data_6Q3W
# 
_entry.id   6Q3W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6Q3W         
WWPDB D_1200013256 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q3W 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mackinnon, S.R.'  1  ? 
'Bezerra, G.A.'    2  ? 
'Zhang, M.'        3  ? 
'Foster, W.'       4  ? 
'Krojer, T.'       5  ? 
'Brandao-Neto, J.' 6  ? 
'Douangamath, A.'  7  ? 
'Arrowsmith, C.'   8  ? 
'Edwards, A.'      9  ? 
'Bountra, C.'      10 ? 
'Brennan, P.'      11 ? 
'Lai, K.'          12 ? 
'Yue, W.W.'        13 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of human galactokinase 1 bound with Ethyl 1-(2-pyrazinyl)-4-piperidinecarboxylate' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mackinnon, S.R.'  1  ? 
primary 'Bezerra, G.A.'    2  ? 
primary 'Zhang, M.'        3  ? 
primary 'Foster, W.'       4  ? 
primary 'Krojer, T.'       5  ? 
primary 'Brandao-Neto, J.' 6  ? 
primary 'Douangamath, A.'  7  ? 
primary 'Arrowsmith, C.'   8  ? 
primary 'Edwards, A.'      9  ? 
primary 'Bountra, C.'      10 ? 
primary 'Brennan, P.'      11 ? 
primary 'Lai, K.'          12 ? 
primary 'Yue, W.W.'        13 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.490 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q3W 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     73.262 
_cell.length_a_esd                 ? 
_cell.length_b                     114.807 
_cell.length_b_esd                 ? 
_cell.length_c                     120.818 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q3W 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Galactokinase                                                                             42071.820 4   2.7.1.6 
'K252A, E253A, L235P' ? ? 
2 non-polymer man beta-D-galactopyranose                                                                    180.156   3   ?       
?                     ? ? 
3 non-polymer syn "2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one" 350.414   3   ?       
?                     ? ? 
4 non-polymer syn 'ethyl 1-pyrazin-2-ylpiperidine-4-carboxylate'                                            235.282   1   ?       
?                     ? ? 
5 water       nat water                                                                                     18.015    641 ?       
?                     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Galactose kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEG
ADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSG
TIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRR
QCEEVARALGAASLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVS
CPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEG
ADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSG
TIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRR
QCEEVARALGAASLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVS
CPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   LEU n 
1 4   ARG n 
1 5   GLN n 
1 6   PRO n 
1 7   GLN n 
1 8   VAL n 
1 9   ALA n 
1 10  GLU n 
1 11  LEU n 
1 12  LEU n 
1 13  ALA n 
1 14  GLU n 
1 15  ALA n 
1 16  ARG n 
1 17  ARG n 
1 18  ALA n 
1 19  PHE n 
1 20  ARG n 
1 21  GLU n 
1 22  GLU n 
1 23  PHE n 
1 24  GLY n 
1 25  ALA n 
1 26  GLU n 
1 27  PRO n 
1 28  GLU n 
1 29  LEU n 
1 30  ALA n 
1 31  VAL n 
1 32  SER n 
1 33  ALA n 
1 34  PRO n 
1 35  GLY n 
1 36  ARG n 
1 37  VAL n 
1 38  ASN n 
1 39  LEU n 
1 40  ILE n 
1 41  GLY n 
1 42  GLU n 
1 43  HIS n 
1 44  THR n 
1 45  ASP n 
1 46  TYR n 
1 47  ASN n 
1 48  GLN n 
1 49  GLY n 
1 50  LEU n 
1 51  VAL n 
1 52  LEU n 
1 53  PRO n 
1 54  MET n 
1 55  ALA n 
1 56  LEU n 
1 57  GLU n 
1 58  LEU n 
1 59  MET n 
1 60  THR n 
1 61  VAL n 
1 62  LEU n 
1 63  VAL n 
1 64  GLY n 
1 65  SER n 
1 66  PRO n 
1 67  ARG n 
1 68  LYS n 
1 69  ASP n 
1 70  GLY n 
1 71  LEU n 
1 72  VAL n 
1 73  SER n 
1 74  LEU n 
1 75  LEU n 
1 76  THR n 
1 77  THR n 
1 78  SER n 
1 79  GLU n 
1 80  GLY n 
1 81  ALA n 
1 82  ASP n 
1 83  GLU n 
1 84  PRO n 
1 85  GLN n 
1 86  ARG n 
1 87  LEU n 
1 88  GLN n 
1 89  PHE n 
1 90  PRO n 
1 91  LEU n 
1 92  PRO n 
1 93  THR n 
1 94  ALA n 
1 95  GLN n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  GLU n 
1 100 PRO n 
1 101 GLY n 
1 102 THR n 
1 103 PRO n 
1 104 ARG n 
1 105 TRP n 
1 106 ALA n 
1 107 ASN n 
1 108 TYR n 
1 109 VAL n 
1 110 LYS n 
1 111 GLY n 
1 112 VAL n 
1 113 ILE n 
1 114 GLN n 
1 115 TYR n 
1 116 TYR n 
1 117 PRO n 
1 118 ALA n 
1 119 ALA n 
1 120 PRO n 
1 121 LEU n 
1 122 PRO n 
1 123 GLY n 
1 124 PHE n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 VAL n 
1 129 VAL n 
1 130 SER n 
1 131 SER n 
1 132 VAL n 
1 133 PRO n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 GLY n 
1 138 LEU n 
1 139 SER n 
1 140 SER n 
1 141 SER n 
1 142 ALA n 
1 143 SER n 
1 144 LEU n 
1 145 GLU n 
1 146 VAL n 
1 147 ALA n 
1 148 THR n 
1 149 TYR n 
1 150 THR n 
1 151 PHE n 
1 152 LEU n 
1 153 GLN n 
1 154 GLN n 
1 155 LEU n 
1 156 CYS n 
1 157 PRO n 
1 158 ASP n 
1 159 SER n 
1 160 GLY n 
1 161 THR n 
1 162 ILE n 
1 163 ALA n 
1 164 ALA n 
1 165 ARG n 
1 166 ALA n 
1 167 GLN n 
1 168 VAL n 
1 169 CYS n 
1 170 GLN n 
1 171 GLN n 
1 172 ALA n 
1 173 GLU n 
1 174 HIS n 
1 175 SER n 
1 176 PHE n 
1 177 ALA n 
1 178 GLY n 
1 179 MET n 
1 180 PRO n 
1 181 CYS n 
1 182 GLY n 
1 183 ILE n 
1 184 MET n 
1 185 ASP n 
1 186 GLN n 
1 187 PHE n 
1 188 ILE n 
1 189 SER n 
1 190 LEU n 
1 191 MET n 
1 192 GLY n 
1 193 GLN n 
1 194 LYS n 
1 195 GLY n 
1 196 HIS n 
1 197 ALA n 
1 198 LEU n 
1 199 LEU n 
1 200 ILE n 
1 201 ASP n 
1 202 CYS n 
1 203 ARG n 
1 204 SER n 
1 205 LEU n 
1 206 GLU n 
1 207 THR n 
1 208 SER n 
1 209 LEU n 
1 210 VAL n 
1 211 PRO n 
1 212 LEU n 
1 213 SER n 
1 214 ASP n 
1 215 PRO n 
1 216 LYS n 
1 217 LEU n 
1 218 ALA n 
1 219 VAL n 
1 220 LEU n 
1 221 ILE n 
1 222 THR n 
1 223 ASN n 
1 224 SER n 
1 225 ASN n 
1 226 VAL n 
1 227 ARG n 
1 228 HIS n 
1 229 SER n 
1 230 LEU n 
1 231 ALA n 
1 232 SER n 
1 233 SER n 
1 234 GLU n 
1 235 TYR n 
1 236 PRO n 
1 237 VAL n 
1 238 ARG n 
1 239 ARG n 
1 240 ARG n 
1 241 GLN n 
1 242 CYS n 
1 243 GLU n 
1 244 GLU n 
1 245 VAL n 
1 246 ALA n 
1 247 ARG n 
1 248 ALA n 
1 249 LEU n 
1 250 GLY n 
1 251 ALA n 
1 252 ALA n 
1 253 SER n 
1 254 LEU n 
1 255 ARG n 
1 256 GLU n 
1 257 VAL n 
1 258 GLN n 
1 259 LEU n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 GLU n 
1 264 ALA n 
1 265 ALA n 
1 266 ARG n 
1 267 ASP n 
1 268 LEU n 
1 269 VAL n 
1 270 SER n 
1 271 LYS n 
1 272 GLU n 
1 273 GLY n 
1 274 PHE n 
1 275 ARG n 
1 276 ARG n 
1 277 ALA n 
1 278 ARG n 
1 279 HIS n 
1 280 VAL n 
1 281 VAL n 
1 282 GLY n 
1 283 GLU n 
1 284 ILE n 
1 285 ARG n 
1 286 ARG n 
1 287 THR n 
1 288 ALA n 
1 289 GLN n 
1 290 ALA n 
1 291 ALA n 
1 292 ALA n 
1 293 ALA n 
1 294 LEU n 
1 295 ARG n 
1 296 ARG n 
1 297 GLY n 
1 298 ASP n 
1 299 TYR n 
1 300 ARG n 
1 301 ALA n 
1 302 PHE n 
1 303 GLY n 
1 304 ARG n 
1 305 LEU n 
1 306 MET n 
1 307 VAL n 
1 308 GLU n 
1 309 SER n 
1 310 HIS n 
1 311 ARG n 
1 312 SER n 
1 313 LEU n 
1 314 ARG n 
1 315 ASP n 
1 316 ASP n 
1 317 TYR n 
1 318 GLU n 
1 319 VAL n 
1 320 SER n 
1 321 CYS n 
1 322 PRO n 
1 323 GLU n 
1 324 LEU n 
1 325 ASP n 
1 326 GLN n 
1 327 LEU n 
1 328 VAL n 
1 329 GLU n 
1 330 ALA n 
1 331 ALA n 
1 332 LEU n 
1 333 ALA n 
1 334 VAL n 
1 335 PRO n 
1 336 GLY n 
1 337 VAL n 
1 338 TYR n 
1 339 GLY n 
1 340 SER n 
1 341 ARG n 
1 342 MET n 
1 343 THR n 
1 344 GLY n 
1 345 GLY n 
1 346 GLY n 
1 347 PHE n 
1 348 GLY n 
1 349 GLY n 
1 350 CYS n 
1 351 THR n 
1 352 VAL n 
1 353 THR n 
1 354 LEU n 
1 355 LEU n 
1 356 GLU n 
1 357 ALA n 
1 358 SER n 
1 359 ALA n 
1 360 ALA n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 MET n 
1 365 ARG n 
1 366 HIS n 
1 367 ILE n 
1 368 GLN n 
1 369 GLU n 
1 370 HIS n 
1 371 TYR n 
1 372 GLY n 
1 373 GLY n 
1 374 THR n 
1 375 ALA n 
1 376 THR n 
1 377 PHE n 
1 378 TYR n 
1 379 LEU n 
1 380 SER n 
1 381 GLN n 
1 382 ALA n 
1 383 ALA n 
1 384 ASP n 
1 385 GLY n 
1 386 ALA n 
1 387 LYS n 
1 388 VAL n 
1 389 LEU n 
1 390 CYS n 
1 391 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   391 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GALK1, GALK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC24-Bsa 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GALK1_HUMAN 
_struct_ref.pdbx_db_accession          P51570 
_struct_ref.pdbx_db_isoform            P51570-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEG
ADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSG
TIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRR
QCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVS
CPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6Q3W A 1 ? 391 ? P51570 32 ? 422 ? 2 392 
2 1 6Q3W B 1 ? 391 ? P51570 32 ? 422 ? 2 392 
3 1 6Q3W C 1 ? 391 ? P51570 32 ? 422 ? 2 392 
4 1 6Q3W D 1 ? 391 ? P51570 32 ? 422 ? 2 392 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6Q3W ALA A 251 ? UNP P51570 LYS 282 conflict 252 1 
1 6Q3W ALA A 252 ? UNP P51570 GLU 283 conflict 253 2 
2 6Q3W ALA B 251 ? UNP P51570 LYS 282 conflict 252 3 
2 6Q3W ALA B 252 ? UNP P51570 GLU 283 conflict 253 4 
3 6Q3W ALA C 251 ? UNP P51570 LYS 282 conflict 252 5 
3 6Q3W ALA C 252 ? UNP P51570 GLU 283 conflict 253 6 
4 6Q3W ALA D 251 ? UNP P51570 LYS 282 conflict 252 7 
4 6Q3W ALA D 252 ? UNP P51570 GLU 283 conflict 253 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                   ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                                  ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                                ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                           ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                                  ? 
'C3 H7 N O2 S'   121.158 
GAL 'D-saccharide, beta linking' . beta-D-galactopyranose                                                                    ? 
'C6 H12 O6'      180.156 
GLN 'L-peptide linking'          y GLUTAMINE                                                                                 ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                           ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                   ? 
'C2 H5 N O2'     75.067  
HFK non-polymer                  . "2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one" ? 
'C20 H22 N4 O2'  350.414 
HGE non-polymer                  . 'ethyl 1-pyrazin-2-ylpiperidine-4-carboxylate'                                            ? 
'C12 H17 N3 O2'  235.282 
HIS 'L-peptide linking'          y HISTIDINE                                                                                 ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                     ? 
'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                    ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                                ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                             ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                   ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                    ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                                 ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                                ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                                  ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                    ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q3W 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.97 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.57 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M MOPS/sodium HEPES pH 7.0-7.5, 40-50 % Morpheus Precipitant Mix 4 (50% mix = 12.5% MPD, 12.5% PEG1000, 12.5% PEG3350), 0.1 M Morpheus Carboxylic acids mix (0.02M each of:sodium formate, ammonium acetate, sodium citrate tribasic dehydrate, sodium potassium tartrate tetrahydrate and sodium oxamate).
;
_exptl_crystal_grow.pdbx_pH_range   7-7.5 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-10-01 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91587 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91587 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6Q3W 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.960 
_reflns.d_resolution_low                 82.560 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       139659 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.400 
_reflns.pdbx_Rmerge_I_obs                0.117 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             2355 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.140 
_reflns.pdbx_Rpim_I_all                  0.075 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         472410 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.960 2.070  ? ? 70129 ? ? ? 20366 99.700 ? ? ? ? 1.610 ? ? ? ? ? ? ? ? 3.400 ? ? ? 0.900  1.910 1.018 ? 1 1 0.445 ? 
6.200 82.560 ? ? 14867 ? ? ? 4523  99.200 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 3.300 ? ? ? 22.700 0.040 0.022 ? 2 1 0.998 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                144.990 
_refine.B_iso_mean                               51.2843 
_refine.B_iso_min                                21.920 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Q3W 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9620 
_refine.ls_d_res_low                             82.5560 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     139485 
_refine.ls_number_reflns_R_free                  7029 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3100 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2328 
_refine.ls_R_factor_R_free                       0.2547 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2316 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1WUU 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.8200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9620 
_refine_hist.d_res_low                        82.5560 
_refine_hist.pdbx_number_atoms_ligand         131 
_refine_hist.number_atoms_solvent             641 
_refine_hist.number_atoms_total               11460 
_refine_hist.pdbx_number_residues_total       1523 
_refine_hist.pdbx_B_iso_mean_ligand           50.79 
_refine_hist.pdbx_B_iso_mean_solvent          50.05 
_refine_hist.pdbx_number_atoms_protein        10688 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 11029 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.911  ? 15078 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.032  ? 1792  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1985  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.114 ? 3814  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9615 1.9838  4702 . 235 4467 99.0000  . . . 0.4604 0.0000 0.4021 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 1.9838 2.0071  4589 . 221 4368 100.0000 . . . 0.3856 0.0000 0.3760 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0071 2.0316  4671 . 259 4412 100.0000 . . . 0.3672 0.0000 0.3720 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0316 2.0573  4611 . 250 4361 99.0000  . . . 0.3558 0.0000 0.3493 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0573 2.0844  4655 . 274 4381 99.0000  . . . 0.3514 0.0000 0.3307 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.0844 2.1130  4596 . 221 4375 99.0000  . . . 0.3567 0.0000 0.3297 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1130 2.1432  4608 . 237 4371 99.0000  . . . 0.3434 0.0000 0.3143 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1432 2.1751  4591 . 228 4363 99.0000  . . . 0.3247 0.0000 0.3030 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.1751 2.2091  4667 . 224 4443 99.0000  . . . 0.3505 0.0000 0.2978 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2091 2.2454  4622 . 243 4379 99.0000  . . . 0.3462 0.0000 0.2985 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2454 2.2841  4631 . 235 4396 99.0000  . . . 0.3062 0.0000 0.2934 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.2841 2.3256  4648 . 248 4400 99.0000  . . . 0.2964 0.0000 0.2756 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3256 2.3703  4622 . 217 4405 99.0000  . . . 0.2977 0.0000 0.2664 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.3703 2.4187  4630 . 240 4390 99.0000  . . . 0.3143 0.0000 0.2525 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4187 2.4713  4638 . 226 4412 99.0000  . . . 0.2793 0.0000 0.2493 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.4713 2.5288  4688 . 220 4468 99.0000  . . . 0.2745 0.0000 0.2484 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5288 2.5921  4619 . 238 4381 100.0000 . . . 0.2654 0.0000 0.2399 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5921 2.6622  4647 . 244 4403 100.0000 . . . 0.2659 0.0000 0.2430 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6622 2.7405  4682 . 229 4453 100.0000 . . . 0.2881 0.0000 0.2487 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7405 2.8290  4656 . 249 4407 100.0000 . . . 0.2720 0.0000 0.2486 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8290 2.9301  4678 . 217 4461 100.0000 . . . 0.2828 0.0000 0.2388 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9301 3.0474  4634 . 231 4403 99.0000  . . . 0.2853 0.0000 0.2393 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0474 3.1861  4686 . 225 4461 100.0000 . . . 0.2564 0.0000 0.2302 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1861 3.3541  4624 . 212 4412 100.0000 . . . 0.2523 0.0000 0.2300 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3541 3.5642  4666 . 227 4439 99.0000  . . . 0.2410 0.0000 0.2235 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.5642 3.8394  4662 . 254 4408 99.0000  . . . 0.2235 0.0000 0.2056 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.8394 4.2258  4627 . 228 4399 98.0000  . . . 0.2135 0.0000 0.1941 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2258 4.8372  4669 . 239 4430 99.0000  . . . 0.1932 0.0000 0.1741 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.8372 6.0941  4721 . 229 4492 100.0000 . . . 0.2195 0.0000 0.2020 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.0941 82.6287 4745 . 229 4516 99.0000  . . . 0.1923 0.0000 0.1912 . . . . . . 30 . . . 
# 
_struct.entry_id                     6Q3W 
_struct.title                        'Structure of human galactokinase 1 bound with Ethyl 1-(2-pyrazinyl)-4-piperidinecarboxylate' 
_struct.pdbx_descriptor              
;Pyridoxine-5'-phosphate oxidase (E.C.1.4.3.5)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q3W 
_struct_keywords.text            'GALK1, fragment, fragment-bound, galactokinase 1, sugar kinase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 4 ? 
K N N 3 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 7   ? GLY A 24  ? GLN A 8   GLY A 25  1 ? 18 
HELX_P HELX_P2  AA2 THR A 44  ? GLN A 48  ? THR A 45  GLN A 49  5 ? 5  
HELX_P HELX_P3  AA3 PRO A 103 ? TYR A 116 ? PRO A 104 TYR A 117 1 ? 14 
HELX_P HELX_P4  AA4 SER A 139 ? CYS A 156 ? SER A 140 CYS A 157 1 ? 18 
HELX_P HELX_P5  AA5 THR A 161 ? ALA A 177 ? THR A 162 ALA A 178 1 ? 17 
HELX_P HELX_P6  AA6 ILE A 183 ? GLY A 192 ? ILE A 184 GLY A 193 1 ? 10 
HELX_P HELX_P7  AA7 SER A 229 ? LEU A 249 ? SER A 230 LEU A 250 1 ? 21 
HELX_P HELX_P8  AA8 SER A 253 ? VAL A 257 ? SER A 254 VAL A 258 5 ? 5  
HELX_P HELX_P9  AA9 GLN A 258 ? ALA A 265 ? GLN A 259 ALA A 266 1 ? 8  
HELX_P HELX_P10 AB1 ARG A 266 ? VAL A 269 ? ARG A 267 VAL A 270 5 ? 4  
HELX_P HELX_P11 AB2 SER A 270 ? GLY A 297 ? SER A 271 GLY A 298 1 ? 28 
HELX_P HELX_P12 AB3 ASP A 298 ? ASP A 316 ? ASP A 299 ASP A 317 1 ? 19 
HELX_P HELX_P13 AB4 CYS A 321 ? ALA A 333 ? CYS A 322 ALA A 334 1 ? 13 
HELX_P HELX_P14 AB5 ALA A 359 ? TYR A 371 ? ALA A 360 TYR A 372 1 ? 13 
HELX_P HELX_P15 AB6 ALA B 9   ? GLY B 24  ? ALA B 10  GLY B 25  1 ? 16 
HELX_P HELX_P16 AB7 THR B 44  ? GLN B 48  ? THR B 45  GLN B 49  5 ? 5  
HELX_P HELX_P17 AB8 TRP B 105 ? TYR B 115 ? TRP B 106 TYR B 116 1 ? 11 
HELX_P HELX_P18 AB9 SER B 139 ? CYS B 156 ? SER B 140 CYS B 157 1 ? 18 
HELX_P HELX_P19 AC1 THR B 161 ? GLY B 178 ? THR B 162 GLY B 179 1 ? 18 
HELX_P HELX_P20 AC2 ILE B 183 ? GLY B 192 ? ILE B 184 GLY B 193 1 ? 10 
HELX_P HELX_P21 AC3 GLU B 234 ? LEU B 249 ? GLU B 235 LEU B 250 1 ? 16 
HELX_P HELX_P22 AC4 SER B 253 ? VAL B 257 ? SER B 254 VAL B 258 5 ? 5  
HELX_P HELX_P23 AC5 GLN B 258 ? ALA B 264 ? GLN B 259 ALA B 265 1 ? 7  
HELX_P HELX_P24 AC6 SER B 270 ? ARG B 296 ? SER B 271 ARG B 297 1 ? 27 
HELX_P HELX_P25 AC7 ASP B 298 ? ASP B 316 ? ASP B 299 ASP B 317 1 ? 19 
HELX_P HELX_P26 AC8 CYS B 321 ? ALA B 333 ? CYS B 322 ALA B 334 1 ? 13 
HELX_P HELX_P27 AC9 ALA B 359 ? HIS B 370 ? ALA B 360 HIS B 371 1 ? 12 
HELX_P HELX_P28 AD1 GLN C 7   ? GLY C 24  ? GLN C 8   GLY C 25  1 ? 18 
HELX_P HELX_P29 AD2 THR C 44  ? GLN C 48  ? THR C 45  GLN C 49  5 ? 5  
HELX_P HELX_P30 AD3 ARG C 104 ? TYR C 116 ? ARG C 105 TYR C 117 1 ? 13 
HELX_P HELX_P31 AD4 SER C 139 ? CYS C 156 ? SER C 140 CYS C 157 1 ? 18 
HELX_P HELX_P32 AD5 THR C 161 ? GLY C 178 ? THR C 162 GLY C 179 1 ? 18 
HELX_P HELX_P33 AD6 ILE C 183 ? GLY C 192 ? ILE C 184 GLY C 193 1 ? 10 
HELX_P HELX_P34 AD7 SER C 233 ? LEU C 249 ? SER C 234 LEU C 250 1 ? 17 
HELX_P HELX_P35 AD8 GLN C 258 ? ALA C 264 ? GLN C 259 ALA C 265 1 ? 7  
HELX_P HELX_P36 AD9 ALA C 265 ? VAL C 269 ? ALA C 266 VAL C 270 5 ? 5  
HELX_P HELX_P37 AE1 SER C 270 ? GLU C 272 ? SER C 271 GLU C 273 5 ? 3  
HELX_P HELX_P38 AE2 PHE C 274 ? GLY C 297 ? PHE C 275 GLY C 298 1 ? 24 
HELX_P HELX_P39 AE3 ASP C 298 ? ASP C 316 ? ASP C 299 ASP C 317 1 ? 19 
HELX_P HELX_P40 AE4 CYS C 321 ? LEU C 332 ? CYS C 322 LEU C 333 1 ? 12 
HELX_P HELX_P41 AE5 ALA C 359 ? HIS C 370 ? ALA C 360 HIS C 371 1 ? 12 
HELX_P HELX_P42 AE6 VAL D 8   ? ALA D 13  ? VAL D 9   ALA D 14  1 ? 6  
HELX_P HELX_P43 AE7 GLY D 41  ? GLN D 48  ? GLY D 42  GLN D 49  5 ? 8  
HELX_P HELX_P44 AE8 TRP D 105 ? TYR D 115 ? TRP D 106 TYR D 116 1 ? 11 
HELX_P HELX_P45 AE9 SER D 139 ? CYS D 156 ? SER D 140 CYS D 157 1 ? 18 
HELX_P HELX_P46 AF1 THR D 161 ? GLU D 173 ? THR D 162 GLU D 174 1 ? 13 
HELX_P HELX_P47 AF2 ASP D 185 ? GLY D 192 ? ASP D 186 GLY D 193 1 ? 8  
HELX_P HELX_P48 AF3 GLU D 234 ? LEU D 249 ? GLU D 235 LEU D 250 1 ? 16 
HELX_P HELX_P49 AF4 SER D 253 ? VAL D 257 ? SER D 254 VAL D 258 5 ? 5  
HELX_P HELX_P50 AF5 GLN D 258 ? ALA D 264 ? GLN D 259 ALA D 265 1 ? 7  
HELX_P HELX_P51 AF6 SER D 270 ? ARG D 296 ? SER D 271 ARG D 297 1 ? 27 
HELX_P HELX_P52 AF7 ASP D 298 ? ASP D 316 ? ASP D 299 ASP D 317 1 ? 19 
HELX_P HELX_P53 AF8 CYS D 321 ? LEU D 332 ? CYS D 322 LEU D 333 1 ? 12 
HELX_P HELX_P54 AF9 ALA D 359 ? HIS D 370 ? ALA D 360 HIS D 371 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 390 SG ? ? ? 1_555 D CYS 390 SG ? ? A CYS 391 D CYS 391 1_455 ? ? ? ? ? ? ? 2.030 ? ? 
disulf2 disulf ? ? B CYS 390 SG ? ? ? 1_555 C CYS 390 SG ? ? B CYS 391 C CYS 391 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 83  A . ? GLU 84  A PRO 84  A ? PRO 85  A 1 -3.70  
2  THR 102 A . ? THR 103 A PRO 103 A ? PRO 104 A 1 -0.38  
3  ALA 119 A . ? ALA 120 A PRO 120 A ? PRO 121 A 1 -4.65  
4  GLN 5   B . ? GLN 6   B PRO 6   B ? PRO 7   B 1 -9.48  
5  GLU 83  B . ? GLU 84  B PRO 84  B ? PRO 85  B 1 -3.01  
6  THR 102 B . ? THR 103 B PRO 103 B ? PRO 104 B 1 0.84   
7  ALA 119 B . ? ALA 120 B PRO 120 B ? PRO 121 B 1 -0.90  
8  GLU 83  C . ? GLU 84  C PRO 84  C ? PRO 85  C 1 -0.64  
9  THR 102 C . ? THR 103 C PRO 103 C ? PRO 104 C 1 -4.56  
10 ALA 119 C . ? ALA 120 C PRO 120 C ? PRO 121 C 1 0.90   
11 LEU 230 C . ? LEU 231 C ALA 231 C ? ALA 232 C 1 -11.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6  ? 
AA2 ? 3  ? 
AA3 ? 4  ? 
AA4 ? 12 ? 
AA5 ? 10 ? 
AA6 ? 4  ? 
AA7 ? 4  ? 
AA8 ? 5  ? 
AA9 ? 5  ? 
AB1 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA4 5  6  ? anti-parallel 
AA4 6  7  ? anti-parallel 
AA4 7  8  ? anti-parallel 
AA4 8  9  ? anti-parallel 
AA4 9  10 ? anti-parallel 
AA4 10 11 ? parallel      
AA4 11 12 ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? anti-parallel 
AA5 5  6  ? anti-parallel 
AA5 6  7  ? anti-parallel 
AA5 7  8  ? anti-parallel 
AA5 8  9  ? anti-parallel 
AA5 9  10 ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA8 1  2  ? parallel      
AA8 2  3  ? anti-parallel 
AA8 3  4  ? anti-parallel 
AA8 4  5  ? anti-parallel 
AA9 1  2  ? parallel      
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AA9 4  5  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
AB1 3  4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ARG A 86  ? PRO A 90  ? ARG A 87  PRO A 91  
AA1 2  LEU A 71  ? THR A 76  ? LEU A 72  THR A 77  
AA1 3  PHE A 124 ? SER A 130 ? PHE A 125 SER A 131 
AA1 4  PRO A 53  ? PRO A 66  ? PRO A 54  PRO A 67  
AA1 5  LEU A 29  ? ASN A 38  ? LEU A 30  ASN A 39  
AA1 6  LYS A 387 ? CYS A 390 ? LYS A 388 CYS A 391 
AA2 1  LEU A 50  ? VAL A 51  ? LEU A 51  VAL A 52  
AA2 2  HIS A 196 ? ASP A 201 ? HIS A 197 ASP A 202 
AA2 3  THR A 207 ? PRO A 211 ? THR A 208 PRO A 212 
AA3 1  VAL A 337 ? MET A 342 ? VAL A 338 MET A 343 
AA3 2  GLY A 348 ? GLU A 356 ? GLY A 349 GLU A 357 
AA3 3  LEU A 217 ? ARG A 227 ? LEU A 218 ARG A 228 
AA3 4  THR A 376 ? LEU A 379 ? THR A 377 LEU A 380 
AA4 1  ARG B 86  ? PRO B 90  ? ARG B 87  PRO B 91  
AA4 2  LEU B 71  ? THR B 76  ? LEU B 72  THR B 77  
AA4 3  GLY B 123 ? SER B 130 ? GLY B 124 SER B 131 
AA4 4  LEU B 50  ? ARG B 67  ? LEU B 51  ARG B 68  
AA4 5  HIS B 196 ? ASP B 201 ? HIS B 197 ASP B 202 
AA4 6  THR B 207 ? PRO B 211 ? THR B 208 PRO B 212 
AA4 7  THR C 207 ? PRO C 211 ? THR C 208 PRO C 212 
AA4 8  HIS C 196 ? ASP C 201 ? HIS C 197 ASP C 202 
AA4 9  LEU C 50  ? PRO C 66  ? LEU C 51  PRO C 67  
AA4 10 PHE C 124 ? SER C 130 ? PHE C 125 SER C 131 
AA4 11 LEU C 71  ? THR C 76  ? LEU C 72  THR C 77  
AA4 12 ARG C 86  ? PRO C 90  ? ARG C 87  PRO C 91  
AA5 1  LYS B 387 ? CYS B 390 ? LYS B 388 CYS B 391 
AA5 2  LEU B 29  ? ILE B 40  ? LEU B 30  ILE B 41  
AA5 3  LEU B 50  ? ARG B 67  ? LEU B 51  ARG B 68  
AA5 4  HIS B 196 ? ASP B 201 ? HIS B 197 ASP B 202 
AA5 5  THR B 207 ? PRO B 211 ? THR B 208 PRO B 212 
AA5 6  THR C 207 ? PRO C 211 ? THR C 208 PRO C 212 
AA5 7  HIS C 196 ? ASP C 201 ? HIS C 197 ASP C 202 
AA5 8  LEU C 50  ? PRO C 66  ? LEU C 51  PRO C 67  
AA5 9  LEU C 29  ? ILE C 40  ? LEU C 30  ILE C 41  
AA5 10 LYS C 387 ? CYS C 390 ? LYS C 388 CYS C 391 
AA6 1  VAL B 337 ? MET B 342 ? VAL B 338 MET B 343 
AA6 2  GLY B 348 ? GLU B 356 ? GLY B 349 GLU B 357 
AA6 3  LEU B 217 ? ARG B 227 ? LEU B 218 ARG B 228 
AA6 4  THR B 376 ? LEU B 379 ? THR B 377 LEU B 380 
AA7 1  VAL C 337 ? MET C 342 ? VAL C 338 MET C 343 
AA7 2  GLY C 348 ? GLU C 356 ? GLY C 349 GLU C 357 
AA7 3  LEU C 217 ? ARG C 227 ? LEU C 218 ARG C 228 
AA7 4  THR C 376 ? LEU C 379 ? THR C 377 LEU C 380 
AA8 1  VAL D 72  ? THR D 76  ? VAL D 73  THR D 77  
AA8 2  PHE D 124 ? SER D 130 ? PHE D 125 SER D 131 
AA8 3  LEU D 50  ? SER D 65  ? LEU D 51  SER D 66  
AA8 4  HIS D 196 ? ASP D 201 ? HIS D 197 ASP D 202 
AA8 5  THR D 207 ? PRO D 211 ? THR D 208 PRO D 212 
AA9 1  VAL D 72  ? THR D 76  ? VAL D 73  THR D 77  
AA9 2  PHE D 124 ? SER D 130 ? PHE D 125 SER D 131 
AA9 3  LEU D 50  ? SER D 65  ? LEU D 51  SER D 66  
AA9 4  LEU D 29  ? ILE D 40  ? LEU D 30  ILE D 41  
AA9 5  LYS D 387 ? CYS D 390 ? LYS D 388 CYS D 391 
AB1 1  VAL D 337 ? THR D 343 ? VAL D 338 THR D 344 
AB1 2  GLY D 348 ? GLU D 356 ? GLY D 349 GLU D 357 
AB1 3  LEU D 217 ? ARG D 227 ? LEU D 218 ARG D 228 
AB1 4  THR D 376 ? SER D 380 ? THR D 377 SER D 381 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O LEU A 87  ? O LEU A 88  N LEU A 74  ? N LEU A 75  
AA1 2  3  N LEU A 75  ? N LEU A 76  O VAL A 128 ? O VAL A 129 
AA1 3  4  O VAL A 129 ? O VAL A 130 N VAL A 61  ? N VAL A 62  
AA1 4  5  O THR A 60  ? O THR A 61  N ALA A 33  ? N ALA A 34  
AA1 5  6  N ALA A 30  ? N ALA A 31  O LEU A 389 ? O LEU A 390 
AA2 1  2  N VAL A 51  ? N VAL A 52  O ILE A 200 ? O ILE A 201 
AA2 2  3  N ALA A 197 ? N ALA A 198 O VAL A 210 ? O VAL A 211 
AA3 1  2  N ARG A 341 ? N ARG A 342 O VAL A 352 ? O VAL A 353 
AA3 2  3  O THR A 353 ? O THR A 354 N LEU A 220 ? N LEU A 221 
AA3 3  4  N ASN A 223 ? N ASN A 224 O THR A 376 ? O THR A 377 
AA4 1  2  O LEU B 87  ? O LEU B 88  N LEU B 74  ? N LEU B 75  
AA4 2  3  N LEU B 75  ? N LEU B 76  O VAL B 128 ? O VAL B 129 
AA4 3  4  O VAL B 127 ? O VAL B 128 N VAL B 63  ? N VAL B 64  
AA4 4  5  N PRO B 53  ? N PRO B 54  O LEU B 198 ? O LEU B 199 
AA4 5  6  N ALA B 197 ? N ALA B 198 O VAL B 210 ? O VAL B 211 
AA4 6  7  N THR B 207 ? N THR B 208 O LEU C 209 ? O LEU C 210 
AA4 7  8  O VAL C 210 ? O VAL C 211 N ALA C 197 ? N ALA C 198 
AA4 8  9  O LEU C 198 ? O LEU C 199 N PRO C 53  ? N PRO C 54  
AA4 9  10 N VAL C 63  ? N VAL C 64  O VAL C 127 ? O VAL C 128 
AA4 10 11 O VAL C 128 ? O VAL C 129 N LEU C 75  ? N LEU C 76  
AA4 11 12 N VAL C 72  ? N VAL C 73  O PHE C 89  ? O PHE C 90  
AA5 1  2  O LEU B 389 ? O LEU B 390 N ALA B 30  ? N ALA B 31  
AA5 2  3  N VAL B 37  ? N VAL B 38  O MET B 54  ? O MET B 55  
AA5 3  4  N PRO B 53  ? N PRO B 54  O LEU B 198 ? O LEU B 199 
AA5 4  5  N ALA B 197 ? N ALA B 198 O VAL B 210 ? O VAL B 211 
AA5 5  6  N THR B 207 ? N THR B 208 O LEU C 209 ? O LEU C 210 
AA5 6  7  O VAL C 210 ? O VAL C 211 N ALA C 197 ? N ALA C 198 
AA5 7  8  O LEU C 198 ? O LEU C 199 N PRO C 53  ? N PRO C 54  
AA5 8  9  O THR C 60  ? O THR C 61  N ALA C 33  ? N ALA C 34  
AA5 9  10 N ALA C 30  ? N ALA C 31  O LEU C 389 ? O LEU C 390 
AA6 1  2  N ARG B 341 ? N ARG B 342 O VAL B 352 ? O VAL B 353 
AA6 2  3  O THR B 353 ? O THR B 354 N LEU B 220 ? N LEU B 221 
AA6 3  4  N ILE B 221 ? N ILE B 222 O TYR B 378 ? O TYR B 379 
AA7 1  2  N ARG C 341 ? N ARG C 342 O VAL C 352 ? O VAL C 353 
AA7 2  3  O GLY C 349 ? O GLY C 350 N SER C 224 ? N SER C 225 
AA7 3  4  N ASN C 223 ? N ASN C 224 O THR C 376 ? O THR C 377 
AA8 1  2  N SER D 73  ? N SER D 74  O ALA D 126 ? O ALA D 127 
AA8 2  3  O VAL D 129 ? O VAL D 130 N VAL D 61  ? N VAL D 62  
AA8 3  4  N VAL D 51  ? N VAL D 52  O ILE D 200 ? O ILE D 201 
AA8 4  5  N ALA D 197 ? N ALA D 198 O VAL D 210 ? O VAL D 211 
AA9 1  2  N SER D 73  ? N SER D 74  O ALA D 126 ? O ALA D 127 
AA9 2  3  O VAL D 129 ? O VAL D 130 N VAL D 61  ? N VAL D 62  
AA9 3  4  O LEU D 58  ? O LEU D 59  N GLY D 35  ? N GLY D 36  
AA9 4  5  N ALA D 30  ? N ALA D 31  O LEU D 389 ? O LEU D 390 
AB1 1  2  N ARG D 341 ? N ARG D 342 O VAL D 352 ? O VAL D 353 
AB1 2  3  O LEU D 355 ? O LEU D 356 N ALA D 218 ? N ALA D 219 
AB1 3  4  N ASN D 223 ? N ASN D 224 O THR D 376 ? O THR D 377 
# 
_atom_sites.entry_id                    6Q3W 
_atom_sites.fract_transf_matrix[1][1]   0.013650 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002528 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008710 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008418 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A 1 1   ? -15.202 -37.022  -22.232 1.00 77.48  ? 2   ALA A N   1 
ATOM   2     C CA  . ALA A 1 1   ? -16.628 -36.829  -21.999 1.00 76.27  ? 2   ALA A CA  1 
ATOM   3     C C   . ALA A 1 1   ? -16.921 -35.413  -21.513 1.00 74.41  ? 2   ALA A C   1 
ATOM   4     O O   . ALA A 1 1   ? -16.030 -34.714  -21.027 1.00 73.81  ? 2   ALA A O   1 
ATOM   5     C CB  . ALA A 1 1   ? -17.144 -37.849  -20.998 1.00 76.48  ? 2   ALA A CB  1 
ATOM   6     N N   . ALA A 1 2   ? -18.176 -34.995  -21.643 1.00 73.59  ? 3   ALA A N   1 
ATOM   7     C CA  . ALA A 1 2   ? -18.588 -33.665  -21.211 1.00 72.08  ? 3   ALA A CA  1 
ATOM   8     C C   . ALA A 1 2   ? -18.786 -33.607  -19.700 1.00 71.11  ? 3   ALA A C   1 
ATOM   9     O O   . ALA A 1 2   ? -19.354 -34.524  -19.102 1.00 70.74  ? 3   ALA A O   1 
ATOM   10    C CB  . ALA A 1 2   ? -19.862 -33.250  -21.925 1.00 71.57  ? 3   ALA A CB  1 
ATOM   11    N N   . LEU A 1 3   ? -18.321 -32.521  -19.090 1.00 70.16  ? 4   LEU A N   1 
ATOM   12    C CA  . LEU A 1 3   ? -18.455 -32.335  -17.651 1.00 69.50  ? 4   LEU A CA  1 
ATOM   13    C C   . LEU A 1 3   ? -19.922 -32.208  -17.252 1.00 69.62  ? 4   LEU A C   1 
ATOM   14    O O   . LEU A 1 3   ? -20.704 -31.535  -17.928 1.00 68.87  ? 4   LEU A O   1 
ATOM   15    C CB  . LEU A 1 3   ? -17.673 -31.101  -17.193 1.00 67.81  ? 4   LEU A CB  1 
ATOM   16    N N   . ARG A 1 4   ? -20.287 -32.869  -16.157 1.00 70.17  ? 5   ARG A N   1 
ATOM   17    C CA  . ARG A 1 4   ? -21.647 -32.806  -15.636 1.00 70.20  ? 5   ARG A CA  1 
ATOM   18    C C   . ARG A 1 4   ? -22.038 -31.366  -15.323 1.00 69.01  ? 5   ARG A C   1 
ATOM   19    O O   . ARG A 1 4   ? -21.215 -30.566  -14.877 1.00 67.80  ? 5   ARG A O   1 
ATOM   20    C CB  . ARG A 1 4   ? -21.786 -33.677  -14.383 1.00 70.79  ? 5   ARG A CB  1 
ATOM   21    N N   . GLN A 1 5   ? -23.297 -31.035  -15.579 1.00 69.04  ? 6   GLN A N   1 
ATOM   22    C CA  . GLN A 1 5   ? -23.809 -29.712  -15.267 1.00 67.47  ? 6   GLN A CA  1 
ATOM   23    C C   . GLN A 1 5   ? -24.935 -29.850  -14.255 1.00 66.65  ? 6   GLN A C   1 
ATOM   24    O O   . GLN A 1 5   ? -26.054 -30.217  -14.616 1.00 67.87  ? 6   GLN A O   1 
ATOM   25    C CB  . GLN A 1 5   ? -24.289 -29.002  -16.534 1.00 67.58  ? 6   GLN A CB  1 
ATOM   26    C CG  . GLN A 1 5   ? -23.247 -28.981  -17.644 1.00 69.05  ? 6   GLN A CG  1 
ATOM   27    C CD  . GLN A 1 5   ? -23.691 -28.196  -18.863 1.00 70.18  ? 6   GLN A CD  1 
ATOM   28    O OE1 . GLN A 1 5   ? -24.564 -27.334  -18.777 1.00 69.65  ? 6   GLN A OE1 1 
ATOM   29    N NE2 . GLN A 1 5   ? -23.093 -28.498  -20.011 1.00 71.71  ? 6   GLN A NE2 1 
ATOM   30    N N   . PRO A 1 6   ? -24.630 -29.576  -12.977 1.00 65.38  ? 7   PRO A N   1 
ATOM   31    C CA  . PRO A 1 6   ? -25.600 -29.723  -11.889 1.00 64.52  ? 7   PRO A CA  1 
ATOM   32    C C   . PRO A 1 6   ? -26.867 -28.922  -12.148 1.00 63.48  ? 7   PRO A C   1 
ATOM   33    O O   . PRO A 1 6   ? -26.787 -27.760  -12.548 1.00 62.36  ? 7   PRO A O   1 
ATOM   34    C CB  . PRO A 1 6   ? -24.848 -29.174  -10.670 1.00 64.31  ? 7   PRO A CB  1 
ATOM   35    C CG  . PRO A 1 6   ? -23.409 -29.325  -11.014 1.00 64.83  ? 7   PRO A CG  1 
ATOM   36    C CD  . PRO A 1 6   ? -23.324 -29.099  -12.492 1.00 65.06  ? 7   PRO A CD  1 
ATOM   37    N N   . GLN A 1 7   ? -28.021 -29.546  -11.937 1.00 63.97  ? 8   GLN A N   1 
ATOM   38    C CA  . GLN A 1 7   ? -29.291 -28.841  -12.038 1.00 63.50  ? 8   GLN A CA  1 
ATOM   39    C C   . GLN A 1 7   ? -29.359 -27.774  -10.954 1.00 61.01  ? 8   GLN A C   1 
ATOM   40    O O   . GLN A 1 7   ? -28.624 -27.840  -9.966  1.00 59.92  ? 8   GLN A O   1 
ATOM   41    C CB  . GLN A 1 7   ? -30.470 -29.811  -11.912 1.00 65.09  ? 8   GLN A CB  1 
ATOM   42    N N   . VAL A 1 8   ? -30.234 -26.791  -11.141 1.00 59.96  ? 9   VAL A N   1 
ATOM   43    C CA  . VAL A 1 8   ? -30.373 -25.712  -10.173 1.00 59.35  ? 9   VAL A CA  1 
ATOM   44    C C   . VAL A 1 8   ? -30.759 -26.280  -8.805  1.00 59.68  ? 9   VAL A C   1 
ATOM   45    O O   . VAL A 1 8   ? -30.381 -25.733  -7.777  1.00 58.93  ? 9   VAL A O   1 
ATOM   46    C CB  . VAL A 1 8   ? -31.412 -24.656  -10.640 1.00 63.87  ? 9   VAL A CB  1 
ATOM   47    C CG1 . VAL A 1 8   ? -32.793 -25.277  -10.800 1.00 65.50  ? 9   VAL A CG1 1 
ATOM   48    C CG2 . VAL A 1 8   ? -31.450 -23.470  -9.681  1.00 62.02  ? 9   VAL A CG2 1 
ATOM   49    N N   . ALA A 1 9   ? -31.473 -27.402  -8.802  1.00 60.33  ? 10  ALA A N   1 
ATOM   50    C CA  . ALA A 1 9   ? -31.880 -28.053  -7.561  1.00 60.04  ? 10  ALA A CA  1 
ATOM   51    C C   . ALA A 1 9   ? -30.680 -28.552  -6.748  1.00 59.48  ? 10  ALA A C   1 
ATOM   52    O O   . ALA A 1 9   ? -30.672 -28.467  -5.517  1.00 56.43  ? 10  ALA A O   1 
ATOM   53    C CB  . ALA A 1 9   ? -32.824 -29.202  -7.862  1.00 61.26  ? 10  ALA A CB  1 
ATOM   54    N N   . GLU A 1 10  ? -29.675 -29.076  -7.443  1.00 60.42  ? 11  GLU A N   1 
ATOM   55    C CA  . GLU A 1 10  ? -28.472 -29.589  -6.793  1.00 59.37  ? 11  GLU A CA  1 
ATOM   56    C C   . GLU A 1 10  ? -27.625 -28.472  -6.205  1.00 56.63  ? 11  GLU A C   1 
ATOM   57    O O   . GLU A 1 10  ? -27.152 -28.574  -5.075  1.00 56.84  ? 11  GLU A O   1 
ATOM   58    C CB  . GLU A 1 10  ? -27.636 -30.397  -7.780  1.00 61.21  ? 11  GLU A CB  1 
ATOM   59    C CG  . GLU A 1 10  ? -26.342 -30.934  -7.203  1.00 62.21  ? 11  GLU A CG  1 
ATOM   60    C CD  . GLU A 1 10  ? -25.643 -31.878  -8.155  1.00 64.41  ? 11  GLU A CD  1 
ATOM   61    O OE1 . GLU A 1 10  ? -26.341 -32.540  -8.951  1.00 65.80  ? 11  GLU A OE1 1 
ATOM   62    O OE2 . GLU A 1 10  ? -24.397 -31.955  -8.111  1.00 65.13  ? 11  GLU A OE2 1 
ATOM   63    N N   . LEU A 1 11  ? -27.420 -27.414  -6.986  1.00 53.34  ? 12  LEU A N   1 
ATOM   64    C CA  . LEU A 1 11  ? -26.682 -26.250  -6.514  1.00 49.33  ? 12  LEU A CA  1 
ATOM   65    C C   . LEU A 1 11  ? -27.436 -25.572  -5.379  1.00 47.60  ? 12  LEU A C   1 
ATOM   66    O O   . LEU A 1 11  ? -26.831 -25.082  -4.424  1.00 47.58  ? 12  LEU A O   1 
ATOM   67    C CB  . LEU A 1 11  ? -26.437 -25.265  -7.658  1.00 47.79  ? 12  LEU A CB  1 
ATOM   68    C CG  . LEU A 1 11  ? -25.480 -25.774  -8.735  1.00 48.27  ? 12  LEU A CG  1 
ATOM   69    C CD1 . LEU A 1 11  ? -25.498 -24.863  -9.948  1.00 48.52  ? 12  LEU A CD1 1 
ATOM   70    C CD2 . LEU A 1 11  ? -24.072 -25.893  -8.175  1.00 48.33  ? 12  LEU A CD2 1 
ATOM   71    N N   . LEU A 1 12  ? -28.761 -25.555  -5.491  1.00 47.65  ? 13  LEU A N   1 
ATOM   72    C CA  . LEU A 1 12  ? -29.615 -25.020  -4.439  1.00 48.83  ? 13  LEU A CA  1 
ATOM   73    C C   . LEU A 1 12  ? -29.413 -25.786  -3.134  1.00 49.19  ? 13  LEU A C   1 
ATOM   74    O O   . LEU A 1 12  ? -29.219 -25.183  -2.076  1.00 46.57  ? 13  LEU A O   1 
ATOM   75    C CB  . LEU A 1 12  ? -31.083 -25.076  -4.861  1.00 50.29  ? 13  LEU A CB  1 
ATOM   76    C CG  . LEU A 1 12  ? -32.116 -24.630  -3.825  1.00 51.35  ? 13  LEU A CG  1 
ATOM   77    C CD1 . LEU A 1 12  ? -31.805 -23.233  -3.329  1.00 49.23  ? 13  LEU A CD1 1 
ATOM   78    C CD2 . LEU A 1 12  ? -33.510 -24.694  -4.430  1.00 53.11  ? 13  LEU A CD2 1 
ATOM   79    N N   . ALA A 1 13  ? -29.455 -27.114  -3.221  1.00 48.70  ? 14  ALA A N   1 
ATOM   80    C CA  . ALA A 1 13  ? -29.288 -27.973  -2.055  1.00 52.98  ? 14  ALA A CA  1 
ATOM   81    C C   . ALA A 1 13  ? -27.923 -27.765  -1.404  1.00 53.15  ? 14  ALA A C   1 
ATOM   82    O O   . ALA A 1 13  ? -27.821 -27.673  -0.184  1.00 52.72  ? 14  ALA A O   1 
ATOM   83    C CB  . ALA A 1 13  ? -29.476 -29.436  -2.440  1.00 53.91  ? 14  ALA A CB  1 
ATOM   84    N N   . GLU A 1 14  ? -26.878 -27.687  -2.224  1.00 54.39  ? 15  GLU A N   1 
ATOM   85    C CA  . GLU A 1 14  ? -25.532 -27.445  -1.713  1.00 54.45  ? 15  GLU A CA  1 
ATOM   86    C C   . GLU A 1 14  ? -25.444 -26.091  -1.008  1.00 50.81  ? 15  GLU A C   1 
ATOM   87    O O   . GLU A 1 14  ? -24.864 -25.977  0.075   1.00 50.21  ? 15  GLU A O   1 
ATOM   88    C CB  . GLU A 1 14  ? -24.502 -27.510  -2.845  1.00 56.25  ? 15  GLU A CB  1 
ATOM   89    C CG  . GLU A 1 14  ? -23.072 -27.290  -2.368  1.00 58.06  ? 15  GLU A CG  1 
ATOM   90    C CD  . GLU A 1 14  ? -22.158 -26.761  -3.458  1.00 58.63  ? 15  GLU A CD  1 
ATOM   91    O OE1 . GLU A 1 14  ? -21.039 -26.307  -3.128  1.00 58.16  ? 15  GLU A OE1 1 
ATOM   92    O OE2 . GLU A 1 14  ? -22.557 -26.798  -4.641  1.00 59.43  ? 15  GLU A OE2 1 
ATOM   93    N N   . ALA A 1 15  ? -26.026 -25.069  -1.628  1.00 48.35  ? 16  ALA A N   1 
ATOM   94    C CA  . ALA A 1 15  ? -26.001 -23.720  -1.079  1.00 46.91  ? 16  ALA A CA  1 
ATOM   95    C C   . ALA A 1 15  ? -26.804 -23.635  0.214   1.00 47.55  ? 16  ALA A C   1 
ATOM   96    O O   . ALA A 1 15  ? -26.392 -22.970  1.170   1.00 43.84  ? 16  ALA A O   1 
ATOM   97    C CB  . ALA A 1 15  ? -26.531 -22.721  -2.102  1.00 43.67  ? 16  ALA A CB  1 
ATOM   98    N N   . ARG A 1 16  ? -27.944 -24.320  0.246   1.00 45.36  ? 17  ARG A N   1 
ATOM   99    C CA  . ARG A 1 16  ? -28.804 -24.300  1.421   1.00 49.46  ? 17  ARG A CA  1 
ATOM   100   C C   . ARG A 1 16  ? -28.137 -24.965  2.626   1.00 48.93  ? 17  ARG A C   1 
ATOM   101   O O   . ARG A 1 16  ? -28.202 -24.442  3.735   1.00 46.15  ? 17  ARG A O   1 
ATOM   102   C CB  . ARG A 1 16  ? -30.139 -24.981  1.129   1.00 52.51  ? 17  ARG A CB  1 
ATOM   103   C CG  . ARG A 1 16  ? -31.115 -24.117  0.355   1.00 56.61  ? 17  ARG A CG  1 
ATOM   104   C CD  . ARG A 1 16  ? -32.518 -24.690  0.417   1.00 61.05  ? 17  ARG A CD  1 
ATOM   105   N NE  . ARG A 1 16  ? -33.112 -24.501  1.736   1.00 64.08  ? 17  ARG A NE  1 
ATOM   106   C CZ  . ARG A 1 16  ? -34.418 -24.514  1.977   1.00 66.70  ? 17  ARG A CZ  1 
ATOM   107   N NH1 . ARG A 1 16  ? -35.278 -24.715  0.988   1.00 66.82  ? 17  ARG A NH1 1 
ATOM   108   N NH2 . ARG A 1 16  ? -34.865 -24.329  3.211   1.00 68.16  ? 17  ARG A NH2 1 
ATOM   109   N N   . ARG A 1 17  ? -27.508 -26.115  2.401   1.00 49.12  ? 18  ARG A N   1 
ATOM   110   C CA  . ARG A 1 17  ? -26.837 -26.845  3.468   1.00 50.92  ? 18  ARG A CA  1 
ATOM   111   C C   . ARG A 1 17  ? -25.661 -26.035  3.997   1.00 49.85  ? 18  ARG A C   1 
ATOM   112   O O   . ARG A 1 17  ? -25.427 -25.976  5.206   1.00 50.46  ? 18  ARG A O   1 
ATOM   113   C CB  . ARG A 1 17  ? -26.362 -28.215  2.976   1.00 53.06  ? 18  ARG A CB  1 
ATOM   114   N N   . ALA A 1 18  ? -24.930 -25.408  3.082   1.00 48.71  ? 19  ALA A N   1 
ATOM   115   C CA  . ALA A 1 18  ? -23.808 -24.553  3.450   1.00 48.28  ? 19  ALA A CA  1 
ATOM   116   C C   . ALA A 1 18  ? -24.284 -23.375  4.291   1.00 47.83  ? 19  ALA A C   1 
ATOM   117   O O   . ALA A 1 18  ? -23.683 -23.052  5.317   1.00 44.61  ? 19  ALA A O   1 
ATOM   118   C CB  . ALA A 1 18  ? -23.082 -24.060  2.206   1.00 46.11  ? 19  ALA A CB  1 
ATOM   119   N N   . PHE A 1 19  ? -25.365 -22.735  3.852   1.00 47.34  ? 20  PHE A N   1 
ATOM   120   C CA  . PHE A 1 19  ? -25.925 -21.610  4.588   1.00 46.03  ? 20  PHE A CA  1 
ATOM   121   C C   . PHE A 1 19  ? -26.358 -22.031  5.988   1.00 46.53  ? 20  PHE A C   1 
ATOM   122   O O   . PHE A 1 19  ? -26.065 -21.343  6.968   1.00 45.88  ? 20  PHE A O   1 
ATOM   123   C CB  . PHE A 1 19  ? -27.113 -20.995  3.842   1.00 44.49  ? 20  PHE A CB  1 
ATOM   124   C CG  . PHE A 1 19  ? -27.606 -19.708  4.450   1.00 44.18  ? 20  PHE A CG  1 
ATOM   125   C CD1 . PHE A 1 19  ? -28.436 -19.719  5.564   1.00 45.08  ? 20  PHE A CD1 1 
ATOM   126   C CD2 . PHE A 1 19  ? -27.238 -18.487  3.910   1.00 44.88  ? 20  PHE A CD2 1 
ATOM   127   C CE1 . PHE A 1 19  ? -28.883 -18.541  6.133   1.00 44.40  ? 20  PHE A CE1 1 
ATOM   128   C CE2 . PHE A 1 19  ? -27.688 -17.299  4.469   1.00 44.59  ? 20  PHE A CE2 1 
ATOM   129   C CZ  . PHE A 1 19  ? -28.511 -17.329  5.588   1.00 43.90  ? 20  PHE A CZ  1 
ATOM   130   N N   . ARG A 1 20  ? -27.069 -23.151  6.067   1.00 47.91  ? 21  ARG A N   1 
ATOM   131   C CA  . ARG A 1 20  ? -27.592 -23.646  7.335   1.00 49.66  ? 21  ARG A CA  1 
ATOM   132   C C   . ARG A 1 20  ? -26.472 -23.859  8.349   1.00 48.52  ? 21  ARG A C   1 
ATOM   133   O O   . ARG A 1 20  ? -26.582 -23.438  9.497   1.00 48.56  ? 21  ARG A O   1 
ATOM   134   C CB  . ARG A 1 20  ? -28.371 -24.946  7.119   1.00 52.61  ? 21  ARG A CB  1 
ATOM   135   C CG  . ARG A 1 20  ? -28.846 -25.616  8.397   1.00 54.73  ? 21  ARG A CG  1 
ATOM   136   C CD  . ARG A 1 20  ? -29.667 -24.670  9.264   1.00 54.70  ? 21  ARG A CD  1 
ATOM   137   N NE  . ARG A 1 20  ? -30.116 -25.310  10.500  1.00 56.84  ? 21  ARG A NE  1 
ATOM   138   C CZ  . ARG A 1 20  ? -29.382 -25.406  11.603  1.00 57.64  ? 21  ARG A CZ  1 
ATOM   139   N NH1 . ARG A 1 20  ? -28.156 -24.901  11.632  1.00 56.62  ? 21  ARG A NH1 1 
ATOM   140   N NH2 . ARG A 1 20  ? -29.874 -26.005  12.681  1.00 59.23  ? 21  ARG A NH2 1 
ATOM   141   N N   . GLU A 1 21  ? -25.389 -24.492  7.910   1.00 48.38  ? 22  GLU A N   1 
ATOM   142   C CA  . GLU A 1 21  ? -24.246 -24.744  8.778   1.00 49.34  ? 22  GLU A CA  1 
