798 133.795 1.00 50.80  ?  304 CYS D O   1 
ATOM   8974  C  CB  . CYS E  2 285 ? 134.722 169.106 136.662 1.00 50.80  ?  304 CYS D CB  1 
ATOM   8975  S  SG  . CYS E  2 285 ? 133.718 167.932 135.683 1.00 50.80  ?  304 CYS D SG  1 
ATOM   8976  N  N   . LYS E  2 286 ? 136.058 171.616 135.123 1.00 48.24  ?  305 LYS D N   1 
ATOM   8977  C  CA  . LYS E  2 286 ? 136.063 172.534 133.992 1.00 48.24  ?  305 LYS D CA  1 
ATOM   8978  C  C   . LYS E  2 286 ? 137.386 172.502 133.241 1.00 48.24  ?  305 LYS D C   1 
ATOM   8979  O  O   . LYS E  2 286 ? 137.389 172.553 132.008 1.00 48.24  ?  305 LYS D O   1 
ATOM   8980  C  CB  . LYS E  2 286 ? 135.750 173.953 134.460 1.00 48.24  ?  305 LYS D CB  1 
ATOM   8981  C  CG  . LYS E  2 286 ? 134.299 174.166 134.848 1.00 48.24  ?  305 LYS D CG  1 
ATOM   8982  C  CD  . LYS E  2 286 ? 134.043 175.602 135.267 1.00 48.24  ?  305 LYS D CD  1 
ATOM   8983  C  CE  . LYS E  2 286 ? 132.601 175.800 135.697 1.00 48.24  ?  305 LYS D CE  1 
ATOM   8984  N  NZ  . LYS E  2 286 ? 131.667 175.663 134.548 1.00 48.24  1  305 LYS D NZ  1 
ATOM   8985  N  N   . ILE E  2 287 ? 138.510 172.369 133.948 1.00 47.51  ?  306 ILE D N   1 
ATOM   8986  C  CA  . ILE E  2 287 ? 139.800 172.319 133.260 1.00 47.51  ?  306 ILE D CA  1 
ATOM   8987  C  C   . ILE E  2 287 ? 139.984 170.979 132.550 1.00 47.51  ?  306 ILE D C   1 
ATOM   8988  O  O   . ILE E  2 287 ? 140.505 170.926 131.428 1.00 47.51  ?  306 ILE D O   1 
ATOM   8989  C  CB  . ILE E  2 287 ? 140.943 172.628 134.247 1.00 47.51  ?  306 ILE D CB  1 
ATOM   8990  C  CG1 . ILE E  2 287 ? 140.799 174.054 134.766 1.00 47.51  ?  306 ILE D CG1 1 
ATOM   8991  C  CG2 . ILE E  2 287 ? 142.290 172.534 133.580 1.00 47.51  ?  306 ILE D CG2 1 
ATOM   8992  C  CD1 . ILE E  2 287 ? 141.711 174.381 135.908 1.00 47.51  ?  306 ILE D CD1 1 
ATOM   8993  N  N   . PHE E  2 288 ? 139.531 169.881 133.175 1.00 45.60  ?  307 PHE D N   1 
ATOM   8994  C  CA  . PHE E  2 288 ? 139.533 168.583 132.500 1.00 45.60  ?  307 PHE D CA  1 
ATOM   8995  C  C   . PHE E  2 288 ? 138.647 168.584 131.262 1.00 45.60  ?  307 PHE D C   1 
ATOM   8996  O  O   . PHE E  2 288 ? 139.050 168.082 130.208 1.00 45.60  ?  307 PHE D O   1 
ATOM   8997  C  CB  . PHE E  2 288 ? 139.094 167.475 133.456 1.00 45.60  ?  307 PHE D CB  1 
ATOM   8998  C  CG  . PHE E  2 288 ? 140.206 166.901 134.285 1.00 45.60  ?  307 PHE D CG  1 
ATOM   8999  C  CD1 . PHE E  2 288 ? 141.527 167.085 133.926 1.00 45.60  ?  307 PHE D CD1 1 
ATOM   9000  C  CD2 . PHE E  2 288 ? 139.923 166.147 135.407 1.00 45.60  ?  307 PHE D CD2 1 
ATOM   9001  C  CE1 . PHE E  2 288 ? 142.544 166.543 134.681 1.00 45.60  ?  307 PHE D CE1 1 
ATOM   9002  C  CE2 . PHE E  2 288 ? 140.935 165.603 136.164 1.00 45.60  ?  307 PHE D CE2 1 
ATOM   9003  C  CZ  . PHE E  2 288 ? 142.245 165.803 135.801 1.00 45.60  ?  307 PHE D CZ  1 
ATOM   9004  N  N   . GLN E  2 289 ? 137.447 169.156 131.363 1.00 48.36  ?  308 GLN D N   1 
ATOM   9005  C  CA  . GLN E  2 289 ? 136.565 169.278 130.210 1.00 48.36  ?  308 GLN D CA  1 
ATOM   9006  C  C   . GLN E  2 289 ? 137.147 170.200 129.152 1.00 48.36  ?  308 GLN D C   1 
ATOM   9007  O  O   . GLN E  2 289 ? 136.895 169.998 127.962 1.00 48.36  ?  308 GLN D O   1 
ATOM   9008  C  CB  . GLN E  2 289 ? 135.193 169.780 130.666 1.00 48.36  ?  308 GLN D CB  1 
ATOM   9009  C  CG  . GLN E  2 289 ? 134.119 169.787 129.590 1.00 48.36  ?  308 GLN D CG  1 
ATOM   9010  C  CD  . GLN E  2 289 ? 132.785 170.282 130.100 1.00 48.36  ?  308 GLN D CD  1 
ATOM   9011  O  OE1 . GLN E  2 289 ? 132.653 170.657 131.263 1.00 48.36  ?  308 GLN D OE1 1 
ATOM   9012  N  NE2 . GLN E  2 289 ? 131.787 170.291 129.226 1.00 48.36  ?  308 GLN D NE2 1 
ATOM   9013  N  N   . HIS E  2 290 ? 137.949 171.183 129.560 1.00 49.30  ?  309 HIS D N   1 
ATOM   9014  C  CA  . HIS E  2 290 ? 138.606 172.050 128.595 1.00 49.30  ?  309 HIS D CA  1 
ATOM   9015  C  C   . HIS E  2 290 ? 139.703 171.308 127.843 1.00 49.30  ?  309 HIS D C   1 
ATOM   9016  O  O   . HIS E  2 290 ? 139.849 171.477 126.629 1.00 49.30  ?  309 HIS D O   1 
ATOM   9017  C  CB  . HIS E  2 290 ? 139.167 173.279 129.306 1.00 49.30  ?  309 HIS D CB  1 
ATOM   9018  C  CG  . HIS E  2 290 ? 139.795 174.274 128.385 1.00 49.30  ?  309 HIS D CG  1 
ATOM   9019  N  ND1 . HIS E  2 290 ? 139.058 175.058 127.524 1.00 49.30  ?  309 HIS D ND1 1 
ATOM   9020  C  CD2 . HIS E  2 290 ? 141.088 174.622 128.194 1.00 49.30  ?  309 HIS D CD2 1 
ATOM   9021  C  CE1 . HIS E  2 290 ? 139.870 175.841 126.839 1.00 49.30  ?  309 HIS D CE1 1 
ATOM   9022  N  NE2 . HIS E  2 290 ? 141.108 175.597 127.226 1.00 49.30  ?  309 HIS D NE2 1 
ATOM   9023  N  N   . MET E  2 291 ? 140.474 170.469 128.539 1.00 45.51  ?  310 MET D N   1 
ATOM   9024  C  CA  . MET E  2 291 ? 141.555 169.758 127.861 1.00 45.51  ?  310 MET D CA  1 
ATOM   9025  C  C   . MET E  2 291 ? 141.037 168.615 126.998 1.00 45.51  ?  310 MET D C   1 
ATOM   9026  O  O   . MET E  2 291 ? 141.550 168.390 125.898 1.00 45.51  ?  310 MET D O   1 
ATOM   9027  C  CB  . MET E  2 291 ? 142.580 169.228 128.863 1.00 45.51  ?  310 MET D CB  1 
ATOM   9028  C  CG  . MET E  2 291 ? 143.412 170.296 129.534 1.00 45.51  ?  310 MET D CG  1 
ATOM   9029  S  SD  . MET E  2 291 ? 144.794 169.597 130.447 1.00 45.51  ?  310 MET D SD  1 
ATOM   9030  C  CE  . MET E  2 291 ? 143.959 168.853 131.836 1.00 45.51  ?  310 MET D CE  1 
ATOM   9031  N  N   . LEU E  2 292 ? 140.021 167.887 127.468 1.00 41.96  ?  311 LEU D N   1 
ATOM   9032  C  CA  . LEU E  2 292 ? 139.538 166.724 126.729 1.00 41.96  ?  311 LEU D CA  1 
ATOM   9033  C  C   . LEU E  2 292 ? 138.668 167.101 125.537 1.00 41.96  ?  311 LEU D C   1 
ATOM   9034  O  O   . LEU E  2 292 ? 138.340 166.228 124.729 1.00 41.96  ?  311 LEU D O   1 
ATOM   9035  C  CB  . LEU E  2 292 ? 138.751 165.796 127.651 1.00 41.96  ?  311 LEU D CB  1 
ATOM   9036  C  CG  . LEU E  2 292 ? 139.533 165.173 128.802 1.00 41.96  ?  311 LEU D CG  1 
ATOM   9037  C  CD1 . LEU E  2 292 ? 138.623 164.335 129.662 1.00 41.96  ?  311 LEU D CD1 1 
ATOM   9038  C  CD2 . LEU E  2 292 ? 140.685 164.359 128.287 1.00 41.96  ?  311 LEU D CD2 1 
ATOM   9039  N  N   . HIS E  2 293 ? 138.281 168.367 125.413 1.00 54.37  ?  312 HIS D N   1 
ATOM   9040  C  CA  . HIS E  2 293 ? 137.356 168.763 124.363 1.00 54.37  ?  312 HIS D CA  1 
ATOM   9041  C  C   . HIS E  2 293 ? 138.076 168.811 123.024 1.00 54.37  ?  312 HIS D C   1 
ATOM   9042  O  O   . HIS E  2 293 ? 139.290 169.018 122.966 1.00 54.37  ?  312 HIS D O   1 
ATOM   9043  C  CB  . HIS E  2 293 ? 136.746 170.123 124.697 1.00 54.37  ?  312 HIS D CB  1 
ATOM   9044  C  CG  . HIS E  2 293 ? 135.561 170.479 123.860 1.00 54.37  ?  312 HIS D CG  1 
ATOM   9045  N  ND1 . HIS E  2 293 ? 135.672 171.116 122.646 1.00 54.37  ?  312 HIS D ND1 1 
ATOM   9046  C  CD2 . HIS E  2 293 ? 134.236 170.292 124.067 1.00 54.37  ?  312 HIS D CD2 1 
ATOM   9047  C  CE1 . HIS E  2 293 ? 134.469 171.300 122.134 1.00 54.37  ?  312 HIS D CE1 1 
ATOM   9048  N  NE2 . HIS E  2 293 ? 133.579 170.811 122.979 1.00 54.37  ?  312 HIS D NE2 1 
ATOM   9049  N  N   . ARG E  2 294 ? 137.319 168.615 121.943 1.00 61.96  ?  313 ARG D N   1 
ATOM   9050  C  CA  . ARG E  2 294 ? 137.930 168.486 120.624 1.00 61.96  ?  313 ARG D CA  1 
ATOM   9051  C  C   . ARG E  2 294 ? 138.234 169.851 120.015 1.00 61.96  ?  313 ARG D C   1 
ATOM   9052  O  O   . ARG E  2 294 ? 139.299 170.054 119.423 1.00 61.96  ?  313 ARG D O   1 
ATOM   9053  C  CB  . ARG E  2 294 ? 137.013 167.653 119.724 1.00 61.96  ?  313 ARG D CB  1 
ATOM   9054  C  CG  . ARG E  2 294 ? 137.594 167.241 118.377 1.00 61.96  ?  313 ARG D CG  1 
ATOM   9055  C  CD  . ARG E  2 294 ? 137.120 168.133 117.235 1.00 61.96  ?  313 ARG D CD  1 
ATOM   9056  N  NE  . ARG E  2 294 ? 135.661 168.199 117.185 1.00 61.96  ?  313 ARG D NE  1 
ATOM   9057  C  CZ  . ARG E  2 294 ? 134.881 167.278 116.626 1.00 61.96  ?  313 ARG D CZ  1 
ATOM   9058  N  NH1 . ARG E  2 294 ? 133.563 167.433 116.638 1.00 61.96  1  313 ARG D NH1 1 
ATOM   9059  N  NH2 . ARG E  2 294 ? 135.409 166.205 116.051 1.00 61.96  ?  313 ARG D NH2 1 
ATOM   9060  N  N   . LYS E  2 295 ? 137.312 170.805 120.152 1.00 64.60  ?  314 LYS D N   1 
ATOM   9061  C  CA  . LYS E  2 295 ? 137.474 172.136 119.576 1.00 64.60  ?  314 LYS D CA  1 
ATOM   9062  C  C   . LYS E  2 295 ? 138.350 173.057 120.413 1.00 64.60  ?  314 LYS D C   1 
ATOM   9063  O  O   . LYS E  2 295 ? 138.440 174.246 120.092 1.00 64.60  ?  314 LYS D O   1 
ATOM   9064  C  CB  . LYS E  2 295 ? 136.112 172.804 119.375 1.00 64.60  ?  314 LYS D CB  1 
ATOM   9065  C  CG  . LYS E  2 295 ? 135.253 172.184 118.295 1.00 64.60  ?  314 LYS D CG  1 
ATOM   9066  C  CD  . LYS E  2 295 ? 133.951 172.955 118.152 1.00 64.60  ?  314 LYS D CD  1 
ATOM   9067  C  CE  . LYS E  2 295 ? 133.045 172.335 117.106 1.00 64.60  ?  314 LYS D CE  1 
ATOM   9068  N  NZ  . LYS E  2 295 ? 131.761 173.071 116.948 1.00 64.60  1  314 LYS D NZ  1 
ATOM   9069  N  N   . SER E  2 296 ? 138.996 172.553 121.468 1.00 62.83  ?  315 SER D N   1 
ATOM   9070  C  CA  . SER E  2 296 ? 139.854 173.408 122.279 1.00 62.83  ?  315 SER D CA  1 
ATOM   9071  C  C   . SER E  2 296 ? 141.184 173.689 121.596 1.00 62.83  ?  315 SER D C   1 
ATOM   9072  O  O   . SER E  2 296 ? 141.924 174.578 122.032 1.00 62.83  ?  315 SER D O   1 
ATOM   9073  C  CB  . SER E  2 296 ? 140.097 172.770 123.642 1.00 62.83  ?  315 SER D CB  1 
ATOM   9074  O  OG  . SER E  2 296 ? 138.897 172.666 124.383 1.00 62.83  ?  315 SER D OG  1 
ATOM   9075  N  N   . CYS E  2 297 ? 141.512 172.946 120.542 1.00 73.78  ?  316 CYS D N   1 
ATOM   9076  C  CA  . CYS E  2 297 ? 142.774 173.135 119.848 1.00 73.78  ?  316 CYS D CA  1 
ATOM   9077  C  C   . CYS E  2 297 ? 142.658 173.347 118.345 1.00 73.78  ?  316 CYS D C   1 
ATOM   9078  O  O   . CYS E  2 297 ? 143.410 174.168 117.808 1.00 73.78  ?  316 CYS D O   1 
ATOM   9079  C  CB  . CYS E  2 297 ? 143.701 171.940 120.102 1.00 73.78  ?  316 CYS D CB  1 
ATOM   9080  S  SG  . CYS E  2 297 ? 144.291 171.774 121.785 1.00 73.78  ?  316 CYS D SG  1 
ATOM   9081  N  N   . PHE E  2 298 ? 141.755 172.658 117.646 1.00 71.43  ?  317 PHE D N   1 
ATOM   9082  C  CA  . PHE E  2 298 ? 141.754 172.660 116.181 1.00 71.43  ?  317 PHE D CA  1 
ATOM   9083  C  C   . PHE E  2 298 ? 140.334 172.824 115.656 1.00 71.43  ?  317 PHE D C   1 
ATOM   9084  O  O   . PHE E  2 298 ? 139.457 172.006 115.936 1.00 71.43  ?  317 PHE D O   1 
ATOM   9085  C  CB  . PHE E  2 298 ? 142.391 171.388 115.648 1.00 71.43  ?  317 PHE D CB  1 
ATOM   9086  C  CG  . PHE E  2 298 ? 143.798 171.188 116.114 1.00 71.43  ?  317 PHE D CG  1 
ATOM   9087  C  CD1 . PHE E  2 298 ? 144.829 171.963 115.605 1.00 71.43  ?  317 PHE D CD1 1 
ATOM   9088  C  CD2 . PHE E  2 298 ? 144.087 170.222 117.060 1.00 71.43  ?  317 PHE D CD2 1 
ATOM   9089  C  CE1 . PHE E  2 298 ? 146.126 171.785 116.048 1.00 71.43  ?  317 PHE D CE1 1 
ATOM   9090  C  CE2 . PHE E  2 298 ? 145.379 170.035 117.507 1.00 71.43  ?  317 PHE D CE2 1 
ATOM   9091  C  CZ  . PHE E  2 298 ? 146.402 170.815 116.999 1.00 71.43  ?  317 PHE D CZ  1 
ATOM   9092  N  N   . ASN E  2 299 ? 140.118 173.890 114.888 1.00 72.28  ?  318 ASN D N   1 
ATOM   9093  C  CA  . ASN E  2 299 ? 138.904 174.062 114.094 1.00 72.28  ?  318 ASN D CA  1 
ATOM   9094  C  C   . ASN E  2 299 ? 139.154 174.955 112.879 1.00 72.28  ?  318 ASN D C   1 
ATOM   9095  O  O   . ASN E  2 299 ? 138.350 175.832 112.560 1.00 72.28  ?  318 ASN D O   1 
ATOM   9096  C  CB  . ASN E  2 299 ? 137.756 174.621 114.944 1.00 72.28  ?  318 ASN D CB  1 
ATOM   9097  C  CG  . ASN E  2 299 ? 138.114 175.911 115.660 1.00 72.28  ?  318 ASN D CG  1 
ATOM   9098  O  OD1 . ASN E  2 299 ? 139.229 176.424 115.549 1.00 72.28  ?  318 ASN D OD1 1 
ATOM   9099  N  ND2 . ASN E  2 299 ? 137.147 176.457 116.386 1.00 72.28  ?  318 ASN D ND2 1 
ATOM   9100  N  N   . LEU F  3 1   ? 138.065 177.084 159.943 1.00 56.84  ?  29  LEU F N   1 
ATOM   9101  C  CA  . LEU F  3 1   ? 138.001 178.202 159.013 1.00 56.84  ?  29  LEU F CA  1 
ATOM   9102  C  C   . LEU F  3 1   ? 138.104 177.673 157.600 1.00 56.84  ?  29  LEU F C   1 
ATOM   9103  O  O   . LEU F  3 1   ? 137.879 176.491 157.362 1.00 56.84  ?  29  LEU F O   1 
ATOM   9104  C  CB  . LEU F  3 1   ? 139.121 179.199 159.281 1.00 56.84  ?  29  LEU F CB  1 
ATOM   9105  C  CG  . LEU F  3 1   ? 139.156 179.829 160.668 1.00 56.84  ?  29  LEU F CG  1 
ATOM   9106  C  CD1 . LEU F  3 1   ? 140.388 180.674 160.813 1.00 56.84  ?  29  LEU F CD1 1 
ATOM   9107  C  CD2 . LEU F  3 1   ? 137.926 180.656 160.907 1.00 56.84  ?  29  LEU F CD2 1 
ATOM   9108  N  N   . TYR F  3 2   ? 138.457 178.547 156.665 1.00 53.10  ?  30  TYR F N   1 
ATOM   9109  C  CA  . TYR F  3 2   ? 138.705 178.122 155.295 1.00 53.10  ?  30  TYR F CA  1 
ATOM   9110  C  C   . TYR F  3 2   ? 139.638 179.120 154.639 1.00 53.10  ?  30  TYR F C   1 
ATOM   9111  O  O   . TYR F  3 2   ? 139.469 180.330 154.811 1.00 53.10  ?  30  TYR F O   1 
ATOM   9112  C  CB  . TYR F  3 2   ? 137.404 177.986 154.504 1.00 53.10  ?  30  TYR F CB  1 
ATOM   9113  C  CG  . TYR F  3 2   ? 136.621 179.251 154.261 1.00 53.10  ?  30  TYR F CG  1 
ATOM   9114  C  CD1 . TYR F  3 2   ? 135.758 179.750 155.224 1.00 53.10  ?  30  TYR F CD1 1 
ATOM   9115  C  CD2 . TYR F  3 2   ? 136.684 179.900 153.040 1.00 53.10  ?  30  TYR F CD2 1 
ATOM   9116  C  CE1 . TYR F  3 2   ? 135.022 180.892 154.996 1.00 53.10  ?  30  TYR F CE1 1 
ATOM   9117  C  CE2 . TYR F  3 2   ? 135.945 181.039 152.804 1.00 53.10  ?  30  TYR F CE2 1 
ATOM   9118  C  CZ  . TYR F  3 2   ? 135.117 181.527 153.786 1.00 53.10  ?  30  TYR F CZ  1 
ATOM   9119  O  OH  . TYR F  3 2   ? 134.378 182.660 153.563 1.00 53.10  ?  30  TYR F OH  1 
ATOM   9120  N  N   . PHE F  3 3   ? 140.633 178.609 153.921 1.00 51.46  ?  31  PHE F N   1 
ATOM   9121  C  CA  . PHE F  3 3   ? 141.537 179.467 153.175 1.00 51.46  ?  31  PHE F CA  1 
ATOM   9122  C  C   . PHE F  3 3   ? 140.792 180.140 152.037 1.00 51.46  ?  31  PHE F C   1 
ATOM   9123  O  O   . PHE F  3 3   ? 139.847 179.577 151.479 1.00 51.46  ?  31  PHE F O   1 
ATOM   9124  C  CB  . PHE F  3 3   ? 142.710 178.654 152.633 1.00 51.46  ?  31  PHE F CB  1 
ATOM   9125  C  CG  . PHE F  3 3   ? 143.693 178.227 153.678 1.00 51.46  ?  31  PHE F CG  1 
ATOM   9126  C  CD1 . PHE F  3 3   ? 144.739 179.050 154.036 1.00 51.46  ?  31  PHE F CD1 1 
ATOM   9127  C  CD2 . PHE F  3 3   ? 143.558 177.008 154.313 1.00 51.46  ?  31  PHE F CD2 1 
ATOM   9128  C  CE1 . PHE F  3 3   ? 145.641 178.659 154.994 1.00 51.46  ?  31  PHE F CE1 1 
ATOM   9129  C  CE2 . PHE F  3 3   ? 144.457 176.611 155.274 1.00 51.46  ?  31  PHE F CE2 1 
ATOM   9130  C  CZ  . PHE F  3 3   ? 145.496 177.437 155.618 1.00 51.46  ?  31  PHE F CZ  1 
ATOM   9131  N  N   . SER F  3 4   ? 141.214 181.364 151.716 1.00 47.28  ?  32  SER F N   1 
ATOM   9132  C  CA  . SER F  3 4   ? 140.587 182.133 150.649 1.00 47.28  ?  32  SER F CA  1 
ATOM   9133  C  C   . SER F  3 4   ? 140.776 181.475 149.297 1.00 47.28  ?  32  SER F C   1 
ATOM   9134  O  O   . SER F  3 4   ? 139.903 181.578 148.429 1.00 47.28  ?  32  SER F O   1 
ATOM   9135  C  CB  . SER F  3 4   ? 141.175 183.533 150.608 1.00 47.28  ?  32  SER F CB  1 
ATOM   9136  O  OG  . SER F  3 4   ? 142.535 183.477 150.223 1.00 47.28  ?  32  SER F OG  1 
ATOM   9137  N  N   . ARG F  3 5   ? 141.902 180.805 149.101 1.00 46.56  ?  33  ARG F N   1 
ATOM   9138  C  CA  . ARG F  3 5   ? 142.183 180.059 147.893 1.00 46.56  ?  33  ARG F CA  1 
ATOM   9139  C  C   . ARG F  3 5   ? 142.369 178.602 148.279 1.00 46.56  ?  33  ARG F C   1 
ATOM   9140  O  O   . ARG F  3 5   ? 142.294 178.236 149.452 1.00 46.56  ?  33  ARG F O   1 
ATOM   9141  C  CB  . ARG F  3 5   ? 143.422 180.618 147.188 1.00 46.56  ?  33  ARG F CB  1 
ATOM   9142  C  CG  . ARG F  3 5   ? 143.262 182.059 146.747 1.00 46.56  ?  33  ARG F CG  1 
ATOM   9143  C  CD  . ARG F  3 5   ? 144.521 182.602 146.107 1.00 46.56  ?  33  ARG F CD  1 
ATOM   9144  N  NE  . ARG F  3 5   ? 144.823 181.910 144.864 1.00 46.56  ?  33  ARG F NE  1 
ATOM   9145  C  CZ  . ARG F  3 5   ? 145.930 182.098 144.160 1.00 46.56  ?  33  ARG F CZ  1 
ATOM   9146  N  NH1 . ARG F  3 5   ? 146.834 182.975 144.572 1.00 46.56  1  33  ARG F NH1 1 
ATOM   9147  N  NH2 . ARG F  3 5   ? 146.124 181.420 143.037 1.00 46.56  ?  33  ARG F NH2 1 
ATOM   9148  N  N   . ASP F  3 6   ? 142.600 177.758 147.286 1.00 47.62  ?  34  ASP F N   1 
ATOM   9149  C  CA  . ASP F  3 6   ? 142.991 176.382 147.541 1.00 47.62  ?  34  ASP F CA  1 
ATOM   9150  C  C   . ASP F  3 6   ? 144.491 176.176 147.463 1.00 47.62  ?  34  ASP F C   1 
ATOM   9151  O  O   . ASP F  3 6   ? 145.031 175.335 148.182 1.00 47.62  ?  34  ASP F O   1 
ATOM   9152  C  CB  . ASP F  3 6   ? 142.285 175.435 146.565 1.00 47.62  ?  34  ASP F CB  1 
ATOM   9153  C  CG  . ASP F  3 6   ? 142.478 175.834 145.116 1.00 47.62  ?  34  ASP F CG  1 
ATOM   9154  O  OD1 . ASP F  3 6   ? 143.020 176.928 144.860 1.00 47.62  ?  34  ASP F OD1 1 
ATOM   9155  O  OD2 . ASP F  3 6   ? 142.096 175.046 144.227 1.00 47.62  -1 34  ASP F OD2 1 
ATOM   9156  N  N   . ALA F  3 7   ? 145.172 176.941 146.613 1.00 45.77  ?  35  ALA F N   1 
ATOM   9157  C  CA  . ALA F  3 7   ? 146.619 176.893 146.503 1.00 45.77  ?  35  ALA F CA  1 
ATOM   9158  C  C   . ALA F  3 7   ? 147.172 178.209 145.984 1.00 45.77  ?  35  ALA F C   1 
ATOM   9159  O  O   . ALA F  3 7   ? 146.471 178.976 145.323 1.00 45.77  ?  35  ALA F O   1 