ATOM   143   C C   . GLU A 1 21  ? -23.514 -23.451  9.123   1.00 48.38  ? 22  GLU A C   1 
ATOM   144   O O   . GLU A 1 21  ? -22.999 -23.296  10.229  1.00 50.01  ? 22  GLU A O   1 
ATOM   145   C CB  . GLU A 1 21  ? -23.279 -25.732  8.118   1.00 50.40  ? 22  GLU A CB  1 
ATOM   146   N N   . GLU A 1 22  ? -23.474 -22.524  8.173   1.00 46.70  ? 23  GLU A N   1 
ATOM   147   C CA  . GLU A 1 22  ? -22.723 -21.287  8.342   1.00 45.35  ? 23  GLU A CA  1 
ATOM   148   C C   . GLU A 1 22  ? -23.399 -20.296  9.281   1.00 45.43  ? 23  GLU A C   1 
ATOM   149   O O   . GLU A 1 22  ? -22.750 -19.719  10.155  1.00 45.15  ? 23  GLU A O   1 
ATOM   150   C CB  . GLU A 1 22  ? -22.494 -20.616  6.991   1.00 43.03  ? 23  GLU A CB  1 
ATOM   151   C CG  . GLU A 1 22  ? -21.774 -19.282  7.066   1.00 42.17  ? 23  GLU A CG  1 
ATOM   152   C CD  . GLU A 1 22  ? -20.316 -19.426  7.447   1.00 44.78  ? 23  GLU A CD  1 
ATOM   153   O OE1 . GLU A 1 22  ? -19.818 -20.572  7.517   1.00 44.04  ? 23  GLU A OE1 1 
ATOM   154   O OE2 . GLU A 1 22  ? -19.646 -18.393  7.661   1.00 42.50  ? 23  GLU A OE2 1 
ATOM   155   N N   . PHE A 1 23  ? -24.700 -20.099  9.097   1.00 45.25  ? 24  PHE A N   1 
ATOM   156   C CA  . PHE A 1 23  ? -25.414 -19.052  9.818   1.00 44.71  ? 24  PHE A CA  1 
ATOM   157   C C   . PHE A 1 23  ? -26.368 -19.587  10.882  1.00 45.10  ? 24  PHE A C   1 
ATOM   158   O O   . PHE A 1 23  ? -27.033 -18.811  11.565  1.00 46.25  ? 24  PHE A O   1 
ATOM   159   C CB  . PHE A 1 23  ? -26.177 -18.173  8.826   1.00 44.23  ? 24  PHE A CB  1 
ATOM   160   C CG  . PHE A 1 23  ? -25.282 -17.397  7.905   1.00 43.70  ? 24  PHE A CG  1 
ATOM   161   C CD1 . PHE A 1 23  ? -24.602 -16.277  8.361   1.00 43.74  ? 24  PHE A CD1 1 
ATOM   162   C CD2 . PHE A 1 23  ? -25.106 -17.793  6.589   1.00 40.55  ? 24  PHE A CD2 1 
ATOM   163   C CE1 . PHE A 1 23  ? -23.772 -15.562  7.518   1.00 43.69  ? 24  PHE A CE1 1 
ATOM   164   C CE2 . PHE A 1 23  ? -24.279 -17.083  5.744   1.00 41.90  ? 24  PHE A CE2 1 
ATOM   165   C CZ  . PHE A 1 23  ? -23.610 -15.965  6.208   1.00 42.62  ? 24  PHE A CZ  1 
ATOM   166   N N   . GLY A 1 24  ? -26.437 -20.909  11.016  1.00 51.11  ? 25  GLY A N   1 
ATOM   167   C CA  . GLY A 1 24  ? -27.228 -21.527  12.067  1.00 53.62  ? 25  GLY A CA  1 
ATOM   168   C C   . GLY A 1 24  ? -28.725 -21.481  11.833  1.00 56.04  ? 25  GLY A C   1 
ATOM   169   O O   . GLY A 1 24  ? -29.513 -21.841  12.706  1.00 55.27  ? 25  GLY A O   1 
ATOM   170   N N   . ALA A 1 25  ? -29.121 -21.040  10.643  1.00 55.33  ? 26  ALA A N   1 
ATOM   171   C CA  . ALA A 1 25  ? -30.532 -20.962  10.292  1.00 56.31  ? 26  ALA A CA  1 
ATOM   172   C C   . ALA A 1 25  ? -30.740 -21.262  8.814   1.00 55.85  ? 26  ALA A C   1 
ATOM   173   O O   . ALA A 1 25  ? -29.798 -21.251  8.024   1.00 54.97  ? 26  ALA A O   1 
ATOM   174   C CB  . ALA A 1 25  ? -31.093 -19.592  10.640  1.00 56.21  ? 26  ALA A CB  1 
ATOM   175   N N   . GLU A 1 26  ? -31.986 -21.534  8.453   1.00 56.40  ? 27  GLU A N   1 
ATOM   176   C CA  . GLU A 1 26  ? -32.338 -21.809  7.074   1.00 55.14  ? 27  GLU A CA  1 
ATOM   177   C C   . GLU A 1 26  ? -32.425 -20.501  6.295   1.00 51.06  ? 27  GLU A C   1 
ATOM   178   O O   . GLU A 1 26  ? -32.912 -19.502  6.817   1.00 50.52  ? 27  GLU A O   1 
ATOM   179   C CB  . GLU A 1 26  ? -33.663 -22.565  7.013   1.00 59.17  ? 27  GLU A CB  1 
ATOM   180   C CG  . GLU A 1 26  ? -33.686 -23.678  5.997   1.00 61.16  ? 27  GLU A CG  1 
ATOM   181   C CD  . GLU A 1 26  ? -32.792 -24.837  6.378   1.00 64.26  ? 27  GLU A CD  1 
ATOM   182   O OE1 . GLU A 1 26  ? -31.996 -25.283  5.525   1.00 64.29  ? 27  GLU A OE1 1 
ATOM   183   O OE2 . GLU A 1 26  ? -32.890 -25.307  7.529   1.00 67.73  ? 27  GLU A OE2 1 
ATOM   184   N N   . PRO A 1 27  ? -31.936 -20.495  5.048   1.00 49.49  ? 28  PRO A N   1 
ATOM   185   C CA  . PRO A 1 27  ? -32.057 -19.305  4.199   1.00 47.13  ? 28  PRO A CA  1 
ATOM   186   C C   . PRO A 1 27  ? -33.511 -19.030  3.807   1.00 46.15  ? 28  PRO A C   1 
ATOM   187   O O   . PRO A 1 27  ? -34.316 -19.960  3.759   1.00 46.95  ? 28  PRO A O   1 
ATOM   188   C CB  . PRO A 1 27  ? -31.212 -19.661  2.972   1.00 45.33  ? 28  PRO A CB  1 
ATOM   189   C CG  . PRO A 1 27  ? -31.225 -21.151  2.928   1.00 46.78  ? 28  PRO A CG  1 
ATOM   190   C CD  . PRO A 1 27  ? -31.239 -21.598  4.364   1.00 49.59  ? 28  PRO A CD  1 
ATOM   191   N N   . GLU A 1 28  ? -33.841 -17.771  3.538   1.00 45.04  ? 29  GLU A N   1 
ATOM   192   C CA  . GLU A 1 28  ? -35.216 -17.400  3.223   1.00 46.66  ? 29  GLU A CA  1 
ATOM   193   C C   . GLU A 1 28  ? -35.409 -17.179  1.723   1.00 45.27  ? 29  GLU A C   1 
ATOM   194   O O   . GLU A 1 28  ? -36.535 -17.222  1.223   1.00 45.16  ? 29  GLU A O   1 
ATOM   195   C CB  . GLU A 1 28  ? -35.622 -16.141  3.997   1.00 49.54  ? 29  GLU A CB  1 
ATOM   196   C CG  . GLU A 1 28  ? -35.476 -16.264  5.513   1.00 54.58  ? 29  GLU A CG  1 
ATOM   197   C CD  . GLU A 1 28  ? -35.863 -14.993  6.253   1.00 59.15  ? 29  GLU A CD  1 
ATOM   198   O OE1 . GLU A 1 28  ? -36.497 -14.110  5.639   1.00 59.96  ? 29  GLU A OE1 1 
ATOM   199   O OE2 . GLU A 1 28  ? -35.542 -14.879  7.456   1.00 63.64  ? 29  GLU A OE2 1 
ATOM   200   N N   . LEU A 1 29  ? -34.303 -16.949  1.018   1.00 43.97  ? 30  LEU A N   1 
ATOM   201   C CA  . LEU A 1 29  ? -34.331 -16.586  -0.396  1.00 44.35  ? 30  LEU A CA  1 
ATOM   202   C C   . LEU A 1 29  ? -33.335 -17.400  -1.207  1.00 42.93  ? 30  LEU A C   1 
ATOM   203   O O   . LEU A 1 29  ? -32.277 -17.777  -0.702  1.00 42.66  ? 30  LEU A O   1 
ATOM   204   C CB  . LEU A 1 29  ? -34.014 -15.100  -0.572  1.00 45.29  ? 30  LEU A CB  1 
ATOM   205   C CG  . LEU A 1 29  ? -34.779 -14.100  0.286   1.00 48.64  ? 30  LEU A CG  1 
ATOM   206   C CD1 . LEU A 1 29  ? -34.229 -12.705  0.078   1.00 48.91  ? 30  LEU A CD1 1 
ATOM   207   C CD2 . LEU A 1 29  ? -36.245 -14.149  -0.057  1.00 50.36  ? 30  LEU A CD2 1 
ATOM   208   N N   . ALA A 1 30  ? -33.666 -17.646  -2.472  1.00 41.50  ? 31  ALA A N   1 
ATOM   209   C CA  . ALA A 1 30  ? -32.743 -18.294  -3.399  1.00 39.30  ? 31  ALA A CA  1 
ATOM   210   C C   . ALA A 1 30  ? -32.883 -17.710  -4.799  1.00 37.10  ? 31  ALA A C   1 
ATOM   211   O O   . ALA A 1 30  ? -33.992 -17.557  -5.305  1.00 36.74  ? 31  ALA A O   1 
ATOM   212   C CB  . ALA A 1 30  ? -32.980 -19.788  -3.429  1.00 40.21  ? 31  ALA A CB  1 
ATOM   213   N N   . VAL A 1 31  ? -31.758 -17.376  -5.419  1.00 35.07  ? 32  VAL A N   1 
ATOM   214   C CA  . VAL A 1 31  ? -31.771 -16.925  -6.804  1.00 34.15  ? 32  VAL A CA  1 
ATOM   215   C C   . VAL A 1 31  ? -30.682 -17.623  -7.601  1.00 33.50  ? 32  VAL A C   1 
ATOM   216   O O   . VAL A 1 31  ? -29.733 -18.171  -7.036  1.00 32.94  ? 32  VAL A O   1 
ATOM   217   C CB  . VAL A 1 31  ? -31.567 -15.402  -6.931  1.00 33.08  ? 32  VAL A CB  1 
ATOM   218   C CG1 . VAL A 1 31  ? -32.657 -14.643  -6.188  1.00 34.83  ? 32  VAL A CG1 1 
ATOM   219   C CG2 . VAL A 1 31  ? -30.181 -15.010  -6.436  1.00 30.52  ? 32  VAL A CG2 1 
ATOM   220   N N   . SER A 1 32  ? -30.830 -17.594  -8.920  1.00 31.97  ? 33  SER A N   1 
ATOM   221   C CA  . SER A 1 32  ? -29.827 -18.135  -9.819  1.00 31.04  ? 33  SER A CA  1 
ATOM   222   C C   . SER A 1 32  ? -29.659 -17.220  -11.022 1.00 30.66  ? 33  SER A C   1 
ATOM   223   O O   . SER A 1 32  ? -30.581 -16.495  -11.392 1.00 30.90  ? 33  SER A O   1 
ATOM   224   C CB  . SER A 1 32  ? -30.212 -19.542  -10.272 1.00 33.02  ? 33  SER A CB  1 
ATOM   225   O OG  . SER A 1 32  ? -31.506 -19.545  -10.844 1.00 33.40  ? 33  SER A OG  1 
ATOM   226   N N   . ALA A 1 33  ? -28.470 -17.244  -11.613 1.00 29.98  ? 34  ALA A N   1 
ATOM   227   C CA  . ALA A 1 33  ? -28.199 -16.518  -12.845 1.00 28.25  ? 34  ALA A CA  1 
ATOM   228   C C   . ALA A 1 33  ? -27.153 -17.289  -13.622 1.00 27.74  ? 34  ALA A C   1 
ATOM   229   O O   . ALA A 1 33  ? -26.153 -17.720  -13.057 1.00 28.63  ? 34  ALA A O   1 
ATOM   230   C CB  . ALA A 1 33  ? -27.730 -15.100  -12.561 1.00 27.12  ? 34  ALA A CB  1 
ATOM   231   N N   . PRO A 1 34  ? -27.389 -17.479  -14.926 1.00 27.63  ? 35  PRO A N   1 
ATOM   232   C CA  . PRO A 1 34  ? -26.524 -18.354  -15.714 1.00 26.07  ? 35  PRO A CA  1 
ATOM   233   C C   . PRO A 1 34  ? -25.298 -17.655  -16.282 1.00 25.35  ? 35  PRO A C   1 
ATOM   234   O O   . PRO A 1 34  ? -25.272 -16.428  -16.418 1.00 24.22  ? 35  PRO A O   1 
ATOM   235   C CB  . PRO A 1 34  ? -27.450 -18.808  -16.842 1.00 25.99  ? 35  PRO A CB  1 
ATOM   236   C CG  . PRO A 1 34  ? -28.307 -17.616  -17.077 1.00 26.29  ? 35  PRO A CG  1 
ATOM   237   C CD  . PRO A 1 34  ? -28.529 -16.983  -15.716 1.00 27.38  ? 35  PRO A CD  1 
ATOM   238   N N   . GLY A 1 35  ? -24.288 -18.449  -16.615 1.00 26.59  ? 36  GLY A N   1 
ATOM   239   C CA  . GLY A 1 35  ? -23.202 -17.980  -17.449 1.00 27.53  ? 36  GLY A CA  1 
ATOM   240   C C   . GLY A 1 35  ? -23.734 -18.067  -18.871 1.00 27.29  ? 36  GLY A C   1 
ATOM   241   O O   . GLY A 1 35  ? -24.921 -18.312  -19.075 1.00 26.17  ? 36  GLY A O   1 
ATOM   242   N N   . ARG A 1 36  ? -22.875 -17.881  -19.862 1.00 27.78  ? 37  ARG A N   1 
ATOM   243   C CA  . ARG A 1 36  ? -23.344 -17.927  -21.240 1.00 30.82  ? 37  ARG A CA  1 
ATOM   244   C C   . ARG A 1 36  ? -22.249 -18.208  -22.251 1.00 28.08  ? 37  ARG A C   1 
ATOM   245   O O   . ARG A 1 36  ? -21.058 -18.069  -21.968 1.00 27.60  ? 37  ARG A O   1 
ATOM   246   C CB  . ARG A 1 36  ? -23.969 -16.610  -21.630 1.00 34.99  ? 37  ARG A CB  1 
ATOM   247   C CG  . ARG A 1 36  ? -22.865 -15.651  -21.861 1.00 40.46  ? 37  ARG A CG  1 
ATOM   248   C CD  . ARG A 1 36  ? -22.939 -15.057  -23.246 1.00 45.64  ? 37  ARG A CD  1 
ATOM   249   N NE  . ARG A 1 36  ? -21.629 -14.599  -23.683 1.00 49.52  ? 37  ARG A NE  1 
ATOM   250   C CZ  . ARG A 1 36  ? -20.990 -13.601  -23.101 1.00 53.14  ? 37  ARG A CZ  1 
ATOM   251   N NH1 . ARG A 1 36  ? -21.545 -13.027  -22.063 1.00 55.42  ? 37  ARG A NH1 1 
ATOM   252   N NH2 . ARG A 1 36  ? -19.786 -13.215  -23.513 1.00 54.79  ? 37  ARG A NH2 1 
ATOM   253   N N   . VAL A 1 37  ? -22.685 -18.557  -23.454 1.00 29.17  ? 38  VAL A N   1 
ATOM   254   C CA  . VAL A 1 37  ? -21.799 -18.627  -24.601 1.00 28.14  ? 38  VAL A CA  1 
ATOM   255   C C   . VAL A 1 37  ? -22.344 -17.682  -25.670 1.00 28.00  ? 38  VAL A C   1 
ATOM   256   O O   . VAL A 1 37  ? -23.560 -17.523  -25.808 1.00 28.45  ? 38  VAL A O   1 
ATOM   257   C CB  . VAL A 1 37  ? -21.671 -20.073  -25.133 1.00 28.02  ? 38  VAL A CB  1 
ATOM   258   C CG1 . VAL A 1 37  ? -22.997 -20.573  -25.714 1.00 27.73  ? 38  VAL A CG1 1 
ATOM   259   C CG2 . VAL A 1 37  ? -20.546 -20.177  -26.148 1.00 28.96  ? 38  VAL A CG2 1 
ATOM   260   N N   . ASN A 1 38  ? -21.451 -17.011  -26.388 1.00 27.21  ? 39  ASN A N   1 
ATOM   261   C CA  . ASN A 1 38  ? -21.879 -16.149  -27.480 1.00 27.17  ? 39  ASN A CA  1 
ATOM   262   C C   . ASN A 1 38  ? -21.748 -16.904  -28.801 1.00 27.64  ? 39  ASN A C   1 
ATOM   263   O O   . ASN A 1 38  ? -20.643 -17.251  -29.217 1.00 29.70  ? 39  ASN A O   1 
ATOM   264   C CB  . ASN A 1 38  ? -21.066 -14.856  -27.510 1.00 26.41  ? 39  ASN A CB  1 
ATOM   265   C CG  . ASN A 1 38  ? -21.654 -13.816  -28.456 1.00 27.62  ? 39  ASN A CG  1 
ATOM   266   O OD1 . ASN A 1 38  ? -22.847 -13.836  -28.757 1.00 26.24  ? 39  ASN A OD1 1 
ATOM   267   N ND2 . ASN A 1 38  ? -20.814 -12.893  -28.919 1.00 29.25  ? 39  ASN A ND2 1 
ATOM   268   N N   . LEU A 1 39  ? -22.875 -17.180  -29.445 1.00 26.95  ? 40  LEU A N   1 
ATOM   269   C CA  . LEU A 1 39  ? -22.862 -17.982  -30.674 1.00 27.94  ? 40  LEU A CA  1 
ATOM   270   C C   . LEU A 1 39  ? -22.109 -17.267  -31.788 1.00 27.12  ? 40  LEU A C   1 
ATOM   271   O O   . LEU A 1 39  ? -21.333 -17.883  -32.515 1.00 28.68  ? 40  LEU A O   1 
ATOM   272   C CB  . LEU A 1 39  ? -24.282 -18.301  -31.130 1.00 29.14  ? 40  LEU A CB  1 
ATOM   273   C CG  . LEU A 1 39  ? -25.165 -19.064  -30.145 1.00 30.14  ? 40  LEU A CG  1 
ATOM   274   C CD1 . LEU A 1 39  ? -26.459 -19.473  -30.843 1.00 29.52  ? 40  LEU A CD1 1 
ATOM   275   C CD2 . LEU A 1 39  ? -24.434 -20.282  -29.591 1.00 31.41  ? 40  LEU A CD2 1 
ATOM   276   N N   . ILE A 1 40  ? -22.349 -15.964  -31.905 1.00 25.12  ? 41  ILE A N   1 
ATOM   277   C CA  . ILE A 1 40  ? -21.690 -15.130  -32.900 1.00 25.07  ? 41  ILE A CA  1 
ATOM   278   C C   . ILE A 1 40  ? -21.971 -13.663  -32.578 1.00 24.67  ? 41  ILE A C   1 
ATOM   279   O O   . ILE A 1 40  ? -22.944 -13.350  -31.883 1.00 24.81  ? 41  ILE A O   1 
ATOM   280   C CB  . ILE A 1 40  ? -22.167 -15.473  -34.340 1.00 27.98  ? 41  ILE A CB  1 
ATOM   281   C CG1 . ILE A 1 40  ? -21.169 -14.971  -35.386 1.00 28.95  ? 41  ILE A CG1 1 
ATOM   282   C CG2 . ILE A 1 40  ? -23.570 -14.933  -34.592 1.00 26.36  ? 41  ILE A CG2 1 
ATOM   283   C CD1 . ILE A 1 40  ? -21.537 -15.362  -36.814 1.00 30.24  ? 41  ILE A CD1 1 
ATOM   284   N N   . GLY A 1 41  ? -21.120 -12.768  -33.073 1.00 24.46  ? 42  GLY A N   1 
ATOM   285   C CA  . GLY A 1 41  ? -21.249 -11.348  -32.779 1.00 24.18  ? 42  GLY A CA  1 
ATOM   286   C C   . GLY A 1 41  ? -20.283 -10.912  -31.693 1.00 26.30  ? 42  GLY A C   1 
ATOM   287   O O   . GLY A 1 41  ? -20.690 -10.445  -30.621 1.00 25.36  ? 42  GLY A O   1 
ATOM   288   N N   . GLU A 1 42  ? -18.993 -11.065  -31.976 1.00 27.67  ? 43  GLU A N   1 
ATOM   289   C CA  . GLU A 1 42  ? -17.956 -10.832  -30.978 1.00 28.24  ? 43  GLU A CA  1 
ATOM   290   C C   . GLU A 1 42  ? -17.336 -9.451   -31.100 1.00 29.34  ? 43  GLU A C   1 
ATOM   291   O O   . GLU A 1 42  ? -17.034 -8.992   -32.205 1.00 29.64  ? 43  GLU A O   1 
ATOM   292   C CB  . GLU A 1 42  ? -16.859 -11.886  -31.096 1.00 29.44  ? 43  GLU A CB  1 
ATOM   293   C CG  . GLU A 1 42  ? -16.365 -12.406  -29.754 1.00 27.92  ? 43  GLU A CG  1 
ATOM   294   C CD  . GLU A 1 42  ? -17.447 -13.147  -28.996 1.00 25.64  ? 43  GLU A CD  1 
ATOM   295   O OE1 . GLU A 1 42  ? -18.111 -12.529  -28.141 1.00 23.71  ? 43  GLU A OE1 1 
ATOM   296   O OE2 . GLU A 1 42  ? -17.635 -14.351  -29.257 1.00 26.25  ? 43  GLU A OE2 1 
ATOM   297   N N   . HIS A 1 43  ? -17.131 -8.809   -29.952 1.00 28.83  ? 44  HIS A N   1 
ATOM   298   C CA  . HIS A 1 43  ? -16.550 -7.474   -29.880 1.00 27.39  ? 44  HIS A CA  1 
ATOM   299   C C   . HIS A 1 43  ? -17.376 -6.484   -30.674 1.00 26.45  ? 44  HIS A C   1 
ATOM   300   O O   . HIS A 1 43  ? -16.854 -5.556   -31.289 1.00 27.07  ? 44  HIS A O   1 
ATOM   301   C CB  . HIS A 1 43  ? -15.100 -7.492   -30.355 1.00 28.82  ? 44  HIS A CB  1 
ATOM   302   C CG  . HIS A 1 43  ? -14.151 -8.016   -29.326 1.00 30.72  ? 44  HIS A CG  1 
ATOM   303   N ND1 . HIS A 1 43  ? -13.705 -7.248   -28.269 1.00 31.83  ? 44  HIS A ND1 1 
ATOM   304   C CD2 . HIS A 1 43  ? -13.588 -9.237   -29.165 1.00 31.84  ? 44  HIS A CD2 1 
ATOM   305   C CE1 . HIS A 1 43  ? -12.898 -7.968   -27.514 1.00 32.09  ? 44  HIS A CE1 1 
ATOM   306   N NE2 . HIS A 1 43  ? -12.808 -9.180   -28.035 1.00 32.67  ? 44  HIS A NE2 1 
ATOM   307   N N   . THR A 1 44  ? -18.685 -6.691   -30.627 1.00 23.17  ? 45  THR A N   1 
ATOM   308   C CA  . THR A 1 44  ? -19.632 -5.792   -31.247 1.00 27.97  ? 45  THR A CA  1 
ATOM   309   C C   . THR A 1 44  ? -20.526 -5.110   -30.220 1.00 27.87  ? 45  THR A C   1 
ATOM   310   O O   . THR A 1 44  ? -21.106 -4.065   -30.515 1.00 29.11  ? 45  THR A O   1 
ATOM   311   C CB  . THR A 1 44  ? -20.516 -6.535   -32.259 1.00 26.34  ? 45  THR A CB  1 
ATOM   312   O OG1 . THR A 1 44  ? -21.151 -7.645   -31.610 1.00 27.00  ? 45  THR A OG1 1 
ATOM   313   C CG2 . THR A 1 44  ? -19.671 -7.052   -33.409 1.00 26.10  ? 45  THR A CG2 1 
ATOM   314   N N   . ASP A 1 45  ? -20.644 -5.675   -29.017 1.00 28.51  ? 46  ASP A N   1 
ATOM   315   C CA  . ASP A 1 45  ? -21.618 -5.119   -28.078 1.00 27.67  ? 46  ASP A CA  1 
ATOM   316   C C   . ASP A 1 45  ? -21.242 -3.688   -27.673 1.00 26.86  ? 46  ASP A C   1 
ATOM   317   O O   . ASP A 1 45  ? -22.103 -2.806   -27.706 1.00 27.35  ? 46  ASP A O   1 
ATOM   318   C CB  . ASP A 1 45  ? -21.836 -6.037   -26.850 1.00 27.87  ? 46  ASP A CB  1 
ATOM   319   C CG  . ASP A 1 45  ? -20.591 -6.248   -25.991 1.00 28.30  ? 46  ASP A CG  1 
ATOM   320   O OD1 . ASP A 1 45  ? -19.451 -6.009   -26.437 1.00 27.85  ? 46  ASP A OD1 1 
ATOM   321   O OD2 . ASP A 1 45  ? -20.780 -6.693   -24.837 1.00 28.05  ? 46  ASP A OD2 1 
ATOM   322   N N   . TYR A 1 46  ? -19.971 -3.424   -27.377 1.00 24.68  ? 47  TYR A N   1 
ATOM   323   C CA  . TYR A 1 46  ? -19.570 -2.056   -27.042 1.00 26.66  ? 47  TYR A CA  1 
ATOM   324   C C   . TYR A 1 46  ? -19.444 -1.160   -28.282 1.00 29.00  ? 47  TYR A C   1 
ATOM   325   O O   . TYR A 1 46  ? -19.150 0.031    -28.174 1.00 30.78  ? 47  TYR A O   1 
ATOM   326   C CB  . TYR A 1 46  ? -18.258 -2.044   -26.247 1.00 28.17  ? 47  TYR A CB  1 
ATOM   327   C CG  . TYR A 1 46  ? -17.079 -2.781   -26.862 1.00 28.60  ? 47  TYR A CG  1 
ATOM   328   C CD1 . TYR A 1 46  ? -16.242 -2.156   -27.784 1.00 29.56  ? 47  TYR A CD1 1 
ATOM   329   C CD2 . TYR A 1 46  ? -16.775 -4.082   -26.481 1.00 27.48  ? 47  TYR A CD2 1 
ATOM   330   C CE1 . TYR A 1 46  ? -15.149 -2.822   -28.330 1.00 30.55  ? 47  TYR A CE1 1 
ATOM   331   C CE2 . TYR A 1 46  ? -15.686 -4.753   -27.019 1.00 28.19  ? 47  TYR A CE2 1 
ATOM   332   C CZ  . TYR A 1 46  ? -14.876 -4.118   -27.938 1.00 29.19  ? 47  TYR A CZ  1 
ATOM   333   O OH  . TYR A 1 46  ? -13.796 -4.786   -28.473 1.00 29.68  ? 47  TYR A OH  1 
ATOM   334   N N   . ASN A 1 47  ? -19.681 -1.732   -29.457 1.00 27.96  ? 48  ASN A N   1 
ATOM   335   C CA  . ASN A 1 47  ? -19.712 -0.951   -30.689 1.00 29.32  ? 48  ASN A CA  1 
ATOM   336   C C   . ASN A 1 47  ? -21.147 -0.714   -31.143 1.00 28.56  ? 48  ASN A C   1 
ATOM   337   O O   . ASN A 1 47  ? -21.404 -0.415   -32.311 1.00 29.77  ? 48  ASN A O   1 
ATOM   338   C CB  . ASN A 1 47  ? -18.904 -1.653   -31.775 1.00 26.54  ? 48  ASN A CB  1 
ATOM   339   C CG  . ASN A 1 47  ? -17.413 -1.512   -31.560 1.00 30.35  ? 48  ASN A CG  1 
ATOM   340   O OD1 . ASN A 1 47  ? -16.902 -0.398   -31.434 1.00 29.66  ? 48  ASN A OD1 1 
ATOM   341   N ND2 . ASN A 1 47  ? -16.710 -2.635   -31.489 1.00 26.06  ? 48  ASN A ND2 1 
ATOM   342   N N   . GLN A 1 48  ? -22.071 -0.851   -30.193 1.00 29.51  ? 49  GLN A N   1 
ATOM   343   C CA  . GLN A 1 48  ? -23.505 -0.726   -30.436 1.00 31.91  ? 49  GLN A CA  1 
ATOM   344   C C   . GLN A 1 48  ? -23.946 -1.650   -31.561 1.00 31.90  ? 49  GLN A C   1 
ATOM   345   O O   . GLN A 1 48  ? -24.804 -1.295   -32.369 1.00 34.67  ? 49  GLN A O   1 
ATOM   346   C CB  . GLN A 1 48  ? -23.879 0.726    -30.755 1.00 36.99  ? 49  GLN A CB  1 
ATOM   347   C CG  . GLN A 1 48  ? -23.333 1.730    -29.752 1.00 41.54  ? 49  GLN A CG  1 
ATOM   348   C CD  . GLN A 1 48  ? -24.112 3.031    -29.734 1.00 47.00  ? 49  GLN A CD  1 
ATOM   349   O OE1 . GLN A 1 48  ? -25.282 3.076    -30.115 1.00 49.02  ? 49  GLN A OE1 1 
ATOM   350   N NE2 . GLN A 1 48  ? -23.461 4.103    -29.293 1.00 49.26  ? 49  GLN A NE2 1 
ATOM   351   N N   . GLY A 1 49  ? -23.356 -2.841   -31.602 1.00 30.33  ? 50  GLY A N   1 
ATOM   352   C CA  . GLY A 1 49  ? -23.631 -3.795   -32.659 1.00 29.92  ? 50  GLY A CA  1 
ATOM   353   C C   . GLY A 1 49  ? -24.708 -4.810   -32.324 1.00 29.96  ? 50  GLY A C   1 
ATOM   354   O O   . GLY A 1 49  ? -25.623 -4.539   -31.545 1.00 30.04  ? 50  GLY A O   1 
ATOM   355   N N   . LEU A 1 50  ? -24.601 -5.983   -32.941 1.00 26.05  ? 51  LEU A N   1 
ATOM   356   C CA  . LEU A 1 50  ? -25.528 -7.078   -32.710 1.00 24.42  ? 51  LEU A CA  1 
ATOM   357   C C   . LEU A 1 50  ? -24.771 -8.232   -32.076 1.00 24.41  ? 51  LEU A C   1 
ATOM   358   O O   . LEU A 1 50  ? -23.616 -8.483   -32.414 1.00 23.76  ? 51  LEU A O   1 
ATOM   359   C CB  . LEU A 1 50  ? -26.188 -7.530   -34.027 1.00 26.35  ? 51  LEU A CB  1 
ATOM   360   C CG  . LEU A 1 50  ? -27.009 -6.509   -34.821 1.00 25.97  ? 51  LEU A CG  1 
ATOM   361   C CD1 . LEU A 1 50  ? -27.392 -7.063   -36.204 1.00 27.54  ? 51  LEU A CD1 1 
ATOM   362   C CD2 . LEU A 1 50  ? -28.264 -6.102   -34.057 1.00 24.31  ? 51  LEU A CD2 1 
ATOM   363   N N   . VAL A 1 51  ? -25.412 -8.927   -31.144 1.00 24.10  ? 52  VAL A N   1 
ATOM   364   C CA  . VAL A 1 51  ? -24.820 -10.119  -30.555 1.00 24.26  ? 52  VAL A CA  1 
ATOM   365   C C   . VAL A 1 51  ? -25.876 -11.210  -30.470 1.00 23.99  ? 52  VAL A C   1 
ATOM   366   O O   . VAL A 1 51  ? -27.069 -10.922  -30.359 1.00 25.18  ? 52  VAL A O   1 
ATOM   367   C CB  . VAL A 1 51  ? -24.228 -9.851   -29.141 1.00 26.82  ? 52  VAL A CB  1 
ATOM   368   C CG1 . VAL A 1 51  ? -23.076 -8.859   -29.206 1.00 27.52  ? 52  VAL A CG1 1 
ATOM   369   C CG2 . VAL A 1 51  ? -25.298 -9.355   -28.185 1.00 25.97  ? 52  VAL A CG2 1 
ATOM   370   N N   . LEU A 1 52  ? -25.439 -12.462  -30.525 1.00 23.02  ? 53  LEU A N   1 
ATOM   371   C CA  . LEU A 1 52  ? -26.364 -13.581  -30.429 1.00 25.04  ? 53  LEU A CA  1 
ATOM   372   C C   . LEU A 1 52  ? -25.906 -14.618  -29.390 1.00 26.72  ? 53  LEU A C   1 
ATOM   373   O O   . LEU A 1 52  ? -25.496 -15.718  -29.744 1.00 28.70  ? 53  LEU A O   1 
ATOM   374   C CB  . LEU A 1 52  ? -26.530 -14.232  -31.813 1.00 25.57  ? 53  LEU A CB  1 
ATOM   375   C CG  . LEU A 1 52  ? -27.588 -15.323  -32.004 1.00 26.96  ? 53  LEU A CG  1 
ATOM   376   C CD1 . LEU A 1 52  ? -28.977 -14.847  -31.567 1.00 28.02  ? 53  LEU A CD1 1 
ATOM   377   C CD2 . LEU A 1 52  ? -27.604 -15.783  -33.454 1.00 27.32  ? 53  LEU A CD2 1 
ATOM   378   N N   . PRO A 1 53  ? -25.965 -14.263  -28.097 1.00 25.87  ? 54  PRO A N   1 
ATOM   379   C CA  . PRO A 1 53  ? -25.604 -15.245  -27.068 1.00 27.23  ? 54  PRO A CA  1 
ATOM   380   C C   . PRO A 1 53  ? -26.763 -16.157  -26.682 1.00 27.98  ? 54  PRO A C   1 
ATOM   381   O O   . PRO A 1 53  ? -27.902 -15.912  -27.088 1.00 28.43  ? 54  PRO A O   1 
ATOM   382   C CB  . PRO A 1 53  ? -25.212 -14.364  -25.884 1.00 27.08  ? 54  PRO A CB  1 
ATOM   383   C CG  . PRO A 1 53  ? -26.125 -13.189  -26.011 1.00 26.33  ? 54  PRO A CG  1 
ATOM   384   C CD  . PRO A 1 53  ? -26.189 -12.927  -27.512 1.00 24.88  ? 54  PRO A CD  1 
ATOM   385   N N   . MET A 1 54  ? -26.467 -17.198  -25.904 1.00 28.04  ? 55  MET A N   1 
ATOM   386   C CA  . MET A 1 54  ? -27.501 -17.982  -25.237 1.00 27.03  ? 55  MET A CA  1 
ATOM   387   C C   . MET A 1 54  ? -27.052 -18.265  -23.802 1.00 28.14  ? 55  MET A C   1 
ATOM   388   O O   . MET A 1 54  ? -25.857 -18.347  -23.521 1.00 26.80  ? 55  MET A O   1 
ATOM   389   C CB  . MET A 1 54  ? -27.803 -19.284  -26.002 1.00 28.02  ? 55  MET A CB  1 
ATOM   390   C CG  . MET A 1 54  ? -26.958 -20.497  -25.637 1.00 28.83  ? 55  MET A CG  1 
ATOM   391   S SD  . MET A 1 54  ? -27.283 -21.952  -26.687 1.00 33.75  ? 55  MET A SD  1 
ATOM   392   C CE  . MET A 1 54  ? -26.347 -23.206  -25.826 1.00 35.40  ? 55  MET A CE  1 
ATOM   393   N N   . ALA A 1 55  ? -28.010 -18.379  -22.891 1.00 29.42  ? 56  ALA A N   1 
ATOM   394   C CA  . ALA A 1 55  ? -27.696 -18.699  -21.505 1.00 32.02  ? 56  ALA A CA  1 
ATOM   395   C C   . ALA A 1 55  ? -27.346 -20.177  -21.373 1.00 33.55  ? 56  ALA A C   1 
ATOM   396   O O   . ALA A 1 55  ? -27.840 -21.017  -22.139 1.00 33.28  ? 56  ALA A O   1 
ATOM   397   C CB  . ALA A 1 55  ? -28.859 -18.339  -20.596 1.00 32.22  ? 56  ALA A CB  1 
ATOM   398   N N   . LEU A 1 56  ? -26.487 -20.483  -20.406 1.00 32.42  ? 57  LEU A N   1 
ATOM   399   C CA  . LEU A 1 56  ? -26.010 -21.843  -20.183 1.00 34.10  ? 57  LEU A CA  1 
ATOM   400   C C   . LEU A 1 56  ? -26.655 -22.474  -18.962 1.00 36.64  ? 57  LEU A C   1 
ATOM   401   O O   . LEU A 1 56  ? -27.192 -21.779  -18.098 1.00 36.78  ? 57  LEU A O   1 
ATOM   402   C CB  . LEU A 1 56  ? -24.489 -21.860  -20.008 1.00 33.32  ? 57  LEU A CB  1 
ATOM   403   C CG  . LEU A 1 56  ? -23.648 -21.411  -21.200 1.00 31.54  ? 57  LEU A CG  1 
ATOM   404   C CD1 . LEU A 1 56  ? -22.165 -21.533  -20.885 1.00 30.87  ? 57  LEU A CD1 1 
ATOM   405   C CD2 . LEU A 1 56  ? -24.013 -22.218  -22.429 1.00 32.27  ? 57  LEU A CD2 1 
ATOM   406   N N   . GLU A 1 57  ? -26.585 -23.797  -18.882 1.00 39.34  ? 58  GLU A N   1 
ATOM   407   C CA  . GLU A 1 57  ? -27.045 -24.489  -17.687 1.00 43.18  ? 58  GLU A CA  1 
ATOM   408   C C   . GLU A 1 57  ? -26.034 -24.297  -16.556 1.00 40.74  ? 58  GLU A C   1 
ATOM   409   O O   . GLU A 1 57  ? -26.364 -24.477  -15.387 1.00 41.34  ? 58  GLU A O   1 
ATOM   410   C CB  . GLU A 1 57  ? -27.285 -25.969  -17.976 1.00 49.02  ? 58  GLU A CB  1 
ATOM   411   C CG  . GLU A 1 57  ? -28.572 -26.227  -18.744 1.00 53.72  ? 58  GLU A CG  1 
ATOM   412   C CD  . GLU A 1 57  ? -28.731 -27.675  -19.156 1.00 59.83  ? 58  GLU A CD  1 
ATOM   413   O OE1 . GLU A 1 57  ? -27.772 -28.243  -19.723 1.00 62.10  ? 58  GLU A OE1 1 
ATOM   414   O OE2 . GLU A 1 57  ? -29.815 -28.247  -18.909 1.00 62.40  ? 58  GLU A OE2 1 
ATOM   415   N N   . LEU A 1 58  ? -24.810 -23.917  -16.910 1.00 37.61  ? 59  LEU A N   1 
ATOM   416   C CA  . LEU A 1 58  ? -23.840 -23.457  -15.923 1.00 37.85  ? 59  LEU A CA  1 
ATOM   417   C C   . LEU A 1 58  ? -24.354 -22.165  -15.287 1.00 37.53  ? 59  LEU A C   1 
ATOM   418   O O   . LEU A 1 58  ? -24.738 -21.228  -15.992 1.00 36.72  ? 59  LEU A O   1 
ATOM   419   C CB  . LEU A 1 58  ? -22.469 -23.230  -16.565 1.00 36.69  ? 59  LEU A CB  1 
ATOM   420   C CG  . LEU A 1 58  ? -21.858 -24.412  -17.318 1.00 37.78  ? 59  LEU A CG  1 
ATOM   421   C CD1 . LEU A 1 58  ? -20.481 -24.047  -17.846 1.00 36.54  ? 59  LEU A CD1 1 
ATOM   422   C CD2 . LEU A 1 58  ? -21.786 -25.643  -16.419 1.00 39.42  ? 59  LEU A CD2 1 
ATOM   423   N N   . MET A 1 59  ? -24.371 -22.112  -13.958 1.00 36.30  ? 60  MET A N   1 
ATOM   424   C CA  . MET A 1 59  ? -24.994 -20.983  -13.281 1.00 34.52  ? 60  MET A CA  1 
ATOM   425   C C   . MET A 1 59  ? -24.387 -20.671  -11.919 1.00 34.85  ? 60  MET A C   1 
ATOM   426   O O   . MET A 1 59  ? -23.689 -21.492  -11.329 1.00 36.12  ? 60  MET A O   1 
ATOM   427   C CB  . MET A 1 59  ? -26.487 -21.245  -13.107 1.00 34.19  ? 60  MET A CB  1 
ATOM   428   C CG  . MET A 1 59  ? -26.789 -22.332  -12.094 1.00 34.42  ? 60  MET A CG  1 
ATOM   429   S SD  . MET A 1 59  ? -28.547 -22.675  -11.931 1.00 48.28  ? 60  MET A SD  1 
ATOM   430   C CE  . MET A 1 59  ? -28.814 -23.765  -13.325 1.00 63.96  ? 60  MET A CE  1 
ATOM   431   N N   . THR A 1 60  ? -24.670 -19.468  -11.433 1.00 33.46  ? 61  THR A N   1 
ATOM   432   C CA  . THR A 1 60  ? -24.328 -19.076  -10.073 1.00 33.70  ? 61  THR A CA  1 
ATOM   433   C C   . THR A 1 60  ? -25.608 -19.015  -9.247  1.00 33.64  ? 61  THR A C   1 
ATOM   434   O O   . THR A 1 60  ? -26.617 -18.476  -9.699  1.00 31.83  ? 61  THR A O   1 
ATOM   435   C CB  . THR A 1 60  ? -23.603 -17.716  -10.035 1.00 32.62  ? 61  THR A CB  1 
ATOM   436   O OG1 . THR A 1 60  ? -22.299 -17.851  -10.613 1.00 33.54  ? 61  THR A OG1 1 
ATOM   437   C CG2 . THR A 1 60  ? -23.463 -17.214  -8.605  1.00 32.36  ? 61  THR A CG2 1 
ATOM   438   N N   . VAL A 1 61  ? -25.572 -19.594  -8.051  1.00 33.45  ? 62  VAL A N   1 
ATOM   439   C CA  . VAL A 1 61  ? -26.731 -19.592  -7.168  1.00 34.09  ? 62  VAL A CA  1 
ATOM   440   C C   . VAL A 1 61  ? -26.401 -18.891  -5.851  1.00 34.45  ? 62  VAL A C   1 
ATOM   441   O O   . VAL A 1 61  ? -25.362 -19.143  -5.253  1.00 33.38  ? 62  VAL A O   1 
ATOM   442   C CB  . VAL A 1 61  ? -27.229 -21.029  -6.888  1.00 35.68  ? 62  VAL A CB  1 
ATOM   443   C CG1 . VAL A 1 61  ? -28.207 -21.053  -5.713  1.00 36.64  ? 62  VAL A CG1 1 
ATOM   444   C CG2 . VAL A 1 61  ? -27.866 -21.625  -8.136  1.00 35.78  ? 62  VAL A CG2 1 
ATOM   445   N N   . LEU A 1 62  ? -27.279 -17.987  -5.430  1.00 35.57  ? 63  LEU A N   1 
ATOM   446   C CA  . LEU A 1 62  ? -27.166 -17.342  -4.131  1.00 37.93  ? 63  LEU A CA  1 
ATOM   447   C C   . LEU A 1 62  ? -28.345 -17.733  -3.265  1.00 37.54  ? 63  LEU A C   1 
ATOM   448   O O   . LEU A 1 62  ? -29.489 -17.675  -3.713  1.00 36.68  ? 63  LEU A O   1 
ATOM   449   C CB  . LEU A 1 62  ? -27.122 -15.821  -4.269  1.00 41.37  ? 63  LEU A CB  1 
ATOM   450   C CG  . LEU A 1 62  ? -25.778 -15.104  -4.228  1.00 43.40  ? 63  LEU A CG  1 
ATOM   451   C CD1 . LEU A 1 62  ? -25.083 -15.223  -5.575  1.00 43.58  ? 63  LEU A CD1 1 
ATOM   452   C CD2 . LEU A 1 62  ? -25.978 -13.647  -3.847  1.00 43.63  ? 63  LEU A CD2 1 
ATOM   453   N N   . VAL A 1 63  ? -28.073 -18.146  -2.031  1.00 37.78  ? 64  VAL A N   1 
ATOM   454   C CA  . VAL A 1 63  ? -29.138 -18.314  -1.059  1.00 39.13  ? 64  VAL A CA  1 
ATOM   455   C C   . VAL A 1 63  ? -28.836 -17.401  0.120   1.00 42.07  ? 64  VAL A C   1 
ATOM   456   O O   . VAL A 1 63  ? -27.674 -17.134  0.417   1.00 43.10  ? 64  VAL A O   1 
ATOM   457   C CB  . VAL A 1 63  ? -29.290 -19.779  -0.594  1.00 39.87  ? 64  VAL A CB  1 
ATOM   458   C CG1 . VAL A 1 63  ? -29.544 -20.682  -1.779  1.00 37.97  ? 64  VAL A CG1 1 
ATOM   459   C CG2 . VAL A 1 63  ? -28.059 -20.242  0.187   1.00 39.37  ? 64  VAL A CG2 1 
ATOM   460   N N   . GLY A 1 64  ? -29.872 -16.899  0.780   1.00 42.54  ? 65  GLY A N   1 
ATOM   461   C CA  . GLY A 1 64  ? -29.649 -15.952  1.850   1.00 42.59  ? 65  GLY A CA  1 
ATOM   462   C C   . GLY A 1 64  ? -30.875 -15.373  2.519   1.00 43.51  ? 65  GLY A C   1 
ATOM   463   O O   . GLY A 1 64  ? -32.012 -15.705  2.177   1.00 44.04  ? 65  GLY A O   1 
ATOM   464   N N   . SER A 1 65  ? -30.625 -14.495  3.486   1.00 41.66  ? 66  SER A N   1 
ATOM   465   C CA  . SER A 1 65  ? -31.678 -13.860  4.266   1.00 42.44  ? 66  SER A CA  1 
ATOM   466   C C   . SER A 1 65  ? -31.333 -12.398  4.528   1.00 42.22  ? 66  SER A C   1 
ATOM   467   O O   . SER A 1 65  ? -30.157 -12.044  4.619   1.00 42.41  ? 66  SER A O   1 
ATOM   468   C CB  . SER A 1 65  ? -31.877 -14.592  5.598   1.00 43.01  ? 66  SER A CB  1 
ATOM   469   O OG  . SER A 1 65  ? -31.965 -15.992  5.407   1.00 43.89  ? 66  SER A OG  1 
ATOM   470   N N   . PRO A 1 66  ? -32.356 -11.544  4.666   1.00 41.68  ? 67  PRO A N   1 
ATOM   471   C CA  . PRO A 1 66  ? -32.074 -10.153  5.033   1.00 40.83  ? 67  PRO A CA  1 
ATOM   472   C C   . PRO A 1 66  ? -31.613 -10.055  6.486   1.00 40.55  ? 67  PRO A C   1 
ATOM   473   O O   . PRO A 1 66  ? -32.054 -10.850  7.317   1.00 40.51  ? 67  PRO A O   1 
ATOM   474   C CB  . PRO A 1 66  ? -33.421 -9.456   4.829   1.00 41.74  ? 67  PRO A CB  1 
ATOM   475   C CG  . PRO A 1 66  ? -34.432 -10.537  5.051   1.00 43.48  ? 67  PRO A CG  1 
ATOM   476   C CD  . PRO A 1 66  ? -33.800 -11.808  4.541   1.00 42.76  ? 67  PRO A CD  1 
ATOM   477   N N   . ARG A 1 67  ? -30.727 -9.108   6.782   1.00 40.71  ? 68  ARG A N   1 
ATOM   478   C CA  . ARG A 1 67  ? -30.300 -8.865   8.161   1.00 42.49  ? 68  ARG A CA  1 
ATOM   479   C C   . ARG A 1 67  ? -30.903 -7.562   8.665   1.00 45.06  ? 68  ARG A C   1 
ATOM   480   O O   . ARG A 1 67  ? -31.352 -6.730   7.872   1.00 44.76  ? 68  ARG A O   1 
ATOM   481   C CB  . ARG A 1 67  ? -28.776 -8.804   8.273   1.00 40.93  ? 68  ARG A CB  1 
ATOM   482   C CG  . ARG A 1 67  ? -28.049 -10.099  7.960   1.00 39.92  ? 68  ARG A CG  1 
ATOM   483   C CD  . ARG A 1 67  ? -26.537 -9.886   7.967   1.00 39.02  ? 68  ARG A CD  1 
ATOM   484   N NE  . ARG A 1 67  ? -26.029 -9.529   9.294   1.00 40.80  ? 68  ARG A NE  1 
ATOM   485   C CZ  . ARG A 1 67  ? -25.330 -10.348  10.077  1.00 40.75  ? 68  ARG A CZ  1 
ATOM   486   N NH1 . ARG A 1 67  ? -25.043 -11.578  9.672   1.00 39.50  ? 68  ARG A NH1 1 
ATOM   487   N NH2 . ARG A 1 67  ? -24.910 -9.935   11.267  1.00 42.72  ? 68  ARG A NH2 1 
ATOM   488   N N   . LYS A 1 68  ? -30.900 -7.379   9.981   1.00 47.75  ? 69  LYS A N   1 
ATOM   489   C CA  . LYS A 1 68  ? -31.449 -6.168   10.580  1.00 49.84  ? 69  LYS A CA  1 
ATOM   490   C C   . LYS A 1 68  ? -30.359 -5.201   11.049  1.00 50.64  ? 69  LYS A C   1 
ATOM   491   O O   . LYS A 1 68  ? -30.664 -4.114   11.534  1.00 53.85  ? 69  LYS A O   1 
ATOM   492   C CB  . LYS A 1 68  ? -32.365 -6.526   11.754  1.00 51.24  ? 69  LYS A CB  1 
ATOM   493   N N   . ASP A 1 69  ? -29.095 -5.585   10.896  1.00 48.18  ? 70  ASP A N   1 
ATOM   494   C CA  . ASP A 1 69  ? -27.995 -4.773   11.415  1.00 48.61  ? 70  ASP A CA  1 
ATOM   495   C C   . ASP A 1 69  ? -27.204 -4.036   10.333  1.00 48.82  ? 70  ASP A C   1 
ATOM   496   O O   . ASP A 1 69  ? -26.142 -3.479   10.610  1.00 49.83  ? 70  ASP A O   1 
ATOM   497   C CB  . ASP A 1 69  ? -27.042 -5.640   12.249  1.00 46.62  ? 70  ASP A CB  1 
ATOM   498   C CG  . ASP A 1 69  ? -26.438 -6.792   11.458  1.00 44.78  ? 70  ASP A CG  1 
ATOM   499   O OD1 . ASP A 1 69  ? -26.553 -6.808   10.210  1.00 42.95  ? 70  ASP A OD1 1 
ATOM   500   O OD2 . ASP A 1 69  ? -25.838 -7.686   12.094  1.00 44.48  ? 70  ASP A OD2 1 
ATOM   501   N N   . GLY A 1 70  ? -27.711 -4.047   9.104   1.00 47.98  ? 71  GLY A N   1 
ATOM   502   C CA  . GLY A 1 70  ? -27.103 -3.291   8.020   1.00 45.87  ? 71  GLY A CA  1 
ATOM   503   C C   . GLY A 1 70  ? -25.721 -3.766   7.604   1.00 44.79  ? 71  GLY A C   1 
ATOM   504   O O   . GLY A 1 70  ? -24.980 -3.045   6.935   1.00 45.08  ? 71  GLY A O   1 
ATOM   505   N N   . LEU A 1 71  ? -25.370 -4.986   7.996   1.00 43.83  ? 72  LEU A N   1 
ATOM   506   C CA  . LEU A 1 71  ? -24.097 -5.577   7.601   1.00 41.67  ? 72  LEU A CA  1 
ATOM   507   C C   . LEU A 1 71  ? -24.312 -6.610   6.502   1.00 39.17  ? 72  LEU A C   1 
ATOM   508   O O   . LEU A 1 71  ? -25.383 -7.209   6.404   1.00 39.44  ? 72  LEU A O   1 
ATOM   509   C CB  . LEU A 1 71  ? -23.404 -6.220   8.808   1.00 42.45  ? 72  LEU A CB  1 
ATOM   510   N N   . VAL A 1 72  ? -23.296 -6.813   5.671   1.00 36.76  ? 73  VAL A N   1 
ATOM   511   C CA  . VAL A 1 72  ? -23.363 -7.847   4.649   1.00 35.88  ? 73  VAL A CA  1 
ATOM   512   C C   . VAL A 1 72  ? -22.353 -8.934   4.977   1.00 35.78  ? 73  VAL A C   1 
ATOM   513   O O   . VAL A 1 72  ? -21.175 -8.650   5.166   1.00 36.54  ? 73  VAL A O   1 
ATOM   514   C CB  . VAL A 1 72  ? -23.084 -7.291   3.238   1.00 33.91  ? 73  VAL A CB  1 
ATOM   515   C CG1 . VAL A 1 72  ? -23.204 -8.400   2.197   1.00 32.78  ? 73  VAL A CG1 1 
ATOM   516   C CG2 . VAL A 1 72  ? -24.031 -6.153   2.922   1.00 33.14  ? 73  VAL A CG2 1 
ATOM   517   N N   . SER A 1 73  ? -22.820 -10.176  5.046   1.00 35.67  ? 74  SER A N   1 
ATOM   518   C CA  . SER A 1 73  ? -21.962 -11.303  5.404   1.00 36.26  ? 74  SER A CA  1 
ATOM   519   C C   . SER A 1 73  ? -22.023 -12.378  4.322   1.00 36.51  ? 74  SER A C   1 
ATOM   520   O O   . SER A 1 73  ? -23.084 -12.944  4.061   1.00 32.68  ? 74  SER A O   1 
ATOM   521   C CB  . SER A 1 73  ? -22.378 -11.884  6.759   1.00 34.60  ? 74  SER A CB  1 
ATOM   522   O OG  . SER A 1 73  ? -21.619 -13.037  7.081   1.00 38.86  ? 74  SER A OG  1 
ATOM   523   N N   . LEU A 1 74  ? -20.877 -12.660  3.710   1.00 34.47  ? 75  LEU A N   1 
ATOM   524   C CA  . LEU A 1 74  ? -20.823 -13.537  2.546   1.00 34.70  ? 75  LEU A CA  1 
ATOM   525   C C   . LEU A 1 74  ? -19.955 -14.765  2.764   1.00 35.11  ? 75  LEU A C   1 
ATOM   526   O O   . LEU A 1 74  ? -18.980 -14.733  3.517   1.00 32.89  ? 75  LEU A O   1 
ATOM   527   C CB  . LEU A 1 74  ? -20.298 -12.771  1.328   1.00 33.34  ? 75  LEU A CB  1 
ATOM   528   C CG  . LEU A 1 74  ? -21.014 -11.472  0.967   1.00 32.72  ? 75  LEU A CG  1 
ATOM   529   C CD1 . LEU A 1 74  ? -20.288 -10.763  -0.167  1.00 33.24  ? 75  LEU A CD1 1 
ATOM   530   C CD2 . LEU A 1 74  ? -22.458 -11.768  0.585   1.00 31.28  ? 75  LEU A CD2 1 
ATOM   531   N N   . LEU A 1 75  ? -20.320 -15.843  2.080   1.00 33.36  ? 76  LEU A N   1 
ATOM   532   C CA  . LEU A 1 75  ? -19.498 -17.041  2.014   1.00 34.83  ? 76  LEU A CA  1 
ATOM   533   C C   . LEU A 1 75  ? -19.636 -17.666  0.633   1.00 34.43  ? 76  LEU A C   1 
ATOM   534   O O   . LEU A 1 75  ? -20.743 -17.800  0.120   1.00 33.17  ? 76  LEU A O   1 
ATOM   535   C CB  . LEU A 1 75  ? -19.903 -18.052  3.086   1.00 36.16  ? 76  LEU A CB  1 
ATOM   536   C CG  . LEU A 1 75  ? -19.468 -19.500  2.831   1.00 38.39  ? 76  LEU A CG  1 
ATOM   537   C CD1 . LEU A 1 75  ? -17.948 -19.660  2.915   1.00 39.50  ? 76  LEU A CD1 1 
ATOM   538   C CD2 . LEU A 1 75  ? -20.165 -20.451  3.792   1.00 40.66  ? 76  LEU A CD2 1 
ATOM   539   N N   . THR A 1 76  ? -18.517 -18.040  0.028   1.00 35.59  ? 77  THR A N   1 
ATOM   540   C CA  . THR A 1 76  ? -18.584 -18.809  -1.203  1.00 37.60  ? 77  THR A CA  1 
ATOM   541   C C   . THR A 1 76  ? -17.901 -20.155  -1.011  1.00 42.30  ? 77  THR A C   1 
ATOM   542   O O   . THR A 1 76  ? -16.949 -20.281  -0.238  1.00 44.07  ? 77  THR A O   1 
ATOM   543   C CB  . THR A 1 76  ? -17.954 -18.055  -2.399  1.00 35.93  ? 77  THR A CB  1 
ATOM   544   O OG1 . THR A 1 76  ? -18.085 -18.852  -3.587  1.00 36.18  ? 77  THR A OG1 1 
ATOM   545   C CG2 . THR A 1 76  ? -16.482 -17.754  -2.145  1.00 35.35  ? 77  THR A CG2 1 
ATOM   546   N N   . THR A 1 77  ? -18.417 -21.164  -1.702  1.00 45.83  ? 78  THR A N   1 
ATOM   547   C CA  . THR A 1 77  ? -17.878 -22.515  -1.628  1.00 50.40  ? 78  THR A CA  1 
ATOM   548   C C   . THR A 1 77  ? -17.109 -22.869  -2.894  1.00 53.62  ? 78  THR A C   1 
ATOM   549   O O   . THR A 1 77  ? -16.582 -23.971  -3.021  1.00 54.68  ? 78  THR A O   1 
ATOM   550   C CB  . THR A 1 77  ? -18.992 -23.552  -1.421  1.00 51.95  ? 78  THR A CB  1 
ATOM   551   O OG1 . THR A 1 77  ? -19.866 -23.543  -2.556  1.00 51.16  ? 78  THR A OG1 1 
ATOM   552   C CG2 . THR A 1 77  ? -19.795 -23.228  -0.174  1.00 52.70  ? 78  THR A CG2 1 
ATOM   553   N N   . SER A 1 78  ? -17.056 -21.933  -3.834  1.00 57.19  ? 79  SER A N   1 
ATOM   554   C CA  . SER A 1 78  ? -16.338 -22.153  -5.080  1.00 62.09  ? 79  SER A CA  1 
ATOM   555   C C   . SER A 1 78  ? -14.838 -22.251  -4.847  1.00 67.26  ? 79  SER A C   1 
ATOM   556   O O   . SER A 1 78  ? -14.211 -21.295  -4.400  1.00 67.88  ? 79  SER A O   1 
ATOM   557   C CB  . SER A 1 78  ? -16.627 -21.028  -6.078  1.00 60.57  ? 79  SER A CB  1 
ATOM   558   O OG  . SER A 1 78  ? -18.017 -20.785  -6.194  1.00 60.26  ? 79  SER A OG  1 
ATOM   559   N N   . GLU A 1 79  ? -14.264 -23.412  -5.138  1.00 73.44  ? 80  GLU A N   1 
ATOM   560   C CA  . GLU A 1 79  ? -12.816 -23.515  -5.212  1.00 75.92  ? 80  GLU A CA  1 
ATOM   561   C C   . GLU A 1 79  ? -12.393 -22.788  -6.483  1.00 75.74  ? 80  GLU A C   1 
ATOM   562   O O   . GLU A 1 79  ? -13.075 -22.866  -7.506  1.00 75.83  ? 80  GLU A O   1 
ATOM   563   C CB  . GLU A 1 79  ? -12.353 -24.974  -5.218  1.00 77.96  ? 80  GLU A CB  1 
ATOM   564   N N   . GLY A 1 80  ? -11.281 -22.069  -6.416  1.00 69.43  ? 81  GLY A N   1 
ATOM   565   C CA  . GLY A 1 80  ? -10.897 -21.184  -7.497  1.00 63.98  ? 81  GLY A CA  1 
ATOM   566   C C   . GLY A 1 80  ? -11.116 -19.750  -7.060  1.00 58.70  ? 81  GLY A C   1 
ATOM   567   O O   . GLY A 1 80  ? -10.420 -18.839  -7.504  1.00 59.01  ? 81  GLY A O   1 
ATOM   568   N N   . ALA A 1 81  ? -12.097 -19.551  -6.184  1.00 53.69  ? 82  ALA A N   1 
ATOM   569   C CA  . ALA A 1 81  ? -12.299 -18.254  -5.552  1.00 48.78  ? 82  ALA A CA  1 
ATOM   570   C C   . ALA A 1 81  ? -11.131 -17.965  -4.619  1.00 45.65  ? 82  ALA A C   1 
ATOM   571   O O   . ALA A 1 81  ? -10.662 -18.853  -3.908  1.00 44.85  ? 82  ALA A O   1 
ATOM   572   C CB  . ALA A 1 81  ? -13.613 -18.221  -4.793  1.00 48.21  ? 82  ALA A CB  1 
ATOM   573   N N   . ASP A 1 82  ? -10.659 -16.724  -4.626  1.00 44.07  ? 83  ASP A N   1 
ATOM   574   C CA  . ASP A 1 82  ? -9.497  -16.363  -3.828  1.00 44.36  ? 83  ASP A CA  1 
ATOM   575   C C   . ASP A 1 82  ? -9.842  -16.226  -2.344  1.00 44.40  ? 83  ASP A C   1 
ATOM   576   O O   . ASP A 1 82  ? -10.983 -15.933  -1.982  1.00 43.03  ? 83  ASP A O   1 
ATOM   577   C CB  . ASP A 1 82  ? -8.870  -15.070  -4.353  1.00 44.56  ? 83  ASP A CB  1 
ATOM   578   C CG  . ASP A 1 82  ? -9.872  -13.943  -4.481  1.00 44.85  ? 83  ASP A CG  1 
ATOM   579   O OD1 . ASP A 1 82  ? -11.058 -14.218  -4.768  1.00 44.52  ? 83  ASP A OD1 1 
ATOM   580   O OD2 . ASP A 1 82  ? -9.464  -12.776  -4.313  1.00 44.96  ? 83  ASP A OD2 1 
ATOM   581   N N   . GLU A 1 83  ? -8.846  -16.454  -1.493  1.00 44.86  ? 84  GLU A N   1 
ATOM   582   C CA  . GLU A 1 83  ? -9.024  -16.366  -0.046  1.00 45.61  ? 84  GLU A CA  1 
ATOM   583   C C   . GLU A 1 83  ? -9.136  -14.912  0.415   1.00 44.43  ? 84  GLU A C   1 
ATOM   584   O O   . GLU A 1 83  ? -8.551  -14.021  -0.197  1.00 43.28  ? 84  GLU A O   1 
ATOM   585   C CB  . GLU A 1 83  ? -7.861  -17.059  0.677   1.00 47.24  ? 84  GLU A CB  1 
ATOM   586   N N   . PRO A 1 84  ? -9.899  -14.666  1.494   1.00 43.98  ? 85  PRO A N   1 
ATOM   587   C CA  . PRO A 1 84  ? -10.698 -15.656  2.228   1.00 42.59  ? 85  PRO A CA  1 
ATOM   588   C C   . PRO A 1 84  ? -12.017 -15.986  1.528   1.00 40.30  ? 85  PRO A C   1 
ATOM   589   O O   . PRO A 1 84  ? -12.498 -15.183  0.734   1.00 39.05  ? 85  PRO A O   1 
ATOM   590   C CB  . PRO A 1 84  ? -10.960 -14.963  3.563   1.00 41.59  ? 85  PRO A CB  1 
ATOM   591   C CG  . PRO A 1 84  ? -10.990 -13.516  3.213   1.00 41.48  ? 85  PRO A CG  1 
ATOM   592   C CD  . PRO A 1 84  ? -9.952  -13.339  2.135   1.00 42.99  ? 85  PRO A CD  1 
ATOM   593   N N   . GLN A 1 85  ? -12.588 -17.146  1.838   1.00 40.01  ? 86  GLN A N   1 
ATOM   594   C CA  . GLN A 1 85  ? -13.868 -17.556  1.273   1.00 41.78  ? 86  GLN A CA  1 
ATOM   595   C C   . GLN A 1 85  ? -15.037 -16.874  1.978   1.00 40.37  ? 86  GLN A C   1 
ATOM   596   O O   . GLN A 1 85  ? -16.194 -17.068  1.606   1.00 40.85  ? 86  GLN A O   1 
ATOM   597   C CB  . GLN A 1 85  ? -14.027 -19.078  1.352   1.00 44.23  ? 86  GLN A CB  1 
ATOM   598   N N   . ARG A 1 86  ? -14.731 -16.081  3.001   1.00 37.37  ? 87  ARG A N   1 
ATOM   599   C CA  . ARG A 1 86  ? -15.753 -15.325  3.713   1.00 38.04  ? 87  ARG A CA  1 
ATOM   600   C C   . ARG A 1 86  ? -15.393 -13.851  3.769   1.00 37.69  ? 87  ARG A C   1 
ATOM   601   O O   . ARG A 1 86  ? -14.219 -13.491  3.814   1.00 38.65  ? 87  ARG A O   1 
ATOM   602   C CB  . ARG A 1 86  ? -15.943 -15.860  5.134   1.00 39.19  ? 87  ARG A CB  1 
ATOM   603   C CG  . ARG A 1 86  ? -16.108 -17.361  5.202   1.00 40.91  ? 87  ARG A CG  1 
ATOM   604   C CD  . ARG A 1 86  ? -15.787 -17.904  6.585   1.00 41.70  ? 87  ARG A CD  1 
ATOM   605   N NE  . ARG A 1 86  ? -15.448 -19.324  6.516   1.00 42.83  ? 87  ARG A NE  1 
ATOM   606   C CZ  . ARG A 1 86  ? -16.340 -20.303  6.599   1.00 45.21  ? 87  ARG A CZ  1 
ATOM   607   N NH1 . ARG A 1 86  ? -15.962 -21.570  6.523   1.00 47.89  ? 87  ARG A NH1 1 
ATOM   608   N NH2 . ARG A 1 86  ? -17.613 -20.011  6.771   1.00 45.25  ? 87  ARG A NH2 1 
ATOM   609   N N   . LEU A 1 87  ? -16.410 -13.001  3.764   1.00 36.34  ? 88  LEU A N   1 
ATOM   610   C CA  . LEU A 1 87  ? -16.191 -11.574  3.912   1.00 36.46  ? 88  LEU A CA  1 
ATOM   611   C C   . LEU A 1 87  ? -17.405 -10.913  4.540   1.00 34.39  ? 88  LEU A C   1 
ATOM   612   O O   . LEU A 1 87  ? -18.547 -11.270  4.238   1.00 33.02  ? 88  LEU A O   1 
ATOM   613   C CB  . LEU A 1 87  ? -15.881 -10.923  2.560   1.00 35.96  ? 88  LEU A CB  1 
ATOM   614   C CG  . LEU A 1 87  ? -15.279 -9.521   2.678   1.00 36.86  ? 88  LEU A CG  1 
ATOM   615   C CD1 . LEU A 1 87  ? -13.924 -9.585   3.385   1.00 37.90  ? 88  LEU A CD1 1 
ATOM   616   C CD2 . LEU A 1 87  ? -15.146 -8.858   1.323   1.00 36.21  ? 88  LEU A CD2 1 
ATOM   617   N N   . GLN A 1 88  ? -17.147 -9.952   5.419   1.00 35.47  ? 89  GLN A N   1 
ATOM   618   C CA  . GLN A 1 88  ? -18.200 -9.131   6.001   1.00 35.94  ? 89  GLN A CA  1 
ATOM   619   C C   . GLN A 1 88  ? -17.835 -7.659   5.873   1.00 36.70  ? 89  GLN A C   1 
ATOM   620   O O   . GLN A 1 88  ? -16.669 -7.285   5.969   1.00 34.70  ? 89  GLN A O   1 
ATOM   621   C CB  . GLN A 1 88  ? -18.445 -9.488   7.471   1.00 35.26  ? 89  GLN A CB  1 
ATOM   622   C CG  . GLN A 1 88  ? -18.718 -10.957  7.722   1.00 35.46  ? 89  GLN A CG  1 
ATOM   623   C CD  . GLN A 1 88  ? -17.474 -11.708  8.147   1.00 37.98  ? 89  GLN A CD  1 
ATOM   624   O OE1 . GLN A 1 88  ? -16.618 -11.167  8.853   1.00 37.64  ? 89  GLN A OE1 1 
ATOM   625   N NE2 . GLN A 1 88  ? -17.363 -12.961  7.722   1.00 37.60  ? 89  GLN A NE2 1 
ATOM   626   N N   . PHE A 1 89  ? -18.842 -6.831   5.646   1.00 36.67  ? 90  PHE A N   1 
ATOM   627   C CA  . PHE A 1 89  ? -18.634 -5.405   5.488   1.00 37.43  ? 90  PHE A CA  1 
ATOM   628   C C   . PHE A 1 89  ? -19.947 -4.693   5.739   1.00 38.73  ? 90  PHE A C   1 
ATOM   629   O O   . PHE A 1 89  ? -21.015 -5.256   5.505   1.00 34.09  ? 90  PHE A O   1 
ATOM   630   C CB  . PHE A 1 89  ? -18.078 -5.071   4.089   1.00 36.38  ? 90  PHE A CB  1 
ATOM   631   C CG  . PHE A 1 89  ? -18.895 -5.622   2.941   1.00 35.32  ? 90  PHE A CG  1 
ATOM   632   C CD1 . PHE A 1 89  ? -19.923 -4.879   2.380   1.00 35.94  ? 90  PHE A CD1 1 
ATOM   633   C CD2 . PHE A 1 89  ? -18.613 -6.870   2.404   1.00 35.14  ? 90  PHE A CD2 1 
ATOM   634   C CE1 . PHE A 1 89  ? -20.668 -5.380   1.318   1.00 34.79  ? 90  PHE A CE1 1 
ATOM   635   C CE2 . PHE A 1 89  ? -19.355 -7.377   1.341   1.00 35.09  ? 90  PHE A CE2 1 
ATOM   636   C CZ  . PHE A 1 89  ? -20.383 -6.630   0.799   1.00 33.58  ? 90  PHE A CZ  1 
ATOM   637   N N   . PRO A 1 90  ? -19.879 -3.457   6.246   1.00 40.09  ? 91  PRO A N   1 
ATOM   638   C CA  . PRO A 1 90  ? -21.129 -2.719   6.420   1.00 41.86  ? 91  PRO A CA  1 
ATOM   639   C C   . PRO A 1 90  ? -21.658 -2.242   5.073   1.00 41.71  ? 91  PRO A C   1 
ATOM   640   O O   . PRO A 1 90  ? -20.884 -2.103   4.124   1.00 41.85  ? 91  PRO A O   1 
ATOM   641   C CB  . PRO A 1 90  ? -20.720 -1.543   7.311   1.00 43.30  ? 91  PRO A CB  1 
ATOM   642   C CG  . PRO A 1 90  ? -19.282 -1.321   6.988   1.00 43.35  ? 91  PRO A CG  1 
ATOM   643   C CD  . PRO A 1 90  ? -18.704 -2.680   6.678   1.00 41.50  ? 91  PRO A CD  1 
ATOM   644   N N   . LEU A 1 91  ? -22.964 -2.018   4.988   1.00 42.90  ? 92  LEU A N   1 
ATOM   645   C CA  . LEU A 1 91  ? -23.550 -1.426   3.796   1.00 40.53  ? 92  LEU A CA  1 
ATOM   646   C C   . LEU A 1 91  ? -22.954 -0.054   3.529   1.00 40.74  ? 92  LEU A C   1 
ATOM   647   O O   . LEU A 1 91  ? -22.638 0.680    4.463   1.00 43.74  ? 92  LEU A O   1 
ATOM   648   C CB  . LEU A 1 91  ? -25.067 -1.313   3.938   1.00 41.61  ? 92  LEU A CB  1 
ATOM   649   C CG  . LEU A 1 91  ? -25.867 -2.584   3.652   1.00 42.42  ? 92  LEU A CG  1 
ATOM   650   C CD1 . LEU A 1 91  ? -27.322 -2.359   3.993   1.00 44.12  ? 92  LEU A CD1 1 
ATOM   651   C CD2 . LEU A 1 91  ? -25.717 -3.003   2.198   1.00 41.47  ? 92  LEU A CD2 1 
ATOM   652   N N   . PRO A 1 92  ? -22.796 0.296    2.246   1.00 39.08  ? 93  PRO A N   1 
ATOM   653   C CA  . PRO A 1 92  ? -22.341 1.640    1.886   1.00 39.72  ? 93  PRO A CA  1 
ATOM   654   C C   . PRO A 1 92  ? -23.306 2.704    2.378   1.00 41.76  ? 93  PRO A C   1 
ATOM   655   O O   . PRO A 1 92  ? -24.491 2.430    2.579   1.00 40.47  ? 93  PRO A O   1 
ATOM   656   C CB  . PRO A 1 92  ? -22.311 1.606    0.351   1.00 37.74  ? 93  PRO A CB  1 
ATOM   657   C CG  . PRO A 1 92  ? -23.276 0.523    -0.016  1.00 35.83  ? 93  PRO A CG  1 
ATOM   658   C CD  . PRO A 1 92  ? -23.105 -0.516   1.055   1.00 35.84  ? 93  PRO A CD  1 
ATOM   659   N N   . THR A 1 93  ? -22.794 3.911    2.574   1.00 46.34  ? 94  THR A N   1 
ATOM   660   C CA  . THR A 1 93  ? -23.629 5.038    2.957   1.00 51.95  ? 94  THR A CA  1 
ATOM   661   C C   . THR A 1 93  ? -23.303 6.226    2.069   1.00 55.11  ? 94  THR A C   1 
ATOM   662   O O   . THR A 1 93  ? -22.419 6.144    1.215   1.00 54.02  ? 94  THR A O   1 
ATOM   663   C CB  . THR A 1 93  ? -23.424 5.428    4.429   1.00 55.47  ? 94  THR A CB  1 
ATOM   664   O OG1 . THR A 1 93  ? -22.047 5.759    4.643   1.00 57.96  ? 94  THR A OG1 1 
ATOM   665   C CG2 . THR A 1 93  ? -23.807 4.275    5.345   1.00 54.78  ? 94  THR A CG2 1 
ATOM   666   N N   . ALA A 1 94  ? -24.014 7.328    2.274   1.00 59.30  ? 95  ALA A N   1 
ATOM   667   C CA  . ALA A 1 94  ? -23.751 8.551    1.529   1.00 62.47  ? 95  ALA A CA  1 
ATOM   668   C C   . ALA A 1 94  ? -22.359 9.080    1.855   1.00 65.40  ? 95  ALA A C   1 
ATOM   669   O O   . ALA A 1 94  ? -21.720 9.729    1.025   1.00 67.11  ? 95  ALA A O   1 
ATOM   670   C CB  . ALA A 1 94  ? -24.809 9.602    1.839   1.00 64.97  ? 95  ALA A CB  1 
ATOM   671   N N   . GLN A 1 95  ? -21.892 8.785    3.064   1.00 65.94  ? 96  GLN A N   1 
ATOM   672   C CA  . GLN A 1 95  ? -20.600 9.270    3.533   1.00 67.57  ? 96  GLN A CA  1 
ATOM   673   C C   . GLN A 1 95  ? -19.481 8.256    3.305   1.00 65.07  ? 96  GLN A C   1 
ATOM   674   O O   . GLN A 1 95  ? -18.307 8.623    3.228   1.00 66.91  ? 96  GLN A O   1 
ATOM   675   C CB  . GLN A 1 95  ? -20.680 9.627    5.019   1.00 70.41  ? 96  GLN A CB  1 
ATOM   676   N N   . ARG A 1 96  ? -19.845 6.981    3.201   1.00 60.90  ? 97  ARG A N   1 
ATOM   677   C CA  . ARG A 1 96  ? -18.861 5.919    3.019   1.00 57.99  ? 97  ARG A CA  1 
ATOM   678   C C   . ARG A 1 96  ? -19.327 4.893    1.988   1.00 52.49  ? 97  ARG A C   1 
ATOM   679   O O   . ARG A 1 96  ? -20.337 4.214    2.176   1.00 49.52  ? 97  ARG A O   1 
ATOM   680   C CB  . ARG A 1 96  ? -18.567 5.226    4.353   1.00 59.84  ? 97  ARG A CB  1 
ATOM   681   N N   . SER A 1 97  ? -18.584 4.780    0.896   1.00 51.35  ? 98  SER A N   1 
ATOM   682   C CA  . SER A 1 97  ? -18.950 3.849    -0.161  1.00 49.68  ? 98  SER A CA  1 
ATOM   683   C C   . SER A 1 97  ? -18.043 2.626    -0.133  1.00 48.48  ? 98  SER A C   1 
ATOM   684   O O   . SER A 1 97  ? -16.927 2.689    0.379   1.00 51.22  ? 98  SER A O   1 
ATOM   685   C CB  . SER A 1 97  ? -18.884 4.538    -1.526  1.00 49.61  ? 98  SER A CB  1 
ATOM   686   O OG  . SER A 1 97  ? -17.553 4.890    -1.853  1.00 51.43  ? 98  SER A OG  1 
ATOM   687   N N   . LEU A 1 98  ? -18.532 1.512    -0.670  1.00 44.79  ? 99  LEU A N   1 
ATOM   688   C CA  . LEU A 1 98  ? -17.729 0.299    -0.761  1.00 41.94  ? 99  LEU A CA  1 
ATOM   689   C C   . LEU A 1 98  ? -16.541 0.527    -1.686  1.00 42.51  ? 99  LEU A C   1 
ATOM   690   O O   . LEU A 1 98  ? -16.569 1.409    -2.542  1.00 42.93  ? 99  LEU A O   1 
ATOM   691   C CB  . LEU A 1 98  ? -18.568 -0.877   -1.258  1.00 38.69  ? 99  LEU A CB  1 
ATOM   692   C CG  . LEU A 1 98  ? -19.794 -1.243   -0.421  1.00 37.90  ? 99  LEU A CG  1 
ATOM   693   C CD1 . LEU A 1 98  ? -20.533 -2.414   -1.049  1.00 34.93  ? 99  LEU A CD1 1 
ATOM   694   C CD2 . LEU A 1 98  ? -19.402 -1.560   1.017   1.00 37.37  ? 99  LEU A CD2 1 
ATOM   695   N N   . GLU A 1 99  ? -15.497 -0.272   -1.507  1.00 43.34  ? 100 GLU A N   1 
ATOM   696   C CA  . GLU A 1 99  ? -14.280 -0.122   -2.292  1.00 44.46  ? 100 GLU A CA  1 
ATOM   697   C C   . GLU A 1 99  ? -13.775 -1.477   -2.761  1.00 43.51  ? 100 GLU A C   1 
ATOM   698   O O   . GLU A 1 99  ? -13.817 -2.452   -2.008  1.00 43.22  ? 100 GLU A O   1 
ATOM   699   C CB  . GLU A 1 99  ? -13.196 0.592    -1.474  1.00 46.86  ? 100 GLU A CB  1 
ATOM   700   N N   . PRO A 1 100 ? -13.294 -1.541   -4.011  1.00 42.99  ? 101 PRO A N   1 
ATOM   701   C CA  . PRO A 1 100 ? -12.707 -2.773   -4.546  1.00 42.06  ? 101 PRO A CA  1 
ATOM   702   C C   . PRO A 1 100 ? -11.462 -3.157   -3.756  1.00 44.12  ? 101 PRO A C   1 
ATOM   703   O O   . PRO A 1 100 ? -10.748 -2.275   -3.280  1.00 45.66  ? 101 PRO A O   1 
ATOM   704   C CB  . PRO A 1 100 ? -12.343 -2.406   -5.993  1.00 41.76  ? 101 PRO A CB  1 
ATOM   705   C CG  . PRO A 1 100 ? -13.041 -1.112   -6.272  1.00 42.27  ? 101 PRO A CG  1 
ATOM   706   C CD  . PRO A 1 100 ? -13.192 -0.421   -4.960  1.00 42.92  ? 101 PRO A CD  1 
ATOM   707   N N   . GLY A 1 101 ? -11.214 -4.454   -3.617  1.00 43.91  ? 102 GLY A N   1 
ATOM   708   C CA  . GLY A 1 101 ? -10.039 -4.933   -2.917  1.00 46.59  ? 102 GLY A CA  1 
ATOM   709   C C   . GLY A 1 101 ? -9.960  -6.447   -2.931  1.00 47.09  ? 102 GLY A C   1 
ATOM   710   O O   . GLY A 1 101 ? -10.291 -7.089   -3.930  1.00 46.92  ? 102 GLY A O   1 
ATOM   711   N N   . THR A 1 102 ? -9.522  -7.016   -1.814  1.00 47.27  ? 103 THR A N   1 
ATOM   712   C CA  . THR A 1 102 ? -9.411  -8.460   -1.671  1.00 47.49  ? 103 THR A CA  1 
ATOM   713   C C   . THR A 1 102 ? -10.436 -8.949   -0.653  1.00 48.23  ? 103 THR A C   1 
ATOM   714   O O   . THR A 1 102 ? -10.693 -8.269   0.339   1.00 52.17  ? 103 THR A O   1 
ATOM   715   C CB  . THR A 1 102 ? -7.988  -8.876   -1.229  1.00 49.37  ? 103 THR A CB  1 
ATOM   716   N N   . PRO A 1 103 ? -11.035 -10.127  -0.892  1.00 45.50  ? 104 PRO A N   1 
ATOM   717   C CA  . PRO A 1 103 ? -10.820 -11.010  -2.042  1.00 43.78  ? 104 PRO A CA  1 
ATOM   718   C C   . PRO A 1 103 ? -11.544 -10.503  -3.287  1.00 41.47  ? 104 PRO A C   1 
ATOM   719   O O   . PRO A 1 103 ? -12.570 -9.836   -3.169  1.00 38.88  ? 104 PRO A O   1 
ATOM   720   C CB  . PRO A 1 103 ? -11.409 -12.337  -1.569  1.00 42.93  ? 104 PRO A CB  1 
ATOM   721   C CG  . PRO A 1 103 ? -12.534 -11.918  -0.692  1.00 42.82  ? 104 PRO A CG  1 
ATOM   722   C CD  . PRO A 1 103 ? -12.041 -10.681  0.032   1.00 45.04  ? 104 PRO A CD  1 
ATOM   723   N N   . ARG A 1 104 ? -11.012 -10.823  -4.460  1.00 42.84  ? 105 ARG A N   1 
ATOM   724   C CA  . ARG A 1 104 ? -11.534 -10.281  -5.709  1.00 43.38  ? 105 ARG A CA  1 
ATOM   725   C C   . ARG A 1 104 ? -12.955 -10.749  -6.019  1.00 39.43  ? 105 ARG A C   1 
ATOM   726   O O   . ARG A 1 104 ? -13.720 -10.019  -6.649  1.00 39.66  ? 105 ARG A O   1 
ATOM   727   C CB  . ARG A 1 104 ? -10.595 -10.639  -6.865  1.00 47.71  ? 105 ARG A CB  1 
ATOM   728   C CG  . ARG A 1 104 ? -9.250  -9.929   -6.781  1.00 52.66  ? 105 ARG A CG  1 
ATOM   729   C CD  . ARG A 1 104 ? -8.139  -10.731  -7.438  1.00 57.62  ? 105 ARG A CD  1 
ATOM   730   N NE  . ARG A 1 104 ? -8.214  -10.712  -8.896  1.00 59.78  ? 105 ARG A NE  1 
ATOM   731   C CZ  . ARG A 1 104 ? -7.451  -11.459  -9.688  1.00 63.57  ? 105 ARG A CZ  1 
ATOM   732   N NH1 . ARG A 1 104 ? -6.560  -12.288  -9.162  1.00 66.68  ? 105 ARG A NH1 1 
ATOM   733   N NH2 . ARG A 1 104 ? -7.580  -11.381  -11.006 1.00 64.12  ? 105 ARG A NH2 1 
ATOM   734   N N   . TRP A 1 105 ? -13.315 -11.950  -5.571  1.00 36.44  ? 106 TRP A N   1 
ATOM   735   C CA  . TRP A 1 105 ? -14.642 -12.490  -5.865  1.00 34.59  ? 106 TRP A CA  1 
ATOM   736   C C   . TRP A 1 105 ? -15.737 -11.638  -5.233  1.00 31.54  ? 106 TRP A C   1 
ATOM   737   O O   . TRP A 1 105 ? -16.840 -11.535  -5.766  1.00 29.92  ? 106 TRP A O   1 
ATOM   738   C CB  . TRP A 1 105 ? -14.762 -13.950  -5.400  1.00 37.55  ? 106 TRP A CB  1 
ATOM   739   C CG  . TRP A 1 105 ? -14.663 -14.171  -3.915  1.00 39.59  ? 106 TRP A CG  1 
ATOM   740   C CD1 . TRP A 1 105 ? -13.553 -14.547  -3.219  1.00 42.00  ? 106 TRP A CD1 1 
ATOM   741   C CD2 . TRP A 1 105 ? -15.718 -14.054  -2.952  1.00 39.60  ? 106 TRP A CD2 1 
ATOM   742   N NE1 . TRP A 1 105 ? -13.846 -14.664  -1.883  1.00 43.92  ? 106 TRP A NE1 1 
ATOM   743   C CE2 . TRP A 1 105 ? -15.171 -14.364  -1.691  1.00 43.03  ? 106 TRP A CE2 1 
ATOM   744   C CE3 . TRP A 1 105 ? -17.072 -13.714  -3.030  1.00 38.67  ? 106 TRP A CE3 1 
ATOM   745   C CZ2 . TRP A 1 105 ? -15.927 -14.340  -0.518  1.00 44.22  ? 106 TRP A CZ2 1 
ATOM   746   C CZ3 . TRP A 1 105 ? -17.822 -13.691  -1.864  1.00 39.35  ? 106 TRP A CZ3 1 
ATOM   747   C CH2 . TRP A 1 105 ? -17.250 -14.004  -0.628  1.00 41.61  ? 106 TRP A CH2 1 
ATOM   748   N N   . ALA A 1 106 ? -15.420 -11.008  -4.106  1.00 31.09  ? 107 ALA A N   1 
ATOM   749   C CA  . ALA A 1 106 ? -16.388 -10.182  -3.399  1.00 30.57  ? 107 ALA A CA  1 
ATOM   750   C C   . ALA A 1 106 ? -16.604 -8.837   -4.093  1.00 29.09  ? 107 ALA A C   1 
ATOM   751   O O   . ALA A 1 106 ? -17.635 -8.196   -3.904  1.00 29.70  ? 107 ALA A O   1 
ATOM   752   C CB  . ALA A 1 106 ? -15.939 -9.970   -1.944  1.00 30.42  ? 107 ALA A CB  1 
ATOM   753   N N   . ASN A 1 107 ? -15.630 -8.415   -4.893  1.00 29.70  ? 108 ASN A N   1 
ATOM   754   C CA  . ASN A 1 107 ? -15.732 -7.158   -5.631  1.00 31.22  ? 108 ASN A CA  1 
ATOM   755   C C   . ASN A 1 107 ? -16.978 -7.097   -6.518  1.00 30.73  ? 108 ASN A C   1 
ATOM   756   O O   . ASN A 1 107 ? -17.564 -6.033   -6.696  1.00 32.02  ? 108 ASN A O   1 
ATOM   757   C CB  . ASN A 1 107 ? -14.480 -6.929   -6.486  1.00 33.21  ? 108 ASN A CB  1 
ATOM   758   C CG  . ASN A 1 107 ? -13.265 -6.548   -5.655  1.00 36.38  ? 108 ASN A CG  1 
ATOM   759   O OD1 . ASN A 1 107 ? -13.395 -6.002   -4.560  1.00 37.47  ? 108 ASN A OD1 1 
ATOM   760   N ND2 . ASN A 1 107 ? -12.076 -6.825   -6.180  1.00 37.52  ? 108 ASN A ND2 1 
ATOM   761   N N   . TYR A 1 108 ? -17.387 -8.238   -7.061  1.00 30.45  ? 109 TYR A N   1 
ATOM   762   C CA  . TYR A 1 108 ? -18.564 -8.273   -7.930  1.00 30.58  ? 109 TYR A CA  1 
ATOM   763   C C   . TYR A 1 108 ? -19.828 -8.024   -7.116  1.00 30.31  ? 109 TYR A C   1 
ATOM   764   O O   . TYR A 1 108 ? -20.697 -7.250   -7.521  1.00 30.02  ? 109 TYR A O   1 
ATOM   765   C CB  . TYR A 1 108 ? -18.659 -9.608   -8.666  1.00 31.48  ? 109 TYR A CB  1 
ATOM   766   C CG  . TYR A 1 108 ? -17.443 -9.917   -9.500  1.00 33.41  ? 109 TYR A CG  1 
ATOM   767   C CD1 . TYR A 1 108 ? -17.162 -9.184   -10.647 1.00 34.20  ? 109 TYR A CD1 1 
ATOM   768   C CD2 . TYR A 1 108 ? -16.575 -10.941  -9.146  1.00 34.18  ? 109 TYR A CD2 1 
ATOM   769   C CE1 . TYR A 1 108 ? -16.049 -9.460   -11.417 1.00 35.18  ? 109 TYR A CE1 1 
ATOM   770   C CE2 . TYR A 1 108 ? -15.457 -11.227  -9.915  1.00 35.55  ? 109 TYR A CE2 1 
ATOM   771   C CZ  . TYR A 1 108 ? -15.200 -10.482  -11.049 1.00 35.79  ? 109 TYR A CZ  1 
ATOM   772   O OH  . TYR A 1 108 ? -14.092 -10.763  -11.818 1.00 36.90  ? 109 TYR A OH  1 
ATOM   773   N N   . VAL A 1 109 ? -19.923 -8.679   -5.963  1.00 29.02  ? 110 VAL A N   1 
ATOM   774   C CA  . VAL A 1 109 ? -21.046 -8.453   -5.060  1.00 29.23  ? 110 VAL A CA  1 
ATOM   775   C C   . VAL A 1 109 ? -21.047 -7.019   -4.521  1.00 28.03  ? 110 VAL A C   1 
ATOM   776   O O   . VAL A 1 109 ? -22.087 -6.363   -4.505  1.00 26.71  ? 110 VAL A O   1 
ATOM   777   C CB  . VAL A 1 109 ? -21.029 -9.444   -3.880  1.00 31.32  ? 110 VAL A CB  1 
ATOM   778   C CG1 . VAL A 1 109 ? -22.244 -9.222   -2.990  1.00 31.31  ? 110 VAL A CG1 1 
ATOM   779   C CG2 . VAL A 1 109 ? -20.996 -10.874  -4.401  1.00 31.32  ? 110 VAL A CG2 1 
ATOM   780   N N   . LYS A 1 110 ? -19.881 -6.540   -4.085  1.00 29.35  ? 111 LYS A N   1 
ATOM   781   C CA  . LYS A 1 110 ? -19.744 -5.164   -3.598  1.00 30.35  ? 111 LYS A CA  1 
ATOM   782   C C   . LYS A 1 110 ? -20.164 -4.131   -4.646  1.00 30.48  ? 111 LYS A C   1 
ATOM   783   O O   . LYS A 1 110 ? -20.817 -3.136   -4.324  1.00 31.36  ? 111 LYS A O   1 
ATOM   784   C CB  . LYS A 1 110 ? -18.302 -4.872   -3.180  1.00 32.62  ? 111 LYS A CB  1 
ATOM   785   C CG  . LYS A 1 110 ? -17.831 -5.526   -1.890  1.00 34.22  ? 111 LYS A CG  1 
ATOM   786   C CD  . LYS A 1 110 ? -16.369 -5.161   -1.660  1.00 36.98  ? 111 LYS A CD  1 
ATOM   787   C CE  . LYS A 1 110 ? -15.827 -5.707   -0.357  1.00 40.26  ? 111 LYS A CE  1 
ATOM   788   N NZ  . LYS A 1 110 ? -14.370 -5.388   -0.200  1.00 41.97  ? 111 LYS A NZ  1 
ATOM   789   N N   . GLY A 1 111 ? -19.760 -4.359   -5.892  1.00 30.10  ? 112 GLY A N   1 
ATOM   790   C CA  . GLY A 1 111 ? -20.061 -3.436   -6.974  1.00 29.36  ? 112 GLY A CA  1 
ATOM   791   C C   . GLY A 1 111 ? -21.549 -3.299   -7.227  1.00 28.57  ? 112 GLY A C   1 
ATOM   792   O O   . GLY A 1 111 ? -22.053 -2.195   -7.424  1.00 31.06  ? 112 GLY A O   1 
ATOM   793   N N   . VAL A 1 112 ? -22.256 -4.424   -7.221  1.00 26.55  ? 113 VAL A N   1 
ATOM   794   C CA  . VAL A 1 112 ? -23.701 -4.424   -7.448  1.00 26.91  ? 113 VAL A CA  1 
ATOM   795   C C   . VAL A 1 112 ? -24.436 -3.722   -6.308  1.00 28.15  ? 113 VAL A C   1 
ATOM   796   O O   . VAL A 1 112 ? -25.361 -2.939   -6.538  1.00 30.54  ? 113 VAL A O   1 
ATOM   797   C CB  . VAL A 1 112 ? -24.246 -5.865   -7.607  1.00 27.08  ? 113 VAL A CB  1 
ATOM   798   C CG1 . VAL A 1 112 ? -25.763 -5.859   -7.718  1.00 25.91  ? 113 VAL A CG1 1 
ATOM   799   C CG2 . VAL A 1 112 ? -23.630 -6.540   -8.828  1.00 27.76  ? 113 VAL A CG2 1 
ATOM   800   N N   . ILE A 1 113 ? -24.019 -4.009   -5.077  1.00 28.85  ? 114 ILE A N   1 
ATOM   801   C CA  . ILE A 1 113 ? -24.568 -3.333   -3.903  1.00 28.00  ? 114 ILE A CA  1 
ATOM   802   C C   . ILE A 1 113 ? -24.383 -1.824   -4.023  1.00 27.62  ? 114 ILE A C   1 
ATOM   803   O O   . ILE A 1 113 ? -25.337 -1.062   -3.858  1.00 30.64  ? 114 ILE A O   1 
ATOM   804   C CB  . ILE A 1 113 ? -23.906 -3.840   -2.594  1.00 29.34  ? 114 ILE A CB  1 
ATOM   805   C CG1 . ILE A 1 113 ? -24.332 -5.280   -2.302  1.00 29.15  ? 114 ILE A CG1 1 
ATOM   806   C CG2 . ILE A 1 113 ? -24.268 -2.941   -1.414  1.00 29.96  ? 114 ILE A CG2 1 
ATOM   807   C CD1 . ILE A 1 113 ? -23.571 -5.920   -1.144  1.00 31.21  ? 114 ILE A CD1 1 
ATOM   808   N N   . GLN A 1 114 ? -23.160 -1.401   -4.329  1.00 27.87  ? 115 GLN A N   1 
ATOM   809   C CA  . GLN A 1 114 ? -22.827 0.019    -4.411  1.00 33.04  ? 115 GLN A CA  1 
ATOM   810   C C   . GLN A 1 114 ? -23.711 0.775    -5.396  1.00 34.15  ? 115 GLN A C   1 
ATOM   811   O O   . GLN A 1 114 ? -24.120 1.904    -5.133  1.00 33.63  ? 115 GLN A O   1 
ATOM   812   C CB  . GLN A 1 114 ? -21.359 0.203    -4.811  1.00 33.12  ? 115 GLN A CB  1 
ATOM   813   C CG  . GLN A 1 114 ? -20.913 1.661    -4.853  1.00 34.16  ? 115 GLN A CG  1 
ATOM   814   C CD  . GLN A 1 114 ? -20.931 2.306    -3.478  1.00 34.59  ? 115 GLN A CD  1 
ATOM   815   O OE1 . GLN A 1 114 ? -20.525 1.694    -2.493  1.00 34.80  ? 115 GLN A OE1 1 
ATOM   816   N NE2 . GLN A 1 114 ? -21.403 3.545    -3.407  1.00 35.14  ? 115 GLN A NE2 1 
ATOM   817   N N   . TYR A 1 115 ? -24.001 0.154    -6.536  1.00 35.06  ? 116 TYR A N   1 
ATOM   818   C CA  . TYR A 1 115 ? -24.758 0.834    -7.577  1.00 37.37  ? 116 TYR A CA  1 
ATOM   819   C C   . TYR A 1 115 ? -26.217 0.396    -7.643  1.00 37.10  ? 116 TYR A C   1 
ATOM   820   O O   . TYR A 1 115 ? -26.926 0.774    -8.573  1.00 38.45  ? 116 TYR A O   1 
ATOM   821   C CB  . TYR A 1 115 ? -24.091 0.627    -8.939  1.00 39.31  ? 116 TYR A CB  1 
ATOM   822   C CG  . TYR A 1 115 ? -22.684 1.171    -8.982  1.00 41.94  ? 116 TYR A CG  1 
ATOM   823   C CD1 . TYR A 1 115 ? -22.445 2.532    -8.831  1.00 44.25  ? 116 TYR A CD1 1 
ATOM   824   C CD2 . TYR A 1 115 ? -21.595 0.328    -9.160  1.00 40.91  ? 116 TYR A CD2 1 
ATOM   825   C CE1 . TYR A 1 115 ? -21.161 3.037    -8.860  1.00 45.18  ? 116 TYR A CE1 1 
ATOM   826   C CE2 . TYR A 1 115 ? -20.309 0.825    -9.192  1.00 42.38  ? 116 TYR A CE2 1 
ATOM   827   C CZ  . TYR A 1 115 ? -20.098 2.181    -9.040  1.00 44.51  ? 116 TYR A CZ  1 
ATOM   828   O OH  . TYR A 1 115 ? -18.821 2.687    -9.073  1.00 45.98  ? 116 TYR A OH  1 
ATOM   829   N N   . TYR A 1 116 ? -26.672 -0.386   -6.665  1.00 35.27  ? 117 TYR A N   1 
ATOM   830   C CA  . TYR A 1 116 ? -28.079 -0.768   -6.645  1.00 34.83  ? 117 TYR A CA  1 
ATOM   831   C C   . TYR A 1 116 ? -28.931 0.489    -6.483  1.00 37.43  ? 117 TYR A C   1 
ATOM   832   O O   . TYR A 1 116 ? -28.728 1.262    -5.548  1.00 39.69  ? 117 TYR A O   1 
ATOM   833   C CB  . TYR A 1 116 ? -28.382 -1.782   -5.537  1.00 33.31  ? 117 TYR A CB  1 
ATOM   834   C CG  . TYR A 1 116 ? -29.759 -2.383   -5.698  1.00 31.95  ? 117 TYR A CG  1 
ATOM   835   C CD1 . TYR A 1 116 ? -30.030 -3.267   -6.739  1.00 31.21  ? 117 TYR A CD1 1 
ATOM   836   C CD2 . TYR A 1 116 ? -30.794 -2.044   -4.841  1.00 32.03  ? 117 TYR A CD2 1 
ATOM   837   C CE1 . TYR A 1 116 ? -31.288 -3.806   -6.913  1.00 32.32  ? 117 TYR A CE1 1 
ATOM   838   C CE2 . TYR A 1 116 ? -32.060 -2.582   -5.003  1.00 34.01  ? 117 TYR A CE2 1 
ATOM   839   C CZ  . TYR A 1 116 ? -32.300 -3.464   -6.042  1.00 34.88  ? 117 TYR A CZ  1 
ATOM   840   O OH  . TYR A 1 116 ? -33.556 -4.002   -6.214  1.00 36.73  ? 117 TYR A OH  1 
ATOM   841   N N   . PRO A 1 117 ? -29.878 0.705    -7.413  1.00 38.27  ? 118 PRO A N   1 
ATOM   842   C CA  . PRO A 1 117 ? -30.611 1.972    -7.521  1.00 40.31  ? 118 PRO A CA  1 
ATOM   843   C C   . PRO A 1 117 ? -31.719 2.176    -6.486  1.00 41.65  ? 118 PRO A C   1 
ATOM   844   O O   . PRO A 1 117 ? -32.101 3.322    -6.251  1.00 44.90  ? 118 PRO A O   1 
ATOM   845   C CB  . PRO A 1 117 ? -31.214 1.899    -8.925  1.00 41.35  ? 118 PRO A CB  1 
ATOM   846   C CG  . PRO A 1 117 ? -31.420 0.446    -9.156  1.00 40.36  ? 118 PRO A CG  1 
ATOM   847   C CD  . PRO A 1 117 ? -30.267 -0.248   -8.469  1.00 37.95  ? 118 PRO A CD  1 
ATOM   848   N N   . ALA A 1 118 ? -32.232 1.105    -5.889  1.00 38.06  ? 119 ALA A N   1 
ATOM   849   C CA  . ALA A 1 118 ? -33.388 1.234    -5.006  1.00 39.27  ? 119 ALA A CA  1 
ATOM   850   C C   . ALA A 1 118 ? -32.984 1.221    -3.533  1.00 39.64  ? 119 ALA A C   1 
ATOM   851   O O   . ALA A 1 118 ? -31.941 0.683    -3.169  1.00 38.46  ? 119 ALA A O   1 
ATOM   852   C CB  . ALA A 1 118 ? -34.397 0.135    -5.290  1.00 39.86  ? 119 ALA A CB  1 
ATOM   853   N N   . ALA A 1 119 ? -33.827 1.822    -2.698  1.00 41.84  ? 120 ALA A N   1 
ATOM   854   C CA  . ALA A 1 119 ? -33.552 1.990    -1.273  1.00 43.59  ? 120 ALA A CA  1 
ATOM   855   C C   . ALA A 1 119 ? -34.863 1.985    -0.490  1.00 46.38  ? 120 ALA A C   1 
ATOM   856   O O   . ALA A 1 119 ? -35.917 2.257    -1.059  1.00 47.53  ? 120 ALA A O   1 
ATOM   857   C CB  . ALA A 1 119 ? -32.790 3.289    -1.036  1.00 43.95  ? 120 ALA A CB  1 
ATOM   858   N N   . PRO A 1 120 ? -34.813 1.683    0.822   1.00 48.13  ? 121 PRO A N   1 
ATOM   859   C CA  . PRO A 1 120 ? -33.638 1.258    1.593   1.00 47.22  ? 121 PRO A CA  1 
ATOM   860   C C   . PRO A 1 120 ? -33.290 -0.216   1.391   1.00 44.61  ? 121 PRO A C   1 
ATOM   861   O O   . PRO A 1 120 ? -34.155 -1.091   1.451   1.00 45.44  ? 121 PRO A O   1 
ATOM   862   C CB  . PRO A 1 120 ? -34.050 1.535    3.045   1.00 49.87  ? 121 PRO A CB  1 
ATOM   863   C CG  . PRO A 1 120 ? -35.523 1.491    3.033   1.00 51.98  ? 121 PRO A CG  1 
ATOM   864   C CD  . PRO A 1 120 ? -35.948 2.021    1.697   1.00 51.02  ? 121 PRO A CD  1 
ATOM   865   N N   . LEU A 1 121 ? -32.016 -0.465   1.113   1.00 41.25  ? 122 LEU A N   1 
ATOM   866   C CA  . LEU A 1 121 ? -31.483 -1.813   1.028   1.00 39.95  ? 122 LEU A CA  1 
ATOM   867   C C   . LEU A 1 121 ? -31.026 -2.257   2.417   1.00 41.07  ? 122 LEU A C   1 
ATOM   868   O O   . LEU A 1 121 ? -30.243 -1.561   3.060   1.00 40.33  ? 122 LEU A O   1 
ATOM   869   C CB  . LEU A 1 121 ? -30.320 -1.863   0.037   1.00 39.44  ? 122 LEU A CB  1 
ATOM   870   C CG  . LEU A 1 121 ? -29.748 -3.218   -0.377  1.00 39.18  ? 122 LEU A CG  1 
ATOM   871   C CD1 . LEU A 1 121 ? -30.808 -4.070   -1.070  1.00 37.79  ? 122 LEU A CD1 1 
ATOM   872   C CD2 . LEU A 1 121 ? -28.539 -3.018   -1.284  1.00 38.58  ? 122 LEU A CD2 1 
ATOM   873   N N   . PRO A 1 122 ? -31.530 -3.403   2.897   1.00 42.58  ? 123 PRO A N   1 
ATOM   874   C CA  . PRO A 1 122 ? -31.055 -3.916   4.183   1.00 43.87  ? 123 PRO A CA  1 
ATOM   875   C C   . PRO A 1 122 ? -29.763 -4.696   4.011   1.00 42.14  ? 123 PRO A C   1 
ATOM   876   O O   . PRO A 1 122 ? -29.379 -5.015   2.886   1.00 39.16  ? 123 PRO A O   1 
ATOM   877   C CB  . PRO A 1 122 ? -32.188 -4.834   4.627   1.00 45.63  ? 123 PRO A CB  1 
ATOM   878   C CG  . PRO A 1 122 ? -32.711 -5.382   3.319   1.00 44.09  ? 123 PRO A CG  1 
ATOM   879   C CD  . PRO A 1 122 ? -32.589 -4.253   2.322   1.00 43.35  ? 123 PRO A CD  1 
ATOM   880   N N   . GLY A 1 123 ? -29.095 -4.996   5.117   1.00 43.80  ? 124 GLY A N   1 
ATOM   881   C CA  . GLY A 1 123 ? -27.959 -5.892   5.081   1.00 43.00  ? 124 GLY A CA  1 
ATOM   882   C C   . GLY A 1 123 ? -28.473 -7.303   4.877   1.00 42.54  ? 124 GLY A C   1 
ATOM   883   O O   . GLY A 1 123 ? -29.679 -7.540   4.954   1.00 42.93  ? 124 GLY A O   1 
ATOM   884   N N   . PHE A 1 124 ? -27.573 -8.244   4.617   1.00 39.82  ? 125 PHE A N   1 
ATOM   885   C CA  . PHE A 1 124 ? -27.994 -9.620   4.407   1.00 39.46  ? 125 PHE A CA  1 
ATOM   886   C C   . PHE A 1 124 ? -26.867 -10.618  4.605   1.00 33.25  ? 125 PHE A C   1 
ATOM   887   O O   . PHE A 1 124 ? -25.690 -10.263  4.613   1.00 32.76  ? 125 PHE A O   1 
ATOM   888   C CB  . PHE A 1 124 ? -28.586 -9.787   3.000   1.00 36.69  ? 125 PHE A CB  1 
ATOM   889   C CG  . PHE A 1 124 ? -27.624 -9.467   1.891   1.00 34.46  ? 125 PHE A CG  1 
ATOM   890   C CD1 . PHE A 1 124 ? -27.493 -8.169   1.420   1.00 33.92  ? 125 PHE A CD1 1 
ATOM   891   C CD2 . PHE A 1 124 ? -26.867 -10.469  1.303   1.00 33.65  ? 125 PHE A CD2 1 
ATOM   892   C CE1 . PHE A 1 124 ? -26.615 -7.873   0.392   1.00 33.72  ? 125 PHE A CE1 1 
ATOM   893   C CE2 . PHE A 1 124 ? -25.988 -10.184  0.273   1.00 33.02  ? 125 PHE A CE2 1 
ATOM   894   C CZ  . PHE A 1 124 ? -25.860 -8.883   -0.183  1.00 33.36  ? 125 PHE A CZ  1 
ATOM   895   N N   . SER A 1 125 ? -27.251 -11.876  4.765   1.00 34.50  ? 126 SER A N   1 
ATOM   896   C CA  . SER A 1 125 ? -26.305 -12.979  4.821   1.00 35.27  ? 126 SER A CA  1 
ATOM   897   C C   . SER A 1 125 ? -26.540 -13.830  3.590   1.00 36.03  ? 126 SER A C   1 
ATOM   898   O O   . SER A 1 125 ? -27.688 -14.108  3.248   1.00 36.08  ? 126 SER A O   1 
ATOM   899   C CB  . SER A 1 125 ? -26.490 -13.805  6.096   1.00 37.06  ? 126 SER A CB  1 
ATOM   900   O OG  . SER A 1 125 ? -26.405 -12.988  7.250   1.00 37.98  ? 126 SER A OG  1 
ATOM   901   N N   . ALA A 1 126 ? -25.468 -14.234  2.916   1.00 35.78  ? 127 ALA A N   1 
ATOM   902   C CA  . ALA A 1 126 ? -25.620 -15.031  1.707   1.00 33.15  ? 127 ALA A CA  1 
ATOM   903   C C   . ALA A 1 126 ? -24.487 -16.029  1.505   1.00 32.09  ? 127 ALA A C   1 
ATOM   904   O O   . ALA A 1 126 ? -23.353 -15.806  1.933   1.00 33.91  ? 127 ALA A O   1 
ATOM   905   C CB  . ALA A 1 126 ? -25.734 -14.116  0.485   1.00 33.23  ? 127 ALA A CB  1 
ATOM   906   N N   . VAL A 1 127 ? -24.825 -17.141  0.859   1.00 30.77  ? 128 VAL A N   1 
ATOM   907   C CA  . VAL A 1 127 ? -23.857 -18.122  0.395   1.00 31.51  ? 128 VAL A CA  1 
ATOM   908   C C   . VAL A 1 127 ? -23.862 -18.148  -1.136  1.00 32.12  ? 128 VAL A C   1 
ATOM   909   O O   . VAL A 1 127 ? -24.924 -18.148  -1.754  1.00 33.70  ? 128 VAL A O   1 
ATOM   910   C CB  . VAL A 1 127 ? -24.166 -19.528  0.945   1.00 33.95  ? 128 VAL A CB  1 
ATOM   911   C CG1 . VAL A 1 127 ? -23.333 -20.579  0.234   1.00 34.35  ? 128 VAL A CG1 1 
ATOM   912   C CG2 . VAL A 1 127 ? -23.925 -19.576  2.460   1.00 35.64  ? 128 VAL A CG2 1 
ATOM   913   N N   . VAL A 1 128 ? -22.676 -18.155  -1.737  1.00 32.71  ? 129 VAL A N   1 
ATOM   914   C CA  . VAL A 1 128 ? -22.542 -18.162  -3.184  1.00 34.15  ? 129 VAL A CA  1 
ATOM   915   C C   . VAL A 1 128 ? -21.942 -19.467  -3.689  1.00 35.80  ? 129 VAL A C   1 
ATOM   916   O O   . VAL A 1 128 ? -20.872 -19.882  -3.235  1.00 36.59  ? 129 VAL A O   1 
ATOM   917   C CB  . VAL A 1 128 ? -21.652 -16.999  -3.673  1.00 34.95  ? 129 VAL A CB  1 
ATOM   918   C CG1 . VAL A 1 128 ? -21.534 -17.024  -5.190  1.00 32.69  ? 129 VAL A CG1 1 
ATOM   919   C CG2 . VAL A 1 128 ? -22.198 -15.666  -3.191  1.00 35.80  ? 129 VAL A CG2 1 
ATOM   920   N N   . VAL A 1 129 ? -22.631 -20.111  -4.628  1.00 35.65  ? 130 VAL A N   1 
ATOM   921   C CA  . VAL A 1 129 ? -22.097 -21.293  -5.293  1.00 35.41  ? 130 VAL A CA  1 
ATOM   922   C C   . VAL A 1 129 ? -22.207 -21.095  -6.796  1.00 34.92  ? 130 VAL A C   1 
ATOM   923   O O   . VAL A 1 129 ? -23.038 -20.318  -7.268  1.00 34.26  ? 130 VAL A O   1 
ATOM   924   C CB  . VAL A 1 129 ? -22.830 -22.595  -4.880  1.00 42.24  ? 130 VAL A CB  1 
ATOM   925   C CG1 . VAL A 1 129 ? -22.872 -22.738  -3.364  1.00 44.65  ? 130 VAL A CG1 1 
ATOM   926   C CG2 . VAL A 1 129 ? -24.234 -22.630  -5.452  1.00 43.28  ? 130 VAL A CG2 1 
ATOM   927   N N   . SER A 1 130 ? -21.359 -21.787  -7.549  1.00 35.43  ? 131 SER A N   1 
ATOM   928   C CA  . SER A 1 130 ? -21.393 -21.670  -8.996  1.00 34.77  ? 131 SER A CA  1 
ATOM   929   C C   . SER A 1 130 ? -20.877 -22.929  -9.679  1.00 36.09  ? 131 SER A C   1 
ATOM   930   O O   . SER A 1 130 ? -20.076 -23.682  -9.120  1.00 35.85  ? 131 SER A O   1 
ATOM   931   C CB  . SER A 1 130 ? -20.582 -20.456  -9.453  1.00 33.58  ? 131 SER A CB  1 
ATOM   932   O OG  . SER A 1 130 ? -20.659 -20.293  -10.863 1.00 32.97  ? 131 SER A OG  1 
ATOM   933   N N   . SER A 1 131 ? -21.359 -23.150  -10.895 1.00 35.64  ? 132 SER A N   1 
ATOM   934   C CA  . SER A 1 131 ? -20.884 -24.237  -11.735 1.00 37.81  ? 132 SER A CA  1 
ATOM   935   C C   . SER A 1 131 ? -20.236 -23.644  -12.976 1.00 38.58  ? 132 SER A C   1 
ATOM   936   O O   . SER A 1 131 ? -19.756 -24.368  -13.847 1.00 41.60  ? 132 SER A O   1 
ATOM   937   C CB  . SER A 1 131 ? -22.031 -25.179  -12.112 1.00 37.19  ? 132 SER A CB  1 
ATOM   938   O OG  . SER A 1 131 ? -23.123 -24.456  -12.650 1.00 34.21  ? 132 SER A OG  1 
ATOM   939   N N   . VAL A 1 132 ? -20.240 -22.315  -13.052 1.00 36.45  ? 133 VAL A N   1 
ATOM   940   C CA  . VAL A 1 132 ? -19.551 -21.605  -14.119 1.00 35.37  ? 133 VAL A CA  1 
ATOM   941   C C   . VAL A 1 132 ? -18.070 -21.516  -13.785 1.00 35.28  ? 133 VAL A C   1 
ATOM   942   O O   . VAL A 1 132 ? -17.700 -20.970  -12.740 1.00 34.59  ? 133 VAL A O   1 
ATOM   943   C CB  . VAL A 1 132 ? -20.102 -20.176  -14.326 1.00 34.46  ? 133 VAL A CB  1 
ATOM   944   C CG1 . VAL A 1 132 ? -19.612 -19.607  -15.646 1.00 34.10  ? 133 VAL A CG1 1 
ATOM   945   C CG2 . VAL A 1 132 ? -21.618 -20.168  -14.266 1.00 34.24  ? 133 VAL A CG2 1 
ATOM   946   N N   . PRO A 1 133 ? -17.215 -22.044  -14.671 1.00 36.55  ? 134 PRO A N   1 
ATOM   947   C CA  . PRO A 1 133 ? -15.767 -22.010  -14.442 1.00 37.52  ? 134 PRO A CA  1 
ATOM   948   C C   . PRO A 1 133 ? -15.287 -20.583  -14.237 1.00 36.67  ? 134 PRO A C   1 
ATOM   949   O O   . PRO A 1 133 ? -15.475 -19.744  -15.119 1.00 36.27  ? 134 PRO A O   1 
ATOM   950   C CB  . PRO A 1 133 ? -15.188 -22.619  -15.726 1.00 37.58  ? 134 PRO A CB  1 
ATOM   951   C CG  . PRO A 1 133 ? -16.268 -22.466  -16.744 1.00 37.35  ? 134 PRO A CG  1 
ATOM   952   C CD  . PRO A 1 133 ? -17.552 -22.602  -15.991 1.00 36.68  ? 134 PRO A CD  1 
ATOM   953   N N   . LEU A 1 134 ? -14.697 -20.316  -13.075 1.00 36.94  ? 135 LEU A N   1 
ATOM   954   C CA  . LEU A 1 134 ? -14.305 -18.964  -12.696 1.00 35.97  ? 135 LEU A CA  1 
ATOM   955   C C   . LEU A 1 134 ? -13.273 -18.404  -13.662 1.00 36.07  ? 135 LEU A C   1 
ATOM   956   O O   . LEU A 1 134 ? -12.182 -18.955  -13.811 1.00 37.38  ? 135 LEU A O   1 
ATOM   957   C CB  . LEU A 1 134 ? -13.760 -18.938  -11.261 1.00 37.50  ? 135 LEU A CB  1 
ATOM   958   C CG  . LEU A 1 134 ? -14.730 -19.409  -10.172 1.00 38.61  ? 135 LEU A CG  1 
ATOM   959   C CD1 . LEU A 1 134 ? -14.254 -18.984  -8.780  1.00 39.93  ? 135 LEU A CD1 1 
ATOM   960   C CD2 . LEU A 1 134 ? -16.149 -18.915  -10.441 1.00 37.21  ? 135 LEU A CD2 1 
ATOM   961   N N   . GLY A 1 135 ? -13.636 -17.308  -14.322 1.00 35.84  ? 136 GLY A N   1 
ATOM   962   C CA  . GLY A 1 135 ? -12.785 -16.688  -15.321 1.00 36.58  ? 136 GLY A CA  1 
ATOM   963   C C   . GLY A 1 135 ? -12.460 -17.584  -16.502 1.00 36.29  ? 136 GLY A C   1 
ATOM   964   O O   . GLY A 1 135 ? -11.447 -17.378  -17.169 1.00 37.36  ? 136 GLY A O   1 
ATOM   965   N N   . GLY A 1 136 ? -13.314 -18.572  -16.762 1.00 34.70  ? 137 GLY A N   1 
ATOM   966   C CA  . GLY A 1 136 ? -13.079 -19.538  -17.827 1.00 34.21  ? 137 GLY A CA  1 
ATOM   967   C C   . GLY A 1 136 ? -13.563 -19.119  -19.212 1.00 33.54  ? 137 GLY A C   1 
ATOM   968   O O   . GLY A 1 136 ? -13.413 -19.870  -20.184 1.00 33.70  ? 137 GLY A O   1 
ATOM   969   N N   . GLY A 1 137 ? -14.148 -17.929  -19.306 1.00 32.12  ? 138 GLY A N   1 
ATOM   970   C CA  . GLY A 1 137 ? -14.593 -17.386  -20.584 1.00 31.83  ? 138 GLY A CA  1 
ATOM   971   C C   . GLY A 1 137 ? -16.093 -17.438  -20.817 1.00 30.97  ? 138 GLY A C   1 
ATOM   972   O O   . GLY A 1 137 ? -16.583 -17.061  -21.891 1.00 32.09  ? 138 GLY A O   1 
ATOM   973   N N   . LEU A 1 138 ? -16.829 -17.898  -19.810 1.00 29.71  ? 139 LEU A N   1 
ATOM   974   C CA  . LEU A 1 138 ? -18.273 -18.066  -19.927 1.00 27.23  ? 139 LEU A CA  1 
ATOM   975   C C   . LEU A 1 138 ? -19.049 -17.121  -19.020 1.00 27.04  ? 139 LEU A C   1 
ATOM   976   O O   . LEU A 1 138 ? -20.199 -17.394  -18.672 1.00 28.11  ? 139 LEU A O   1 
ATOM   977   C CB  . LEU A 1 138 ? -18.656 -19.512  -19.626 1.00 27.73  ? 139 LEU A CB  1 
ATOM   978   C CG  . LEU A 1 138 ? -18.015 -20.531  -20.567 1.00 29.14  ? 139 LEU A CG  1 
ATOM   979   C CD1 . LEU A 1 138 ? -18.338 -21.959  -20.134 1.00 30.57  ? 139 LEU A CD1 1 
ATOM   980   C CD2 . LEU A 1 138 ? -18.471 -20.276  -22.011 1.00 27.26  ? 139 LEU A CD2 1 
ATOM   981   N N   . SER A 1 139 ? -18.407 -16.012  -18.654 1.00 27.06  ? 140 SER A N   1 
ATOM   982   C CA  . SER A 1 139 ? -19.026 -14.927  -17.890 1.00 27.13  ? 140 SER A CA  1 
ATOM   983   C C   . SER A 1 139 ? -19.446 -15.351  -16.487 1.00 27.73  ? 140 SER A C   1 
ATOM   984   O O   . SER A 1 139 ? -20.581 -15.098  -16.068 1.00 27.14  ? 140 SER A O   1 
ATOM   985   C CB  . SER A 1 139 ? -20.236 -14.366  -18.639 1.00 27.68  ? 140 SER A CB  1 
ATOM   986   O OG  . SER A 1 139 ? -19.924 -14.136  -20.003 1.00 27.35  ? 140 SER A OG  1 
ATOM   987   N N   . SER A 1 140 ? -18.537 -16.005  -15.768 1.00 27.36  ? 141 SER A N   1 
ATOM   988   C CA  . SER A 1 140 ? -18.794 -16.331  -14.370 1.00 28.28  ? 141 SER A CA  1 
ATOM   989   C C   . SER A 1 140 ? -19.139 -15.053  -13.608 1.00 28.07  ? 141 SER A C   1 
ATOM   990   O O   . SER A 1 140 ? -20.094 -15.023  -12.833 1.00 28.29  ? 141 SER A O   1 
ATOM   991   C CB  . SER A 1 140 ? -17.588 -17.033  -13.733 1.00 28.24  ? 141 SER A CB  1 
ATOM   992   O OG  . SER A 1 140 ? -16.397 -16.286  -13.920 1.00 28.40  ? 141 SER A OG  1 
ATOM   993   N N   . SER A 1 141 ? -18.390 -13.986  -13.866 1.00 28.34  ? 142 SER A N   1 
ATOM   994   C CA  . SER A 1 141 ? -18.588 -12.737  -13.134 1.00 29.64  ? 142 SER A CA  1 
ATOM   995   C C   . SER A 1 141 ? -19.937 -12.085  -13.451 1.00 26.84  ? 142 SER A C   1 
ATOM   996   O O   . SER A 1 141 ? -20.595 -11.558  -12.550 1.00 27.30  ? 142 SER A O   1 
ATOM   997   C CB  . SER A 1 141 ? -17.446 -11.757  -13.419 1.00 30.98  ? 142 SER A CB  1 
ATOM   998   O OG  . SER A 1 141 ? -17.530 -11.210  -14.718 1.00 32.02  ? 142 SER A OG  1 
ATOM   999   N N   . ALA A 1 142 ? -20.352 -12.122  -14.717 1.00 24.85  ? 143 ALA A N   1 
ATOM   1000  C CA  . ALA A 1 142 ? -21.667 -11.608  -15.080 1.00 21.92  ? 143 ALA A CA  1 
ATOM   1001  C C   . ALA A 1 142 ? -22.763 -12.351  -14.322 1.00 23.45  ? 143 ALA A C   1 
ATOM   1002  O O   . ALA A 1 142 ? -23.719 -11.737  -13.851 1.00 25.54  ? 143 ALA A O   1 
ATOM   1003  C CB  . ALA A 1 142 ? -21.899 -11.713  -16.601 1.00 22.32  ? 143 ALA A CB  1 
ATOM   1004  N N   . SER A 1 143 ? -22.624 -13.671  -14.197 1.00 23.73  ? 144 SER A N   1 
ATOM   1005  C CA  . SER A 1 143 ? -23.638 -14.463  -13.503 1.00 25.15  ? 144 SER A CA  1 
ATOM   1006  C C   . SER A 1 143 ? -23.692 -14.119  -12.016 1.00 25.64  ? 144 SER A C   1 
ATOM   1007  O O   . SER A 1 143 ? -24.772 -14.093  -11.426 1.00 26.51  ? 144 SER A O   1 
ATOM   1008  C CB  . SER A 1 143 ? -23.391 -15.967  -13.691 1.00 27.65  ? 144 SER A CB  1 
ATOM   1009  O OG  . SER A 1 143 ? -22.253 -16.406  -12.971 1.00 30.61  ? 144 SER A OG  1 
ATOM   1010  N N   . LEU A 1 144 ? -22.536 -13.842  -11.415 1.00 26.23  ? 145 LEU A N   1 
ATOM   1011  C CA  . LEU A 1 144 ? -22.485 -13.457  -10.001 1.00 27.60  ? 145 LEU A CA  1 
ATOM   1012  C C   . LEU A 1 144 ? -23.116 -12.079  -9.812  1.00 26.84  ? 145 LEU A C   1 
ATOM   1013  O O   . LEU A 1 144 ? -23.877 -11.862  -8.867  1.00 27.67  ? 145 LEU A O   1 
ATOM   1014  C CB  . LEU A 1 144 ? -21.042 -13.463  -9.475  1.00 26.83  ? 145 LEU A CB  1 
ATOM   1015  C CG  . LEU A 1 144 ? -20.830 -13.014  -8.020  1.00 28.22  ? 145 LEU A CG  1 
ATOM   1016  C CD1 . LEU A 1 144 ? -21.706 -13.814  -7.055  1.00 29.23  ? 145 LEU A CD1 1 
ATOM   1017  C CD2 . LEU A 1 144 ? -19.362 -13.124  -7.619  1.00 27.56  ? 145 LEU A CD2 1 
ATOM   1018  N N   . GLU A 1 145 ? -22.807 -11.157  -10.722 1.00 24.03  ? 146 GLU A N   1 
ATOM   1019  C CA  . GLU A 1 145 ? -23.393 -9.819   -10.676 1.00 24.39  ? 146 GLU A CA  1 
ATOM   1020  C C   . GLU A 1 145 ? -24.909 -9.877   -10.791 1.00 23.84  ? 146 GLU A C   1 
ATOM   1021  O O   . GLU A 1 145 ? -25.632 -9.210   -10.053 1.00 25.22  ? 146 GLU A O   1 
ATOM   1022  C CB  . GLU A 1 145 ? -22.819 -8.943   -11.792 1.00 25.67  ? 146 GLU A CB  1 
ATOM   1023  C CG  . GLU A 1 145 ? -21.381 -8.538   -11.565 1.00 27.95  ? 146 GLU A CG  1 
ATOM   1024  C CD  . GLU A 1 145 ? -20.593 -8.376   -12.848 1.00 28.01  ? 146 GLU A CD  1 
ATOM   1025  O OE1 . GLU A 1 145 ? -21.187 -8.401   -13.945 1.00 27.44  ? 146 GLU A OE1 1 
ATOM   1026  O OE2 . GLU A 1 145 ? -19.359 -8.238   -12.750 1.00 29.81  ? 146 GLU A OE2 1 
ATOM   1027  N N   . VAL A 1 146 ? -25.390 -10.688  -11.721 1.00 23.22  ? 147 VAL A N   1 
ATOM   1028  C CA  . VAL A 1 146 ? -26.818 -10.751  -11.992 1.00 24.66  ? 147 VAL A CA  1 
ATOM   1029  C C   . VAL A 1 146 ? -27.551 -11.519  -10.899 1.00 26.75  ? 147 VAL A C   1 
ATOM   1030  O O   . VAL A 1 146 ? -28.662 -11.151  -10.507 1.00 28.54  ? 147 VAL A O   1 
ATOM   1031  C CB  . VAL A 1 146 ? -27.080 -11.380  -13.373 1.00 24.87  ? 147 VAL A CB  1 
ATOM   1032  C CG1 . VAL A 1 146 ? -28.559 -11.714  -13.549 1.00 22.05  ? 147 VAL A CG1 1 
ATOM   1033  C CG2 . VAL A 1 146 ? -26.602 -10.419  -14.460 1.00 23.89  ? 147 VAL A CG2 1 
ATOM   1034  N N   . ALA A 1 147 ? -26.923 -12.576  -10.395 1.00 26.96  ? 148 ALA A N   1 
ATOM   1035  C CA  . ALA A 1 147 ? -27.464 -13.290  -9.243  1.00 26.76  ? 148 ALA A CA  1 
ATOM   1036  C C   . ALA A 1 147 ? -27.581 -12.339  -8.059  1.00 25.83  ? 148 ALA A C   1 
ATOM   1037  O O   . ALA A 1 147 ? -28.602 -12.315  -7.364  1.00 26.47  ? 148 ALA A O   1 
ATOM   1038  C CB  . ALA A 1 147 ? -26.588 -14.490  -8.881  1.00 26.59  ? 148 ALA A CB  1 
ATOM   1039  N N   . THR A 1 148 ? -26.534 -11.550  -7.836  1.00 26.66  ? 149 THR A N   1 
ATOM   1040  C CA  . THR A 1 148 ? -26.548 -10.584  -6.743  1.00 27.57  ? 149 THR A CA  1 
ATOM   1041  C C   . THR A 1 148 ? -27.671 -9.570   -6.953  1.00 29.98  ? 149 THR A C   1 
ATOM   1042  O O   . THR A 1 148 ? -28.444 -9.306   -6.028  1.00 31.67  ? 149 THR A O   1 
ATOM   1043  C CB  . THR A 1 148 ? -25.195 -9.857   -6.607  1.00 26.78  ? 149 THR A CB  1 
ATOM   1044  O OG1 . THR A 1 148 ? -24.171 -10.806  -6.276  1.00 26.99  ? 149 THR A OG1 1 
ATOM   1045  C CG2 . THR A 1 148 ? -25.258 -8.785   -5.523  1.00 26.05  ? 149 THR A CG2 1 
ATOM   1046  N N   . TYR A 1 149 ? -27.785 -9.033   -8.174  1.00 28.28  ? 150 TYR A N   1 
ATOM   1047  C CA  . TYR A 1 149 ? -28.826 -8.045   -8.459  1.00 27.35  ? 150 TYR A CA  1 
ATOM   1048  C C   . TYR A 1 149 ? -30.201 -8.631   -8.175  1.00 26.61  ? 150 TYR A C   1 
ATOM   1049  O O   . TYR A 1 149 ? -31.043 -7.994   -7.532  1.00 27.39  ? 150 TYR A O   1 
ATOM   1050  C CB  . TYR A 1 149 ? -28.770 -7.546   -9.916  1.00 27.01  ? 150 TYR A CB  1 
ATOM   1051  C CG  . TYR A 1 149 ? -29.555 -6.258   -10.094 1.00 27.34  ? 150 TYR A CG  1 
ATOM   1052  C CD1 . TYR A 1 149 ? -30.945 -6.272   -10.164 1.00 25.42  ? 150 TYR A CD1 1 
ATOM   1053  C CD2 . TYR A 1 149 ? -28.908 -5.025   -10.142 1.00 27.35  ? 150 TYR A CD2 1 
ATOM   1054  C CE1 . TYR A 1 149 ? -31.665 -5.103   -10.285 1.00 25.54  ? 150 TYR A CE1 1 
ATOM   1055  C CE2 . TYR A 1 149 ? -29.622 -3.846   -10.269 1.00 27.93  ? 150 TYR A CE2 1 
ATOM   1056  C CZ  . TYR A 1 149 ? -31.001 -3.892   -10.347 1.00 29.32  ? 150 TYR A CZ  1 
ATOM   1057  O OH  . TYR A 1 149 ? -31.719 -2.728   -10.466 1.00 26.39  ? 150 TYR A OH  1 
ATOM   1058  N N   . THR A 1 150 ? -30.416 -9.847   -8.666  1.00 26.58  ? 151 THR A N   1 
ATOM   1059  C CA  . THR A 1 150 ? -31.692 -10.536  -8.527  1.00 28.26  ? 151 THR A CA  1 
ATOM   1060  C C   . THR A 1 150 ? -32.036 -10.741  -7.048  1.00 29.12  ? 151 THR A C   1 
ATOM   1061  O O   . THR A 1 150 ? -33.203 -10.699  -6.647  1.00 29.58  ? 151 THR A O   1 
ATOM   1062  C CB  . THR A 1 150 ? -31.660 -11.891  -9.252  1.00 31.02  ? 151 THR A CB  1 
ATOM   1063  O OG1 . THR A 1 150 ? -31.187 -11.706  -10.594 1.00 30.58  ? 151 THR A OG1 1 
ATOM   1064  C CG2 . THR A 1 150 ? -33.041 -12.512  -9.296  1.00 32.01  ? 151 THR A CG2 1 
ATOM   1065  N N   . PHE A 1 151 ? -31.007 -10.949  -6.239  1.00 29.96  ? 152 PHE A N   1 
ATOM   1066  C CA  . PHE A 1 151 ? -31.191 -11.098  -4.796  1.00 31.97  ? 152 PHE A CA  1 
ATOM   1067  C C   . PHE A 1 151 ? -31.583 -9.765   -4.155  1.00 31.88  ? 152 PHE A C   1 
ATOM   1068  O O   . PHE A 1 151 ? -32.525 -9.708   -3.361  1.00 34.10  ? 152 PHE A O   1 
ATOM   1069  C CB  . PHE A 1 151 ? -29.917 -11.656  -4.158  1.00 33.38  ? 152 PHE A CB  1 
ATOM   1070  C CG  . PHE A 1 151 ? -30.054 -11.970  -2.691  1.00 37.77  ? 152 PHE A CG  1 
ATOM   1071  C CD1 . PHE A 1 151 ? -30.595 -13.176  -2.273  1.00 40.07  ? 152 PHE A CD1 1 
ATOM   1072  C CD2 . PHE A 1 151 ? -29.632 -11.067  -1.735  1.00 38.31  ? 152 PHE A CD2 1 
ATOM   1073  C CE1 . PHE A 1 151 ? -30.716 -13.471  -0.925  1.00 41.22  ? 152 PHE A CE1 1 
ATOM   1074  C CE2 . PHE A 1 151 ? -29.748 -11.356  -0.388  1.00 40.66  ? 152 PHE A CE2 1 
ATOM   1075  C CZ  . PHE A 1 151 ? -30.291 -12.559  0.017   1.00 41.88  ? 152 PHE A CZ  1 
ATOM   1076  N N   . LEU A 1 152 ? -30.878 -8.693   -4.513  1.00 29.41  ? 153 LEU A N   1 
ATOM   1077  C CA  . LEU A 1 152 ? -31.160 -7.370   -3.953  1.00 30.11  ? 153 LEU A CA  1 
ATOM   1078  C C   . LEU A 1 152 ? -32.586 -6.901   -4.262  1.00 31.73  ? 153 LEU A C   1 
ATOM   1079  O O   . LEU A 1 152 ? -33.186 -6.157   -3.481  1.00 33.87  ? 153 LEU A O   1 
ATOM   1080  C CB  . LEU A 1 152 ? -30.147 -6.342   -4.467  1.00 28.28  ? 153 LEU A CB  1 
ATOM   1081  C CG  . LEU A 1 152 ? -28.677 -6.614   -4.127  1.00 30.56  ? 153 LEU A CG  1 
ATOM   1082  C CD1 . LEU A 1 152 ? -27.798 -5.445   -4.532  1.00 27.45  ? 153 LEU A CD1 1 
ATOM   1083  C CD2 . LEU A 1 152 ? -28.492 -6.942   -2.634  1.00 27.85  ? 153 LEU A CD2 1 
ATOM   1084  N N   . GLN A 1 153 ? -33.124 -7.344   -5.397  1.00 32.82  ? 154 GLN A N   1 
ATOM   1085  C CA  . GLN A 1 153 ? -34.499 -7.027   -5.776  1.00 32.98  ? 154 GLN A CA  1 
ATOM   1086  C C   . GLN A 1 153 ? -35.504 -7.627   -4.809  1.00 34.83  ? 154 GLN A C   1 
ATOM   1087  O O   . GLN A 1 153 ? -36.547 -7.033   -4.532  1.00 36.59  ? 154 GLN A O   1 
ATOM   1088  C CB  . GLN A 1 153 ? -34.801 -7.529   -7.190  1.00 32.84  ? 154 GLN A CB  1 
ATOM   1089  C CG  . GLN A 1 153 ? -34.116 -6.762   -8.297  1.00 31.85  ? 154 GLN A CG  1 
ATOM   1090  C CD  . GLN A 1 153 ? -34.457 -7.325   -9.660  1.00 31.54  ? 154 GLN A CD  1 
ATOM   1091  O OE1 . GLN A 1 153 ? -33.660 -8.036   -10.268 1.00 31.91  ? 154 GLN A OE1 1 
ATOM   1092  N NE2 . GLN A 1 153 ? -35.657 -7.023   -10.138 1.00 31.50  ? 154 GLN A NE2 1 
ATOM   1093  N N   . GLN A 1 154 ? -35.200 -8.821   -4.315  1.00 35.63  ? 155 GLN A N   1 
ATOM   1094  C CA  . GLN A 1 154 ? -36.051 -9.458   -3.318  1.00 38.45  ? 155 GLN A CA  1 
ATOM   1095  C C   . GLN A 1 154 ? -35.971 -8.716   -1.986  1.00 38.53  ? 155 GLN A C   1 
ATOM   1096  O O   . GLN A 1 154 ? -36.956 -8.627   -1.259  1.00 40.37  ? 155 GLN A O   1 
ATOM   1097  C CB  . GLN A 1 154 ? -35.666 -10.925  -3.140  1.00 39.86  ? 155 GLN A CB  1 
ATOM   1098  C CG  . GLN A 1 154 ? -35.984 -11.776  -4.344  1.00 41.64  ? 155 GLN A CG  1 
ATOM   1099  C CD  . GLN A 1 154 ? -37.434 -11.636  -4.780  1.00 44.32  ? 155 GLN A CD  1 
ATOM   1100  O OE1 . GLN A 1 154 ? -38.351 -11.666  -3.955  1.00 47.12  ? 155 GLN A OE1 1 
ATOM   1101  N NE2 . GLN A 1 154 ? -37.645 -11.471  -6.080  1.00 42.99  ? 155 GLN A NE2 1 
ATOM   1102  N N   . LEU A 1 155 ? -34.797 -8.177   -1.678  1.00 38.04  ? 156 LEU A N   1 