ATOM   9160  C  CB  . ALA F  3 7   ? 147.076 175.769 145.594 1.00 45.77  ?  35  ALA F CB  1 
ATOM   9161  N  N   . TYR F  3 8   ? 148.445 178.437 146.266 1.00 45.66  ?  36  TYR F N   1 
ATOM   9162  C  CA  . TYR F  3 8   ? 149.140 179.664 145.929 1.00 45.66  ?  36  TYR F CA  1 
ATOM   9163  C  C   . TYR F  3 8   ? 150.264 179.343 144.954 1.00 45.66  ?  36  TYR F C   1 
ATOM   9164  O  O   . TYR F  3 8   ? 150.435 178.196 144.538 1.00 45.66  ?  36  TYR F O   1 
ATOM   9165  C  CB  . TYR F  3 8   ? 149.678 180.323 147.200 1.00 45.66  ?  36  TYR F CB  1 
ATOM   9166  C  CG  . TYR F  3 8   ? 148.587 180.779 148.140 1.00 45.66  ?  36  TYR F CG  1 
ATOM   9167  C  CD1 . TYR F  3 8   ? 148.033 182.039 148.027 1.00 45.66  ?  36  TYR F CD1 1 
ATOM   9168  C  CD2 . TYR F  3 8   ? 148.086 179.931 149.115 1.00 45.66  ?  36  TYR F CD2 1 
ATOM   9169  C  CE1 . TYR F  3 8   ? 147.033 182.455 148.878 1.00 45.66  ?  36  TYR F CE1 1 
ATOM   9170  C  CE2 . TYR F  3 8   ? 147.083 180.335 149.960 1.00 45.66  ?  36  TYR F CE2 1 
ATOM   9171  C  CZ  . TYR F  3 8   ? 146.563 181.598 149.840 1.00 45.66  ?  36  TYR F CZ  1 
ATOM   9172  O  OH  . TYR F  3 8   ? 145.563 182.007 150.685 1.00 45.66  ?  36  TYR F OH  1 
ATOM   9173  N  N   . TRP F  3 9   ? 151.030 180.363 144.577 1.00 48.10  ?  37  TRP F N   1 
ATOM   9174  C  CA  . TRP F  3 9   ? 152.141 180.201 143.646 1.00 48.10  ?  37  TRP F CA  1 
ATOM   9175  C  C   . TRP F  3 9   ? 153.226 181.216 143.963 1.00 48.10  ?  37  TRP F C   1 
ATOM   9176  O  O   . TRP F  3 9   ? 152.929 182.316 144.439 1.00 48.10  ?  37  TRP F O   1 
ATOM   9177  C  CB  . TRP F  3 9   ? 151.689 180.375 142.198 1.00 48.10  ?  37  TRP F CB  1 
ATOM   9178  C  CG  . TRP F  3 9   ? 150.887 179.249 141.630 1.00 48.10  ?  37  TRP F CG  1 
ATOM   9179  C  CD1 . TRP F  3 9   ? 149.538 179.100 141.693 1.00 48.10  ?  37  TRP F CD1 1 
ATOM   9180  C  CD2 . TRP F  3 9   ? 151.372 178.161 140.832 1.00 48.10  ?  37  TRP F CD2 1 
ATOM   9181  N  NE1 . TRP F  3 9   ? 149.152 177.967 141.025 1.00 48.10  ?  37  TRP F NE1 1 
ATOM   9182  C  CE2 . TRP F  3 9   ? 150.259 177.376 140.479 1.00 48.10  ?  37  TRP F CE2 1 
ATOM   9183  C  CE3 . TRP F  3 9   ? 152.637 177.768 140.393 1.00 48.10  ?  37  TRP F CE3 1 
ATOM   9184  C  CZ2 . TRP F  3 9   ? 150.372 176.223 139.707 1.00 48.10  ?  37  TRP F CZ2 1 
ATOM   9185  C  CZ3 . TRP F  3 9   ? 152.747 176.619 139.633 1.00 48.10  ?  37  TRP F CZ3 1 
ATOM   9186  C  CH2 . TRP F  3 9   ? 151.624 175.859 139.302 1.00 48.10  ?  37  TRP F CH2 1 
ATOM   9187  N  N   . GLU F  3 10  ? 154.473 180.850 143.672 1.00 55.39  ?  38  GLU F N   1 
ATOM   9188  C  CA  . GLU F  3 10  ? 155.635 181.668 143.977 1.00 55.39  ?  38  GLU F CA  1 
ATOM   9189  C  C   . GLU F  3 10  ? 156.809 181.147 143.162 1.00 55.39  ?  38  GLU F C   1 
ATOM   9190  O  O   . GLU F  3 10  ? 156.900 179.950 142.886 1.00 55.39  ?  38  GLU F O   1 
ATOM   9191  C  CB  . GLU F  3 10  ? 155.955 181.630 145.476 1.00 55.39  ?  38  GLU F CB  1 
ATOM   9192  C  CG  . GLU F  3 10  ? 157.047 182.572 145.952 1.00 55.39  ?  38  GLU F CG  1 
ATOM   9193  C  CD  . GLU F  3 10  ? 156.652 184.035 145.853 1.00 55.39  ?  38  GLU F CD  1 
ATOM   9194  O  OE1 . GLU F  3 10  ? 155.442 184.338 145.902 1.00 55.39  ?  38  GLU F OE1 1 
ATOM   9195  O  OE2 . GLU F  3 10  ? 157.556 184.888 145.738 1.00 55.39  -1 38  GLU F OE2 1 
ATOM   9196  N  N   . LYS F  3 11  ? 157.703 182.051 142.769 1.00 60.92  ?  39  LYS F N   1 
ATOM   9197  C  CA  . LYS F  3 11  ? 158.893 181.703 142.001 1.00 60.92  ?  39  LYS F CA  1 
ATOM   9198  C  C   . LYS F  3 11  ? 160.119 181.859 142.895 1.00 60.92  ?  39  LYS F C   1 
ATOM   9199  O  O   . LYS F  3 11  ? 160.443 182.970 143.322 1.00 60.92  ?  39  LYS F O   1 
ATOM   9200  C  CB  . LYS F  3 11  ? 159.005 182.581 140.759 1.00 60.92  ?  39  LYS F CB  1 
ATOM   9201  C  CG  . LYS F  3 11  ? 157.904 182.359 139.745 1.00 60.92  ?  39  LYS F CG  1 
ATOM   9202  C  CD  . LYS F  3 11  ? 158.093 183.250 138.532 1.00 60.92  ?  39  LYS F CD  1 
ATOM   9203  C  CE  . LYS F  3 11  ? 156.974 183.058 137.523 1.00 60.92  ?  39  LYS F CE  1 
ATOM   9204  N  NZ  . LYS F  3 11  ? 157.145 183.933 136.333 1.00 60.92  1  39  LYS F NZ  1 
ATOM   9205  N  N   . LEU F  3 12  ? 160.796 180.748 143.175 1.00 64.42  ?  40  LEU F N   1 
ATOM   9206  C  CA  . LEU F  3 12  ? 162.060 180.771 143.899 1.00 64.42  ?  40  LEU F CA  1 
ATOM   9207  C  C   . LEU F  3 12  ? 163.224 180.825 142.921 1.00 64.42  ?  40  LEU F C   1 
ATOM   9208  O  O   . LEU F  3 12  ? 163.150 180.272 141.820 1.00 64.42  ?  40  LEU F O   1 
ATOM   9209  C  CB  . LEU F  3 12  ? 162.198 179.544 144.797 1.00 64.42  ?  40  LEU F CB  1 
ATOM   9210  C  CG  . LEU F  3 12  ? 161.284 179.524 146.011 1.00 64.42  ?  40  LEU F CG  1 
ATOM   9211  C  CD1 . LEU F  3 12  ? 161.403 178.211 146.756 1.00 64.42  ?  40  LEU F CD1 1 
ATOM   9212  C  CD2 . LEU F  3 12  ? 161.663 180.665 146.906 1.00 64.42  ?  40  LEU F CD2 1 
ATOM   9213  N  N   . TYR F  3 13  ? 164.304 181.484 143.331 1.00 72.18  ?  41  TYR F N   1 
ATOM   9214  C  CA  . TYR F  3 13  ? 165.482 181.635 142.491 1.00 72.18  ?  41  TYR F CA  1 
ATOM   9215  C  C   . TYR F  3 13  ? 166.742 181.249 143.253 1.00 72.18  ?  41  TYR F C   1 
ATOM   9216  O  O   . TYR F  3 13  ? 166.734 181.127 144.481 1.00 72.18  ?  41  TYR F O   1 
ATOM   9217  C  CB  . TYR F  3 13  ? 165.625 183.066 141.977 1.00 72.18  ?  41  TYR F CB  1 
ATOM   9218  C  CG  . TYR F  3 13  ? 164.571 183.478 140.982 1.00 72.18  ?  41  TYR F CG  1 
ATOM   9219  C  CD1 . TYR F  3 13  ? 164.597 182.998 139.681 1.00 72.18  ?  41  TYR F CD1 1 
ATOM   9220  C  CD2 . TYR F  3 13  ? 163.577 184.379 141.328 1.00 72.18  ?  41  TYR F CD2 1 
ATOM   9221  C  CE1 . TYR F  3 13  ? 163.645 183.381 138.759 1.00 72.18  ?  41  TYR F CE1 1 
ATOM   9222  C  CE2 . TYR F  3 13  ? 162.623 184.773 140.413 1.00 72.18  ?  41  TYR F CE2 1 
ATOM   9223  C  CZ  . TYR F  3 13  ? 162.662 184.270 139.129 1.00 72.18  ?  41  TYR F CZ  1 
ATOM   9224  O  OH  . TYR F  3 13  ? 161.713 184.659 138.215 1.00 72.18  ?  41  TYR F OH  1 
ATOM   9225  N  N   . VAL F  3 14  ? 167.825 181.052 142.498 1.00 77.48  ?  42  VAL F N   1 
ATOM   9226  C  CA  . VAL F  3 14  ? 169.140 180.748 143.052 1.00 77.48  ?  42  VAL F CA  1 
ATOM   9227  C  C   . VAL F  3 14  ? 169.666 181.955 143.812 1.00 77.48  ?  42  VAL F C   1 
ATOM   9228  O  O   . VAL F  3 14  ? 169.641 183.079 143.297 1.00 77.48  ?  42  VAL F O   1 
ATOM   9229  C  CB  . VAL F  3 14  ? 170.127 180.330 141.945 1.00 77.48  ?  42  VAL F CB  1 
ATOM   9230  C  CG1 . VAL F  3 14  ? 171.534 180.173 142.492 1.00 77.48  ?  42  VAL F CG1 1 
ATOM   9231  C  CG2 . VAL F  3 14  ? 169.687 179.040 141.322 1.00 77.48  ?  42  VAL F CG2 1 
ATOM   9232  N  N   . ASP F  3 15  ? 170.103 181.719 145.057 1.00 81.18  ?  43  ASP F N   1 
ATOM   9233  C  CA  . ASP F  3 15  ? 170.866 182.668 145.876 1.00 81.18  ?  43  ASP F CA  1 
ATOM   9234  C  C   . ASP F  3 15  ? 170.048 183.913 146.217 1.00 81.18  ?  43  ASP F C   1 
ATOM   9235  O  O   . ASP F  3 15  ? 170.541 185.039 146.155 1.00 81.18  ?  43  ASP F O   1 
ATOM   9236  C  CB  . ASP F  3 15  ? 172.195 183.049 145.212 1.00 81.18  ?  43  ASP F CB  1 
ATOM   9237  C  CG  . ASP F  3 15  ? 173.188 181.905 145.194 1.00 81.18  ?  43  ASP F CG  1 
ATOM   9238  O  OD1 . ASP F  3 15  ? 173.141 181.057 146.109 1.00 81.18  ?  43  ASP F OD1 1 
ATOM   9239  O  OD2 . ASP F  3 15  ? 174.018 181.854 144.262 1.00 81.18  -1 43  ASP F OD2 1 
ATOM   9240  N  N   . GLN F  3 16  ? 168.787 183.704 146.575 1.00 74.99  ?  44  GLN F N   1 
ATOM   9241  C  CA  . GLN F  3 16  ? 168.053 184.799 147.177 1.00 74.99  ?  44  GLN F CA  1 
ATOM   9242  C  C   . GLN F  3 16  ? 168.530 185.004 148.610 1.00 74.99  ?  44  GLN F C   1 
ATOM   9243  O  O   . GLN F  3 16  ? 168.989 184.077 149.281 1.00 74.99  ?  44  GLN F O   1 
ATOM   9244  C  CB  . GLN F  3 16  ? 166.549 184.540 147.141 1.00 74.99  ?  44  GLN F CB  1 
ATOM   9245  C  CG  . GLN F  3 16  ? 165.950 184.511 145.751 1.00 74.99  ?  44  GLN F CG  1 
ATOM   9246  C  CD  . GLN F  3 16  ? 164.445 184.383 145.788 1.00 74.99  ?  44  GLN F CD  1 
ATOM   9247  O  OE1 . GLN F  3 16  ? 163.844 184.318 146.857 1.00 74.99  ?  44  GLN F OE1 1 
ATOM   9248  N  NE2 . GLN F  3 16  ? 163.828 184.337 144.617 1.00 74.99  ?  44  GLN F NE2 1 
ATOM   9249  N  N   . ALA F  3 17  ? 168.423 186.239 149.078 1.00 80.57  ?  45  ALA F N   1 
ATOM   9250  C  CA  . ALA F  3 17  ? 168.951 186.622 150.376 1.00 80.57  ?  45  ALA F CA  1 
ATOM   9251  C  C   . ALA F  3 17  ? 168.066 186.089 151.496 1.00 80.57  ?  45  ALA F C   1 
ATOM   9252  O  O   . ALA F  3 17  ? 166.898 185.750 151.299 1.00 80.57  ?  45  ALA F O   1 
ATOM   9253  C  CB  . ALA F  3 17  ? 169.080 188.144 150.476 1.00 80.57  ?  45  ALA F CB  1 
ATOM   9254  N  N   . ALA F  3 18  ? 168.651 186.007 152.685 1.00 80.97  ?  46  ALA F N   1 
ATOM   9255  C  CA  . ALA F  3 18  ? 167.897 185.625 153.867 1.00 80.97  ?  46  ALA F CA  1 
ATOM   9256  C  C   . ALA F  3 18  ? 166.969 186.759 154.285 1.00 80.97  ?  46  ALA F C   1 
ATOM   9257  O  O   . ALA F  3 18  ? 167.272 187.941 154.100 1.00 80.97  ?  46  ALA F O   1 
ATOM   9258  C  CB  . ALA F  3 18  ? 168.840 185.268 155.012 1.00 80.97  ?  46  ALA F CB  1 
ATOM   9259  N  N   . GLY F  3 19  ? 165.827 186.389 154.855 1.00 73.82  ?  47  GLY F N   1 
ATOM   9260  C  CA  . GLY F  3 19  ? 164.846 187.391 155.219 1.00 73.82  ?  47  GLY F CA  1 
ATOM   9261  C  C   . GLY F  3 19  ? 164.118 188.009 154.049 1.00 73.82  ?  47  GLY F C   1 
ATOM   9262  O  O   . GLY F  3 19  ? 163.610 189.126 154.169 1.00 73.82  ?  47  GLY F O   1 
ATOM   9263  N  N   . THR F  3 20  ? 164.067 187.316 152.911 1.00 74.31  ?  48  THR F N   1 
ATOM   9264  C  CA  . THR F  3 20  ? 163.333 187.786 151.748 1.00 74.31  ?  48  THR F CA  1 
ATOM   9265  C  C   . THR F  3 20  ? 161.900 187.299 151.830 1.00 74.31  ?  48  THR F C   1 
ATOM   9266  O  O   . THR F  3 20  ? 161.682 186.079 151.845 1.00 74.31  ?  48  THR F O   1 
ATOM   9267  C  CB  . THR F  3 20  ? 163.978 187.279 150.466 1.00 74.31  ?  48  THR F CB  1 
ATOM   9268  O  OG1 . THR F  3 20  ? 165.303 187.806 150.351 1.00 74.31  ?  48  THR F OG1 1 
ATOM   9269  C  CG2 . THR F  3 20  ? 163.156 187.694 149.260 1.00 74.31  ?  48  THR F CG2 1 
ATOM   9270  N  N   . PRO F  3 21  ? 160.910 188.185 151.897 1.00 68.48  ?  49  PRO F N   1 
ATOM   9271  C  CA  . PRO F  3 21  ? 159.516 187.731 151.888 1.00 68.48  ?  49  PRO F CA  1 
ATOM   9272  C  C   . PRO F  3 21  ? 159.127 187.154 150.539 1.00 68.48  ?  49  PRO F C   1 
ATOM   9273  O  O   . PRO F  3 21  ? 159.550 187.634 149.485 1.00 68.48  ?  49  PRO F O   1 
ATOM   9274  C  CB  . PRO F  3 21  ? 158.726 189.008 152.192 1.00 68.48  ?  49  PRO F CB  1 
ATOM   9275  C  CG  . PRO F  3 21  ? 159.706 189.908 152.870 1.00 68.48  ?  49  PRO F CG  1 
ATOM   9276  C  CD  . PRO F  3 21  ? 161.014 189.619 152.209 1.00 68.48  ?  49  PRO F CD  1 
ATOM   9277  N  N   . LEU F  3 22  ? 158.313 186.102 150.582 1.00 63.80  ?  50  LEU F N   1 
ATOM   9278  C  CA  . LEU F  3 22  ? 157.850 185.437 149.372 1.00 63.80  ?  50  LEU F CA  1 
ATOM   9279  C  C   . LEU F  3 22  ? 156.380 185.725 149.099 1.00 63.80  ?  50  LEU F C   1 
ATOM   9280  O  O   . LEU F  3 22  ? 156.056 186.253 148.032 1.00 63.80  ?  50  LEU F O   1 
ATOM   9281  C  CB  . LEU F  3 22  ? 158.091 183.926 149.457 1.00 63.80  ?  50  LEU F CB  1 
ATOM   9282  C  CG  . LEU F  3 22  ? 159.545 183.476 149.513 1.00 63.80  ?  50  LEU F CG  1 
ATOM   9283  C  CD1 . LEU F  3 22  ? 159.623 181.987 149.763 1.00 63.80  ?  50  LEU F CD1 1 
ATOM   9284  C  CD2 . LEU F  3 22  ? 160.229 183.844 148.217 1.00 63.80  ?  50  LEU F CD2 1 
ATOM   9285  N  N   . LEU F  3 23  ? 155.481 185.426 150.041 1.00 59.58  ?  51  LEU F N   1 
ATOM   9286  C  CA  . LEU F  3 23  ? 154.072 185.739 149.814 1.00 59.58  ?  51  LEU F CA  1 
ATOM   9287  C  C   . LEU F  3 23  ? 153.304 185.847 151.121 1.00 59.58  ?  51  LEU F C   1 
ATOM   9288  O  O   . LEU F  3 23  ? 153.757 185.410 152.179 1.00 59.58  ?  51  LEU F O   1 
ATOM   9289  C  CB  . LEU F  3 23  ? 153.384 184.718 148.887 1.00 59.58  ?  51  LEU F CB  1 
ATOM   9290  C  CG  . LEU F  3 23  ? 153.400 183.203 149.087 1.00 59.58  ?  51  LEU F CG  1 
ATOM   9291  C  CD1 . LEU F  3 23  ? 152.338 182.712 150.034 1.00 59.58  ?  51  LEU F CD1 1 
ATOM   9292  C  CD2 . LEU F  3 23  ? 153.185 182.571 147.741 1.00 59.58  ?  51  LEU F CD2 1 
ATOM   9293  N  N   . TYR F  3 24  ? 152.135 186.466 151.024 1.00 59.88  ?  52  TYR F N   1 
ATOM   9294  C  CA  . TYR F  3 24  ? 151.150 186.475 152.092 1.00 59.88  ?  52  TYR F CA  1 
ATOM   9295  C  C   . TYR F  3 24  ? 150.142 185.352 151.891 1.00 59.88  ?  52  TYR F C   1 
ATOM   9296  O  O   . TYR F  3 24  ? 149.890 184.904 150.772 1.00 59.88  ?  52  TYR F O   1 
ATOM   9297  C  CB  . TYR F  3 24  ? 150.398 187.803 152.148 1.00 59.88  ?  52  TYR F CB  1 
ATOM   9298  C  CG  . TYR F  3 24  ? 151.175 188.973 152.682 1.00 59.88  ?  52  TYR F CG  1 
ATOM   9299  C  CD1 . TYR F  3 24  ? 152.371 188.799 153.356 1.00 59.88  ?  52  TYR F CD1 1 
ATOM   9300  C  CD2 . TYR F  3 24  ? 150.693 190.259 152.527 1.00 59.88  ?  52  TYR F CD2 1 
ATOM   9301  C  CE1 . TYR F  3 24  ? 153.070 189.883 153.851 1.00 59.88  ?  52  TYR F CE1 1 
ATOM   9302  C  CE2 . TYR F  3 24  ? 151.380 191.343 153.015 1.00 59.88  ?  52  TYR F CE2 1 
ATOM   9303  C  CZ  . TYR F  3 24  ? 152.568 191.152 153.676 1.00 59.88  ?  52  TYR F CZ  1 
ATOM   9304  O  OH  . TYR F  3 24  ? 153.252 192.243 154.161 1.00 59.88  ?  52  TYR F OH  1 
ATOM   9305  N  N   . VAL F  3 25  ? 149.560 184.905 153.000 1.00 57.62  ?  53  VAL F N   1 
ATOM   9306  C  CA  . VAL F  3 25  ? 148.373 184.062 152.978 1.00 57.62  ?  53  VAL F CA  1 
ATOM   9307  C  C   . VAL F  3 25  ? 147.350 184.647 153.941 1.00 57.62  ?  53  VAL F C   1 
ATOM   9308  O  O   . VAL F  3 25  ? 147.696 185.233 154.972 1.00 57.62  ?  53  VAL F O   1 
ATOM   9309  C  CB  . VAL F  3 25  ? 148.680 182.589 153.324 1.00 57.62  ?  53  VAL F CB  1 
ATOM   9310  C  CG1 . VAL F  3 25  ? 149.420 181.926 152.194 1.00 57.62  ?  53  VAL F CG1 1 
ATOM   9311  C  CG2 . VAL F  3 25  ? 149.518 182.511 154.563 1.00 57.62  ?  53  VAL F CG2 1 
ATOM   9312  N  N   . HIS F  3 26  ? 146.076 184.502 153.585 1.00 56.00  ?  54  HIS F N   1 
ATOM   9313  C  CA  . HIS F  3 26  ? 144.988 185.029 154.392 1.00 56.00  ?  54  HIS F CA  1 
ATOM   9314  C  C   . HIS F  3 26  ? 143.889 183.987 154.495 1.00 56.00  ?  54  HIS F C   1 
ATOM   9315  O  O   . HIS F  3 26  ? 143.554 183.325 153.511 1.00 56.00  ?  54  HIS F O   1 
ATOM   9316  C  CB  . HIS F  3 26  ? 144.422 186.319 153.801 1.00 56.00  ?  54  HIS F CB  1 
ATOM   9317  C  CG  . HIS F  3 26  ? 145.404 187.444 153.752 1.00 56.00  ?  54  HIS F CG  1 
ATOM   9318  N  ND1 . HIS F  3 26  ? 146.182 187.705 152.647 1.00 56.00  ?  54  HIS F ND1 1 
ATOM   9319  C  CD2 . HIS F  3 26  ? 145.748 188.367 154.680 1.00 56.00  ?  54  HIS F CD2 1 
ATOM   9320  C  CE1 . HIS F  3 26  ? 146.953 188.749 152.890 1.00 56.00  ?  54  HIS F CE1 1 
ATOM   9321  N  NE2 . HIS F  3 26  ? 146.710 189.169 154.118 1.00 56.00  ?  54  HIS F NE2 1 
ATOM   9322  N  N   . ALA F  3 27  ? 143.323 183.858 155.690 1.00 54.82  ?  55  ALA F N   1 
ATOM   9323  C  CA  . ALA F  3 27  ? 142.294 182.865 155.974 1.00 54.82  ?  55  ALA F CA  1 
ATOM   9324  C  C   . ALA F  3 27  ? 141.019 183.594 156.368 1.00 54.82  ?  55  ALA F C   1 
ATOM   9325  O  O   . ALA F  3 27  ? 141.016 184.369 157.328 1.00 54.82  ?  55  ALA F O   1 
ATOM   9326  C  CB  . ALA F  3 27  ? 142.741 181.913 157.080 1.00 54.82  ?  55  ALA F CB  1 
ATOM   9327  N  N   . LEU F  3 28  ? 139.942 183.348 155.629 1.00 52.15  ?  56  LEU F N   1 
ATOM   9328  C  CA  . LEU F  3 28  ? 138.665 183.946 155.974 1.00 52.15  ?  56  LEU F CA  1 
ATOM   9329  C  C   . LEU F  3 28  ? 138.035 183.204 157.145 1.00 52.15  ?  56  LEU F C   1 
ATOM   9330  O  O   . LEU F  3 28  ? 138.531 182.175 157.608 1.00 52.15  ?  56  LEU F O   1 
ATOM   9331  C  CB  . LEU F  3 28  ? 137.722 183.943 154.777 1.00 52.15  ?  56  LEU F CB  1 
ATOM   9332  C  CG  . LEU F  3 28  ? 138.175 184.811 153.606 1.00 52.15  ?  56  LEU F CG  1 
ATOM   9333  C  CD1 . LEU F  3 28  ? 137.209 184.681 152.462 1.00 52.15  ?  56  LEU F CD1 1 
ATOM   9334  C  CD2 . LEU F  3 28  ? 138.303 186.252 154.023 1.00 52.15  ?  56  LEU F CD2 1 
ATOM   9335  N  N   . ARG F  3 29  ? 136.917 183.735 157.618 1.00 61.39  ?  57  ARG F N   1 
ATOM   9336  C  CA  . ARG F  3 29  ? 136.355 183.322 158.890 1.00 61.39  ?  57  ARG F CA  1 
ATOM   9337  C  C   . ARG F  3 29  ? 134.982 182.691 158.709 1.00 61.39  ?  57  ARG F C   1 
ATOM   9338  O  O   . ARG F  3 29  ? 134.212 183.073 157.823 1.00 61.39  ?  57  ARG F O   1 
ATOM   9339  C  CB  . ARG F  3 29  ? 136.265 184.517 159.839 1.00 61.39  ?  57  ARG F CB  1 
ATOM   9340  C  CG  . ARG F  3 29  ? 137.626 185.052 160.234 1.00 61.39  ?  57  ARG F CG  1 
ATOM   9341  C  CD  . ARG F  3 29  ? 137.519 186.230 161.167 1.00 61.39  ?  57  ARG F CD  1 
ATOM   9342  N  NE  . ARG F  3 29  ? 136.950 187.389 160.491 1.00 61.39  ?  57  ARG F NE  1 
ATOM   9343  C  CZ  . ARG F  3 29  ? 135.780 187.929 160.807 1.00 61.39  ?  57  ARG F CZ  1 
ATOM   9344  N  NH1 . ARG F  3 29  ? 135.063 187.418 161.795 1.00 61.39  1  57  ARG F NH1 1 
ATOM   9345  N  NH2 . ARG F  3 29  ? 135.331 188.981 160.142 1.00 61.39  ?  57  ARG F NH2 1 