ATOM   1103  C CA  . LEU A 1 155 ? -34.614 -7.383   -0.463  1.00 40.01  ? 156 LEU A CA  1 
ATOM   1104  C C   . LEU A 1 155 ? -35.257 -6.014   -0.610  1.00 42.40  ? 156 LEU A C   1 
ATOM   1105  O O   . LEU A 1 155 ? -35.778 -5.459   0.349   1.00 45.06  ? 156 LEU A O   1 
ATOM   1106  C CB  . LEU A 1 155 ? -33.129 -7.216   -0.141  1.00 37.70  ? 156 LEU A CB  1 
ATOM   1107  C CG  . LEU A 1 155 ? -32.308 -8.490   0.003   1.00 38.65  ? 156 LEU A CG  1 
ATOM   1108  C CD1 . LEU A 1 155 ? -30.882 -8.143   0.402   1.00 39.21  ? 156 LEU A CD1 1 
ATOM   1109  C CD2 . LEU A 1 155 ? -32.943 -9.406   1.035   1.00 41.27  ? 156 LEU A CD2 1 
ATOM   1110  N N   . CYS A 1 156 ? -35.212 -5.473   -1.822  1.00 42.40  ? 157 CYS A N   1 
ATOM   1111  C CA  . CYS A 1 156 ? -35.680 -4.117   -2.077  1.00 43.20  ? 157 CYS A CA  1 
ATOM   1112  C C   . CYS A 1 156 ? -35.962 -3.938   -3.568  1.00 42.25  ? 157 CYS A C   1 
ATOM   1113  O O   . CYS A 1 156 ? -35.063 -3.601   -4.341  1.00 41.11  ? 157 CYS A O   1 
ATOM   1114  C CB  . CYS A 1 156 ? -34.645 -3.098   -1.593  1.00 42.07  ? 157 CYS A CB  1 
ATOM   1115  S SG  . CYS A 1 156 ? -35.181 -1.378   -1.626  1.00 44.21  ? 157 CYS A SG  1 
ATOM   1116  N N   . PRO A 1 157 ? -37.216 -4.180   -3.976  1.00 42.88  ? 158 PRO A N   1 
ATOM   1117  C CA  . PRO A 1 157 ? -37.603 -4.128   -5.388  1.00 42.80  ? 158 PRO A CA  1 
ATOM   1118  C C   . PRO A 1 157 ? -37.199 -2.820   -6.052  1.00 42.81  ? 158 PRO A C   1 
ATOM   1119  O O   . PRO A 1 157 ? -37.454 -1.751   -5.498  1.00 43.30  ? 158 PRO A O   1 
ATOM   1120  C CB  . PRO A 1 157 ? -39.127 -4.266   -5.337  1.00 44.77  ? 158 PRO A CB  1 
ATOM   1121  C CG  . PRO A 1 157 ? -39.388 -5.017   -4.068  1.00 45.92  ? 158 PRO A CG  1 
ATOM   1122  C CD  . PRO A 1 157 ? -38.349 -4.536   -3.103  1.00 45.41  ? 158 PRO A CD  1 
ATOM   1123  N N   . ASP A 1 158 ? -36.545 -2.906   -7.207  1.00 42.17  ? 159 ASP A N   1 
ATOM   1124  C CA  . ASP A 1 158 ? -36.321 -1.718   -8.017  1.00 44.00  ? 159 ASP A CA  1 
ATOM   1125  C C   . ASP A 1 158 ? -37.594 -1.452   -8.814  1.00 46.98  ? 159 ASP A C   1 
ATOM   1126  O O   . ASP A 1 158 ? -38.552 -2.216   -8.724  1.00 48.19  ? 159 ASP A O   1 
ATOM   1127  C CB  . ASP A 1 158 ? -35.092 -1.875   -8.934  1.00 41.20  ? 159 ASP A CB  1 
ATOM   1128  C CG  . ASP A 1 158 ? -35.251 -2.971   -10.000 1.00 39.80  ? 159 ASP A CG  1 
ATOM   1129  O OD1 . ASP A 1 158 ? -36.380 -3.424   -10.293 1.00 40.00  ? 159 ASP A OD1 1 
ATOM   1130  O OD2 . ASP A 1 158 ? -34.215 -3.369   -10.573 1.00 37.82  ? 159 ASP A OD2 1 
ATOM   1131  N N   . SER A 1 159 ? -37.616 -0.382   -9.595  1.00 49.95  ? 160 SER A N   1 
ATOM   1132  C CA  . SER A 1 159 ? -38.785 -0.113   -10.424 1.00 53.24  ? 160 SER A CA  1 
ATOM   1133  C C   . SER A 1 159 ? -38.387 0.220    -11.861 1.00 50.98  ? 160 SER A C   1 
ATOM   1134  O O   . SER A 1 159 ? -39.083 0.973    -12.535 1.00 52.98  ? 160 SER A O   1 
ATOM   1135  C CB  . SER A 1 159 ? -39.623 1.022    -9.811  1.00 58.38  ? 160 SER A CB  1 
ATOM   1136  O OG  . SER A 1 159 ? -38.851 2.201    -9.652  1.00 60.49  ? 160 SER A OG  1 
ATOM   1137  N N   . GLY A 1 160 ? -37.281 -0.355   -12.333 1.00 47.12  ? 161 GLY A N   1 
ATOM   1138  C CA  . GLY A 1 160 ? -36.776 -0.035   -13.657 1.00 45.46  ? 161 GLY A CA  1 
ATOM   1139  C C   . GLY A 1 160 ? -36.879 -1.171   -14.658 1.00 42.81  ? 161 GLY A C   1 
ATOM   1140  O O   . GLY A 1 160 ? -37.557 -2.163   -14.425 1.00 41.19  ? 161 GLY A O   1 
ATOM   1141  N N   . THR A 1 161 ? -36.194 -1.015   -15.786 1.00 42.53  ? 162 THR A N   1 
ATOM   1142  C CA  . THR A 1 161 ? -36.196 -2.027   -16.842 1.00 41.10  ? 162 THR A CA  1 
ATOM   1143  C C   . THR A 1 161 ? -35.067 -3.034   -16.652 1.00 36.72  ? 162 THR A C   1 
ATOM   1144  O O   . THR A 1 161 ? -34.213 -2.881   -15.772 1.00 34.27  ? 162 THR A O   1 
ATOM   1145  C CB  . THR A 1 161 ? -36.075 -1.388   -18.217 1.00 42.63  ? 162 THR A CB  1 
ATOM   1146  O OG1 . THR A 1 161 ? -34.790 -0.779   -18.323 1.00 41.44  ? 162 THR A OG1 1 
ATOM   1147  C CG2 . THR A 1 161 ? -37.162 -0.332   -18.415 1.00 45.29  ? 162 THR A CG2 1 
ATOM   1148  N N   . ILE A 1 162 ? -35.063 -4.060   -17.495 1.00 33.85  ? 163 ILE A N   1 
ATOM   1149  C CA  . ILE A 1 162 ? -34.049 -5.094   -17.419 1.00 33.20  ? 163 ILE A CA  1 
ATOM   1150  C C   . ILE A 1 162 ? -32.720 -4.562   -17.927 1.00 31.33  ? 163 ILE A C   1 
ATOM   1151  O O   . ILE A 1 162 ? -31.662 -5.012   -17.491 1.00 30.72  ? 163 ILE A O   1 
ATOM   1152  C CB  . ILE A 1 162 ? -34.442 -6.343   -18.223 1.00 34.11  ? 163 ILE A CB  1 
ATOM   1153  N N   . ALA A 1 163 ? -32.769 -3.583   -18.823 1.00 30.44  ? 164 ALA A N   1 
ATOM   1154  C CA  . ALA A 1 163 ? -31.534 -3.001   -19.350 1.00 31.38  ? 164 ALA A CA  1 
ATOM   1155  C C   . ALA A 1 163 ? -30.823 -2.173   -18.284 1.00 32.05  ? 164 ALA A C   1 
ATOM   1156  O O   . ALA A 1 163 ? -29.597 -2.186   -18.197 1.00 33.35  ? 164 ALA A O   1 
ATOM   1157  C CB  . ALA A 1 163 ? -31.816 -2.152   -20.579 1.00 31.20  ? 164 ALA A CB  1 
ATOM   1158  N N   . ALA A 1 164 ? -31.594 -1.462   -17.467 1.00 31.74  ? 165 ALA A N   1 
ATOM   1159  C CA  . ALA A 1 164 ? -31.025 -0.706   -16.350 1.00 31.27  ? 165 ALA A CA  1 
ATOM   1160  C C   . ALA A 1 164 ? -30.348 -1.630   -15.340 1.00 30.25  ? 165 ALA A C   1 
ATOM   1161  O O   . ALA A 1 164 ? -29.341 -1.263   -14.739 1.00 28.73  ? 165 ALA A O   1 
ATOM   1162  C CB  . ALA A 1 164 ? -32.096 0.127    -15.660 1.00 30.85  ? 165 ALA A CB  1 
ATOM   1163  N N   . ARG A 1 165 ? -30.904 -2.827   -15.162 1.00 30.10  ? 166 ARG A N   1 
ATOM   1164  C CA  . ARG A 1 165 ? -30.306 -3.828   -14.280 1.00 27.37  ? 166 ARG A CA  1 
ATOM   1165  C C   . ARG A 1 165 ? -28.992 -4.339   -14.854 1.00 26.90  ? 166 ARG A C   1 
ATOM   1166  O O   . ARG A 1 165 ? -28.028 -4.555   -14.122 1.00 27.92  ? 166 ARG A O   1 
ATOM   1167  C CB  . ARG A 1 165 ? -31.265 -4.996   -14.054 1.00 25.28  ? 166 ARG A CB  1 
ATOM   1168  C CG  . ARG A 1 165 ? -32.588 -4.585   -13.472 1.00 25.81  ? 166 ARG A CG  1 
ATOM   1169  C CD  . ARG A 1 165 ? -33.493 -5.773   -13.217 1.00 26.97  ? 166 ARG A CD  1 
ATOM   1170  N NE  . ARG A 1 165 ? -34.771 -5.316   -12.686 1.00 31.39  ? 166 ARG A NE  1 
ATOM   1171  C CZ  . ARG A 1 165 ? -35.955 -5.761   -13.084 1.00 35.03  ? 166 ARG A CZ  1 
ATOM   1172  N NH1 . ARG A 1 165 ? -36.033 -6.692   -14.025 1.00 37.13  ? 166 ARG A NH1 1 
ATOM   1173  N NH2 . ARG A 1 165 ? -37.062 -5.272   -12.541 1.00 36.25  ? 166 ARG A NH2 1 
ATOM   1174  N N   . ALA A 1 166 ? -28.956 -4.539   -16.167 1.00 25.89  ? 167 ALA A N   1 
ATOM   1175  C CA  . ALA A 1 166 ? -27.731 -4.979   -16.818 1.00 24.54  ? 167 ALA A CA  1 
ATOM   1176  C C   . ALA A 1 166 ? -26.647 -3.920   -16.695 1.00 24.99  ? 167 ALA A C   1 
ATOM   1177  O O   . ALA A 1 166 ? -25.479 -4.239   -16.501 1.00 25.11  ? 167 ALA A O   1 
ATOM   1178  C CB  . ALA A 1 166 ? -27.989 -5.312   -18.294 1.00 24.92  ? 167 ALA A CB  1 
ATOM   1179  N N   . GLN A 1 167 ? -27.038 -2.656   -16.805 1.00 27.18  ? 168 GLN A N   1 
ATOM   1180  C CA  . GLN A 1 167 ? -26.078 -1.559   -16.776 1.00 30.72  ? 168 GLN A CA  1 
ATOM   1181  C C   . GLN A 1 167 ? -25.493 -1.376   -15.374 1.00 31.88  ? 168 GLN A C   1 
ATOM   1182  O O   . GLN A 1 167 ? -24.316 -1.037   -15.224 1.00 31.48  ? 168 GLN A O   1 
ATOM   1183  C CB  . GLN A 1 167 ? -26.736 -0.268   -17.278 1.00 34.57  ? 168 GLN A CB  1 
ATOM   1184  C CG  . GLN A 1 167 ? -26.943 -0.269   -18.796 1.00 38.80  ? 168 GLN A CG  1 
ATOM   1185  C CD  . GLN A 1 167 ? -27.989 0.729    -19.274 1.00 43.98  ? 168 GLN A CD  1 
ATOM   1186  O OE1 . GLN A 1 167 ? -28.623 1.420    -18.476 1.00 46.96  ? 168 GLN A OE1 1 
ATOM   1187  N NE2 . GLN A 1 167 ? -28.164 0.813    -20.591 1.00 45.07  ? 168 GLN A NE2 1 
ATOM   1188  N N   . VAL A 1 168 ? -26.308 -1.628   -14.354 1.00 32.47  ? 169 VAL A N   1 
ATOM   1189  C CA  . VAL A 1 168 ? -25.824 -1.637   -12.978 1.00 32.18  ? 169 VAL A CA  1 
ATOM   1190  C C   . VAL A 1 168 ? -24.761 -2.714   -12.789 1.00 31.51  ? 169 VAL A C   1 
ATOM   1191  O O   . VAL A 1 168 ? -23.704 -2.456   -12.211 1.00 32.08  ? 169 VAL A O   1 
ATOM   1192  C CB  . VAL A 1 168 ? -26.970 -1.867   -11.972 1.00 32.99  ? 169 VAL A CB  1 
ATOM   1193  C CG1 . VAL A 1 168 ? -26.417 -2.194   -10.594 1.00 33.25  ? 169 VAL A CG1 1 
ATOM   1194  C CG2 . VAL A 1 168 ? -27.880 -0.646   -11.916 1.00 33.33  ? 169 VAL A CG2 1 
ATOM   1195  N N   . CYS A 1 169 ? -25.037 -3.917   -13.288 1.00 30.08  ? 170 CYS A N   1 
ATOM   1196  C CA  . CYS A 1 169 ? -24.089 -5.018   -13.157 1.00 27.82  ? 170 CYS A CA  1 
ATOM   1197  C C   . CYS A 1 169 ? -22.843 -4.741   -13.978 1.00 28.47  ? 170 CYS A C   1 
ATOM   1198  O O   . CYS A 1 169 ? -21.724 -5.085   -13.574 1.00 28.54  ? 170 CYS A O   1 
ATOM   1199  C CB  . CYS A 1 169 ? -24.726 -6.338   -13.586 1.00 26.38  ? 170 CYS A CB  1 
ATOM   1200  S SG  . CYS A 1 169 ? -26.095 -6.836   -12.547 1.00 28.25  ? 170 CYS A SG  1 
ATOM   1201  N N   . GLN A 1 170 ? -23.048 -4.112   -15.133 1.00 27.12  ? 171 GLN A N   1 
ATOM   1202  C CA  . GLN A 1 170 ? -21.948 -3.680   -15.984 1.00 26.94  ? 171 GLN A CA  1 
ATOM   1203  C C   . GLN A 1 170 ? -21.068 -2.637   -15.288 1.00 27.55  ? 171 GLN A C   1 
ATOM   1204  O O   . GLN A 1 170 ? -19.840 -2.707   -15.349 1.00 27.22  ? 171 GLN A O   1 
ATOM   1205  C CB  . GLN A 1 170 ? -22.492 -3.113   -17.301 1.00 27.53  ? 171 GLN A CB  1 
ATOM   1206  C CG  . GLN A 1 170 ? -21.426 -2.676   -18.278 1.00 28.86  ? 171 GLN A CG  1 
ATOM   1207  C CD  . GLN A 1 170 ? -22.011 -1.939   -19.472 1.00 30.83  ? 171 GLN A CD  1 
ATOM   1208  O OE1 . GLN A 1 170 ? -23.112 -1.387   -19.398 1.00 31.89  ? 171 GLN A OE1 1 
ATOM   1209  N NE2 . GLN A 1 170 ? -21.275 -1.926   -20.578 1.00 29.16  ? 171 GLN A NE2 1 
ATOM   1210  N N   . GLN A 1 171 ? -21.695 -1.667   -14.629 1.00 29.16  ? 172 GLN A N   1 
ATOM   1211  C CA  . GLN A 1 171 ? -20.941 -0.644   -13.901 1.00 33.12  ? 172 GLN A CA  1 
ATOM   1212  C C   . GLN A 1 171 ? -20.124 -1.263   -12.760 1.00 31.44  ? 172 GLN A C   1 
ATOM   1213  O O   . GLN A 1 171 ? -19.013 -0.823   -12.467 1.00 31.78  ? 172 GLN A O   1 
ATOM   1214  C CB  . GLN A 1 171 ? -21.885 0.437    -13.363 1.00 37.43  ? 172 GLN A CB  1 
ATOM   1215  C CG  . GLN A 1 171 ? -21.208 1.549    -12.569 1.00 42.74  ? 172 GLN A CG  1 
ATOM   1216  C CD  . GLN A 1 171 ? -20.381 2.497    -13.428 1.00 47.90  ? 172 GLN A CD  1 
ATOM   1217  O OE1 . GLN A 1 171 ? -19.378 2.107    -14.024 1.00 48.69  ? 172 GLN A OE1 1 
ATOM   1218  N NE2 . GLN A 1 171 ? -20.805 3.756    -13.491 1.00 52.27  ? 172 GLN A NE2 1 
ATOM   1219  N N   . ALA A 1 172 ? -20.675 -2.294   -12.129 1.00 30.33  ? 173 ALA A N   1 
ATOM   1220  C CA  . ALA A 1 172 ? -19.945 -3.033   -11.101 1.00 29.03  ? 173 ALA A CA  1 
ATOM   1221  C C   . ALA A 1 172 ? -18.698 -3.674   -11.699 1.00 28.65  ? 173 ALA A C   1 
ATOM   1222  O O   . ALA A 1 172 ? -17.623 -3.648   -11.101 1.00 28.17  ? 173 ALA A O   1 
ATOM   1223  C CB  . ALA A 1 172 ? -20.837 -4.096   -10.467 1.00 27.36  ? 173 ALA A CB  1 
ATOM   1224  N N   . GLU A 1 173 ? -18.849 -4.248   -12.889 1.00 29.66  ? 174 GLU A N   1 
ATOM   1225  C CA  . GLU A 1 173 ? -17.722 -4.871   -13.572 1.00 31.28  ? 174 GLU A CA  1 
ATOM   1226  C C   . GLU A 1 173 ? -16.656 -3.818   -13.884 1.00 28.94  ? 174 GLU A C   1 
ATOM   1227  O O   . GLU A 1 173 ? -15.467 -4.034   -13.644 1.00 29.40  ? 174 GLU A O   1 
ATOM   1228  C CB  . GLU A 1 173 ? -18.185 -5.575   -14.854 1.00 34.32  ? 174 GLU A CB  1 
ATOM   1229  C CG  . GLU A 1 173 ? -17.072 -6.299   -15.596 1.00 39.48  ? 174 GLU A CG  1 
ATOM   1230  C CD  . GLU A 1 173 ? -17.025 -7.787   -15.300 1.00 43.97  ? 174 GLU A CD  1 
ATOM   1231  O OE1 . GLU A 1 173 ? -17.110 -8.172   -14.118 1.00 43.70  ? 174 GLU A OE1 1 
ATOM   1232  O OE2 . GLU A 1 173 ? -16.908 -8.578   -16.258 1.00 48.01  ? 174 GLU A OE2 1 
ATOM   1233  N N   . HIS A 1 174 ? -17.089 -2.674   -14.406 1.00 27.34  ? 175 HIS A N   1 
ATOM   1234  C CA  . HIS A 1 174 ? -16.170 -1.587   -14.732 1.00 30.72  ? 175 HIS A CA  1 
ATOM   1235  C C   . HIS A 1 174 ? -15.429 -1.052   -13.500 1.00 33.11  ? 175 HIS A C   1 
ATOM   1236  O O   . HIS A 1 174 ? -14.201 -0.951   -13.489 1.00 34.03  ? 175 HIS A O   1 
ATOM   1237  C CB  . HIS A 1 174 ? -16.915 -0.424   -15.396 1.00 30.88  ? 175 HIS A CB  1 
ATOM   1238  C CG  . HIS A 1 174 ? -17.320 -0.679   -16.813 1.00 31.50  ? 175 HIS A CG  1 
ATOM   1239  N ND1 . HIS A 1 174 ? -17.187 0.275    -17.805 1.00 33.77  ? 175 HIS A ND1 1 
ATOM   1240  C CD2 . HIS A 1 174 ? -17.878 -1.758   -17.410 1.00 30.07  ? 175 HIS A CD2 1 
ATOM   1241  C CE1 . HIS A 1 174 ? -17.635 -0.210   -18.946 1.00 32.44  ? 175 HIS A CE1 1 
ATOM   1242  N NE2 . HIS A 1 174 ? -18.065 -1.444   -18.735 1.00 30.77  ? 175 HIS A NE2 1 
ATOM   1243  N N   . SER A 1 175 ? -16.189 -0.710   -12.466 1.00 33.58  ? 176 SER A N   1 
ATOM   1244  C CA  . SER A 1 175 ? -15.653 0.070    -11.355 1.00 36.31  ? 176 SER A CA  1 
ATOM   1245  C C   . SER A 1 175 ? -15.093 -0.765   -10.209 1.00 36.00  ? 176 SER A C   1 
ATOM   1246  O O   . SER A 1 175 ? -14.263 -0.286   -9.441  1.00 37.16  ? 176 SER A O   1 
ATOM   1247  C CB  . SER A 1 175 ? -16.735 1.002    -10.814 1.00 38.71  ? 176 SER A CB  1 
ATOM   1248  O OG  . SER A 1 175 ? -17.214 1.854    -11.838 1.00 41.54  ? 176 SER A OG  1 
ATOM   1249  N N   . PHE A 1 176 ? -15.543 -2.007   -10.082 1.00 35.20  ? 177 PHE A N   1 
ATOM   1250  C CA  . PHE A 1 176 ? -15.077 -2.836   -8.977  1.00 35.39  ? 177 PHE A CA  1 
ATOM   1251  C C   . PHE A 1 176 ? -14.213 -4.002   -9.436  1.00 36.36  ? 177 PHE A C   1 
ATOM   1252  O O   . PHE A 1 176 ? -13.460 -4.565   -8.641  1.00 36.31  ? 177 PHE A O   1 
ATOM   1253  C CB  . PHE A 1 176 ? -16.266 -3.335   -8.157  1.00 33.59  ? 177 PHE A CB  1 
ATOM   1254  C CG  . PHE A 1 176 ? -16.706 -2.361   -7.099  1.00 34.73  ? 177 PHE A CG  1 
ATOM   1255  C CD1 . PHE A 1 176 ? -17.317 -1.169   -7.451  1.00 35.06  ? 177 PHE A CD1 1 
ATOM   1256  C CD2 . PHE A 1 176 ? -16.485 -2.627   -5.753  1.00 35.86  ? 177 PHE A CD2 1 
ATOM   1257  C CE1 . PHE A 1 176 ? -17.714 -0.264   -6.484  1.00 36.49  ? 177 PHE A CE1 1 
ATOM   1258  C CE2 . PHE A 1 176 ? -16.881 -1.726   -4.779  1.00 36.14  ? 177 PHE A CE2 1 
ATOM   1259  C CZ  . PHE A 1 176 ? -17.497 -0.545   -5.144  1.00 36.93  ? 177 PHE A CZ  1 
ATOM   1260  N N   . ALA A 1 177 ? -14.301 -4.351   -10.718 1.00 35.95  ? 178 ALA A N   1 
ATOM   1261  C CA  . ALA A 1 177 ? -13.469 -5.422   -11.259 1.00 36.27  ? 178 ALA A CA  1 
ATOM   1262  C C   . ALA A 1 177 ? -12.506 -4.913   -12.323 1.00 36.35  ? 178 ALA A C   1 
ATOM   1263  O O   . ALA A 1 177 ? -11.757 -5.696   -12.908 1.00 37.37  ? 178 ALA A O   1 
ATOM   1264  C CB  . ALA A 1 177 ? -14.331 -6.529   -11.826 1.00 36.14  ? 178 ALA A CB  1 
ATOM   1265  N N   . GLY A 1 178 ? -12.530 -3.606   -12.573 1.00 35.53  ? 179 GLY A N   1 
ATOM   1266  C CA  . GLY A 1 178 ? -11.633 -2.989   -13.536 1.00 36.16  ? 179 GLY A CA  1 
ATOM   1267  C C   . GLY A 1 178 ? -11.711 -3.557   -14.946 1.00 35.72  ? 179 GLY A C   1 
ATOM   1268  O O   . GLY A 1 178 ? -10.727 -3.535   -15.685 1.00 37.71  ? 179 GLY A O   1 
ATOM   1269  N N   . MET A 1 179 ? -12.879 -4.068   -15.323 1.00 33.10  ? 180 MET A N   1 
ATOM   1270  C CA  . MET A 1 179 ? -13.063 -4.649   -16.652 1.00 31.62  ? 180 MET A CA  1 
ATOM   1271  C C   . MET A 1 179 ? -14.210 -3.943   -17.380 1.00 31.15  ? 180 MET A C   1 
ATOM   1272  O O   . MET A 1 179 ? -15.381 -4.165   -17.070 1.00 29.26  ? 180 MET A O   1 
ATOM   1273  C CB  . MET A 1 179 ? -13.323 -6.155   -16.545 1.00 30.97  ? 180 MET A CB  1 
ATOM   1274  C CG  . MET A 1 179 ? -13.749 -6.830   -17.852 1.00 33.16  ? 180 MET A CG  1 
ATOM   1275  S SD  . MET A 1 179 ? -12.541 -6.675   -19.184 1.00 58.66  ? 180 MET A SD  1 
ATOM   1276  C CE  . MET A 1 179 ? -11.099 -7.387   -18.407 1.00 51.67  ? 180 MET A CE  1 
ATOM   1277  N N   . PRO A 1 180 ? -13.869 -3.077   -18.347 1.00 31.50  ? 181 PRO A N   1 
ATOM   1278  C CA  . PRO A 1 180 ? -14.841 -2.215   -19.025 1.00 31.91  ? 181 PRO A CA  1 
ATOM   1279  C C   . PRO A 1 180 ? -15.640 -2.957   -20.099 1.00 32.46  ? 181 PRO A C   1 
ATOM   1280  O O   . PRO A 1 180 ? -15.586 -2.600   -21.274 1.00 32.51  ? 181 PRO A O   1 
ATOM   1281  C CB  . PRO A 1 180 ? -13.959 -1.125   -19.640 1.00 32.25  ? 181 PRO A CB  1 
ATOM   1282  C CG  . PRO A 1 180 ? -12.675 -1.826   -19.938 1.00 31.84  ? 181 PRO A CG  1 
ATOM   1283  C CD  . PRO A 1 180 ? -12.504 -2.885   -18.867 1.00 32.33  ? 181 PRO A CD  1 
ATOM   1284  N N   . CYS A 1 181 ? -16.387 -3.971   -19.673 1.00 32.64  ? 182 CYS A N   1 
ATOM   1285  C CA  . CYS A 1 181 ? -17.154 -4.820   -20.575 1.00 33.57  ? 182 CYS A CA  1 
ATOM   1286  C C   . CYS A 1 181 ? -18.284 -4.074   -21.280 1.00 32.08  ? 182 CYS A C   1 
ATOM   1287  O O   . CYS A 1 181 ? -18.675 -2.974   -20.873 1.00 31.20  ? 182 CYS A O   1 
ATOM   1288  C CB  . CYS A 1 181 ? -17.740 -6.001   -19.799 1.00 34.47  ? 182 CYS A CB  1 
ATOM   1289  S SG  . CYS A 1 181 ? -18.910 -5.483   -18.514 1.00 28.33  ? 182 CYS A SG  1 
ATOM   1290  N N   . GLY A 1 182 ? -18.801 -4.689   -22.339 1.00 30.84  ? 183 GLY A N   1 
ATOM   1291  C CA  . GLY A 1 182 ? -20.023 -4.230   -22.974 1.00 29.45  ? 183 GLY A CA  1 
ATOM   1292  C C   . GLY A 1 182 ? -21.210 -4.764   -22.198 1.00 28.09  ? 183 GLY A C   1 
ATOM   1293  O O   . GLY A 1 182 ? -21.057 -5.270   -21.087 1.00 26.82  ? 183 GLY A O   1 
ATOM   1294  N N   . ILE A 1 183 ? -22.396 -4.679   -22.780 1.00 27.82  ? 184 ILE A N   1 
ATOM   1295  C CA  . ILE A 1 183 ? -23.608 -5.044   -22.056 1.00 28.40  ? 184 ILE A CA  1 
ATOM   1296  C C   . ILE A 1 183 ? -24.024 -6.517   -22.217 1.00 26.96  ? 184 ILE A C   1 
ATOM   1297  O O   . ILE A 1 183 ? -24.897 -7.000   -21.492 1.00 26.85  ? 184 ILE A O   1 
ATOM   1298  C CB  . ILE A 1 183 ? -24.783 -4.146   -22.497 1.00 31.22  ? 184 ILE A CB  1 
ATOM   1299  C CG1 . ILE A 1 183 ? -25.899 -4.153   -21.446 1.00 34.19  ? 184 ILE A CG1 1 
ATOM   1300  C CG2 . ILE A 1 183 ? -25.285 -4.569   -23.877 1.00 31.44  ? 184 ILE A CG2 1 
ATOM   1301  C CD1 . ILE A 1 183 ? -26.998 -3.145   -21.704 1.00 36.44  ? 184 ILE A CD1 1 
ATOM   1302  N N   . MET A 1 184 ? -23.401 -7.234   -23.151 1.00 25.50  ? 185 MET A N   1 
ATOM   1303  C CA  . MET A 1 184 ? -23.906 -8.553   -23.545 1.00 25.47  ? 185 MET A CA  1 
ATOM   1304  C C   . MET A 1 184 ? -24.038 -9.530   -22.387 1.00 24.89  ? 185 MET A C   1 
ATOM   1305  O O   . MET A 1 184 ? -25.095 -10.118  -22.179 1.00 25.33  ? 185 MET A O   1 
ATOM   1306  C CB  . MET A 1 184 ? -23.011 -9.192   -24.606 1.00 25.21  ? 185 MET A CB  1 
ATOM   1307  C CG  . MET A 1 184 ? -23.275 -10.681  -24.768 1.00 24.66  ? 185 MET A CG  1 
ATOM   1308  S SD  . MET A 1 184 ? -22.476 -11.428  -26.199 1.00 28.84  ? 185 MET A SD  1 
ATOM   1309  C CE  . MET A 1 184 ? -20.773 -10.939  -25.937 1.00 33.35  ? 185 MET A CE  1 
ATOM   1310  N N   . ASP A 1 185 ? -22.948 -9.697   -21.648 1.00 24.61  ? 186 ASP A N   1 
ATOM   1311  C CA  . ASP A 1 185 ? -22.850 -10.731  -20.627 1.00 25.25  ? 186 ASP A CA  1 
ATOM   1312  C C   . ASP A 1 185 ? -23.963 -10.630  -19.593 1.00 26.29  ? 186 ASP A C   1 
ATOM   1313  O O   . ASP A 1 185 ? -24.594 -11.632  -19.239 1.00 27.44  ? 186 ASP A O   1 
ATOM   1314  C CB  . ASP A 1 185 ? -21.490 -10.659  -19.939 1.00 23.26  ? 186 ASP A CB  1 
ATOM   1315  C CG  . ASP A 1 185 ? -20.335 -10.889  -20.903 1.00 26.71  ? 186 ASP A CG  1 
ATOM   1316  O OD1 . ASP A 1 185 ? -20.600 -11.034  -22.123 1.00 28.11  ? 186 ASP A OD1 1 
ATOM   1317  O OD2 . ASP A 1 185 ? -19.169 -10.972  -20.471 1.00 27.63  ? 186 ASP A OD2 1 
ATOM   1318  N N   . GLN A 1 186 ? -24.199 -9.416   -19.115 1.00 24.88  ? 187 GLN A N   1 
ATOM   1319  C CA  . GLN A 1 186 ? -25.198 -9.177   -18.096 1.00 26.29  ? 187 GLN A CA  1 
ATOM   1320  C C   . GLN A 1 186 ? -26.589 -9.302   -18.688 1.00 27.29  ? 187 GLN A C   1 
ATOM   1321  O O   . GLN A 1 186 ? -27.497 -9.836   -18.058 1.00 29.02  ? 187 GLN A O   1 
ATOM   1322  C CB  . GLN A 1 186 ? -24.987 -7.796   -17.472 1.00 26.01  ? 187 GLN A CB  1 
ATOM   1323  C CG  . GLN A 1 186 ? -23.713 -7.676   -16.623 1.00 25.60  ? 187 GLN A CG  1 
ATOM   1324  C CD  . GLN A 1 186 ? -22.428 -7.609   -17.444 1.00 28.09  ? 187 GLN A CD  1 
ATOM   1325  O OE1 . GLN A 1 186 ? -22.450 -7.301   -18.636 1.00 30.17  ? 187 GLN A OE1 1 
ATOM   1326  N NE2 . GLN A 1 186 ? -21.301 -7.898   -16.802 1.00 27.65  ? 187 GLN A NE2 1 
ATOM   1327  N N   . PHE A 1 187 ? -26.750 -8.815   -19.913 1.00 27.35  ? 188 PHE A N   1 
ATOM   1328  C CA  . PHE A 1 187 ? -28.054 -8.826   -20.557 1.00 28.58  ? 188 PHE A CA  1 
ATOM   1329  C C   . PHE A 1 187 ? -28.563 -10.248  -20.779 1.00 25.29  ? 188 PHE A C   1 
ATOM   1330  O O   . PHE A 1 187 ? -29.725 -10.546  -20.506 1.00 27.09  ? 188 PHE A O   1 
ATOM   1331  C CB  . PHE A 1 187 ? -27.999 -8.073   -21.887 1.00 33.38  ? 188 PHE A CB  1 
ATOM   1332  C CG  . PHE A 1 187 ? -29.229 -7.271   -22.173 1.00 39.94  ? 188 PHE A CG  1 
ATOM   1333  C CD1 . PHE A 1 187 ? -29.205 -5.891   -22.108 1.00 42.82  ? 188 PHE A CD1 1 
ATOM   1334  C CD2 . PHE A 1 187 ? -30.422 -7.899   -22.474 1.00 45.03  ? 188 PHE A CD2 1 
ATOM   1335  C CE1 . PHE A 1 187 ? -30.346 -5.148   -22.370 1.00 45.84  ? 188 PHE A CE1 1 
ATOM   1336  C CE2 . PHE A 1 187 ? -31.567 -7.164   -22.729 1.00 47.48  ? 188 PHE A CE2 1 
ATOM   1337  C CZ  . PHE A 1 187 ? -31.529 -5.787   -22.677 1.00 47.04  ? 188 PHE A CZ  1 
ATOM   1338  N N   . ILE A 1 188 ? -27.699 -11.135  -21.262 1.00 22.50  ? 189 ILE A N   1 
ATOM   1339  C CA  . ILE A 1 188 ? -28.138 -12.505  -21.527 1.00 23.73  ? 189 ILE A CA  1 
ATOM   1340  C C   . ILE A 1 188 ? -28.329 -13.280  -20.221 1.00 25.13  ? 189 ILE A C   1 
ATOM   1341  O O   . ILE A 1 188 ? -29.207 -14.147  -20.125 1.00 24.29  ? 189 ILE A O   1 
ATOM   1342  C CB  . ILE A 1 188 ? -27.151 -13.262  -22.478 1.00 24.23  ? 189 ILE A CB  1 
ATOM   1343  C CG1 . ILE A 1 188 ? -27.639 -14.691  -22.757 1.00 26.42  ? 189 ILE A CG1 1 
ATOM   1344  C CG2 . ILE A 1 188 ? -25.729 -13.272  -21.928 1.00 23.54  ? 189 ILE A CG2 1 
ATOM   1345  C CD1 . ILE A 1 188 ? -29.063 -14.775  -23.277 1.00 27.94  ? 189 ILE A CD1 1 
ATOM   1346  N N   . SER A 1 189 ? -27.539 -12.958  -19.199 1.00 26.32  ? 190 SER A N   1 
ATOM   1347  C CA  . SER A 1 189 ? -27.713 -13.640  -17.922 1.00 27.41  ? 190 SER A CA  1 
ATOM   1348  C C   . SER A 1 189 ? -29.090 -13.304  -17.373 1.00 28.71  ? 190 SER A C   1 
ATOM   1349  O O   . SER A 1 189 ? -29.796 -14.171  -16.859 1.00 29.48  ? 190 SER A O   1 
ATOM   1350  C CB  . SER A 1 189 ? -26.626 -13.250  -16.921 1.00 28.20  ? 190 SER A CB  1 
ATOM   1351  O OG  . SER A 1 189 ? -26.666 -14.128  -15.811 1.00 29.41  ? 190 SER A OG  1 
ATOM   1352  N N   . LEU A 1 190 ? -29.478 -12.041  -17.521 1.00 28.37  ? 191 LEU A N   1 
ATOM   1353  C CA  . LEU A 1 190 ? -30.795 -11.579  -17.096 1.00 29.96  ? 191 LEU A CA  1 
ATOM   1354  C C   . LEU A 1 190 ? -31.941 -12.131  -17.940 1.00 32.37  ? 191 LEU A C   1 
ATOM   1355  O O   . LEU A 1 190 ? -32.979 -12.520  -17.405 1.00 33.40  ? 191 LEU A O   1 
ATOM   1356  C CB  . LEU A 1 190 ? -30.853 -10.051  -17.133 1.00 27.88  ? 191 LEU A CB  1 
ATOM   1357  C CG  . LEU A 1 190 ? -30.144 -9.274   -16.026 1.00 27.30  ? 191 LEU A CG  1 
ATOM   1358  C CD1 . LEU A 1 190 ? -29.940 -7.845   -16.478 1.00 28.05  ? 191 LEU A CD1 1 
ATOM   1359  C CD2 . LEU A 1 190 ? -30.971 -9.314   -14.748 1.00 27.14  ? 191 LEU A CD2 1 
ATOM   1360  N N   . MET A 1 191 ? -31.753 -12.160  -19.259 1.00 33.18  ? 192 MET A N   1 
ATOM   1361  C CA  . MET A 1 191 ? -32.878 -12.320  -20.179 1.00 34.98  ? 192 MET A CA  1 
ATOM   1362  C C   . MET A 1 191 ? -32.949 -13.644  -20.935 1.00 35.73  ? 192 MET A C   1 
ATOM   1363  O O   . MET A 1 191 ? -33.807 -13.815  -21.798 1.00 38.11  ? 192 MET A O   1 
ATOM   1364  C CB  . MET A 1 191 ? -32.866 -11.183  -21.195 1.00 37.12  ? 192 MET A CB  1 
ATOM   1365  C CG  . MET A 1 191 ? -33.489 -9.907   -20.677 1.00 39.58  ? 192 MET A CG  1 
ATOM   1366  S SD  . MET A 1 191 ? -34.299 -9.020   -22.017 1.00 107.24 ? 192 MET A SD  1 
ATOM   1367  C CE  . MET A 1 191 ? -35.201 -10.358  -22.794 1.00 66.73  ? 192 MET A CE  1 
ATOM   1368  N N   . GLY A 1 192 ? -32.052 -14.569  -20.620 1.00 35.59  ? 193 GLY A N   1 
ATOM   1369  C CA  . GLY A 1 192 ? -32.057 -15.873  -21.253 1.00 35.81  ? 193 GLY A CA  1 
ATOM   1370  C C   . GLY A 1 192 ? -33.386 -16.592  -21.113 1.00 38.80  ? 193 GLY A C   1 
ATOM   1371  O O   . GLY A 1 192 ? -34.116 -16.401  -20.141 1.00 39.07  ? 193 GLY A O   1 
ATOM   1372  N N   . GLN A 1 193 ? -33.718 -17.398  -22.114 1.00 41.25  ? 194 GLN A N   1 
ATOM   1373  C CA  . GLN A 1 193 ? -34.893 -18.253  -22.049 1.00 42.97  ? 194 GLN A CA  1 
ATOM   1374  C C   . GLN A 1 193 ? -34.519 -19.642  -22.531 1.00 41.16  ? 194 GLN A C   1 
ATOM   1375  O O   . GLN A 1 193 ? -33.835 -19.786  -23.549 1.00 39.46  ? 194 GLN A O   1 
ATOM   1376  C CB  . GLN A 1 193 ? -36.042 -17.688  -22.890 1.00 45.99  ? 194 GLN A CB  1 
ATOM   1377  C CG  . GLN A 1 193 ? -36.604 -16.368  -22.395 1.00 48.36  ? 194 GLN A CG  1 
ATOM   1378  C CD  . GLN A 1 193 ? -37.183 -16.459  -20.994 1.00 51.49  ? 194 GLN A CD  1 
ATOM   1379  O OE1 . GLN A 1 193 ? -37.591 -17.531  -20.543 1.00 54.66  ? 194 GLN A OE1 1 
ATOM   1380  N NE2 . GLN A 1 193 ? -37.218 -15.328  -20.295 1.00 50.36  ? 194 GLN A NE2 1 
ATOM   1381  N N   . LYS A 1 194 ? -34.957 -20.659  -21.796 1.00 40.19  ? 195 LYS A N   1 
ATOM   1382  C CA  . LYS A 1 194 ? -34.727 -22.038  -22.199 1.00 41.06  ? 195 LYS A CA  1 
ATOM   1383  C C   . LYS A 1 194 ? -35.178 -22.264  -23.643 1.00 40.64  ? 195 LYS A C   1 
ATOM   1384  O O   . LYS A 1 194 ? -36.288 -21.900  -24.017 1.00 40.05  ? 195 LYS A O   1 
ATOM   1385  C CB  . LYS A 1 194 ? -35.456 -23.003  -21.265 1.00 44.16  ? 195 LYS A CB  1 
ATOM   1386  C CG  . LYS A 1 194 ? -35.421 -24.445  -21.735 1.00 47.96  ? 195 LYS A CG  1 
ATOM   1387  C CD  . LYS A 1 194 ? -35.886 -25.399  -20.652 1.00 52.62  ? 195 LYS A CD  1 
ATOM   1388  C CE  . LYS A 1 194 ? -35.764 -26.843  -21.115 1.00 56.93  ? 195 LYS A CE  1 
ATOM   1389  N NZ  . LYS A 1 194 ? -34.409 -27.130  -21.674 1.00 57.39  ? 195 LYS A NZ  1 
ATOM   1390  N N   . GLY A 1 195 ? -34.292 -22.834  -24.453 1.00 41.11  ? 196 GLY A N   1 
ATOM   1391  C CA  . GLY A 1 195 ? -34.629 -23.210  -25.810 1.00 41.95  ? 196 GLY A CA  1 
ATOM   1392  C C   . GLY A 1 195 ? -34.489 -22.076  -26.803 1.00 40.58  ? 196 GLY A C   1 
ATOM   1393  O O   . GLY A 1 195 ? -34.875 -22.217  -27.962 1.00 39.58  ? 196 GLY A O   1 
ATOM   1394  N N   . HIS A 1 196 ? -33.941 -20.951  -26.353 1.00 37.50  ? 197 HIS A N   1 
ATOM   1395  C CA  . HIS A 1 196 ? -33.741 -19.805  -27.227 1.00 35.18  ? 197 HIS A CA  1 
ATOM   1396  C C   . HIS A 1 196 ? -32.380 -19.152  -27.050 1.00 32.08  ? 197 HIS A C   1 
ATOM   1397  O O   . HIS A 1 196 ? -31.855 -19.044  -25.934 1.00 29.76  ? 197 HIS A O   1 
ATOM   1398  C CB  . HIS A 1 196 ? -34.818 -18.744  -26.991 1.00 35.81  ? 197 HIS A CB  1 
ATOM   1399  C CG  . HIS A 1 196 ? -36.215 -19.237  -27.199 1.00 37.91  ? 197 HIS A CG  1 
ATOM   1400  N ND1 . HIS A 1 196 ? -36.884 -19.987  -26.259 1.00 38.70  ? 197 HIS A ND1 1 
ATOM   1401  C CD2 . HIS A 1 196 ? -37.070 -19.081  -28.238 1.00 40.84  ? 197 HIS A CD2 1 
ATOM   1402  C CE1 . HIS A 1 196 ? -38.094 -20.275  -26.709 1.00 42.13  ? 197 HIS A CE1 1 
ATOM   1403  N NE2 . HIS A 1 196 ? -38.230 -19.737  -27.908 1.00 43.37  ? 197 HIS A NE2 1 
ATOM   1404  N N   . ALA A 1 197 ? -31.818 -18.706  -28.166 1.00 31.33  ? 198 ALA A N   1 
ATOM   1405  C CA  . ALA A 1 197 ? -30.728 -17.748  -28.136 1.00 29.55  ? 198 ALA A CA  1 
ATOM   1406  C C   . ALA A 1 197 ? -31.363 -16.369  -28.089 1.00 29.47  ? 198 ALA A C   1 
ATOM   1407  O O   . ALA A 1 197 ? -32.575 -16.228  -28.265 1.00 29.27  ? 198 ALA A O   1 
ATOM   1408  C CB  . ALA A 1 197 ? -29.814 -17.896  -29.350 1.00 29.41  ? 198 ALA A CB  1 
ATOM   1409  N N   . LEU A 1 198 ? -30.554 -15.353  -27.837 1.00 29.72  ? 199 LEU A N   1 
ATOM   1410  C CA  . LEU A 1 198 ? -31.078 -14.011  -27.684 1.00 30.51  ? 199 LEU A CA  1 
ATOM   1411  C C   . LEU A 1 198 ? -30.328 -13.055  -28.586 1.00 29.60  ? 199 LEU A C   1 
ATOM   1412  O O   . LEU A 1 198 ? -29.157 -12.767  -28.352 1.00 29.50  ? 199 LEU A O   1 
ATOM   1413  C CB  . LEU A 1 198 ? -30.972 -13.551  -26.229 1.00 32.11  ? 199 LEU A CB  1 
ATOM   1414  C CG  . LEU A 1 198 ? -31.560 -12.174  -25.929 1.00 34.28  ? 199 LEU A CG  1 
ATOM   1415  C CD1 . LEU A 1 198 ? -33.080 -12.197  -26.070 1.00 36.01  ? 199 LEU A CD1 1 
ATOM   1416  C CD2 . LEU A 1 198 ? -31.144 -11.711  -24.544 1.00 33.94  ? 199 LEU A CD2 1 
ATOM   1417  N N   . LEU A 1 199 ? -31.007 -12.577  -29.622 1.00 28.37  ? 200 LEU A N   1 
ATOM   1418  C CA  . LEU A 1 199 ? -30.450 -11.552  -30.487 1.00 28.59  ? 200 LEU A CA  1 
ATOM   1419  C C   . LEU A 1 199 ? -30.571 -10.212  -29.781 1.00 30.33  ? 200 LEU A C   1 
ATOM   1420  O O   . LEU A 1 199 ? -31.674 -9.746   -29.494 1.00 32.27  ? 200 LEU A O   1 
ATOM   1421  C CB  . LEU A 1 199 ? -31.169 -11.524  -31.838 1.00 27.89  ? 200 LEU A CB  1 
ATOM   1422  C CG  . LEU A 1 199 ? -30.678 -10.528  -32.890 1.00 27.08  ? 200 LEU A CG  1 
ATOM   1423  C CD1 . LEU A 1 199 ? -29.255 -10.847  -33.317 1.00 26.62  ? 200 LEU A CD1 1 
ATOM   1424  C CD2 . LEU A 1 199 ? -31.628 -10.526  -34.090 1.00 26.74  ? 200 LEU A CD2 1 
ATOM   1425  N N   . ILE A 1 200 ? -29.435 -9.601   -29.481 1.00 27.97  ? 201 ILE A N   1 
ATOM   1426  C CA  . ILE A 1 200 ? -29.443 -8.326   -28.784 1.00 28.60  ? 201 ILE A CA  1 
ATOM   1427  C C   . ILE A 1 200 ? -28.927 -7.236   -29.701 1.00 29.44  ? 201 ILE A C   1 
ATOM   1428  O O   . ILE A 1 200 ? -27.797 -7.314   -30.185 1.00 30.24  ? 201 ILE A O   1 
ATOM   1429  C CB  . ILE A 1 200 ? -28.579 -8.354   -27.499 1.00 26.83  ? 201 ILE A CB  1 
ATOM   1430  C CG1 . ILE A 1 200 ? -28.991 -9.511   -26.583 1.00 26.68  ? 201 ILE A CG1 1 
ATOM   1431  C CG2 . ILE A 1 200 ? -28.659 -7.019   -26.780 1.00 26.50  ? 201 ILE A CG2 1 
ATOM   1432  C CD1 . ILE A 1 200 ? -28.067 -9.695   -25.376 1.00 27.70  ? 201 ILE A CD1 1 
ATOM   1433  N N   . ASP A 1 201 ? -29.761 -6.232   -29.950 1.00 28.91  ? 202 ASP A N   1 
ATOM   1434  C CA  . ASP A 1 201 ? -29.313 -5.032   -30.644 1.00 29.36  ? 202 ASP A CA  1 
ATOM   1435  C C   . ASP A 1 201 ? -28.768 -4.091   -29.580 1.00 27.63  ? 202 ASP A C   1 
ATOM   1436  O O   . ASP A 1 201 ? -29.525 -3.555   -28.778 1.00 27.61  ? 202 ASP A O   1 
ATOM   1437  C CB  . ASP A 1 201 ? -30.456 -4.381   -31.441 1.00 29.52  ? 202 ASP A CB  1 
ATOM   1438  C CG  . ASP A 1 201 ? -30.000 -3.175   -32.262 1.00 32.18  ? 202 ASP A CG  1 
ATOM   1439  O OD1 . ASP A 1 201 ? -29.209 -2.350   -31.753 1.00 31.01  ? 202 ASP A OD1 1 
ATOM   1440  O OD2 . ASP A 1 201 ? -30.440 -3.046   -33.430 1.00 33.92  ? 202 ASP A OD2 1 
ATOM   1441  N N   . CYS A 1 202 ? -27.455 -3.888   -29.581 1.00 27.76  ? 203 CYS A N   1 
ATOM   1442  C CA  . CYS A 1 202 ? -26.803 -3.136   -28.513 1.00 28.45  ? 203 CYS A CA  1 
ATOM   1443  C C   . CYS A 1 202 ? -26.836 -1.628   -28.736 1.00 30.27  ? 203 CYS A C   1 
ATOM   1444  O O   . CYS A 1 202 ? -26.301 -0.868   -27.929 1.00 30.58  ? 203 CYS A O   1 
ATOM   1445  C CB  . CYS A 1 202 ? -25.362 -3.607   -28.349 1.00 28.26  ? 203 CYS A CB  1 
ATOM   1446  S SG  . CYS A 1 202 ? -25.244 -5.324   -27.806 1.00 30.48  ? 203 CYS A SG  1 
ATOM   1447  N N   . ARG A 1 203 ? -27.458 -1.197   -29.830 1.00 30.10  ? 204 ARG A N   1 
ATOM   1448  C CA  . ARG A 1 203 ? -27.721 0.221    -30.033 1.00 32.42  ? 204 ARG A CA  1 
ATOM   1449  C C   . ARG A 1 203 ? -29.077 0.581    -29.443 1.00 34.55  ? 204 ARG A C   1 
ATOM   1450  O O   . ARG A 1 203 ? -29.181 1.469    -28.593 1.00 36.09  ? 204 ARG A O   1 
ATOM   1451  C CB  . ARG A 1 203 ? -27.678 0.593    -31.519 1.00 33.22  ? 204 ARG A CB  1 
ATOM   1452  C CG  . ARG A 1 203 ? -28.073 2.041    -31.791 1.00 34.46  ? 204 ARG A CG  1 
ATOM   1453  C CD  . ARG A 1 203 ? -27.826 2.431    -33.245 1.00 35.96  ? 204 ARG A CD  1 
ATOM   1454  N NE  . ARG A 1 203 ? -28.545 1.562    -34.169 1.00 36.41  ? 204 ARG A NE  1 
ATOM   1455  C CZ  . ARG A 1 203 ? -28.425 1.609    -35.492 1.00 37.50  ? 204 ARG A CZ  1 
ATOM   1456  N NH1 . ARG A 1 203 ? -27.606 2.487    -36.059 1.00 37.61  ? 204 ARG A NH1 1 
ATOM   1457  N NH2 . ARG A 1 203 ? -29.119 0.769    -36.247 1.00 37.14  ? 204 ARG A NH2 1 
ATOM   1458  N N   . SER A 1 204 ? -30.112 -0.127   -29.885 1.00 34.31  ? 205 SER A N   1 
ATOM   1459  C CA  . SER A 1 204 ? -31.485 0.167    -29.478 1.00 35.00  ? 205 SER A CA  1 
ATOM   1460  C C   . SER A 1 204 ? -31.892 -0.528   -28.185 1.00 33.58  ? 205 SER A C   1 
ATOM   1461  O O   . SER A 1 204 ? -32.883 -0.149   -27.559 1.00 34.63  ? 205 SER A O   1 
ATOM   1462  C CB  . SER A 1 204 ? -32.458 -0.236   -30.587 1.00 36.20  ? 205 SER A CB  1 
ATOM   1463  O OG  . SER A 1 204 ? -32.396 -1.636   -30.809 1.00 36.01  ? 205 SER A OG  1 
ATOM   1464  N N   . LEU A 1 205 ? -31.138 -1.558   -27.814 1.00 32.26  ? 206 LEU A N   1 
ATOM   1465  C CA  . LEU A 1 205 ? -31.457 -2.420   -26.673 1.00 34.07  ? 206 LEU A CA  1 
ATOM   1466  C C   . LEU A 1 205 ? -32.741 -3.216   -26.902 1.00 35.88  ? 206 LEU A C   1 
ATOM   1467  O O   . LEU A 1 205 ? -33.332 -3.739   -25.954 1.00 37.02  ? 206 LEU A O   1 
ATOM   1468  C CB  . LEU A 1 205 ? -31.553 -1.606   -25.374 1.00 33.81  ? 206 LEU A CB  1 
ATOM   1469  C CG  . LEU A 1 205 ? -30.277 -0.841   -25.027 1.00 33.72  ? 206 LEU A CG  1 
ATOM   1470  C CD1 . LEU A 1 205 ? -30.346 -0.229   -23.616 1.00 34.37  ? 206 LEU A CD1 1 
ATOM   1471  C CD2 . LEU A 1 205 ? -29.072 -1.759   -25.173 1.00 33.07  ? 206 LEU A CD2 1 
ATOM   1472  N N   . GLU A 1 206 ? -33.158 -3.321   -28.163 1.00 34.99  ? 207 GLU A N   1 
ATOM   1473  C CA  . GLU A 1 206 ? -34.229 -4.237   -28.539 1.00 34.98  ? 207 GLU A CA  1 
ATOM   1474  C C   . GLU A 1 206 ? -33.674 -5.656   -28.532 1.00 33.10  ? 207 GLU A C   1 
ATOM   1475  O O   . GLU A 1 206 ? -32.525 -5.888   -28.916 1.00 32.39  ? 207 GLU A O   1 
ATOM   1476  C CB  . GLU A 1 206 ? -34.808 -3.889   -29.920 1.00 37.17  ? 207 GLU A CB  1 
ATOM   1477  C CG  . GLU A 1 206 ? -35.847 -4.886   -30.440 1.00 39.04  ? 207 GLU A CG  1 
ATOM   1478  C CD  . GLU A 1 206 ? -36.546 -4.420   -31.708 1.00 42.69  ? 207 GLU A CD  1 
ATOM   1479  O OE1 . GLU A 1 206 ? -36.378 -3.240   -32.089 1.00 44.42  ? 207 GLU A OE1 1 
ATOM   1480  O OE2 . GLU A 1 206 ? -37.262 -5.237   -32.327 1.00 43.59  ? 207 GLU A OE2 1 
ATOM   1481  N N   . THR A 1 207 ? -34.482 -6.609   -28.087 1.00 32.95  ? 208 THR A N   1 
ATOM   1482  C CA  . THR A 1 207 ? -34.025 -7.989   -28.029 1.00 32.88  ? 208 THR A CA  1 
ATOM   1483  C C   . THR A 1 207 ? -35.048 -8.924   -28.632 1.00 33.38  ? 208 THR A C   1 
ATOM   1484  O O   . THR A 1 207 ? -36.254 -8.678   -28.569 1.00 35.97  ? 208 THR A O   1 
ATOM   1485  C CB  . THR A 1 207 ? -33.730 -8.443   -26.583 1.00 32.67  ? 208 THR A CB  1 
ATOM   1486  O OG1 . THR A 1 207 ? -34.933 -8.390   -25.816 1.00 35.01  ? 208 THR A OG1 1 
ATOM   1487  C CG2 . THR A 1 207 ? -32.691 -7.545   -25.937 1.00 30.32  ? 208 THR A CG2 1 
ATOM   1488  N N   . SER A 1 208 ? -34.562 -10.013  -29.206 1.00 31.92  ? 209 SER A N   1 
ATOM   1489  C CA  . SER A 1 208 ? -35.448 -10.974  -29.832 1.00 34.13  ? 209 SER A CA  1 
ATOM   1490  C C   . SER A 1 208 ? -35.071 -12.391  -29.429 1.00 35.35  ? 209 SER A C   1 
ATOM   1491  O O   . SER A 1 208 ? -33.910 -12.793  -29.525 1.00 35.33  ? 209 SER A O   1 
ATOM   1492  C CB  . SER A 1 208 ? -35.410 -10.820  -31.350 1.00 34.60  ? 209 SER A CB  1 
ATOM   1493  O OG  . SER A 1 208 ? -36.187 -11.833  -31.960 1.00 39.42  ? 209 SER A OG  1 
ATOM   1494  N N   . LEU A 1 209 ? -36.056 -13.143  -28.960 1.00 36.17  ? 210 LEU A N   1 
ATOM   1495  C CA  . LEU A 1 209 ? -35.824 -14.528  -28.596 1.00 37.29  ? 210 LEU A CA  1 
ATOM   1496  C C   . LEU A 1 209 ? -35.886 -15.405  -29.836 1.00 38.98  ? 210 LEU A C   1 
ATOM   1497  O O   . LEU A 1 209 ? -36.937 -15.541  -30.462 1.00 40.62  ? 210 LEU A O   1 
ATOM   1498  C CB  . LEU A 1 209 ? -36.838 -14.985  -27.552 1.00 39.70  ? 210 LEU A CB  1 
ATOM   1499  C CG  . LEU A 1 209 ? -36.609 -14.371  -26.168 1.00 39.80  ? 210 LEU A CG  1 
ATOM   1500  C CD1 . LEU A 1 209 ? -37.837 -14.559  -25.289 1.00 42.98  ? 210 LEU A CD1 1 
ATOM   1501  C CD2 . LEU A 1 209 ? -35.386 -14.985  -25.522 1.00 37.95  ? 210 LEU A CD2 1 
ATOM   1502  N N   . VAL A 1 210 ? -34.744 -15.983  -30.193 1.00 40.19  ? 211 VAL A N   1 
ATOM   1503  C CA  . VAL A 1 210 ? -34.636 -16.838  -31.372 1.00 42.54  ? 211 VAL A CA  1 
ATOM   1504  C C   . VAL A 1 210 ? -34.602 -18.311  -30.981 1.00 45.18  ? 211 VAL A C   1 
ATOM   1505  O O   . VAL A 1 210 ? -33.663 -18.755  -30.323 1.00 45.47  ? 211 VAL A O   1 
ATOM   1506  C CB  . VAL A 1 210 ? -33.371 -16.512  -32.184 1.00 41.83  ? 211 VAL A CB  1 
ATOM   1507  C CG1 . VAL A 1 210 ? -33.241 -17.457  -33.373 1.00 43.39  ? 211 VAL A CG1 1 
ATOM   1508  C CG2 . VAL A 1 210 ? -33.390 -15.057  -32.632 1.00 41.84  ? 211 VAL A CG2 1 
ATOM   1509  N N   . PRO A 1 211 ? -35.630 -19.073  -31.388 1.00 48.71  ? 212 PRO A N   1 
ATOM   1510  C CA  . PRO A 1 211 ? -35.739 -20.508  -31.097 1.00 50.18  ? 212 PRO A CA  1 
ATOM   1511  C C   . PRO A 1 211 ? -34.479 -21.293  -31.452 1.00 50.60  ? 212 PRO A C   1 
ATOM   1512  O O   . PRO A 1 211 ? -33.980 -21.200  -32.571 1.00 49.97  ? 212 PRO A O   1 
ATOM   1513  C CB  . PRO A 1 211 ? -36.916 -20.946  -31.968 1.00 51.57  ? 212 PRO A CB  1 
ATOM   1514  C CG  . PRO A 1 211 ? -37.766 -19.729  -32.056 1.00 50.95  ? 212 PRO A CG  1 
ATOM   1515  C CD  . PRO A 1 211 ? -36.803 -18.577  -32.130 1.00 49.21  ? 212 PRO A CD  1 
ATOM   1516  N N   . LEU A 1 212 ? -33.971 -22.049  -30.484 1.00 51.10  ? 213 LEU A N   1 
ATOM   1517  C CA  . LEU A 1 212 ? -32.782 -22.868  -30.676 1.00 52.47  ? 213 LEU A CA  1 
ATOM   1518  C C   . LEU A 1 212 ? -32.928 -24.146  -29.859 1.00 55.13  ? 213 LEU A C   1 
ATOM   1519  O O   . LEU A 1 212 ? -32.298 -24.315  -28.812 1.00 56.11  ? 213 LEU A O   1 
ATOM   1520  C CB  . LEU A 1 212 ? -31.520 -22.094  -30.278 1.00 51.83  ? 213 LEU A CB  1 
ATOM   1521  C CG  . LEU A 1 212 ? -30.152 -22.784  -30.320 1.00 52.22  ? 213 LEU A CG  1 
ATOM   1522  C CD1 . LEU A 1 212 ? -29.887 -23.445  -31.657 1.00 52.78  ? 213 LEU A CD1 1 
ATOM   1523  C CD2 . LEU A 1 212 ? -29.057 -21.788  -29.987 1.00 52.19  ? 213 LEU A CD2 1 
ATOM   1524  N N   . SER A 1 213 ? -33.797 -25.033  -30.328 1.00 56.37  ? 214 SER A N   1 
ATOM   1525  C CA  . SER A 1 213 ? -34.023 -26.308  -29.662 1.00 57.84  ? 214 SER A CA  1 
ATOM   1526  C C   . SER A 1 213 ? -34.323 -27.383  -30.693 1.00 59.93  ? 214 SER A C   1 
ATOM   1527  O O   . SER A 1 213 ? -35.481 -27.691  -30.976 1.00 62.84  ? 214 SER A O   1 
ATOM   1528  C CB  . SER A 1 213 ? -35.163 -26.206  -28.650 1.00 58.44  ? 214 SER A CB  1 
ATOM   1529  O OG  . SER A 1 213 ? -35.161 -27.319  -27.775 1.00 58.70  ? 214 SER A OG  1 
ATOM   1530  N N   . ASP A 1 214 ? -33.262 -27.941  -31.259 1.00 58.18  ? 215 ASP A N   1 
ATOM   1531  C CA  . ASP A 1 214 ? -33.380 -28.976  -32.270 1.00 57.06  ? 215 ASP A CA  1 
ATOM   1532  C C   . ASP A 1 214 ? -32.589 -30.196  -31.835 1.00 57.66  ? 215 ASP A C   1 
ATOM   1533  O O   . ASP A 1 214 ? -31.358 -30.181  -31.862 1.00 57.77  ? 215 ASP A O   1 
ATOM   1534  C CB  . ASP A 1 214 ? -32.877 -28.469  -33.626 1.00 54.87  ? 215 ASP A CB  1 
ATOM   1535  C CG  . ASP A 1 214 ? -33.159 -29.439  -34.767 1.00 54.68  ? 215 ASP A CG  1 
ATOM   1536  O OD1 . ASP A 1 214 ? -33.699 -30.535  -34.515 1.00 54.75  ? 215 ASP A OD1 1 
ATOM   1537  O OD2 . ASP A 1 214 ? -32.826 -29.104  -35.922 1.00 54.19  ? 215 ASP A OD2 1 
ATOM   1538  N N   . PRO A 1 215 ? -33.291 -31.251  -31.405 1.00 58.14  ? 216 PRO A N   1 
ATOM   1539  C CA  . PRO A 1 215 ? -32.580 -32.517  -31.249 1.00 58.54  ? 216 PRO A CA  1 
ATOM   1540  C C   . PRO A 1 215 ? -32.082 -32.954  -32.617 1.00 60.97  ? 216 PRO A C   1 
ATOM   1541  O O   . PRO A 1 215 ? -32.908 -33.075  -33.525 1.00 64.63  ? 216 PRO A O   1 
ATOM   1542  C CB  . PRO A 1 215 ? -33.648 -33.464  -30.694 1.00 59.47  ? 216 PRO A CB  1 
ATOM   1543  C CG  . PRO A 1 215 ? -34.949 -32.853  -31.101 1.00 60.32  ? 216 PRO A CG  1 
ATOM   1544  C CD  . PRO A 1 215 ? -34.726 -31.370  -31.098 1.00 59.38  ? 216 PRO A CD  1 
ATOM   1545  N N   . LYS A 1 216 ? -30.768 -33.173  -32.717 1.00 58.58  ? 217 LYS A N   1 
ATOM   1546  C CA  . LYS A 1 216 ? -29.975 -33.417  -33.938 1.00 56.13  ? 217 LYS A CA  1 
ATOM   1547  C C   . LYS A 1 216 ? -28.934 -32.317  -33.990 1.00 52.01  ? 217 LYS A C   1 
ATOM   1548  O O   . LYS A 1 216 ? -27.874 -32.477  -34.584 1.00 51.64  ? 217 LYS A O   1 
ATOM   1549  C CB  . LYS A 1 216 ? -30.787 -33.430  -35.240 1.00 57.69  ? 217 LYS A CB  1 
ATOM   1550  N N   . LEU A 1 217 ? -29.252 -31.194  -33.355 1.00 48.90  ? 218 LEU A N   1 
ATOM   1551  C CA  . LEU A 1 217 ? -28.322 -30.085  -33.251 1.00 45.87  ? 218 LEU A CA  1 
ATOM   1552  C C   . LEU A 1 217 ? -27.788 -29.979  -31.830 1.00 44.82  ? 218 LEU A C   1 
ATOM   1553  O O   . LEU A 1 217 ? -28.545 -30.075  -30.862 1.00 45.54  ? 218 LEU A O   1 
ATOM   1554  C CB  . LEU A 1 217 ? -28.994 -28.776  -33.660 1.00 46.99  ? 218 LEU A CB  1 
ATOM   1555  C CG  . LEU A 1 217 ? -28.116 -27.531  -33.515 1.00 48.01  ? 218 LEU A CG  1 
ATOM   1556  C CD1 . LEU A 1 217 ? -26.846 -27.691  -34.333 1.00 48.62  ? 218 LEU A CD1 1 
ATOM   1557  C CD2 . LEU A 1 217 ? -28.867 -26.270  -33.916 1.00 49.02  ? 218 LEU A CD2 1 
ATOM   1558  N N   . ALA A 1 218 ? -26.481 -29.788  -31.704 1.00 42.82  ? 219 ALA A N   1 
ATOM   1559  C CA  . ALA A 1 218 ? -25.876 -29.585  -30.395 1.00 41.87  ? 219 ALA A CA  1 
ATOM   1560  C C   . ALA A 1 218 ? -24.896 -28.422  -30.422 1.00 39.73  ? 219 ALA A C   1 
ATOM   1561  O O   . ALA A 1 218 ? -24.308 -28.112  -31.459 1.00 39.85  ? 219 ALA A O   1 
ATOM   1562  C CB  . ALA A 1 218 ? -25.179 -30.854  -29.923 1.00 42.94  ? 219 ALA A CB  1 
ATOM   1563  N N   . VAL A 1 219 ? -24.736 -27.777  -29.274 1.00 38.55  ? 220 VAL A N   1 
ATOM   1564  C CA  . VAL A 1 219 ? -23.735 -26.737  -29.111 1.00 38.22  ? 220 VAL A CA  1 
ATOM   1565  C C   . VAL A 1 219 ? -22.634 -27.231  -28.177 1.00 37.42  ? 220 VAL A C   1 
ATOM   1566  O O   . VAL A 1 219 ? -22.872 -27.454  -26.994 1.00 36.35  ? 220 VAL A O   1 
ATOM   1567  C CB  . VAL A 1 219 ? -24.348 -25.440  -28.550 1.00 37.27  ? 220 VAL A CB  1 
ATOM   1568  C CG1 . VAL A 1 219 ? -23.255 -24.430  -28.235 1.00 35.55  ? 220 VAL A CG1 1 
ATOM   1569  C CG2 . VAL A 1 219 ? -25.359 -24.864  -29.540 1.00 36.77  ? 220 VAL A CG2 1 
ATOM   1570  N N   . LEU A 1 220 ? -21.438 -27.418  -28.724 1.00 36.58  ? 221 LEU A N   1 
ATOM   1571  C CA  . LEU A 1 220 ? -20.310 -27.917  -27.952 1.00 35.15  ? 221 LEU A CA  1 
ATOM   1572  C C   . LEU A 1 220 ? -19.411 -26.773  -27.524 1.00 33.22  ? 221 LEU A C   1 
ATOM   1573  O O   . LEU A 1 220 ? -18.892 -26.026  -28.357 1.00 31.15  ? 221 LEU A O   1 
ATOM   1574  C CB  . LEU A 1 220 ? -19.501 -28.940  -28.757 1.00 36.27  ? 221 LEU A CB  1 
ATOM   1575  C CG  . LEU A 1 220 ? -18.209 -29.438  -28.098 1.00 36.87  ? 221 LEU A CG  1 
ATOM   1576  C CD1 . LEU A 1 220 ? -18.510 -30.329  -26.898 1.00 37.61  ? 221 LEU A CD1 1 
ATOM   1577  C CD2 . LEU A 1 220 ? -17.307 -30.156  -29.096 1.00 38.10  ? 221 LEU A CD2 1 
ATOM   1578  N N   . ILE A 1 221 ? -19.229 -26.639  -26.218 1.00 33.85  ? 222 ILE A N   1 
ATOM   1579  C CA  . ILE A 1 221 ? -18.337 -25.625  -25.686 1.00 33.15  ? 222 ILE A CA  1 
ATOM   1580  C C   . ILE A 1 221 ? -17.036 -26.273  -25.238 1.00 34.99  ? 222 ILE A C   1 
ATOM   1581  O O   . ILE A 1 221 ? -17.043 -27.206  -24.432 1.00 37.17  ? 222 ILE A O   1 
ATOM   1582  C CB  . ILE A 1 221 ? -18.987 -24.874  -24.522 1.00 32.93  ? 222 ILE A CB  1 
ATOM   1583  C CG1 . ILE A 1 221 ? -20.235 -24.143  -25.019 1.00 33.69  ? 222 ILE A CG1 1 
ATOM   1584  C CG2 . ILE A 1 221 ? -17.999 -23.903  -23.894 1.00 31.86  ? 222 ILE A CG2 1 
ATOM   1585  C CD1 . ILE A 1 221 ? -21.290 -23.954  -23.958 1.00 35.25  ? 222 ILE A CD1 1 
ATOM   1586  N N   . THR A 1 222 ? -15.922 -25.789  -25.775 1.00 34.69  ? 223 THR A N   1 
ATOM   1587  C CA  . THR A 1 222 ? -14.616 -26.323  -25.413 1.00 36.33  ? 223 THR A CA  1 
ATOM   1588  C C   . THR A 1 222 ? -13.770 -25.280  -24.689 1.00 36.64  ? 223 THR A C   1 
ATOM   1589  O O   . THR A 1 222 ? -13.444 -24.242  -25.255 1.00 36.11  ? 223 THR A O   1 
ATOM   1590  C CB  . THR A 1 222 ? -13.843 -26.812  -26.643 1.00 38.85  ? 223 THR A CB  1 
ATOM   1591  O OG1 . THR A 1 222 ? -14.634 -27.772  -27.357 1.00 40.69  ? 223 THR A OG1 1 
ATOM   1592  C CG2 . THR A 1 222 ? -12.523 -27.447  -26.217 1.00 39.21  ? 223 THR A CG2 1 
ATOM   1593  N N   . ASN A 1 223 ? -13.410 -25.569  -23.443 1.00 36.20  ? 224 ASN A N   1 
ATOM   1594  C CA  . ASN A 1 223 ? -12.545 -24.680  -22.676 1.00 36.58  ? 224 ASN A CA  1 
ATOM   1595  C C   . ASN A 1 223 ? -11.075 -25.004  -22.930 1.00 38.37  ? 224 ASN A C   1 
ATOM   1596  O O   . ASN A 1 223 ? -10.640 -26.143  -22.749 1.00 42.29  ? 224 ASN A O   1 
ATOM   1597  C CB  . ASN A 1 223 ? -12.871 -24.783  -21.183 1.00 36.66  ? 224 ASN A CB  1 
ATOM   1598  C CG  . ASN A 1 223 ? -12.179 -23.708  -20.340 1.00 37.22  ? 224 ASN A CG  1 
ATOM   1599  O OD1 . ASN A 1 223 ? -11.177 -23.115  -20.744 1.00 36.68  ? 224 ASN A OD1 1 
ATOM   1600  N ND2 . ASN A 1 223 ? -12.716 -23.468  -19.152 1.00 37.83  ? 224 ASN A ND2 1 
ATOM   1601  N N   . SER A 1 224 ? -10.314 -23.999  -23.351 1.00 35.39  ? 225 SER A N   1 
ATOM   1602  C CA  . SER A 1 224 ? -8.886  -24.172  -23.587 1.00 36.03  ? 225 SER A CA  1 
ATOM   1603  C C   . SER A 1 224 ? -8.133  -24.297  -22.269 1.00 38.81  ? 225 SER A C   1 
ATOM   1604  O O   . SER A 1 224 ? -6.995  -24.772  -22.235 1.00 39.32  ? 225 SER A O   1 
ATOM   1605  C CB  . SER A 1 224 ? -8.323  -22.999  -24.389 1.00 36.14  ? 225 SER A CB  1 
ATOM   1606  O OG  . SER A 1 224 ? -8.321  -21.812  -23.610 1.00 36.59  ? 225 SER A OG  1 
ATOM   1607  N N   . ASN A 1 225 ? -8.780  -23.852  -21.193 1.00 39.45  ? 226 ASN A N   1 
ATOM   1608  C CA  . ASN A 1 225 ? -8.172  -23.803  -19.870 1.00 42.82  ? 226 ASN A CA  1 
ATOM   1609  C C   . ASN A 1 225 ? -6.862  -23.033  -19.872 1.00 45.17  ? 226 ASN A C   1 
ATOM   1610  O O   . ASN A 1 225 ? -5.938  -23.353  -19.125 1.00 47.07  ? 226 ASN A O   1 
ATOM   1611  C CB  . ASN A 1 225 ? -7.960  -25.212  -19.321 1.00 43.92  ? 226 ASN A CB  1 
ATOM   1612  C CG  . ASN A 1 225 ? -9.257  -25.862  -18.905 1.00 43.66  ? 226 ASN A CG  1 
ATOM   1613  O OD1 . ASN A 1 225 ? -9.671  -26.870  -19.476 1.00 44.96  ? 226 ASN A OD1 1 
ATOM   1614  N ND2 . ASN A 1 225 ? -9.913  -25.283  -17.907 1.00 42.42  ? 226 ASN A ND2 1 
ATOM   1615  N N   . VAL A 1 226 ? -6.784  -22.026  -20.736 1.00 43.75  ? 227 VAL A N   1 
ATOM   1616  C CA  . VAL A 1 226 ? -5.705  -21.054  -20.670 1.00 44.79  ? 227 VAL A CA  1 
ATOM   1617  C C   . VAL A 1 226 ? -6.317  -19.664  -20.722 1.00 43.05  ? 227 VAL A C   1 
ATOM   1618  O O   . VAL A 1 226 ? -7.437  -19.485  -21.201 1.00 39.67  ? 227 VAL A O   1 
ATOM   1619  C CB  . VAL A 1 226 ? -4.675  -21.225  -21.810 1.00 45.66  ? 227 VAL A CB  1 
ATOM   1620  C CG1 . VAL A 1 226 ? -4.138  -22.655  -21.846 1.00 47.12  ? 227 VAL A CG1 1 
ATOM   1621  C CG2 . VAL A 1 226 ? -5.281  -20.840  -23.149 1.00 44.87  ? 227 VAL A CG2 1 
ATOM   1622  N N   . ARG A 1 227 ? -5.589  -18.687  -20.198 1.00 44.42  ? 228 ARG A N   1 
ATOM   1623  C CA  . ARG A 1 227 ? -6.017  -17.299  -20.273 1.00 45.26  ? 228 ARG A CA  1 
ATOM   1624  C C   . ARG A 1 227 ? -4.801  -16.397  -20.202 1.00 46.37  ? 228 ARG A C   1 
ATOM   1625  O O   . ARG A 1 227 ? -4.242  -16.183  -19.128 1.00 47.92  ? 228 ARG A O   1 
ATOM   1626  C CB  . ARG A 1 227 ? -7.000  -16.956  -19.151 1.00 46.41  ? 228 ARG A CB  1 
ATOM   1627  C CG  . ARG A 1 227 ? -7.611  -15.562  -19.280 1.00 47.32  ? 228 ARG A CG  1 
ATOM   1628  C CD  . ARG A 1 227 ? -8.592  -15.265  -18.153 1.00 49.18  ? 228 ARG A CD  1 
ATOM   1629  N NE  . ARG A 1 227 ? -9.386  -14.067  -18.419 1.00 49.42  ? 228 ARG A NE  1 
ATOM   1630  C CZ  . ARG A 1 227 ? -9.038  -12.840  -18.045 1.00 50.06  ? 228 ARG A CZ  1 
ATOM   1631  N NH1 . ARG A 1 227 ? -7.903  -12.642  -17.389 1.00 51.02  ? 228 ARG A NH1 1 
ATOM   1632  N NH2 . ARG A 1 227 ? -9.822  -11.808  -18.334 1.00 49.92  ? 228 ARG A NH2 1 
ATOM   1633  N N   . HIS A 1 228 ? -4.379  -15.888  -21.353 1.00 45.01  ? 229 HIS A N   1 
ATOM   1634  C CA  . HIS A 1 228 ? -3.248  -14.975  -21.404 1.00 45.68  ? 229 HIS A CA  1 
ATOM   1635  C C   . HIS A 1 228 ? -3.625  -13.658  -20.736 1.00 44.54  ? 229 HIS A C   1 
ATOM   1636  O O   . HIS A 1 228 ? -4.800  -13.295  -20.696 1.00 40.85  ? 229 HIS A O   1 
ATOM   1637  C CB  . HIS A 1 228 ? -2.807  -14.740  -22.848 1.00 46.05  ? 229 HIS A CB  1 
ATOM   1638  C CG  . HIS A 1 228 ? -2.418  -15.992  -23.570 1.00 45.85  ? 229 HIS A CG  1 
ATOM   1639  N ND1 . HIS A 1 228 ? -1.139  -16.504  -23.536 1.00 47.17  ? 229 HIS A ND1 1 
ATOM   1640  C CD2 . HIS A 1 228 ? -3.139  -16.830  -24.353 1.00 44.58  ? 229 HIS A CD2 1 
ATOM   1641  C CE1 . HIS A 1 228 ? -1.089  -17.606  -24.263 1.00 47.72  ? 229 HIS A CE1 1 
ATOM   1642  N NE2 . HIS A 1 228 ? -2.289  -17.826  -24.769 1.00 45.70  ? 229 HIS A NE2 1 
ATOM   1643  N N   . SER A 1 229 ? -2.627  -12.953  -20.211 1.00 48.31  ? 230 SER A N   1 
ATOM   1644  C CA  . SER A 1 229 ? -2.853  -11.699  -19.493 1.00 49.21  ? 230 SER A CA  1 
ATOM   1645  C C   . SER A 1 229 ? -3.473  -10.633  -20.391 1.00 48.18  ? 230 SER A C   1 
ATOM   1646  O O   . SER A 1 229 ? -4.118  -9.702   -19.907 1.00 47.32  ? 230 SER A O   1 
ATOM   1647  C CB  . SER A 1 229 ? -1.542  -11.182  -18.901 1.00 52.94  ? 230 SER A CB  1 
ATOM   1648  O OG  . SER A 1 229 ? -0.582  -10.950  -19.916 1.00 55.04  ? 230 SER A OG  1 
ATOM   1649  N N   . LEU A 1 230 ? -3.286  -10.780  -21.701 1.00 47.96  ? 231 LEU A N   1 
ATOM   1650  C CA  . LEU A 1 230 ? -3.845  -9.837   -22.670 1.00 46.96  ? 231 LEU A CA  1 
ATOM   1651  C C   . LEU A 1 230 ? -5.369  -9.768   -22.620 1.00 45.48  ? 231 LEU A C   1 
ATOM   1652  O O   . LEU A 1 230 ? -5.961  -8.758   -22.999 1.00 45.28  ? 231 LEU A O   1 
ATOM   1653  C CB  . LEU A 1 230 ? -3.404  -10.201  -24.088 1.00 47.09  ? 231 LEU A CB  1 
ATOM   1654  C CG  . LEU A 1 230 ? -1.911  -10.086  -24.380 1.00 49.17  ? 231 LEU A CG  1 
ATOM   1655  C CD1 . LEU A 1 230 ? -1.616  -10.539  -25.802 1.00 49.96  ? 231 LEU A CD1 1 
ATOM   1656  C CD2 . LEU A 1 230 ? -1.452  -8.661   -24.156 1.00 50.06  ? 231 LEU A CD2 1 
ATOM   1657  N N   . ALA A 1 231 ? -6.002  -10.841  -22.159 1.00 44.78  ? 232 ALA A N   1 
ATOM   1658  C CA  . ALA A 1 231 ? -7.457  -10.870  -22.043 1.00 42.95  ? 232 ALA A CA  1 
ATOM   1659  C C   . ALA A 1 231 ? -7.945  -9.728   -21.160 1.00 42.73  ? 232 ALA A C   1 
ATOM   1660  O O   . ALA A 1 231 ? -9.050  -9.213   -21.348 1.00 41.92  ? 232 ALA A O   1 
ATOM   1661  C CB  . ALA A 1 231 ? -7.924  -12.207  -21.493 1.00 42.40  ? 232 ALA A CB  1 
ATOM   1662  N N   . SER A 1 232 ? -7.106  -9.335   -20.203 1.00 42.83  ? 233 SER A N   1 
ATOM   1663  C CA  . SER A 1 232 ? -7.415  -8.223   -19.311 1.00 42.83  ? 233 SER A CA  1 
ATOM   1664  C C   . SER A 1 232 ? -6.911  -6.884   -19.845 1.00 42.33  ? 233 SER A C   1 
ATOM   1665  O O   . SER A 1 232 ? -7.624  -5.884   -19.782 1.00 42.95  ? 233 SER A O   1 
ATOM   1666  C CB  . SER A 1 232 ? -6.820  -8.467   -17.918 1.00 44.41  ? 233 SER A CB  1 
ATOM   1667  O OG  . SER A 1 232 ? -7.493  -9.518   -17.244 1.00 45.06  ? 233 SER A OG  1 
ATOM   1668  N N   . SER A 1 233 ? -5.684  -6.857   -20.358 1.00 40.94  ? 234 SER A N   1 
ATOM   1669  C CA  . SER A 1 233 ? -5.059  -5.586   -20.716 1.00 40.46  ? 234 SER A CA  1 
ATOM   1670  C C   . SER A 1 233 ? -5.351  -5.138   -22.151 1.00 39.42  ? 234 SER A C   1 
ATOM   1671  O O   . SER A 1 233 ? -5.373  -3.942   -22.436 1.00 39.59  ? 234 SER A O   1 
ATOM   1672  C CB  . SER A 1 233 ? -3.542  -5.658   -20.486 1.00 42.82  ? 234 SER A CB  1 
ATOM   1673  O OG  . SER A 1 233 ? -2.920  -6.596   -21.349 1.00 43.64  ? 234 SER A OG  1 
ATOM   1674  N N   . GLU A 1 234 ? -5.594  -6.081   -23.055 1.00 38.75  ? 235 GLU A N   1 
ATOM   1675  C CA  . GLU A 1 234 ? -5.803  -5.715   -24.452 1.00 37.47  ? 235 GLU A CA  1 
ATOM   1676  C C   . GLU A 1 234 ? -7.277  -5.424   -24.756 1.00 35.24  ? 235 GLU A C   1 
ATOM   1677  O O   . GLU A 1 234 ? -7.591  -4.731   -25.723 1.00 34.74  ? 235 GLU A O   1 
ATOM   1678  C CB  . GLU A 1 234 ? -5.266  -6.814   -25.375 1.00 38.35  ? 235 GLU A CB  1 
ATOM   1679  C CG  . GLU A 1 234 ? -5.086  -6.391   -26.826 1.00 40.00  ? 235 GLU A CG  1 
ATOM   1680  C CD  . GLU A 1 234 ? -3.913  -5.439   -27.044 1.00 42.50  ? 235 GLU A CD  1 
ATOM   1681  O OE1 . GLU A 1 234 ? -3.702  -5.024   -28.205 1.00 42.30  ? 235 GLU A OE1 1 
ATOM   1682  O OE2 . GLU A 1 234 ? -3.203  -5.103   -26.068 1.00 43.49  ? 235 GLU A OE2 1 
ATOM   1683  N N   . TYR A 1 235 ? -8.179  -5.939   -23.924 1.00 34.14  ? 236 TYR A N   1 
ATOM   1684  C CA  . TYR A 1 235 ? -9.604  -5.636   -24.077 1.00 32.58  ? 236 TYR A CA  1 
ATOM   1685  C C   . TYR A 1 235 ? -9.885  -4.123   -24.109 1.00 32.89  ? 236 TYR A C   1 
ATOM   1686  O O   . TYR A 1 235 ? -10.538 -3.652   -25.041 1.00 33.48  ? 236 TYR A O   1 
ATOM   1687  C CB  . TYR A 1 235 ? -10.431 -6.301   -22.967 1.00 30.74  ? 236 TYR A CB  1 
ATOM   1688  C CG  . TYR A 1 235 ? -11.929 -6.180   -23.162 1.00 30.31  ? 236 TYR A CG  1 
ATOM   1689  C CD1 . TYR A 1 235 ? -12.619 -5.052   -22.731 1.00 29.74  ? 236 TYR A CD1 1 
ATOM   1690  C CD2 . TYR A 1 235 ? -12.655 -7.192   -23.786 1.00 28.93  ? 236 TYR A CD2 1 
ATOM   1691  C CE1 . TYR A 1 235 ? -13.983 -4.934   -22.912 1.00 27.83  ? 236 TYR A CE1 1 
ATOM   1692  C CE2 . TYR A 1 235 ? -14.023 -7.083   -23.962 1.00 27.66  ? 236 TYR A CE2 1 
ATOM   1693  C CZ  . TYR A 1 235 ? -14.681 -5.950   -23.523 1.00 26.99  ? 236 TYR A CZ  1 
ATOM   1694  O OH  . TYR A 1 235 ? -16.041 -5.826   -23.697 1.00 25.38  ? 236 TYR A OH  1 
ATOM   1695  N N   . PRO A 1 236 ? -9.401  -3.355   -23.103 1.00 32.43  ? 237 PRO A N   1 
ATOM   1696  C CA  . PRO A 1 236 ? -9.697  -1.917   -23.160 1.00 32.26  ? 237 PRO A CA  1 
ATOM   1697  C C   . PRO A 1 236 ? -9.017  -1.229   -24.337 1.00 33.89  ? 237 PRO A C   1 
ATOM   1698  O O   . PRO A 1 236 ? -9.508  -0.200   -24.800 1.00 34.62  ? 237 PRO A O   1 
ATOM   1699  C CB  . PRO A 1 236 ? -9.133  -1.371   -21.834 1.00 32.81  ? 237 PRO A CB  1 
ATOM   1700  C CG  . PRO A 1 236 ? -8.827  -2.564   -20.999 1.00 33.22  ? 237 PRO A CG  1 
ATOM   1701  C CD  . PRO A 1 236 ? -8.551  -3.682   -21.943 1.00 32.09  ? 237 PRO A CD  1 
ATOM   1702  N N   . VAL A 1 237 ? -7.891  -1.778   -24.788 1.00 34.66  ? 238 VAL A N   1 
ATOM   1703  C CA  . VAL A 1 237 ? -7.194  -1.249   -25.955 1.00 35.85  ? 238 VAL A CA  1 
ATOM   1704  C C   . VAL A 1 237 ? -8.087  -1.349   -27.197 1.00 36.29  ? 238 VAL A C   1 
ATOM   1705  O O   . VAL A 1 237 ? -8.164  -0.410   -27.995 1.00 38.59  ? 238 VAL A O   1 
ATOM   1706  C CB  . VAL A 1 237 ? -5.861  -1.991   -26.210 1.00 36.98  ? 238 VAL A CB  1 
ATOM   1707  C CG1 . VAL A 1 237 ? -5.224  -1.528   -27.515 1.00 38.91  ? 238 VAL A CG1 1 
ATOM   1708  C CG2 . VAL A 1 237 ? -4.901  -1.787   -25.049 1.00 38.23  ? 238 VAL A CG2 1 
ATOM   1709  N N   . ARG A 1 238 ? -8.768  -2.482   -27.353 1.00 34.66  ? 239 ARG A N   1 
ATOM   1710  C CA  . ARG A 1 238 ? -9.670  -2.670   -28.488 1.00 34.70  ? 239 ARG A CA  1 
ATOM   1711  C C   . ARG A 1 238 ? -10.793 -1.631   -28.483 1.00 34.77  ? 239 ARG A C   1 
ATOM   1712  O O   . ARG A 1 238 ? -11.131 -1.075   -29.527 1.00 34.60  ? 239 ARG A O   1 
ATOM   1713  C CB  . ARG A 1 238 ? -10.258 -4.083   -28.490 1.00 33.14  ? 239 ARG A CB  1 
ATOM   1714  C CG  . ARG A 1 238 ? -9.255  -5.173   -28.861 1.00 32.69  ? 239 ARG A CG  1 
ATOM   1715  C CD  . ARG A 1 238 ? -8.736  -5.013   -30.291 1.00 33.49  ? 239 ARG A CD  1 
ATOM   1716  N NE  . ARG A 1 238 ? -7.679  -5.978   -30.586 1.00 33.87  ? 239 ARG A NE  1 
ATOM   1717  C CZ  . ARG A 1 238 ? -6.401  -5.806   -30.261 1.00 34.55  ? 239 ARG A CZ  1 
ATOM   1718  N NH1 . ARG A 1 238 ? -6.018  -4.699   -29.636 1.00 36.12  ? 239 ARG A NH1 1 
ATOM   1719  N NH2 . ARG A 1 238 ? -5.506  -6.738   -30.555 1.00 34.98  ? 239 ARG A NH2 1 
ATOM   1720  N N   . ARG A 1 239 ? -11.353 -1.357   -27.306 1.00 34.70  ? 240 ARG A N   1 
ATOM   1721  C CA  . ARG A 1 239 ? -12.425 -0.372   -27.186 1.00 34.25  ? 240 ARG A CA  1 
ATOM   1722  C C   . ARG A 1 239 ? -11.960 1.016    -27.614 1.00 34.94  ? 240 ARG A C   1 
ATOM   1723  O O   . ARG A 1 239 ? -12.684 1.737    -28.302 1.00 35.55  ? 240 ARG A O   1 
ATOM   1724  C CB  . ARG A 1 239 ? -12.961 -0.317   -25.750 1.00 33.84  ? 240 ARG A CB  1 
ATOM   1725  C CG  . ARG A 1 239 ? -13.696 -1.573   -25.314 1.00 34.01  ? 240 ARG A CG  1 
ATOM   1726  C CD  . ARG A 1 239 ? -14.610 -1.293   -24.126 1.00 34.28  ? 240 ARG A CD  1 
ATOM   1727  N NE  . ARG A 1 239 ? -15.617 -0.281   -24.445 1.00 34.26  ? 240 ARG A NE  1 
ATOM   1728  C CZ  . ARG A 1 239 ? -16.731 -0.079   -23.745 1.00 33.17  ? 240 ARG A CZ  1 
ATOM   1729  N NH1 . ARG A 1 239 ? -17.000 -0.827   -22.680 1.00 31.47  ? 240 ARG A NH1 1 
ATOM   1730  N NH2 . ARG A 1 239 ? -17.583 0.870    -24.116 1.00 32.05  ? 240 ARG A NH2 1 
ATOM   1731  N N   . ARG A 1 240 ? -10.750 1.385    -27.206 1.00 35.36  ? 241 ARG A N   1 
ATOM   1732  C CA  . ARG A 1 240 ? -10.200 2.695    -27.539 1.00 36.73  ? 241 ARG A CA  1 
ATOM   1733  C C   . ARG A 1 240 ? -9.930  2.809    -29.038 1.00 37.67  ? 241 ARG A C   1 
ATOM   1734  O O   . ARG A 1 240 ? -10.153 3.861    -29.640 1.00 37.76  ? 241 ARG A O   1 
ATOM   1735  C CB  . ARG A 1 240 ? -8.915  2.959    -26.751 1.00 37.19  ? 241 ARG A CB  1 
ATOM   1736  N N   . GLN A 1 241 ? -9.453  1.719    -29.629 1.00 36.97  ? 242 GLN A N   1 
ATOM   1737  C CA  . GLN A 1 241 ? -9.148  1.688    -31.053 1.00 37.69  ? 242 GLN A CA  1 
ATOM   1738  C C   . GLN A 1 241 ? -10.420 1.844    -31.889 1.00 37.67  ? 242 GLN A C   1 
ATOM   1739  O O   . GLN A 1 241 ? -10.416 2.515    -32.920 1.00 38.54  ? 242 GLN A O   1 
ATOM   1740  C CB  . GLN A 1 241 ? -8.415  0.392    -31.411 1.00 37.22  ? 242 GLN A CB  1 
ATOM   1741  C CG  . GLN A 1 241 ? -6.977  0.359    -30.907 1.00 37.84  ? 242 GLN A CG  1 
ATOM   1742  C CD  . GLN A 1 241 ? -6.323  -1.006   -31.038 1.00 37.90  ? 242 GLN A CD  1 
ATOM   1743  O OE1 . GLN A 1 241 ? -7.000  -2.030   -31.137 1.00 36.69  ? 242 GLN A OE1 1 
ATOM   1744  N NE2 . GLN A 1 241 ? -4.993  -1.024   -31.030 1.00 39.45  ? 242 GLN A NE2 1 
ATOM   1745  N N   . CYS A 1 242 ? -11.508 1.237    -31.429 1.00 35.51  ? 243 CYS A N   1 
ATOM   1746  C CA  . CYS A 1 242 ? -12.789 1.361    -32.115 1.00 35.51  ? 243 CYS A CA  1 
ATOM   1747  C C   . CYS A 1 242 ? -13.328 2.780    -31.989 1.00 37.95  ? 243 CYS A C   1 
ATOM   1748  O O   . CYS A 1 242 ? -13.862 3.337    -32.951 1.00 39.48  ? 243 CYS A O   1 
ATOM   1749  C CB  . CYS A 1 242 ? -13.802 0.358    -31.559 1.00 32.56  ? 243 CYS A CB  1 
ATOM   1750  S SG  . CYS A 1 242 ? -13.447 -1.367   -31.971 1.00 33.18  ? 243 CYS A SG  1 
ATOM   1751  N N   . GLU A 1 243 ? -13.183 3.357    -30.798 1.00 38.32  ? 244 GLU A N   1 
ATOM   1752  C CA  . GLU A 1 243 ? -13.624 4.726    -30.542 1.00 40.22  ? 244 GLU A CA  1 
ATOM   1753  C C   . GLU A 1 243 ? -12.869 5.705    -31.430 1.00 40.63  ? 244 GLU A C   1 
ATOM   1754  O O   . GLU A 1 243 ? -13.464 6.611    -32.019 1.00 42.21  ? 244 GLU A O   1 
ATOM   1755  C CB  . GLU A 1 243 ? -13.430 5.090    -29.067 1.00 42.00  ? 244 GLU A CB  1 
ATOM   1756  C CG  . GLU A 1 243 ? -14.426 4.423    -28.134 1.00 44.21  ? 244 GLU A CG  1 
ATOM   1757  C CD  . GLU A 1 243 ? -13.900 4.283    -26.709 1.00 47.13  ? 244 GLU A CD  1 
ATOM   1758  O OE1 . GLU A 1 243 ? -12.821 4.836    -26.410 1.00 49.65  ? 244 GLU A OE1 1 
ATOM   1759  O OE2 . GLU A 1 243 ? -14.563 3.614    -25.888 1.00 46.84  ? 244 GLU A OE2 1 
ATOM   1760  N N   . GLU A 1 244 ? -11.559 5.506    -31.533 1.00 39.76  ? 245 GLU A N   1 
ATOM   1761  C CA  . GLU A 1 244 ? -10.718 6.363    -32.352 1.00 41.47  ? 245 GLU A CA  1 
ATOM   1762  C C   . GLU A 1 244 ? -11.154 6.328    -33.816 1.00 43.76  ? 245 GLU A C   1 
ATOM   1763  O O   . GLU A 1 244 ? -11.234 7.370    -34.465 1.00 46.75  ? 245 GLU A O   1 
ATOM   1764  C CB  . GLU A 1 244 ? -9.248  5.955    -32.222 1.00 41.44  ? 245 GLU A CB  1 
ATOM   1765  N N   . VAL A 1 245 ? -11.447 5.134    -34.327 1.00 43.34  ? 246 VAL A N   1 
ATOM   1766  C CA  . VAL A 1 245 ? -11.895 4.988    -35.712 1.00 45.10  ? 246 VAL A CA  1 
ATOM   1767  C C   . VAL A 1 245 ? -13.247 5.664    -35.919 1.00 44.62  ? 246 VAL A C   1 
ATOM   1768  O O   . VAL A 1 245 ? -13.448 6.377    -36.902 1.00 44.99  ? 246 VAL A O   1 
ATOM   1769  C CB  . VAL A 1 245 ? -11.998 3.504    -36.132 1.00 44.52  ? 246 VAL A CB  1 
ATOM   1770  C CG1 . VAL A 1 245 ? -12.738 3.370    -37.461 1.00 46.15  ? 246 VAL A CG1 1 
ATOM   1771  C CG2 . VAL A 1 245 ? -10.617 2.883    -36.227 1.00 44.66  ? 246 VAL A CG2 1 
ATOM   1772  N N   . ALA A 1 246 ? -14.166 5.450    -34.981 1.00 43.29  ? 247 ALA A N   1 
ATOM   1773  C CA  . ALA A 1 246 ? -15.487 6.063    -35.061 1.00 45.05  ? 247 ALA A CA  1 
ATOM   1774  C C   . ALA A 1 246 ? -15.393 7.589    -35.025 1.00 48.91  ? 247 ALA A C   1 
ATOM   1775  O O   . ALA A 1 246 ? -16.137 8.283    -35.717 1.00 50.43  ? 247 ALA A O   1 
ATOM   1776  C CB  . ALA A 1 246 ? -16.376 5.558    -33.936 1.00 42.84  ? 247 ALA A CB  1 
ATOM   1777  N N   . ARG A 1 247 ? -14.468 8.104    -34.220 1.00 50.06  ? 248 ARG A N   1 
ATOM   1778  C CA  . ARG A 1 247 ? -14.293 9.544    -34.084 1.00 51.46  ? 248 ARG A CA  1 
ATOM   1779  C C   . ARG A 1 247 ? -13.707 10.153   -35.352 1.00 52.60  ? 248 ARG A C   1 
ATOM   1780  O O   . ARG A 1 247 ? -14.101 11.245   -35.763 1.00 54.60  ? 248 ARG A O   1 
ATOM   1781  C CB  . ARG A 1 247 ? -13.399 9.865    -32.884 1.00 51.36  ? 248 ARG A CB  1 
ATOM   1782  N N   . ALA A 1 248 ? -12.769 9.440    -35.969 1.00 51.61  ? 249 ALA A N   1 
ATOM   1783  C CA  . ALA A 1 248 ? -12.103 9.919    -37.179 1.00 52.23  ? 249 ALA A CA  1 
ATOM   1784  C C   . ALA A 1 248 ? -13.060 9.998    -38.365 1.00 53.62  ? 249 ALA A C   1 
ATOM   1785  O O   . ALA A 1 248 ? -12.821 10.740   -39.317 1.00 56.02  ? 249 ALA A O   1 
ATOM   1786  C CB  . ALA A 1 248 ? -10.918 9.023    -37.521 1.00 50.71  ? 249 ALA A CB  1 
ATOM   1787  N N   . LEU A 1 249 ? -14.143 9.231    -38.302 1.00 53.96  ? 250 LEU A N   1 
ATOM   1788  C CA  . LEU A 1 249 ? -15.095 9.162    -39.404 1.00 56.11  ? 250 LEU A CA  1 
ATOM   1789  C C   . LEU A 1 249 ? -16.358 9.958    -39.093 1.00 56.23  ? 250 LEU A C   1 
ATOM   1790  O O   . LEU A 1 249 ? -17.297 9.978    -39.885 1.00 56.85  ? 250 LEU A O   1 
ATOM   1791  C CB  . LEU A 1 249 ? -15.454 7.705    -39.717 1.00 54.92  ? 250 LEU A CB  1 
ATOM   1792  C CG  . LEU A 1 249 ? -14.524 6.885    -40.620 1.00 55.99  ? 250 LEU A CG  1 
ATOM   1793  C CD1 . LEU A 1 249 ? -13.089 6.870    -40.111 1.00 56.10  ? 250 LEU A CD1 1 
ATOM   1794  C CD2 . LEU A 1 249 ? -15.047 5.463    -40.753 1.00 54.59  ? 250 LEU A CD2 1 
ATOM   1795  N N   . GLY A 1 250 ? -16.371 10.612   -37.935 1.00 55.47  ? 251 GLY A N   1 
ATOM   1796  C CA  . GLY A 1 250 ? -17.514 11.405   -37.520 1.00 54.88  ? 251 GLY A CA  1 
ATOM   1797  C C   . GLY A 1 250 ? -18.758 10.567   -37.293 1.00 52.39  ? 251 GLY A C   1 
ATOM   1798  O O   . GLY A 1 250 ? -19.871 10.996   -37.593 1.00 53.71  ? 251 GLY A O   1 
ATOM   1799  N N   . ALA A 1 251 ? -18.567 9.363    -36.765 1.00 48.99  ? 252 ALA A N   1 
ATOM   1800  C CA  . ALA A 1 251 ? -19.684 8.466    -36.505 1.00 46.50  ? 252 ALA A CA  1 
ATOM   1801  C C   . ALA A 1 251 ? -19.888 8.286    -35.010 1.00 45.41  ? 252 ALA A C   1 
ATOM   1802  O O   . ALA A 1 251 ? -18.926 8.232    -34.249 1.00 44.94  ? 252 ALA A O   1 
ATOM   1803  C CB  . ALA A 1 251 ? -19.457 7.117    -37.175 1.00 44.69  ? 252 ALA A CB  1 
ATOM   1804  N N   . ALA A 1 252 ? -21.149 8.200    -34.599 1.00 45.00  ? 253 ALA A N   1 
ATOM   1805  C CA  . ALA A 1 252 ? -21.486 7.934    -33.210 1.00 43.30  ? 253 ALA A CA  1 
ATOM   1806  C C   . ALA A 1 252 ? -20.880 6.606    -32.762 1.00 41.49  ? 253 ALA A C   1 
ATOM   1807  O O   . ALA A 1 252 ? -20.411 6.476    -31.627 1.00 39.97  ? 253 ALA A O   1 
ATOM   1808  C CB  . ALA A 1 252 ? -22.994 7.926    -33.025 1.00 43.25  ? 253 ALA A CB  1 
ATOM   1809  N N   . SER A 1 253 ? -20.887 5.627    -33.665 1.00 40.06  ? 254 SER A N   1 
ATOM   1810  C CA  . SER A 1 253 ? -20.290 4.317    -33.400 1.00 37.19  ? 254 SER A CA  1 
ATOM   1811  C C   . SER A 1 253 ? -20.038 3.576    -34.710 1.00 37.04  ? 254 SER A C   1 
ATOM   1812  O O   . SER A 1 253 ? -20.444 4.038    -35.776 1.00 39.67  ? 254 SER A O   1 
ATOM   1813  C CB  . SER A 1 253 ? -21.190 3.483    -32.489 1.00 34.25  ? 254 SER A CB  1 
ATOM   1814  O OG  . SER A 1 253 ? -22.341 3.036    -33.187 1.00 34.75  ? 254 SER A OG  1 
ATOM   1815  N N   . LEU A 1 254 ? -19.374 2.426    -34.632 1.00 35.64  ? 255 LEU A N   1 
ATOM   1816  C CA  . LEU A 1 254 ? -19.066 1.648    -35.831 1.00 35.46  ? 255 LEU A CA  1 
ATOM   1817  C C   . LEU A 1 254 ? -20.311 0.971    -36.389 1.00 35.64  ? 255 LEU A C   1 
ATOM   1818  O O   . LEU A 1 254 ? -20.306 0.503    -37.527 1.00 36.16  ? 255 LEU A O   1 
ATOM   1819  C CB  . LEU A 1 254 ? -17.988 0.602    -35.547 1.00 33.82  ? 255 LEU A CB  1 
ATOM   1820  C CG  . LEU A 1 254 ? -16.608 1.151    -35.166 1.00 34.11  ? 255 LEU A CG  1 
ATOM   1821  C CD1 . LEU A 1 254 ? -15.595 0.020    -35.037 1.00 33.29  ? 255 LEU A CD1 1 
ATOM   1822  C CD2 . LEU A 1 254 ? -16.135 2.199    -36.171 1.00 36.13  ? 255 LEU A CD2 1 
ATOM   1823  N N   . ARG A 1 255 ? -21.374 0.915    -35.588 1.00 33.91  ? 256 ARG A N   1 
ATOM   1824  C CA  . ARG A 1 255 ? -22.660 0.432    -36.080 1.00 34.50  ? 256 ARG A CA  1 
ATOM   1825  C C   . ARG A 1 255 ? -23.134 1.291    -37.254 1.00 37.25  ? 256 ARG A C   1 
ATOM   1826  O O   . ARG A 1 255 ? -23.778 0.796    -38.178 1.00 39.22  ? 256 ARG A O   1 
ATOM   1827  C CB  . ARG A 1 255 ? -23.709 0.436    -34.964 1.00 31.08  ? 256 ARG A CB  1 
ATOM   1828  C CG  . ARG A 1 255 ? -25.107 -0.002   -35.411 1.00 31.89  ? 256 ARG A CG  1 
ATOM   1829  C CD  . ARG A 1 255 ? -25.157 -1.483   -35.777 1.00 30.58  ? 256 ARG A CD  1 
ATOM   1830  N NE  . ARG A 1 255 ? -26.519 -1.933   -36.046 1.00 32.09  ? 256 ARG A NE  1 
ATOM   1831  C CZ  . ARG A 1 255 ? -27.401 -2.266   -35.107 1.00 34.16  ? 256 ARG A CZ  1 
ATOM   1832  N NH1 . ARG A 1 255 ? -27.072 -2.199   -33.823 1.00 28.77  ? 256 ARG A NH1 1 
ATOM   1833  N NH2 . ARG A 1 255 ? -28.619 -2.658   -35.451 1.00 35.02  ? 256 ARG A NH2 1 
ATOM   1834  N N   . GLU A 1 256 ? -22.801 2.578    -37.221 1.00 39.02  ? 257 GLU A N   1 
ATOM   1835  C CA  . GLU A 1 256 ? -23.217 3.500    -38.281 1.00 42.29  ? 257 GLU A CA  1 
ATOM   1836  C C   . GLU A 1 256 ? -22.330 3.396    -39.519 1.00 43.79  ? 257 GLU A C   1 
ATOM   1837  O O   . GLU A 1 256 ? -22.630 3.984    -40.557 1.00 46.83  ? 257 GLU A O   1 
ATOM   1838  C CB  . GLU A 1 256 ? -23.212 4.945    -37.771 1.00 44.26  ? 257 GLU A CB  1 
ATOM   1839  C CG  . GLU A 1 256 ? -23.891 5.140    -36.425 1.00 44.73  ? 257 GLU A CG  1 
ATOM   1840  C CD  . GLU A 1 256 ? -25.360 4.755    -36.442 1.00 46.64  ? 257 GLU A CD  1 
ATOM   1841  O OE1 . GLU A 1 256 ? -25.976 4.777    -37.528 1.00 49.88  ? 257 GLU A OE1 1 
ATOM   1842  O OE2 . GLU A 1 256 ? -25.899 4.424    -35.366 1.00 45.60  ? 257 GLU A OE2 1 
ATOM   1843  N N   . VAL A 1 257 ? -21.243 2.642    -39.407 1.00 42.36  ? 258 VAL A N   1 
ATOM   1844  C CA  . VAL A 1 257 ? -20.250 2.558    -40.474 1.00 44.55  ? 258 VAL A CA  1 
ATOM   1845  C C   . VAL A 1 257 ? -20.371 1.263    -41.279 1.00 45.50  ? 258 VAL A C   1 
ATOM   1846  O O   . VAL A 1 257 ? -20.519 0.181    -40.713 1.00 45.29  ? 258 VAL A O   1 
ATOM   1847  C CB  . VAL A 1 257 ? -18.818 2.666    -39.897 1.00 43.85  ? 258 VAL A CB  1 
ATOM   1848  C CG1 . VAL A 1 257 ? -17.775 2.561    -41.000 1.00 46.08  ? 258 VAL A CG1 1 
ATOM   1849  C CG2 . VAL A 1 257 ? -18.659 3.969    -39.125 1.00 43.22  ? 258 VAL A CG2 1 
ATOM   1850  N N   . GLN A 1 258 ? -20.308 1.384    -42.601 1.00 47.14  ? 259 GLN A N   1 
ATOM   1851  C CA  . GLN A 1 258 ? -20.310 0.224    -43.489 1.00 47.86  ? 259 GLN A CA  1 
ATOM   1852  C C   . GLN A 1 258 ? -18.937 0.048    -44.135 1.00 48.28  ? 259 GLN A C   1 
ATOM   1853  O O   . GLN A 1 258 ? -18.170 1.006    -44.232 1.00 50.17  ? 259 GLN A O   1 
ATOM   1854  C CB  . GLN A 1 258 ? -21.387 0.368    -44.564 1.00 49.65  ? 259 GLN A CB  1 
ATOM   1855  N N   . LEU A 1 259 ? -18.639 -1.173   -44.575 1.00 46.98  ? 260 LEU A N   1 
ATOM   1856  C CA  . LEU A 1 259 ? -17.330 -1.505   -45.143 1.00 47.77  ? 260 LEU A CA  1 
ATOM   1857  C C   . LEU A 1 259 ? -16.884 -0.526   -46.231 1.00 50.07  ? 260 LEU A C   1 
ATOM   1858  O O   . LEU A 1 259 ? -15.713 -0.143   -46.291 1.00 49.65  ? 260 LEU A O   1 
ATOM   1859  C CB  . LEU A 1 259 ? -17.341 -2.928   -45.710 1.00 47.94  ? 260 LEU A CB  1 
ATOM   1860  C CG  . LEU A 1 259 ? -16.050 -3.398   -46.385 1.00 49.50  ? 260 LEU A CG  1 
ATOM   1861  C CD1 . LEU A 1 259 ? -14.880 -3.348   -45.414 1.00 48.95  ? 260 LEU A CD1 1 
ATOM   1862  C CD2 . LEU A 1 259 ? -16.218 -4.801   -46.947 1.00 50.03  ? 260 LEU A CD2 1 
ATOM   1863  N N   . GLU A 1 260 ? -17.821 -0.117   -47.079 1.00 51.39  ? 261 GLU A N   1 
ATOM   1864  C CA  . GLU A 1 260 ? -17.515 0.813    -48.162 1.00 55.78  ? 261 GLU A CA  1 
ATOM   1865  C C   . GLU A 1 260 ? -17.049 2.159    -47.613 1.00 57.16  ? 261 GLU A C   1 
ATOM   1866  O O   . GLU A 1 260 ? -16.049 2.716    -48.071 1.00 59.24  ? 261 GLU A O   1 
ATOM   1867  C CB  . GLU A 1 260 ? -18.734 1.003    -49.067 1.00 56.71  ? 261 GLU A CB  1 
ATOM   1868  N N   . GLU A 1 261 ? -17.779 2.670    -46.624 1.00 56.42  ? 262 GLU A N   1 
ATOM   1869  C CA  . GLU A 1 261 ? -17.442 3.933    -45.978 1.00 57.60  ? 262 GLU A CA  1 
ATOM   1870  C C   . GLU A 1 261 ? -16.080 3.846    -45.303 1.00 56.44  ? 262 GLU A C   1 
ATOM   1871  O O   . GLU A 1 261 ? -15.309 4.807    -45.294 1.00 57.54  ? 262 GLU A O   1 
ATOM   1872  C CB  . GLU A 1 261 ? -18.512 4.309    -44.952 1.00 57.51  ? 262 GLU A CB  1 
ATOM   1873  C CG  . GLU A 1 261 ? -19.915 4.394    -45.525 1.00 60.34  ? 262 GLU A CG  1 
ATOM   1874  C CD  . GLU A 1 261 ? -20.976 4.530    -44.451 1.00 60.21  ? 262 GLU A CD  1 
ATOM   1875  O OE1 . GLU A 1 261 ? -21.702 5.546    -44.457 1.00 63.03  ? 262 GLU A OE1 1 
ATOM   1876  O OE2 . GLU A 1 261 ? -21.087 3.620    -43.604 1.00 57.59  ? 262 GLU A OE2 1 
ATOM   1877  N N   . LEU A 1 262 ? -15.794 2.679    -44.740 1.00 54.58  ? 263 LEU A N   1 
ATOM   1878  C CA  . LEU A 1 262 ? -14.534 2.440    -44.055 1.00 53.78  ? 263 LEU A CA  1 
ATOM   1879  C C   . LEU A 1 262 ? -13.355 2.509    -45.020 1.00 56.27  ? 263 LEU A C   1 
ATOM   1880  O O   . LEU A 1 262 ? -12.366 3.195    -44.761 1.00 56.54  ? 263 LEU A O   1 
ATOM   1881  C CB  . LEU A 1 262 ? -14.564 1.082    -43.355 1.00 50.91  ? 263 LEU A CB  1 
ATOM   1882  C CG  . LEU A 1 262 ? -13.293 0.683    -42.611 1.00 50.65  ? 263 LEU A CG  1 
ATOM   1883  C CD1 . LEU A 1 262 ? -13.026 1.637    -41.456 1.00 50.38  ? 263 LEU A CD1 1 
ATOM   1884  C CD2 . LEU A 1 262 ? -13.394 -0.754   -42.126 1.00 48.43  ? 263 LEU A CD2 1 
ATOM   1885  N N   . GLU A 1 263 ? -13.467 1.800    -46.138 1.00 58.80  ? 264 GLU A N   1 
ATOM   1886  C CA  . GLU A 1 263 ? -12.391 1.768    -47.121 1.00 63.66  ? 264 GLU A CA  1 
ATOM   1887  C C   . GLU A 1 263 ? -12.171 3.128    -47.768 1.00 65.03  ? 264 GLU A C   1 
ATOM   1888  O O   . GLU A 1 263 ? -11.046 3.476    -48.121 1.00 67.28  ? 264 GLU A O   1 
ATOM   1889  C CB  . GLU A 1 263 ? -12.678 0.716    -48.192 1.00 67.24  ? 264 GLU A CB  1 
ATOM   1890  C CG  . GLU A 1 263 ? -11.744 -0.475   -48.120 1.00 69.87  ? 264 GLU A CG  1 
ATOM   1891  C CD  . GLU A 1 263 ? -12.436 -1.776   -48.453 1.00 71.32  ? 264 GLU A CD  1 
ATOM   1892  O OE1 . GLU A 1 263 ? -13.402 -1.752   -49.246 1.00 72.98  ? 264 GLU A OE1 1 
ATOM   1893  O OE2 . GLU A 1 263 ? -12.022 -2.822   -47.909 1.00 70.83  ? 264 GLU A OE2 1 
ATOM   1894  N N   . ALA A 1 264 ? -13.247 3.894    -47.915 1.00 65.18  ? 265 ALA A N   1 
ATOM   1895  C CA  . ALA A 1 264 ? -13.165 5.221    -48.519 1.00 68.93  ? 265 ALA A CA  1 
ATOM   1896  C C   . ALA A 1 264 ? -12.433 6.201    -47.606 1.00 69.31  ? 265 ALA A C   1 
ATOM   1897  O O   . ALA A 1 264 ? -11.838 7.172    -48.072 1.00 71.97  ? 265 ALA A O   1 
ATOM   1898  C CB  . ALA A 1 264 ? -14.555 5.741    -48.847 1.00 69.19  ? 265 ALA A CB  1 
ATOM   1899  N N   . ALA A 1 265 ? -12.484 5.939    -46.303 1.00 66.93  ? 266 ALA A N   1 
ATOM   1900  C CA  . ALA A 1 265 ? -11.808 6.782    -45.325 1.00 66.84  ? 266 ALA A CA  1 
ATOM   1901  C C   . ALA A 1 265 ? -10.580 6.074    -44.767 1.00 67.02  ? 266 ALA A C   1 
ATOM   1902  O O   . ALA A 1 265 ? -10.201 6.278    -43.613 1.00 65.84  ? 266 ALA A O   1 
ATOM   1903  C CB  . ALA A 1 265 ? -12.760 7.161    -44.204 1.00 64.13  ? 266 ALA A CB  1 
ATOM   1904  N N   . ARG A 1 266 ? -9.963  5.242    -45.601 1.00 68.96  ? 267 ARG A N   1 
ATOM   1905  C CA  . ARG A 1 266 ? -8.814  4.442    -45.193 1.00 69.79  ? 267 ARG A CA  1 
ATOM   1906  C C   . ARG A 1 266 ? -7.638  5.307    -44.747 1.00 72.08  ? 267 ARG A C   1 
ATOM   1907  O O   . ARG A 1 266 ? -6.896  4.940    -43.834 1.00 71.50  ? 267 ARG A O   1 
ATOM   1908  C CB  . ARG A 1 266 ? -8.382  3.523    -46.337 1.00 71.75  ? 267 ARG A CB  1 
ATOM   1909  C CG  . ARG A 1 266 ? -7.312  2.517    -45.958 1.00 72.16  ? 267 ARG A CG  1 
ATOM   1910  C CD  . ARG A 1 266 ? -7.201  1.420    -46.999 1.00 74.19  ? 267 ARG A CD  1 
ATOM   1911  N NE  . ARG A 1 266 ? -6.557  0.229    -46.457 1.00 74.19  ? 267 ARG A NE  1 
ATOM   1912  C CZ  . ARG A 1 266 ? -7.011  -1.008   -46.631 1.00 73.56  ? 267 ARG A CZ  1 
ATOM   1913  N NH1 . ARG A 1 266 ? -8.114  -1.218   -47.337 1.00 72.97  ? 267 ARG A NH1 1 
ATOM   1914  N NH2 . ARG A 1 266 ? -6.361  -2.034   -46.099 1.00 73.74  ? 267 ARG A NH2 1 
ATOM   1915  N N   . ASP A 1 267 ? -7.480  6.462    -45.384 1.00 74.80  ? 268 ASP A N   1 
ATOM   1916  C CA  . ASP A 1 267 ? -6.358  7.350    -45.097 1.00 77.33  ? 268 ASP A CA  1 
ATOM   1917  C C   . ASP A 1 267 ? -6.510  8.070    -43.759 1.00 75.91  ? 268 ASP A C   1 
ATOM   1918  O O   . ASP A 1 267 ? -5.568  8.698    -43.276 1.00 77.60  ? 268 ASP A O   1 
ATOM   1919  C CB  . ASP A 1 267 ? -6.194  8.376    -46.221 1.00 80.57  ? 268 ASP A CB  1 
ATOM   1920  N N   . LEU A 1 268 ? -7.691  7.972    -43.157 1.00 73.11  ? 269 LEU A N   1 
ATOM   1921  C CA  . LEU A 1 268 ? -7.980  8.709    -41.930 1.00 71.82  ? 269 LEU A CA  1 
ATOM   1922  C C   . LEU A 1 268 ? -7.701  7.908    -40.657 1.00 69.47  ? 269 LEU A C   1 
ATOM   1923  O O   . LEU A 1 268 ? -7.738  8.458    -39.557 1.00 69.26  ? 269 LEU A O   1 
ATOM   1924  C CB  . LEU A 1 268 ? -9.437  9.178    -41.933 1.00 70.42  ? 269 LEU A CB  1 
ATOM   1925  N N   . VAL A 1 269 ? -7.428  6.614    -40.796 1.00 67.52  ? 270 VAL A N   1 
ATOM   1926  C CA  . VAL A 1 269 ? -7.150  5.781    -39.627 1.00 63.94  ? 270 VAL A CA  1 
ATOM   1927  C C   . VAL A 1 269 ? -5.851  4.995    -39.773 1.00 65.70  ? 270 VAL A C   1 
ATOM   1928  O O   . VAL A 1 269 ? -5.286  4.902    -40.863 1.00 67.80  ? 270 VAL A O   1 
ATOM   1929  C CB  . VAL A 1 269 ? -8.298  4.787    -39.348 1.00 59.34  ? 270 VAL A CB  1 
ATOM   1930  C CG1 . VAL A 1 269 ? -9.615  5.525    -39.186 1.00 58.03  ? 270 VAL A CG1 1 
ATOM   1931  C CG2 . VAL A 1 269 ? -8.394  3.752    -40.457 1.00 59.36  ? 270 VAL A CG2 1 
ATOM   1932  N N   . SER A 1 270 ? -5.388  4.429    -38.662 1.00 65.22  ? 271 SER A N   1 
ATOM   1933  C CA  . SER A 1 270 ? -4.168  3.631    -38.649 1.00 67.55  ? 271 SER A CA  1 
ATOM   1934  C C   . SER A 1 270 ? -4.391  2.292    -39.340 1.00 67.35  ? 271 SER A C   1 
ATOM   1935  O O   . SER A 1 270 ? -5.531  1.879    -39.555 1.00 65.34  ? 271 SER A O   1 
ATOM   1936  C CB  . SER A 1 270 ? -3.686  3.407    -37.213 1.00 66.63  ? 271 SER A CB  1 
ATOM   1937  O OG  . SER A 1 270 ? -4.734  2.921    -36.391 1.00 63.98  ? 271 SER A OG  1 
ATOM   1938  N N   . LYS A 1 271 ? -3.298  1.619    -39.685 1.00 63.62  ? 272 LYS A N   1 
ATOM   1939  C CA  . LYS A 1 271 ? -3.373  0.324    -40.350 1.00 63.46  ? 272 LYS A CA  1 
ATOM   1940  C C   . LYS A 1 271 ? -4.125  -0.689   -39.494 1.00 60.87  ? 272 LYS A C   1 
ATOM   1941  O O   . LYS A 1 271 ? -5.066  -1.330   -39.962 1.00 59.21  ? 272 LYS A O   1 
ATOM   1942  C CB  . LYS A 1 271 ? -1.972  -0.196   -40.674 1.00 66.03  ? 272 LYS A CB  1 
ATOM   1943  N N   . GLU A 1 272 ? -3.711  -0.823   -38.238 1.00 60.53  ? 273 GLU A N   1 
ATOM   1944  C CA  . GLU A 1 272 ? -4.365  -1.740   -37.315 1.00 58.33  ? 273 GLU A CA  1 
ATOM   1945  C C   . GLU A 1 272 ? -5.779  -1.274   -36.997 1.00 54.71  ? 273 GLU A C   1 
ATOM   1946  O O   . GLU A 1 272 ? -6.680  -2.090   -36.815 1.00 52.21  ? 273 GLU A O   1 
ATOM   1947  C CB  . GLU A 1 272 ? -3.557  -1.881   -36.024 1.00 60.76  ? 273 GLU A CB  1 
ATOM   1948  C CG  . GLU A 1 272 ? -3.200  -0.563   -35.365 1.00 64.80  ? 273 GLU A CG  1 
ATOM   1949  C CD  . GLU A 1 272 ? -2.583  -0.747   -33.992 1.00 66.77  ? 273 GLU A CD  1 
ATOM   1950  O OE1 . GLU A 1 272 ? -2.340  -1.908   -33.599 1.00 66.48  ? 273 GLU A OE1 1 
ATOM   1951  O OE2 . GLU A 1 272 ? -2.338  0.271    -33.308 1.00 68.47  ? 273 GLU A OE2 1 
ATOM   1952  N N   . GLY A 1 273 ? -5.966  0.041    -36.932 1.00 54.62  ? 274 GLY A N   1 
ATOM   1953  C CA  . GLY A 1 273 ? -7.275  0.614    -36.680 1.00 52.30  ? 274 GLY A CA  1 
ATOM   1954  C C   . GLY A 1 273 ? -8.274  0.190    -37.736 1.00 50.42  ? 274 GLY A C   1 
ATOM   1955  O O   . GLY A 1 273 ? -9.422  -0.134   -37.425 1.00 48.71  ? 274 GLY A O   1 
ATOM   1956  N N   . PHE A 1 274 ? -7.826  0.185    -38.988 1.00 50.82  ? 275 PHE A N   1 
ATOM   1957  C CA  . PHE A 1 274 ? -8.641  -0.277   -40.102 1.00 49.50  ? 275 PHE A CA  1 
ATOM   1958  C C   . PHE A 1 274 ? -9.012  -1.746   -39.925 1.00 46.52  ? 275 PHE A C   1 
ATOM   1959  O O   . PHE A 1 274 ? -10.154 -2.136   -40.163 1.00 43.82  ? 275 PHE A O   1 
ATOM   1960  C CB  . PHE A 1 274 ? -7.905  -0.071   -41.431 1.00 52.92  ? 275 PHE A CB  1 
ATOM   1961  C CG  . PHE A 1 274 ? -8.721  -0.441   -42.641 1.00 53.88  ? 275 PHE A CG  1 
ATOM   1962  C CD1 . PHE A 1 274 ? -9.554  0.489    -43.242 1.00 55.06  ? 275 PHE A CD1 1 
ATOM   1963  C CD2 . PHE A 1 274 ? -8.655  -1.719   -43.177 1.00 53.87  ? 275 PHE A CD2 1 
ATOM   1964  C CE1 . PHE A 1 274 ? -10.306 0.152    -44.355 1.00 56.04  ? 275 PHE A CE1 1 
ATOM   1965  C CE2 . PHE A 1 274 ? -9.407  -2.062   -44.288 1.00 54.80  ? 275 PHE A CE2 1 
ATOM   1966  C CZ  . PHE A 1 274 ? -10.233 -1.125   -44.877 1.00 55.63  ? 275 PHE A CZ  1 
ATOM   1967  N N   . ARG A 1 275 ? -8.042  -2.555   -39.501 1.00 47.50  ? 276 ARG A N   1 
ATOM   1968  C CA  . ARG A 1 275 ? -8.273  -3.981   -39.284 1.00 46.04  ? 276 ARG A CA  1 
ATOM   1969  C C   . ARG A 1 275 ? -9.334  -4.211   -38.215 1.00 42.00  ? 276 ARG A C   1 
ATOM   1970  O O   . ARG A 1 275 ? -10.186 -5.091   -38.358 1.00 40.47  ? 276 ARG A O   1 
ATOM   1971  C CB  . ARG A 1 275 ? -6.977  -4.694   -38.888 1.00 48.69  ? 276 ARG A CB  1 
ATOM   1972  C CG  . ARG A 1 275 ? -5.879  -4.635   -39.938 1.00 53.64  ? 276 ARG A CG  1 
ATOM   1973  C CD  . ARG A 1 275 ? -4.866  -5.762   -39.747 1.00 55.97  ? 276 ARG A CD  1 
ATOM   1974  N NE  . ARG A 1 275 ? -4.206  -5.716   -38.443 1.00 56.48  ? 276 ARG A NE  1 
ATOM   1975  C CZ  . ARG A 1 275 ? -3.115  -5.002   -38.183 1.00 58.99  ? 276 ARG A CZ  1 
ATOM   1976  N NH1 . ARG A 1 275 ? -2.557  -4.270   -39.137 1.00 61.31  ? 276 ARG A NH1 1 
ATOM   1977  N NH2 . ARG A 1 275 ? -2.579  -5.021   -36.968 1.00 59.00  ? 276 ARG A NH2 1 
ATOM   1978  N N   . ARG A 1 276 ? -9.283  -3.417   -37.149 1.00 39.57  ? 277 ARG A N   1 
ATOM   1979  C CA  . ARG A 1 276 ? -10.243 -3.552   -36.060 1.00 37.93  ? 277 ARG A CA  1 
ATOM   1980  C C   . ARG A 1 276 ? -11.655 -3.233   -36.539 1.00 35.66  ? 277 ARG A C   1 
ATOM   1981  O O   . ARG A 1 276 ? -12.597 -3.978   -36.271 1.00 34.44  ? 277 ARG A O   1 
ATOM   1982  C CB  . ARG A 1 276 ? -9.872  -2.638   -34.886 1.00 39.00  ? 277 ARG A CB  1 
ATOM   1983  C CG  . ARG A 1 276 ? -8.461  -2.825   -34.348 1.00 40.85  ? 277 ARG A CG  1 
ATOM   1984  C CD  . ARG A 1 276 ? -8.239  -4.221   -33.788 1.00 40.81  ? 277 ARG A CD  1 
ATOM   1985  N NE  . ARG A 1 276 ? -6.938  -4.337   -33.133 1.00 42.13  ? 277 ARG A NE  1 
ATOM   1986  C CZ  . ARG A 1 276 ? -5.894  -4.986   -33.638 1.00 43.44  ? 277 ARG A CZ  1 
ATOM   1987  N NH1 . ARG A 1 276 ? -5.990  -5.602   -34.812 1.00 43.16  ? 277 ARG A NH1 1 
ATOM   1988  N NH2 . ARG A 1 276 ? -4.753  -5.029   -32.963 1.00 45.46  ? 277 ARG A NH2 1 
ATOM   1989  N N   . ALA A 1 277 ? -11.794 -2.120   -37.253 1.00 36.88  ? 278 ALA A N   1 
ATOM   1990  C CA  . ALA A 1 277 ? -13.096 -1.672   -37.730 1.00 36.77  ? 278 ALA A CA  1 
ATOM   1991  C C   . ALA A 1 277 ? -13.680 -2.634   -38.765 1.00 36.01  ? 278 ALA A C   1 
ATOM   1992  O O   . ALA A 1 277 ? -14.889 -2.872   -38.785 1.00 33.90  ? 278 ALA A O   1 
ATOM   1993  C CB  . ALA A 1 277 ? -12.989 -0.269   -38.312 1.00 39.13  ? 278 ALA A CB  1 
ATOM   1994  N N   . ARG A 1 278 ? -12.820 -3.185   -39.619 1.00 36.93  ? 279 ARG A N   1 
ATOM   1995  C CA  . ARG A 1 278 ? -13.274 -4.107   -40.657 1.00 37.74  ? 279 ARG A CA  1 
ATOM   1996  C C   . ARG A 1 278 ? -13.908 -5.344   -40.039 1.00 35.76  ? 279 ARG A C   1 
ATOM   1997  O O   . ARG A 1 278 ? -14.935 -5.828   -40.517 1.00 35.34  ? 279 ARG A O   1 
ATOM   1998  C CB  . ARG A 1 278 ? -12.122 -4.512   -41.578 1.00 38.77  ? 279 ARG A CB  1 
ATOM   1999  C CG  . ARG A 1 278 ? -12.577 -5.335   -42.779 1.00 39.03  ? 279 ARG A CG  1 
ATOM   2000  C CD  . ARG A 1 278 ? -11.497 -5.414   -43.852 1.00 40.66  ? 279 ARG A CD  1 
ATOM   2001  N NE  . ARG A 1 278 ? -10.297 -6.070   -43.350 1.00 40.50  ? 279 ARG A NE  1 
ATOM   2002  C CZ  . ARG A 1 278 ? -9.132  -6.094   -43.985 1.00 44.46  ? 279 ARG A CZ  1 
ATOM   2003  N NH1 . ARG A 1 278 ? -8.997  -5.497   -45.166 1.00 47.90  ? 279 ARG A NH1 1 
ATOM   2004  N NH2 . ARG A 1 278 ? -8.099  -6.716   -43.436 1.00 45.68  ? 279 ARG A NH2 1 
ATOM   2005  N N   . HIS A 1 279 ? -13.298 -5.853   -38.973 1.00 35.74  ? 280 HIS A N   1 
ATOM   2006  C CA  . HIS A 1 279 ? -13.913 -6.945   -38.230 1.00 34.54  ? 280 HIS A CA  1 
ATOM   2007  C C   . HIS A 1 279 ? -15.278 -6.557   -37.680 1.00 34.12  ? 280 HIS A C   1 
ATOM   2008  O O   . HIS A 1 279 ? -16.241 -7.308   -37.807 1.00 34.95  ? 280 HIS A O   1 
ATOM   2009  C CB  . HIS A 1 279 ? -13.059 -7.402   -37.051 1.00 33.03  ? 280 HIS A CB  1 
ATOM   2010  C CG  . HIS A 1 279 ? -13.853 -8.167   -36.041 1.00 32.30  ? 280 HIS A CG  1 
ATOM   2011  N ND1 . HIS A 1 279 ? -14.217 -9.483   -36.229 1.00 32.31  ? 280 HIS A ND1 1 
ATOM   2012  C CD2 . HIS A 1 279 ? -14.430 -7.780   -34.878 1.00 31.90  ? 280 HIS A CD2 1 
ATOM   2013  C CE1 . HIS A 1 279 ? -14.952 -9.885   -35.208 1.00 31.07  ? 280 HIS A CE1 1 
ATOM   2014  N NE2 . HIS A 1 279 ? -15.094 -8.871   -34.372 1.00 30.64  ? 280 HIS A NE2 1 
ATOM   2015  N N   . VAL A 1 280 ? -15.341 -5.400   -37.027 1.00 33.54  ? 281 VAL A N   1 
ATOM   2016  C CA  . VAL A 1 280 ? -16.560 -4.976   -36.344 1.00 31.26  ? 281 VAL A CA  1 
ATOM   2017  C C   . VAL A 1 280 ? -17.715 -4.825   -37.328 1.00 31.00  ? 281 VAL A C   1 
ATOM   2018  O O   . VAL A 1 280 ? -18.805 -5.351   -37.105 1.00 30.81  ? 281 VAL A O   1 
ATOM   2019  C CB  . VAL A 1 280 ? -16.351 -3.652   -35.585 1.00 30.78  ? 281 VAL A CB  1 
ATOM   2020  C CG1 . VAL A 1 280 ? -17.680 -3.126   -35.060 1.00 31.73  ? 281 VAL A CG1 1 
ATOM   2021  C CG2 . VAL A 1 280 ? -15.361 -3.854   -34.434 1.00 30.30  ? 281 VAL A CG2 1 
ATOM   2022  N N   . VAL A 1 281 ? -17.457 -4.115   -38.420 1.00 31.96  ? 282 VAL A N   1 
ATOM   2023  C CA  . VAL A 1 281 ? -18.451 -3.905   -39.467 1.00 35.53  ? 282 VAL A CA  1 
ATOM   2024  C C   . VAL A 1 281 ? -18.896 -5.231   -40.095 1.00 34.55  ? 282 VAL A C   1 
ATOM   2025  O O   . VAL A 1 281 ? -20.084 -5.456   -40.314 1.00 34.42  ? 282 VAL A O   1 
ATOM   2026  C CB  . VAL A 1 281 ? -17.896 -2.955   -40.550 1.00 40.06  ? 282 VAL A CB  1 
ATOM   2027  C CG1 . VAL A 1 281 ? -18.777 -2.959   -41.778 1.00 43.20  ? 282 VAL A CG1 1 
ATOM   2028  C CG2 . VAL A 1 281 ? -17.756 -1.541   -39.982 1.00 41.24  ? 282 VAL A CG2 1 
ATOM   2029  N N   . GLY A 1 282 ? -17.941 -6.117   -40.356 1.00 34.69  ? 283 GLY A N   1 
ATOM   2030  C CA  . GLY A 1 282 ? -18.248 -7.425   -40.909 1.00 34.28  ? 283 GLY A CA  1 
ATOM   2031  C C   . GLY A 1 282 ? -18.982 -8.334   -39.935 1.00 32.63  ? 283 GLY A C   1 
ATOM   2032  O O   . GLY A 1 282 ? -19.842 -9.118   -40.340 1.00 33.33  ? 283 GLY A O   1 
ATOM   2033  N N   . GLU A 1 283 ? -18.645 -8.229   -38.650 1.00 30.45  ? 284 GLU A N   1 
ATOM   2034  C CA  . GLU A 1 283 ? -19.231 -9.095   -37.624 1.00 28.96  ? 284 GLU A CA  1 
ATOM   2035  C C   . GLU A 1 283 ? -20.687 -8.744   -37.330 1.00 28.91  ? 284 GLU A C   1 
ATOM   2036  O O   . GLU A 1 283 ? -21.503 -9.625   -37.056 1.00 28.81  ? 284 GLU A O   1 
ATOM   2037  C CB  . GLU A 1 283 ? -18.410 -9.025   -36.334 1.00 27.90  ? 284 GLU A CB  1 
ATOM   2038  C CG  . GLU A 1 283 ? -18.863 -9.985   -35.238 1.00 27.37  ? 284 GLU A CG  1 
ATOM   2039  C CD  . GLU A 1 283 ? -18.370 -11.405  -35.440 1.00 29.27  ? 284 GLU A CD  1 
ATOM   2040  O OE1 . GLU A 1 283 ? -17.821 -11.707  -36.525 1.00 30.72  ? 284 GLU A OE1 1 
ATOM   2041  O OE2 . GLU A 1 283 ? -18.533 -12.223  -34.505 1.00 28.93  ? 284 GLU A OE2 1 
ATOM   2042  N N   . ILE A 1 284 ? -21.011 -7.457   -37.375 1.00 29.14  ? 285 ILE A N   1 
ATOM   2043  C CA  . ILE A 1 284 ? -22.398 -7.019   -37.251 1.00 28.59  ? 285 ILE A CA  1 
ATOM   2044  C C   . ILE A 1 284 ? -23.232 -7.587   -38.402 1.00 30.02  ? 285 ILE A C   1 
ATOM   2045  O O   . ILE A 1 284 ? -24.336 -8.090   -38.193 1.00 29.62  ? 285 ILE A O   1 
ATOM   2046  C CB  . ILE A 1 284 ? -22.505 -5.483   -37.234 1.00 29.68  ? 285 ILE A CB  1 
ATOM   2047  C CG1 . ILE A 1 284 ? -21.817 -4.915   -35.992 1.00 30.94  ? 285 ILE A CG1 1 
ATOM   2048  C CG2 . ILE A 1 284 ? -23.958 -5.044   -37.272 1.00 30.48  ? 285 ILE A CG2 1 
ATOM   2049  C CD1 . ILE A 1 284 ? -21.808 -3.402   -35.941 1.00 33.88  ? 285 ILE A CD1 1 
ATOM   2050  N N   . ARG A 1 285 ? -22.694 -7.508   -39.616 1.00 32.80  ? 286 ARG A N   1 
ATOM   2051  C CA  . ARG A 1 285 ? -23.355 -8.078   -40.792 1.00 35.23  ? 286 ARG A CA  1 
ATOM   2052  C C   . ARG A 1 285 ? -23.589 -9.577   -40.605 1.00 32.74  ? 286 ARG A C   1 
ATOM   2053  O O   . ARG A 1 285 ? -24.723 -10.053  -40.701 1.00 31.37  ? 286 ARG A O   1 
ATOM   2054  C CB  . ARG A 1 285 ? -22.522 -7.817   -42.050 1.00 39.50  ? 286 ARG A CB  1 
ATOM   2055  C CG  . ARG A 1 285 ? -22.924 -8.627   -43.285 1.00 43.07  ? 286 ARG A CG  1 
ATOM   2056  C CD  . ARG A 1 285 ? -24.230 -8.139   -43.889 1.00 47.21  ? 286 ARG A CD  1 
ATOM   2057  N NE  . ARG A 1 285 ? -24.253 -6.687   -44.047 1.00 50.51  ? 286 ARG A NE  1 
ATOM   2058  C CZ  . ARG A 1 285 ? -23.844 -6.039   -45.133 1.00 54.20  ? 286 ARG A CZ  1 
ATOM   2059  N NH1 . ARG A 1 285 ? -23.373 -6.708   -46.178 1.00 55.85  ? 286 ARG A NH1 1 
ATOM   2060  N NH2 . ARG A 1 285 ? -23.907 -4.715   -45.173 1.00 56.61  ? 286 ARG A NH2 1 
ATOM   2061  N N   . ARG A 1 286 ? -22.508 -10.302  -40.319 1.00 31.95  ? 287 ARG A N   1 
ATOM   2062  C CA  . ARG A 1 286 ? -22.548 -11.751  -40.102 1.00 31.20  ? 287 ARG A CA  1 