ATOM   9346  N  N   . ASP F  3 30  ? 134.691 181.702 159.558 1.00 63.54  ?  58  ASP F N   1 
ATOM   9347  C  CA  . ASP F  3 30  ? 133.357 181.131 159.666 1.00 63.54  ?  58  ASP F CA  1 
ATOM   9348  C  C   . ASP F  3 30  ? 132.609 181.613 160.896 1.00 63.54  ?  58  ASP F C   1 
ATOM   9349  O  O   . ASP F  3 30  ? 131.410 181.339 161.022 1.00 63.54  ?  58  ASP F O   1 
ATOM   9350  C  CB  . ASP F  3 30  ? 133.422 179.598 159.694 1.00 63.54  ?  58  ASP F CB  1 
ATOM   9351  C  CG  . ASP F  3 30  ? 133.690 179.000 158.329 1.00 63.54  ?  58  ASP F CG  1 
ATOM   9352  O  OD1 . ASP F  3 30  ? 133.273 179.609 157.326 1.00 63.54  ?  58  ASP F OD1 1 
ATOM   9353  O  OD2 . ASP F  3 30  ? 134.311 177.920 158.258 1.00 63.54  -1 58  ASP F OD2 1 
ATOM   9354  N  N   . ALA F  3 31  ? 133.280 182.318 161.790 1.00 68.97  ?  59  ALA F N   1 
ATOM   9355  C  CA  . ALA F  3 31  ? 132.685 182.818 163.018 1.00 68.97  ?  59  ALA F CA  1 
ATOM   9356  C  C   . ALA F  3 31  ? 133.222 184.221 163.272 1.00 68.97  ?  59  ALA F C   1 
ATOM   9357  O  O   . ALA F  3 31  ? 134.272 184.581 162.727 1.00 68.97  ?  59  ALA F O   1 
ATOM   9358  C  CB  . ALA F  3 31  ? 133.006 181.875 164.180 1.00 68.97  ?  59  ALA F CB  1 
ATOM   9359  N  N   . PRO F  3 32  ? 132.534 185.052 164.060 1.00 71.80  ?  60  PRO F N   1 
ATOM   9360  C  CA  . PRO F  3 32  ? 133.085 186.377 164.376 1.00 71.80  ?  60  PRO F CA  1 
ATOM   9361  C  C   . PRO F  3 32  ? 134.318 186.339 165.268 1.00 71.80  ?  60  PRO F C   1 
ATOM   9362  O  O   . PRO F  3 32  ? 135.129 187.269 165.235 1.00 71.80  ?  60  PRO F O   1 
ATOM   9363  C  CB  . PRO F  3 32  ? 131.917 187.082 165.079 1.00 71.80  ?  60  PRO F CB  1 
ATOM   9364  C  CG  . PRO F  3 32  ? 130.707 186.396 164.574 1.00 71.80  ?  60  PRO F CG  1 
ATOM   9365  C  CD  . PRO F  3 32  ? 131.105 184.963 164.413 1.00 71.80  ?  60  PRO F CD  1 
ATOM   9366  N  N   . GLU F  3 33  ? 134.479 185.281 166.062 1.00 76.27  ?  61  GLU F N   1 
ATOM   9367  C  CA  . GLU F  3 33  ? 135.512 185.260 167.091 1.00 76.27  ?  61  GLU F CA  1 
ATOM   9368  C  C   . GLU F  3 33  ? 136.788 184.536 166.679 1.00 76.27  ?  61  GLU F C   1 
ATOM   9369  O  O   . GLU F  3 33  ? 137.822 184.729 167.328 1.00 76.27  ?  61  GLU F O   1 
ATOM   9370  C  CB  . GLU F  3 33  ? 134.973 184.603 168.365 1.00 76.27  ?  61  GLU F CB  1 
ATOM   9371  C  CG  . GLU F  3 33  ? 134.668 183.120 168.218 1.00 76.27  ?  61  GLU F CG  1 
ATOM   9372  C  CD  . GLU F  3 33  ? 134.116 182.505 169.488 1.00 76.27  ?  61  GLU F CD  1 
ATOM   9373  O  OE1 . GLU F  3 33  ? 133.935 183.244 170.479 1.00 76.27  ?  61  GLU F OE1 1 
ATOM   9374  O  OE2 . GLU F  3 33  ? 133.867 181.281 169.499 1.00 76.27  -1 61  GLU F OE2 1 
ATOM   9375  N  N   . GLU F  3 34  ? 136.751 183.720 165.630 1.00 75.67  ?  62  GLU F N   1 
ATOM   9376  C  CA  . GLU F  3 34  ? 137.833 182.774 165.369 1.00 75.67  ?  62  GLU F CA  1 
ATOM   9377  C  C   . GLU F  3 34  ? 138.992 183.465 164.660 1.00 75.67  ?  62  GLU F C   1 
ATOM   9378  O  O   . GLU F  3 34  ? 138.850 183.940 163.529 1.00 75.67  ?  62  GLU F O   1 
ATOM   9379  C  CB  . GLU F  3 34  ? 137.303 181.596 164.559 1.00 75.67  ?  62  GLU F CB  1 
ATOM   9380  C  CG  . GLU F  3 34  ? 136.369 180.705 165.365 1.00 75.67  ?  62  GLU F CG  1 
ATOM   9381  C  CD  . GLU F  3 34  ? 135.790 179.563 164.562 1.00 75.67  ?  62  GLU F CD  1 
ATOM   9382  O  OE1 . GLU F  3 34  ? 135.986 179.540 163.333 1.00 75.67  ?  62  GLU F OE1 1 
ATOM   9383  O  OE2 . GLU F  3 34  ? 135.138 178.686 165.165 1.00 75.67  -1 62  GLU F OE2 1 
ATOM   9384  N  N   . VAL F  3 35  ? 140.137 183.512 165.326 1.00 71.33  ?  63  VAL F N   1 
ATOM   9385  C  CA  . VAL F  3 35  ? 141.355 184.118 164.794 1.00 71.33  ?  63  VAL F CA  1 
ATOM   9386  C  C   . VAL F  3 35  ? 142.242 182.999 164.257 1.00 71.33  ?  63  VAL F C   1 
ATOM   9387  O  O   . VAL F  3 35  ? 142.457 182.008 164.969 1.00 71.33  ?  63  VAL F O   1 
ATOM   9388  C  CB  . VAL F  3 35  ? 142.088 184.932 165.879 1.00 71.33  ?  63  VAL F CB  1 
ATOM   9389  C  CG1 . VAL F  3 35  ? 143.407 185.493 165.365 1.00 71.33  ?  63  VAL F CG1 1 
ATOM   9390  C  CG2 . VAL F  3 35  ? 141.195 186.051 166.390 1.00 71.33  ?  63  VAL F CG2 1 
ATOM   9391  N  N   . PRO F  3 36  ? 142.759 183.104 163.023 1.00 67.19  ?  64  PRO F N   1 
ATOM   9392  C  CA  . PRO F  3 36  ? 143.526 181.989 162.447 1.00 67.19  ?  64  PRO F CA  1 
ATOM   9393  C  C   . PRO F  3 36  ? 144.901 181.767 163.055 1.00 67.19  ?  64  PRO F C   1 
ATOM   9394  O  O   . PRO F  3 36  ? 145.384 182.551 163.876 1.00 67.19  ?  64  PRO F O   1 
ATOM   9395  C  CB  . PRO F  3 36  ? 143.651 182.382 160.969 1.00 67.19  ?  64  PRO F CB  1 
ATOM   9396  C  CG  . PRO F  3 36  ? 143.524 183.853 160.957 1.00 67.19  ?  64  PRO F CG  1 
ATOM   9397  C  CD  . PRO F  3 36  ? 142.551 184.186 162.046 1.00 67.19  ?  64  PRO F CD  1 
ATOM   9398  N  N   . SER F  3 37  ? 145.528 180.673 162.633 1.00 62.14  ?  65  SER F N   1 
ATOM   9399  C  CA  . SER F  3 37  ? 146.896 180.337 162.990 1.00 62.14  ?  65  SER F CA  1 
ATOM   9400  C  C   . SER F  3 37  ? 147.538 179.709 161.763 1.00 62.14  ?  65  SER F C   1 
ATOM   9401  O  O   . SER F  3 37  ? 146.862 179.407 160.780 1.00 62.14  ?  65  SER F O   1 
ATOM   9402  C  CB  . SER F  3 37  ? 146.949 179.396 164.194 1.00 62.14  ?  65  SER F CB  1 
ATOM   9403  O  OG  . SER F  3 37  ? 148.282 179.033 164.495 1.00 62.14  ?  65  SER F OG  1 
ATOM   9404  N  N   . PHE F  3 38  ? 148.854 179.524 161.811 1.00 61.89  ?  66  PHE F N   1 
ATOM   9405  C  CA  . PHE F  3 38  ? 149.566 179.001 160.653 1.00 61.89  ?  66  PHE F CA  1 
ATOM   9406  C  C   . PHE F  3 38  ? 150.709 178.100 161.086 1.00 61.89  ?  66  PHE F C   1 
ATOM   9407  O  O   . PHE F  3 38  ? 151.420 178.405 162.047 1.00 61.89  ?  66  PHE F O   1 
ATOM   9408  C  CB  . PHE F  3 38  ? 150.108 180.132 159.768 1.00 61.89  ?  66  PHE F CB  1 
ATOM   9409  C  CG  . PHE F  3 38  ? 149.043 180.879 159.015 1.00 61.89  ?  66  PHE F CG  1 
ATOM   9410  C  CD1 . PHE F  3 38  ? 148.490 180.346 157.862 1.00 61.89  ?  66  PHE F CD1 1 
ATOM   9411  C  CD2 . PHE F  3 38  ? 148.602 182.114 159.455 1.00 61.89  ?  66  PHE F CD2 1 
ATOM   9412  C  CE1 . PHE F  3 38  ? 147.508 181.027 157.168 1.00 61.89  ?  66  PHE F CE1 1 
ATOM   9413  C  CE2 . PHE F  3 38  ? 147.622 182.800 158.762 1.00 61.89  ?  66  PHE F CE2 1 
ATOM   9414  C  CZ  . PHE F  3 38  ? 147.078 182.255 157.617 1.00 61.89  ?  66  PHE F CZ  1 
ATOM   9415  N  N   . ARG F  3 39  ? 150.871 176.989 160.373 1.00 61.91  ?  67  ARG F N   1 
ATOM   9416  C  CA  . ARG F  3 39  ? 152.043 176.136 160.486 1.00 61.91  ?  67  ARG F CA  1 
ATOM   9417  C  C   . ARG F  3 39  ? 152.287 175.486 159.135 1.00 61.91  ?  67  ARG F C   1 
ATOM   9418  O  O   . ARG F  3 39  ? 151.348 175.258 158.368 1.00 61.91  ?  67  ARG F O   1 
ATOM   9419  C  CB  . ARG F  3 39  ? 151.878 175.074 161.582 1.00 61.91  ?  67  ARG F CB  1 
ATOM   9420  C  CG  . ARG F  3 39  ? 150.796 174.039 161.332 1.00 61.91  ?  67  ARG F CG  1 
ATOM   9421  C  CD  . ARG F  3 39  ? 150.699 173.065 162.494 1.00 61.91  ?  67  ARG F CD  1 
ATOM   9422  N  NE  . ARG F  3 39  ? 151.902 172.249 162.624 1.00 61.91  ?  67  ARG F NE  1 
ATOM   9423  C  CZ  . ARG F  3 39  ? 152.104 171.101 161.987 1.00 61.91  ?  67  ARG F CZ  1 
ATOM   9424  N  NH1 . ARG F  3 39  ? 153.232 170.430 162.167 1.00 61.91  1  67  ARG F NH1 1 
ATOM   9425  N  NH2 . ARG F  3 39  ? 151.176 170.616 161.179 1.00 61.91  ?  67  ARG F NH2 1 
ATOM   9426  N  N   . LEU F  3 40  ? 153.549 175.216 158.834 1.00 62.72  ?  68  LEU F N   1 
ATOM   9427  C  CA  . LEU F  3 40  ? 153.919 174.658 157.546 1.00 62.72  ?  68  LEU F CA  1 
ATOM   9428  C  C   . LEU F  3 40  ? 153.852 173.138 157.568 1.00 62.72  ?  68  LEU F C   1 
ATOM   9429  O  O   . LEU F  3 40  ? 153.589 172.510 158.594 1.00 62.72  ?  68  LEU F O   1 
ATOM   9430  C  CB  . LEU F  3 40  ? 155.323 175.102 157.150 1.00 62.72  ?  68  LEU F CB  1 
ATOM   9431  C  CG  . LEU F  3 40  ? 155.497 176.562 156.755 1.00 62.72  ?  68  LEU F CG  1 
ATOM   9432  C  CD1 . LEU F  3 40  ? 156.966 176.896 156.632 1.00 62.72  ?  68  LEU F CD1 1 
ATOM   9433  C  CD2 . LEU F  3 40  ? 154.791 176.833 155.449 1.00 62.72  ?  68  LEU F CD2 1 
ATOM   9434  N  N   . GLY F  3 41  ? 154.105 172.550 156.405 1.00 66.25  ?  69  GLY F N   1 
ATOM   9435  C  CA  . GLY F  3 41  ? 154.256 171.119 156.320 1.00 66.25  ?  69  GLY F CA  1 
ATOM   9436  C  C   . GLY F  3 41  ? 155.598 170.653 156.844 1.00 66.25  ?  69  GLY F C   1 
ATOM   9437  O  O   . GLY F  3 41  ? 156.435 171.432 157.294 1.00 66.25  ?  69  GLY F O   1 
ATOM   9438  N  N   . GLN F  3 42  ? 155.803 169.342 156.791 1.00 72.44  ?  70  GLN F N   1 
ATOM   9439  C  CA  . GLN F  3 42  ? 157.054 168.791 157.292 1.00 72.44  ?  70  GLN F CA  1 
ATOM   9440  C  C   . GLN F  3 42  ? 158.082 168.637 156.180 1.00 72.44  ?  70  GLN F C   1 
ATOM   9441  O  O   . GLN F  3 42  ? 159.285 168.766 156.428 1.00 72.44  ?  70  GLN F O   1 
ATOM   9442  C  CB  . GLN F  3 42  ? 156.787 167.453 157.980 1.00 72.44  ?  70  GLN F CB  1 
ATOM   9443  C  CG  . GLN F  3 42  ? 157.973 166.873 158.727 1.00 72.44  ?  70  GLN F CG  1 
ATOM   9444  C  CD  . GLN F  3 42  ? 157.632 165.577 159.428 1.00 72.44  ?  70  GLN F CD  1 
ATOM   9445  O  OE1 . GLN F  3 42  ? 156.512 165.078 159.325 1.00 72.44  ?  70  GLN F OE1 1 
ATOM   9446  N  NE2 . GLN F  3 42  ? 158.599 165.022 160.149 1.00 72.44  ?  70  GLN F NE2 1 
ATOM   9447  N  N   . HIS F  3 43  ? 157.637 168.395 154.950 1.00 70.06  ?  71  HIS F N   1 
ATOM   9448  C  CA  . HIS F  3 43  ? 158.532 168.001 153.876 1.00 70.06  ?  71  HIS F CA  1 
ATOM   9449  C  C   . HIS F  3 43  ? 158.244 168.809 152.620 1.00 70.06  ?  71  HIS F C   1 
ATOM   9450  O  O   . HIS F  3 43  ? 157.127 169.280 152.402 1.00 70.06  ?  71  HIS F O   1 
ATOM   9451  C  CB  . HIS F  3 43  ? 158.388 166.511 153.582 1.00 70.06  ?  71  HIS F CB  1 
ATOM   9452  C  CG  . HIS F  3 43  ? 158.642 165.639 154.770 1.00 70.06  ?  71  HIS F CG  1 
ATOM   9453  N  ND1 . HIS F  3 43  ? 159.908 165.387 155.251 1.00 70.06  ?  71  HIS F ND1 1 
ATOM   9454  C  CD2 . HIS F  3 43  ? 157.790 164.974 155.585 1.00 70.06  ?  71  HIS F CD2 1 
ATOM   9455  C  CE1 . HIS F  3 43  ? 159.826 164.594 156.305 1.00 70.06  ?  71  HIS F CE1 1 
ATOM   9456  N  NE2 . HIS F  3 43  ? 158.551 164.327 156.526 1.00 70.06  ?  71  HIS F NE2 1 
ATOM   9457  N  N   . LEU F  3 44  ? 159.273 168.949 151.782 1.00 64.96  ?  72  LEU F N   1 
ATOM   9458  C  CA  . LEU F  3 44  ? 159.181 169.653 150.505 1.00 64.96  ?  72  LEU F CA  1 
ATOM   9459  C  C   . LEU F  3 44  ? 158.791 168.624 149.452 1.00 64.96  ?  72  LEU F C   1 
ATOM   9460  O  O   . LEU F  3 44  ? 159.644 167.901 148.936 1.00 64.96  ?  72  LEU F O   1 
ATOM   9461  C  CB  . LEU F  3 44  ? 160.510 170.313 150.154 1.00 64.96  ?  72  LEU F CB  1 
ATOM   9462  C  CG  . LEU F  3 44  ? 161.069 171.427 151.039 1.00 64.96  ?  72  LEU F CG  1 
ATOM   9463  C  CD1 . LEU F  3 44  ? 162.497 171.736 150.643 1.00 64.96  ?  72  LEU F CD1 1 
ATOM   9464  C  CD2 . LEU F  3 44  ? 160.240 172.667 150.903 1.00 64.96  ?  72  LEU F CD2 1 
ATOM   9465  N  N   . TYR F  3 45  ? 157.504 168.557 149.127 1.00 61.83  ?  73  TYR F N   1 
ATOM   9466  C  CA  . TYR F  3 45  ? 157.032 167.512 148.235 1.00 61.83  ?  73  TYR F CA  1 
ATOM   9467  C  C   . TYR F  3 45  ? 157.377 167.823 146.782 1.00 61.83  ?  73  TYR F C   1 
ATOM   9468  O  O   . TYR F  3 45  ? 157.915 168.879 146.446 1.00 61.83  ?  73  TYR F O   1 
ATOM   9469  C  CB  . TYR F  3 45  ? 155.528 167.318 148.377 1.00 61.83  ?  73  TYR F CB  1 
ATOM   9470  C  CG  . TYR F  3 45  ? 155.095 166.649 149.654 1.00 61.83  ?  73  TYR F CG  1 
ATOM   9471  C  CD1 . TYR F  3 45  ? 156.000 165.966 150.451 1.00 61.83  ?  73  TYR F CD1 1 
ATOM   9472  C  CD2 . TYR F  3 45  ? 153.775 166.698 150.061 1.00 61.83  ?  73  TYR F CD2 1 
ATOM   9473  C  CE1 . TYR F  3 45  ? 155.597 165.352 151.617 1.00 61.83  ?  73  TYR F CE1 1 
ATOM   9474  C  CE2 . TYR F  3 45  ? 153.366 166.089 151.226 1.00 61.83  ?  73  TYR F CE2 1 
ATOM   9475  C  CZ  . TYR F  3 45  ? 154.278 165.420 151.998 1.00 61.83  ?  73  TYR F CZ  1 
ATOM   9476  O  OH  . TYR F  3 45  ? 153.864 164.815 153.159 1.00 61.83  ?  73  TYR F OH  1 
ATOM   9477  N  N   . GLY F  3 46  ? 157.060 166.866 145.915 1.00 65.46  ?  74  GLY F N   1 
ATOM   9478  C  CA  . GLY F  3 46  ? 157.278 167.002 144.491 1.00 65.46  ?  74  GLY F CA  1 
ATOM   9479  C  C   . GLY F  3 46  ? 156.133 166.412 143.698 1.00 65.46  ?  74  GLY F C   1 
ATOM   9480  O  O   . GLY F  3 46  ? 154.991 166.410 144.164 1.00 65.46  ?  74  GLY F O   1 
ATOM   9481  N  N   . THR F  3 47  ? 156.424 165.899 142.508 1.00 70.26  ?  75  THR F N   1 
ATOM   9482  C  CA  . THR F  3 47  ? 155.396 165.333 141.646 1.00 70.26  ?  75  THR F CA  1 
ATOM   9483  C  C   . THR F  3 47  ? 154.946 163.979 142.189 1.00 70.26  ?  75  THR F C   1 
ATOM   9484  O  O   . THR F  3 47  ? 155.761 163.182 142.662 1.00 70.26  ?  75  THR F O   1 
ATOM   9485  C  CB  . THR F  3 47  ? 155.938 165.197 140.220 1.00 70.26  ?  75  THR F CB  1 
ATOM   9486  O  OG1 . THR F  3 47  ? 156.460 166.460 139.797 1.00 70.26  ?  75  THR F OG1 1 
ATOM   9487  C  CG2 . THR F  3 47  ? 154.849 164.800 139.246 1.00 70.26  ?  75  THR F CG2 1 
ATOM   9488  N  N   . TYR F  3 48  ? 153.623 163.746 142.138 1.00 73.00  ?  76  TYR F N   1 
ATOM   9489  C  CA  . TYR F  3 48  ? 152.949 162.548 142.663 1.00 73.00  ?  76  TYR F CA  1 
ATOM   9490  C  C   . TYR F  3 48  ? 153.206 162.348 144.151 1.00 73.00  ?  76  TYR F C   1 
ATOM   9491  O  O   . TYR F  3 48  ? 153.347 161.207 144.598 1.00 73.00  ?  76  TYR F O   1 
ATOM   9492  C  CB  . TYR F  3 48  ? 153.343 161.269 141.916 1.00 73.00  ?  76  TYR F CB  1 
ATOM   9493  C  CG  . TYR F  3 48  ? 152.924 161.171 140.476 1.00 73.00  ?  76  TYR F CG  1 
ATOM   9494  C  CD1 . TYR F  3 48  ? 151.622 160.845 140.132 1.00 73.00  ?  76  TYR F CD1 1 
ATOM   9495  C  CD2 . TYR F  3 48  ? 153.852 161.344 139.460 1.00 73.00  ?  76  TYR F CD2 1 
ATOM   9496  C  CE1 . TYR F  3 48  ? 151.247 160.731 138.809 1.00 73.00  ?  76  TYR F CE1 1 
ATOM   9497  C  CE2 . TYR F  3 48  ? 153.489 161.235 138.141 1.00 73.00  ?  76  TYR F CE2 1 
ATOM   9498  C  CZ  . TYR F  3 48  ? 152.188 160.928 137.821 1.00 73.00  ?  76  TYR F CZ  1 
ATOM   9499  O  OH  . TYR F  3 48  ? 151.837 160.811 136.501 1.00 73.00  ?  76  TYR F OH  1 
ATOM   9500  N  N   . ARG F  3 49  ? 153.259 163.462 144.895 1.00 72.57  ?  77  ARG F N   1 
ATOM   9501  C  CA  . ARG F  3 49  ? 153.621 163.557 146.324 1.00 72.57  ?  77  ARG F CA  1 
ATOM   9502  C  C   . ARG F  3 49  ? 154.825 162.686 146.708 1.00 72.57  ?  77  ARG F C   1 
ATOM   9503  O  O   . ARG F  3 49  ? 154.883 162.077 147.778 1.00 72.57  ?  77  ARG F O   1 
ATOM   9504  C  CB  . ARG F  3 49  ? 152.404 163.303 147.237 1.00 72.57  ?  77  ARG F CB  1 
ATOM   9505  C  CG  . ARG F  3 49  ? 151.727 161.928 147.250 1.00 72.57  ?  77  ARG F CG  1 
ATOM   9506  C  CD  . ARG F  3 49  ? 150.550 161.898 148.211 1.00 72.57  ?  77  ARG F CD  1 
ATOM   9507  N  NE  . ARG F  3 49  ? 149.475 162.790 147.787 1.00 72.57  ?  77  ARG F NE  1 
ATOM   9508  C  CZ  . ARG F  3 49  ? 149.154 163.919 148.407 1.00 72.57  ?  77  ARG F CZ  1 
ATOM   9509  N  NH1 . ARG F  3 49  ? 149.826 164.301 149.483 1.00 72.57  1  77  ARG F NH1 1 
ATOM   9510  N  NH2 . ARG F  3 49  ? 148.162 164.669 147.948 1.00 72.57  ?  77  ARG F NH2 1 
ATOM   9511  N  N   . THR F  3 50  ? 155.827 162.671 145.831 1.00 71.86  ?  78  THR F N   1 
ATOM   9512  C  CA  . THR F  3 50  ? 157.080 161.973 146.091 1.00 71.86  ?  78  THR F CA  1 
ATOM   9513  C  C   . THR F  3 50  ? 157.892 162.819 147.061 1.00 71.86  ?  78  THR F C   1 
ATOM   9514  O  O   . THR F  3 50  ? 158.434 163.862 146.678 1.00 71.86  ?  78  THR F O   1 
ATOM   9515  C  CB  . THR F  3 50  ? 157.850 161.735 144.798 1.00 71.86  ?  78  THR F CB  1 
ATOM   9516  O  OG1 . THR F  3 50  ? 157.044 160.965 143.898 1.00 71.86  ?  78  THR F OG1 1 
ATOM   9517  C  CG2 . THR F  3 50  ? 159.138 160.986 145.082 1.00 71.86  ?  78  THR F CG2 1 
ATOM   9518  N  N   . ARG F  3 51  ? 157.968 162.371 148.312 1.00 71.62  ?  79  ARG F N   1 
ATOM   9519  C  CA  . ARG F  3 51  ? 158.581 163.149 149.383 1.00 71.62  ?  79  ARG F CA  1 
ATOM   9520  C  C   . ARG F  3 51  ? 160.079 163.291 149.158 1.00 71.62  ?  79  ARG F C   1 
ATOM   9521  O  O   . ARG F  3 51  ? 160.823 162.311 149.239 1.00 71.62  ?  79  ARG F O   1 
ATOM   9522  C  CB  . ARG F  3 51  ? 158.304 162.481 150.724 1.00 71.62  ?  79  ARG F CB  1 
ATOM   9523  C  CG  . ARG F  3 51  ? 158.905 163.201 151.901 1.00 71.62  ?  79  ARG F CG  1 
ATOM   9524  C  CD  . ARG F  3 51  ? 158.514 162.513 153.187 1.00 71.62  ?  79  ARG F CD  1 
ATOM   9525  N  NE  . ARG F  3 51  ? 157.089 162.667 153.462 1.00 71.62  ?  79  ARG F NE  1 
ATOM   9526  C  CZ  . ARG F  3 51  ? 156.445 162.038 154.438 1.00 71.62  ?  79  ARG F CZ  1 
ATOM   9527  N  NH1 . ARG F  3 51  ? 157.098 161.209 155.238 1.00 71.62  1  79  ARG F NH1 1 
ATOM   9528  N  NH2 . ARG F  3 51  ? 155.148 162.239 154.617 1.00 71.62  ?  79  ARG F NH2 1 
ATOM   9529  N  N   . LEU F  3 52  ? 160.522 164.516 148.874 1.00 73.02  ?  80  LEU F N   1 
ATOM   9530  C  CA  . LEU F  3 52  ? 161.915 164.733 148.494 1.00 73.02  ?  80  LEU F CA  1 
ATOM   9531  C  C   . LEU F  3 52  ? 162.818 164.826 149.721 1.00 73.02  ?  80  LEU F C   1 
ATOM   9532  O  O   . LEU F  3 52  ? 163.695 163.982 149.926 1.00 73.02  ?  80  LEU F O   1 