ATOM   2063  C C   . ARG A 1 286 ? -23.551 -12.178  -39.032 1.00 30.82  ? 287 ARG A C   1 
ATOM   2064  O O   . ARG A 1 286 ? -24.166 -13.237  -39.141 1.00 33.10  ? 287 ARG A O   1 
ATOM   2065  C CB  . ARG A 1 286 ? -21.158 -12.268  -39.720 1.00 30.73  ? 287 ARG A CB  1 
ATOM   2066  C CG  . ARG A 1 286 ? -20.196 -12.417  -40.894 1.00 33.45  ? 287 ARG A CG  1 
ATOM   2067  C CD  . ARG A 1 286 ? -18.916 -13.119  -40.467 1.00 34.21  ? 287 ARG A CD  1 
ATOM   2068  N NE  . ARG A 1 286 ? -18.154 -12.331  -39.503 1.00 33.30  ? 287 ARG A NE  1 
ATOM   2069  C CZ  . ARG A 1 286 ? -17.245 -11.421  -39.844 1.00 33.91  ? 287 ARG A CZ  1 
ATOM   2070  N NH1 . ARG A 1 286 ? -16.990 -11.187  -41.129 1.00 33.98  ? 287 ARG A NH1 1 
ATOM   2071  N NH2 . ARG A 1 286 ? -16.598 -10.741  -38.904 1.00 33.95  ? 287 ARG A NH2 1 
ATOM   2072  N N   . THR A 1 287 ? -23.712 -11.358  -37.998 1.00 27.60  ? 288 THR A N   1 
ATOM   2073  C CA  . THR A 1 287 ? -24.642 -11.671  -36.919 1.00 26.45  ? 288 THR A CA  1 
ATOM   2074  C C   . THR A 1 287 ? -26.083 -11.517  -37.380 1.00 27.62  ? 288 THR A C   1 
ATOM   2075  O O   . THR A 1 287 ? -26.945 -12.325  -37.030 1.00 29.05  ? 288 THR A O   1 
ATOM   2076  C CB  . THR A 1 287 ? -24.395 -10.775  -35.693 1.00 25.88  ? 288 THR A CB  1 
ATOM   2077  O OG1 . THR A 1 287 ? -23.019 -10.869  -35.325 1.00 26.45  ? 288 THR A OG1 1 
ATOM   2078  C CG2 . THR A 1 287 ? -25.249 -11.220  -34.515 1.00 26.89  ? 288 THR A CG2 1 
ATOM   2079  N N   . ALA A 1 288 ? -26.343 -10.467  -38.153 1.00 26.86  ? 289 ALA A N   1 
ATOM   2080  C CA  . ALA A 1 288 ? -27.644 -10.306  -38.794 1.00 28.85  ? 289 ALA A CA  1 
ATOM   2081  C C   . ALA A 1 288 ? -27.899 -11.492  -39.708 1.00 29.34  ? 289 ALA A C   1 
ATOM   2082  O O   . ALA A 1 288 ? -28.973 -12.092  -39.680 1.00 31.12  ? 289 ALA A O   1 
ATOM   2083  C CB  . ALA A 1 288 ? -27.709 -9.003   -39.582 1.00 29.96  ? 289 ALA A CB  1 
ATOM   2084  N N   . GLN A 1 289 ? -26.898 -11.836  -40.507 1.00 28.75  ? 290 GLN A N   1 
ATOM   2085  C CA  . GLN A 1 289 ? -27.007 -12.975  -41.418 1.00 32.12  ? 290 GLN A CA  1 
ATOM   2086  C C   . GLN A 1 289 ? -27.197 -14.280  -40.642 1.00 31.44  ? 290 GLN A C   1 
ATOM   2087  O O   . GLN A 1 289 ? -27.953 -15.161  -41.070 1.00 31.84  ? 290 GLN A O   1 
ATOM   2088  C CB  . GLN A 1 289 ? -25.769 -13.075  -42.313 1.00 33.59  ? 290 GLN A CB  1 
ATOM   2089  C CG  . GLN A 1 289 ? -25.654 -11.977  -43.361 1.00 37.65  ? 290 GLN A CG  1 
ATOM   2090  C CD  . GLN A 1 289 ? -24.303 -11.971  -44.062 1.00 39.13  ? 290 GLN A CD  1 
ATOM   2091  O OE1 . GLN A 1 289 ? -23.287 -12.391  -43.498 1.00 38.13  ? 290 GLN A OE1 1 
ATOM   2092  N NE2 . GLN A 1 289 ? -24.284 -11.486  -45.296 1.00 41.01  ? 290 GLN A NE2 1 
ATOM   2093  N N   . ALA A 1 290 ? -26.521 -14.390  -39.496 1.00 28.45  ? 291 ALA A N   1 
ATOM   2094  C CA  . ALA A 1 290 ? -26.573 -15.612  -38.694 1.00 27.91  ? 291 ALA A CA  1 
ATOM   2095  C C   . ALA A 1 290 ? -27.945 -15.798  -38.071 1.00 29.57  ? 291 ALA A C   1 
ATOM   2096  O O   . ALA A 1 290 ? -28.491 -16.901  -38.071 1.00 30.70  ? 291 ALA A O   1 
ATOM   2097  C CB  . ALA A 1 290 ? -25.499 -15.596  -37.610 1.00 26.80  ? 291 ALA A CB  1 
ATOM   2098  N N   . ALA A 1 291 ? -28.488 -14.709  -37.535 1.00 30.66  ? 292 ALA A N   1 
ATOM   2099  C CA  . ALA A 1 291 ? -29.828 -14.712  -36.967 1.00 31.49  ? 292 ALA A CA  1 
ATOM   2100  C C   . ALA A 1 291 ? -30.855 -15.229  -37.977 1.00 34.90  ? 292 ALA A C   1 
ATOM   2101  O O   . ALA A 1 291 ? -31.683 -16.073  -37.641 1.00 37.61  ? 292 ALA A O   1 
ATOM   2102  C CB  . ALA A 1 291 ? -30.203 -13.315  -36.492 1.00 29.65  ? 292 ALA A CB  1 
ATOM   2103  N N   . ALA A 1 292 ? -30.792 -14.732  -39.211 1.00 35.14  ? 293 ALA A N   1 
ATOM   2104  C CA  . ALA A 1 292 ? -31.725 -15.167  -40.247 1.00 37.88  ? 293 ALA A CA  1 
ATOM   2105  C C   . ALA A 1 292 ? -31.529 -16.646  -40.570 1.00 37.00  ? 293 ALA A C   1 
ATOM   2106  O O   . ALA A 1 292 ? -32.499 -17.389  -40.700 1.00 38.86  ? 293 ALA A O   1 
ATOM   2107  C CB  . ALA A 1 292 ? -31.568 -14.320  -41.511 1.00 32.99  ? 293 ALA A CB  1 
ATOM   2108  N N   . ALA A 1 293 ? -30.274 -17.066  -40.692 1.00 33.66  ? 294 ALA A N   1 
ATOM   2109  C CA  . ALA A 1 293 ? -29.962 -18.458  -40.998 1.00 34.28  ? 294 ALA A CA  1 
ATOM   2110  C C   . ALA A 1 293 ? -30.526 -19.393  -39.930 1.00 37.30  ? 294 ALA A C   1 
ATOM   2111  O O   . ALA A 1 293 ? -31.164 -20.396  -40.248 1.00 38.65  ? 294 ALA A O   1 
ATOM   2112  C CB  . ALA A 1 293 ? -28.462 -18.647  -41.132 1.00 32.19  ? 294 ALA A CB  1 
ATOM   2113  N N   . LEU A 1 294 ? -30.295 -19.050  -38.664 1.00 38.29  ? 295 LEU A N   1 
ATOM   2114  C CA  . LEU A 1 294 ? -30.795 -19.843  -37.546 1.00 41.28  ? 295 LEU A CA  1 
ATOM   2115  C C   . LEU A 1 294 ? -32.321 -19.946  -37.575 1.00 44.16  ? 295 LEU A C   1 
ATOM   2116  O O   . LEU A 1 294 ? -32.887 -20.988  -37.241 1.00 47.09  ? 295 LEU A O   1 
ATOM   2117  C CB  . LEU A 1 294 ? -30.317 -19.241  -36.218 1.00 41.81  ? 295 LEU A CB  1 
ATOM   2118  C CG  . LEU A 1 294 ? -30.636 -20.010  -34.933 1.00 43.27  ? 295 LEU A CG  1 
ATOM   2119  C CD1 . LEU A 1 294 ? -30.241 -21.473  -35.056 1.00 44.30  ? 295 LEU A CD1 1 
ATOM   2120  C CD2 . LEU A 1 294 ? -29.930 -19.363  -33.747 1.00 42.53  ? 295 LEU A CD2 1 
ATOM   2121  N N   . ARG A 1 295 ? -32.975 -18.863  -37.986 1.00 44.62  ? 296 ARG A N   1 
ATOM   2122  C CA  . ARG A 1 295 ? -34.421 -18.845  -38.190 1.00 49.12  ? 296 ARG A CA  1 
ATOM   2123  C C   . ARG A 1 295 ? -34.871 -19.895  -39.200 1.00 51.70  ? 296 ARG A C   1 
ATOM   2124  O O   . ARG A 1 295 ? -35.844 -20.619  -38.968 1.00 53.69  ? 296 ARG A O   1 
ATOM   2125  C CB  . ARG A 1 295 ? -34.876 -17.463  -38.664 1.00 51.10  ? 296 ARG A CB  1 
ATOM   2126  C CG  . ARG A 1 295 ? -34.763 -16.378  -37.617 1.00 51.68  ? 296 ARG A CG  1 
ATOM   2127  C CD  . ARG A 1 295 ? -35.310 -15.048  -38.133 1.00 52.56  ? 296 ARG A CD  1 
ATOM   2128  N NE  . ARG A 1 295 ? -35.149 -13.981  -37.146 1.00 50.97  ? 296 ARG A NE  1 
ATOM   2129  C CZ  . ARG A 1 295 ? -34.273 -12.982  -37.239 1.00 49.16  ? 296 ARG A CZ  1 
ATOM   2130  N NH1 . ARG A 1 295 ? -33.460 -12.890  -38.285 1.00 48.67  ? 296 ARG A NH1 1 
ATOM   2131  N NH2 . ARG A 1 295 ? -34.211 -12.066  -36.280 1.00 47.73  ? 296 ARG A NH2 1 
ATOM   2132  N N   . ARG A 1 296 ? -34.157 -19.965  -40.322 1.00 51.28  ? 297 ARG A N   1 
ATOM   2133  C CA  . ARG A 1 296 ? -34.503 -20.876  -41.411 1.00 53.22  ? 297 ARG A CA  1 
ATOM   2134  C C   . ARG A 1 296 ? -34.169 -22.313  -41.053 1.00 53.38  ? 297 ARG A C   1 
ATOM   2135  O O   . ARG A 1 296 ? -34.532 -23.240  -41.775 1.00 55.60  ? 297 ARG A O   1 
ATOM   2136  C CB  . ARG A 1 296 ? -33.763 -20.507  -42.701 1.00 53.73  ? 297 ARG A CB  1 
ATOM   2137  C CG  . ARG A 1 296 ? -33.938 -19.083  -43.178 1.00 53.96  ? 297 ARG A CG  1 
ATOM   2138  C CD  . ARG A 1 296 ? -33.399 -18.921  -44.597 1.00 55.41  ? 297 ARG A CD  1 
ATOM   2139  N NE  . ARG A 1 296 ? -32.031 -19.415  -44.756 1.00 54.72  ? 297 ARG A NE  1 
ATOM   2140  C CZ  . ARG A 1 296 ? -30.942 -18.666  -44.602 1.00 55.11  ? 297 ARG A CZ  1 
ATOM   2141  N NH1 . ARG A 1 296 ? -31.051 -17.386  -44.268 1.00 54.39  ? 297 ARG A NH1 1 
ATOM   2142  N NH2 . ARG A 1 296 ? -29.738 -19.198  -44.773 1.00 55.29  ? 297 ARG A NH2 1 
ATOM   2143  N N   . GLY A 1 297 ? -33.451 -22.492  -39.950 1.00 51.10  ? 298 GLY A N   1 
ATOM   2144  C CA  . GLY A 1 297 ? -32.932 -23.796  -39.591 1.00 51.43  ? 298 GLY A CA  1 
ATOM   2145  C C   . GLY A 1 297 ? -31.788 -24.171  -40.512 1.00 50.80  ? 298 GLY A C   1 
ATOM   2146  O O   . GLY A 1 297 ? -31.526 -25.350  -40.745 1.00 53.32  ? 298 GLY A O   1 
ATOM   2147  N N   . ASP A 1 298 ? -31.112 -23.156  -41.044 1.00 47.58  ? 299 ASP A N   1 
ATOM   2148  C CA  . ASP A 1 298 ? -29.982 -23.358  -41.945 1.00 45.12  ? 299 ASP A CA  1 
ATOM   2149  C C   . ASP A 1 298 ? -28.681 -23.371  -41.150 1.00 41.33  ? 299 ASP A C   1 
ATOM   2150  O O   . ASP A 1 298 ? -27.971 -22.362  -41.080 1.00 38.05  ? 299 ASP A O   1 
ATOM   2151  C CB  . ASP A 1 298 ? -29.950 -22.261  -43.016 1.00 44.21  ? 299 ASP A CB  1 
ATOM   2152  C CG  . ASP A 1 298 ? -28.955 -22.548  -44.128 1.00 45.14  ? 299 ASP A CG  1 
ATOM   2153  O OD1 . ASP A 1 298 ? -28.113 -23.456  -43.969 1.00 46.15  ? 299 ASP A OD1 1 
ATOM   2154  O OD2 . ASP A 1 298 ? -29.007 -21.848  -45.162 1.00 44.54  ? 299 ASP A OD2 1 
ATOM   2155  N N   . TYR A 1 299 ? -28.367 -24.523  -40.563 1.00 42.22  ? 300 TYR A N   1 
ATOM   2156  C CA  . TYR A 1 299 ? -27.211 -24.652  -39.677 1.00 41.45  ? 300 TYR A CA  1 
ATOM   2157  C C   . TYR A 1 299 ? -25.902 -24.625  -40.451 1.00 39.29  ? 300 TYR A C   1 
ATOM   2158  O O   . TYR A 1 299 ? -24.857 -24.267  -39.908 1.00 36.80  ? 300 TYR A O   1 
ATOM   2159  C CB  . TYR A 1 299 ? -27.302 -25.944  -38.864 1.00 45.15  ? 300 TYR A CB  1 
ATOM   2160  C CG  . TYR A 1 299 ? -28.609 -26.105  -38.128 1.00 47.81  ? 300 TYR A CG  1 
ATOM   2161  C CD1 . TYR A 1 299 ? -29.267 -25.006  -37.589 1.00 46.89  ? 300 TYR A CD1 1 
ATOM   2162  C CD2 . TYR A 1 299 ? -29.192 -27.356  -37.981 1.00 51.73  ? 300 TYR A CD2 1 
ATOM   2163  C CE1 . TYR A 1 299 ? -30.470 -25.149  -36.921 1.00 48.97  ? 300 TYR A CE1 1 
ATOM   2164  C CE2 . TYR A 1 299 ? -30.390 -27.511  -37.313 1.00 53.63  ? 300 TYR A CE2 1 
ATOM   2165  C CZ  . TYR A 1 299 ? -31.024 -26.406  -36.786 1.00 52.45  ? 300 TYR A CZ  1 
ATOM   2166  O OH  . TYR A 1 299 ? -32.219 -26.560  -36.122 1.00 54.88  ? 300 TYR A OH  1 
ATOM   2167  N N   . ARG A 1 300 ? -25.964 -25.016  -41.720 1.00 40.04  ? 301 ARG A N   1 
ATOM   2168  C CA  . ARG A 1 300 ? -24.773 -25.046  -42.557 1.00 40.44  ? 301 ARG A CA  1 
ATOM   2169  C C   . ARG A 1 300 ? -24.301 -23.627  -42.861 1.00 37.90  ? 301 ARG A C   1 
ATOM   2170  O O   . ARG A 1 300 ? -23.103 -23.363  -42.892 1.00 36.85  ? 301 ARG A O   1 
ATOM   2171  C CB  . ARG A 1 300 ? -25.040 -25.820  -43.858 1.00 41.95  ? 301 ARG A CB  1 
ATOM   2172  N N   . ALA A 1 301 ? -25.245 -22.717  -43.085 1.00 37.54  ? 302 ALA A N   1 
ATOM   2173  C CA  . ALA A 1 301 ? -24.902 -21.317  -43.313 1.00 36.71  ? 302 ALA A CA  1 
ATOM   2174  C C   . ALA A 1 301 ? -24.472 -20.667  -41.999 1.00 33.51  ? 302 ALA A C   1 
ATOM   2175  O O   . ALA A 1 301 ? -23.504 -19.906  -41.953 1.00 32.56  ? 302 ALA A O   1 
ATOM   2176  C CB  . ALA A 1 301 ? -26.074 -20.564  -43.920 1.00 35.71  ? 302 ALA A CB  1 
ATOM   2177  N N   . PHE A 1 302 ? -25.207 -20.964  -40.935 1.00 33.06  ? 303 PHE A N   1 
ATOM   2178  C CA  . PHE A 1 302 ? -24.854 -20.454  -39.620 1.00 32.37  ? 303 PHE A CA  1 
ATOM   2179  C C   . PHE A 1 302 ? -23.413 -20.845  -39.286 1.00 33.88  ? 303 PHE A C   1 
ATOM   2180  O O   . PHE A 1 302 ? -22.612 -20.001  -38.879 1.00 33.72  ? 303 PHE A O   1 
ATOM   2181  C CB  . PHE A 1 302 ? -25.823 -20.972  -38.556 1.00 32.26  ? 303 PHE A CB  1 
ATOM   2182  C CG  . PHE A 1 302 ? -25.737 -20.224  -37.253 1.00 31.77  ? 303 PHE A CG  1 
ATOM   2183  C CD1 . PHE A 1 302 ? -24.759 -20.536  -36.321 1.00 31.77  ? 303 PHE A CD1 1 
ATOM   2184  C CD2 . PHE A 1 302 ? -26.624 -19.200  -36.968 1.00 31.56  ? 303 PHE A CD2 1 
ATOM   2185  C CE1 . PHE A 1 302 ? -24.667 -19.841  -35.122 1.00 30.92  ? 303 PHE A CE1 1 
ATOM   2186  C CE2 . PHE A 1 302 ? -26.542 -18.500  -35.774 1.00 30.17  ? 303 PHE A CE2 1 
ATOM   2187  C CZ  . PHE A 1 302 ? -25.559 -18.824  -34.847 1.00 30.26  ? 303 PHE A CZ  1 
ATOM   2188  N N   . GLY A 1 303 ? -23.084 -22.118  -39.493 1.00 34.98  ? 304 GLY A N   1 
ATOM   2189  C CA  . GLY A 1 303 ? -21.750 -22.626  -39.218 1.00 35.55  ? 304 GLY A CA  1 
ATOM   2190  C C   . GLY A 1 303 ? -20.669 -21.932  -40.025 1.00 36.11  ? 304 GLY A C   1 
ATOM   2191  O O   . GLY A 1 303 ? -19.612 -21.585  -39.490 1.00 36.06  ? 304 GLY A O   1 
ATOM   2192  N N   . ARG A 1 304 ? -20.938 -21.726  -41.313 1.00 36.24  ? 305 ARG A N   1 
ATOM   2193  C CA  . ARG A 1 304 ? -20.007 -21.027  -42.194 1.00 36.03  ? 305 ARG A CA  1 
ATOM   2194  C C   . ARG A 1 304 ? -19.737 -19.617  -41.689 1.00 31.53  ? 305 ARG A C   1 
ATOM   2195  O O   . ARG A 1 304 ? -18.609 -19.135  -41.743 1.00 34.77  ? 305 ARG A O   1 
ATOM   2196  C CB  . ARG A 1 304 ? -20.551 -20.973  -43.626 1.00 38.79  ? 305 ARG A CB  1 
ATOM   2197  N N   . LEU A 1 305 ? -20.785 -18.962  -41.202 1.00 30.18  ? 306 LEU A N   1 
ATOM   2198  C CA  . LEU A 1 305 ? -20.662 -17.619  -40.648 1.00 31.37  ? 306 LEU A CA  1 
ATOM   2199  C C   . LEU A 1 305 ? -19.847 -17.612  -39.352 1.00 30.61  ? 306 LEU A C   1 
ATOM   2200  O O   . LEU A 1 305 ? -19.117 -16.655  -39.089 1.00 29.03  ? 306 LEU A O   1 
ATOM   2201  C CB  . LEU A 1 305 ? -22.043 -17.015  -40.399 1.00 30.60  ? 306 LEU A CB  1 
ATOM   2202  C CG  . LEU A 1 305 ? -22.863 -16.748  -41.665 1.00 32.26  ? 306 LEU A CG  1 
ATOM   2203  C CD1 . LEU A 1 305 ? -24.294 -16.391  -41.302 1.00 32.45  ? 306 LEU A CD1 1 
ATOM   2204  C CD2 . LEU A 1 305 ? -22.225 -15.645  -42.499 1.00 31.56  ? 306 LEU A CD2 1 
ATOM   2205  N N   . MET A 1 306 ? -19.975 -18.670  -38.548 1.00 31.62  ? 307 MET A N   1 
ATOM   2206  C CA  . MET A 1 306 ? -19.176 -18.793  -37.326 1.00 30.70  ? 307 MET A CA  1 
ATOM   2207  C C   . MET A 1 306 ? -17.694 -18.831  -37.677 1.00 32.51  ? 307 MET A C   1 
ATOM   2208  O O   . MET A 1 306 ? -16.871 -18.220  -36.992 1.00 34.03  ? 307 MET A O   1 
ATOM   2209  C CB  . MET A 1 306 ? -19.548 -20.050  -36.530 1.00 30.98  ? 307 MET A CB  1 
ATOM   2210  C CG  . MET A 1 306 ? -20.934 -20.031  -35.913 1.00 30.22  ? 307 MET A CG  1 
ATOM   2211  S SD  . MET A 1 306 ? -21.351 -21.626  -35.190 1.00 33.57  ? 307 MET A SD  1 
ATOM   2212  C CE  . MET A 1 306 ? -20.191 -21.689  -33.816 1.00 28.39  ? 307 MET A CE  1 
ATOM   2213  N N   . VAL A 1 307 ? -17.368 -19.550  -38.750 1.00 32.53  ? 308 VAL A N   1 
ATOM   2214  C CA  . VAL A 1 307 ? -15.989 -19.702  -39.195 1.00 33.71  ? 308 VAL A CA  1 
ATOM   2215  C C   . VAL A 1 307 ? -15.424 -18.369  -39.678 1.00 34.62  ? 308 VAL A C   1 
ATOM   2216  O O   . VAL A 1 307 ? -14.266 -18.049  -39.415 1.00 36.50  ? 308 VAL A O   1 
ATOM   2217  C CB  . VAL A 1 307 ? -15.870 -20.750  -40.327 1.00 33.00  ? 308 VAL A CB  1 
ATOM   2218  C CG1 . VAL A 1 307 ? -14.423 -20.878  -40.791 1.00 34.71  ? 308 VAL A CG1 1 
ATOM   2219  C CG2 . VAL A 1 307 ? -16.396 -22.102  -39.867 1.00 36.86  ? 308 VAL A CG2 1 
ATOM   2220  N N   . GLU A 1 308 ? -16.243 -17.595  -40.383 1.00 33.94  ? 309 GLU A N   1 
ATOM   2221  C CA  . GLU A 1 308 ? -15.821 -16.285  -40.867 1.00 35.61  ? 309 GLU A CA  1 
ATOM   2222  C C   . GLU A 1 308 ? -15.595 -15.351  -39.675 1.00 33.51  ? 309 GLU A C   1 
ATOM   2223  O O   . GLU A 1 308 ? -14.668 -14.539  -39.669 1.00 33.56  ? 309 GLU A O   1 
ATOM   2224  C CB  . GLU A 1 308 ? -16.859 -15.701  -41.841 1.00 38.56  ? 309 GLU A CB  1 
ATOM   2225  C CG  . GLU A 1 308 ? -16.983 -16.455  -43.169 1.00 44.55  ? 309 GLU A CG  1 
ATOM   2226  C CD  . GLU A 1 308 ? -18.153 -15.971  -44.029 1.00 48.96  ? 309 GLU A CD  1 
ATOM   2227  O OE1 . GLU A 1 308 ? -18.740 -14.910  -43.714 1.00 48.94  ? 309 GLU A OE1 1 
ATOM   2228  O OE2 . GLU A 1 308 ? -18.484 -16.651  -45.027 1.00 52.17  ? 309 GLU A OE2 1 
ATOM   2229  N N   . SER A 1 309 ? -16.438 -15.491  -38.658 1.00 31.20  ? 310 SER A N   1 
ATOM   2230  C CA  . SER A 1 309 ? -16.287 -14.728  -37.423 1.00 29.39  ? 310 SER A CA  1 
ATOM   2231  C C   . SER A 1 309 ? -14.943 -15.013  -36.746 1.00 30.03  ? 310 SER A C   1 
ATOM   2232  O O   . SER A 1 309 ? -14.253 -14.093  -36.323 1.00 27.84  ? 310 SER A O   1 
ATOM   2233  C CB  . SER A 1 309 ? -17.434 -15.038  -36.462 1.00 29.03  ? 310 SER A CB  1 
ATOM   2234  O OG  . SER A 1 309 ? -17.196 -14.469  -35.184 1.00 29.63  ? 310 SER A OG  1 
ATOM   2235  N N   . HIS A 1 310 ? -14.563 -16.285  -36.661 1.00 31.97  ? 311 HIS A N   1 
ATOM   2236  C CA  . HIS A 1 310 ? -13.289 -16.631  -36.042 1.00 33.29  ? 311 HIS A CA  1 
ATOM   2237  C C   . HIS A 1 310 ? -12.095 -16.101  -36.829 1.00 35.42  ? 311 HIS A C   1 
ATOM   2238  O O   . HIS A 1 310 ? -11.163 -15.538  -36.251 1.00 36.48  ? 311 HIS A O   1 
ATOM   2239  C CB  . HIS A 1 310 ? -13.138 -18.140  -35.875 1.00 34.14  ? 311 HIS A CB  1 
ATOM   2240  C CG  . HIS A 1 310 ? -11.904 -18.521  -35.114 1.00 36.39  ? 311 HIS A CG  1 
ATOM   2241  N ND1 . HIS A 1 310 ? -11.806 -18.390  -33.748 1.00 37.27  ? 311 HIS A ND1 1 
ATOM   2242  C CD2 . HIS A 1 310 ? -10.703 -18.984  -35.537 1.00 38.59  ? 311 HIS A CD2 1 
ATOM   2243  C CE1 . HIS A 1 310 ? -10.604 -18.777  -33.354 1.00 39.64  ? 311 HIS A CE1 1 
ATOM   2244  N NE2 . HIS A 1 310 ? -9.916  -19.141  -34.421 1.00 40.41  ? 311 HIS A NE2 1 
ATOM   2245  N N   . ARG A 1 311 ? -12.122 -16.294  -38.143 1.00 36.22  ? 312 ARG A N   1 
ATOM   2246  C CA  . ARG A 1 311 ? -11.036 -15.835  -39.000 1.00 37.41  ? 312 ARG A CA  1 
ATOM   2247  C C   . ARG A 1 311 ? -10.862 -14.324  -38.881 1.00 36.68  ? 312 ARG A C   1 
ATOM   2248  O O   . ARG A 1 311 ? -9.743  -13.813  -38.865 1.00 37.65  ? 312 ARG A O   1 
ATOM   2249  C CB  . ARG A 1 311 ? -11.299 -16.229  -40.457 1.00 38.01  ? 312 ARG A CB  1 
ATOM   2250  N N   . SER A 1 312 ? -11.984 -13.619  -38.789 1.00 35.03  ? 313 SER A N   1 
ATOM   2251  C CA  . SER A 1 312 ? -11.973 -12.175  -38.644 1.00 34.89  ? 313 SER A CA  1 
ATOM   2252  C C   . SER A 1 312 ? -11.351 -11.795  -37.301 1.00 32.48  ? 313 SER A C   1 
ATOM   2253  O O   . SER A 1 312 ? -10.485 -10.924  -37.233 1.00 32.88  ? 313 SER A O   1 
ATOM   2254  C CB  . SER A 1 312 ? -13.393 -11.618  -38.767 1.00 35.36  ? 313 SER A CB  1 
ATOM   2255  O OG  . SER A 1 312 ? -13.408 -10.208  -38.645 1.00 36.56  ? 313 SER A OG  1 
ATOM   2256  N N   . LEU A 1 313 ? -11.791 -12.470  -36.244 1.00 31.31  ? 314 LEU A N   1 
ATOM   2257  C CA  . LEU A 1 313 ? -11.268 -12.247  -34.895 1.00 31.38  ? 314 LEU A CA  1 
ATOM   2258  C C   . LEU A 1 313 ? -9.782  -12.572  -34.806 1.00 34.32  ? 314 LEU A C   1 
ATOM   2259  O O   . LEU A 1 313 ? -9.030  -11.910  -34.086 1.00 35.41  ? 314 LEU A O   1 
ATOM   2260  C CB  . LEU A 1 313 ? -12.044 -13.088  -33.877 1.00 29.12  ? 314 LEU A CB  1 
ATOM   2261  C CG  . LEU A 1 313 ? -13.464 -12.612  -33.566 1.00 28.38  ? 314 LEU A CG  1 
ATOM   2262  C CD1 . LEU A 1 313 ? -14.264 -13.729  -32.921 1.00 28.17  ? 314 LEU A CD1 1 
ATOM   2263  C CD2 . LEU A 1 313 ? -13.413 -11.393  -32.657 1.00 28.12  ? 314 LEU A CD2 1 
ATOM   2264  N N   . ARG A 1 314 ? -9.371  -13.599  -35.541 1.00 35.41  ? 315 ARG A N   1 
ATOM   2265  C CA  . ARG A 1 314 ? -7.988  -14.054  -35.531 1.00 37.72  ? 315 ARG A CA  1 
ATOM   2266  C C   . ARG A 1 314 ? -7.076  -13.108  -36.308 1.00 39.41  ? 315 ARG A C   1 
ATOM   2267  O O   . ARG A 1 314 ? -5.966  -12.802  -35.873 1.00 41.07  ? 315 ARG A O   1 
ATOM   2268  C CB  . ARG A 1 314 ? -7.893  -15.469  -36.118 1.00 38.95  ? 315 ARG A CB  1 
ATOM   2269  C CG  . ARG A 1 314 ? -6.501  -16.083  -36.088 1.00 42.01  ? 315 ARG A CG  1 
ATOM   2270  C CD  . ARG A 1 314 ? -6.447  -17.334  -36.960 1.00 44.56  ? 315 ARG A CD  1 
ATOM   2271  N NE  . ARG A 1 314 ? -6.870  -17.040  -38.327 1.00 45.82  ? 315 ARG A NE  1 
ATOM   2272  C CZ  . ARG A 1 314 ? -7.218  -17.958  -39.224 1.00 47.38  ? 315 ARG A CZ  1 
ATOM   2273  N NH1 . ARG A 1 314 ? -7.202  -19.246  -38.906 1.00 49.03  ? 315 ARG A NH1 1 
ATOM   2274  N NH2 . ARG A 1 314 ? -7.589  -17.585  -40.440 1.00 47.18  ? 315 ARG A NH2 1 
ATOM   2275  N N   . ASP A 1 315 ? -7.552  -12.637  -37.455 1.00 39.42  ? 316 ASP A N   1 
ATOM   2276  C CA  . ASP A 1 315 ? -6.680  -11.943  -38.396 1.00 40.43  ? 316 ASP A CA  1 
ATOM   2277  C C   . ASP A 1 315 ? -6.834  -10.426  -38.393 1.00 38.50  ? 316 ASP A C   1 
ATOM   2278  O O   . ASP A 1 315 ? -5.857  -9.706   -38.587 1.00 39.45  ? 316 ASP A O   1 
ATOM   2279  C CB  . ASP A 1 315 ? -6.914  -12.485  -39.808 1.00 41.98  ? 316 ASP A CB  1 
ATOM   2280  C CG  . ASP A 1 315 ? -6.568  -13.956  -39.924 1.00 45.13  ? 316 ASP A CG  1 
ATOM   2281  O OD1 . ASP A 1 315 ? -5.855  -14.465  -39.031 1.00 45.91  ? 316 ASP A OD1 1 
ATOM   2282  O OD2 . ASP A 1 315 ? -7.002  -14.604  -40.900 1.00 47.02  ? 316 ASP A OD2 1 
ATOM   2283  N N   . ASP A 1 316 ? -8.049  -9.935   -38.179 1.00 35.69  ? 317 ASP A N   1 
ATOM   2284  C CA  . ASP A 1 316 ? -8.276  -8.494   -38.193 1.00 36.66  ? 317 ASP A CA  1 
ATOM   2285  C C   . ASP A 1 316 ? -8.313  -7.903   -36.786 1.00 37.73  ? 317 ASP A C   1 
ATOM   2286  O O   . ASP A 1 316 ? -7.623  -6.927   -36.501 1.00 38.82  ? 317 ASP A O   1 
ATOM   2287  C CB  . ASP A 1 316 ? -9.571  -8.155   -38.938 1.00 35.69  ? 317 ASP A CB  1 
ATOM   2288  C CG  . ASP A 1 316 ? -9.353  -7.977   -40.439 1.00 37.79  ? 317 ASP A CG  1 
ATOM   2289  O OD1 . ASP A 1 316 ? -8.194  -7.768   -40.857 1.00 39.77  ? 317 ASP A OD1 1 
ATOM   2290  O OD2 . ASP A 1 316 ? -10.341 -8.037   -41.198 1.00 37.14  ? 317 ASP A OD2 1 
ATOM   2291  N N   . TYR A 1 317 ? -9.116  -8.493   -35.907 1.00 37.73  ? 318 TYR A N   1 
ATOM   2292  C CA  . TYR A 1 317 ? -9.238  -7.975   -34.546 1.00 37.61  ? 318 TYR A CA  1 
ATOM   2293  C C   . TYR A 1 317 ? -8.084  -8.469   -33.676 1.00 39.99  ? 318 TYR A C   1 
ATOM   2294  O O   . TYR A 1 317 ? -7.740  -7.841   -32.675 1.00 41.68  ? 318 TYR A O   1 
ATOM   2295  C CB  . TYR A 1 317 ? -10.587 -8.370   -33.939 1.00 34.74  ? 318 TYR A CB  1 
ATOM   2296  C CG  . TYR A 1 317 ? -11.202 -7.272   -33.104 1.00 34.29  ? 318 TYR A CG  1 
ATOM   2297  C CD1 . TYR A 1 317 ? -11.641 -6.091   -33.693 1.00 33.69  ? 318 TYR A CD1 1 
ATOM   2298  C CD2 . TYR A 1 317 ? -11.338 -7.409   -31.728 1.00 32.97  ? 318 TYR A CD2 1 
ATOM   2299  C CE1 . TYR A 1 317 ? -12.197 -5.077   -32.934 1.00 33.21  ? 318 TYR A CE1 1 
ATOM   2300  C CE2 . TYR A 1 317 ? -11.894 -6.400   -30.962 1.00 32.72  ? 318 TYR A CE2 1 
ATOM   2301  C CZ  . TYR A 1 317 ? -12.324 -5.238   -31.568 1.00 33.16  ? 318 TYR A CZ  1 
ATOM   2302  O OH  . TYR A 1 317 ? -12.880 -4.234   -30.805 1.00 33.35  ? 318 TYR A OH  1 
ATOM   2303  N N   . GLU A 1 318 ? -7.489  -9.591   -34.078 1.00 41.28  ? 319 GLU A N   1 
ATOM   2304  C CA  . GLU A 1 318 ? -6.323  -10.170  -33.409 1.00 42.73  ? 319 GLU A CA  1 
ATOM   2305  C C   . GLU A 1 318 ? -6.535  -10.373  -31.914 1.00 41.98  ? 319 GLU A C   1 
ATOM   2306  O O   . GLU A 1 318 ? -5.758  -9.880   -31.095 1.00 42.88  ? 319 GLU A O   1 
ATOM   2307  C CB  . GLU A 1 318 ? -5.087  -9.295   -33.639 1.00 45.07  ? 319 GLU A CB  1 
ATOM   2308  C CG  . GLU A 1 318 ? -4.737  -9.088   -35.107 1.00 47.07  ? 319 GLU A CG  1 
ATOM   2309  C CD  . GLU A 1 318 ? -3.442  -8.323   -35.287 1.00 49.39  ? 319 GLU A CD  1 
ATOM   2310  O OE1 . GLU A 1 318 ? -2.377  -8.971   -35.352 1.00 51.80  ? 319 GLU A OE1 1 
ATOM   2311  O OE2 . GLU A 1 318 ? -3.487  -7.076   -35.356 1.00 48.77  ? 319 GLU A OE2 1 
ATOM   2312  N N   . VAL A 1 319 ? -7.588  -11.102  -31.560 1.00 40.00  ? 320 VAL A N   1 
ATOM   2313  C CA  . VAL A 1 319 ? -7.856  -11.395  -30.160 1.00 38.70  ? 320 VAL A CA  1 
ATOM   2314  C C   . VAL A 1 319 ? -7.960  -12.896  -29.916 1.00 39.20  ? 320 VAL A C   1 
ATOM   2315  O O   . VAL A 1 319 ? -8.417  -13.331  -28.864 1.00 39.16  ? 320 VAL A O   1 
ATOM   2316  C CB  . VAL A 1 319 ? -9.139  -10.705  -29.675 1.00 36.22  ? 320 VAL A CB  1 
ATOM   2317  C CG1 . VAL A 1 319 ? -8.977  -9.197   -29.745 1.00 35.84  ? 320 VAL A CG1 1 
ATOM   2318  C CG2 . VAL A 1 319 ? -10.339 -11.162  -30.495 1.00 35.13  ? 320 VAL A CG2 1 
ATOM   2319  N N   . SER A 1 320 ? -7.529  -13.687  -30.892 1.00 40.13  ? 321 SER A N   1 
ATOM   2320  C CA  . SER A 1 320 ? -7.430  -15.129  -30.701 1.00 40.39  ? 321 SER A CA  1 
ATOM   2321  C C   . SER A 1 320 ? -6.054  -15.472  -30.143 1.00 42.76  ? 321 SER A C   1 
ATOM   2322  O O   . SER A 1 320 ? -5.303  -14.582  -29.741 1.00 44.78  ? 321 SER A O   1 
ATOM   2323  C CB  . SER A 1 320 ? -7.676  -15.877  -32.010 1.00 38.40  ? 321 SER A CB  1 
ATOM   2324  O OG  . SER A 1 320 ? -7.803  -17.267  -31.775 1.00 37.65  ? 321 SER A OG  1 
ATOM   2325  N N   . CYS A 1 321 ? -5.735  -16.763  -30.113 1.00 41.80  ? 322 CYS A N   1 
ATOM   2326  C CA  . CYS A 1 321 ? -4.433  -17.234  -29.657 1.00 43.95  ? 322 CYS A CA  1 
ATOM   2327  C C   . CYS A 1 321 ? -4.229  -18.651  -30.187 1.00 45.26  ? 322 CYS A C   1 
ATOM   2328  O O   . CYS A 1 321 ? -5.205  -19.306  -30.558 1.00 45.31  ? 322 CYS A O   1 
ATOM   2329  C CB  . CYS A 1 321 ? -4.338  -17.183  -28.122 1.00 44.23  ? 322 CYS A CB  1 
ATOM   2330  S SG  . CYS A 1 321 ? -5.492  -18.248  -27.233 1.00 45.69  ? 322 CYS A SG  1 
ATOM   2331  N N   . PRO A 1 322 ? -2.966  -19.120  -30.249 1.00 45.94  ? 323 PRO A N   1 
ATOM   2332  C CA  . PRO A 1 322 ? -2.659  -20.460  -30.768 1.00 45.67  ? 323 PRO A CA  1 
ATOM   2333  C C   . PRO A 1 322 ? -3.510  -21.575  -30.166 1.00 45.07  ? 323 PRO A C   1 
ATOM   2334  O O   . PRO A 1 322 ? -3.843  -22.533  -30.865 1.00 45.67  ? 323 PRO A O   1 
ATOM   2335  C CB  . PRO A 1 322 ? -1.188  -20.647  -30.391 1.00 47.53  ? 323 PRO A CB  1 
ATOM   2336  C CG  . PRO A 1 322 ? -0.634  -19.269  -30.407 1.00 47.78  ? 323 PRO A CG  1 
ATOM   2337  C CD  . PRO A 1 322 ? -1.737  -18.374  -29.914 1.00 46.97  ? 323 PRO A CD  1 
ATOM   2338  N N   . GLU A 1 323 ? -3.857  -21.451  -28.890 1.00 44.40  ? 324 GLU A N   1 
ATOM   2339  C CA  . GLU A 1 323 ? -4.700  -22.445  -28.240 1.00 44.42  ? 324 GLU A CA  1 
ATOM   2340  C C   . GLU A 1 323 ? -6.096  -22.464  -28.867 1.00 42.92  ? 324 GLU A C   1 
ATOM   2341  O O   . GLU A 1 323 ? -6.580  -23.517  -29.282 1.00 43.67  ? 324 GLU A O   1 
ATOM   2342  C CB  . GLU A 1 323 ? -4.794  -22.177  -26.734 1.00 44.47  ? 324 GLU A CB  1 
ATOM   2343  C CG  . GLU A 1 323 ? -3.487  -22.405  -25.973 1.00 46.67  ? 324 GLU A CG  1 
ATOM   2344  C CD  . GLU A 1 323 ? -2.536  -21.220  -26.058 1.00 48.60  ? 324 GLU A CD  1 
ATOM   2345  O OE1 . GLU A 1 323 ? -2.960  -20.139  -26.524 1.00 47.71  ? 324 GLU A OE1 1 
ATOM   2346  O OE2 . GLU A 1 323 ? -1.362  -21.371  -25.658 1.00 50.46  ? 324 GLU A OE2 1 
ATOM   2347  N N   . LEU A 1 324 ? -6.732  -21.298  -28.938 1.00 41.15  ? 325 LEU A N   1 
ATOM   2348  C CA  . LEU A 1 324 ? -8.066  -21.184  -29.527 1.00 39.99  ? 325 LEU A CA  1 
ATOM   2349  C C   . LEU A 1 324 ? -8.064  -21.614  -30.988 1.00 40.36  ? 325 LEU A C   1 
ATOM   2350  O O   . LEU A 1 324 ? -8.975  -22.306  -31.440 1.00 40.85  ? 325 LEU A O   1 
ATOM   2351  C CB  . LEU A 1 324 ? -8.593  -19.752  -29.409 1.00 38.42  ? 325 LEU A CB  1 
ATOM   2352  C CG  . LEU A 1 324 ? -8.979  -19.237  -28.019 1.00 37.69  ? 325 LEU A CG  1 
ATOM   2353  C CD1 . LEU A 1 324 ? -9.247  -17.735  -28.052 1.00 35.65  ? 325 LEU A CD1 1 
ATOM   2354  C CD2 . LEU A 1 324 ? -10.195 -19.984  -27.485 1.00 37.43  ? 325 LEU A CD2 1 
ATOM   2355  N N   . ASP A 1 325 ? -7.034  -21.205  -31.721 1.00 40.38  ? 326 ASP A N   1 
ATOM   2356  C CA  . ASP A 1 325 ? -6.950  -21.515  -33.143 1.00 41.16  ? 326 ASP A CA  1 
ATOM   2357  C C   . ASP A 1 325 ? -6.839  -23.018  -33.376 1.00 41.94  ? 326 ASP A C   1 
ATOM   2358  O O   . ASP A 1 325 ? -7.485  -23.565  -34.276 1.00 40.86  ? 326 ASP A O   1 
ATOM   2359  C CB  . ASP A 1 325 ? -5.763  -20.794  -33.784 1.00 42.29  ? 326 ASP A CB  1 
ATOM   2360  C CG  . ASP A 1 325 ? -5.977  -19.293  -33.888 1.00 41.90  ? 326 ASP A CG  1 
ATOM   2361  O OD1 . ASP A 1 325 ? -7.134  -18.836  -33.748 1.00 39.91  ? 326 ASP A OD1 1 
ATOM   2362  O OD2 . ASP A 1 325 ? -4.986  -18.570  -34.121 1.00 43.21  ? 326 ASP A OD2 1 
ATOM   2363  N N   . GLN A 1 326 ? -6.019  -23.682  -32.564 1.00 43.19  ? 327 GLN A N   1 
ATOM   2364  C CA  . GLN A 1 326 ? -5.847  -25.126  -32.673 1.00 44.48  ? 327 GLN A CA  1 
ATOM   2365  C C   . GLN A 1 326 ? -7.137  -25.853  -32.305 1.00 43.62  ? 327 GLN A C   1 
ATOM   2366  O O   . GLN A 1 326 ? -7.447  -26.901  -32.867 1.00 44.23  ? 327 GLN A O   1 
ATOM   2367  C CB  . GLN A 1 326 ? -4.697  -25.607  -31.786 1.00 45.18  ? 327 GLN A CB  1 
ATOM   2368  N N   . LEU A 1 327 ? -7.887  -25.295  -31.360 1.00 41.74  ? 328 LEU A N   1 
ATOM   2369  C CA  . LEU A 1 327 ? -9.172  -25.871  -30.985 1.00 40.37  ? 328 LEU A CA  1 
ATOM   2370  C C   . LEU A 1 327 ? -10.185 -25.744  -32.116 1.00 38.85  ? 328 LEU A C   1 
ATOM   2371  O O   . LEU A 1 327 ? -10.957 -26.665  -32.378 1.00 38.11  ? 328 LEU A O   1 
ATOM   2372  C CB  . LEU A 1 327 ? -9.716  -25.202  -29.726 1.00 39.85  ? 328 LEU A CB  1 
ATOM   2373  C CG  . LEU A 1 327 ? -9.037  -25.608  -28.419 1.00 41.36  ? 328 LEU A CG  1 
ATOM   2374  C CD1 . LEU A 1 327 ? -9.665  -24.873  -27.250 1.00 40.10  ? 328 LEU A CD1 1 
ATOM   2375  C CD2 . LEU A 1 327 ? -9.125  -27.115  -28.229 1.00 42.78  ? 328 LEU A CD2 1 
ATOM   2376  N N   . VAL A 1 328 ? -10.182 -24.592  -32.777 1.00 38.15  ? 329 VAL A N   1 
ATOM   2377  C CA  . VAL A 1 328 ? -11.093 -24.354  -33.889 1.00 38.17  ? 329 VAL A CA  1 
ATOM   2378  C C   . VAL A 1 328 ? -10.744 -25.240  -35.078 1.00 39.87  ? 329 VAL A C   1 
ATOM   2379  O O   . VAL A 1 328 ? -11.612 -25.930  -35.619 1.00 40.40  ? 329 VAL A O   1 
ATOM   2380  C CB  . VAL A 1 328 ? -11.076 -22.875  -34.326 1.00 37.17  ? 329 VAL A CB  1 
ATOM   2381  C CG1 . VAL A 1 328 ? -11.804 -22.701  -35.662 1.00 35.78  ? 329 VAL A CG1 1 
ATOM   2382  C CG2 . VAL A 1 328 ? -11.704 -22.008  -33.249 1.00 33.44  ? 329 VAL A CG2 1 
ATOM   2383  N N   . GLU A 1 329 ? -9.474  -25.227  -35.474 1.00 41.16  ? 330 GLU A N   1 
ATOM   2384  C CA  . GLU A 1 329 ? -9.029  -26.006  -36.625 1.00 44.00  ? 330 GLU A CA  1 
ATOM   2385  C C   . GLU A 1 329 ? -9.332  -27.491  -36.426 1.00 46.18  ? 330 GLU A C   1 
ATOM   2386  O O   . GLU A 1 329 ? -9.731  -28.179  -37.363 1.00 46.55  ? 330 GLU A O   1 
ATOM   2387  C CB  . GLU A 1 329 ? -7.533  -25.795  -36.879 1.00 44.41  ? 330 GLU A CB  1 
ATOM   2388  N N   . ALA A 1 330 ? -9.166  -27.969  -35.195 1.00 47.05  ? 331 ALA A N   1 
ATOM   2389  C CA  . ALA A 1 330 ? -9.439  -29.366  -34.877 1.00 47.67  ? 331 ALA A CA  1 
ATOM   2390  C C   . ALA A 1 330 ? -10.919 -29.698  -35.048 1.00 46.43  ? 331 ALA A C   1 
ATOM   2391  O O   . ALA A 1 330 ? -11.270 -30.719  -35.644 1.00 48.27  ? 331 ALA A O   1 
ATOM   2392  C CB  . ALA A 1 330 ? -8.990  -29.683  -33.463 1.00 47.81  ? 331 ALA A CB  1 
ATOM   2393  N N   . ALA A 1 331 ? -11.778 -28.828  -34.527 1.00 42.92  ? 332 ALA A N   1 
ATOM   2394  C CA  . ALA A 1 331 ? -13.222 -29.033  -34.582 1.00 41.37  ? 332 ALA A CA  1 
ATOM   2395  C C   . ALA A 1 331 ? -13.758 -29.050  -36.017 1.00 42.07  ? 332 ALA A C   1 
ATOM   2396  O O   . ALA A 1 331 ? -14.671 -29.814  -36.338 1.00 42.46  ? 332 ALA A O   1 
ATOM   2397  C CB  . ALA A 1 331 ? -13.929 -27.959  -33.775 1.00 39.31  ? 332 ALA A CB  1 
ATOM   2398  N N   . LEU A 1 332 ? -13.189 -28.206  -36.874 1.00 41.53  ? 333 LEU A N   1 
ATOM   2399  C CA  . LEU A 1 332 ? -13.643 -28.093  -38.257 1.00 41.86  ? 333 LEU A CA  1 
ATOM   2400  C C   . LEU A 1 332 ? -13.255 -29.318  -39.081 1.00 43.52  ? 333 LEU A C   1 
ATOM   2401  O O   . LEU A 1 332 ? -13.768 -29.521  -40.181 1.00 45.40  ? 333 LEU A O   1 
ATOM   2402  C CB  . LEU A 1 332 ? -13.078 -26.825  -38.901 1.00 41.61  ? 333 LEU A CB  1 
ATOM   2403  C CG  . LEU A 1 332 ? -13.608 -25.511  -38.318 1.00 41.10  ? 333 LEU A CG  1 
ATOM   2404  C CD1 . LEU A 1 332 ? -12.900 -24.311  -38.929 1.00 41.38  ? 333 LEU A CD1 1 
ATOM   2405  C CD2 . LEU A 1 332 ? -15.115 -25.402  -38.511 1.00 39.95  ? 333 LEU A CD2 1 
ATOM   2406  N N   . ALA A 1 333 ? -12.355 -30.132  -38.540 1.00 44.14  ? 334 ALA A N   1 
ATOM   2407  C CA  . ALA A 1 333 ? -11.900 -31.342  -39.218 1.00 46.27  ? 334 ALA A CA  1 
ATOM   2408  C C   . ALA A 1 333 ? -12.810 -32.523  -38.908 1.00 47.54  ? 334 ALA A C   1 
ATOM   2409  O O   . ALA A 1 333 ? -12.647 -33.604  -39.462 1.00 49.76  ? 334 ALA A O   1 
ATOM   2410  C CB  . ALA A 1 333 ? -10.465 -31.663  -38.823 1.00 46.58  ? 334 ALA A CB  1 
ATOM   2411  N N   . VAL A 1 334 ? -13.772 -32.305  -38.021 1.00 47.08  ? 335 VAL A N   1 
ATOM   2412  C CA  . VAL A 1 334 ? -14.664 -33.367  -37.577 1.00 47.62  ? 335 VAL A CA  1 
ATOM   2413  C C   . VAL A 1 334 ? -15.955 -33.384  -38.388 1.00 46.62  ? 335 VAL A C   1 
ATOM   2414  O O   . VAL A 1 334 ? -16.618 -32.355  -38.519 1.00 45.54  ? 335 VAL A O   1 
ATOM   2415  C CB  . VAL A 1 334 ? -14.998 -33.213  -36.080 1.00 47.27  ? 335 VAL A CB  1 
ATOM   2416  C CG1 . VAL A 1 334 ? -15.966 -34.297  -35.625 1.00 48.42  ? 335 VAL A CG1 1 
ATOM   2417  C CG2 . VAL A 1 334 ? -13.723 -33.247  -35.256 1.00 48.35  ? 335 VAL A CG2 1 
ATOM   2418  N N   . PRO A 1 335 ? -16.311 -34.553  -38.945 1.00 47.51  ? 336 PRO A N   1 
ATOM   2419  C CA  . PRO A 1 335 ? -17.554 -34.690  -39.713 1.00 47.21  ? 336 PRO A CA  1 
ATOM   2420  C C   . PRO A 1 335 ? -18.781 -34.415  -38.849 1.00 45.98  ? 336 PRO A C   1 
ATOM   2421  O O   . PRO A 1 335 ? -18.853 -34.894  -37.718 1.00 46.09  ? 336 PRO A O   1 
ATOM   2422  C CB  . PRO A 1 335 ? -17.533 -36.155  -40.176 1.00 49.19  ? 336 PRO A CB  1 
ATOM   2423  C CG  . PRO A 1 335 ? -16.107 -36.592  -40.041 1.00 50.48  ? 336 PRO A CG  1 
ATOM   2424  C CD  . PRO A 1 335 ? -15.548 -35.812  -38.893 1.00 49.19  ? 336 PRO A CD  1 
ATOM   2425  N N   . GLY A 1 336 ? -19.734 -33.654  -39.376 1.00 45.03  ? 337 GLY A N   1 
ATOM   2426  C CA  . GLY A 1 336 ? -20.935 -33.328  -38.631 1.00 44.62  ? 337 GLY A CA  1 
ATOM   2427  C C   . GLY A 1 336 ? -20.856 -31.975  -37.946 1.00 43.74  ? 337 GLY A C   1 
ATOM   2428  O O   . GLY A 1 336 ? -21.855 -31.472  -37.428 1.00 43.79  ? 337 GLY A O   1 
ATOM   2429  N N   . VAL A 1 337 ? -19.668 -31.381  -37.938 1.00 43.02  ? 338 VAL A N   1 
ATOM   2430  C CA  . VAL A 1 337 ? -19.503 -30.039  -37.391 1.00 41.58  ? 338 VAL A CA  1 
ATOM   2431  C C   . VAL A 1 337 ? -19.864 -28.989  -38.445 1.00 39.55  ? 338 VAL A C   1 
ATOM   2432  O O   . VAL A 1 337 ? -19.315 -28.989  -39.548 1.00 38.40  ? 338 VAL A O   1 
ATOM   2433  C CB  . VAL A 1 337 ? -18.061 -29.802  -36.884 1.00 42.26  ? 338 VAL A CB  1 
ATOM   2434  C CG1 . VAL A 1 337 ? -17.831 -28.326  -36.586 1.00 40.33  ? 338 VAL A CG1 1 
ATOM   2435  C CG2 . VAL A 1 337 ? -17.789 -30.650  -35.645 1.00 43.62  ? 338 VAL A CG2 1 
ATOM   2436  N N   . TYR A 1 338 ? -20.799 -28.108  -38.098 1.00 37.89  ? 339 TYR A N   1 
ATOM   2437  C CA  . TYR A 1 338 ? -21.220 -27.028  -38.985 1.00 36.28  ? 339 TYR A CA  1 
ATOM   2438  C C   . TYR A 1 338 ? -20.244 -25.866  -38.951 1.00 34.15  ? 339 TYR A C   1 
ATOM   2439  O O   . TYR A 1 338 ? -19.888 -25.316  -39.988 1.00 33.42  ? 339 TYR A O   1 
ATOM   2440  C CB  . TYR A 1 338 ? -22.613 -26.530  -38.608 1.00 37.35  ? 339 TYR A CB  1 
ATOM   2441  C CG  . TYR A 1 338 ? -23.702 -27.554  -38.806 1.00 41.49  ? 339 TYR A CG  1 
ATOM   2442  C CD1 . TYR A 1 338 ? -24.095 -27.942  -40.084 1.00 42.90  ? 339 TYR A CD1 1 
ATOM   2443  C CD2 . TYR A 1 338 ? -24.342 -28.131  -37.719 1.00 42.66  ? 339 TYR A CD2 1 
ATOM   2444  C CE1 . TYR A 1 338 ? -25.092 -28.883  -40.268 1.00 44.51  ? 339 TYR A CE1 1 
ATOM   2445  C CE2 . TYR A 1 338 ? -25.340 -29.069  -37.893 1.00 43.95  ? 339 TYR A CE2 1 
ATOM   2446  C CZ  . TYR A 1 338 ? -25.711 -29.443  -39.168 1.00 45.11  ? 339 TYR A CZ  1 
ATOM   2447  O OH  . TYR A 1 338 ? -26.709 -30.376  -39.339 1.00 46.80  ? 339 TYR A OH  1 
ATOM   2448  N N   . GLY A 1 339 ? -19.817 -25.488  -37.751 1.00 33.67  ? 340 GLY A N   1 
ATOM   2449  C CA  . GLY A 1 339 ? -18.888 -24.387  -37.603 1.00 33.02  ? 340 GLY A CA  1 
ATOM   2450  C C   . GLY A 1 339 ? -18.300 -24.328  -36.208 1.00 34.65  ? 340 GLY A C   1 
ATOM   2451  O O   . GLY A 1 339 ? -18.807 -24.958  -35.279 1.00 31.72  ? 340 GLY A O   1 
ATOM   2452  N N   . SER A 1 340 ? -17.217 -23.572  -36.067 1.00 35.72  ? 341 SER A N   1 
ATOM   2453  C CA  . SER A 1 340 ? -16.564 -23.404  -34.776 1.00 36.45  ? 341 SER A CA  1 
ATOM   2454  C C   . SER A 1 340 ? -15.825 -22.075  -34.752 1.00 35.88  ? 341 SER A C   1 
ATOM   2455  O O   . SER A 1 340 ? -15.361 -21.598  -35.788 1.00 36.77  ? 341 SER A O   1 
ATOM   2456  C CB  . SER A 1 340 ? -15.607 -24.562  -34.493 1.00 38.12  ? 341 SER A CB  1 
ATOM   2457  O OG  . SER A 1 340 ? -15.155 -24.534  -33.148 1.00 38.46  ? 341 SER A OG  1 
ATOM   2458  N N   . ARG A 1 341 ? -15.727 -21.481  -33.567 1.00 33.62  ? 342 ARG A N   1 
ATOM   2459  C CA  . ARG A 1 341 ? -15.123 -20.166  -33.403 1.00 32.74  ? 342 ARG A CA  1 
ATOM   2460  C C   . ARG A 1 341 ? -14.809 -19.907  -31.934 1.00 32.88  ? 342 ARG A C   1 
ATOM   2461  O O   . ARG A 1 341 ? -15.483 -20.443  -31.054 1.00 32.77  ? 342 ARG A O   1 
ATOM   2462  C CB  . ARG A 1 341 ? -16.062 -19.075  -33.929 1.00 31.59  ? 342 ARG A CB  1 
ATOM   2463  C CG  . ARG A 1 341 ? -17.437 -19.090  -33.260 1.00 32.17  ? 342 ARG A CG  1 
ATOM   2464  C CD  . ARG A 1 341 ? -18.335 -17.948  -33.723 1.00 34.08  ? 342 ARG A CD  1 
ATOM   2465  N NE  . ARG A 1 341 ? -17.777 -16.648  -33.377 1.00 37.37  ? 342 ARG A NE  1 
ATOM   2466  C CZ  . ARG A 1 341 ? -17.937 -16.042  -32.204 1.00 37.98  ? 342 ARG A CZ  1 
ATOM   2467  N NH1 . ARG A 1 341 ? -18.652 -16.603  -31.237 1.00 38.72  ? 342 ARG A NH1 1 
ATOM   2468  N NH2 . ARG A 1 341 ? -17.374 -14.867  -31.999 1.00 38.10  ? 342 ARG A NH2 1 
ATOM   2469  N N   . MET A 1 342 ? -13.801 -19.080  -31.668 1.00 33.35  ? 343 MET A N   1 
ATOM   2470  C CA  . MET A 1 342 ? -13.583 -18.590  -30.310 1.00 33.22  ? 343 MET A CA  1 
ATOM   2471  C C   . MET A 1 342 ? -14.827 -17.828  -29.863 1.00 32.98  ? 343 MET A C   1 
ATOM   2472  O O   . MET A 1 342 ? -15.562 -17.284  -30.692 1.00 32.43  ? 343 MET A O   1 
ATOM   2473  C CB  . MET A 1 342 ? -12.349 -17.686  -30.228 1.00 33.31  ? 343 MET A CB  1 
ATOM   2474  C CG  . MET A 1 342 ? -12.416 -16.457  -31.131 1.00 32.78  ? 343 MET A CG  1 
ATOM   2475  S SD  . MET A 1 342 ? -11.494 -15.052  -30.474 1.00 34.45  ? 343 MET A SD  1 
ATOM   2476  C CE  . MET A 1 342 ? -12.643 -14.474  -29.226 1.00 32.90  ? 343 MET A CE  1 
ATOM   2477  N N   . THR A 1 343 ? -15.074 -17.803  -28.559 1.00 31.84  ? 344 THR A N   1 
ATOM   2478  C CA  . THR A 1 343 ? -16.229 -17.096  -28.033 1.00 32.20  ? 344 THR A CA  1 
ATOM   2479  C C   . THR A 1 343 ? -15.800 -16.239  -26.840 1.00 33.24  ? 344 THR A C   1 
ATOM   2480  O O   . THR A 1 343 ? -14.831 -16.561  -26.148 1.00 32.85  ? 344 THR A O   1 
ATOM   2481  C CB  . THR A 1 343 ? -17.355 -18.074  -27.628 1.00 32.93  ? 344 THR A CB  1 
ATOM   2482  O OG1 . THR A 1 343 ? -18.571 -17.349  -27.404 1.00 33.83  ? 344 THR A OG1 1 
ATOM   2483  C CG2 . THR A 1 343 ? -16.981 -18.848  -26.356 1.00 33.94  ? 344 THR A CG2 1 
ATOM   2484  N N   . GLY A 1 344 ? -16.505 -15.137  -26.616 1.00 34.03  ? 345 GLY A N   1 
ATOM   2485  C CA  . GLY A 1 344 ? -16.148 -14.223  -25.543 1.00 35.60  ? 345 GLY A CA  1 
ATOM   2486  C C   . GLY A 1 344 ? -15.021 -13.279  -25.929 1.00 36.51  ? 345 GLY A C   1 
ATOM   2487  O O   . GLY A 1 344 ? -14.820 -12.991  -27.108 1.00 35.35  ? 345 GLY A O   1 
ATOM   2488  N N   . GLY A 1 345 ? -14.271 -12.815  -24.933 1.00 36.39  ? 346 GLY A N   1 
ATOM   2489  C CA  . GLY A 1 345 ? -13.260 -11.791  -25.137 1.00 35.15  ? 346 GLY A CA  1 
ATOM   2490  C C   . GLY A 1 345 ? -12.034 -12.212  -25.927 1.00 34.74  ? 346 GLY A C   1 
ATOM   2491  O O   . GLY A 1 345 ? -11.440 -11.399  -26.633 1.00 35.33  ? 346 GLY A O   1 
ATOM   2492  N N   . GLY A 1 346 ? -11.641 -13.475  -25.800 1.00 34.00  ? 347 GLY A N   1 
ATOM   2493  C CA  . GLY A 1 346 ? -10.487 -13.981  -26.522 1.00 34.14  ? 347 GLY A CA  1 
ATOM   2494  C C   . GLY A 1 346 ? -9.243  -14.133  -25.671 1.00 35.24  ? 347 GLY A C   1 
ATOM   2495  O O   . GLY A 1 346 ? -9.312  -14.049  -24.443 1.00 36.49  ? 347 GLY A O   1 
ATOM   2496  N N   . PHE A 1 347 ? -8.107  -14.362  -26.330 1.00 35.75  ? 348 PHE A N   1 
ATOM   2497  C CA  . PHE A 1 347 ? -6.820  -14.568  -25.656 1.00 38.24  ? 348 PHE A CA  1 
ATOM   2498  C C   . PHE A 1 347 ? -6.873  -15.727  -24.664 1.00 39.39  ? 348 PHE A C   1 
ATOM   2499  O O   . PHE A 1 347 ? -6.177  -15.723  -23.647 1.00 40.72  ? 348 PHE A O   1 
ATOM   2500  C CB  . PHE A 1 347 ? -6.373  -13.295  -24.934 1.00 37.83  ? 348 PHE A CB  1 
ATOM   2501  C CG  . PHE A 1 347 ? -6.201  -12.107  -25.840 1.00 37.57  ? 348 PHE A CG  1 
ATOM   2502  C CD1 . PHE A 1 347 ? -5.158  -12.057  -26.748 1.00 37.71  ? 348 PHE A CD1 1 
ATOM   2503  C CD2 . PHE A 1 347 ? -7.069  -11.033  -25.765 1.00 38.09  ? 348 PHE A CD2 1 
ATOM   2504  C CE1 . PHE A 1 347 ? -4.994  -10.963  -27.578 1.00 37.64  ? 348 PHE A CE1 1 
ATOM   2505  C CE2 . PHE A 1 347 ? -6.909  -9.937   -26.593 1.00 38.42  ? 348 PHE A CE2 1 
ATOM   2506  C CZ  . PHE A 1 347 ? -5.865  -9.904   -27.497 1.00 37.70  ? 348 PHE A CZ  1 
ATOM   2507  N N   . GLY A 1 348 ? -7.700  -16.719  -24.978 1.00 38.53  ? 349 GLY A N   1 
ATOM   2508  C CA  . GLY A 1 348 ? -7.939  -17.848  -24.102 1.00 38.10  ? 349 GLY A CA  1 
ATOM   2509  C C   . GLY A 1 348 ? -9.432  -18.060  -23.951 1.00 38.00  ? 349 GLY A C   1 
ATOM   2510  O O   . GLY A 1 348 ? -10.226 -17.508  -24.711 1.00 36.59  ? 349 GLY A O   1 
ATOM   2511  N N   . GLY A 1 349 ? -9.822  -18.852  -22.962 1.00 38.27  ? 350 GLY A N   1 
ATOM   2512  C CA  . GLY A 1 349 ? -11.227 -19.123  -22.740 1.00 35.46  ? 350 GLY A CA  1 
ATOM   2513  C C   . GLY A 1 349 ? -11.737 -20.240  -23.628 1.00 33.81  ? 350 GLY A C   1 
ATOM   2514  O O   . GLY A 1 349 ? -11.013 -21.190  -23.930 1.00 34.13  ? 350 GLY A O   1 
ATOM   2515  N N   . CYS A 1 350 ? -12.987 -20.116  -24.058 1.00 36.14  ? 351 CYS A N   1 
ATOM   2516  C CA  . CYS A 1 350 ? -13.665 -21.198  -24.761 1.00 39.06  ? 351 CYS A CA  1 
ATOM   2517  C C   . CYS A 1 350 ? -13.857 -20.970  -26.258 1.00 34.46  ? 351 CYS A C   1 
ATOM   2518  O O   . CYS A 1 350 ? -13.847 -19.836  -26.736 1.00 33.47  ? 351 CYS A O   1 
ATOM   2519  C CB  . CYS A 1 350 ? -15.030 -21.447  -24.118 1.00 33.99  ? 351 CYS A CB  1 
ATOM   2520  S SG  . CYS A 1 350 ? -14.926 -22.003  -22.405 1.00 38.73  ? 351 CYS A SG  1 
ATOM   2521  N N   . THR A 1 351 ? -14.027 -22.067  -26.990 1.00 35.41  ? 352 THR A N   1 
ATOM   2522  C CA  . THR A 1 351 ? -14.573 -22.001  -28.342 1.00 35.03  ? 352 THR A CA  1 
ATOM   2523  C C   . THR A 1 351 ? -15.999 -22.527  -28.297 1.00 41.76  ? 352 THR A C   1 
ATOM   2524  O O   . THR A 1 351 ? -16.379 -23.230  -27.355 1.00 40.64  ? 352 THR A O   1 
ATOM   2525  C CB  . THR A 1 351 ? -13.762 -22.821  -29.363 1.00 36.68  ? 352 THR A CB  1 
ATOM   2526  O OG1 . THR A 1 351 ? -13.867 -24.216  -29.054 1.00 37.88  ? 352 THR A OG1 1 
ATOM   2527  C CG2 . THR A 1 351 ? -12.304 -22.403  -29.362 1.00 39.28  ? 352 THR A CG2 1 
ATOM   2528  N N   . VAL A 1 352 ? -16.792 -22.176  -29.304 1.00 33.69  ? 353 VAL A N   1 
ATOM   2529  C CA  . VAL A 1 352 ? -18.148 -22.690  -29.406 1.00 36.08  ? 353 VAL A CA  1 
ATOM   2530  C C   . VAL A 1 352 ? -18.303 -23.405  -30.746 1.00 36.96  ? 353 VAL A C   1 
ATOM   2531  O O   . VAL A 1 352 ? -17.875 -22.905  -31.785 1.00 36.77  ? 353 VAL A O   1 
ATOM   2532  C CB  . VAL A 1 352 ? -19.209 -21.569  -29.253 1.00 31.80  ? 353 VAL A CB  1 
ATOM   2533  C CG1 . VAL A 1 352 ? -18.997 -20.460  -30.273 1.00 31.19  ? 353 VAL A CG1 1 
ATOM   2534  C CG2 . VAL A 1 352 ? -20.613 -22.143  -29.354 1.00 37.40  ? 353 VAL A CG2 1 
ATOM   2535  N N   . THR A 1 353 ? -18.887 -24.595  -30.709 1.00 37.18  ? 354 THR A N   1 
ATOM   2536  C CA  . THR A 1 353 ? -19.028 -25.401  -31.911 1.00 38.28  ? 354 THR A CA  1 
ATOM   2537  C C   . THR A 1 353 ? -20.484 -25.784  -32.149 1.00 37.79  ? 354 THR A C   1 
ATOM   2538  O O   . THR A 1 353 ? -21.182 -26.230  -31.234 1.00 37.43  ? 354 THR A O   1 
ATOM   2539  C CB  . THR A 1 353 ? -18.164 -26.676  -31.831 1.00 37.56  ? 354 THR A CB  1 
ATOM   2540  O OG1 . THR A 1 353 ? -16.783 -26.310  -31.729 1.00 38.08  ? 354 THR A OG1 1 
ATOM   2541  C CG2 . THR A 1 353 ? -18.354 -27.541  -33.070 1.00 38.60  ? 354 THR A CG2 1 
ATOM   2542  N N   . LEU A 1 354 ? -20.935 -25.580  -33.381 1.00 38.38  ? 355 LEU A N   1 