ATOM   9533  C  CB  . LEU F  3 52  ? 162.035 165.998 147.643 1.00 73.02  ?  80  LEU F CB  1 
ATOM   9534  C  CG  . LEU F  3 52  ? 161.214 166.038 146.354 1.00 73.02  ?  80  LEU F CG  1 
ATOM   9535  C  CD1 . LEU F  3 52  ? 161.420 167.363 145.640 1.00 73.02  ?  80  LEU F CD1 1 
ATOM   9536  C  CD2 . LEU F  3 52  ? 161.534 164.876 145.441 1.00 73.02  ?  80  LEU F CD2 1 
ATOM   9537  N  N   . HIS F  3 53  ? 162.602 165.839 150.556 1.00 74.84  ?  81  HIS F N   1 
ATOM   9538  C  CA  . HIS F  3 53  ? 163.533 166.157 151.629 1.00 74.84  ?  81  HIS F CA  1 
ATOM   9539  C  C   . HIS F  3 53  ? 162.808 166.999 152.666 1.00 74.84  ?  81  HIS F C   1 
ATOM   9540  O  O   . HIS F  3 53  ? 161.853 167.707 152.337 1.00 74.84  ?  81  HIS F O   1 
ATOM   9541  C  CB  . HIS F  3 53  ? 164.755 166.897 151.072 1.00 74.84  ?  81  HIS F CB  1 
ATOM   9542  C  CG  . HIS F  3 53  ? 165.842 167.135 152.072 1.00 74.84  ?  81  HIS F CG  1 
ATOM   9543  N  ND1 . HIS F  3 53  ? 166.671 166.133 152.525 1.00 74.84  ?  81  HIS F ND1 1 
ATOM   9544  C  CD2 . HIS F  3 53  ? 166.252 168.268 152.689 1.00 74.84  ?  81  HIS F CD2 1 
ATOM   9545  C  CE1 . HIS F  3 53  ? 167.536 166.634 153.389 1.00 74.84  ?  81  HIS F CE1 1 
ATOM   9546  N  NE2 . HIS F  3 53  ? 167.302 167.929 153.506 1.00 74.84  ?  81  HIS F NE2 1 
ATOM   9547  N  N   . GLU F  3 54  ? 163.268 166.926 153.913 1.00 77.38  ?  82  GLU F N   1 
ATOM   9548  C  CA  . GLU F  3 54  ? 162.615 167.644 154.998 1.00 77.38  ?  82  GLU F CA  1 
ATOM   9549  C  C   . GLU F  3 54  ? 162.899 169.140 154.884 1.00 77.38  ?  82  GLU F C   1 
ATOM   9550  O  O   . GLU F  3 54  ? 163.952 169.548 154.386 1.00 77.38  ?  82  GLU F O   1 
ATOM   9551  C  CB  . GLU F  3 54  ? 163.094 167.097 156.344 1.00 77.38  ?  82  GLU F CB  1 
ATOM   9552  C  CG  . GLU F  3 54  ? 162.281 167.542 157.552 1.00 77.38  ?  82  GLU F CG  1 
ATOM   9553  C  CD  . GLU F  3 54  ? 162.763 166.923 158.846 1.00 77.38  ?  82  GLU F CD  1 
ATOM   9554  O  OE1 . GLU F  3 54  ? 163.768 166.180 158.813 1.00 77.38  ?  82  GLU F OE1 1 
ATOM   9555  O  OE2 . GLU F  3 54  ? 162.133 167.173 159.895 1.00 77.38  -1 82  GLU F OE2 1 
ATOM   9556  N  N   . ASN F  3 55  ? 161.939 169.953 155.330 1.00 77.88  ?  83  ASN F N   1 
ATOM   9557  C  CA  . ASN F  3 55  ? 161.985 171.404 155.170 1.00 77.88  ?  83  ASN F CA  1 
ATOM   9558  C  C   . ASN F  3 55  ? 163.123 172.023 155.969 1.00 77.88  ?  83  ASN F C   1 
ATOM   9559  O  O   . ASN F  3 55  ? 163.249 171.803 157.175 1.00 77.88  ?  83  ASN F O   1 
ATOM   9560  C  CB  . ASN F  3 55  ? 160.653 172.015 155.618 1.00 77.88  ?  83  ASN F CB  1 
ATOM   9561  C  CG  . ASN F  3 55  ? 160.496 173.463 155.185 1.00 77.88  ?  83  ASN F CG  1 
ATOM   9562  O  OD1 . ASN F  3 55  ? 161.328 174.006 154.459 1.00 77.88  ?  83  ASN F OD1 1 
ATOM   9563  N  ND2 . ASN F  3 55  ? 159.433 174.104 155.655 1.00 77.88  ?  83  ASN F ND2 1 
ATOM   9564  N  N   . ASN F  3 56  ? 163.947 172.807 155.280 1.00 79.09  ?  84  ASN F N   1 
ATOM   9565  C  CA  . ASN F  3 56  ? 165.049 173.507 155.920 1.00 79.09  ?  84  ASN F CA  1 
ATOM   9566  C  C   . ASN F  3 56  ? 164.957 175.005 155.670 1.00 79.09  ?  84  ASN F C   1 
ATOM   9567  O  O   . ASN F  3 56  ? 165.212 175.811 156.569 1.00 79.09  ?  84  ASN F O   1 
ATOM   9568  C  CB  . ASN F  3 56  ? 166.380 172.959 155.408 1.00 79.09  ?  84  ASN F CB  1 
ATOM   9569  C  CG  . ASN F  3 56  ? 166.610 171.523 155.821 1.00 79.09  ?  84  ASN F CG  1 
ATOM   9570  O  OD1 . ASN F  3 56  ? 166.331 171.138 156.956 1.00 79.09  ?  84  ASN F OD1 1 
ATOM   9571  N  ND2 . ASN F  3 56  ? 167.115 170.716 154.896 1.00 79.09  ?  84  ASN F ND2 1 
ATOM   9572  N  N   . TRP F  3 57  ? 164.582 175.384 154.449 1.00 78.51  ?  85  TRP F N   1 
ATOM   9573  C  CA  . TRP F  3 57  ? 164.743 176.767 154.016 1.00 78.51  ?  85  TRP F CA  1 
ATOM   9574  C  C   . TRP F  3 57  ? 163.544 177.625 154.392 1.00 78.51  ?  85  TRP F C   1 
ATOM   9575  O  O   . TRP F  3 57  ? 163.682 178.629 155.100 1.00 78.51  ?  85  TRP F O   1 
ATOM   9576  C  CB  . TRP F  3 57  ? 164.964 176.806 152.507 1.00 78.51  ?  85  TRP F CB  1 
ATOM   9577  C  CG  . TRP F  3 57  ? 166.229 176.166 152.097 1.00 78.51  ?  85  TRP F CG  1 
ATOM   9578  C  CD1 . TRP F  3 57  ? 167.437 176.768 151.945 1.00 78.51  ?  85  TRP F CD1 1 
ATOM   9579  C  CD2 . TRP F  3 57  ? 166.429 174.782 151.807 1.00 78.51  ?  85  TRP F CD2 1 
ATOM   9580  N  NE1 . TRP F  3 57  ? 168.380 175.849 151.557 1.00 78.51  ?  85  TRP F NE1 1 
ATOM   9581  C  CE2 . TRP F  3 57  ? 167.785 174.619 151.471 1.00 78.51  ?  85  TRP F CE2 1 
ATOM   9582  C  CE3 . TRP F  3 57  ? 165.591 173.664 151.792 1.00 78.51  ?  85  TRP F CE3 1 
ATOM   9583  C  CZ2 . TRP F  3 57  ? 168.322 173.386 151.129 1.00 78.51  ?  85  TRP F CZ2 1 
ATOM   9584  C  CZ3 . TRP F  3 57  ? 166.126 172.442 151.448 1.00 78.51  ?  85  TRP F CZ3 1 
ATOM   9585  C  CH2 . TRP F  3 57  ? 167.477 172.310 151.120 1.00 78.51  ?  85  TRP F CH2 1 
ATOM   9586  N  N   . ILE F  3 58  ? 162.361 177.250 153.916 1.00 70.38  ?  86  ILE F N   1 
ATOM   9587  C  CA  . ILE F  3 58  ? 161.215 178.152 153.875 1.00 70.38  ?  86  ILE F CA  1 
ATOM   9588  C  C   . ILE F  3 58  ? 160.603 178.242 155.268 1.00 70.38  ?  86  ILE F C   1 
ATOM   9589  O  O   . ILE F  3 58  ? 160.207 177.233 155.852 1.00 70.38  ?  86  ILE F O   1 
ATOM   9590  C  CB  . ILE F  3 58  ? 160.185 177.690 152.843 1.00 70.38  ?  86  ILE F CB  1 
ATOM   9591  C  CG1 . ILE F  3 58  ? 160.831 177.653 151.460 1.00 70.38  ?  86  ILE F CG1 1 
ATOM   9592  C  CG2 . ILE F  3 58  ? 159.006 178.627 152.835 1.00 70.38  ?  86  ILE F CG2 1 
ATOM   9593  C  CD1 . ILE F  3 58  ? 160.024 176.939 150.424 1.00 70.38  ?  86  ILE F CD1 1 
ATOM   9594  N  N   . CYS F  3 59  ? 160.532 179.455 155.802 1.00 70.58  ?  87  CYS F N   1 
ATOM   9595  C  CA  . CYS F  3 59  ? 159.955 179.705 157.110 1.00 70.58  ?  87  CYS F CA  1 
ATOM   9596  C  C   . CYS F  3 59  ? 158.659 180.493 156.973 1.00 70.58  ?  87  CYS F C   1 
ATOM   9597  O  O   . CYS F  3 59  ? 158.350 181.062 155.920 1.00 70.58  ?  87  CYS F O   1 
ATOM   9598  C  CB  . CYS F  3 59  ? 160.939 180.462 158.002 1.00 70.58  ?  87  CYS F CB  1 
ATOM   9599  S  SG  . CYS F  3 59  ? 160.348 180.743 159.684 1.00 70.58  ?  87  CYS F SG  1 
ATOM   9600  N  N   . ILE F  3 60  ? 157.900 180.523 158.065 1.00 69.18  ?  88  ILE F N   1 
ATOM   9601  C  CA  . ILE F  3 60  ? 156.594 181.164 158.093 1.00 69.18  ?  88  ILE F CA  1 
ATOM   9602  C  C   . ILE F  3 60  ? 156.488 182.014 159.352 1.00 69.18  ?  88  ILE F C   1 
ATOM   9603  O  O   . ILE F  3 60  ? 157.107 181.727 160.381 1.00 69.18  ?  88  ILE F O   1 
ATOM   9604  C  CB  . ILE F  3 60  ? 155.454 180.112 158.013 1.00 69.18  ?  88  ILE F CB  1 
ATOM   9605  C  CG1 . ILE F  3 60  ? 154.103 180.753 157.688 1.00 69.18  ?  88  ILE F CG1 1 
ATOM   9606  C  CG2 . ILE F  3 60  ? 155.358 179.281 159.287 1.00 69.18  ?  88  ILE F CG2 1 
ATOM   9607  C  CD1 . ILE F  3 60  ? 153.022 179.750 157.368 1.00 69.18  ?  88  ILE F CD1 1 
ATOM   9608  N  N   . GLN F  3 61  ? 155.758 183.116 159.235 1.00 72.78  ?  89  GLN F N   1 
ATOM   9609  C  CA  . GLN F  3 61  ? 155.283 183.858 160.388 1.00 72.78  ?  89  GLN F CA  1 
ATOM   9610  C  C   . GLN F  3 61  ? 153.945 183.278 160.817 1.00 72.78  ?  89  GLN F C   1 
ATOM   9611  O  O   . GLN F  3 61  ? 153.040 183.116 159.995 1.00 72.78  ?  89  GLN F O   1 
ATOM   9612  C  CB  . GLN F  3 61  ? 155.148 185.346 160.067 1.00 72.78  ?  89  GLN F CB  1 
ATOM   9613  C  CG  . GLN F  3 61  ? 156.473 186.042 159.847 1.00 72.78  ?  89  GLN F CG  1 
ATOM   9614  C  CD  . GLN F  3 61  ? 157.306 186.085 161.112 1.00 72.78  ?  89  GLN F CD  1 
ATOM   9615  O  OE1 . GLN F  3 61  ? 156.781 186.292 162.206 1.00 72.78  ?  89  GLN F OE1 1 
ATOM   9616  N  NE2 . GLN F  3 61  ? 158.609 185.880 160.971 1.00 72.78  ?  89  GLN F NE2 1 
ATOM   9617  N  N   . GLU F  3 62  ? 153.834 182.948 162.098 1.00 72.61  ?  90  GLU F N   1 
ATOM   9618  C  CA  . GLU F  3 62  ? 152.631 182.332 162.637 1.00 72.61  ?  90  GLU F CA  1 
ATOM   9619  C  C   . GLU F  3 62  ? 151.453 183.296 162.688 1.00 72.61  ?  90  GLU F C   1 
ATOM   9620  O  O   . GLU F  3 62  ? 150.304 182.853 162.598 1.00 72.61  ?  90  GLU F O   1 
ATOM   9621  C  CB  . GLU F  3 62  ? 152.931 181.782 164.039 1.00 72.61  ?  90  GLU F CB  1 
ATOM   9622  C  CG  . GLU F  3 62  ? 151.851 180.912 164.659 1.00 72.61  ?  90  GLU F CG  1 
ATOM   9623  C  CD  . GLU F  3 62  ? 152.250 180.377 166.021 1.00 72.61  ?  90  GLU F CD  1 
ATOM   9624  O  OE1 . GLU F  3 62  ? 153.352 180.722 166.495 1.00 72.61  ?  90  GLU F OE1 1 
ATOM   9625  O  OE2 . GLU F  3 62  ? 151.465 179.609 166.616 1.00 72.61  -1 90  GLU F OE2 1 
ATOM   9626  N  N   . ASP F  3 63  ? 151.707 184.599 162.779 1.00 76.64  ?  91  ASP F N   1 
ATOM   9627  C  CA  . ASP F  3 63  ? 150.638 185.572 163.023 1.00 76.64  ?  91  ASP F CA  1 
ATOM   9628  C  C   . ASP F  3 63  ? 150.085 186.156 161.724 1.00 76.64  ?  91  ASP F C   1 
ATOM   9629  O  O   . ASP F  3 63  ? 148.906 185.978 161.408 1.00 76.64  ?  91  ASP F O   1 
ATOM   9630  C  CB  . ASP F  3 63  ? 151.155 186.679 163.942 1.00 76.64  ?  91  ASP F CB  1 
ATOM   9631  C  CG  . ASP F  3 63  ? 151.475 186.172 165.331 1.00 76.64  ?  91  ASP F CG  1 
ATOM   9632  O  OD1 . ASP F  3 63  ? 150.829 185.199 165.770 1.00 76.64  ?  91  ASP F OD1 1 
ATOM   9633  O  OD2 . ASP F  3 63  ? 152.377 186.740 165.982 1.00 76.64  -1 91  ASP F OD2 1 
ATOM   9634  N  N   . THR F  3 64  ? 150.932 186.837 160.957 1.00 71.34  ?  92  THR F N   1 
ATOM   9635  C  CA  . THR F  3 64  ? 150.457 187.608 159.814 1.00 71.34  ?  92  THR F CA  1 
ATOM   9636  C  C   . THR F  3 64  ? 150.206 186.759 158.581 1.00 71.34  ?  92  THR F C   1 
ATOM   9637  O  O   . THR F  3 64  ? 149.649 187.271 157.604 1.00 71.34  ?  92  THR F O   1 
ATOM   9638  C  CB  . THR F  3 64  ? 151.459 188.707 159.461 1.00 71.34  ?  92  THR F CB  1 
ATOM   9639  O  OG1 . THR F  3 64  ? 152.689 188.112 159.031 1.00 71.34  ?  92  THR F OG1 1 
ATOM   9640  C  CG2 . THR F  3 64  ? 151.727 189.589 160.670 1.00 71.34  ?  92  THR F CG2 1 
ATOM   9641  N  N   . GLY F  3 65  ? 150.595 185.491 158.594 1.00 67.86  ?  93  GLY F N   1 
ATOM   9642  C  CA  . GLY F  3 65  ? 150.449 184.660 157.420 1.00 67.86  ?  93  GLY F CA  1 
ATOM   9643  C  C   . GLY F  3 65  ? 151.422 185.041 156.326 1.00 67.86  ?  93  GLY F C   1 
ATOM   9644  O  O   . GLY F  3 65  ? 151.018 185.426 155.228 1.00 67.86  ?  93  GLY F O   1 
ATOM   9645  N  N   . LEU F  3 66  ? 152.712 184.935 156.625 1.00 67.42  ?  94  LEU F N   1 
ATOM   9646  C  CA  . LEU F  3 66  ? 153.780 185.324 155.718 1.00 67.42  ?  94  LEU F CA  1 
ATOM   9647  C  C   . LEU F  3 66  ? 154.735 184.160 155.503 1.00 67.42  ?  94  LEU F C   1 
ATOM   9648  O  O   . LEU F  3 66  ? 155.290 183.619 156.460 1.00 67.42  ?  94  LEU F O   1 
ATOM   9649  C  CB  . LEU F  3 66  ? 154.540 186.530 156.277 1.00 67.42  ?  94  LEU F CB  1 
ATOM   9650  C  CG  . LEU F  3 66  ? 155.830 186.985 155.592 1.00 67.42  ?  94  LEU F CG  1 
ATOM   9651  C  CD1 . LEU F  3 66  ? 155.619 187.351 154.139 1.00 67.42  ?  94  LEU F CD1 1 
ATOM   9652  C  CD2 . LEU F  3 66  ? 156.396 188.171 156.343 1.00 67.42  ?  94  LEU F CD2 1 
ATOM   9653  N  N   . LEU F  3 67  ? 154.928 183.779 154.244 1.00 64.21  ?  95  LEU F N   1 
ATOM   9654  C  CA  . LEU F  3 67  ? 155.920 182.783 153.867 1.00 64.21  ?  95  LEU F CA  1 
ATOM   9655  C  C   . LEU F  3 67  ? 157.132 183.517 153.323 1.00 64.21  ?  95  LEU F C   1 
ATOM   9656  O  O   . LEU F  3 67  ? 156.989 184.381 152.446 1.00 64.21  ?  95  LEU F O   1 
ATOM   9657  C  CB  . LEU F  3 67  ? 155.376 181.805 152.824 1.00 64.21  ?  95  LEU F CB  1 
ATOM   9658  C  CG  . LEU F  3 67  ? 154.599 180.567 153.273 1.00 64.21  ?  95  LEU F CG  1 
ATOM   9659  C  CD1 . LEU F  3 67  ? 153.233 180.913 153.824 1.00 64.21  ?  95  LEU F CD1 1 
ATOM   9660  C  CD2 . LEU F  3 67  ? 154.466 179.614 152.101 1.00 64.21  ?  95  LEU F CD2 1 
ATOM   9661  N  N   . TYR F  3 68  ? 158.310 183.175 153.848 1.00 69.96  ?  96  TYR F N   1 
ATOM   9662  C  CA  . TYR F  3 68  ? 159.571 183.795 153.470 1.00 69.96  ?  96  TYR F CA  1 
ATOM   9663  C  C   . TYR F  3 68  ? 160.668 182.739 153.519 1.00 69.96  ?  96  TYR F C   1 
ATOM   9664  O  O   . TYR F  3 68  ? 160.418 181.570 153.820 1.00 69.96  ?  96  TYR F O   1 
ATOM   9665  C  CB  . TYR F  3 68  ? 159.913 184.985 154.382 1.00 69.96  ?  96  TYR F CB  1 
ATOM   9666  C  CG  . TYR F  3 68  ? 160.136 184.631 155.833 1.00 69.96  ?  96  TYR F CG  1 
ATOM   9667  C  CD1 . TYR F  3 68  ? 159.070 184.558 156.718 1.00 69.96  ?  96  TYR F CD1 1 
ATOM   9668  C  CD2 . TYR F  3 68  ? 161.412 184.407 156.328 1.00 69.96  ?  96  TYR F CD2 1 
ATOM   9669  C  CE1 . TYR F  3 68  ? 159.265 184.242 158.044 1.00 69.96  ?  96  TYR F CE1 1 
ATOM   9670  C  CE2 . TYR F  3 68  ? 161.617 184.088 157.650 1.00 69.96  ?  96  TYR F CE2 1 
ATOM   9671  C  CZ  . TYR F  3 68  ? 160.542 184.012 158.504 1.00 69.96  ?  96  TYR F CZ  1 
ATOM   9672  O  OH  . TYR F  3 68  ? 160.744 183.697 159.826 1.00 69.96  ?  96  TYR F OH  1 
ATOM   9673  N  N   . LEU F  3 69  ? 161.898 183.165 153.241 1.00 72.57  ?  97  LEU F N   1 
ATOM   9674  C  CA  . LEU F  3 69  ? 163.062 182.287 153.270 1.00 72.57  ?  97  LEU F CA  1 
ATOM   9675  C  C   . LEU F  3 69  ? 163.880 182.551 154.526 1.00 72.57  ?  97  LEU F C   1 
ATOM   9676  O  O   . LEU F  3 69  ? 164.161 183.708 154.853 1.00 72.57  ?  97  LEU F O   1 
ATOM   9677  C  CB  . LEU F  3 69  ? 163.935 182.489 152.034 1.00 72.57  ?  97  LEU F CB  1 
ATOM   9678  C  CG  . LEU F  3 69  ? 163.431 181.965 150.697 1.00 72.57  ?  97  LEU F CG  1 
ATOM   9679  C  CD1 . LEU F  3 69  ? 164.359 182.401 149.585 1.00 72.57  ?  97  LEU F CD1 1 
ATOM   9680  C  CD2 . LEU F  3 69  ? 163.361 180.460 150.757 1.00 72.57  ?  97  LEU F CD2 1 
ATOM   9681  N  N   . ASN F  3 70  ? 164.273 181.481 155.220 1.00 80.99  ?  98  ASN F N   1 
ATOM   9682  C  CA  . ASN F  3 70  ? 165.247 181.640 156.294 1.00 80.99  ?  98  ASN F CA  1 
ATOM   9683  C  C   . ASN F  3 70  ? 166.664 181.480 155.767 1.00 80.99  ?  98  ASN F C   1 
ATOM   9684  O  O   . ASN F  3 70  ? 167.496 182.380 155.913 1.00 80.99  ?  98  ASN F O   1 
ATOM   9685  C  CB  . ASN F  3 70  ? 165.006 180.629 157.410 1.00 80.99  ?  98  ASN F CB  1 
ATOM   9686  C  CG  . ASN F  3 70  ? 165.819 180.939 158.646 1.00 80.99  ?  98  ASN F CG  1 
ATOM   9687  O  OD1 . ASN F  3 70  ? 166.356 182.039 158.777 1.00 80.99  ?  98  ASN F OD1 1 
ATOM   9688  N  ND2 . ASN F  3 70  ? 165.948 179.953 159.537 1.00 80.99  ?  98  ASN F ND2 1 
ATOM   9689  N  N   . ARG F  3 71  ? 166.961 180.332 155.175 1.00 83.76  ?  99  ARG F N   1 
ATOM   9690  C  CA  . ARG F  3 71  ? 168.259 180.058 154.590 1.00 83.76  ?  99  ARG F CA  1 
ATOM   9691  C  C   . ARG F  3 71  ? 168.237 180.458 153.116 1.00 83.76  ?  99  ARG F C   1 
ATOM   9692  O  O   . ARG F  3 71  ? 167.287 181.078 152.633 1.00 83.76  ?  99  ARG F O   1 
ATOM   9693  C  CB  . ARG F  3 71  ? 168.615 178.587 154.798 1.00 83.76  ?  99  ARG F CB  1 
ATOM   9694  C  CG  . ARG F  3 71  ? 168.759 178.213 156.264 1.00 83.76  ?  99  ARG F CG  1 
ATOM   9695  C  CD  . ARG F  3 71  ? 169.086 176.743 156.455 1.00 83.76  ?  99  ARG F CD  1 
ATOM   9696  N  NE  . ARG F  3 71  ? 170.403 176.400 155.927 1.00 83.76  ?  99  ARG F NE  1 
ATOM   9697  C  CZ  . ARG F  3 71  ? 170.600 175.613 154.875 1.00 83.76  ?  99  ARG F CZ  1 
ATOM   9698  N  NH1 . ARG F  3 71  ? 169.563 175.079 154.250 1.00 83.76  1  99  ARG F NH1 1 
ATOM   9699  N  NH2 . ARG F  3 71  ? 171.829 175.351 154.457 1.00 83.76  ?  99  ARG F NH2 1 
ATOM   9700  N  N   . SER F  3 72  ? 169.289 180.102 152.386 1.00 79.48  ?  100 SER F N   1 
ATOM   9701  C  CA  . SER F  3 72  ? 169.404 180.472 150.983 1.00 79.48  ?  100 SER F CA  1 
ATOM   9702  C  C   . SER F  3 72  ? 169.616 179.202 150.174 1.00 79.48  ?  100 SER F C   1 
ATOM   9703  O  O   . SER F  3 72  ? 169.918 178.136 150.717 1.00 79.48  ?  100 SER F O   1 
ATOM   9704  C  CB  . SER F  3 72  ? 170.538 181.482 150.774 1.00 79.48  ?  100 SER F CB  1 
ATOM   9705  O  OG  . SER F  3 72  ? 171.798 180.892 151.035 1.00 79.48  ?  100 SER F OG  1 
ATOM   9706  N  N   . LEU F  3 73  ? 169.478 179.321 148.860 1.00 79.47  ?  101 LEU F N   1 
ATOM   9707  C  CA  . LEU F  3 73  ? 169.502 178.180 147.958 1.00 79.47  ?  101 LEU F CA  1 
ATOM   9708  C  C   . LEU F  3 73  ? 170.781 178.211 147.136 1.00 79.47  ?  101 LEU F C   1 
ATOM   9709  O  O   . LEU F  3 73  ? 170.967 179.106 146.306 1.00 79.47  ?  101 LEU F O   1 
ATOM   9710  C  CB  . LEU F  3 73  ? 168.281 178.202 147.042 1.00 79.47  ?  101 LEU F CB  1 
ATOM   9711  C  CG  . LEU F  3 73  ? 166.927 178.097 147.741 1.00 79.47  ?  101 LEU F CG  1 
ATOM   9712  C  CD1 . LEU F  3 73  ? 165.820 178.338 146.741 1.00 79.47  ?  101 LEU F CD1 1 
ATOM   9713  C  CD2 . LEU F  3 73  ? 166.751 176.748 148.427 1.00 79.47  ?  101 LEU F CD2 1 
ATOM   9714  N  N   . ASP F  3 74  ? 171.654 177.235 147.360 1.00 84.69  ?  102 ASP F N   1 
ATOM   9715  C  CA  . ASP F  3 74  ? 172.813 177.019 146.509 1.00 84.69  ?  102 ASP F CA  1 
ATOM   9716  C  C   . ASP F  3 74  ? 172.505 175.935 145.484 1.00 84.69  ?  102 ASP F C   1 
ATOM   9717  O  O   . ASP F  3 74  ? 171.455 175.289 145.535 1.00 84.69  ?  102 ASP F O   1 
ATOM   9718  C  CB  . ASP F  3 74  ? 174.052 176.648 147.335 1.00 84.69  ?  102 ASP F CB  1 
ATOM   9719  C  CG  . ASP F  3 74  ? 173.817 175.466 148.258 1.00 84.69  ?  102 ASP F CG  1 
ATOM   9720  O  OD1 . ASP F  3 74  ? 172.659 175.031 148.406 1.00 84.69  ?  102 ASP F OD1 1 
ATOM   9721  O  OD2 . ASP F  3 74  ? 174.803 174.959 148.833 1.00 84.69  -1 102 ASP F OD2 1 
ATOM   9722  N  N   . HIS F  3 75  ? 173.436 175.752 144.544 1.00 84.19  ?  103 HIS F N   1 
ATOM   9723  C  CA  . HIS F  3 75  ? 173.239 174.771 143.480 1.00 84.19  ?  103 HIS F CA  1 
ATOM   9724  C  C   . HIS F  3 75  ? 173.243 173.347 144.018 1.00 84.19  ?  103 HIS F C   1 
ATOM   9725  O  O   . HIS F  3 75  ? 172.573 172.471 143.457 1.00 84.19  ?  103 HIS F O   1 
ATOM   9726  C  CB  . HIS F  3 75  ? 174.323 174.924 142.415 1.00 84.19  ?  103 HIS F CB  1 
ATOM   9727  C  CG  . HIS F  3 75  ? 174.273 176.225 141.677 1.00 84.19  ?  103 HIS F CG  1 
ATOM   9728  N  ND1 . HIS F  3 75  ? 174.914 177.361 142.125 1.00 84.19  ?  103 HIS F ND1 1 
ATOM   9729  C  CD2 . HIS F  3 75  ? 173.677 176.567 140.509 1.00 84.19  ?  103 HIS F CD2 1 
ATOM   9730  C  CE1 . HIS F  3 75  ? 174.707 178.347 141.271 1.00 84.19  ?  103 HIS F CE1 1 
ATOM   9731  N  NE2 . HIS F  3 75  ? 173.960 177.892 140.282 1.00 84.19  ?  103 HIS F NE2 1 
ATOM   9732  N  N   . SER F  3 76  ? 173.971 173.107 145.112 1.00 85.90  ?  104 SER F N   1 
ATOM   9733  C  CA  . SER F  3 76  ? 174.058 171.764 145.676 1.00 85.90  ?  104 SER F CA  1 
ATOM   9734  C  C   . SER F  3 76  ? 172.733 171.317 146.272 1.00 85.90  ?  104 SER F C   1 
ATOM   9735  O  O   . SER F  3 76  ? 172.427 170.122 146.259 1.00 85.90  ?  104 SER F O   1 
ATOM   9736  C  CB  . SER F  3 76  ? 175.159 171.708 146.734 1.00 85.90  ?  104 SER F CB  1 
ATOM   9737  O  OG  . SER F  3 76  ? 174.836 172.515 147.852 1.00 85.90  ?  104 SER F OG  1 
ATOM   9738  N  N   . SER F  3 77  ? 171.919 172.261 146.752 1.00 83.82  ?  105 SER F N   1 
ATOM   9739  C  CA  . SER F  3 77  ? 170.612 171.918 147.307 1.00 83.82  ?  105 SER F CA  1 
ATOM   9740  C  C   . SER F  3 77  ? 169.669 171.391 146.233 1.00 83.82  ?  105 SER F C   1 
ATOM   9741  O  O   . SER F  3 77  ? 168.986 170.381 146.433 1.00 83.82  ?  105 SER F O   1 
ATOM   9742  C  CB  . SER F  3 77  ? 170.004 173.140 147.987 1.00 83.82  ?  105 SER F CB  1 
ATOM   9743  O  OG  . SER F  3 77  ? 170.818 173.583 149.060 1.00 83.82  ?  105 SER F OG  1 
ATOM   9744  N  N   . TRP F  3 78  ? 169.637 172.044 145.077 1.00 82.86  ?  106 TRP F N   1 
ATOM   9745  C  CA  . TRP F  3 78  ? 168.743 171.609 144.018 1.00 82.86  ?  106 TRP F CA  1 
ATOM   9746  C  C   . TRP F  3 78  ? 169.315 170.451 143.218 1.00 82.86  ?  106 TRP F C   1 
ATOM   9747  O  O   . TRP F  3 78  ? 168.546 169.704 142.602 1.00 82.86  ?  106 TRP F O   1 
ATOM   9748  C  CB  . TRP F  3 78  ? 168.400 172.806 143.134 1.00 82.86  ?  106 TRP F CB  1 
ATOM   9749  C  CG  . TRP F  3 78  ? 167.611 173.795 143.930 1.00 82.86  ?  106 TRP F CG  1 
ATOM   9750  C  CD1 . TRP F  3 78  ? 168.102 174.840 144.655 1.00 82.86  ?  106 TRP F CD1 1 
ATOM   9751  C  CD2 . TRP F  3 78  ? 166.188 173.815 144.115 1.00 82.86  ?  106 TRP F CD2 1 
ATOM   9752  N  NE1 . TRP F  3 78  ? 167.077 175.512 145.272 1.00 82.86  ?  106 TRP F NE1 1 
ATOM   9753  C  CE2 . TRP F  3 78  ? 165.892 174.907 144.953 1.00 82.86  ?  106 TRP F CE2 1 
ATOM   9754  C  CE3 . TRP F  3 78  ? 165.137 173.024 143.643 1.00 82.86  ?  106 TRP F CE3 1 
ATOM   9755  C  CZ2 . TRP F  3 78  ? 164.591 175.215 145.341 1.00 82.86  ?  106 TRP F CZ2 1 
ATOM   9756  C  CZ3 . TRP F  3 78  ? 163.847 173.340 144.021 1.00 82.86  ?  106 TRP F CZ3 1 
ATOM   9757  C  CH2 . TRP F  3 78  ? 163.585 174.427 144.859 1.00 82.86  ?  106 TRP F CH2 1 
ATOM   9758  N  N   . GLU F  3 79  ? 170.635 170.253 143.247 1.00 88.55  ?  107 GLU F N   1 
ATOM   9759  C  CA  . GLU F  3 79  ? 171.176 168.990 142.761 1.00 88.55  ?  107 GLU F CA  1 
ATOM   9760  C  C   . GLU F  3 79  ? 170.847 167.851 143.720 1.00 88.55  ?  107 GLU F C   1 
ATOM   9761  O  O   . GLU F  3 79  ? 170.657 166.709 143.292 1.00 88.55  ?  107 GLU F O   1 
ATOM   9762  C  CB  . GLU F  3 79  ? 172.687 169.098 142.550 1.00 88.55  ?  107 GLU F CB  1 
ATOM   9763  C  CG  . GLU F  3 79  ? 173.100 170.010 141.401 1.00 88.55  ?  107 GLU F CG  1 
ATOM   9764  C  CD  . GLU F  3 79  ? 172.693 169.478 140.041 1.00 88.55  ?  107 GLU F CD  1 
ATOM   9765  O  OE1 . GLU F  3 79  ? 172.669 168.243 139.862 1.00 88.55  ?  107 GLU F OE1 1 
ATOM   9766  O  OE2 . GLU F  3 79  ? 172.398 170.302 139.148 1.00 88.55  -1 107 GLU F OE2 1 
ATOM   9767  N  N   . LYS F  3 80  ? 170.773 168.145 145.021 1.00 86.36  ?  108 LYS F N   1 
ATOM   9768  C  CA  . LYS F  3 80  ? 170.379 167.142 146.000 1.00 86.36  ?  108 LYS F CA  1 
ATOM   9769  C  C   . LYS F  3 80  ? 168.909 166.783 145.867 1.00 86.36  ?  108 LYS F C   1 
ATOM   9770  O  O   . LYS F  3 80  ? 168.534 165.618 146.040 1.00 86.36  ?  108 LYS F O   1 
ATOM   9771  C  CB  . LYS F  3 80  ? 170.670 167.669 147.404 1.00 86.36  ?  108 LYS F CB  1 
ATOM   9772  C  CG  . LYS F  3 80  ? 170.472 166.676 148.526 1.00 86.36  ?  108 LYS F CG  1 
ATOM   9773  C  CD  . LYS F  3 80  ? 170.732 167.328 149.875 1.00 86.36  ?  108 LYS F CD  1 
ATOM   9774  C  CE  . LYS F  3 80  ? 172.157 167.094 150.351 1.00 86.36  ?  108 LYS F CE  1 
ATOM   9775  N  NZ  . LYS F  3 80  ? 173.141 167.986 149.674 1.00 86.36  1  108 LYS F NZ  1 
ATOM   9776  N  N   . LEU F  3 81  ? 168.068 167.767 145.557 1.00 86.57  ?  109 LEU F N   1 
ATOM   9777  C  CA  . LEU F  3 81  ? 166.645 167.509 145.379 1.00 86.57  ?  109 LEU F CA  1 
ATOM   9778  C  C   . LEU F  3 81  ? 166.358 166.831 144.042 1.00 86.57  ?  109 LEU F C   1 
ATOM   9779  O  O   . LEU F  3 81  ? 165.487 165.959 143.959 1.00 86.57  ?  109 LEU F O   1 
ATOM   9780  C  CB  . LEU F  3 81  ? 165.854 168.813 145.495 1.00 86.57  ?  109 LEU F CB  1 
ATOM   9781  C  CG  . LEU F  3 81  ? 165.758 169.440 146.882 1.00 86.57  ?  109 LEU F CG  1 
ATOM   9782  C  CD1 . LEU F  3 81  ? 165.115 170.811 146.810 1.00 86.57  ?  109 LEU F CD1 1 
ATOM   9783  C  CD2 . LEU F  3 81  ? 164.951 168.531 147.769 1.00 86.57  ?  109 LEU F CD2 1 
ATOM   9784  N  N   . SER F  3 82  ? 167.082 167.213 142.987 1.00 91.28  ?  110 SER F N   1 
ATOM   9785  C  CA  . SER F  3 82  ? 166.765 166.723 141.652 1.00 91.28  ?  110 SER F CA  1 
ATOM   9786  C  C   . SER F  3 82  ? 167.123 165.255 141.445 1.00 91.28  ?  110 SER F C   1 
ATOM   9787  O  O   . SER F  3 82  ? 166.586 164.637 140.520 1.00 91.28  ?  110 SER F O   1 
ATOM   9788  C  CB  . SER F  3 82  ? 167.470 167.584 140.604 1.00 91.28  ?  110 SER F CB  1 
ATOM   9789  O  OG  . SER F  3 82  ? 167.151 167.148 139.296 1.00 91.28  ?  110 SER F OG  1 
ATOM   9790  N  N   . VAL F  3 83  ? 168.010 164.687 142.270 1.00 94.31  ?  111 VAL F N   1 
ATOM   9791  C  CA  . VAL F  3 83  ? 168.274 163.248 142.228 1.00 94.31  ?  111 VAL F CA  1 
ATOM   9792  C  C   . VAL F  3 83  ? 167.073 162.432 142.676 1.00 94.31  ?  111 VAL F C   1 
ATOM   9793  O  O   . VAL F  3 83  ? 166.709 161.457 142.005 1.00 94.31  ?  111 VAL F O   1 
ATOM   9794  C  CB  . VAL F  3 83  ? 169.514 162.916 143.084 1.00 94.31  ?  111 VAL F CB  1 
ATOM   9795  C  CG1 . VAL F  3 83  ? 169.714 161.413 143.220 1.00 94.31  ?  111 VAL F CG1 1 
ATOM   9796  C  CG2 . VAL F  3 83  ? 170.756 163.535 142.471 1.00 94.31  ?  111 VAL F CG2 1 
ATOM   9797  N  N   . ARG F  3 84  ? 166.407 162.840 143.754 1.00 91.94  ?  112 ARG F N   1 
ATOM   9798  C  CA  . ARG F  3 84  ? 165.223 162.172 144.282 1.00 91.94  ?  112 ARG F CA  1 
ATOM   9799  C  C   . ARG F  3 84  ? 164.015 162.289 143.349 1.00 91.94  ?  112 ARG F C   1 
ATOM   9800  O  O   . ARG F  3 84  ? 163.078 161.489 143.453 1.00 91.94  ?  112 ARG F O   1 
ATOM   9801  C  CB  . ARG F  3 84  ? 164.917 162.747 145.678 1.00 91.94  ?  112 ARG F CB  1 
ATOM   9802  C  CG  . ARG F  3 84  ? 163.788 162.107 146.482 1.00 91.94  ?  112 ARG F CG  1 
ATOM   9803  C  CD  . ARG F  3 84  ? 164.065 160.664 146.855 1.00 91.94  ?  112 ARG F CD  1 
ATOM   9804  N  NE  . ARG F  3 84  ? 162.971 160.127 147.660 1.00 91.94  ?  112 ARG F NE  1 
ATOM   9805  C  CZ  . ARG F  3 84  ? 162.826 158.846 147.984 1.00 91.94  ?  112 ARG F CZ  1 
ATOM   9806  N  NH1 . ARG F  3 84  ? 161.794 158.462 148.721 1.00 91.94  1  112 ARG F NH1 1 
ATOM   9807  N  NH2 . ARG F  3 84  ? 163.709 157.950 147.568 1.00 91.94  ?  112 ARG F NH2 1 
ATOM   9808  N  N   . ASN F  3 85  ? 164.067 163.188 142.364 1.00 93.63  ?  113 ASN F N   1 
ATOM   9809  C  CA  . ASN F  3 85  ? 162.975 163.504 141.446 1.00 93.63  ?  113 ASN F CA  1 
ATOM   9810  C  C   . ASN F  3 85  ? 162.736 162.415 140.382 1.00 93.63  ?  113 ASN F C   1 
ATOM   9811  O  O   . ASN F  3 85  ? 161.992 162.671 139.426 1.00 93.63  ?  113 ASN F O   1 
ATOM   9812  C  CB  . ASN F  3 85  ? 163.276 164.848 140.769 1.00 93.63  ?  113 ASN F CB  1 
ATOM   9813  C  CG  . ASN F  3 85  ? 162.032 165.550 140.254 1.00 93.63  ?  113 ASN F CG  1 
ATOM   9814  O  OD1 . ASN F  3 85  ? 160.910 165.113 140.506 1.00 93.63  ?  113 ASN F OD1 1 
ATOM   9815  N  ND2 . ASN F  3 85  ? 162.232 166.607 139.480 1.00 93.63  ?  113 ASN F ND2 1 
ATOM   9816  N  N   . HIS F  3 86  ? 163.358 161.237 140.527 1.00 95.63  ?  114 HIS F N   1 
ATOM   9817  C  CA  . HIS F  3 86  ? 163.179 160.076 139.641 1.00 95.63  ?  114 HIS F CA  1 
ATOM   9818  C  C   . HIS F  3 86  ? 163.575 160.400 138.202 1.00 95.63  ?  114 HIS F C   1 
ATOM   9819  O  O   . HIS F  3 86  ? 162.915 159.990 137.245 1.00 95.63  ?  114 HIS F O   1 
ATOM   9820  C  CB  . HIS F  3 86  ? 161.748 159.528 139.704 1.00 95.63  ?  114 HIS F CB  1 
ATOM   9821  C  CG  . HIS F  3 86  ? 161.360 158.996 141.047 1.00 95.63  ?  114 HIS F CG  1 
ATOM   9822  N  ND1 . HIS F  3 86  ? 161.810 157.785 141.526 1.00 95.63  ?  114 HIS F ND1 1 
ATOM   9823  C  CD2 . HIS F  3 86  ? 160.556 159.505 142.010 1.00 95.63  ?  114 HIS F CD2 1 
ATOM   9824  C  CE1 . HIS F  3 86  ? 161.305 157.572 142.726 1.00 95.63  ?  114 HIS F CE1 1 
ATOM   9825  N  NE2 . HIS F  3 86  ? 160.540 158.600 143.044 1.00 95.63  ?  114 HIS F NE2 1 
ATOM   9826  N  N   . GLY F  3 87  ? 164.659 161.151 138.052 1.00 95.42  ?  115 GLY F N   1 
ATOM   9827  C  CA  . GLY F  3 87  ? 165.149 161.507 136.731 1.00 95.42  ?  115 GLY F CA  1 
ATOM   9828  C  C   . GLY F  3 87  ? 164.291 162.508 135.991 1.00 95.42  ?  115 GLY F C   1 
ATOM   9829  O  O   . GLY F  3 87  ? 164.214 162.462 134.757 1.00 95.42  ?  115 GLY F O   1 
ATOM   9830  N  N   . PHE F  3 88  ? 163.636 163.412 136.713 1.00 89.41  ?  116 PHE F N   1 
ATOM   9831  C  CA  . PHE F  3 88  ? 162.854 164.456 136.084 1.00 89.41  ?  116 PHE F CA  1 
ATOM   9832  C  C   . PHE F  3 88  ? 163.389 165.821 136.491 1.00 89.41  ?  116 PHE F C   1 
ATOM   9833  O  O   . PHE F  3 88  ? 163.848 165.998 137.623 1.00 89.41  ?  116 PHE F O   1 
ATOM   9834  C  CB  . PHE F  3 88  ? 161.372 164.351 136.467 1.00 89.41  ?  116 PHE F CB  1 
ATOM   9835  C  CG  . PHE F  3 88  ? 160.686 163.152 135.887 1.00 89.41  ?  116 PHE F CG  1 
ATOM   9836  C  CD1 . PHE F  3 88  ? 160.254 163.157 134.570 1.00 89.41  ?  116 PHE F CD1 1 
ATOM   9837  C  CD2 . PHE F  3 88  ? 160.467 162.021 136.657 1.00 89.41  ?  116 PHE F CD2 1 
ATOM   9838  C  CE1 . PHE F  3 88  ? 159.617 162.054 134.029 1.00 89.41  ?  116 PHE F CE1 1 
ATOM   9839  C  CE2 . PHE F  3 88  ? 159.832 160.913 136.124 1.00 89.41  ?  116 PHE F CE2 1 
ATOM   9840  C  CZ  . PHE F  3 88  ? 159.405 160.931 134.809 1.00 89.41  ?  116 PHE F CZ  1 
ATOM   9841  N  N   . PRO F  3 89  ? 163.372 166.796 135.582 1.00 86.11  ?  117 PRO F N   1 
ATOM   9842  C  CA  . PRO F  3 89  ? 163.792 168.150 135.954 1.00 86.11  ?  117 PRO F CA  1 
ATOM   9843  C  C   . PRO F  3 89  ? 162.795 168.786 136.910 1.00 86.11  ?  117 PRO F C   1 
ATOM   9844  O  O   . PRO F  3 89  ? 161.579 168.667 136.749 1.00 86.11  ?  117 PRO F O   1 
ATOM   9845  C  CB  . PRO F  3 89  ? 163.846 168.889 134.613 1.00 86.11  ?  117 PRO F CB  1 
ATOM   9846  C  CG  . PRO F  3 89  ? 162.923 168.131 133.728 1.00 86.11  ?  117 PRO F CG  1 
ATOM   9847  C  CD  . PRO F  3 89  ? 163.033 166.698 134.151 1.00 86.11  ?  117 PRO F CD  1 
ATOM   9848  N  N   . LEU F  3 90  ? 163.330 169.463 137.921 1.00 79.89  ?  118 LEU F N   1 
ATOM   9849  C  CA  . LEU F  3 90  ? 162.548 169.932 139.057 1.00 79.89  ?  118 LEU F CA  1 
ATOM   9850  C  C   . LEU F  3 90  ? 162.149 171.389 138.849 1.00 79.89  ?  118 LEU F C   1 
ATOM   9851  O  O   . LEU F  3 90  ? 162.870 172.322 139.205 1.00 79.89  ?  118 LEU F O   1 
ATOM   9852  C  CB  . LEU F  3 90  ? 163.340 169.744 140.345 1.00 79.89  ?  118 LEU F CB  1 
ATOM   9853  C  CG  . LEU F  3 90  ? 162.582 170.014 141.638 1.00 79.89  ?  118 LEU F CG  1 
ATOM   9854  C  CD1 . LEU F  3 90  ? 161.440 169.032 141.773 1.00 79.89  ?  118 LEU F CD1 1 
ATOM   9855  C  CD2 . LEU F  3 90  ? 163.513 169.896 142.818 1.00 79.89  ?  118 LEU F CD2 1 
ATOM   9856  N  N   . LEU F  3 91  ? 160.973 171.576 138.258 1.00 69.23  ?  119 LEU F N   1 
ATOM   9857  C  CA  . LEU F  3 91  ? 160.376 172.891 138.102 1.00 69.23  ?  119 LEU F CA  1 
ATOM   9858  C  C   . LEU F  3 91  ? 159.203 173.113 139.047 1.00 69.23  ?  119 LEU F C   1 
ATOM   9859  O  O   . LEU F  3 91  ? 158.480 174.102 138.897 1.00 69.23  ?  119 LEU F O   1 
ATOM   9860  C  CB  . LEU F  3 91  ? 159.921 173.097 136.658 1.00 69.23  ?  119 LEU F CB  1 
ATOM   9861  C  CG  . LEU F  3 91  ? 161.018 173.198 135.603 1.00 69.23  ?  119 LEU F CG  1 
ATOM   9862  C  CD1 . LEU F  3 91  ? 160.417 173.260 134.210 1.00 69.23  ?  119 LEU F CD1 1 
ATOM   9863  C  CD2 . LEU F  3 91  ? 161.876 174.420 135.874 1.00 69.23  ?  119 LEU F CD2 1 
ATOM   9864  N  N   . THR F  3 92  ? 158.991 172.215 140.009 1.00 62.50  ?  120 THR F N   1 
ATOM   9865  C  CA  . THR F  3 92  ? 157.851 172.313 140.917 1.00 62.50  ?  120 THR F CA  1 
ATOM   9866  C  C   . THR F  3 92  ? 158.171 171.600 142.218 1.00 62.50  ?  120 THR F C   1 
ATOM   9867  O  O   . THR F  3 92  ? 158.418 170.391 142.217 1.00 62.50  ?  120 THR F O   1 
ATOM   9868  C  CB  . THR F  3 92  ? 156.590 171.707 140.296 1.00 62.50  ?  120 THR F CB  1 
ATOM   9869  O  OG1 . THR F  3 92  ? 156.182 172.478 139.159 1.00 62.50  ?  120 THR F OG1 1 
ATOM   9870  C  CG2 . THR F  3 92  ? 155.464 171.667 141.310 1.00 62.50  ?  120 THR F CG2 1 
ATOM   9871  N  N   . VAL F  3 93  ? 158.166 172.339 143.323 1.00 58.21  ?  121 VAL F N   1 
ATOM   9872  C  CA  . VAL F  3 93  ? 158.079 171.740 144.646 1.00 58.21  ?  121 VAL F CA  1 
ATOM   9873  C  C   . VAL F  3 93  ? 156.893 172.386 145.338 1.00 58.21  ?  121 VAL F C   1 
ATOM   9874  O  O   . VAL F  3 93  ? 156.364 173.394 144.872 1.00 58.21  ?  121 VAL F O   1 
ATOM   9875  C  CB  . VAL F  3 93  ? 159.361 171.923 145.482 1.00 58.21  ?  121 VAL F CB  1 
ATOM   9876  C  CG1 . VAL F  3 93  ? 160.526 171.217 144.822 1.00 58.21  ?  121 VAL F CG1 1 
ATOM   9877  C  CG2 . VAL F  3 93  ? 159.663 173.394 145.672 1.00 58.21  ?  121 VAL F CG2 1 
ATOM   9878  N  N   . TYR F  3 94  ? 156.460 171.799 146.454 1.00 55.91  ?  122 TYR F N   1 
ATOM   9879  C  CA  . TYR F  3 94  ? 155.405 172.458 147.208 1.00 55.91  ?  122 TYR F CA  1 
ATOM   9880  C  C   . TYR F  3 94  ? 155.451 172.117 148.682 1.00 55.91  ?  122 TYR F C   1 
ATOM   9881  O  O   . TYR F  3 94  ? 156.058 171.134 149.108 1.00 55.91  ?  122 TYR F O   1 
ATOM   9882  C  CB  . TYR F  3 94  ? 154.009 172.143 146.677 1.00 55.91  ?  122 TYR F CB  1 
ATOM   9883  C  CG  . TYR F  3 94  ? 153.484 170.736 146.755 1.00 55.91  ?  122 TYR F CG  1 
ATOM   9884  C  CD1 . TYR F  3 94  ? 153.673 169.850 145.707 1.00 55.91  ?  122 TYR F CD1 1 
ATOM   9885  C  CD2 . TYR F  3 94  ? 152.714 170.321 147.835 1.00 55.91  ?  122 TYR F CD2 1 
ATOM   9886  C  CE1 . TYR F  3 94  ? 153.158 168.574 145.757 1.00 55.91  ?  122 TYR F CE1 1 
ATOM   9887  C  CE2 . TYR F  3 94  ? 152.196 169.049 147.893 1.00 55.91  ?  122 TYR F CE2 1 
ATOM   9888  C  CZ  . TYR F  3 94  ? 152.422 168.181 146.853 1.00 55.91  ?  122 TYR F CZ  1 
ATOM   9889  O  OH  . TYR F  3 94  ? 151.909 166.910 146.911 1.00 55.91  ?  122 TYR F OH  1 
ATOM   9890  N  N   . LEU F  3 95  ? 154.759 172.952 149.444 1.00 52.65  ?  123 LEU F N   1 
ATOM   9891  C  CA  . LEU F  3 95  ? 154.557 172.787 150.868 1.00 52.65  ?  123 LEU F CA  1 
ATOM   9892  C  C   . LEU F  3 95  ? 153.086 172.533 151.138 1.00 52.65  ?  123 LEU F C   1 
ATOM   9893  O  O   . LEU F  3 95  ? 152.225 172.814 150.305 1.00 52.65  ?  123 LEU F O   1 
ATOM   9894  C  CB  . LEU F  3 95  ? 154.980 174.034 151.641 1.00 52.65  ?  123 LEU F CB  1 
ATOM   9895  C  CG  . LEU F  3 95  ? 156.450 174.383 151.739 1.00 52.65  ?  123 LEU F CG  1 
ATOM   9896  C  CD1 . LEU F  3 95  ? 156.574 175.783 152.264 1.00 52.65  ?  123 LEU F CD1 1 
ATOM   9897  C  CD2 . LEU F  3 95  ? 157.088 173.425 152.700 1.00 52.65  ?  123 LEU F CD2 1 
ATOM   9898  N  N   . LYS F  3 96  ? 152.808 172.026 152.328 1.00 58.40  ?  124 LYS F N   1 
ATOM   9899  C  CA  . LYS F  3 96  ? 151.475 172.063 152.903 1.00 58.40  ?  124 LYS F CA  1 
ATOM   9900  C  C   . LYS F  3 96  ? 151.461 173.171 153.941 1.00 58.40  ?  124 LYS F C   1 
ATOM   9901  O  O   . LYS F  3 96  ? 152.449 173.359 154.657 1.00 58.40  ?  124 LYS F O   1 
ATOM   9902  C  CB  . LYS F  3 96  ? 151.105 170.725 153.540 1.00 58.40  ?  124 LYS F CB  1 
ATOM   9903  C  CG  . LYS F  3 96  ? 150.869 169.605 152.547 1.00 58.40  ?  124 LYS F CG  1 
ATOM   9904  C  CD  . LYS F  3 96  ? 150.431 168.335 153.259 1.00 58.40  ?  124 LYS F CD  1 