ATOM   2543  C CA  . LEU A 1 354 ? -22.253 -26.017  -33.813 1.00 39.58  ? 355 LEU A CA  1 
ATOM   2544  C C   . LEU A 1 354 ? -22.070 -27.292  -34.621 1.00 39.76  ? 355 LEU A C   1 
ATOM   2545  O O   . LEU A 1 354 ? -21.316 -27.312  -35.594 1.00 39.37  ? 355 LEU A O   1 
ATOM   2546  C CB  . LEU A 1 354 ? -22.944 -24.940  -34.649 1.00 41.94  ? 355 LEU A CB  1 
ATOM   2547  C CG  . LEU A 1 354 ? -24.467 -25.015  -34.774 1.00 44.55  ? 355 LEU A CG  1 
ATOM   2548  C CD1 . LEU A 1 354 ? -25.124 -24.544  -33.486 1.00 44.42  ? 355 LEU A CD1 1 
ATOM   2549  C CD2 . LEU A 1 354 ? -24.966 -24.205  -35.972 1.00 46.36  ? 355 LEU A CD2 1 
ATOM   2550  N N   . LEU A 1 355 ? -22.741 -28.358  -34.206 1.00 40.45  ? 356 LEU A N   1 
ATOM   2551  C CA  . LEU A 1 355 ? -22.544 -29.661  -34.827 1.00 42.68  ? 356 LEU A CA  1 
ATOM   2552  C C   . LEU A 1 355 ? -23.779 -30.536  -34.692 1.00 43.30  ? 356 LEU A C   1 
ATOM   2553  O O   . LEU A 1 355 ? -24.636 -30.286  -33.842 1.00 41.91  ? 356 LEU A O   1 
ATOM   2554  C CB  . LEU A 1 355 ? -21.334 -30.378  -34.210 1.00 44.29  ? 356 LEU A CB  1 
ATOM   2555  C CG  . LEU A 1 355 ? -21.451 -30.976  -32.800 1.00 46.82  ? 356 LEU A CG  1 
ATOM   2556  C CD1 . LEU A 1 355 ? -20.217 -31.799  -32.475 1.00 49.23  ? 356 LEU A CD1 1 
ATOM   2557  C CD2 . LEU A 1 355 ? -21.654 -29.917  -31.726 1.00 44.38  ? 356 LEU A CD2 1 
ATOM   2558  N N   . GLU A 1 356 ? -23.868 -31.557  -35.544 1.00 44.03  ? 357 GLU A N   1 
ATOM   2559  C CA  . GLU A 1 356 ? -24.909 -32.566  -35.408 1.00 45.84  ? 357 GLU A CA  1 
ATOM   2560  C C   . GLU A 1 356 ? -24.761 -33.251  -34.055 1.00 48.17  ? 357 GLU A C   1 
ATOM   2561  O O   . GLU A 1 356 ? -23.650 -33.583  -33.643 1.00 50.18  ? 357 GLU A O   1 
ATOM   2562  C CB  . GLU A 1 356 ? -24.837 -33.588  -36.547 1.00 46.91  ? 357 GLU A CB  1 
ATOM   2563  N N   . ALA A 1 357 ? -25.880 -33.445  -33.362 1.00 48.97  ? 358 ALA A N   1 
ATOM   2564  C CA  . ALA A 1 357 ? -25.872 -33.996  -32.007 1.00 49.08  ? 358 ALA A CA  1 
ATOM   2565  C C   . ALA A 1 357 ? -25.119 -35.320  -31.928 1.00 50.97  ? 358 ALA A C   1 
ATOM   2566  O O   . ALA A 1 357 ? -24.387 -35.570  -30.972 1.00 50.90  ? 358 ALA A O   1 
ATOM   2567  C CB  . ALA A 1 357 ? -27.298 -34.172  -31.501 1.00 48.58  ? 358 ALA A CB  1 
ATOM   2568  N N   . SER A 1 358 ? -25.288 -36.159  -32.945 1.00 51.87  ? 359 SER A N   1 
ATOM   2569  C CA  . SER A 1 358 ? -24.652 -37.471  -32.958 1.00 53.09  ? 359 SER A CA  1 
ATOM   2570  C C   . SER A 1 358 ? -23.130 -37.372  -33.078 1.00 52.29  ? 359 SER A C   1 
ATOM   2571  O O   . SER A 1 358 ? -22.410 -38.307  -32.727 1.00 53.90  ? 359 SER A O   1 
ATOM   2572  C CB  . SER A 1 358 ? -25.219 -38.324  -34.096 1.00 54.51  ? 359 SER A CB  1 
ATOM   2573  O OG  . SER A 1 358 ? -25.320 -37.578  -35.297 1.00 55.24  ? 359 SER A OG  1 
ATOM   2574  N N   . ALA A 1 359 ? -22.644 -36.234  -33.560 1.00 49.91  ? 360 ALA A N   1 
ATOM   2575  C CA  . ALA A 1 359 ? -21.212 -36.048  -33.778 1.00 50.07  ? 360 ALA A CA  1 
ATOM   2576  C C   . ALA A 1 359 ? -20.468 -35.590  -32.520 1.00 50.38  ? 360 ALA A C   1 
ATOM   2577  O O   . ALA A 1 359 ? -19.240 -35.583  -32.495 1.00 51.96  ? 360 ALA A O   1 
ATOM   2578  C CB  . ALA A 1 359 ? -20.984 -35.052  -34.906 1.00 48.54  ? 360 ALA A CB  1 
ATOM   2579  N N   . ALA A 1 360 ? -21.207 -35.213  -31.482 1.00 49.58  ? 361 ALA A N   1 
ATOM   2580  C CA  . ALA A 1 360 ? -20.599 -34.645  -30.274 1.00 49.94  ? 361 ALA A CA  1 
ATOM   2581  C C   . ALA A 1 360 ? -19.539 -35.538  -29.596 1.00 53.76  ? 361 ALA A C   1 
ATOM   2582  O O   . ALA A 1 360 ? -18.482 -35.034  -29.207 1.00 55.32  ? 361 ALA A O   1 
ATOM   2583  C CB  . ALA A 1 360 ? -21.687 -34.272  -29.268 1.00 47.84  ? 361 ALA A CB  1 
ATOM   2584  N N   . PRO A 1 361 ? -19.805 -36.853  -29.442 1.00 54.42  ? 362 PRO A N   1 
ATOM   2585  C CA  . PRO A 1 361 ? -18.764 -37.664  -28.796 1.00 56.63  ? 362 PRO A CA  1 
ATOM   2586  C C   . PRO A 1 361 ? -17.478 -37.771  -29.619 1.00 57.36  ? 362 PRO A C   1 
ATOM   2587  O O   . PRO A 1 361 ? -16.386 -37.764  -29.050 1.00 57.89  ? 362 PRO A O   1 
ATOM   2588  C CB  . PRO A 1 361 ? -19.424 -39.042  -28.656 1.00 58.23  ? 362 PRO A CB  1 
ATOM   2589  C CG  . PRO A 1 361 ? -20.885 -38.779  -28.717 1.00 56.78  ? 362 PRO A CG  1 
ATOM   2590  C CD  . PRO A 1 361 ? -21.034 -37.635  -29.669 1.00 54.52  ? 362 PRO A CD  1 
ATOM   2591  N N   . HIS A 1 362 ? -17.613 -37.879  -30.937 1.00 57.12  ? 363 HIS A N   1 
ATOM   2592  C CA  . HIS A 1 362 ? -16.455 -37.988  -31.820 1.00 57.66  ? 363 HIS A CA  1 
ATOM   2593  C C   . HIS A 1 362 ? -15.724 -36.650  -31.943 1.00 55.51  ? 363 HIS A C   1 
ATOM   2594  O O   . HIS A 1 362 ? -14.515 -36.608  -32.171 1.00 56.33  ? 363 HIS A O   1 
ATOM   2595  C CB  . HIS A 1 362 ? -16.880 -38.486  -33.204 1.00 58.18  ? 363 HIS A CB  1 
ATOM   2596  N N   . ALA A 1 363 ? -16.462 -35.557  -31.793 1.00 52.20  ? 364 ALA A N   1 
ATOM   2597  C CA  . ALA A 1 363 ? -15.848 -34.240  -31.811 1.00 50.56  ? 364 ALA A CA  1 
ATOM   2598  C C   . ALA A 1 363 ? -14.951 -34.070  -30.588 1.00 50.09  ? 364 ALA A C   1 
ATOM   2599  O O   . ALA A 1 363 ? -13.824 -33.586  -30.690 1.00 49.63  ? 364 ALA A O   1 
ATOM   2600  C CB  . ALA A 1 363 ? -16.909 -33.155  -31.853 1.00 48.81  ? 364 ALA A CB  1 
ATOM   2601  N N   . MET A 1 364 ? -15.454 -34.490  -29.433 1.00 50.00  ? 365 MET A N   1 
ATOM   2602  C CA  . MET A 1 364 ? -14.722 -34.329  -28.185 1.00 50.82  ? 365 MET A CA  1 
ATOM   2603  C C   . MET A 1 364 ? -13.423 -35.135  -28.177 1.00 52.54  ? 365 MET A C   1 
ATOM   2604  O O   . MET A 1 364 ? -12.384 -34.637  -27.746 1.00 51.64  ? 365 MET A O   1 
ATOM   2605  C CB  . MET A 1 364 ? -15.605 -34.724  -27.000 1.00 52.16  ? 365 MET A CB  1 
ATOM   2606  C CG  . MET A 1 364 ? -16.627 -33.659  -26.632 1.00 50.67  ? 365 MET A CG  1 
ATOM   2607  S SD  . MET A 1 364 ? -17.623 -34.086  -25.195 1.00 51.71  ? 365 MET A SD  1 
ATOM   2608  C CE  . MET A 1 364 ? -18.682 -35.357  -25.878 1.00 56.23  ? 365 MET A CE  1 
ATOM   2609  N N   . ARG A 1 365 ? -13.479 -36.369  -28.669 1.00 53.52  ? 366 ARG A N   1 
ATOM   2610  C CA  . ARG A 1 365 ? -12.289 -37.213  -28.727 1.00 55.23  ? 366 ARG A CA  1 
ATOM   2611  C C   . ARG A 1 365 ? -11.204 -36.597  -29.613 1.00 57.86  ? 366 ARG A C   1 
ATOM   2612  O O   . ARG A 1 365 ? -10.048 -36.486  -29.203 1.00 57.33  ? 366 ARG A O   1 
ATOM   2613  C CB  . ARG A 1 365 ? -12.648 -38.614  -29.230 1.00 56.79  ? 366 ARG A CB  1 
ATOM   2614  N N   . HIS A 1 366 ? -11.584 -36.182  -30.819 1.00 54.52  ? 367 HIS A N   1 
ATOM   2615  C CA  . HIS A 1 366 ? -10.628 -35.642  -31.784 1.00 56.43  ? 367 HIS A CA  1 
ATOM   2616  C C   . HIS A 1 366 ? -10.066 -34.276  -31.381 1.00 56.01  ? 367 HIS A C   1 
ATOM   2617  O O   . HIS A 1 366 ? -8.868  -34.026  -31.530 1.00 58.00  ? 367 HIS A O   1 
ATOM   2618  C CB  . HIS A 1 366 ? -11.274 -35.538  -33.166 1.00 55.45  ? 367 HIS A CB  1 
ATOM   2619  C CG  . HIS A 1 366 ? -10.351 -35.021  -34.224 1.00 56.55  ? 367 HIS A CG  1 
ATOM   2620  N ND1 . HIS A 1 366 ? -10.343 -33.702  -34.626 1.00 54.62  ? 367 HIS A ND1 1 
ATOM   2621  C CD2 . HIS A 1 366 ? -9.404  -35.644  -34.964 1.00 59.49  ? 367 HIS A CD2 1 
ATOM   2622  C CE1 . HIS A 1 366 ? -9.432  -33.536  -35.568 1.00 56.31  ? 367 HIS A CE1 1 
ATOM   2623  N NE2 . HIS A 1 366 ? -8.849  -34.700  -35.793 1.00 59.56  ? 367 HIS A NE2 1 
ATOM   2624  N N   . ILE A 1 367 ? -10.930 -33.391  -30.892 1.00 53.22  ? 368 ILE A N   1 
ATOM   2625  C CA  . ILE A 1 367 ? -10.486 -32.078  -30.430 1.00 52.35  ? 368 ILE A CA  1 
ATOM   2626  C C   . ILE A 1 367 ? -9.444  -32.233  -29.323 1.00 54.61  ? 368 ILE A C   1 
ATOM   2627  O O   . ILE A 1 367 ? -8.397  -31.587  -29.349 1.00 55.59  ? 368 ILE A O   1 
ATOM   2628  C CB  . ILE A 1 367 ? -11.671 -31.220  -29.930 1.00 50.00  ? 368 ILE A CB  1 
ATOM   2629  C CG1 . ILE A 1 367 ? -12.532 -30.766  -31.112 1.00 46.60  ? 368 ILE A CG1 1 
ATOM   2630  C CG2 . ILE A 1 367 ? -11.174 -30.001  -29.167 1.00 47.05  ? 368 ILE A CG2 1 
ATOM   2631  C CD1 . ILE A 1 367 ? -13.872 -30.219  -30.710 1.00 44.53  ? 368 ILE A CD1 1 
ATOM   2632  N N   . GLN A 1 368 ? -9.722  -33.118  -28.371 1.00 56.25  ? 369 GLN A N   1 
ATOM   2633  C CA  . GLN A 1 368 ? -8.798  -33.374  -27.271 1.00 58.47  ? 369 GLN A CA  1 
ATOM   2634  C C   . GLN A 1 368 ? -7.472  -33.951  -27.762 1.00 62.05  ? 369 GLN A C   1 
ATOM   2635  O O   . GLN A 1 368 ? -6.407  -33.586  -27.267 1.00 63.31  ? 369 GLN A O   1 
ATOM   2636  C CB  . GLN A 1 368 ? -9.431  -34.324  -26.253 1.00 58.79  ? 369 GLN A CB  1 
ATOM   2637  C CG  . GLN A 1 368 ? -8.616  -34.509  -24.987 1.00 60.63  ? 369 GLN A CG  1 
ATOM   2638  C CD  . GLN A 1 368 ? -8.509  -33.233  -24.175 1.00 59.72  ? 369 GLN A CD  1 
ATOM   2639  O OE1 . GLN A 1 368 ? -7.616  -32.415  -24.394 1.00 59.62  ? 369 GLN A OE1 1 
ATOM   2640  N NE2 . GLN A 1 368 ? -9.425  -33.057  -23.229 1.00 58.69  ? 369 GLN A NE2 1 
ATOM   2641  N N   . GLU A 1 369 ? -7.543  -34.848  -28.741 1.00 63.88  ? 370 GLU A N   1 
ATOM   2642  C CA  . GLU A 1 369 ? -6.352  -35.517  -29.259 1.00 67.42  ? 370 GLU A CA  1 
ATOM   2643  C C   . GLU A 1 369 ? -5.460  -34.564  -30.049 1.00 69.20  ? 370 GLU A C   1 
ATOM   2644  O O   . GLU A 1 369 ? -4.245  -34.746  -30.109 1.00 70.69  ? 370 GLU A O   1 
ATOM   2645  C CB  . GLU A 1 369 ? -6.746  -36.711  -30.134 1.00 67.67  ? 370 GLU A CB  1 
ATOM   2646  N N   . HIS A 1 370 ? -6.065  -33.548  -30.652 1.00 70.22  ? 371 HIS A N   1 
ATOM   2647  C CA  . HIS A 1 370 ? -5.308  -32.570  -31.422 1.00 74.84  ? 371 HIS A CA  1 
ATOM   2648  C C   . HIS A 1 370 ? -4.947  -31.340  -30.599 1.00 78.60  ? 371 HIS A C   1 
ATOM   2649  O O   . HIS A 1 370 ? -4.129  -30.523  -31.020 1.00 78.01  ? 371 HIS A O   1 
ATOM   2650  C CB  . HIS A 1 370 ? -6.087  -32.158  -32.668 1.00 73.91  ? 371 HIS A CB  1 
ATOM   2651  C CG  . HIS A 1 370 ? -5.962  -33.132  -33.797 1.00 76.79  ? 371 HIS A CG  1 
ATOM   2652  N ND1 . HIS A 1 370 ? -5.503  -32.769  -35.042 1.00 77.86  ? 371 HIS A ND1 1 
ATOM   2653  C CD2 . HIS A 1 370 ? -6.212  -34.462  -33.856 1.00 78.49  ? 371 HIS A CD2 1 
ATOM   2654  C CE1 . HIS A 1 370 ? -5.485  -33.834  -35.828 1.00 79.77  ? 371 HIS A CE1 1 
ATOM   2655  N NE2 . HIS A 1 370 ? -5.910  -34.871  -35.132 1.00 79.93  ? 371 HIS A NE2 1 
ATOM   2656  N N   . TYR A 1 371 ? -5.551  -31.209  -29.425 1.00 76.13  ? 372 TYR A N   1 
ATOM   2657  C CA  . TYR A 1 371 ? -5.231  -30.090  -28.551 1.00 82.31  ? 372 TYR A CA  1 
ATOM   2658  C C   . TYR A 1 371 ? -4.009  -30.405  -27.698 1.00 78.16  ? 372 TYR A C   1 
ATOM   2659  O O   . TYR A 1 371 ? -4.074  -31.222  -26.778 1.00 74.35  ? 372 TYR A O   1 
ATOM   2660  C CB  . TYR A 1 371 ? -6.420  -29.734  -27.659 1.00 93.52  ? 372 TYR A CB  1 
ATOM   2661  C CG  . TYR A 1 371 ? -6.196  -28.492  -26.825 1.00 99.96  ? 372 TYR A CG  1 
ATOM   2662  C CD1 . TYR A 1 371 ? -5.727  -27.321  -27.405 1.00 104.79 ? 372 TYR A CD1 1 
ATOM   2663  C CD2 . TYR A 1 371 ? -6.461  -28.488  -25.462 1.00 105.52 ? 372 TYR A CD2 1 
ATOM   2664  C CE1 . TYR A 1 371 ? -5.521  -26.184  -26.650 1.00 107.94 ? 372 TYR A CE1 1 
ATOM   2665  C CE2 . TYR A 1 371 ? -6.259  -27.354  -24.699 1.00 108.57 ? 372 TYR A CE2 1 
ATOM   2666  C CZ  . TYR A 1 371 ? -5.789  -26.205  -25.299 1.00 114.51 ? 372 TYR A CZ  1 
ATOM   2667  O OH  . TYR A 1 371 ? -5.586  -25.074  -24.546 1.00 126.06 ? 372 TYR A OH  1 
ATOM   2668  N N   . GLY A 1 372 ? -2.894  -29.754  -28.016 1.00 77.99  ? 373 GLY A N   1 
ATOM   2669  C CA  . GLY A 1 372 ? -1.678  -29.890  -27.236 1.00 80.29  ? 373 GLY A CA  1 
ATOM   2670  C C   . GLY A 1 372 ? -1.844  -29.228  -25.882 1.00 79.68  ? 373 GLY A C   1 
ATOM   2671  O O   . GLY A 1 372 ? -1.192  -28.230  -25.576 1.00 80.84  ? 373 GLY A O   1 
ATOM   2672  N N   . GLY A 1 373 ? -2.730  -29.796  -25.073 1.00 77.22  ? 374 GLY A N   1 
ATOM   2673  C CA  . GLY A 1 373 ? -3.092  -29.232  -23.788 1.00 73.56  ? 374 GLY A CA  1 
ATOM   2674  C C   . GLY A 1 373 ? -4.285  -29.990  -23.246 1.00 69.67  ? 374 GLY A C   1 
ATOM   2675  O O   . GLY A 1 373 ? -4.629  -31.058  -23.756 1.00 70.21  ? 374 GLY A O   1 
ATOM   2676  N N   . THR A 1 374 ? -4.928  -29.444  -22.221 1.00 65.06  ? 375 THR A N   1 
ATOM   2677  C CA  . THR A 1 374 ? -6.049  -30.138  -21.603 1.00 62.23  ? 375 THR A CA  1 
ATOM   2678  C C   . THR A 1 374 ? -7.359  -29.391  -21.798 1.00 56.61  ? 375 THR A C   1 
ATOM   2679  O O   . THR A 1 374 ? -7.630  -28.399  -21.122 1.00 55.24  ? 375 THR A O   1 
ATOM   2680  C CB  . THR A 1 374 ? -5.807  -30.354  -20.106 1.00 63.28  ? 375 THR A CB  1 
ATOM   2681  O OG1 . THR A 1 374 ? -4.529  -30.974  -19.921 1.00 66.25  ? 375 THR A OG1 1 
ATOM   2682  C CG2 . THR A 1 374 ? -6.892  -31.243  -19.519 1.00 63.88  ? 375 THR A CG2 1 
ATOM   2683  N N   . ALA A 1 375 ? -8.173  -29.877  -22.728 1.00 52.98  ? 376 ALA A N   1 
ATOM   2684  C CA  . ALA A 1 375 ? -9.455  -29.251  -23.002 1.00 49.52  ? 376 ALA A CA  1 
ATOM   2685  C C   . ALA A 1 375 ? -10.531 -29.778  -22.065 1.00 49.23  ? 376 ALA A C   1 
ATOM   2686  O O   . ALA A 1 375 ? -10.482 -30.925  -21.621 1.00 50.66  ? 376 ALA A O   1 
ATOM   2687  C CB  . ALA A 1 375 ? -9.865  -29.470  -24.464 1.00 48.64  ? 376 ALA A CB  1 
ATOM   2688  N N   . THR A 1 376 ? -11.498 -28.918  -21.770 1.00 48.43  ? 377 THR A N   1 
ATOM   2689  C CA  . THR A 1 376 ? -12.681 -29.284  -21.008 1.00 48.32  ? 377 THR A CA  1 
ATOM   2690  C C   . THR A 1 376 ? -13.905 -29.027  -21.879 1.00 45.13  ? 377 THR A C   1 
ATOM   2691  O O   . THR A 1 376 ? -13.954 -28.030  -22.601 1.00 43.26  ? 377 THR A O   1 
ATOM   2692  C CB  . THR A 1 376 ? -12.773 -28.485  -19.694 1.00 50.14  ? 377 THR A CB  1 
ATOM   2693  O OG1 . THR A 1 376 ? -11.542 -28.619  -18.973 1.00 53.34  ? 377 THR A OG1 1 
ATOM   2694  C CG2 . THR A 1 376 ? -13.914 -28.991  -18.828 1.00 51.43  ? 377 THR A CG2 1 
ATOM   2695  N N   . PHE A 1 377 ? -14.885 -29.924  -21.822 1.00 45.10  ? 378 PHE A N   1 
ATOM   2696  C CA  . PHE A 1 377 ? -16.050 -29.826  -22.697 1.00 43.76  ? 378 PHE A CA  1 
ATOM   2697  C C   . PHE A 1 377 ? -17.360 -29.644  -21.941 1.00 42.87  ? 378 PHE A C   1 
ATOM   2698  O O   . PHE A 1 377 ? -17.564 -30.223  -20.877 1.00 43.77  ? 378 PHE A O   1 
ATOM   2699  C CB  . PHE A 1 377 ? -16.162 -31.071  -23.585 1.00 46.11  ? 378 PHE A CB  1 
ATOM   2700  C CG  . PHE A 1 377 ? -14.949 -31.330  -24.431 1.00 47.14  ? 378 PHE A CG  1 
ATOM   2701  C CD1 . PHE A 1 377 ? -14.677 -30.542  -25.537 1.00 45.94  ? 378 PHE A CD1 1 
ATOM   2702  C CD2 . PHE A 1 377 ? -14.088 -32.375  -24.129 1.00 50.02  ? 378 PHE A CD2 1 
ATOM   2703  C CE1 . PHE A 1 377 ? -13.562 -30.782  -26.319 1.00 47.07  ? 378 PHE A CE1 1 
ATOM   2704  C CE2 . PHE A 1 377 ? -12.972 -32.624  -24.910 1.00 50.60  ? 378 PHE A CE2 1 
ATOM   2705  C CZ  . PHE A 1 377 ? -12.708 -31.827  -26.005 1.00 49.22  ? 378 PHE A CZ  1 
ATOM   2706  N N   . TYR A 1 378 ? -18.246 -28.837  -22.515 1.00 42.68  ? 379 TYR A N   1 
ATOM   2707  C CA  . TYR A 1 378 ? -19.628 -28.738  -22.064 1.00 44.32  ? 379 TYR A CA  1 
ATOM   2708  C C   . TYR A 1 378 ? -20.575 -28.900  -23.247 1.00 44.19  ? 379 TYR A C   1 
ATOM   2709  O O   . TYR A 1 378 ? -20.394 -28.256  -24.281 1.00 45.03  ? 379 TYR A O   1 
ATOM   2710  C CB  . TYR A 1 378 ? -19.913 -27.392  -21.392 1.00 43.08  ? 379 TYR A CB  1 
ATOM   2711  C CG  . TYR A 1 378 ? -19.010 -27.023  -20.246 1.00 45.01  ? 379 TYR A CG  1 
ATOM   2712  C CD1 . TYR A 1 378 ? -19.263 -27.485  -18.959 1.00 46.72  ? 379 TYR A CD1 1 
ATOM   2713  C CD2 . TYR A 1 378 ? -17.925 -26.178  -20.439 1.00 43.78  ? 379 TYR A CD2 1 
ATOM   2714  C CE1 . TYR A 1 378 ? -18.445 -27.135  -17.902 1.00 46.89  ? 379 TYR A CE1 1 
ATOM   2715  C CE2 . TYR A 1 378 ? -17.102 -25.823  -19.388 1.00 43.36  ? 379 TYR A CE2 1 
ATOM   2716  C CZ  . TYR A 1 378 ? -17.367 -26.303  -18.124 1.00 45.65  ? 379 TYR A CZ  1 
ATOM   2717  O OH  . TYR A 1 378 ? -16.548 -25.948  -17.077 1.00 46.15  ? 379 TYR A OH  1 
ATOM   2718  N N   . LEU A 1 379 ? -21.582 -29.751  -23.092 1.00 43.70  ? 380 LEU A N   1 
ATOM   2719  C CA  . LEU A 1 379 ? -22.679 -29.822  -24.052 1.00 44.40  ? 380 LEU A CA  1 
ATOM   2720  C C   . LEU A 1 379 ? -23.894 -29.146  -23.442 1.00 44.44  ? 380 LEU A C   1 
ATOM   2721  O O   . LEU A 1 379 ? -24.486 -29.667  -22.500 1.00 46.36  ? 380 LEU A O   1 
ATOM   2722  C CB  . LEU A 1 379 ? -23.006 -31.269  -24.422 1.00 46.65  ? 380 LEU A CB  1 
ATOM   2723  C CG  . LEU A 1 379 ? -22.091 -31.963  -25.430 1.00 48.01  ? 380 LEU A CG  1 
ATOM   2724  C CD1 . LEU A 1 379 ? -22.451 -33.438  -25.542 1.00 51.49  ? 380 LEU A CD1 1 
ATOM   2725  C CD2 . LEU A 1 379 ? -22.189 -31.280  -26.788 1.00 46.30  ? 380 LEU A CD2 1 
ATOM   2726  N N   . SER A 1 380 ? -24.272 -27.988  -23.969 1.00 43.84  ? 381 SER A N   1 
ATOM   2727  C CA  . SER A 1 380 ? -25.295 -27.201  -23.299 1.00 45.37  ? 381 SER A CA  1 
ATOM   2728  C C   . SER A 1 380 ? -26.494 -26.860  -24.171 1.00 45.42  ? 381 SER A C   1 
ATOM   2729  O O   . SER A 1 380 ? -26.355 -26.480  -25.333 1.00 47.25  ? 381 SER A O   1 
ATOM   2730  C CB  . SER A 1 380 ? -24.683 -25.911  -22.748 1.00 45.29  ? 381 SER A CB  1 
ATOM   2731  O OG  . SER A 1 380 ? -25.580 -25.273  -21.851 1.00 46.32  ? 381 SER A OG  1 
ATOM   2732  N N   . GLN A 1 381 ? -27.678 -27.014  -23.590 1.00 44.03  ? 382 GLN A N   1 
ATOM   2733  C CA  . GLN A 1 381 ? -28.902 -26.487  -24.168 1.00 43.16  ? 382 GLN A CA  1 
ATOM   2734  C C   . GLN A 1 381 ? -29.023 -25.002  -23.827 1.00 41.36  ? 382 GLN A C   1 
ATOM   2735  O O   . GLN A 1 381 ? -28.374 -24.520  -22.897 1.00 40.53  ? 382 GLN A O   1 
ATOM   2736  C CB  . GLN A 1 381 ? -30.118 -27.260  -23.650 1.00 44.36  ? 382 GLN A CB  1 
ATOM   2737  N N   . ALA A 1 382 ? -29.834 -24.275  -24.589 1.00 41.01  ? 383 ALA A N   1 
ATOM   2738  C CA  . ALA A 1 382 ? -30.138 -22.890  -24.260 1.00 40.12  ? 383 ALA A CA  1 
ATOM   2739  C C   . ALA A 1 382 ? -30.952 -22.865  -22.973 1.00 41.54  ? 383 ALA A C   1 
ATOM   2740  O O   . ALA A 1 382 ? -31.974 -23.547  -22.872 1.00 43.09  ? 383 ALA A O   1 
ATOM   2741  C CB  . ALA A 1 382 ? -30.896 -22.212  -25.398 1.00 40.54  ? 383 ALA A CB  1 
ATOM   2742  N N   . ALA A 1 383 ? -30.503 -22.084  -21.994 1.00 39.25  ? 384 ALA A N   1 
ATOM   2743  C CA  . ALA A 1 383 ? -31.097 -22.129  -20.660 1.00 39.34  ? 384 ALA A CA  1 
ATOM   2744  C C   . ALA A 1 383 ? -31.829 -20.849  -20.272 1.00 37.10  ? 384 ALA A C   1 
ATOM   2745  O O   . ALA A 1 383 ? -31.738 -19.830  -20.953 1.00 34.82  ? 384 ALA A O   1 
ATOM   2746  C CB  . ALA A 1 383 ? -30.023 -22.444  -19.621 1.00 38.93  ? 384 ALA A CB  1 
ATOM   2747  N N   . ASP A 1 384 ? -32.559 -20.925  -19.163 1.00 38.05  ? 385 ASP A N   1 
ATOM   2748  C CA  . ASP A 1 384 ? -33.285 -19.788  -18.608 1.00 38.84  ? 385 ASP A CA  1 
ATOM   2749  C C   . ASP A 1 384 ? -32.346 -18.695  -18.119 1.00 36.27  ? 385 ASP A C   1 
ATOM   2750  O O   . ASP A 1 384 ? -31.174 -18.953  -17.843 1.00 35.67  ? 385 ASP A O   1 
ATOM   2751  C CB  . ASP A 1 384 ? -34.169 -20.240  -17.440 1.00 43.00  ? 385 ASP A CB  1 
ATOM   2752  C CG  . ASP A 1 384 ? -35.470 -20.858  -17.894 1.00 45.66  ? 385 ASP A CG  1 
ATOM   2753  O OD1 . ASP A 1 384 ? -35.905 -20.570  -19.024 1.00 45.75  ? 385 ASP A OD1 1 
ATOM   2754  O OD2 . ASP A 1 384 ? -36.062 -21.629  -17.111 1.00 48.68  ? 385 ASP A OD2 1 
ATOM   2755  N N   . GLY A 1 385 ? -32.876 -17.481  -17.992 1.00 34.32  ? 386 GLY A N   1 
ATOM   2756  C CA  . GLY A 1 385 ? -32.137 -16.384  -17.398 1.00 32.14  ? 386 GLY A CA  1 
ATOM   2757  C C   . GLY A 1 385 ? -32.260 -16.409  -15.882 1.00 34.09  ? 386 GLY A C   1 
ATOM   2758  O O   . GLY A 1 385 ? -32.535 -17.458  -15.292 1.00 34.94  ? 386 GLY A O   1 
ATOM   2759  N N   . ALA A 1 386 ? -32.074 -15.253  -15.250 1.00 32.55  ? 387 ALA A N   1 
ATOM   2760  C CA  . ALA A 1 386 ? -32.109 -15.167  -13.794 1.00 34.40  ? 387 ALA A CA  1 
ATOM   2761  C C   . ALA A 1 386 ? -33.486 -15.531  -13.244 1.00 32.64  ? 387 ALA A C   1 
ATOM   2762  O O   . ALA A 1 386 ? -34.509 -15.161  -13.816 1.00 32.83  ? 387 ALA A O   1 
ATOM   2763  C CB  . ALA A 1 386 ? -31.705 -13.772  -13.336 1.00 30.29  ? 387 ALA A CB  1 
ATOM   2764  N N   . LYS A 1 387 ? -33.502 -16.260  -12.132 1.00 34.07  ? 388 LYS A N   1 
ATOM   2765  C CA  . LYS A 1 387 ? -34.751 -16.691  -11.515 1.00 36.05  ? 388 LYS A CA  1 
ATOM   2766  C C   . LYS A 1 387 ? -34.723 -16.537  -9.996  1.00 37.34  ? 388 LYS A C   1 
ATOM   2767  O O   . LYS A 1 387 ? -33.663 -16.328  -9.402  1.00 36.85  ? 388 LYS A O   1 
ATOM   2768  C CB  . LYS A 1 387 ? -35.048 -18.144  -11.883 1.00 51.48  ? 388 LYS A CB  1 
ATOM   2769  N N   . VAL A 1 388 ? -35.895 -16.638  -9.375  1.00 39.20  ? 389 VAL A N   1 
ATOM   2770  C CA  . VAL A 1 388 ? -36.022 -16.520  -7.923  1.00 46.29  ? 389 VAL A CA  1 
ATOM   2771  C C   . VAL A 1 388 ? -36.826 -17.683  -7.349  1.00 46.09  ? 389 VAL A C   1 
ATOM   2772  O O   . VAL A 1 388 ? -37.827 -18.094  -7.934  1.00 44.52  ? 389 VAL A O   1 
ATOM   2773  C CB  . VAL A 1 388 ? -36.711 -15.195  -7.516  1.00 46.26  ? 389 VAL A CB  1 
ATOM   2774  C CG1 . VAL A 1 388 ? -36.818 -15.083  -5.999  1.00 47.74  ? 389 VAL A CG1 1 
ATOM   2775  C CG2 . VAL A 1 388 ? -35.956 -14.009  -8.073  1.00 45.03  ? 389 VAL A CG2 1 
ATOM   2776  N N   . LEU A 1 389 ? -36.392 -18.212  -6.206  1.00 45.52  ? 390 LEU A N   1 
ATOM   2777  C CA  . LEU A 1 389 ? -37.183 -19.205  -5.490  1.00 48.32  ? 390 LEU A CA  1 
ATOM   2778  C C   . LEU A 1 389 ? -37.275 -18.853  -4.014  1.00 52.64  ? 390 LEU A C   1 
ATOM   2779  O O   . LEU A 1 389 ? -36.261 -18.713  -3.336  1.00 49.86  ? 390 LEU A O   1 
ATOM   2780  C CB  . LEU A 1 389 ? -36.601 -20.613  -5.655  1.00 49.35  ? 390 LEU A CB  1 
ATOM   2781  C CG  . LEU A 1 389 ? -37.418 -21.765  -5.040  1.00 56.46  ? 390 LEU A CG  1 
ATOM   2782  C CD1 . LEU A 1 389 ? -38.733 -21.979  -5.734  1.00 58.36  ? 390 LEU A CD1 1 
ATOM   2783  C CD2 . LEU A 1 389 ? -36.670 -23.064  -5.068  1.00 57.31  ? 390 LEU A CD2 1 
ATOM   2784  N N   . CYS A 1 390 ? -38.500 -18.706  -3.525  1.00 52.17  ? 391 CYS A N   1 
ATOM   2785  C CA  . CYS A 1 390 ? -38.734 -18.428  -2.119  1.00 60.17  ? 391 CYS A CA  1 
ATOM   2786  C C   . CYS A 1 390 ? -38.600 -19.720  -1.319  1.00 57.37  ? 391 CYS A C   1 
ATOM   2787  O O   . CYS A 1 390 ? -39.190 -20.739  -1.672  1.00 61.72  ? 391 CYS A O   1 
ATOM   2788  C CB  . CYS A 1 390 ? -40.113 -17.795  -1.926  1.00 55.66  ? 391 CYS A CB  1 
ATOM   2789  S SG  . CYS A 1 390 ? -40.430 -16.386  -3.036  1.00 54.89  ? 391 CYS A SG  1 
ATOM   2790  N N   . LEU A 1 391 ? -37.810 -19.682  -0.252  1.00 61.59  ? 392 LEU A N   1 
ATOM   2791  C CA  . LEU A 1 391 ? -37.534 -20.886  0.524   1.00 63.35  ? 392 LEU A CA  1 
ATOM   2792  C C   . LEU A 1 391 ? -38.383 -20.949  1.783   1.00 66.56  ? 392 LEU A C   1 
ATOM   2793  O O   . LEU A 1 391 ? -38.828 -19.921  2.291   1.00 66.03  ? 392 LEU A O   1 
ATOM   2794  C CB  . LEU A 1 391 ? -36.051 -20.957  0.889   1.00 61.82  ? 392 LEU A CB  1 
ATOM   2795  C CG  . LEU A 1 391 ? -35.091 -20.977  -0.303  1.00 58.11  ? 392 LEU A CG  1 
ATOM   2796  C CD1 . LEU A 1 391 ? -33.661 -21.172  0.166   1.00 57.83  ? 392 LEU A CD1 1 
ATOM   2797  C CD2 . LEU A 1 391 ? -35.488 -22.057  -1.298  1.00 58.67  ? 392 LEU A CD2 1 
ATOM   2798  O OXT . LEU A 1 391 ? -38.638 -22.032  2.313   1.00 68.17  ? 392 LEU A OXT 1 
ATOM   2799  N N   . ALA B 1 1   ? -4.424  -31.721  -38.708 1.00 68.93  ? 2   ALA B N   1 
ATOM   2800  C CA  . ALA B 1 1   ? -5.782  -31.256  -38.441 1.00 68.32  ? 2   ALA B CA  1 
ATOM   2801  C C   . ALA B 1 1   ? -6.795  -32.360  -38.717 1.00 63.22  ? 2   ALA B C   1 
ATOM   2802  O O   . ALA B 1 1   ? -7.473  -32.840  -37.811 1.00 63.31  ? 2   ALA B O   1 
ATOM   2803  C CB  . ALA B 1 1   ? -6.100  -30.022  -39.278 1.00 70.51  ? 2   ALA B CB  1 
ATOM   2804  N N   . ALA B 1 2   ? -6.894  -32.758  -39.979 1.00 58.93  ? 3   ALA B N   1 
ATOM   2805  C CA  . ALA B 1 2   ? -7.808  -33.821  -40.371 1.00 54.65  ? 3   ALA B CA  1 
ATOM   2806  C C   . ALA B 1 2   ? -7.139  -35.184  -40.219 1.00 52.90  ? 3   ALA B C   1 
ATOM   2807  O O   . ALA B 1 2   ? -7.769  -36.219  -40.418 1.00 48.73  ? 3   ALA B O   1 
ATOM   2808  C CB  . ALA B 1 2   ? -8.285  -33.613  -41.803 1.00 53.59  ? 3   ALA B CB  1 
ATOM   2809  N N   . LEU B 1 3   ? -5.860  -35.172  -39.859 1.00 52.66  ? 4   LEU B N   1 
ATOM   2810  C CA  . LEU B 1 3   ? -5.089  -36.402  -39.703 1.00 53.99  ? 4   LEU B CA  1 
ATOM   2811  C C   . LEU B 1 3   ? -5.246  -37.006  -38.309 1.00 56.66  ? 4   LEU B C   1 
ATOM   2812  O O   . LEU B 1 3   ? -4.979  -36.344  -37.312 1.00 58.56  ? 4   LEU B O   1 
ATOM   2813  C CB  . LEU B 1 3   ? -3.609  -36.136  -39.990 1.00 54.87  ? 4   LEU B CB  1 
ATOM   2814  C CG  . LEU B 1 3   ? -2.661  -37.325  -39.806 1.00 54.50  ? 4   LEU B CG  1 
ATOM   2815  C CD1 . LEU B 1 3   ? -2.871  -38.359  -40.905 1.00 51.53  ? 4   LEU B CD1 1 
ATOM   2816  C CD2 . LEU B 1 3   ? -1.203  -36.877  -39.739 1.00 54.49  ? 4   LEU B CD2 1 
ATOM   2817  N N   . ARG B 1 4   ? -5.673  -38.266  -38.244 1.00 58.00  ? 5   ARG B N   1 
ATOM   2818  C CA  . ARG B 1 4   ? -5.776  -38.987  -36.973 1.00 60.36  ? 5   ARG B CA  1 
ATOM   2819  C C   . ARG B 1 4   ? -4.477  -39.741  -36.672 1.00 61.98  ? 5   ARG B C   1 
ATOM   2820  O O   . ARG B 1 4   ? -3.837  -40.263  -37.585 1.00 60.14  ? 5   ARG B O   1 
ATOM   2821  C CB  . ARG B 1 4   ? -6.963  -39.950  -36.999 1.00 59.31  ? 5   ARG B CB  1 
ATOM   2822  N N   . GLN B 1 5   ? -4.104  -39.815  -35.394 1.00 66.27  ? 6   GLN B N   1 
ATOM   2823  C CA  . GLN B 1 5   ? -2.749  -40.231  -35.010 1.00 69.66  ? 6   GLN B CA  1 
ATOM   2824  C C   . GLN B 1 5   ? -2.430  -41.721  -35.261 1.00 73.53  ? 6   GLN B C   1 
ATOM   2825  O O   . GLN B 1 5   ? -1.495  -42.017  -36.004 1.00 74.62  ? 6   GLN B O   1 
ATOM   2826  C CB  . GLN B 1 5   ? -2.484  -39.864  -33.545 1.00 71.41  ? 6   GLN B CB  1 
ATOM   2827  N N   . PRO B 1 6   ? -3.165  -42.672  -34.648 1.00 76.28  ? 7   PRO B N   1 
ATOM   2828  C CA  . PRO B 1 6   ? -4.180  -42.703  -33.595 1.00 78.80  ? 7   PRO B CA  1 
ATOM   2829  C C   . PRO B 1 6   ? -3.540  -43.105  -32.274 1.00 80.65  ? 7   PRO B C   1 
ATOM   2830  O O   . PRO B 1 6   ? -2.392  -42.750  -32.002 1.00 81.36  ? 7   PRO B O   1 
ATOM   2831  C CB  . PRO B 1 6   ? -5.135  -43.782  -34.079 1.00 78.17  ? 7   PRO B CB  1 
ATOM   2832  C CG  . PRO B 1 6   ? -4.193  -44.794  -34.654 1.00 76.69  ? 7   PRO B CG  1 
ATOM   2833  C CD  . PRO B 1 6   ? -3.035  -44.007  -35.263 1.00 75.99  ? 7   PRO B CD  1 
ATOM   2834  N N   . GLN B 1 7   ? -4.269  -43.874  -31.475 1.00 80.86  ? 8   GLN B N   1 
ATOM   2835  C CA  . GLN B 1 7   ? -3.789  -44.269  -30.160 1.00 80.31  ? 8   GLN B CA  1 
ATOM   2836  C C   . GLN B 1 7   ? -2.731  -45.369  -30.225 1.00 77.37  ? 8   GLN B C   1 
ATOM   2837  O O   . GLN B 1 7   ? -1.572  -45.096  -30.528 1.00 77.04  ? 8   GLN B O   1 
ATOM   2838  C CB  . GLN B 1 7   ? -4.960  -44.727  -29.289 1.00 81.59  ? 8   GLN B CB  1 
ATOM   2839  N N   . VAL B 1 8   ? -3.170  -46.604  -29.979 1.00 74.81  ? 9   VAL B N   1 
ATOM   2840  C CA  . VAL B 1 8   ? -2.344  -47.760  -29.578 1.00 71.56  ? 9   VAL B CA  1 
ATOM   2841  C C   . VAL B 1 8   ? -1.480  -47.397  -28.363 1.00 69.50  ? 9   VAL B C   1 
ATOM   2842  O O   . VAL B 1 8   ? -0.910  -46.306  -28.277 1.00 70.65  ? 9   VAL B O   1 
ATOM   2843  C CB  . VAL B 1 8   ? -1.470  -48.340  -30.741 1.00 73.76  ? 9   VAL B CB  1 
ATOM   2844  C CG1 . VAL B 1 8   ? -0.120  -47.646  -30.873 1.00 73.71  ? 9   VAL B CG1 1 
ATOM   2845  C CG2 . VAL B 1 8   ? -1.263  -49.836  -30.533 1.00 72.53  ? 9   VAL B CG2 1 
ATOM   2846  N N   . ALA B 1 9   ? -1.426  -48.329  -27.416 1.00 67.13  ? 10  ALA B N   1 
ATOM   2847  C CA  . ALA B 1 9   ? -0.988  -48.078  -26.037 1.00 66.36  ? 10  ALA B CA  1 
ATOM   2848  C C   . ALA B 1 9   ? -2.024  -47.213  -25.321 1.00 65.33  ? 10  ALA B C   1 
ATOM   2849  O O   . ALA B 1 9   ? -2.512  -47.585  -24.257 1.00 66.98  ? 10  ALA B O   1 
ATOM   2850  C CB  . ALA B 1 9   ? 0.399   -47.429  -25.983 1.00 66.61  ? 10  ALA B CB  1 
ATOM   2851  N N   . GLU B 1 10  ? -2.368  -46.071  -25.912 1.00 63.61  ? 11  GLU B N   1 
ATOM   2852  C CA  . GLU B 1 10  ? -3.428  -45.221  -25.379 1.00 63.95  ? 11  GLU B CA  1 
ATOM   2853  C C   . GLU B 1 10  ? -4.784  -45.910  -25.507 1.00 61.23  ? 11  GLU B C   1 
ATOM   2854  O O   . GLU B 1 10  ? -5.649  -45.771  -24.646 1.00 61.54  ? 11  GLU B O   1 
ATOM   2855  C CB  . GLU B 1 10  ? -3.448  -43.869  -26.097 1.00 65.21  ? 11  GLU B CB  1 
ATOM   2856  N N   . LEU B 1 11  ? -4.961  -46.652  -26.594 1.00 59.44  ? 12  LEU B N   1 
ATOM   2857  C CA  . LEU B 1 11  ? -6.170  -47.439  -26.800 1.00 57.53  ? 12  LEU B CA  1 
ATOM   2858  C C   . LEU B 1 11  ? -6.239  -48.569  -25.770 1.00 55.97  ? 12  LEU B C   1 
ATOM   2859  O O   . LEU B 1 11  ? -7.300  -48.858  -25.214 1.00 55.17  ? 12  LEU B O   1 
ATOM   2860  C CB  . LEU B 1 11  ? -6.197  -48.000  -28.223 1.00 56.66  ? 12  LEU B CB  1 
ATOM   2861  C CG  . LEU B 1 11  ? -7.441  -48.741  -28.710 1.00 56.58  ? 12  LEU B CG  1 
ATOM   2862  C CD1 . LEU B 1 11  ? -8.643  -47.811  -28.790 1.00 58.44  ? 12  LEU B CD1 1 
ATOM   2863  C CD2 . LEU B 1 11  ? -7.162  -49.374  -30.062 1.00 54.45  ? 12  LEU B CD2 1 
ATOM   2864  N N   . LEU B 1 12  ? -5.094  -49.194  -25.517 1.00 55.16  ? 13  LEU B N   1 
ATOM   2865  C CA  . LEU B 1 12  ? -5.003  -50.295  -24.566 1.00 55.50  ? 13  LEU B CA  1 
ATOM   2866  C C   . LEU B 1 12  ? -5.206  -49.811  -23.136 1.00 58.34  ? 13  LEU B C   1 
ATOM   2867  O O   . LEU B 1 12  ? -5.921  -50.440  -22.358 1.00 60.11  ? 13  LEU B O   1 
ATOM   2868  C CB  . LEU B 1 12  ? -3.651  -50.997  -24.689 1.00 53.88  ? 13  LEU B CB  1 
ATOM   2869  C CG  . LEU B 1 12  ? -3.374  -52.105  -23.674 1.00 53.12  ? 13  LEU B CG  1 
ATOM   2870  C CD1 . LEU B 1 12  ? -4.404  -53.218  -23.781 1.00 51.33  ? 13  LEU B CD1 1 
ATOM   2871  C CD2 . LEU B 1 12  ? -1.965  -52.652  -23.849 1.00 52.86  ? 13  LEU B CD2 1 
ATOM   2872  N N   . ALA B 1 13  ? -4.565  -48.695  -22.798 1.00 59.37  ? 14  ALA B N   1 
ATOM   2873  C CA  . ALA B 1 13  ? -4.728  -48.077  -21.486 1.00 63.34  ? 14  ALA B CA  1 
ATOM   2874  C C   . ALA B 1 13  ? -6.192  -47.741  -21.222 1.00 65.44  ? 14  ALA B C   1 
ATOM   2875  O O   . ALA B 1 13  ? -6.696  -47.964  -20.122 1.00 66.75  ? 14  ALA B O   1 
ATOM   2876  C CB  . ALA B 1 13  ? -3.869  -46.826  -21.377 1.00 64.23  ? 14  ALA B CB  1 
ATOM   2877  N N   . GLU B 1 14  ? -6.869  -47.214  -22.239 1.00 65.61  ? 15  GLU B N   1 
ATOM   2878  C CA  . GLU B 1 14  ? -8.285  -46.877  -22.130 1.00 67.68  ? 15  GLU B CA  1 
ATOM   2879  C C   . GLU B 1 14  ? -9.118  -48.133  -21.889 1.00 65.56  ? 15  GLU B C   1 
ATOM   2880  O O   . GLU B 1 14  ? -10.075 -48.115  -21.115 1.00 67.89  ? 15  GLU B O   1 
ATOM   2881  C CB  . GLU B 1 14  ? -8.766  -46.153  -23.391 1.00 69.47  ? 15  GLU B CB  1 
ATOM   2882  C CG  . GLU B 1 14  ? -10.277 -45.970  -23.487 1.00 72.74  ? 15  GLU B CG  1 
ATOM   2883  C CD  . GLU B 1 14  ? -10.699 -45.254  -24.765 1.00 74.95  ? 15  GLU B CD  1 
ATOM   2884  O OE1 . GLU B 1 14  ? -9.866  -44.525  -25.347 1.00 75.14  ? 15  GLU B OE1 1 
ATOM   2885  O OE2 . GLU B 1 14  ? -11.860 -45.431  -25.196 1.00 75.96  ? 15  GLU B OE2 1 
ATOM   2886  N N   . ALA B 1 15  ? -8.740  -49.224  -22.547 1.00 60.47  ? 16  ALA B N   1 
ATOM   2887  C CA  . ALA B 1 15  ? -9.424  -50.499  -22.372 1.00 57.73  ? 16  ALA B CA  1 
ATOM   2888  C C   . ALA B 1 15  ? -9.230  -51.036  -20.955 1.00 58.94  ? 16  ALA B C   1 
ATOM   2889  O O   . ALA B 1 15  ? -10.177 -51.508  -20.327 1.00 59.77  ? 16  ALA B O   1 
ATOM   2890  C CB  . ALA B 1 15  ? -8.931  -51.513  -23.394 1.00 54.46  ? 16  ALA B CB  1 
ATOM   2891  N N   . ARG B 1 16  ? -8.000  -50.956  -20.457 1.00 59.98  ? 17  ARG B N   1 
ATOM   2892  C CA  . ARG B 1 16  ? -7.671  -51.493  -19.140 1.00 62.31  ? 17  ARG B CA  1 
ATOM   2893  C C   . ARG B 1 16  ? -8.287  -50.664  -18.012 1.00 63.64  ? 17  ARG B C   1 
ATOM   2894  O O   . ARG B 1 16  ? -8.772  -51.218  -17.028 1.00 65.13  ? 17  ARG B O   1 
ATOM   2895  C CB  . ARG B 1 16  ? -6.153  -51.577  -18.970 1.00 63.60  ? 17  ARG B CB  1 
ATOM   2896  C CG  . ARG B 1 16  ? -5.501  -52.602  -19.881 1.00 63.71  ? 17  ARG B CG  1 
ATOM   2897  C CD  . ARG B 1 16  ? -3.987  -52.490  -19.878 1.00 64.90  ? 17  ARG B CD  1 
ATOM   2898  N NE  . ARG B 1 16  ? -3.386  -53.144  -18.719 1.00 67.66  ? 17  ARG B NE  1 
ATOM   2899  C CZ  . ARG B 1 16  ? -2.102  -53.478  -18.638 1.00 68.23  ? 17  ARG B CZ  1 
ATOM   2900  N NH1 . ARG B 1 16  ? -1.285  -53.231  -19.655 1.00 67.67  ? 17  ARG B NH1 1 
ATOM   2901  N NH2 . ARG B 1 16  ? -1.638  -54.069  -17.547 1.00 69.12  ? 17  ARG B NH2 1 
ATOM   2902  N N   . ARG B 1 17  ? -8.274  -49.343  -18.162 1.00 63.36  ? 18  ARG B N   1 
ATOM   2903  C CA  . ARG B 1 17  ? -8.872  -48.454  -17.168 1.00 65.98  ? 18  ARG B CA  1 
ATOM   2904  C C   . ARG B 1 17  ? -10.393 -48.591  -17.131 1.00 66.38  ? 18  ARG B C   1 
ATOM   2905  O O   . ARG B 1 17  ? -11.022 -48.314  -16.112 1.00 68.01  ? 18  ARG B O   1 
ATOM   2906  C CB  . ARG B 1 17  ? -8.486  -46.999  -17.446 1.00 66.78  ? 18  ARG B CB  1 
ATOM   2907  N N   . ALA B 1 18  ? -10.981 -49.019  -18.246 1.00 64.64  ? 19  ALA B N   1 
ATOM   2908  C CA  . ALA B 1 18  ? -12.430 -49.177  -18.333 1.00 65.04  ? 19  ALA B CA  1 
ATOM   2909  C C   . ALA B 1 18  ? -12.888 -50.528  -17.782 1.00 65.09  ? 19  ALA B C   1 
ATOM   2910  O O   . ALA B 1 18  ? -13.958 -50.627  -17.179 1.00 67.08  ? 19  ALA B O   1 
ATOM   2911  C CB  . ALA B 1 18  ? -12.897 -49.007  -19.772 1.00 64.42  ? 19  ALA B CB  1 
ATOM   2912  N N   . PHE B 1 19  ? -12.077 -51.562  -17.991 1.00 63.10  ? 20  PHE B N   1 
ATOM   2913  C CA  . PHE B 1 19  ? -12.376 -52.893  -17.467 1.00 63.06  ? 20  PHE B CA  1 
ATOM   2914  C C   . PHE B 1 19  ? -12.348 -52.888  -15.942 1.00 64.63  ? 20  PHE B C   1 
ATOM   2915  O O   . PHE B 1 19  ? -13.229 -53.454  -15.293 1.00 65.99  ? 20  PHE B O   1 
ATOM   2916  C CB  . PHE B 1 19  ? -11.385 -53.930  -18.018 1.00 61.21  ? 20  PHE B CB  1 
ATOM   2917  C CG  . PHE B 1 19  ? -11.720 -55.356  -17.648 1.00 60.92  ? 20  PHE B CG  1 
ATOM   2918  C CD1 . PHE B 1 19  ? -11.359 -55.878  -16.409 1.00 61.56  ? 20  PHE B CD1 1 
ATOM   2919  C CD2 . PHE B 1 19  ? -12.388 -56.175  -18.544 1.00 59.46  ? 20  PHE B CD2 1 
ATOM   2920  C CE1 . PHE B 1 19  ? -11.668 -57.183  -16.070 1.00 61.09  ? 20  PHE B CE1 1 
ATOM   2921  C CE2 . PHE B 1 19  ? -12.697 -57.482  -18.212 1.00 59.45  ? 20  PHE B CE2 1 
ATOM   2922  C CZ  . PHE B 1 19  ? -12.337 -57.987  -16.971 1.00 60.55  ? 20  PHE B CZ  1 
ATOM   2923  N N   . ARG B 1 20  ? -11.333 -52.244  -15.377 1.00 64.12  ? 21  ARG B N   1 
ATOM   2924  C CA  . ARG B 1 20  ? -11.161 -52.210  -13.932 1.00 65.36  ? 21  ARG B CA  1 
ATOM   2925  C C   . ARG B 1 20  ? -12.298 -51.449  -13.259 1.00 67.49  ? 21  ARG B C   1 
ATOM   2926  O O   . ARG B 1 20  ? -12.787 -51.854  -12.208 1.00 68.36  ? 21  ARG B O   1 
ATOM   2927  C CB  . ARG B 1 20  ? -9.816  -51.579  -13.568 1.00 64.79  ? 21  ARG B CB  1 
ATOM   2928  N N   . GLU B 1 21  ? -12.721 -50.348  -13.869 1.00 67.97  ? 22  GLU B N   1 
ATOM   2929  C CA  . GLU B 1 21  ? -13.822 -49.565  -13.324 1.00 70.40  ? 22  GLU B CA  1 
ATOM   2930  C C   . GLU B 1 21  ? -15.125 -50.361  -13.353 1.00 72.88  ? 22  GLU B C   1 
ATOM   2931  O O   . GLU B 1 21  ? -15.874 -50.376  -12.377 1.00 75.49  ? 22  GLU B O   1 
ATOM   2932  C CB  . GLU B 1 21  ? -13.984 -48.254  -14.095 1.00 69.02  ? 22  GLU B CB  1 
ATOM   2933  N N   . GLU B 1 22  ? -15.381 -51.036  -14.469 1.00 71.98  ? 23  GLU B N   1 
ATOM   2934  C CA  . GLU B 1 22  ? -16.626 -51.774  -14.657 1.00 73.21  ? 23  GLU B CA  1 
ATOM   2935  C C   . GLU B 1 22  ? -16.668 -53.087  -13.875 1.00 74.82  ? 23  GLU B C   1 
ATOM   2936  O O   . GLU B 1 22  ? -17.680 -53.409  -13.254 1.00 76.29  ? 23  GLU B O   1 
ATOM   2937  C CB  . GLU B 1 22  ? -16.852 -52.058  -16.144 1.00 71.20  ? 23  GLU B CB  1 
ATOM   2938  N N   . PHE B 1 23  ? -15.574 -53.842  -13.902 1.00 74.37  ? 24  PHE B N   1 
ATOM   2939  C CA  . PHE B 1 23  ? -15.575 -55.188  -13.332 1.00 74.91  ? 24  PHE B CA  1 
ATOM   2940  C C   . PHE B 1 23  ? -14.817 -55.305  -12.009 1.00 76.39  ? 24  PHE B C   1 
ATOM   2941  O O   . PHE B 1 23  ? -14.808 -56.369  -11.390 1.00 75.46  ? 24  PHE B O   1 
ATOM   2942  C CB  . PHE B 1 23  ? -14.993 -56.180  -14.338 1.00 72.10  ? 24  PHE B CB  1 
ATOM   2943  C CG  . PHE B 1 23  ? -15.709 -56.192  -15.659 1.00 71.09  ? 24  PHE B CG  1 
ATOM   2944  C CD1 . PHE B 1 23  ? -16.896 -56.891  -15.813 1.00 71.59  ? 24  PHE B CD1 1 
ATOM   2945  C CD2 . PHE B 1 23  ? -15.194 -55.506  -16.746 1.00 68.73  ? 24  PHE B CD2 1 
ATOM   2946  C CE1 . PHE B 1 23  ? -17.556 -56.904  -17.031 1.00 70.13  ? 24  PHE B CE1 1 
ATOM   2947  C CE2 . PHE B 1 23  ? -15.850 -55.514  -17.963 1.00 66.72  ? 24  PHE B CE2 1 
ATOM   2948  C CZ  . PHE B 1 23  ? -17.031 -56.214  -18.106 1.00 67.25  ? 24  PHE B CZ  1 
ATOM   2949  N N   . GLY B 1 24  ? -14.177 -54.221  -11.585 1.00 78.37  ? 25  GLY B N   1 
ATOM   2950  C CA  . GLY B 1 24  ? -13.486 -54.200  -10.308 1.00 82.54  ? 25  GLY B CA  1 
ATOM   2951  C C   . GLY B 1 24  ? -12.060 -54.715  -10.366 1.00 83.11  ? 25  GLY B C   1 
ATOM   2952  O O   . GLY B 1 24  ? -11.137 -54.069  -9.867  1.00 85.56  ? 25  GLY B O   1 
ATOM   2953  N N   . ALA B 1 25  ? -11.876 -55.881  -10.978 1.00 79.72  ? 26  ALA B N   1 
ATOM   2954  C CA  . ALA B 1 25  ? -10.575 -56.536  -10.992 1.00 76.64  ? 26  ALA B CA  1 
ATOM   2955  C C   . ALA B 1 25  ? -9.779  -56.199  -12.249 1.00 72.45  ? 26  ALA B C   1 
ATOM   2956  O O   . ALA B 1 25  ? -10.317 -55.668  -13.219 1.00 70.50  ? 26  ALA B O   1 
ATOM   2957  C CB  . ALA B 1 25  ? -10.743 -58.043  -10.861 1.00 76.83  ? 26  ALA B CB  1 
ATOM   2958  N N   . GLU B 1 26  ? -8.489  -56.512  -12.211 1.00 70.85  ? 27  GLU B N   1 
ATOM   2959  C CA  . GLU B 1 26  ? -7.600  -56.279  -13.335 1.00 68.85  ? 27  GLU B CA  1 
ATOM   2960  C C   . GLU B 1 26  ? -7.807  -57.357  -14.393 1.00 65.85  ? 27  GLU B C   1 
ATOM   2961  O O   . GLU B 1 26  ? -7.939  -58.536  -14.060 1.00 66.33  ? 27  GLU B O   1 
ATOM   2962  C CB  . GLU B 1 26  ? -6.143  -56.260  -12.866 1.00 70.09  ? 27  GLU B CB  1 
ATOM   2963  C CG  . GLU B 1 26  ? -5.251  -55.315  -13.651 1.00 68.77  ? 27  GLU B CG  1 
ATOM   2964  C CD  . GLU B 1 26  ? -5.642  -53.864  -13.463 1.00 69.14  ? 27  GLU B CD  1 
ATOM   2965  O OE1 . GLU B 1 26  ? -6.060  -53.497  -12.341 1.00 70.03  ? 27  GLU B OE1 1 
ATOM   2966  O OE2 . GLU B 1 26  ? -5.538  -53.089  -14.437 1.00 67.95  ? 27  GLU B OE2 1 
ATOM   2967  N N   . PRO B 1 27  ? -7.848  -56.958  -15.675 1.00 62.60  ? 28  PRO B N   1 
ATOM   2968  C CA  . PRO B 1 27  ? -8.018  -57.950  -16.739 1.00 59.27  ? 28  PRO B CA  1 
ATOM   2969  C C   . PRO B 1 27  ? -6.805  -58.857  -16.860 1.00 56.75  ? 28  PRO B C   1 
ATOM   2970  O O   . PRO B 1 27  ? -5.679  -58.395  -16.695 1.00 55.98  ? 28  PRO B O   1 
ATOM   2971  C CB  . PRO B 1 27  ? -8.181  -57.092  -17.994 1.00 58.61  ? 28  PRO B CB  1 
ATOM   2972  C CG  . PRO B 1 27  ? -7.442  -55.836  -17.673 1.00 60.05  ? 28  PRO B CG  1 
ATOM   2973  C CD  . PRO B 1 27  ? -7.697  -55.595  -16.213 1.00 61.37  ? 28  PRO B CD  1 
ATOM   2974  N N   . GLU B 1 28  ? -7.037  -60.132  -17.147 1.00 56.67  ? 29  GLU B N   1 
ATOM   2975  C CA  . GLU B 1 28  ? -5.951  -61.091  -17.288 1.00 57.96  ? 29  GLU B CA  1 
ATOM   2976  C C   . GLU B 1 28  ? -5.356  -61.070  -18.685 1.00 56.03  ? 29  GLU B C   1 
ATOM   2977  O O   . GLU B 1 28  ? -4.220  -61.495  -18.890 1.00 56.03  ? 29  GLU B O   1 
ATOM   2978  C CB  . GLU B 1 28  ? -6.440  -62.503  -16.974 1.00 61.38  ? 29  GLU B CB  1 
ATOM   2979  C CG  . GLU B 1 28  ? -6.713  -62.770  -15.507 1.00 65.62  ? 29  GLU B CG  1 
ATOM   2980  C CD  . GLU B 1 28  ? -7.049  -64.224  -15.255 1.00 68.63  ? 29  GLU B CD  1 
ATOM   2981  O OE1 . GLU B 1 28  ? -7.960  -64.497  -14.444 1.00 71.38  ? 29  GLU B OE1 1 
ATOM   2982  O OE2 . GLU B 1 28  ? -6.405  -65.096  -15.879 1.00 68.19  ? 29  GLU B OE2 1 
ATOM   2983  N N   . LEU B 1 29  ? -6.129  -60.561  -19.639 1.00 54.56  ? 30  LEU B N   1 
ATOM   2984  C CA  . LEU B 1 29  ? -5.838  -60.774  -21.049 1.00 54.71  ? 30  LEU B CA  1 
ATOM   2985  C C   . LEU B 1 29  ? -5.992  -59.534  -21.919 1.00 53.07  ? 30  LEU B C   1 
ATOM   2986  O O   . LEU B 1 29  ? -6.856  -58.692  -21.683 1.00 54.50  ? 30  LEU B O   1 
ATOM   2987  C CB  . LEU B 1 29  ? -6.754  -61.862  -21.595 1.00 56.54  ? 30  LEU B CB  1 
ATOM   2988  C CG  . LEU B 1 29  ? -6.193  -63.244  -21.902 1.00 58.33  ? 30  LEU B CG  1 
ATOM   2989  C CD1 . LEU B 1 29  ? -6.023  -64.073  -20.645 1.00 60.49  ? 30  LEU B CD1 1 
ATOM   2990  C CD2 . LEU B 1 29  ? -7.148  -63.902  -22.865 1.00 58.84  ? 30  LEU B CD2 1 
ATOM   2991  N N   . ALA B 1 30  ? -5.155  -59.444  -22.944 1.00 50.78  ? 31  ALA B N   1 
ATOM   2992  C CA  . ALA B 1 30  ? -5.292  -58.406  -23.951 1.00 49.50  ? 31  ALA B CA  1 
ATOM   2993  C C   . ALA B 1 30  ? -5.084  -59.017  -25.328 1.00 48.24  ? 31  ALA B C   1 
ATOM   2994  O O   . ALA B 1 30  ? -4.121  -59.755  -25.544 1.00 43.81  ? 31  ALA B O   1 
ATOM   2995  C CB  . ALA B 1 30  ? -4.304  -57.283  -23.707 1.00 49.29  ? 31  ALA B CB  1 
ATOM   2996  N N   . VAL B 1 31  ? -6.000  -58.735  -26.250 1.00 43.02  ? 32  VAL B N   1 
ATOM   2997  C CA  . VAL B 1 31  ? -5.825  -59.147  -27.641 1.00 44.62  ? 32  VAL B CA  1 
ATOM   2998  C C   . VAL B 1 31  ? -6.241  -58.020  -28.575 1.00 43.86  ? 32  VAL B C   1 
ATOM   2999  O O   . VAL B 1 31  ? -7.046  -57.162  -28.211 1.00 46.07  ? 32  VAL B O   1 
ATOM   3000  C CB  . VAL B 1 31  ? -6.638  -60.413  -27.996 1.00 41.60  ? 32  VAL B CB  1 
ATOM   3001  C CG1 . VAL B 1 31  ? -6.211  -61.598  -27.141 1.00 42.67  ? 32  VAL B CG1 1 
ATOM   3002  C CG2 . VAL B 1 31  ? -8.130  -60.149  -27.863 1.00 42.93  ? 32  VAL B CG2 1 
ATOM   3003  N N   . SER B 1 32  ? -5.688  -58.027  -29.781 1.00 41.30  ? 33  SER B N   1 
ATOM   3004  C CA  . SER B 1 32  ? -6.041  -57.026  -30.773 1.00 38.73  ? 33  SER B CA  1 
ATOM   3005  C C   . SER B 1 32  ? -6.128  -57.648  -32.159 1.00 40.10  ? 33  SER B C   1 
ATOM   3006  O O   . SER B 1 32  ? -5.558  -58.712  -32.407 1.00 37.42  ? 33  SER B O   1 
ATOM   3007  C CB  . SER B 1 32  ? -5.022  -55.886  -30.773 1.00 38.80  ? 33  SER B CB  1 
ATOM   3008  O OG  . SER B 1 32  ? -3.763  -56.329  -31.246 1.00 38.42  ? 33  SER B OG  1 
ATOM   3009  N N   . ALA B 1 33  ? -6.854  -56.980  -33.052 1.00 36.97  ? 34  ALA B N   1 
ATOM   3010  C CA  . ALA B 1 33  ? -6.919  -57.366  -34.460 1.00 36.83  ? 34  ALA B CA  1 
ATOM   3011  C C   . ALA B 1 33  ? -7.170  -56.116  -35.298 1.00 35.43  ? 34  ALA B C   1 
ATOM   3012  O O   . ALA B 1 33  ? -8.063  -55.328  -34.988 1.00 35.88  ? 34  ALA B O   1 
ATOM   3013  C CB  . ALA B 1 33  ? -8.004  -58.405  -34.690 1.00 36.03  ? 34  ALA B CB  1 
ATOM   3014  N N   . PRO B 1 34  ? -6.368  -55.922  -36.355 1.00 34.67  ? 35  PRO B N   1 
ATOM   3015  C CA  . PRO B 1 34  ? -6.375  -54.678  -37.135 1.00 37.77  ? 35  PRO B CA  1 
ATOM   3016  C C   . PRO B 1 34  ? -7.556  -54.519  -38.077 1.00 36.95  ? 35  PRO B C   1 
ATOM   3017  O O   . PRO B 1 34  ? -8.193  -55.497  -38.480 1.00 33.70  ? 35  PRO B O   1 
ATOM   3018  C CB  . PRO B 1 34  ? -5.090  -54.783  -37.959 1.00 33.83  ? 35  PRO B CB  1 
ATOM   3019  C CG  . PRO B 1 34  ? -4.955  -56.248  -38.194 1.00 33.53  ? 35  PRO B CG  1 
ATOM   3020  C CD  . PRO B 1 34  ? -5.401  -56.894  -36.893 1.00 34.24  ? 35  PRO B CD  1 
ATOM   3021  N N   . GLY B 1 35  ? -7.825  -53.268  -38.433 1.00 36.12  ? 36  GLY B N   1 
ATOM   3022  C CA  . GLY B 1 35  ? -8.646  -52.968  -39.584 1.00 33.69  ? 36  GLY B CA  1 