ATOM   9905  C  CE  . LYS F  3 96  ? 150.115 167.224 152.270 1.00 58.40  ?  124 LYS F CE  1 
ATOM   9906  N  NZ  . LYS F  3 96  ? 149.664 165.978 152.947 1.00 58.40  1  124 LYS F NZ  1 
ATOM   9907  N  N   . VAL F  3 97  ? 150.359 173.910 154.020 1.00 56.27  ?  125 VAL F N   1 
ATOM   9908  C  CA  . VAL F  3 97  ? 150.152 174.899 155.063 1.00 56.27  ?  125 VAL F CA  1 
ATOM   9909  C  C   . VAL F  3 97  ? 148.851 174.538 155.748 1.00 56.27  ?  125 VAL F C   1 
ATOM   9910  O  O   . VAL F  3 97  ? 147.798 174.471 155.103 1.00 56.27  ?  125 VAL F O   1 
ATOM   9911  C  CB  . VAL F  3 97  ? 150.095 176.328 154.517 1.00 56.27  ?  125 VAL F CB  1 
ATOM   9912  C  CG1 . VAL F  3 97  ? 149.751 177.292 155.637 1.00 56.27  ?  125 VAL F CG1 1 
ATOM   9913  C  CG2 . VAL F  3 97  ? 151.407 176.703 153.889 1.00 56.27  ?  125 VAL F CG2 1 
ATOM   9914  N  N   . PHE F  3 98  ? 148.917 174.293 157.042 1.00 55.76  ?  126 PHE F N   1 
ATOM   9915  C  CA  . PHE F  3 98  ? 147.708 174.019 157.790 1.00 55.76  ?  126 PHE F CA  1 
ATOM   9916  C  C   . PHE F  3 98  ? 147.298 175.297 158.508 1.00 55.76  ?  126 PHE F C   1 
ATOM   9917  O  O   . PHE F  3 98  ? 148.024 176.292 158.508 1.00 55.76  ?  126 PHE F O   1 
ATOM   9918  C  CB  . PHE F  3 98  ? 147.934 172.874 158.778 1.00 55.76  ?  126 PHE F CB  1 
ATOM   9919  C  CG  . PHE F  3 98  ? 148.275 171.548 158.131 1.00 55.76  ?  126 PHE F CG  1 
ATOM   9920  C  CD1 . PHE F  3 98  ? 147.999 171.289 156.793 1.00 55.76  ?  126 PHE F CD1 1 
ATOM   9921  C  CD2 . PHE F  3 98  ? 148.892 170.560 158.875 1.00 55.76  ?  126 PHE F CD2 1 
ATOM   9922  C  CE1 . PHE F  3 98  ? 148.330 170.076 156.223 1.00 55.76  ?  126 PHE F CE1 1 
ATOM   9923  C  CE2 . PHE F  3 98  ? 149.223 169.346 158.311 1.00 55.76  ?  126 PHE F CE2 1 
ATOM   9924  C  CZ  . PHE F  3 98  ? 148.940 169.105 156.982 1.00 55.76  ?  126 PHE F CZ  1 
ATOM   9925  N  N   . LEU F  3 99  ? 146.119 175.281 159.115 1.00 56.01  ?  127 LEU F N   1 
ATOM   9926  C  CA  . LEU F  3 99  ? 145.746 176.376 159.993 1.00 56.01  ?  127 LEU F CA  1 
ATOM   9927  C  C   . LEU F  3 99  ? 145.101 175.911 161.285 1.00 56.01  ?  127 LEU F C   1 
ATOM   9928  O  O   . LEU F  3 99  ? 144.955 176.722 162.204 1.00 56.01  ?  127 LEU F O   1 
ATOM   9929  C  CB  . LEU F  3 99  ? 144.808 177.358 159.278 1.00 56.01  ?  127 LEU F CB  1 
ATOM   9930  C  CG  . LEU F  3 99  ? 143.299 177.144 159.253 1.00 56.01  ?  127 LEU F CG  1 
ATOM   9931  C  CD1 . LEU F  3 99  ? 142.668 178.418 158.753 1.00 56.01  ?  127 LEU F CD1 1 
ATOM   9932  C  CD2 . LEU F  3 99  ? 142.865 175.980 158.397 1.00 56.01  ?  127 LEU F CD2 1 
ATOM   9933  N  N   . SER F  3 100 ? 144.711 174.645 161.383 1.00 58.49  ?  128 SER F N   1 
ATOM   9934  C  CA  . SER F  3 100 ? 144.268 174.048 162.633 1.00 58.49  ?  128 SER F CA  1 
ATOM   9935  C  C   . SER F  3 100 ? 145.055 172.764 162.852 1.00 58.49  ?  128 SER F C   1 
ATOM   9936  O  O   . SER F  3 100 ? 144.878 171.799 162.088 1.00 58.49  ?  128 SER F O   1 
ATOM   9937  C  CB  . SER F  3 100 ? 142.765 173.763 162.612 1.00 58.49  ?  128 SER F CB  1 
ATOM   9938  O  OG  . SER F  3 100 ? 142.022 174.968 162.541 1.00 58.49  ?  128 SER F OG  1 
ATOM   9939  N  N   . PRO F  3 101 ? 145.943 172.699 163.856 1.00 63.91  ?  129 PRO F N   1 
ATOM   9940  C  CA  . PRO F  3 101 ? 146.754 171.504 164.101 1.00 63.91  ?  129 PRO F CA  1 
ATOM   9941  C  C   . PRO F  3 101 ? 145.932 170.331 164.625 1.00 63.91  ?  129 PRO F C   1 
ATOM   9942  O  O   . PRO F  3 101 ? 145.500 169.509 163.817 1.00 63.91  ?  129 PRO F O   1 
ATOM   9943  C  CB  . PRO F  3 101 ? 147.763 171.978 165.152 1.00 63.91  ?  129 PRO F CB  1 
ATOM   9944  C  CG  . PRO F  3 101 ? 147.083 173.100 165.848 1.00 63.91  ?  129 PRO F CG  1 
ATOM   9945  C  CD  . PRO F  3 101 ? 146.256 173.783 164.804 1.00 63.91  ?  129 PRO F CD  1 
ATOM   9946  N  N   . GLY F  3 107 ? 148.269 164.536 156.964 1.00 71.96  ?  135 GLY F N   1 
ATOM   9947  C  CA  . GLY F  3 107 ? 147.436 163.617 156.212 1.00 71.96  ?  135 GLY F CA  1 
ATOM   9948  C  C   . GLY F  3 107 ? 147.471 163.888 154.723 1.00 71.96  ?  135 GLY F C   1 
ATOM   9949  O  O   . GLY F  3 107 ? 148.523 163.794 154.094 1.00 71.96  ?  135 GLY F O   1 
ATOM   9950  N  N   . GLU F  3 108 ? 146.316 164.226 154.155 1.00 76.07  ?  136 GLU F N   1 
ATOM   9951  C  CA  . GLU F  3 108 ? 146.213 164.596 152.749 1.00 76.07  ?  136 GLU F CA  1 
ATOM   9952  C  C   . GLU F  3 108 ? 145.615 165.990 152.657 1.00 76.07  ?  136 GLU F C   1 
ATOM   9953  O  O   . GLU F  3 108 ? 144.619 166.289 153.321 1.00 76.07  ?  136 GLU F O   1 
ATOM   9954  C  CB  . GLU F  3 108 ? 145.365 163.595 151.962 1.00 76.07  ?  136 GLU F CB  1 
ATOM   9955  C  CG  . GLU F  3 108 ? 145.312 163.877 150.473 1.00 76.07  ?  136 GLU F CG  1 
ATOM   9956  C  CD  . GLU F  3 108 ? 144.543 162.824 149.714 1.00 76.07  ?  136 GLU F CD  1 
ATOM   9957  O  OE1 . GLU F  3 108 ? 144.041 161.881 150.360 1.00 76.07  ?  136 GLU F OE1 1 
ATOM   9958  O  OE2 . GLU F  3 108 ? 144.438 162.937 148.476 1.00 76.07  -1 136 GLU F OE2 1 
ATOM   9959  N  N   . CYS F  3 109 ? 146.225 166.837 151.832 1.00 69.07  ?  137 CYS F N   1 
ATOM   9960  C  CA  . CYS F  3 109 ? 145.878 168.252 151.788 1.00 69.07  ?  137 CYS F CA  1 
ATOM   9961  C  C   . CYS F  3 109 ? 144.632 168.461 150.938 1.00 69.07  ?  137 CYS F C   1 
ATOM   9962  O  O   . CYS F  3 109 ? 144.650 168.216 149.728 1.00 69.07  ?  137 CYS F O   1 
ATOM   9963  C  CB  . CYS F  3 109 ? 147.052 169.056 151.240 1.00 69.07  ?  137 CYS F CB  1 
ATOM   9964  S  SG  . CYS F  3 109 ? 146.815 170.843 151.239 1.00 69.07  ?  137 CYS F SG  1 
ATOM   9965  N  N   . GLN F  3 110 ? 143.548 168.912 151.568 1.00 62.95  ?  138 GLN F N   1 
ATOM   9966  C  CA  . GLN F  3 110 ? 142.343 169.321 150.862 1.00 62.95  ?  138 GLN F CA  1 
ATOM   9967  C  C   . GLN F  3 110 ? 141.776 170.576 151.504 1.00 62.95  ?  138 GLN F C   1 
ATOM   9968  O  O   . GLN F  3 110 ? 141.949 170.810 152.703 1.00 62.95  ?  138 GLN F O   1 
ATOM   9969  C  CB  . GLN F  3 110 ? 141.263 168.230 150.852 1.00 62.95  ?  138 GLN F CB  1 
ATOM   9970  C  CG  . GLN F  3 110 ? 141.552 167.047 149.942 1.00 62.95  ?  138 GLN F CG  1 
ATOM   9971  C  CD  . GLN F  3 110 ? 140.426 166.033 149.932 1.00 62.95  ?  138 GLN F CD  1 
ATOM   9972  O  OE1 . GLN F  3 110 ? 139.441 166.173 150.656 1.00 62.95  ?  138 GLN F OE1 1 
ATOM   9973  N  NE2 . GLN F  3 110 ? 140.565 165.005 149.105 1.00 62.95  ?  138 GLN F NE2 1 
ATOM   9974  N  N   . TRP F  3 111 ? 141.111 171.385 150.683 1.00 52.87  ?  139 TRP F N   1 
ATOM   9975  C  CA  . TRP F  3 111 ? 140.325 172.501 151.187 1.00 52.87  ?  139 TRP F CA  1 
ATOM   9976  C  C   . TRP F  3 111 ? 139.179 171.954 152.035 1.00 52.87  ?  139 TRP F C   1 
ATOM   9977  O  O   . TRP F  3 111 ? 138.604 170.915 151.692 1.00 52.87  ?  139 TRP F O   1 
ATOM   9978  C  CB  . TRP F  3 111 ? 139.769 173.313 150.011 1.00 52.87  ?  139 TRP F CB  1 
ATOM   9979  C  CG  . TRP F  3 111 ? 139.028 174.540 150.407 1.00 52.87  ?  139 TRP F CG  1 
ATOM   9980  C  CD1 . TRP F  3 111 ? 139.560 175.724 150.822 1.00 52.87  ?  139 TRP F CD1 1 
ATOM   9981  C  CD2 . TRP F  3 111 ? 137.614 174.678 150.523 1.00 52.87  ?  139 TRP F CD2 1 
ATOM   9982  N  NE1 . TRP F  3 111 ? 138.562 176.605 151.143 1.00 52.87  ?  139 TRP F NE1 1 
ATOM   9983  C  CE2 . TRP F  3 111 ? 137.356 175.980 150.984 1.00 52.87  ?  139 TRP F CE2 1 
ATOM   9984  C  CE3 . TRP F  3 111 ? 136.537 173.827 150.271 1.00 52.87  ?  139 TRP F CE3 1 
ATOM   9985  C  CZ2 . TRP F  3 111 ? 136.069 176.461 151.174 1.00 52.87  ?  139 TRP F CZ2 1 
ATOM   9986  C  CZ3 . TRP F  3 111 ? 135.260 174.301 150.469 1.00 52.87  ?  139 TRP F CZ3 1 
ATOM   9987  C  CH2 . TRP F  3 111 ? 135.036 175.607 150.917 1.00 52.87  ?  139 TRP F CH2 1 
ATOM   9988  N  N   . PRO F  3 112 ? 138.809 172.614 153.145 1.00 50.01  ?  140 PRO F N   1 
ATOM   9989  C  CA  . PRO F  3 112 ? 139.240 173.869 153.765 1.00 50.01  ?  140 PRO F CA  1 
ATOM   9990  C  C   . PRO F  3 112 ? 140.325 173.746 154.814 1.00 50.01  ?  140 PRO F C   1 
ATOM   9991  O  O   . PRO F  3 112 ? 140.765 174.763 155.344 1.00 50.01  ?  140 PRO F O   1 
ATOM   9992  C  CB  . PRO F  3 112 ? 137.959 174.367 154.422 1.00 50.01  ?  140 PRO F CB  1 
ATOM   9993  C  CG  . PRO F  3 112 ? 137.268 173.136 154.812 1.00 50.01  ?  140 PRO F CG  1 
ATOM   9994  C  CD  . PRO F  3 112 ? 137.559 172.128 153.751 1.00 50.01  ?  140 PRO F CD  1 
ATOM   9995  N  N   . GLY F  3 113 ? 140.751 172.528 155.125 1.00 56.07  ?  141 GLY F N   1 
ATOM   9996  C  CA  . GLY F  3 113 ? 141.697 172.347 156.206 1.00 56.07  ?  141 GLY F CA  1 
ATOM   9997  C  C   . GLY F  3 113 ? 143.107 172.739 155.830 1.00 56.07  ?  141 GLY F C   1 
ATOM   9998  O  O   . GLY F  3 113 ? 143.790 173.435 156.581 1.00 56.07  ?  141 GLY F O   1 
ATOM   9999  N  N   . CYS F  3 114 ? 143.552 172.305 154.661 1.00 58.72  ?  142 CYS F N   1 
ATOM   10000 C  CA  . CYS F  3 114 ? 144.918 172.520 154.227 1.00 58.72  ?  142 CYS F CA  1 
ATOM   10001 C  C   . CYS F  3 114 ? 144.966 173.367 152.967 1.00 58.72  ?  142 CYS F C   1 
ATOM   10002 O  O   . CYS F  3 114 ? 144.017 173.416 152.182 1.00 58.72  ?  142 CYS F O   1 
ATOM   10003 C  CB  . CYS F  3 114 ? 145.626 171.195 153.972 1.00 58.72  ?  142 CYS F CB  1 
ATOM   10004 S  SG  . CYS F  3 114 ? 147.208 171.387 153.155 1.00 58.72  ?  142 CYS F SG  1 
ATOM   10005 N  N   . ALA F  3 115 ? 146.104 174.028 152.785 1.00 52.37  ?  143 ALA F N   1 
ATOM   10006 C  CA  . ALA F  3 115 ? 146.362 174.852 151.617 1.00 52.37  ?  143 ALA F CA  1 
ATOM   10007 C  C   . ALA F  3 115 ? 147.789 174.589 151.183 1.00 52.37  ?  143 ALA F C   1 
ATOM   10008 O  O   . ALA F  3 115 ? 148.730 174.984 151.876 1.00 52.37  ?  143 ALA F O   1 
ATOM   10009 C  CB  . ALA F  3 115 ? 146.170 176.338 151.924 1.00 52.37  ?  143 ALA F CB  1 
ATOM   10010 N  N   . ARG F  3 116 ? 147.956 173.891 150.077 1.00 51.81  ?  144 ARG F N   1 
ATOM   10011 C  CA  . ARG F  3 116 ? 149.290 173.645 149.573 1.00 51.81  ?  144 ARG F CA  1 
ATOM   10012 C  C   . ARG F  3 116 ? 149.795 174.899 148.878 1.00 51.81  ?  144 ARG F C   1 
ATOM   10013 O  O   . ARG F  3 116 ? 149.013 175.673 148.330 1.00 51.81  ?  144 ARG F O   1 
ATOM   10014 C  CB  . ARG F  3 116 ? 149.295 172.441 148.636 1.00 51.81  ?  144 ARG F CB  1 
ATOM   10015 C  CG  . ARG F  3 116 ? 148.440 172.590 147.411 1.00 51.81  ?  144 ARG F CG  1 
ATOM   10016 C  CD  . ARG F  3 116 ? 148.474 171.322 146.608 1.00 51.81  ?  144 ARG F CD  1 
ATOM   10017 N  NE  . ARG F  3 116 ? 147.876 170.203 147.316 1.00 51.81  ?  144 ARG F NE  1 
ATOM   10018 C  CZ  . ARG F  3 116 ? 146.587 169.904 147.265 1.00 51.81  ?  144 ARG F CZ  1 
ATOM   10019 N  NH1 . ARG F  3 116 ? 145.762 170.640 146.533 1.00 51.81  1  144 ARG F NH1 1 
ATOM   10020 N  NH2 . ARG F  3 116 ? 146.124 168.861 147.938 1.00 51.81  ?  144 ARG F NH2 1 
ATOM   10021 N  N   . VAL F  3 117 ? 151.099 175.126 148.953 1.00 46.51  ?  145 VAL F N   1 
ATOM   10022 C  CA  . VAL F  3 117 ? 151.734 176.311 148.385 1.00 46.51  ?  145 VAL F CA  1 
ATOM   10023 C  C   . VAL F  3 117 ? 152.824 175.857 147.435 1.00 46.51  ?  145 VAL F C   1 
ATOM   10024 O  O   . VAL F  3 117 ? 153.765 175.170 147.846 1.00 46.51  ?  145 VAL F O   1 
ATOM   10025 C  CB  . VAL F  3 117 ? 152.316 177.224 149.474 1.00 46.51  ?  145 VAL F CB  1 
ATOM   10026 C  CG1 . VAL F  3 117 ? 153.109 178.342 148.841 1.00 46.51  ?  145 VAL F CG1 1 
ATOM   10027 C  CG2 . VAL F  3 117 ? 151.214 177.785 150.332 1.00 46.51  ?  145 VAL F CG2 1 
ATOM   10028 N  N   . TYR F  3 118 ? 152.709 176.248 146.177 1.00 47.96  ?  146 TYR F N   1 
ATOM   10029 C  CA  . TYR F  3 118 ? 153.621 175.790 145.144 1.00 47.96  ?  146 TYR F CA  1 
ATOM   10030 C  C   . TYR F  3 118 ? 154.842 176.691 145.095 1.00 47.96  ?  146 TYR F C   1 
ATOM   10031 O  O   . TYR F  3 118 ? 154.818 177.815 145.601 1.00 47.96  ?  146 TYR F O   1 
ATOM   10032 C  CB  . TYR F  3 118 ? 152.931 175.781 143.783 1.00 47.96  ?  146 TYR F CB  1 
ATOM   10033 C  CG  . TYR F  3 118 ? 151.837 174.760 143.676 1.00 47.96  ?  146 TYR F CG  1 
ATOM   10034 C  CD1 . TYR F  3 118 ? 151.840 173.640 144.468 1.00 47.96  ?  146 TYR F CD1 1 
ATOM   10035 C  CD2 . TYR F  3 118 ? 150.773 174.954 142.836 1.00 47.96  ?  146 TYR F CD2 1 
ATOM   10036 C  CE1 . TYR F  3 118 ? 150.850 172.715 144.395 1.00 47.96  ?  146 TYR F CE1 1 
ATOM   10037 C  CE2 . TYR F  3 118 ? 149.762 174.033 142.751 1.00 47.96  ?  146 TYR F CE2 1 
ATOM   10038 C  CZ  . TYR F  3 118 ? 149.809 172.916 143.542 1.00 47.96  ?  146 TYR F CZ  1 
ATOM   10039 O  OH  . TYR F  3 118 ? 148.806 171.991 143.474 1.00 47.96  ?  146 TYR F OH  1 
ATOM   10040 N  N   . PHE F  3 119 ? 155.909 176.184 144.488 1.00 52.67  ?  147 PHE F N   1 
ATOM   10041 C  CA  . PHE F  3 119 ? 157.129 176.940 144.246 1.00 52.67  ?  147 PHE F CA  1 
ATOM   10042 C  C   . PHE F  3 119 ? 157.716 176.434 142.940 1.00 52.67  ?  147 PHE F C   1 
ATOM   10043 O  O   . PHE F  3 119 ? 158.168 175.284 142.861 1.00 52.67  ?  147 PHE F O   1 
ATOM   10044 C  CB  . PHE F  3 119 ? 158.126 176.788 145.390 1.00 52.67  ?  147 PHE F CB  1 
ATOM   10045 C  CG  . PHE F  3 119 ? 157.685 177.433 146.662 1.00 52.67  ?  147 PHE F CG  1 
ATOM   10046 C  CD1 . PHE F  3 119 ? 157.776 178.803 146.824 1.00 52.67  ?  147 PHE F CD1 1 
ATOM   10047 C  CD2 . PHE F  3 119 ? 157.173 176.673 147.696 1.00 52.67  ?  147 PHE F CD2 1 
ATOM   10048 C  CE1 . PHE F  3 119 ? 157.365 179.404 147.993 1.00 52.67  ?  147 PHE F CE1 1 
ATOM   10049 C  CE2 . PHE F  3 119 ? 156.760 177.269 148.869 1.00 52.67  ?  147 PHE F CE2 1 
ATOM   10050 C  CZ  . PHE F  3 119 ? 156.856 178.637 149.016 1.00 52.67  ?  147 PHE F CZ  1 
ATOM   10051 N  N   . SER F  3 120 ? 157.672 177.281 141.917 1.00 62.59  ?  148 SER F N   1 
ATOM   10052 C  CA  . SER F  3 120 ? 158.297 177.003 140.629 1.00 62.59  ?  148 SER F CA  1 
ATOM   10053 C  C   . SER F  3 120 ? 159.702 177.583 140.667 1.00 62.59  ?  148 SER F C   1 
ATOM   10054 O  O   . SER F  3 120 ? 159.890 178.799 140.590 1.00 62.59  ?  148 SER F O   1 
ATOM   10055 C  CB  . SER F  3 120 ? 157.476 177.591 139.488 1.00 62.59  ?  148 SER F CB  1 
ATOM   10056 O  OG  . SER F  3 120 ? 156.214 176.961 139.401 1.00 62.59  ?  148 SER F OG  1 
ATOM   10057 N  N   . PHE F  3 121 ? 160.693 176.710 140.785 1.00 74.08  ?  149 PHE F N   1 
ATOM   10058 C  CA  . PHE F  3 121 ? 162.072 177.131 140.955 1.00 74.08  ?  149 PHE F CA  1 
ATOM   10059 C  C   . PHE F  3 121 ? 162.771 177.295 139.613 1.00 74.08  ?  149 PHE F C   1 
ATOM   10060 O  O   . PHE F  3 121 ? 162.532 176.528 138.675 1.00 74.08  ?  149 PHE F O   1 
ATOM   10061 C  CB  . PHE F  3 121 ? 162.823 176.120 141.814 1.00 74.08  ?  149 PHE F CB  1 
ATOM   10062 C  CG  . PHE F  3 121 ? 164.259 176.461 142.024 1.00 74.08  ?  149 PHE F CG  1 
ATOM   10063 C  CD1 . PHE F  3 121 ? 164.615 177.522 142.838 1.00 74.08  ?  149 PHE F CD1 1 
ATOM   10064 C  CD2 . PHE F  3 121 ? 165.255 175.733 141.399 1.00 74.08  ?  149 PHE F CD2 1 
ATOM   10065 C  CE1 . PHE F  3 121 ? 165.941 177.840 143.039 1.00 74.08  ?  149 PHE F CE1 1 
ATOM   10066 C  CE2 . PHE F  3 121 ? 166.580 176.052 141.585 1.00 74.08  ?  149 PHE F CE2 1 
ATOM   10067 C  CZ  . PHE F  3 121 ? 166.921 177.102 142.413 1.00 74.08  ?  149 PHE F CZ  1 
ATOM   10068 N  N   . PHE F  3 122 ? 163.645 178.297 139.532 1.00 73.80  ?  150 PHE F N   1 
ATOM   10069 C  CA  . PHE F  3 122 ? 164.453 178.555 138.350 1.00 73.80  ?  150 PHE F CA  1 
ATOM   10070 C  C   . PHE F  3 122 ? 165.928 178.458 138.709 1.00 73.80  ?  150 PHE F C   1 
ATOM   10071 O  O   . PHE F  3 122 ? 166.332 178.848 139.809 1.00 73.80  ?  150 PHE F O   1 
ATOM   10072 C  CB  . PHE F  3 122 ? 164.135 179.926 137.762 1.00 73.80  ?  150 PHE F CB  1 
ATOM   10073 C  CG  . PHE F  3 122 ? 162.776 180.008 137.145 1.00 73.80  ?  150 PHE F CG  1 
ATOM   10074 C  CD1 . PHE F  3 122 ? 162.560 179.551 135.855 1.00 73.80  ?  150 PHE F CD1 1 
ATOM   10075 C  CD2 . PHE F  3 122 ? 161.708 180.521 137.860 1.00 73.80  ?  150 PHE F CD2 1 
ATOM   10076 C  CE1 . PHE F  3 122 ? 161.305 179.618 135.280 1.00 73.80  ?  150 PHE F CE1 1 
ATOM   10077 C  CE2 . PHE F  3 122 ? 160.449 180.591 137.295 1.00 73.80  ?  150 PHE F CE2 1 
ATOM   10078 C  CZ  . PHE F  3 122 ? 160.249 180.139 136.002 1.00 73.80  ?  150 PHE F CZ  1 
ATOM   10079 N  N   . ASN F  3 123 ? 166.730 177.958 137.766 1.00 79.03  ?  151 ASN F N   1 
ATOM   10080 C  CA  . ASN F  3 123 ? 168.133 177.652 138.015 1.00 79.03  ?  151 ASN F CA  1 
ATOM   10081 C  C   . ASN F  3 123 ? 169.033 178.879 137.878 1.00 79.03  ?  151 ASN F C   1 
ATOM   10082 O  O   . ASN F  3 123 ? 170.247 178.765 138.071 1.00 79.03  ?  151 ASN F O   1 
ATOM   10083 C  CB  . ASN F  3 123 ? 168.578 176.545 137.051 1.00 79.03  ?  151 ASN F CB  1 
ATOM   10084 C  CG  . ASN F  3 123 ? 169.784 175.767 137.551 1.00 79.03  ?  151 ASN F CG  1 
ATOM   10085 O  OD1 . ASN F  3 123 ? 170.272 175.995 138.658 1.00 79.03  ?  151 ASN F OD1 1 
ATOM   10086 N  ND2 . ASN F  3 123 ? 170.274 174.844 136.728 1.00 79.03  ?  151 ASN F ND2 1 
ATOM   10087 N  N   . THR F  3 124 ? 168.480 180.043 137.559 1.00 78.15  ?  152 THR F N   1 
ATOM   10088 C  CA  . THR F  3 124 ? 169.274 181.256 137.459 1.00 78.15  ?  152 THR F CA  1 
ATOM   10089 C  C   . THR F  3 124 ? 169.091 182.081 138.732 1.00 78.15  ?  152 THR F C   1 
ATOM   10090 O  O   . THR F  3 124 ? 168.271 181.758 139.595 1.00 78.15  ?  152 THR F O   1 
ATOM   10091 C  CB  . THR F  3 124 ? 168.876 182.056 136.223 1.00 78.15  ?  152 THR F CB  1 
ATOM   10092 O  OG1 . THR F  3 124 ? 167.552 182.576 136.396 1.00 78.15  ?  152 THR F OG1 1 
ATOM   10093 C  CG2 . THR F  3 124 ? 168.893 181.162 134.989 1.00 78.15  ?  152 THR F CG2 1 
ATOM   10094 N  N   . SER F  3 125 ? 169.855 183.158 138.863 1.00 79.35  ?  153 SER F N   1 
ATOM   10095 C  CA  . SER F  3 125 ? 169.638 184.107 139.942 1.00 79.35  ?  153 SER F CA  1 
ATOM   10096 C  C   . SER F  3 125 ? 168.500 185.052 139.576 1.00 79.35  ?  153 SER F C   1 
ATOM   10097 O  O   . SER F  3 125 ? 167.951 185.002 138.472 1.00 79.35  ?  153 SER F O   1 
ATOM   10098 C  CB  . SER F  3 125 ? 170.909 184.903 140.239 1.00 79.35  ?  153 SER F CB  1 
ATOM   10099 O  OG  . SER F  3 125 ? 171.933 184.059 140.734 1.00 79.35  ?  153 SER F OG  1 
ATOM   10100 N  N   . PHE F  3 126 ? 168.145 185.910 140.522 1.00 80.48  ?  154 PHE F N   1 
ATOM   10101 C  CA  . PHE F  3 126 ? 167.069 186.863 140.284 1.00 80.48  ?  154 PHE F CA  1 
ATOM   10102 C  C   . PHE F  3 126 ? 167.546 187.942 139.317 1.00 80.48  ?  154 PHE F C   1 
ATOM   10103 O  O   . PHE F  3 126 ? 168.609 188.534 139.535 1.00 80.48  ?  154 PHE F O   1 
ATOM   10104 C  CB  . PHE F  3 126 ? 166.606 187.493 141.590 1.00 80.48  ?  154 PHE F CB  1 
ATOM   10105 C  CG  . PHE F  3 126 ? 165.407 188.373 141.437 1.00 80.48  ?  154 PHE F CG  1 
ATOM   10106 C  CD1 . PHE F  3 126 ? 164.151 187.818 141.297 1.00 80.48  ?  154 PHE F CD1 1 
ATOM   10107 C  CD2 . PHE F  3 126 ? 165.535 189.751 141.415 1.00 80.48  ?  154 PHE F CD2 1 
ATOM   10108 C  CE1 . PHE F  3 126 ? 163.038 188.616 141.150 1.00 80.48  ?  154 PHE F CE1 1 
ATOM   10109 C  CE2 . PHE F  3 126 ? 164.426 190.558 141.267 1.00 80.48  ?  154 PHE F CE2 1 
ATOM   10110 C  CZ  . PHE F  3 126 ? 163.174 189.986 141.135 1.00 80.48  ?  154 PHE F CZ  1 
ATOM   10111 N  N   . PRO F  3 127 ? 166.797 188.227 138.250 1.00 87.73  ?  155 PRO F N   1 
ATOM   10112 C  CA  . PRO F  3 127 ? 167.294 189.150 137.219 1.00 87.73  ?  155 PRO F CA  1 
ATOM   10113 C  C   . PRO F  3 127 ? 167.251 190.613 137.633 1.00 87.73  ?  155 PRO F C   1 
ATOM   10114 O  O   . PRO F  3 127 ? 166.809 190.948 138.736 1.00 87.73  ?  155 PRO F O   1 
ATOM   10115 C  CB  . PRO F  3 127 ? 166.358 188.876 136.037 1.00 87.73  ?  155 PRO F CB  1 
ATOM   10116 C  CG  . PRO F  3 127 ? 165.094 188.409 136.666 1.00 87.73  ?  155 PRO F CG  1 
ATOM   10117 C  CD  . PRO F  3 127 ? 165.498 187.636 137.888 1.00 87.73  ?  155 PRO F CD  1 
ATOM   10118 N  N   . ALA F  3 128 ? 167.710 191.495 136.752 1.00 94.15  ?  156 ALA F N   1 
ATOM   10119 C  CA  . ALA F  3 128 ? 167.713 192.920 137.030 1.00 94.15  ?  156 ALA F CA  1 
ATOM   10120 C  C   . ALA F  3 128 ? 166.343 193.522 136.742 1.00 94.15  ?  156 ALA F C   1 
ATOM   10121 O  O   . ALA F  3 128 ? 165.506 192.933 136.055 1.00 94.15  ?  156 ALA F O   1 
ATOM   10122 C  CB  . ALA F  3 128 ? 168.792 193.627 136.209 1.00 94.15  ?  156 ALA F CB  1 
ATOM   10123 N  N   . CYS F  3 129 ? 166.121 194.724 137.282 1.00 101.42 ?  157 CYS F N   1 
ATOM   10124 C  CA  . CYS F  3 129 ? 164.822 195.376 137.170 1.00 101.42 ?  157 CYS F CA  1 
ATOM   10125 C  C   . CYS F  3 129 ? 164.533 195.852 135.754 1.00 101.42 ?  157 CYS F C   1 
ATOM   10126 O  O   . CYS F  3 129 ? 163.363 195.959 135.376 1.00 101.42 ?  157 CYS F O   1 
ATOM   10127 C  CB  . CYS F  3 129 ? 164.743 196.555 138.139 1.00 101.42 ?  157 CYS F CB  1 
ATOM   10128 S  SG  . CYS F  3 129 ? 164.928 196.111 139.889 1.00 101.42 ?  157 CYS F SG  1 
ATOM   10129 N  N   . SER F  3 130 ? 165.569 196.134 134.965 1.00 100.59 ?  158 SER F N   1 
ATOM   10130 C  CA  . SER F  3 130 ? 165.374 196.490 133.566 1.00 100.59 ?  158 SER F CA  1 
ATOM   10131 C  C   . SER F  3 130 ? 164.996 195.289 132.712 1.00 100.59 ?  158 SER F C   1 
ATOM   10132 O  O   . SER F  3 130 ? 164.452 195.469 131.617 1.00 100.59 ?  158 SER F O   1 
ATOM   10133 C  CB  . SER F  3 130 ? 166.637 197.144 133.005 1.00 100.59 ?  158 SER F CB  1 
ATOM   10134 O  OG  . SER F  3 130 ? 167.713 196.223 132.963 1.00 100.59 ?  158 SER F OG  1 
ATOM   10135 N  N   . SER F  3 131 ? 165.271 194.076 133.186 1.00 99.34  ?  159 SER F N   1 
ATOM   10136 C  CA  . SER F  3 131 ? 164.914 192.856 132.479 1.00 99.34  ?  159 SER F CA  1 
ATOM   10137 C  C   . SER F  3 131 ? 163.595 192.271 132.968 1.00 99.34  ?  159 SER F C   1 
ATOM   10138 O  O   . SER F  3 131 ? 163.376 191.060 132.848 1.00 99.34  ?  159 SER F O   1 
ATOM   10139 C  CB  . SER F  3 131 ? 166.036 191.828 132.613 1.00 99.34  ?  159 SER F CB  1 
ATOM   10140 O  OG  . SER F  3 131 ? 166.213 191.450 133.966 1.00 99.34  ?  159 SER F OG  1 
ATOM   10141 N  N   . LEU F  3 132 ? 162.713 193.104 133.517 1.00 94.53  ?  160 LEU F N   1 
ATOM   10142 C  CA  . LEU F  3 132 ? 161.405 192.666 133.993 1.00 94.53  ?  160 LEU F CA  1 
ATOM   10143 C  C   . LEU F  3 132 ? 160.334 193.529 133.342 1.00 94.53  ?  160 LEU F C   1 
ATOM   10144 O  O   . LEU F  3 132 ? 160.223 194.722 133.642 1.00 94.53  ?  160 LEU F O   1 
ATOM   10145 C  CB  . LEU F  3 132 ? 161.313 192.743 135.515 1.00 94.53  ?  160 LEU F CB  1 
ATOM   10146 C  CG  . LEU F  3 132 ? 162.220 191.782 136.281 1.00 94.53  ?  160 LEU F CG  1 
ATOM   10147 C  CD1 . LEU F  3 132 ? 162.114 192.025 137.778 1.00 94.53  ?  160 LEU F CD1 1 
ATOM   10148 C  CD2 . LEU F  3 132 ? 161.879 190.342 135.937 1.00 94.53  ?  160 LEU F CD2 1 
ATOM   10149 N  N   . LYS F  3 133 ? 159.567 192.923 132.439 1.00 92.29  ?  161 LYS F N   1 
ATOM   10150 C  CA  . LYS F  3 133 ? 158.395 193.559 131.863 1.00 92.29  ?  161 LYS F CA  1 
ATOM   10151 C  C   . LYS F  3 133 ? 157.353 193.786 132.962 1.00 92.29  ?  161 LYS F C   1 
ATOM   10152 O  O   . LYS F  3 133 ? 157.281 193.009 133.918 1.00 92.29  ?  161 LYS F O   1 
ATOM   10153 C  CB  . LYS F  3 133 ? 157.838 192.667 130.751 1.00 92.29  ?  161 LYS F CB  1 
ATOM   10154 C  CG  . LYS F  3 133 ? 156.740 193.248 129.877 1.00 92.29  ?  161 LYS F CG  1 
ATOM   10155 C  CD  . LYS F  3 133 ? 156.379 192.301 128.750 1.00 92.29  ?  161 LYS F CD  1 
ATOM   10156 C  CE  . LYS F  3 133 ? 155.283 192.878 127.874 1.00 92.29  ?  161 LYS F CE  1 
ATOM   10157 N  NZ  . LYS F  3 133 ? 154.919 191.955 126.762 1.00 92.29  1  161 LYS F NZ  1 
ATOM   10158 N  N   . PRO F  3 134 ? 156.561 194.865 132.873 1.00 91.58  ?  162 PRO F N   1 
ATOM   10159 C  CA  . PRO F  3 134 ? 155.522 195.103 133.897 1.00 91.58  ?  162 PRO F CA  1 
ATOM   10160 C  C   . PRO F  3 134 ? 154.444 194.029 134.000 1.00 91.58  ?  162 PRO F C   1 
ATOM   10161 O  O   . PRO F  3 134 ? 153.733 194.003 135.014 1.00 91.58  ?  162 PRO F O   1 
ATOM   10162 C  CB  . PRO F  3 134 ? 154.925 196.452 133.476 1.00 91.58  ?  162 PRO F CB  1 
ATOM   10163 C  CG  . PRO F  3 134 ? 156.046 197.145 132.822 1.00 91.58  ?  162 PRO F CG  1 
ATOM   10164 C  CD  . PRO F  3 134 ? 156.814 196.083 132.083 1.00 91.58  ?  162 PRO F CD  1 
ATOM   10165 N  N   . ARG F  3 135 ? 154.314 193.155 132.994 1.00 89.98  ?  163 ARG F N   1 
ATOM   10166 C  CA  . ARG F  3 135 ? 153.419 192.001 133.072 1.00 89.98  ?  163 ARG F CA  1 
ATOM   10167 C  C   . ARG F  3 135 ? 153.755 191.110 134.263 1.00 89.98  ?  163 ARG F C   1 
ATOM   10168 O  O   . ARG F  3 135 ? 152.859 190.590 134.936 1.00 89.98  ?  163 ARG F O   1 
ATOM   10169 C  CB  . ARG F  3 135 ? 153.502 191.208 131.768 1.00 89.98  ?  163 ARG F CB  1 
ATOM   10170 C  CG  . ARG F  3 135 ? 152.537 190.047 131.666 1.00 89.98  ?  163 ARG F CG  1 
ATOM   10171 C  CD  . ARG F  3 135 ? 152.683 189.345 130.329 1.00 89.98  ?  163 ARG F CD  1 
ATOM   10172 N  NE  . ARG F  3 135 ? 152.333 190.225 129.219 1.00 89.98  ?  163 ARG F NE  1 
ATOM   10173 C  CZ  . ARG F  3 135 ? 151.097 190.407 128.764 1.00 89.98  ?  163 ARG F CZ  1 
ATOM   10174 N  NH1 . ARG F  3 135 ? 150.080 189.761 129.318 1.00 89.98  1  163 ARG F NH1 1 
ATOM   10175 N  NH2 . ARG F  3 135 ? 150.878 191.232 127.751 1.00 89.98  ?  163 ARG F NH2 1 
ATOM   10176 N  N   . GLU F  3 136 ? 155.046 190.939 134.549 1.00 90.97  ?  164 GLU F N   1 
ATOM   10177 C  CA  . GLU F  3 136 ? 155.488 190.238 135.747 1.00 90.97  ?  164 GLU F CA  1 
ATOM   10178 C  C   . GLU F  3 136 ? 155.920 191.193 136.855 1.00 90.97  ?  164 GLU F C   1 
ATOM   10179 O  O   . GLU F  3 136 ? 156.662 190.798 137.759 1.00 90.97  ?  164 GLU F O   1 
ATOM   10180 C  CB  . GLU F  3 136 ? 156.614 189.254 135.415 1.00 90.97  ?  164 GLU F CB  1 
ATOM   10181 C  CG  . GLU F  3 136 ? 157.886 189.880 134.871 1.00 90.97  ?  164 GLU F CG  1 
ATOM   10182 C  CD  . GLU F  3 136 ? 157.907 189.931 133.358 1.00 90.97  ?  164 GLU F CD  1 
ATOM   10183 O  OE1 . GLU F  3 136 ? 156.850 189.681 132.738 1.00 90.97  ?  164 GLU F OE1 1 
ATOM   10184 O  OE2 . GLU F  3 136 ? 158.976 190.232 132.787 1.00 90.97  -1 164 GLU F OE2 1 
ATOM   10185 N  N   . LEU F  3 137 ? 155.456 192.444 136.818 1.00 85.96  ?  165 LEU F N   1 
ATOM   10186 C  CA  . LEU F  3 137 ? 155.701 193.358 137.921 1.00 85.96  ?  165 LEU F CA  1 
ATOM   10187 C  C   . LEU F  3 137 ? 154.445 193.732 138.690 1.00 85.96  ?  165 LEU F C   1 
ATOM   10188 O  O   . LEU F  3 137 ? 154.526 194.566 139.598 1.00 85.96  ?  165 LEU F O   1 
ATOM   10189 C  CB  . LEU F  3 137 ? 156.380 194.646 137.431 1.00 85.96  ?  165 LEU F CB  1 
ATOM   10190 C  CG  . LEU F  3 137 ? 157.791 194.503 136.865 1.00 85.96  ?  165 LEU F CG  1 
ATOM   10191 C  CD1 . LEU F  3 137 ? 158.297 195.834 136.334 1.00 85.96  ?  165 LEU F CD1 1 
ATOM   10192 C  CD2 . LEU F  3 137 ? 158.730 193.955 137.913 1.00 85.96  ?  165 LEU F CD2 1 
ATOM   10193 N  N   . CYS F  3 138 ? 153.297 193.149 138.359 1.00 82.90  ?  166 CYS F N   1 
ATOM   10194 C  CA  . CYS F  3 138 ? 152.046 193.447 139.045 1.00 82.90  ?  166 CYS F CA  1 
ATOM   10195 C  C   . CYS F  3 138 ? 151.434 192.221 139.707 1.00 82.90  ?  166 CYS F C   1 
ATOM   10196 O  O   . CYS F  3 138 ? 151.056 192.270 140.880 1.00 82.90  ?  166 CYS F O   1 
ATOM   10197 C  CB  . CYS F  3 138 ? 151.049 194.053 138.056 1.00 82.90  ?  166 CYS F CB  1 
ATOM   10198 S  SG  . CYS F  3 138 ? 151.526 195.658 137.417 1.00 82.90  ?  166 CYS F SG  1 
ATOM   10199 N  N   . PHE F  3 139 ? 151.335 191.119 138.975 1.00 78.15  ?  167 PHE F N   1 
ATOM   10200 C  CA  . PHE F  3 139 ? 150.638 189.926 139.433 1.00 78.15  ?  167 PHE F CA  1 
ATOM   10201 C  C   . PHE F  3 139 ? 151.433 188.689 139.035 1.00 78.15  ?  167 PHE F C   1 
ATOM   10202 O  O   . PHE F  3 139 ? 152.308 188.779 138.163 1.00 78.15  ?  167 PHE F O   1 
ATOM   10203 C  CB  . PHE F  3 139 ? 149.229 189.891 138.835 1.00 78.15  ?  167 PHE F CB  1 
ATOM   10204 C  CG  . PHE F  3 139 ? 148.328 190.976 139.340 1.00 78.15  ?  167 PHE F CG  1 
ATOM   10205 C  CD1 . PHE F  3 139 ? 147.732 190.873 140.585 1.00 78.15  ?  167 PHE F CD1 1 
ATOM   10206 C  CD2 . PHE F  3 139 ? 148.065 192.091 138.564 1.00 78.15  ?  167 PHE F CD2 1 
ATOM   10207 C  CE1 . PHE F  3 139 ? 146.897 191.866 141.051 1.00 78.15  ?  167 PHE F CE1 1 
ATOM   10208 C  CE2 . PHE F  3 139 ? 147.231 193.089 139.022 1.00 78.15  ?  167 PHE F CE2 1 
ATOM   10209 C  CZ  . PHE F  3 139 ? 146.646 192.975 140.270 1.00 78.15  ?  167 PHE F CZ  1 
ATOM   10210 N  N   . PRO F  3 140 ? 151.185 187.528 139.640 1.00 75.48  ?  168 PRO F N   1 
ATOM   10211 C  CA  . PRO F  3 140 ? 151.824 186.297 139.159 1.00 75.48  ?  168 PRO F CA  1 
ATOM   10212 C  C   . PRO F  3 140 ? 151.260 185.857 137.814 1.00 75.48  ?  168 PRO F C   1 
ATOM   10213 O  O   . PRO F  3 140 ? 150.311 186.432 137.276 1.00 75.48  ?  168 PRO F O   1 
ATOM   10214 C  CB  . PRO F  3 140 ? 151.502 185.275 140.252 1.00 75.48  ?  168 PRO F CB  1 
ATOM   10215 C  CG  . PRO F  3 140 ? 151.240 186.088 141.461 1.00 75.48  ?  168 PRO F CG  1 
ATOM   10216 C  CD  . PRO F  3 140 ? 150.571 187.327 140.965 1.00 75.48  ?  168 PRO F CD  1 
ATOM   10217 N  N   . GLU F  3 141 ? 151.876 184.806 137.268 1.00 74.22  ?  169 GLU F N   1 
ATOM   10218 C  CA  . GLU F  3 141 ? 151.370 184.217 136.034 1.00 74.22  ?  169 GLU F CA  1 
ATOM   10219 C  C   . GLU F  3 141 ? 150.036 183.524 136.264 1.00 74.22  ?  169 GLU F C   1 
ATOM   10220 O  O   . GLU F  3 141 ? 149.075 183.750 135.522 1.00 74.22  ?  169 GLU F O   1 
ATOM   10221 C  CB  . GLU F  3 141 ? 152.380 183.228 135.452 1.00 74.22  ?  169 GLU F CB  1 
ATOM   10222 C  CG  . GLU F  3 141 ? 151.904 182.593 134.149 1.00 74.22  ?  169 GLU F CG  1 
ATOM   10223 C  CD  . GLU F  3 141 ? 152.909 181.628 133.551 1.00 74.22  ?  169 GLU F CD  1 
ATOM   10224 O  OE1 . GLU F  3 141 ? 153.994 181.446 134.142 1.00 74.22  ?  169 GLU F OE1 1 
ATOM   10225 O  OE2 . GLU F  3 141 ? 152.608 181.040 132.491 1.00 74.22  -1 169 GLU F OE2 1 
ATOM   10226 N  N   . THR F  3 142 ? 149.959 182.678 137.286 1.00 69.09  ?  170 THR F N   1 
ATOM   10227 C  CA  . THR F  3 142 ? 148.702 182.030 137.647 1.00 69.09  ?  170 THR F CA  1 
ATOM   10228 C  C   . THR F  3 142 ? 147.819 183.046 138.351 1.00 69.09  ?  170 THR F C   1 
ATOM   10229 O  O   . THR F  3 142 ? 148.118 183.476 139.468 1.00 69.09  ?  170 THR F O   1 
ATOM   10230 C  CB  . THR F  3 142 ? 148.946 180.814 138.529 1.00 69.09  ?  170 THR F CB  1 
ATOM   10231 O  OG1 . THR F  3 142 ? 149.729 179.854 137.812 1.00 69.09  ?  170 THR F OG1 1 
ATOM   10232 C  CG2 . THR F  3 142 ? 147.623 180.185 138.913 1.00 69.09  ?  170 THR F CG2 1 
ATOM   10233 N  N   . ARG F  3 143 ? 146.740 183.453 137.686 1.00 66.52  ?  171 ARG F N   1 
ATOM   10234 C  CA  . ARG F  3 143 ? 145.799 184.368 138.305 1.00 66.52  ?  171 ARG F CA  1 
ATOM   10235 C  C   . ARG F  3 143 ? 145.066 183.652 139.435 1.00 66.52  ?  171 ARG F C   1 
ATOM   10236 O  O   . ARG F  3 143 ? 144.805 182.449 139.349 1.00 66.52  ?  171 ARG F O   1 
ATOM   10237 C  CB  . ARG F  3 143 ? 144.811 184.926 137.273 1.00 66.52  ?  171 ARG F CB  1 
ATOM   10238 C  CG  . ARG F  3 143 ? 144.009 183.916 136.449 1.00 66.52  ?  171 ARG F CG  1 
ATOM   10239 C  CD  . ARG F  3 143 ? 142.647 183.565 137.048 1.00 66.52  ?  171 ARG F CD  1 
ATOM   10240 N  NE  . ARG F  3 143 ? 141.820 182.817 136.112 1.00 66.52  ?  171 ARG F NE  1 
ATOM   10241 C  CZ  . ARG F  3 143 ? 140.729 182.139 136.453 1.00 66.52  ?  171 ARG F CZ  1 
ATOM   10242 N  NH1 . ARG F  3 143 ? 140.347 182.088 137.721 1.00 66.52  1  171 ARG F NH1 1 
ATOM   10243 N  NH2 . ARG F  3 143 ? 140.036 181.491 135.527 1.00 66.52  ?  171 ARG F NH2 1 
ATOM   10244 N  N   . PRO F  3 144 ? 144.746 184.357 140.513 1.00 56.53  ?  172 PRO F N   1 
ATOM   10245 C  CA  . PRO F  3 144 ? 144.030 183.718 141.615 1.00 56.53  ?  172 PRO F CA  1 
ATOM   10246 C  C   . PRO F  3 144 ? 142.586 183.414 141.250 1.00 56.53  ?  172 PRO F C   1 
ATOM   10247 O  O   . PRO F  3 144 ? 142.018 183.964 140.305 1.00 56.53  ?  172 PRO F O   1 
ATOM   10248 C  CB  . PRO F  3 144 ? 144.115 184.753 142.735 1.00 56.53  ?  172 PRO F CB  1 
ATOM   10249 C  CG  . PRO F  3 144 ? 144.295 186.045 142.039 1.00 56.53  ?  172 PRO F CG  1 
ATOM   10250 C  CD  . PRO F  3 144 ? 145.117 185.746 140.830 1.00 56.53  ?  172 PRO F CD  1 
ATOM   10251 N  N   . SER F  3 145 ? 142.003 182.497 142.013 1.00 56.88  ?  173 SER F N   1 
ATOM   10252 C  CA  . SER F  3 145 ? 140.595 182.146 141.865 1.00 56.88  ?  173 SER F CA  1 
ATOM   10253 C  C   . SER F  3 145 ? 140.056 181.946 143.270 1.00 56.88  ?  173 SER F C   1 
ATOM   10254 O  O   . SER F  3 145 ? 140.425 180.981 143.942 1.00 56.88  ?  173 SER F O   1 
ATOM   10255 C  CB  . SER F  3 145 ? 140.420 180.891 141.017 1.00 56.88  ?  173 SER F CB  1 
ATOM   10256 O  OG  . SER F  3 145 ? 140.974 179.762 141.667 1.00 56.88  ?  173 SER F OG  1 
ATOM   10257 N  N   . PHE F  3 146 ? 139.195 182.851 143.710 1.00 49.56  ?  174 PHE F N   1 
ATOM   10258 C  CA  . PHE F  3 146 ? 138.878 182.955 145.122 1.00 49.56  ?  174 PHE F CA  1 
ATOM   10259 C  C   . PHE F  3 146 ? 137.635 182.164 145.486 1.00 49.56  ?  174 PHE F C   1 
ATOM   10260 O  O   . PHE F  3 146 ? 136.939 181.624 144.625 1.00 49.56  ?  174 PHE F O   1 
ATOM   10261 C  CB  . PHE F  3 146 ? 138.715 184.414 145.514 1.00 49.56  ?  174 PHE F CB  1 
ATOM   10262 C  CG  . PHE F  3 146 ? 139.979 185.180 145.410 1.00 49.56  ?  174 PHE F CG  1 
ATOM   10263 C  CD1 . PHE F  3 146 ? 140.940 185.060 146.386 1.00 49.56  ?  174 PHE F CD1 1 
ATOM   10264 C  CD2 . PHE F  3 146 ? 140.227 185.985 144.320 1.00 49.56  ?  174 PHE F CD2 1 
ATOM   10265 C  CE1 . PHE F  3 146 ? 142.113 185.755 146.296 1.00 49.56  ?  174 PHE F CE1 1 
ATOM   10266 C  CE2 . PHE F  3 146 ? 141.400 186.678 144.222 1.00 49.56  ?  174 PHE F CE2 1 
ATOM   10267 C  CZ  . PHE F  3 146 ? 142.341 186.564 145.212 1.00 49.56  ?  174 PHE F CZ  1 
ATOM   10268 N  N   . ARG F  3 147 ? 137.372 182.094 146.784 1.00 48.09  ?  175 ARG F N   1 
ATOM   10269 C  CA  . ARG F  3 147 ? 136.480 181.096 147.349 1.00 48.09  ?  175 ARG F CA  1 
ATOM   10270 C  C   . ARG F  3 147 ? 135.965 181.585 148.694 1.00 48.09  ?  175 ARG F C   1 
ATOM   10271 O  O   . ARG F  3 147 ? 136.689 181.531 149.692 1.00 48.09  ?  175 ARG F O   1 
ATOM   10272 C  CB  . ARG F  3 147 ? 137.234 179.786 147.478 1.00 48.09  ?  175 ARG F CB  1 
ATOM   10273 C  CG  . ARG F  3 147 ? 136.446 178.663 148.013 1.00 48.09  ?  175 ARG F CG  1 
ATOM   10274 C  CD  . ARG F  3 147 ? 137.257 177.402 147.906 1.00 48.09  ?  175 ARG F CD  1 
ATOM   10275 N  NE  . ARG F  3 147 ? 137.430 176.952 146.535 1.00 48.09  ?  175 ARG F NE  1 
ATOM   10276 C  CZ  . ARG F  3 147 ? 138.155 175.897 146.198 1.00 48.09  ?  175 ARG F CZ  1 
ATOM   10277 N  NH1 . ARG F  3 147 ? 138.754 175.188 147.141 1.00 48.09  1  175 ARG F NH1 1 
ATOM   10278 N  NH2 . ARG F  3 147 ? 138.267 175.541 144.927 1.00 48.09  ?  175 ARG F NH2 1 
ATOM   10279 N  N   . ILE F  3 148 ? 134.723 182.059 148.726 1.00 52.06  ?  176 ILE F N   1 
ATOM   10280 C  CA  . ILE F  3 148 ? 134.117 182.630 149.923 1.00 52.06  ?  176 ILE F CA  1 
ATOM   10281 C  C   . ILE F  3 148 ? 132.840 181.862 150.236 1.00 52.06  ?  176 ILE F C   1 
ATOM   10282 O  O   . ILE F  3 148 ? 132.072 181.527 149.328 1.00 52.06  ?  176 ILE F O   1 
ATOM   10283 C  CB  . ILE F  3 148 ? 133.826 184.134 149.727 1.00 52.06  ?  176 ILE F CB  1 
ATOM   10284 C  CG1 . ILE F  3 148 ? 135.111 184.887 149.419 1.00 52.06  ?  176 ILE F CG1 1 
ATOM   10285 C  CG2 . ILE F  3 148 ? 133.195 184.756 150.958 1.00 52.06  ?  176 ILE F CG2 1 
ATOM   10286 C  CD1 . ILE F  3 148 ? 134.888 186.311 149.039 1.00 52.06  ?  176 ILE F CD1 1 
ATOM   10287 N  N   . ARG F  3 149 ? 132.622 181.552 151.512 1.00 56.05  ?  177 ARG F N   1 
ATOM   10288 C  CA  . ARG F  3 149 ? 131.347 181.006 151.952 1.00 56.05  ?  177 ARG F CA  1 
ATOM   10289 C  C   . ARG F  3 149 ? 130.349 182.132 152.184 1.00 56.05  ?  177 ARG F C   1 
ATOM   10290 O  O   . ARG F  3 149 ? 130.708 183.218 152.646 1.00 56.05  ?  177 ARG F O   1 
ATOM   10291 C  CB  . ARG F  3 149 ? 131.504 180.199 153.240 1.00 56.05  ?  177 ARG F CB  1 
ATOM   10292 C  CG  . ARG F  3 149 ? 132.334 178.943 153.110 1.00 56.05  ?  177 ARG F CG  1 
ATOM   10293 C  CD  . ARG F  3 149 ? 132.308 178.156 154.409 1.00 56.05  ?  177 ARG F CD  1 
ATOM   10294 N  NE  . ARG F  3 149 ? 133.200 177.003 154.377 1.00 56.05  ?  177 ARG F NE  1 
ATOM   10295 C  CZ  . ARG F  3 149 ? 132.870 175.813 153.889 1.00 56.05  ?  177 ARG F CZ  1 
ATOM   10296 N  NH1 . ARG F  3 149 ? 131.667 175.613 153.373 1.00 56.05  1  177 ARG F NH1 1 
ATOM   10297 N  NH2 . ARG F  3 149 ? 133.749 174.823 153.908 1.00 56.05  ?  177 ARG F NH2 1 
ATOM   10298 N  N   . GLU F  3 150 ? 129.083 181.865 151.869 1.00 59.29  ?  178 GLU F N   1 
ATOM   10299 C  CA  . GLU F  3 150 ? 128.057 182.875 152.070 1.00 59.29  ?  178 GLU F CA  1 
ATOM   10300 C  C   . GLU F  3 150 ? 127.671 182.962 153.542 1.00 59.29  ?  178 GLU F C   1 
ATOM   10301 O  O   . GLU F  3 150 ? 127.934 182.051 154.333 1.00 59.29  ?  178 GLU F O   1 
ATOM   10302 C  CB  . GLU F  3 150 ? 126.812 182.574 151.243 1.00 59.29  ?  178 GLU F CB  1 
ATOM   10303 C  CG  . GLU F  3 150 ? 126.016 181.390 151.746 1.00 59.29  ?  178 GLU F CG  1 
ATOM   10304 C  CD  . GLU F  3 150 ? 124.739 181.178 150.967 1.00 59.29  ?  178 GLU F CD  1 
ATOM   10305 O  OE1 . GLU F  3 150 ? 124.519 181.902 149.978 1.00 59.29  ?  178 GLU F OE1 1 
ATOM   10306 O  OE2 . GLU F  3 150 ? 123.937 180.310 151.363 1.00 59.29  -1 178 GLU F OE2 1 
ATOM   10307 N  N   . ASN F  3 151 ? 127.033 184.084 153.893 1.00 63.61  ?  179 ASN F N   1 
ATOM   10308 C  CA  . ASN F  3 151 ? 126.483 184.376 155.220 1.00 63.61  ?  179 ASN F CA  1 
ATOM   10309 C  C   . ASN F  3 151 ? 127.525 184.287 156.332 1.00 63.61  ?  179 ASN F C   1 
ATOM   10310 O  O   . ASN F  3 151 ? 127.228 183.803 157.428 1.00 63.61  ?  179 ASN F O   1 
ATOM   10311 C  CB  . ASN F  3 151 ? 125.286 183.472 155.544 1.00 63.61  ?  179 ASN F CB  1 
ATOM   10312 C  CG  . ASN F  3 151 ? 124.108 183.718 154.627 1.00 63.61  ?  179 ASN F CG  1 
ATOM   10313 O  OD1 . ASN F  3 151 ? 123.704 182.842 153.863 1.00 63.61  ?  179 ASN F OD1 1 
ATOM   10314 N  ND2 . ASN F  3 151 ? 123.555 184.919 154.693 1.00 63.61  ?  179 ASN F ND2 1 
ATOM   10315 N  N   . ARG F  3 152 ? 128.743 184.740 156.070 1.00 65.15  ?  180 ARG F N   1 
ATOM   10316 C  CA  . ARG F  3 152 ? 129.838 184.699 157.023 1.00 65.15  ?  180 ARG F CA  1 
ATOM   10317 C  C   . ARG F  3 152 ? 130.325 186.113 157.327 1.00 65.15  ?  180 ARG F C   1 
ATOM   10318 O  O   . ARG F  3 152 ? 130.062 187.020 156.529 1.00 65.15  ?  180 ARG F O   1 
ATOM   10319 C  CB  . ARG F  3 152 ? 130.981 183.844 156.463 1.00 65.15  ?  180 ARG F CB  1 
ATOM   10320 C  CG  . ARG F  3 152 ? 130.577 182.395 156.320 1.00 65.15  ?  180 ARG F CG  1 
ATOM   10321 C  CD  . ARG F  3 152 ? 130.299 181.789 157.686 1.00 65.15  ?  180 ARG F CD  1 
ATOM   10322 N  NE  . ARG F  3 152 ? 129.969 180.370 157.609 1.00 65.15  ?  180 ARG F NE  1 
ATOM   10323 C  CZ  . ARG F  3 152 ? 128.729 179.898 157.533 1.00 65.15  ?  180 ARG F CZ  1 
ATOM   10324 N  NH1 . ARG F  3 152 ? 127.700 180.733 157.534 1.00 65.15  1  180 ARG F NH1 1 
ATOM   10325 N  NH2 . ARG F  3 152 ? 128.518 178.591 157.465 1.00 65.15  ?  180 ARG F NH2 1 
ATOM   10326 N  N   . PRO F  3 153 ? 130.970 186.351 158.475 1.00 66.70  ?  181 PRO F N   1 
ATOM   10327 C  CA  . PRO F  3 153 ? 131.448 187.707 158.802 1.00 66.70  ?  181 PRO F CA  1 
ATOM   10328 C  C   . PRO F  3 153 ? 132.486 188.192 157.806 1.00 66.70  ?  181 PRO F C   1 
ATOM   10329 O  O   . PRO F  3 153 ? 133.258 187.388 157.261 1.00 66.70  ?  181 PRO F O   1 
ATOM   10330 C  CB  . PRO F  3 153 ? 132.058 187.537 160.200 1.00 66.70  ?  181 PRO F CB  1 
ATOM   10331 C  CG  . PRO F  3 153 ? 131.337 186.396 160.777 1.00 66.70  ?  181 PRO F CG  1 
ATOM   10332 C  CD  . PRO F  3 153 ? 131.089 185.455 159.643 1.00 66.70  ?  181 PRO F CD  1 
ATOM   10333 N  N   . PRO F  3 154 ? 132.515 189.494 157.523 1.00 66.49  ?  182 PRO F N   1 
ATOM   10334 C  CA  . PRO F  3 154 ? 133.380 190.000 156.451 1.00 66.49  ?  182 PRO F CA  1 
ATOM   10335 C  C   . PRO F  3 154 ? 134.845 189.992 156.851 1.00 66.49  ?  182 PRO F C   1 
ATOM   10336 O  O   . PRO F  3 154 ? 135.187 190.067 158.032 1.00 66.49  ?  182 PRO F O   1 
ATOM   10337 C  CB  . PRO F  3 154 ? 132.870 191.428 156.239 1.00 66.49  ?  182 PRO F CB  1 
ATOM   10338 C  CG  . PRO F  3 154 ? 132.309 191.814 157.552 1.00 66.49  ?  182 PRO F CG  1 
ATOM   10339 C  CD  . PRO F  3 154 ? 131.708 190.568 158.129 1.00 66.49  ?  182 PRO F CD  1 
ATOM   10340 N  N   . GLY F  3 155 ? 135.714 189.896 155.848 1.00 62.50  ?  183 GLY F N   1 
ATOM   10341 C  CA  . GLY F  3 155 ? 137.138 189.836 156.104 1.00 62.50  ?  183 GLY F CA  1 
ATOM   10342 C  C   . GLY F  3 155 ? 137.995 190.474 155.033 1.00 62.50  ?  183 GLY F C   1 
ATOM   10343 O  O   . GLY F  3 155 ? 137.659 191.534 154.502 1.00 62.50  ?  183 GLY F O   1 
ATOM   10344 N  N   . THR F  3 156 ? 139.105 189.819 154.706 1.00 61.77  ?  184 THR F N   1 
ATOM   10345 C  CA  . THR F  3 156 ? 140.121 190.325 153.792 1.00 61.77  ?  184 THR F CA  1 
ATOM   10346 C  C   . THR F  3 156 ? 140.860 189.139 153.199 1.00 61.77  ?  184 THR F C   1 
ATOM   10347 O  O   . THR F  3 156 ? 141.389 188.315 153.948 1.00 61.77  ?  184 THR F O   1 
ATOM   10348 C  CB  . THR F  3 156 ? 141.108 191.233 154.524 1.00 61.77  ?  184 THR F CB  1 
ATOM   10349 O  OG1 . THR F  3 156 ? 140.464 192.455 154.908 1.00 61.77  ?  184 THR F OG1 1 
ATOM   10350 C  CG2 . THR F  3 156 ? 142.301 191.510 153.664 1.00 61.77  ?  184 THR F CG2 1 
ATOM   10351 N  N   . PHE F  3 157 ? 140.915 189.044 151.869 1.00 56.09  ?  185 PHE F N   1 
ATOM   10352 C  CA  . PHE F  3 157 ? 141.389 187.806 151.264 1.00 56.09  ?  185 PHE F CA  1 
ATOM   10353 C  C   . PHE F  3 157 ? 142.584 187.969 150.325 1.00 56.09  ?  185 PHE F C   1 
ATOM   10354 O  O   . PHE F  3 157 ? 143.376 187.032 150.183 1.00 56.09  ?  185 PHE F O   1 
ATOM   10355 C  CB  . PHE F  3 157 ? 140.225 187.079 150.569 1.00 56.09  ?  185 PHE F CB  1 
ATOM   10356 C  CG  . PHE F  3 157 ? 139.529 187.864 149.495 1.00 56.09  ?  185 PHE F CG  1 
ATOM   10357 C  CD1 . PHE F  3 157 ? 138.421 188.631 149.785 1.00 56.09  ?  185 PHE F CD1 1 
ATOM   10358 C  CD2 . PHE F  3 157 ? 139.944 187.775 148.182 1.00 56.09  ?  185 PHE F CD2 1 
ATOM   10359 C  CE1 . PHE F  3 157 ? 137.765 189.327 148.788 1.00 56.09  ?  185 PHE F CE1 1 
ATOM   10360 C  CE2 . PHE F  3 157 ? 139.294 188.460 147.182 1.00 56.09  ?  185 PHE F CE2 1 
ATOM   10361 C  CZ  . PHE F  3 157 ? 138.204 189.238 147.484 1.00 56.09  ?  185 PHE F CZ  1 
ATOM   10362 N  N   . HIS F  3 158 ? 142.746 189.116 149.681 1.00 58.68  ?  186 HIS F N   1 
ATOM   10363 C  CA  . HIS F  3 158 ? 143.843 189.240 148.730 1.00 58.68  ?  186 HIS F CA  1 
ATOM   10364 C  C   . HIS F  3 158 ? 144.691 190.480 148.999 1.00 58.68  ?  186 HIS F C   1 
ATOM   10365 O  O   . HIS F  3 158 ? 144.207 191.512 149.469 1.00 58.68  ?  186 HIS F O   1 
ATOM   10366 C  CB  . HIS F  3 158 ? 143.310 189.266 147.298 1.00 58.68  ?  186 HIS F CB  1 
ATOM   10367 C  CG  . HIS F  3 158 ? 144.377 189.188 146.253 1.00 58.68  ?  186 HIS F CG  1 
ATOM   10368 N  ND1 . HIS F  3 158 ? 145.129 188.054 146.045 1.00 58.68  ?  186 HIS F ND1 1 
ATOM   10369 C  CD2 . HIS F  3 158 ? 144.805 190.094 145.344 1.00 58.68  ?  186 HIS F CD2 1 
ATOM   10370 C  CE1 . HIS F  3 158 ? 145.982 188.267 145.059 1.00 58.68  ?  186 HIS F CE1 1 
ATOM   10371 N  NE2 . HIS F  3 158 ? 145.806 189.498 144.616 1.00 58.68  ?  186 HIS F NE2 1 
ATOM   10372 N  N   . GLN F  3 159 ? 145.979 190.356 148.690 1.00 63.18  ?  187 GLN F N   1 
ATOM   10373 C  CA  . GLN F  3 159 ? 146.941 191.437 148.808 1.00 63.18  ?  187 GLN F CA  1 
ATOM   10374 C  C   . GLN F  3 159 ? 147.739 191.502 147.512 1.00 63.18  ?  187 GLN F C   1 
ATOM   10375 O  O   . GLN F  3 159 ? 148.025 190.478 146.890 1.00 63.18  ?  187 GLN F O   1 
ATOM   10376 C  CB  . GLN F  3 159 ? 147.856 191.220 150.018 1.00 63.18  ?  187 GLN F CB  1 
ATOM   10377 C  CG  . GLN F  3 159 ? 148.643 192.437 150.452 1.00 63.18  ?  187 GLN F CG  1 
ATOM   10378 C  CD  . GLN F  3 159 ? 149.958 192.578 149.727 1.00 63.18  ?  187 GLN F CD  1 
ATOM   10379 O  OE1 . GLN F  3 159 ? 150.557 191.591 149.309 1.00 63.18  ?  187 GLN F OE1 1 
ATOM   10380 N  NE2 . GLN F  3 159 ? 150.413 193.813 149.571 1.00 63.18  ?  187 GLN F NE2 1 
ATOM   10381 N  N   . PHE F  3 160 ? 148.106 192.717 147.107 1.00 68.94  ?  188 PHE F N   1 
ATOM   10382 C  CA  . PHE F  3 160 ? 148.571 192.960 145.748 1.00 68.94  ?  188 PHE F CA  1 
ATOM   10383 C  C   . PHE F  3 160 ? 150.076 192.863 145.531 1.00 68.94  ?  188 PHE F C   1 
ATOM   10384 O  O   . PHE F  3 160 ? 150.488 192.453 144.441 1.00 68.94  ?  188 PHE F O   1 
ATOM   10385 C  CB  . PHE F  3 160 ? 148.114 194.343 145.272 1.00 68.94  ?  188 PHE F CB  1 
ATOM   10386 C  CG  . PHE F  3 160 ? 146.658 194.423 144.953 1.00 68.94  ?  188 PHE F CG  1 
ATOM   10387 C  CD1 . PHE F  3 160 ? 146.177 193.931 143.751 1.00 68.94  ?  188 PHE F CD1 1 
ATOM   10388 C  CD2 . PHE F  3 160 ? 145.774 195.006 145.837 1.00 68.94  ?  188 PHE F CD2 1 
ATOM   10389 C  CE1 . PHE F  3 160 ? 144.839 194.005 143.441 1.00 68.94  ?  188 PHE F CE1 1 
ATOM   10390 C  CE2 . PHE F  3 160 ? 144.434 195.088 145.532 1.00 68.94  ?  188 PHE F CE2 1 
ATOM   10391 C  CZ  . PHE F  3 160 ? 143.966 194.583 144.332 1.00 68.94  ?  188 PHE F CZ  1 
ATOM   10392 N  N   . ARG F  3 161 ? 150.904 193.242 146.505 1.00 73.39  ?  189 ARG F N   1 
ATOM   10393 C  CA  . ARG F  3 161 ? 152.326 193.476 146.265 1.00 73.39  ?  189 ARG F CA  1 
ATOM   10394 C  C   . ARG F  3 161 ? 153.074 192.169 146.036 1.00 73.39  ?  189 ARG F C   1 
ATOM   10395 O  O   . ARG F  3 161 ? 153.063 191.281 146.894 1.00 73.39  ?  189 ARG F O   1 
ATOM   10396 C  CB  . ARG F  3 161 ? 152.959 194.225 147.436 1.00 73.39  ?  189 ARG F CB  1 
ATOM   10397 C  CG  . ARG F  3 161 ? 152.505 195.652 147.590 1.00 73.39  ?  189 ARG F CG  1 
ATOM   10398 C  CD  . ARG F  3 161 ? 153.128 196.269 148.822 1.00 73.39  ?  189 ARG F CD  1 
ATOM   10399 N  NE  . ARG F  3 161 ? 152.645 197.623 149.060 1.00 73.39  ?  189 ARG F NE  1 
ATOM   10400 C  CZ  . ARG F  3 161 ? 152.971 198.352 150.121 1.00 73.39  ?  189 ARG F CZ  1 
ATOM   10401 N  NH1 . ARG F  3 161 ? 153.782 197.857 151.045 1.00 73.39  1  189 ARG F NH1 1 
ATOM   10402 N  NH2 . ARG F  3 161 ? 152.483 199.577 150.261 1.00 73.39  ?  189 ARG F NH2 1 
ATOM   10403 N  N   . LEU F  3 162 ? 153.730 192.058 144.881 1.00 72.94  ?  190 LEU F N   1 
ATOM   10404 C  CA  . LEU F  3 162 ? 154.688 190.985 144.661 1.00 72.94  ?  190 LEU F CA  1 
ATOM   10405 C  C   . LEU F  3 162 ? 155.917 191.259 145.512 1.00 72.94  ?  190 LEU F C   1 
ATOM   10406 O  O   . LEU F  3 162 ? 156.741 192.106 145.157 1.00 72.94  ?  190 LEU F O   1 
ATOM   10407 C  CB  . LEU F  3 162 ? 155.062 190.877 143.186 1.00 72.94  ?  190 LEU F CB  1 
ATOM   10408 C  CG  . LEU F  3 162 ? 153.927 190.487 142.248 1.00 72.94  ?  190 LEU F CG  1 
ATOM   10409 C  CD1 . LEU F  3 162 ? 154.401 190.502 140.812 1.00 72.94  ?  190 LEU F CD1 1 
ATOM   10410 C  CD2 . LEU F  3 162 ? 153.408 189.124 142.623 1.00 72.94  ?  190 LEU F CD2 1 
ATOM   10411 N  N   . LEU F  3 163 ? 156.035 190.563 146.642 1.00 69.95  ?  191 LEU F N   1 
ATOM   10412 C  CA  . LEU F  3 163 ? 157.027 190.858 147.676 1.00 69.95  ?  191 LEU F CA  1 
ATOM   10413 C  C   . LEU F  3 163 ? 158.500 190.754 147.249 1.00 69.95  ?  191 LEU F C   1 
ATOM   10414 O  O   . LEU F  3 163 ? 159.277 191.635 147.645 1.00 69.95  ?  191 LEU F O   1 
ATOM   10415 C  CB  . LEU F  3 163 ? 156.763 189.980 148.904 1.00 69.95  ?  191 LEU F CB  1 
ATOM   10416 C  CG  . LEU F  3 163 ? 155.420 190.230 149.593 1.00 69.95  ?  191 LEU F CG  1 
ATOM   10417 C  CD1 . LEU F  3 163 ? 155.206 189.253 150.738 1.00 69.95  ?  191 LEU F CD1 1 
ATOM   10418 C  CD2 . LEU F  3 163 ? 155.317 191.662 150.081 1.00 69.95  ?  191 LEU F CD2 1 
ATOM   10419 N  N   . PRO F  3 164 ? 158.952 189.754 146.464 1.00 71.11  ?  192 PRO F N   1 
ATOM   10420 C  CA  . PRO F  3 164 ? 160.354 189.813 146.010 1.00 71.11  ?  192 PRO F CA  1 
ATOM   10421 C  C   . PRO F  3 164 ? 160.630 190.931 145.021 1.00 71.11  ?  192 PRO F C   1 
ATOM   10422 O  O   . PRO F  3 164 ? 161.775 191.388 144.934 1.00 71.11  ?  192 PRO F O   1 
ATOM   10423 C  CB  . PRO F  3 164 ? 160.583 188.437 145.370 1.00 71.11  ?  192 PRO F CB  1 
ATOM   10424 C  CG  . PRO F  3 164 ? 159.576 187.573 145.964 1.00 71.11  ?  192 PRO F CG  1 
ATOM   10425 C  CD  . PRO F  3 164 ? 158.380 188.435 146.118 1.00 71.11  ?  192 PRO F CD  1 
ATOM   10426 N  N   . VAL F  3 165 ? 159.614 191.396 144.293 1.00 72.84  ?  193 VAL F N   1 
ATOM   10427 C  CA  . VAL F  3 165 ? 159.817 192.497 143.356 1.00 72.84  ?  193 VAL F CA  1 
ATOM   10428 C  C   . VAL F  3 165 ? 160.072 193.801 144.099 1.00 72.84  ?  193 VAL F C   1 
ATOM   10429 O  O   . VAL F  3 165 ? 161.068 194.484 143.839 1.00 72.84  ?  193 VAL F O   1 
ATOM   10430 C  CB  . VAL F  3 165 ? 158.622 192.606 142.394 1.00 72.84  ?  193 VAL F CB  1 
ATOM   10431 C  CG1 . VAL F  3 165 ? 158.678 193.904 141.626 1.00 72.84  ?  193 VAL F CG1 1 
ATOM   10432 C  CG2 . VAL F  3 165 ? 158.642 191.441 141.427 1.00 72.84  ?  193 VAL F CG2 1 
ATOM   10433 N  N   . GLN F  3 166 ? 159.203 194.159 145.053 1.00 72.10  ?  194 GLN F N   1 
ATOM   10434 C  CA  . GLN F  3 166 ? 159.455 195.379 145.812 1.00 72.10  ?  194 GLN F CA  1 
ATOM   10435 C  C   . GLN F  3 166 ? 160.607 195.215 146.793 1.00 72.10  ?  194 GLN F C   1 
ATOM   10436 O  O   . GLN F  3 166 ? 161.158 196.220 147.252 1.00 72.10  ?  194 GLN F O   1 
ATOM   10437 C  CB  . GLN F  3 166 ? 158.217 195.845 146.581 1.00 72.10  ?  194 GLN F CB  1 
ATOM   10438 C  CG  . GLN F  3 166 ? 157.844 195.008 147.790 1.00 72.10  ?  194 GLN F CG  1 
ATOM   10439 C  CD  . GLN F  3 166 ? 156.764 195.671 148.620 1.00 72.10  ?  194 GLN F CD  1 
ATOM   10440 O  OE1 . GLN F  3 166 ? 156.346 196.791 148.331 1.00 72.10  ?  194 GLN F OE1 1 
ATOM   10441 N  NE2 . GLN F  3 166 ? 156.319 194.992 149.669 1.00 72.10  ?  194 GLN F NE2 1 
ATOM   10442 N  N   . PHE F  3 167 ? 160.983 193.981 147.125 1.00 75.94  ?  195 PHE F N   1 
ATOM   10443 C  CA  . PHE F  3 167 ? 162.196 193.780 147.898 1.00 75.94  ?  195 PHE F CA  1 
ATOM   10444 C  C   . PHE F  3 167 ? 163.453 193.935 147.052 1.00 75.94  ?  195 PHE F C   1 
ATOM   10445 O  O   . PHE F  3 167 ? 164.499 194.314 147.588 1.00 75.94  ?  195 PHE F O   1 
ATOM   10446 C  CB  . PHE F  3 167 ? 162.172 192.400 148.553 1.00 75.94  ?  195 PHE F CB  1 
ATOM   10447 C  CG  . PHE F  3 167 ? 163.335 192.140 149.454 1.00 75.94  ?  195 PHE F CG  1 
ATOM   10448 C  CD1 . PHE F  3 167 ? 163.412 192.751 150.693 1.00 75.94  ?  195 PHE F CD1 1 
ATOM   10449 C  CD2 . PHE F  3 167 ? 164.348 191.281 149.068 1.00 75.94  ?  195 PHE F CD2 1 
ATOM   10450 C  CE1 . PHE F  3 167 ? 164.482 192.516 151.530 1.00 75.94  ?  195 PHE F CE1 1 
ATOM   10451 C  CE2 . PHE F  3 167 ? 165.422 191.039 149.899 1.00 75.94  ?  195 PHE F CE2 1 
ATOM   10452 C  CZ  . PHE F  3 167 ? 165.488 191.658 151.132 1.00 75.94  ?  195 PHE F CZ  1 
ATOM   10453 N  N   . LEU F  3 168 ? 163.375 193.675 145.742 1.00 80.19  ?  196 LEU F N   1 
ATOM   10454 C  CA  . LEU F  3 168 ? 164.570 193.705 144.907 1.00 80.19  ?  196 LEU F CA  1 
ATOM   10455 C  C   . LEU F  3 168 ? 164.444 194.684 143.740 1.00 80.19  ?  196 LEU F C   1 
ATOM   10456 O  O   . LEU F  3 168 ? 165.254 194.645 142.808 1.00 80.19  ?  196 LEU F O   1 
ATOM   10457 C  CB  . LEU F  3 168 ? 164.903 192.302 144.394 1.00 80.19  ?  196 LEU F CB  1 
ATOM   10458 C  CG  . LEU F  3 168 ? 165.353 191.344 145.500 1.00 80.19  ?  196 LEU F CG  1 
ATOM   10459 C  CD1 . LEU F  3 168 ? 165.515 189.923 144.995 1.00 80.19  ?  196 LEU F CD1 1 
ATOM   10460 C  CD2 . LEU F  3 168 ? 166.649 191.841 146.119 1.00 80.19  ?  196 LEU F CD2 1 
ATOM   10461 N  N   . CYS F  3 169 ? 163.448 195.569 143.777 1.00 87.32  ?  197 CYS F N   1 
ATOM   10462 C  CA  . CYS F  3 169 ? 163.395 196.750 142.918 1.00 87.32  ?  197 CYS F CA  1 
ATOM   10463 C  C   . CYS F  3 169 ? 162.868 197.918 143.743 1.00 87.32  ?  197 CYS F C   1 
ATOM   10464 O  O   . CY