ATOM   3023  C C   . GLY B 1 35  ? -7.750  -53.128  -40.798 1.00 32.87  ? 36  GLY B C   1 
ATOM   3024  O O   . GLY B 1 35  ? -6.588  -53.531  -40.679 1.00 32.70  ? 36  GLY B O   1 
ATOM   3025  N N   . ARG B 1 36  ? -8.271  -52.797  -41.971 1.00 32.53  ? 37  ARG B N   1 
ATOM   3026  C CA  . ARG B 1 36  ? -7.538  -53.089  -43.193 1.00 38.28  ? 37  ARG B CA  1 
ATOM   3027  C C   . ARG B 1 36  ? -7.772  -52.083  -44.310 1.00 36.14  ? 37  ARG B C   1 
ATOM   3028  O O   . ARG B 1 36  ? -8.820  -51.449  -44.388 1.00 32.16  ? 37  ARG B O   1 
ATOM   3029  C CB  . ARG B 1 36  ? -7.913  -54.481  -43.702 1.00 39.48  ? 37  ARG B CB  1 
ATOM   3030  C CG  . ARG B 1 36  ? -9.210  -54.473  -44.497 1.00 42.93  ? 37  ARG B CG  1 
ATOM   3031  C CD  . ARG B 1 36  ? -9.034  -55.104  -45.862 1.00 46.84  ? 37  ARG B CD  1 
ATOM   3032  N NE  . ARG B 1 36  ? -10.230 -54.977  -46.687 1.00 50.91  ? 37  ARG B NE  1 
ATOM   3033  C CZ  . ARG B 1 36  ? -10.613 -53.850  -47.279 1.00 56.18  ? 37  ARG B CZ  1 
ATOM   3034  N NH1 . ARG B 1 36  ? -9.897  -52.741  -47.136 1.00 57.65  ? 37  ARG B NH1 1 
ATOM   3035  N NH2 . ARG B 1 36  ? -11.711 -53.834  -48.023 1.00 58.57  ? 37  ARG B NH2 1 
ATOM   3036  N N   . VAL B 1 37  ? -6.766  -51.940  -45.163 1.00 33.76  ? 38  VAL B N   1 
ATOM   3037  C CA  . VAL B 1 37  ? -6.937  -51.250  -46.429 1.00 31.38  ? 38  VAL B CA  1 
ATOM   3038  C C   . VAL B 1 37  ? -6.549  -52.231  -47.534 1.00 30.76  ? 38  VAL B C   1 
ATOM   3039  O O   . VAL B 1 37  ? -5.616  -53.017  -47.379 1.00 32.51  ? 38  VAL B O   1 
ATOM   3040  C CB  . VAL B 1 37  ? -6.097  -49.947  -46.505 1.00 32.70  ? 38  VAL B CB  1 
ATOM   3041  C CG1 . VAL B 1 37  ? -4.608  -50.250  -46.621 1.00 32.18  ? 38  VAL B CG1 1 
ATOM   3042  C CG2 . VAL B 1 37  ? -6.567  -49.068  -47.658 1.00 33.03  ? 38  VAL B CG2 1 
ATOM   3043  N N   . ASN B 1 38  ? -7.303  -52.221  -48.624 1.00 31.69  ? 39  ASN B N   1 
ATOM   3044  C CA  . ASN B 1 38  ? -6.969  -53.038  -49.784 1.00 30.70  ? 39  ASN B CA  1 
ATOM   3045  C C   . ASN B 1 38  ? -6.223  -52.180  -50.791 1.00 31.36  ? 39  ASN B C   1 
ATOM   3046  O O   . ASN B 1 38  ? -6.759  -51.185  -51.273 1.00 31.17  ? 39  ASN B O   1 
ATOM   3047  C CB  . ASN B 1 38  ? -8.228  -53.635  -50.412 1.00 31.14  ? 39  ASN B CB  1 
ATOM   3048  C CG  . ASN B 1 38  ? -7.918  -54.762  -51.370 1.00 32.40  ? 39  ASN B CG  1 
ATOM   3049  O OD1 . ASN B 1 38  ? -6.780  -55.228  -51.453 1.00 34.15  ? 39  ASN B OD1 1 
ATOM   3050  N ND2 . ASN B 1 38  ? -8.933  -55.220  -52.091 1.00 32.89  ? 39  ASN B ND2 1 
ATOM   3051  N N   . LEU B 1 39  ? -4.978  -52.538  -51.079 1.00 30.27  ? 40  LEU B N   1 
ATOM   3052  C CA  . LEU B 1 39  ? -4.163  -51.729  -51.968 1.00 30.61  ? 40  LEU B CA  1 
ATOM   3053  C C   . LEU B 1 39  ? -4.730  -51.825  -53.383 1.00 33.23  ? 40  LEU B C   1 
ATOM   3054  O O   . LEU B 1 39  ? -4.799  -50.829  -54.103 1.00 30.90  ? 40  LEU B O   1 
ATOM   3055  C CB  . LEU B 1 39  ? -2.700  -52.175  -51.922 1.00 31.08  ? 40  LEU B CB  1 
ATOM   3056  C CG  . LEU B 1 39  ? -2.028  -52.153  -50.542 1.00 33.24  ? 40  LEU B CG  1 
ATOM   3057  C CD1 . LEU B 1 39  ? -0.550  -52.539  -50.637 1.00 33.40  ? 40  LEU B CD1 1 
ATOM   3058  C CD2 . LEU B 1 39  ? -2.197  -50.798  -49.860 1.00 32.76  ? 40  LEU B CD2 1 
ATOM   3059  N N   . ILE B 1 40  ? -5.158  -53.030  -53.751 1.00 32.61  ? 41  ILE B N   1 
ATOM   3060  C CA  . ILE B 1 40  ? -5.747  -53.306  -55.063 1.00 31.77  ? 41  ILE B CA  1 
ATOM   3061  C C   . ILE B 1 40  ? -6.291  -54.733  -55.051 1.00 32.58  ? 41  ILE B C   1 
ATOM   3062  O O   . ILE B 1 40  ? -5.856  -55.562  -54.241 1.00 34.20  ? 41  ILE B O   1 
ATOM   3063  C CB  . ILE B 1 40  ? -4.718  -53.127  -56.203 1.00 30.42  ? 41  ILE B CB  1 
ATOM   3064  C CG1 . ILE B 1 40  ? -5.415  -52.995  -57.564 1.00 31.30  ? 41  ILE B CG1 1 
ATOM   3065  C CG2 . ILE B 1 40  ? -3.710  -54.257  -56.198 1.00 30.38  ? 41  ILE B CG2 1 
ATOM   3066  C CD1 . ILE B 1 40  ? -4.450  -52.763  -58.704 1.00 32.97  ? 41  ILE B CD1 1 
ATOM   3067  N N   . GLY B 1 41  ? -7.254  -55.012  -55.923 1.00 31.86  ? 42  GLY B N   1 
ATOM   3068  C CA  . GLY B 1 41  ? -7.920  -56.300  -55.945 1.00 31.97  ? 42  GLY B CA  1 
ATOM   3069  C C   . GLY B 1 41  ? -9.309  -56.203  -55.350 1.00 32.99  ? 42  GLY B C   1 
ATOM   3070  O O   . GLY B 1 41  ? -9.623  -56.875  -54.366 1.00 34.13  ? 42  GLY B O   1 
ATOM   3071  N N   . GLU B 1 42  ? -10.149 -55.365  -55.949 1.00 32.60  ? 43  GLU B N   1 
ATOM   3072  C CA  . GLU B 1 42  ? -11.458 -55.072  -55.370 1.00 32.58  ? 43  GLU B CA  1 
ATOM   3073  C C   . GLU B 1 42  ? -12.571 -55.886  -56.018 1.00 34.31  ? 43  GLU B C   1 
ATOM   3074  O O   . GLU B 1 42  ? -12.608 -56.043  -57.239 1.00 35.56  ? 43  GLU B O   1 
ATOM   3075  C CB  . GLU B 1 42  ? -11.772 -53.584  -55.496 1.00 31.67  ? 43  GLU B CB  1 
ATOM   3076  C CG  . GLU B 1 42  ? -12.454 -52.985  -54.288 1.00 32.96  ? 43  GLU B CG  1 
ATOM   3077  C CD  . GLU B 1 42  ? -11.533 -52.922  -53.077 1.00 34.82  ? 43  GLU B CD  1 
ATOM   3078  O OE1 . GLU B 1 42  ? -11.586 -53.839  -52.230 1.00 30.99  ? 43  GLU B OE1 1 
ATOM   3079  O OE2 . GLU B 1 42  ? -10.749 -51.957  -52.984 1.00 34.25  ? 43  GLU B OE2 1 
ATOM   3080  N N   . HIS B 1 43  ? -13.478 -56.385  -55.181 1.00 34.52  ? 44  HIS B N   1 
ATOM   3081  C CA  . HIS B 1 43  ? -14.596 -57.217  -55.610 1.00 35.13  ? 44  HIS B CA  1 
ATOM   3082  C C   . HIS B 1 43  ? -14.115 -58.413  -56.420 1.00 35.99  ? 44  HIS B C   1 
ATOM   3083  O O   . HIS B 1 43  ? -14.749 -58.819  -57.400 1.00 38.71  ? 44  HIS B O   1 
ATOM   3084  C CB  . HIS B 1 43  ? -15.601 -56.391  -56.409 1.00 35.55  ? 44  HIS B CB  1 
ATOM   3085  C CG  . HIS B 1 43  ? -16.350 -55.400  -55.577 1.00 35.62  ? 44  HIS B CG  1 
ATOM   3086  N ND1 . HIS B 1 43  ? -17.525 -55.713  -54.930 1.00 37.20  ? 44  HIS B ND1 1 
ATOM   3087  C CD2 . HIS B 1 43  ? -16.083 -54.109  -55.270 1.00 35.04  ? 44  HIS B CD2 1 
ATOM   3088  C CE1 . HIS B 1 43  ? -17.955 -54.654  -54.267 1.00 37.68  ? 44  HIS B CE1 1 
ATOM   3089  N NE2 . HIS B 1 43  ? -17.099 -53.665  -54.460 1.00 36.38  ? 44  HIS B NE2 1 
ATOM   3090  N N   . THR B 1 44  ? -12.981 -58.961  -56.001 1.00 33.15  ? 45  THR B N   1 
ATOM   3091  C CA  . THR B 1 44  ? -12.424 -60.153  -56.615 1.00 34.23  ? 45  THR B CA  1 
ATOM   3092  C C   . THR B 1 44  ? -12.459 -61.337  -55.662 1.00 34.43  ? 45  THR B C   1 
ATOM   3093  O O   . THR B 1 44  ? -12.443 -62.492  -56.094 1.00 35.21  ? 45  THR B O   1 
ATOM   3094  C CB  . THR B 1 44  ? -10.965 -59.934  -57.057 1.00 33.87  ? 45  THR B CB  1 
ATOM   3095  O OG1 . THR B 1 44  ? -10.202 -59.426  -55.950 1.00 32.59  ? 45  THR B OG1 1 
ATOM   3096  C CG2 . THR B 1 44  ? -10.901 -58.947  -58.211 1.00 32.51  ? 45  THR B CG2 1 
ATOM   3097  N N   . ASP B 1 45  ? -12.504 -61.057  -54.363 1.00 34.30  ? 46  ASP B N   1 
ATOM   3098  C CA  . ASP B 1 45  ? -12.300 -62.126  -53.396 1.00 34.65  ? 46  ASP B CA  1 
ATOM   3099  C C   . ASP B 1 45  ? -13.444 -63.138  -53.435 1.00 36.58  ? 46  ASP B C   1 
ATOM   3100  O O   . ASP B 1 45  ? -13.205 -64.340  -53.317 1.00 38.17  ? 46  ASP B O   1 
ATOM   3101  C CB  . ASP B 1 45  ? -12.078 -61.564  -51.975 1.00 35.75  ? 46  ASP B CB  1 
ATOM   3102  C CG  . ASP B 1 45  ? -13.288 -60.849  -51.397 1.00 36.56  ? 46  ASP B CG  1 
ATOM   3103  O OD1 . ASP B 1 45  ? -14.183 -60.418  -52.151 1.00 36.29  ? 46  ASP B OD1 1 
ATOM   3104  O OD2 . ASP B 1 45  ? -13.319 -60.696  -50.152 1.00 38.31  ? 46  ASP B OD2 1 
ATOM   3105  N N   . TYR B 1 46  ? -14.674 -62.682  -53.646 1.00 34.60  ? 47  TYR B N   1 
ATOM   3106  C CA  . TYR B 1 46  ? -15.776 -63.634  -53.757 1.00 37.51  ? 47  TYR B CA  1 
ATOM   3107  C C   . TYR B 1 46  ? -15.894 -64.182  -55.183 1.00 37.92  ? 47  TYR B C   1 
ATOM   3108  O O   . TYR B 1 46  ? -16.812 -64.945  -55.487 1.00 39.36  ? 47  TYR B O   1 
ATOM   3109  C CB  . TYR B 1 46  ? -17.100 -63.003  -53.305 1.00 38.61  ? 47  TYR B CB  1 
ATOM   3110  C CG  . TYR B 1 46  ? -17.460 -61.683  -53.962 1.00 38.60  ? 47  TYR B CG  1 
ATOM   3111  C CD1 . TYR B 1 46  ? -17.995 -61.641  -55.244 1.00 38.49  ? 47  TYR B CD1 1 
ATOM   3112  C CD2 . TYR B 1 46  ? -17.291 -60.482  -53.284 1.00 37.80  ? 47  TYR B CD2 1 
ATOM   3113  C CE1 . TYR B 1 46  ? -18.334 -60.437  -55.836 1.00 39.88  ? 47  TYR B CE1 1 
ATOM   3114  C CE2 . TYR B 1 46  ? -17.628 -59.278  -53.865 1.00 37.74  ? 47  TYR B CE2 1 
ATOM   3115  C CZ  . TYR B 1 46  ? -18.150 -59.258  -55.140 1.00 38.74  ? 47  TYR B CZ  1 
ATOM   3116  O OH  . TYR B 1 46  ? -18.484 -58.055  -55.715 1.00 36.13  ? 47  TYR B OH  1 
ATOM   3117  N N   . ASN B 1 47  ? -14.961 -63.790  -56.048 1.00 35.80  ? 48  ASN B N   1 
ATOM   3118  C CA  . ASN B 1 47  ? -14.862 -64.361  -57.390 1.00 36.93  ? 48  ASN B CA  1 
ATOM   3119  C C   . ASN B 1 47  ? -13.630 -65.246  -57.525 1.00 37.62  ? 48  ASN B C   1 
ATOM   3120  O O   . ASN B 1 47  ? -13.118 -65.454  -58.632 1.00 37.52  ? 48  ASN B O   1 
ATOM   3121  C CB  . ASN B 1 47  ? -14.822 -63.261  -58.454 1.00 36.63  ? 48  ASN B CB  1 
ATOM   3122  C CG  . ASN B 1 47  ? -16.155 -62.567  -58.620 1.00 36.61  ? 48  ASN B CG  1 
ATOM   3123  O OD1 . ASN B 1 47  ? -17.145 -63.190  -58.997 1.00 37.81  ? 48  ASN B OD1 1 
ATOM   3124  N ND2 . ASN B 1 47  ? -16.187 -61.266  -58.345 1.00 35.76  ? 48  ASN B ND2 1 
ATOM   3125  N N   . GLN B 1 48  ? -13.164 -65.756  -56.386 1.00 38.20  ? 49  GLN B N   1 
ATOM   3126  C CA  . GLN B 1 48  ? -11.977 -66.605  -56.312 1.00 39.28  ? 49  GLN B CA  1 
ATOM   3127  C C   . GLN B 1 48  ? -10.767 -65.940  -56.959 1.00 36.60  ? 49  GLN B C   1 
ATOM   3128  O O   . GLN B 1 48  ? -9.933  -66.609  -57.562 1.00 37.29  ? 49  GLN B O   1 
ATOM   3129  C CB  . GLN B 1 48  ? -12.245 -67.968  -56.962 1.00 43.97  ? 49  GLN B CB  1 
ATOM   3130  C CG  . GLN B 1 48  ? -13.382 -68.746  -56.310 1.00 49.03  ? 49  GLN B CG  1 
ATOM   3131  C CD  . GLN B 1 48  ? -13.420 -70.207  -56.726 1.00 54.33  ? 49  GLN B CD  1 
ATOM   3132  O OE1 . GLN B 1 48  ? -12.383 -70.830  -56.957 1.00 55.93  ? 49  GLN B OE1 1 
ATOM   3133  N NE2 . GLN B 1 48  ? -14.623 -70.762  -56.823 1.00 57.08  ? 49  GLN B NE2 1 
ATOM   3134  N N   . GLY B 1 49  ? -10.675 -64.621  -56.822 1.00 34.97  ? 50  GLY B N   1 
ATOM   3135  C CA  . GLY B 1 49  ? -9.599  -63.869  -57.438 1.00 34.37  ? 50  GLY B CA  1 
ATOM   3136  C C   . GLY B 1 49  ? -8.390  -63.643  -56.552 1.00 34.58  ? 50  GLY B C   1 
ATOM   3137  O O   . GLY B 1 49  ? -8.094  -64.431  -55.649 1.00 33.76  ? 50  GLY B O   1 
ATOM   3138  N N   . LEU B 1 50  ? -7.678  -62.559  -56.837 1.00 35.13  ? 51  LEU B N   1 
ATOM   3139  C CA  . LEU B 1 50  ? -6.529  -62.144  -56.050 1.00 34.87  ? 51  LEU B CA  1 
ATOM   3140  C C   . LEU B 1 50  ? -6.826  -60.806  -55.386 1.00 34.56  ? 51  LEU B C   1 
ATOM   3141  O O   . LEU B 1 50  ? -7.382  -59.904  -56.013 1.00 34.60  ? 51  LEU B O   1 
ATOM   3142  C CB  . LEU B 1 50  ? -5.278  -62.032  -56.924 1.00 37.47  ? 51  LEU B CB  1 
ATOM   3143  C CG  . LEU B 1 50  ? -4.844  -63.290  -57.683 1.00 41.69  ? 51  LEU B CG  1 
ATOM   3144  C CD1 . LEU B 1 50  ? -3.786  -62.962  -58.736 1.00 42.97  ? 51  LEU B CD1 1 
ATOM   3145  C CD2 . LEU B 1 50  ? -4.330  -64.350  -56.721 1.00 41.31  ? 51  LEU B CD2 1 
ATOM   3146  N N   . VAL B 1 51  ? -6.474  -60.687  -54.110 1.00 34.00  ? 52  VAL B N   1 
ATOM   3147  C CA  . VAL B 1 51  ? -6.612  -59.420  -53.401 1.00 34.39  ? 52  VAL B CA  1 
ATOM   3148  C C   . VAL B 1 51  ? -5.270  -59.051  -52.781 1.00 30.01  ? 52  VAL B C   1 
ATOM   3149  O O   . VAL B 1 51  ? -4.455  -59.923  -52.495 1.00 30.27  ? 52  VAL B O   1 
ATOM   3150  C CB  . VAL B 1 51  ? -7.708  -59.485  -52.312 1.00 35.18  ? 52  VAL B CB  1 
ATOM   3151  C CG1 . VAL B 1 51  ? -9.047  -59.857  -52.931 1.00 30.64  ? 52  VAL B CG1 1 
ATOM   3152  C CG2 . VAL B 1 51  ? -7.336  -60.481  -51.217 1.00 30.48  ? 52  VAL B CG2 1 
ATOM   3153  N N   . LEU B 1 52  ? -5.024  -57.760  -52.594 1.00 29.80  ? 53  LEU B N   1 
ATOM   3154  C CA  . LEU B 1 52  ? -3.758  -57.336  -52.005 1.00 35.67  ? 53  LEU B CA  1 
ATOM   3155  C C   . LEU B 1 52  ? -3.981  -56.332  -50.870 1.00 35.18  ? 53  LEU B C   1 
ATOM   3156  O O   . LEU B 1 52  ? -3.659  -55.147  -51.000 1.00 34.81  ? 53  LEU B O   1 
ATOM   3157  C CB  . LEU B 1 52  ? -2.840  -56.748  -53.087 1.00 34.64  ? 53  LEU B CB  1 
ATOM   3158  C CG  . LEU B 1 52  ? -1.386  -56.441  -52.700 1.00 34.35  ? 53  LEU B CG  1 
ATOM   3159  C CD1 . LEU B 1 52  ? -0.724  -57.639  -52.014 1.00 32.63  ? 53  LEU B CD1 1 
ATOM   3160  C CD2 . LEU B 1 52  ? -0.576  -56.005  -53.915 1.00 34.59  ? 53  LEU B CD2 1 
ATOM   3161  N N   . PRO B 1 53  ? -4.557  -56.802  -49.751 1.00 29.85  ? 54  PRO B N   1 
ATOM   3162  C CA  . PRO B 1 53  ? -4.782  -55.909  -48.609 1.00 32.35  ? 54  PRO B CA  1 
ATOM   3163  C C   . PRO B 1 53  ? -3.544  -55.732  -47.731 1.00 30.27  ? 54  PRO B C   1 
ATOM   3164  O O   . PRO B 1 53  ? -2.554  -56.449  -47.879 1.00 30.42  ? 54  PRO B O   1 
ATOM   3165  C CB  . PRO B 1 53  ? -5.881  -56.624  -47.826 1.00 33.40  ? 54  PRO B CB  1 
ATOM   3166  C CG  . PRO B 1 53  ? -5.577  -58.076  -48.055 1.00 34.36  ? 54  PRO B CG  1 
ATOM   3167  C CD  . PRO B 1 53  ? -5.137  -58.139  -49.517 1.00 29.93  ? 54  PRO B CD  1 
ATOM   3168  N N   . MET B 1 54  ? -3.615  -54.760  -46.829 1.00 30.53  ? 55  MET B N   1 
ATOM   3169  C CA  . MET B 1 54  ? -2.597  -54.559  -45.800 1.00 37.36  ? 55  MET B CA  1 
ATOM   3170  C C   . MET B 1 54  ? -3.255  -54.153  -44.494 1.00 31.31  ? 55  MET B C   1 
ATOM   3171  O O   . MET B 1 54  ? -4.237  -53.419  -44.493 1.00 31.32  ? 55  MET B O   1 
ATOM   3172  C CB  . MET B 1 54  ? -1.569  -53.516  -46.259 1.00 38.61  ? 55  MET B CB  1 
ATOM   3173  C CG  . MET B 1 54  ? -1.490  -52.247  -45.421 1.00 40.27  ? 55  MET B CG  1 
ATOM   3174  S SD  . MET B 1 54  ? -0.173  -51.112  -45.934 1.00 36.45  ? 55  MET B SD  1 
ATOM   3175  C CE  . MET B 1 54  ? -0.680  -49.611  -45.100 1.00 33.70  ? 55  MET B CE  1 
ATOM   3176  N N   . ALA B 1 55  ? -2.732  -54.659  -43.382 1.00 32.93  ? 56  ALA B N   1 
ATOM   3177  C CA  . ALA B 1 55  ? -3.326  -54.366  -42.089 1.00 32.10  ? 56  ALA B CA  1 
ATOM   3178  C C   . ALA B 1 55  ? -2.971  -52.953  -41.661 1.00 32.72  ? 56  ALA B C   1 
ATOM   3179  O O   . ALA B 1 55  ? -1.895  -52.446  -41.979 1.00 33.04  ? 56  ALA B O   1 
ATOM   3180  C CB  . ALA B 1 55  ? -2.873  -55.376  -41.048 1.00 32.46  ? 56  ALA B CB  1 
ATOM   3181  N N   . LEU B 1 56  ? -3.884  -52.328  -40.929 1.00 39.01  ? 57  LEU B N   1 
ATOM   3182  C CA  . LEU B 1 56  ? -3.690  -50.960  -40.466 1.00 40.12  ? 57  LEU B CA  1 
ATOM   3183  C C   . LEU B 1 56  ? -3.285  -50.874  -39.007 1.00 42.11  ? 57  LEU B C   1 
ATOM   3184  O O   . LEU B 1 56  ? -3.432  -51.826  -38.237 1.00 34.74  ? 57  LEU B O   1 
ATOM   3185  C CB  . LEU B 1 56  ? -4.962  -50.141  -40.679 1.00 38.64  ? 57  LEU B CB  1 
ATOM   3186  C CG  . LEU B 1 56  ? -5.353  -49.975  -42.144 1.00 36.20  ? 57  LEU B CG  1 
ATOM   3187  C CD1 . LEU B 1 56  ? -6.659  -49.210  -42.258 1.00 33.77  ? 57  LEU B CD1 1 
ATOM   3188  C CD2 . LEU B 1 56  ? -4.241  -49.266  -42.894 1.00 33.62  ? 57  LEU B CD2 1 
ATOM   3189  N N   . GLU B 1 57  ? -2.778  -49.707  -38.636 1.00 43.44  ? 58  GLU B N   1 
ATOM   3190  C CA  . GLU B 1 57  ? -2.414  -49.447  -37.259 1.00 45.32  ? 58  GLU B CA  1 
ATOM   3191  C C   . GLU B 1 57  ? -3.677  -49.199  -36.453 1.00 44.34  ? 58  GLU B C   1 
ATOM   3192  O O   . GLU B 1 57  ? -3.660  -49.270  -35.221 1.00 46.24  ? 58  GLU B O   1 
ATOM   3193  C CB  . GLU B 1 57  ? -1.478  -48.244  -37.161 1.00 48.82  ? 58  GLU B CB  1 
ATOM   3194  C CG  . GLU B 1 57  ? -0.016  -48.548  -37.520 1.00 51.08  ? 58  GLU B CG  1 
ATOM   3195  C CD  . GLU B 1 57  ? 0.804   -47.293  -37.722 1.00 53.85  ? 58  GLU B CD  1 
ATOM   3196  O OE1 . GLU B 1 57  ? 0.844   -46.811  -38.875 1.00 53.45  ? 58  GLU B OE1 1 
ATOM   3197  O OE2 . GLU B 1 57  ? 1.385   -46.756  -36.736 1.00 55.90  ? 58  GLU B OE2 1 
ATOM   3198  N N   . LEU B 1 58  ? -4.757  -48.848  -37.148 1.00 40.78  ? 59  LEU B N   1 
ATOM   3199  C CA  . LEU B 1 58  ? -6.082  -48.796  -36.537 1.00 40.22  ? 59  LEU B CA  1 
ATOM   3200  C C   . LEU B 1 58  ? -6.484  -50.209  -36.125 1.00 39.31  ? 59  LEU B C   1 
ATOM   3201  O O   . LEU B 1 58  ? -6.274  -51.161  -36.876 1.00 38.77  ? 59  LEU B O   1 
ATOM   3202  C CB  . LEU B 1 58  ? -7.106  -48.209  -37.506 1.00 39.22  ? 59  LEU B CB  1 
ATOM   3203  C CG  . LEU B 1 58  ? -6.755  -46.859  -38.138 1.00 39.10  ? 59  LEU B CG  1 
ATOM   3204  C CD1 . LEU B 1 58  ? -7.840  -46.407  -39.110 1.00 37.35  ? 59  LEU B CD1 1 
ATOM   3205  C CD2 . LEU B 1 58  ? -6.527  -45.803  -37.073 1.00 39.01  ? 59  LEU B CD2 1 
ATOM   3206  N N   . MET B 1 59  ? -7.063  -50.361  -34.940 1.00 39.52  ? 60  MET B N   1 
ATOM   3207  C CA  . MET B 1 59  ? -7.336  -51.706  -34.444 1.00 37.14  ? 60  MET B CA  1 
ATOM   3208  C C   . MET B 1 59  ? -8.461  -51.770  -33.421 1.00 38.67  ? 60  MET B C   1 
ATOM   3209  O O   . MET B 1 59  ? -8.870  -50.756  -32.858 1.00 39.08  ? 60  MET B O   1 
ATOM   3210  C CB  . MET B 1 59  ? -6.068  -52.304  -33.832 1.00 37.26  ? 60  MET B CB  1 
ATOM   3211  C CG  . MET B 1 59  ? -5.643  -51.627  -32.537 1.00 39.77  ? 60  MET B CG  1 
ATOM   3212  S SD  . MET B 1 59  ? -4.228  -52.427  -31.767 1.00 49.78  ? 60  MET B SD  1 
ATOM   3213  C CE  . MET B 1 59  ? -2.966  -52.143  -33.008 1.00 38.22  ? 60  MET B CE  1 
ATOM   3214  N N   . THR B 1 60  ? -8.952  -52.985  -33.201 1.00 37.94  ? 61  THR B N   1 
ATOM   3215  C CA  . THR B 1 60  ? -9.907  -53.267  -32.143 1.00 40.90  ? 61  THR B CA  1 
ATOM   3216  C C   . THR B 1 60  ? -9.203  -54.067  -31.056 1.00 41.63  ? 61  THR B C   1 
ATOM   3217  O O   . THR B 1 60  ? -8.545  -55.068  -31.337 1.00 38.85  ? 61  THR B O   1 
ATOM   3218  C CB  . THR B 1 60  ? -11.131 -54.046  -32.665 1.00 40.31  ? 61  THR B CB  1 
ATOM   3219  O OG1 . THR B 1 60  ? -11.880 -53.211  -33.555 1.00 40.15  ? 61  THR B OG1 1 
ATOM   3220  C CG2 . THR B 1 60  ? -12.033 -54.469  -31.509 1.00 40.14  ? 61  THR B CG2 1 
ATOM   3221  N N   . VAL B 1 61  ? -9.318  -53.610  -29.815 1.00 41.88  ? 62  VAL B N   1 
ATOM   3222  C CA  . VAL B 1 61  ? -8.685  -54.305  -28.705 1.00 41.94  ? 62  VAL B CA  1 
ATOM   3223  C C   . VAL B 1 61  ? -9.740  -54.913  -27.790 1.00 43.88  ? 62  VAL B C   1 
ATOM   3224  O O   . VAL B 1 61  ? -10.731 -54.264  -27.450 1.00 44.82  ? 62  VAL B O   1 
ATOM   3225  C CB  . VAL B 1 61  ? -7.765  -53.361  -27.897 1.00 42.26  ? 62  VAL B CB  1 
ATOM   3226  C CG1 . VAL B 1 61  ? -7.268  -54.043  -26.625 1.00 44.40  ? 62  VAL B CG1 1 
ATOM   3227  C CG2 . VAL B 1 61  ? -6.596  -52.901  -28.749 1.00 41.42  ? 62  VAL B CG2 1 
ATOM   3228  N N   . LEU B 1 62  ? -9.538  -56.175  -27.422 1.00 45.06  ? 63  LEU B N   1 
ATOM   3229  C CA  . LEU B 1 62  ? -10.342 -56.803  -26.381 1.00 46.68  ? 63  LEU B CA  1 
ATOM   3230  C C   . LEU B 1 62  ? -9.480  -57.062  -25.159 1.00 46.58  ? 63  LEU B C   1 
ATOM   3231  O O   . LEU B 1 62  ? -8.399  -57.643  -25.246 1.00 45.07  ? 63  LEU B O   1 
ATOM   3232  C CB  . LEU B 1 62  ? -10.977 -58.107  -26.863 1.00 47.61  ? 63  LEU B CB  1 
ATOM   3233  C CG  . LEU B 1 62  ? -12.433 -58.009  -27.316 1.00 47.87  ? 63  LEU B CG  1 
ATOM   3234  C CD1 . LEU B 1 62  ? -12.517 -57.359  -28.689 1.00 47.20  ? 63  LEU B CD1 1 
ATOM   3235  C CD2 . LEU B 1 62  ? -13.087 -59.381  -27.321 1.00 48.03  ? 63  LEU B CD2 1 
ATOM   3236  N N   . VAL B 1 63  ? -9.972  -56.616  -24.017 1.00 49.26  ? 64  VAL B N   1 
ATOM   3237  C CA  . VAL B 1 63  ? -9.250  -56.747  -22.768 1.00 52.70  ? 64  VAL B CA  1 
ATOM   3238  C C   . VAL B 1 63  ? -10.203 -57.377  -21.762 1.00 55.49  ? 64  VAL B C   1 
ATOM   3239  O O   . VAL B 1 63  ? -11.282 -56.841  -21.503 1.00 57.51  ? 64  VAL B O   1 
ATOM   3240  C CB  . VAL B 1 63  ? -8.712  -55.366  -22.309 1.00 57.67  ? 64  VAL B CB  1 
ATOM   3241  C CG1 . VAL B 1 63  ? -8.800  -55.188  -20.826 1.00 59.26  ? 64  VAL B CG1 1 
ATOM   3242  C CG2 . VAL B 1 63  ? -7.285  -55.163  -22.802 1.00 56.66  ? 64  VAL B CG2 1 
ATOM   3243  N N   . GLY B 1 64  ? -9.829  -58.541  -21.234 1.00 55.93  ? 65  GLY B N   1 
ATOM   3244  C CA  . GLY B 1 64  ? -10.733 -59.287  -20.378 1.00 56.24  ? 65  GLY B CA  1 
ATOM   3245  C C   . GLY B 1 64  ? -10.170 -60.490  -19.645 1.00 56.55  ? 65  GLY B C   1 
ATOM   3246  O O   . GLY B 1 64  ? -8.957  -60.681  -19.573 1.00 55.85  ? 65  GLY B O   1 
ATOM   3247  N N   . SER B 1 65  ? -11.074 -61.304  -19.103 1.00 57.85  ? 66  SER B N   1 
ATOM   3248  C CA  . SER B 1 65  ? -10.709 -62.419  -18.228 1.00 58.14  ? 66  SER B CA  1 
ATOM   3249  C C   . SER B 1 65  ? -11.719 -63.565  -18.312 1.00 59.22  ? 66  SER B C   1 
ATOM   3250  O O   . SER B 1 65  ? -12.901 -63.333  -18.561 1.00 58.45  ? 66  SER B O   1 
ATOM   3251  C CB  . SER B 1 65  ? -10.600 -61.938  -16.776 1.00 58.93  ? 66  SER B CB  1 
ATOM   3252  O OG  . SER B 1 65  ? -9.615  -60.930  -16.635 1.00 58.31  ? 66  SER B OG  1 
ATOM   3253  N N   . PRO B 1 66  ? -11.256 -64.808  -18.088 1.00 61.95  ? 67  PRO B N   1 
ATOM   3254  C CA  . PRO B 1 66  ? -12.140 -65.980  -18.057 1.00 64.32  ? 67  PRO B CA  1 
ATOM   3255  C C   . PRO B 1 66  ? -13.169 -65.927  -16.927 1.00 67.47  ? 67  PRO B C   1 
ATOM   3256  O O   . PRO B 1 66  ? -13.074 -65.078  -16.040 1.00 67.89  ? 67  PRO B O   1 
ATOM   3257  C CB  . PRO B 1 66  ? -11.169 -67.146  -17.839 1.00 64.27  ? 67  PRO B CB  1 
ATOM   3258  C CG  . PRO B 1 66  ? -9.975  -66.527  -17.200 1.00 63.79  ? 67  PRO B CG  1 
ATOM   3259  C CD  . PRO B 1 66  ? -9.852  -65.182  -17.847 1.00 62.23  ? 67  PRO B CD  1 
ATOM   3260  N N   . ARG B 1 67  ? -14.138 -66.837  -16.966 1.00 69.71  ? 68  ARG B N   1 
ATOM   3261  C CA  . ARG B 1 67  ? -15.181 -66.898  -15.947 1.00 72.51  ? 68  ARG B CA  1 
ATOM   3262  C C   . ARG B 1 67  ? -15.730 -68.317  -15.799 1.00 73.50  ? 68  ARG B C   1 
ATOM   3263  O O   . ARG B 1 67  ? -16.102 -68.957  -16.785 1.00 72.02  ? 68  ARG B O   1 
ATOM   3264  C CB  . ARG B 1 67  ? -16.315 -65.926  -16.285 1.00 72.56  ? 68  ARG B CB  1 
ATOM   3265  N N   . GLY B 1 70  ? -21.010 -69.470  -16.922 1.00 81.17  ? 71  GLY B N   1 
ATOM   3266  C CA  . GLY B 1 70  ? -21.090 -69.367  -18.366 1.00 79.21  ? 71  GLY B CA  1 
ATOM   3267  C C   . GLY B 1 70  ? -21.726 -68.066  -18.817 1.00 78.51  ? 71  GLY B C   1 
ATOM   3268  O O   . GLY B 1 70  ? -22.554 -68.051  -19.728 1.00 77.84  ? 71  GLY B O   1 
ATOM   3269  N N   . LEU B 1 71  ? -21.337 -66.970  -18.174 1.00 78.57  ? 72  LEU B N   1 
ATOM   3270  C CA  . LEU B 1 71  ? -21.874 -65.657  -18.508 1.00 78.44  ? 72  LEU B CA  1 
ATOM   3271  C C   . LEU B 1 71  ? -20.882 -64.832  -19.326 1.00 75.97  ? 72  LEU B C   1 
ATOM   3272  O O   . LEU B 1 71  ? -19.712 -64.713  -18.963 1.00 75.45  ? 72  LEU B O   1 
ATOM   3273  C CB  . LEU B 1 71  ? -22.257 -64.898  -17.236 1.00 80.07  ? 72  LEU B CB  1 
ATOM   3274  N N   . VAL B 1 72  ? -21.361 -64.271  -20.432 1.00 74.55  ? 73  VAL B N   1 
ATOM   3275  C CA  . VAL B 1 72  ? -20.560 -63.366  -21.248 1.00 71.85  ? 73  VAL B CA  1 
ATOM   3276  C C   . VAL B 1 72  ? -20.946 -61.918  -20.955 1.00 72.16  ? 73  VAL B C   1 
ATOM   3277  O O   . VAL B 1 72  ? -22.036 -61.472  -21.310 1.00 73.38  ? 73  VAL B O   1 
ATOM   3278  C CB  . VAL B 1 72  ? -20.733 -63.646  -22.755 1.00 70.26  ? 73  VAL B CB  1 
ATOM   3279  C CG1 . VAL B 1 72  ? -19.941 -62.643  -23.572 1.00 67.90  ? 73  VAL B CG1 1 
ATOM   3280  C CG2 . VAL B 1 72  ? -20.308 -65.069  -23.090 1.00 70.15  ? 73  VAL B CG2 1 
ATOM   3281  N N   . SER B 1 73  ? -20.049 -61.191  -20.297 1.00 71.15  ? 74  SER B N   1 
ATOM   3282  C CA  . SER B 1 73  ? -20.299 -59.799  -19.934 1.00 70.98  ? 74  SER B CA  1 
ATOM   3283  C C   . SER B 1 73  ? -19.418 -58.868  -20.766 1.00 68.37  ? 74  SER B C   1 
ATOM   3284  O O   . SER B 1 73  ? -18.195 -58.997  -20.768 1.00 67.37  ? 74  SER B O   1 
ATOM   3285  C CB  . SER B 1 73  ? -20.049 -59.587  -18.436 1.00 72.36  ? 74  SER B CB  1 
ATOM   3286  O OG  . SER B 1 73  ? -20.328 -58.254  -18.042 1.00 72.65  ? 74  SER B OG  1 
ATOM   3287  N N   . LEU B 1 74  ? -20.042 -57.933  -21.477 1.00 67.23  ? 75  LEU B N   1 
ATOM   3288  C CA  . LEU B 1 74  ? -19.309 -57.062  -22.391 1.00 63.78  ? 75  LEU B CA  1 
ATOM   3289  C C   . LEU B 1 74  ? -19.550 -55.580  -22.127 1.00 63.29  ? 75  LEU B C   1 
ATOM   3290  O O   . LEU B 1 74  ? -20.598 -55.186  -21.623 1.00 64.20  ? 75  LEU B O   1 
ATOM   3291  C CB  . LEU B 1 74  ? -19.680 -57.384  -23.841 1.00 62.21  ? 75  LEU B CB  1 
ATOM   3292  C CG  . LEU B 1 74  ? -19.573 -58.848  -24.266 1.00 61.90  ? 75  LEU B CG  1 
ATOM   3293  C CD1 . LEU B 1 74  ? -20.084 -59.029  -25.686 1.00 60.34  ? 75  LEU B CD1 1 
ATOM   3294  C CD2 . LEU B 1 74  ? -18.138 -59.341  -24.138 1.00 60.83  ? 75  LEU B CD2 1 
ATOM   3295  N N   . LEU B 1 75  ? -18.565 -54.763  -22.486 1.00 62.36  ? 76  LEU B N   1 
ATOM   3296  C CA  . LEU B 1 75  ? -18.690 -53.312  -22.418 1.00 63.04  ? 76  LEU B CA  1 
ATOM   3297  C C   . LEU B 1 75  ? -17.793 -52.655  -23.462 1.00 60.52  ? 76  LEU B C   1 
ATOM   3298  O O   . LEU B 1 75  ? -16.611 -52.980  -23.561 1.00 58.44  ? 76  LEU B O   1 
ATOM   3299  C CB  . LEU B 1 75  ? -18.333 -52.797  -21.025 1.00 65.30  ? 76  LEU B CB  1 
ATOM   3300  C CG  . LEU B 1 75  ? -18.304 -51.273  -20.878 1.00 67.15  ? 76  LEU B CG  1 
ATOM   3301  C CD1 . LEU B 1 75  ? -19.656 -50.742  -20.418 1.00 70.36  ? 76  LEU B CD1 1 
ATOM   3302  C CD2 . LEU B 1 75  ? -17.199 -50.835  -19.929 1.00 67.40  ? 76  LEU B CD2 1 
ATOM   3303  N N   . THR B 1 76  ? -18.352 -51.735  -24.243 1.00 60.00  ? 77  THR B N   1 
ATOM   3304  C CA  . THR B 1 76  ? -17.555 -51.000  -25.218 1.00 57.85  ? 77  THR B CA  1 
ATOM   3305  C C   . THR B 1 76  ? -17.598 -49.497  -24.951 1.00 60.06  ? 77  THR B C   1 
ATOM   3306  O O   . THR B 1 76  ? -18.604 -48.970  -24.472 1.00 60.76  ? 77  THR B O   1 
ATOM   3307  C CB  . THR B 1 76  ? -18.023 -51.275  -26.664 1.00 55.61  ? 77  THR B CB  1 
ATOM   3308  O OG1 . THR B 1 76  ? -17.220 -50.517  -27.576 1.00 54.22  ? 77  THR B OG1 1 
ATOM   3309  C CG2 . THR B 1 76  ? -19.489 -50.893  -26.845 1.00 55.41  ? 77  THR B CG2 1 
ATOM   3310  N N   . THR B 1 77  ? -16.495 -48.816  -25.252 1.00 64.19  ? 78  THR B N   1 
ATOM   3311  C CA  . THR B 1 77  ? -16.408 -47.366  -25.089 1.00 67.94  ? 78  THR B CA  1 
ATOM   3312  C C   . THR B 1 77  ? -16.052 -46.692  -26.410 1.00 68.84  ? 78  THR B C   1 
ATOM   3313  O O   . THR B 1 77  ? -15.427 -45.632  -26.427 1.00 69.14  ? 78  THR B O   1 
ATOM   3314  C CB  . THR B 1 77  ? -15.350 -46.968  -24.044 1.00 68.89  ? 78  THR B CB  1 
ATOM   3315  O OG1 . THR B 1 77  ? -14.056 -46.938  -24.661 1.00 66.80  ? 78  THR B OG1 1 
ATOM   3316  C CG2 . THR B 1 77  ? -15.343 -47.946  -22.870 1.00 69.40  ? 78  THR B CG2 1 
ATOM   3317  N N   . SER B 1 78  ? -16.459 -47.308  -27.514 1.00 69.56  ? 79  SER B N   1 
ATOM   3318  C CA  . SER B 1 78  ? -15.999 -46.897  -28.837 1.00 69.96  ? 79  SER B CA  1 
ATOM   3319  C C   . SER B 1 78  ? -16.531 -45.545  -29.309 1.00 72.70  ? 79  SER B C   1 
ATOM   3320  O O   . SER B 1 78  ? -15.830 -44.825  -30.021 1.00 72.91  ? 79  SER B O   1 
ATOM   3321  C CB  . SER B 1 78  ? -16.370 -47.966  -29.866 1.00 68.82  ? 79  SER B CB  1 
ATOM   3322  O OG  . SER B 1 78  ? -15.486 -49.070  -29.785 1.00 67.77  ? 79  SER B OG  1 
ATOM   3323  N N   . GLU B 1 79  ? -17.755 -45.211  -28.903 1.00 75.20  ? 80  GLU B N   1 
ATOM   3324  C CA  . GLU B 1 79  ? -18.501 -44.070  -29.444 1.00 76.88  ? 80  GLU B CA  1 
ATOM   3325  C C   . GLU B 1 79  ? -18.748 -44.286  -30.936 1.00 75.32  ? 80  GLU B C   1 
ATOM   3326  O O   . GLU B 1 79  ? -17.832 -44.216  -31.759 1.00 73.25  ? 80  GLU B O   1 
ATOM   3327  C CB  . GLU B 1 79  ? -17.772 -42.748  -29.191 1.00 77.39  ? 80  GLU B CB  1 
ATOM   3328  N N   . GLY B 1 80  ? -20.003 -44.555  -31.271 1.00 75.68  ? 81  GLY B N   1 
ATOM   3329  C CA  . GLY B 1 80  ? -20.368 -44.998  -32.601 1.00 72.60  ? 81  GLY B CA  1 
ATOM   3330  C C   . GLY B 1 80  ? -21.176 -46.271  -32.466 1.00 71.25  ? 81  GLY B C   1 
ATOM   3331  O O   . GLY B 1 80  ? -22.147 -46.487  -33.192 1.00 72.31  ? 81  GLY B O   1 
ATOM   3332  N N   . ALA B 1 81  ? -20.772 -47.119  -31.524 1.00 68.70  ? 82  ALA B N   1 
ATOM   3333  C CA  . ALA B 1 81  ? -21.548 -48.303  -31.188 1.00 68.05  ? 82  ALA B CA  1 
ATOM   3334  C C   . ALA B 1 81  ? -22.884 -47.874  -30.594 1.00 69.50  ? 82  ALA B C   1 
ATOM   3335  O O   . ALA B 1 81  ? -22.964 -46.866  -29.892 1.00 70.26  ? 82  ALA B O   1 
ATOM   3336  C CB  . ALA B 1 81  ? -20.784 -49.194  -30.218 1.00 68.18  ? 82  ALA B CB  1 
ATOM   3337  N N   . ASP B 1 82  ? -23.931 -48.637  -30.884 1.00 69.96  ? 83  ASP B N   1 
ATOM   3338  C CA  . ASP B 1 82  ? -25.272 -48.295  -30.429 1.00 71.66  ? 83  ASP B CA  1 
ATOM   3339  C C   . ASP B 1 82  ? -25.517 -48.741  -28.990 1.00 73.25  ? 83  ASP B C   1 
ATOM   3340  O O   . ASP B 1 82  ? -24.653 -49.351  -28.360 1.00 71.18  ? 83  ASP B O   1 
ATOM   3341  C CB  . ASP B 1 82  ? -26.319 -48.912  -31.359 1.00 71.46  ? 83  ASP B CB  1 
ATOM   3342  C CG  . ASP B 1 82  ? -25.992 -50.342  -31.741 1.00 69.20  ? 83  ASP B CG  1 
ATOM   3343  O OD1 . ASP B 1 82  ? -24.796 -50.708  -31.737 1.00 66.30  ? 83  ASP B OD1 1 
ATOM   3344  O OD2 . ASP B 1 82  ? -26.934 -51.102  -32.047 1.00 70.55  ? 83  ASP B OD2 1 
ATOM   3345  N N   . GLU B 1 83  ? -26.702 -48.427  -28.477 1.00 77.06  ? 84  GLU B N   1 
ATOM   3346  C CA  . GLU B 1 83  ? -27.060 -48.749  -27.100 1.00 80.29  ? 84  GLU B CA  1 
ATOM   3347  C C   . GLU B 1 83  ? -27.739 -50.115  -27.000 1.00 81.29  ? 84  GLU B C   1 
ATOM   3348  O O   . GLU B 1 83  ? -28.453 -50.524  -27.915 1.00 81.65  ? 84  GLU B O   1 
ATOM   3349  C CB  . GLU B 1 83  ? -27.973 -47.663  -26.523 1.00 84.24  ? 84  GLU B CB  1 
ATOM   3350  C CG  . GLU B 1 83  ? -27.337 -46.285  -26.469 1.00 84.50  ? 84  GLU B CG  1 
ATOM   3351  C CD  . GLU B 1 83  ? -26.157 -46.224  -25.520 1.00 84.59  ? 84  GLU B CD  1 
ATOM   3352  O OE1 . GLU B 1 83  ? -26.214 -46.872  -24.451 1.00 86.82  ? 84  GLU B OE1 1 
ATOM   3353  O OE2 . GLU B 1 83  ? -25.169 -45.533  -25.845 1.00 82.65  ? 84  GLU B OE2 1 
ATOM   3354  N N   . PRO B 1 84  ? -27.512 -50.832  -25.887 1.00 82.00  ? 85  PRO B N   1 
ATOM   3355  C CA  . PRO B 1 84  ? -26.618 -50.439  -24.790 1.00 81.71  ? 85  PRO B CA  1 
ATOM   3356  C C   . PRO B 1 84  ? -25.155 -50.766  -25.083 1.00 77.60  ? 85  PRO B C   1 
ATOM   3357  O O   . PRO B 1 84  ? -24.869 -51.726  -25.798 1.00 75.26  ? 85  PRO B O   1 
ATOM   3358  C CB  . PRO B 1 84  ? -27.134 -51.266  -23.611 1.00 84.07  ? 85  PRO B CB  1 
ATOM   3359  C CG  . PRO B 1 84  ? -27.672 -52.499  -24.246 1.00 83.67  ? 85  PRO B CG  1 
ATOM   3360  C CD  . PRO B 1 84  ? -28.244 -52.073  -25.578 1.00 83.37  ? 85  PRO B CD  1 
ATOM   3361  N N   . GLN B 1 85  ? -24.244 -49.968  -24.539 1.00 77.14  ? 86  GLN B N   1 
ATOM   3362  C CA  . GLN B 1 85  ? -22.819 -50.219  -24.708 1.00 74.89  ? 86  GLN B CA  1 
ATOM   3363  C C   . GLN B 1 85  ? -22.316 -51.180  -23.631 1.00 75.07  ? 86  GLN B C   1 
ATOM   3364  O O   . GLN B 1 85  ? -21.142 -51.548  -23.610 1.00 72.47  ? 86  GLN B O   1 
ATOM   3365  C CB  . GLN B 1 85  ? -22.040 -48.905  -24.679 1.00 75.75  ? 86  GLN B CB  1 
ATOM   3366  C CG  . GLN B 1 85  ? -22.372 -47.986  -25.848 1.00 76.84  ? 86  GLN B CG  1 
ATOM   3367  C CD  . GLN B 1 85  ? -21.558 -46.707  -25.845 1.00 77.81  ? 86  GLN B CD  1 
ATOM   3368  O OE1 . GLN B 1 85  ? -21.053 -46.283  -24.807 1.00 80.23  ? 86  GLN B OE1 1 
ATOM   3369  N NE2 . GLN B 1 85  ? -21.429 -46.084  -27.011 1.00 76.15  ? 86  GLN B NE2 1 
ATOM   3370  N N   . ARG B 1 86  ? -23.223 -51.578  -22.743 1.00 78.08  ? 87  ARG B N   1 
ATOM   3371  C CA  . ARG B 1 86  ? -22.953 -52.609  -21.745 1.00 78.71  ? 87  ARG B CA  1 
ATOM   3372  C C   . ARG B 1 86  ? -23.934 -53.762  -21.941 1.00 79.30  ? 87  ARG B C   1 
ATOM   3373  O O   . ARG B 1 86  ? -25.104 -53.540  -22.250 1.00 80.58  ? 87  ARG B O   1 
ATOM   3374  C CB  . ARG B 1 86  ? -23.064 -52.043  -20.328 1.00 81.91  ? 87  ARG B CB  1 
ATOM   3375  N N   . LEU B 1 87  ? -23.462 -54.991  -21.759 1.00 78.68  ? 88  LEU B N   1 
ATOM   3376  C CA  . LEU B 1 87  ? -24.278 -56.157  -22.081 1.00 79.36  ? 88  LEU B CA  1 
ATOM   3377  C C   . LEU B 1 87  ? -23.859 -57.420  -21.330 1.00 78.65  ? 88  LEU B C   1 
ATOM   3378  O O   . LEU B 1 87  ? -22.681 -57.623  -21.038 1.00 76.68  ? 88  LEU B O   1 
ATOM   3379  C CB  . LEU B 1 87  ? -24.228 -56.419  -23.589 1.00 77.73  ? 88  LEU B CB  1 
ATOM   3380  C CG  . LEU B 1 87  ? -25.195 -57.471  -24.132 1.00 78.91  ? 88  LEU B CG  1 
ATOM   3381  C CD1 . LEU B 1 87  ? -26.635 -57.006  -23.960 1.00 82.42  ? 88  LEU B CD1 1 
ATOM   3382  C CD2 . LEU B 1 87  ? -24.890 -57.780  -25.585 1.00 76.05  ? 88  LEU B CD2 1 
ATOM   3383  N N   . GLN B 1 88  ? -24.841 -58.265  -21.028 1.00 80.60  ? 89  GLN B N   1 
ATOM   3384  C CA  . GLN B 1 88  ? -24.598 -59.556  -20.398 1.00 80.64  ? 89  GLN B CA  1 
ATOM   3385  C C   . GLN B 1 88  ? -25.573 -60.596  -20.943 1.00 81.00  ? 89  GLN B C   1 
ATOM   3386  O O   . GLN B 1 88  ? -26.777 -60.350  -21.009 1.00 83.99  ? 89  GLN B O   1 
ATOM   3387  C CB  . GLN B 1 88  ? -24.726 -59.450  -18.876 1.00 83.55  ? 89  GLN B CB  1 
ATOM   3388  N N   . PHE B 1 89  ? -25.052 -61.753  -21.337 1.00 78.34  ? 90  PHE B N   1 
ATOM   3389  C CA  . PHE B 1 89  ? -25.886 -62.816  -21.889 1.00 78.89  ? 90  PHE B CA  1 
ATOM   3390  C C   . PHE B 1 89  ? -25.228 -64.182  -21.711 1.00 78.64  ? 90  PHE B C   1 
ATOM   3391  O O   . PHE B 1 89  ? -24.003 -64.284  -21.695 1.00 76.37  ? 90  PHE B O   1 
ATOM   3392  C CB  . PHE B 1 89  ? -26.177 -62.554  -23.369 1.00 76.78  ? 90  PHE B CB  1 
ATOM   3393  C CG  . PHE B 1 89  ? -24.950 -62.525  -24.238 1.00 72.60  ? 90  PHE B CG  1 
ATOM   3394  C CD1 . PHE B 1 89  ? -24.239 -61.349  -24.415 1.00 70.75  ? 90  PHE B CD1 1 
ATOM   3395  C CD2 . PHE B 1 89  ? -24.516 -63.670  -24.887 1.00 71.06  ? 90  PHE B CD2 1 
ATOM   3396  C CE1 . PHE B 1 89  ? -23.112 -61.315  -25.219 1.00 67.86  ? 90  PHE B CE1 1 
ATOM   3397  C CE2 . PHE B 1 89  ? -23.390 -63.644  -25.691 1.00 68.25  ? 90  PHE B CE2 1 
ATOM   3398  C CZ  . PHE B 1 89  ? -22.689 -62.463  -25.859 1.00 66.48  ? 90  PHE B CZ  1 
ATOM   3399  N N   . PRO B 1 90  ? -26.043 -65.241  -21.573 1.00 81.67  ? 91  PRO B N   1 
ATOM   3400  C CA  . PRO B 1 90  ? -25.503 -66.588  -21.360 1.00 81.54  ? 91  PRO B CA  1 
ATOM   3401  C C   . PRO B 1 90  ? -24.889 -67.193  -22.619 1.00 79.17  ? 91  PRO B C   1 
ATOM   3402  O O   . PRO B 1 90  ? -25.201 -66.764  -23.729 1.00 78.31  ? 91  PRO B O   1 
ATOM   3403  C CB  . PRO B 1 90  ? -26.731 -67.388  -20.919 1.00 84.94  ? 91  PRO B CB  1 
ATOM   3404  C CG  . PRO B 1 90  ? -27.875 -66.689  -21.563 1.00 86.48  ? 91  PRO B CG  1 
ATOM   3405  C CD  . PRO B 1 90  ? -27.517 -65.228  -21.545 1.00 85.36  ? 91  PRO B CD  1 
ATOM   3406  N N   . LEU B 1 91  ? -24.020 -68.181  -22.435 1.00 78.70  ? 92  LEU B N   1 
ATOM   3407  C CA  . LEU B 1 91  ? -23.403 -68.887  -23.550 1.00 77.53  ? 92  LEU B CA  1 
ATOM   3408  C C   . LEU B 1 91  ? -24.408 -69.831  -24.209 1.00 80.29  ? 92  LEU B C   1 
ATOM   3409  O O   . LEU B 1 91  ? -25.306 -70.345  -23.543 1.00 83.43  ? 92  LEU B O   1 
ATOM   3410  C CB  . LEU B 1 91  ? -22.170 -69.663  -23.074 1.00 75.70  ? 92  LEU B CB  1 
ATOM   3411  N N   . PRO B 1 92  ? -24.263 -70.056  -25.524 1.00 79.69  ? 93  PRO B N   1 
ATOM   3412  C CA  . PRO B 1 92  ? -25.168 -70.950  -26.258 1.00 82.29  ? 93  PRO B CA  1 
ATOM   3413  C C   . PRO B 1 92  ? -25.011 -72.419  -25.866 1.00 84.55  ? 93  PRO B C   1 
ATOM   3414  O O   . PRO B 1 92  ? -23.897 -72.873  -25.601 1.00 82.50  ? 93  PRO B O   1 
ATOM   3415  C CB  . PRO B 1 92  ? -24.759 -70.737  -27.719 1.00 79.57  ? 93  PRO B CB  1 
ATOM   3416  C CG  . PRO B 1 92  ? -23.341 -70.282  -27.648 1.00 75.99  ? 93  PRO B CG  1 
ATOM   3417  C CD  . PRO B 1 92  ? -23.259 -69.442  -26.411 1.00 76.57  ? 93  PRO B CD  1 
ATOM   3418  N N   . THR B 1 93  ? -26.122 -73.148  -25.833 1.00 89.20  ? 94  THR B N   1 
ATOM   3419  C CA  . THR B 1 93  ? -26.093 -74.573  -25.528 1.00 91.88  ? 94  THR B CA  1 
ATOM   3420  C C   . THR B 1 93  ? -25.879 -75.379  -26.801 1.00 92.55  ? 94  THR B C   1 
ATOM   3421  O O   . THR B 1 93  ? -25.369 -74.863  -27.796 1.00 90.73  ? 94  THR B O   1 
ATOM   3422  C CB  . THR B 1 93  ? -27.393 -75.044  -24.851 1.00 95.74  ? 94  THR B CB  1 
ATOM   3423  O OG1 . THR B 1 93  ? -28.393 -75.293  -25.848 1.00 97.26  ? 94  THR B OG1 1 
ATOM   3424  C CG2 . THR B 1 93  ? -27.898 -73.998  -23.871 1.00 97.61  ? 94  THR B CG2 1 
ATOM   3425  N N   . ALA B 1 94  ? -26.273 -76.647  -26.766 1.00 95.44  ? 95  ALA B N   1 
ATOM   3426  C CA  . ALA B 1 94  ? -26.201 -77.502  -27.943 1.00 96.12  ? 95  ALA B CA  1 
ATOM   3427  C C   . ALA B 1 94  ? -27.563 -77.564  -28.622 1.00 99.44  ? 95  ALA B C   1 
ATOM   3428  O O   . ALA B 1 94  ? -27.685 -78.023  -29.758 1.00 99.95  ? 95  ALA B O   1 
ATOM   3429  C CB  . ALA B 1 94  ? -25.724 -78.896  -27.566 1.00 96.49  ? 95  ALA B CB  1 
ATOM   3430  N N   . GLN B 1 95  ? -28.584 -77.093  -27.913 1.00 101.82 ? 96  GLN B N   1 
ATOM   3431  C CA  . GLN B 1 95  ? -29.944 -77.075  -28.436 1.00 104.70 ? 96  GLN B CA  1 
ATOM   3432  C C   . GLN B 1 95  ? -30.494 -75.652  -28.484 1.00 104.64 ? 96  GLN B C   1 
ATOM   3433  O O   . GLN B 1 95  ? -31.491 -75.384  -29.154 1.00 106.77 ? 96  GLN B O   1 
ATOM   3434  C CB  . GLN B 1 95  ? -30.854 -77.966  -27.588 1.00 108.26 ? 96  GLN B CB  1 
ATOM   3435  N N   . ARG B 1 96  ? -29.838 -74.745  -27.766 1.00 102.09 ? 97  ARG B N   1 
ATOM   3436  C CA  . ARG B 1 96  ? -30.242 -73.343  -27.746 1.00 101.46 ? 97  ARG B CA  1 
ATOM   3437  C C   . ARG B 1 96  ? -29.136 -72.450  -28.300 1.00 97.18  ? 97  ARG B C   1 
ATOM   3438  O O   . ARG B 1 96  ? -28.217 -72.060  -27.579 1.00 95.29  ? 97  ARG B O   1 
ATOM   3439  C CB  . ARG B 1 96  ? -30.610 -72.908  -26.326 1.00 102.96 ? 97  ARG B CB  1 
ATOM   3440  N N   . SER B 1 97  ? -29.232 -72.133  -29.587 1.00 95.46  ? 98  SER B N   1 
ATOM   3441  C CA  . SER B 1 97  ? -28.234 -71.305  -30.253 1.00 90.83  ? 98  SER B CA  1 
ATOM   3442  C C   . SER B 1 97  ? -28.381 -69.839  -29.869 1.00 89.23  ? 98  SER B C   1 
ATOM   3443  O O   . SER B 1 97  ? -29.361 -69.447  -29.236 1.00 92.41  ? 98  SER B O   1 
ATOM   3444  C CB  . SER B 1 97  ? -28.347 -71.454  -31.772 1.00 90.39  ? 98  SER B CB  1 
ATOM   3445  O OG  . SER B 1 97  ? -28.562 -72.805  -32.140 1.00 91.68  ? 98  SER B OG  1 
ATOM   3446  N N   . LEU B 1 98  ? -27.398 -69.032  -30.252 1.00 84.42  ? 99  LEU B N   1 
ATOM   3447  C CA  . LEU B 1 98  ? -27.501 -67.590  -30.094 1.00 82.59  ? 99  LEU B CA  1 
ATOM   3448  C C   . LEU B 1 98  ? -28.080 -66.994  -31.370 1.00 81.65  ? 99  LEU B C   1 
ATOM   3449  O O   . LEU B 1 98  ? -27.922 -67.560  -32.451 1.00 81.14  ? 99  LEU B O   1 
ATOM   3450  C CB  . LEU B 1 98  ? -26.138 -66.972  -29.779 1.00 79.23  ? 99  LEU B CB  1 
ATOM   3451  N N   . GLU B 1 99  ? -28.758 -65.860  -31.241 1.00 81.84  ? 100 GLU B N   1 
ATOM   3452  C CA  . GLU B 1 99  ? -29.366 -65.202  -32.392 1.00 81.79  ? 100 GLU B CA  1 
ATOM   3453  C C   . GLU B 1 99  ? -29.015 -63.717  -32.413 1.00 80.72  ? 100 GLU B C   1 
ATOM   3454  O O   . GLU B 1 99  ? -28.860 -63.100  -31.359 1.00 81.25  ? 100 GLU B O   1 
ATOM   3455  C CB  . GLU B 1 99  ? -30.886 -65.390  -32.375 1.00 84.99  ? 100 GLU B CB  1 
ATOM   3456  N N   . PRO B 1 100 ? -28.884 -63.137  -33.616 1.00 79.44  ? 101 PRO B N   1 
ATOM   3457  C CA  . PRO B 1 100 ? -28.572 -61.708  -33.715 1.00 78.01  ? 101 PRO B CA  1 
ATOM   3458  C C   . PRO B 1 100 ? -29.724 -60.850  -33.209 1.00 80.20  ? 101 PRO B C   1 
ATOM   3459  O O   . PRO B 1 100 ? -30.876 -61.275  -33.273 1.00 83.06  ? 101 PRO B O   1 
ATOM   3460  C CB  . PRO B 1 100 ? -28.347 -61.501  -35.215 1.00 76.90  ? 101 PRO B CB  1 
ATOM   3461  C CG  . PRO B 1 100 ? -29.167 -62.566  -35.860 1.00 78.82  ? 101 PRO B CG  1 
ATOM   3462  C CD  . PRO B 1 100 ? -29.066 -63.754  -34.942 1.00 79.46  ? 101 PRO B CD  1 
ATOM   3463  N N   . GLY B 1 101 ? -29.412 -59.660  -32.709 1.00 79.36  ? 102 GLY B N   1 
ATOM   3464  C CA  . GLY B 1 101 ? -30.434 -58.770  -32.195 1.00 82.61  ? 102 GLY B CA  1 
ATOM   3465  C C   . GLY B 1 101 ? -29.924 -57.374  -31.903 1.00 82.27  ? 102 GLY B C   1 
ATOM   3466  O O   . GLY B 1 101 ? -29.351 -56.713  -32.770 1.00 80.58  ? 102 GLY B O   1 
ATOM   3467  N N   . THR B 1 102 ? -30.134 -56.931  -30.668 1.00 83.96  ? 103 THR B N   1 
ATOM   3468  C CA  . THR B 1 102 ? -29.792 -55.577  -30.252 1.00 83.87  ? 103 THR B CA  1 
ATOM   3469  C C   . THR B 1 102 ? -28.916 -55.640  -29.000 1.00 83.18  ? 103 THR B C   1 
ATOM   3470  O O   . THR B 1 102 ? -29.215 -56.398  -28.078 1.00 85.30  ? 103 THR B O   1 
ATOM   3471  C CB  . THR B 1 102 ? -31.070 -54.747  -29.977 1.00 87.60  ? 103 THR B CB  1 
ATOM   3472  O OG1 . THR B 1 102 ? -31.992 -54.911  -31.062 1.00 88.60  ? 103 THR B OG1 1 
ATOM   3473  C CG2 . THR B 1 102 ? -30.751 -53.268  -29.812 1.00 87.48  ? 103 THR B CG2 1 
ATOM   3474  N N   . PRO B 1 103 ? -27.825 -54.854  -28.959 1.00 80.37  ? 104 PRO B N   1 
ATOM   3475  C CA  . PRO B 1 103 ? -27.343 -53.900  -29.966 1.00 77.63  ? 104 PRO B CA  1 
ATOM   3476  C C   . PRO B 1 103 ? -26.682 -54.564  -31.171 1.00 73.71  ? 104 PRO B C   1 
ATOM   3477  O O   . PRO B 1 103 ? -26.379 -55.757  -31.137 1.00 72.72  ? 104 PRO B O   1 
ATOM   3478  C CB  . PRO B 1 103 ? -26.326 -53.063  -29.188 1.00 76.94  ? 104 PRO B CB  1 
ATOM   3479  C CG  . PRO B 1 103 ? -25.810 -53.994  -28.157 1.00 77.08  ? 104 PRO B CG  1 
ATOM   3480  C CD  . PRO B 1 103 ? -26.976 -54.849  -27.755 1.00 79.80  ? 104 PRO B CD  1 
ATOM   3481  N N   . ARG B 1 104 ? -26.460 -53.784  -32.222 1.00 71.66  ? 105 ARG B N   1 
ATOM   3482  C CA  . ARG B 1 104 ? -25.910 -54.307  -33.465 1.00 68.89  ? 105 ARG B CA  1 
ATOM   3483  C C   . ARG B 1 104 ? -24.439 -54.689  -33.328 1.00 65.42  ? 105 ARG B C   1 
ATOM   3484  O O   . ARG B 1 104 ? -23.988 -55.655  -33.941 1.00 64.34  ? 105 ARG B O   1 
ATOM   3485  C CB  . ARG B 1 104 ? -26.082 -53.287  -34.594 1.00 68.79  ? 105 ARG B CB  1 
ATOM   3486  N N   . TRP B 1 105 ? -23.697 -53.934  -32.523 1.00 63.90  ? 106 TRP B N   1 
ATOM   3487  C CA  . TRP B 1 105 ? -22.261 -54.160  -32.382 1.00 60.58  ? 106 TRP B CA  1 
ATOM   3488  C C   . TRP B 1 105 ? -21.956 -55.483  -31.686 1.00 59.47  ? 106 TRP B C   1 
ATOM   3489  O O   . TRP B 1 105 ? -20.907 -56.085  -31.917 1.00 57.17  ? 106 TRP B O   1 
ATOM   3490  C CB  . TRP B 1 105 ? -21.601 -53.005  -31.619 1.00 61.00  ? 106 TRP B CB  1 
ATOM   3491  C CG  . TRP B 1 105 ? -22.025 -52.883  -30.180 1.00 64.72  ? 106 TRP B CG  1 
ATOM   3492  C CD1 . TRP B 1 105 ? -23.023 -52.094  -29.683 1.00 67.79  ? 106 TRP B CD1 1 
ATOM   3493  C CD2 . TRP B 1 105 ? -21.457 -53.563  -29.052 1.00 65.63  ? 106 TRP B CD2 1 
ATOM   3494  N NE1 . TRP B 1 105 ? -23.113 -52.241  -28.321 1.00 69.77  ? 106 TRP B NE1 1 
ATOM   3495  C CE2 . TRP B 1 105 ? -22.162 -53.141  -27.907 1.00 68.62  ? 106 TRP B CE2 1 
ATOM   3496  C CE3 . TRP B 1 105 ? -20.420 -54.491  -28.899 1.00 64.12  ? 106 TRP B CE3 1 
ATOM   3497  C CZ2 . TRP B 1 105 ? -21.869 -53.610  -26.628 1.00 69.85  ? 106 TRP B CZ2 1 
ATOM   3498  C CZ3 . TRP B 1 105 ? -20.130 -54.959  -27.626 1.00 65.34  ? 106 TRP B CZ3 1 
ATOM   3499  C CH2 . TRP B 1 105 ? -20.852 -54.517  -26.509 1.00 68.03  ? 106 TRP B CH2 1 
ATOM   3500  N N   . ALA B 1 106 ? -22.871 -55.936  -30.836 1.00 60.74  ? 107 ALA B N   1 
ATOM   3501  C CA  . ALA B 1 106 ? -22.666 -57.182  -30.105 1.00 59.87  ? 107 ALA B CA  1 
ATOM   3502  C C   . ALA B 1 106 ? -22.950 -58.402  -30.978 1.00 58.77  ? 107 ALA B C   1 
ATOM   3503  O O   . ALA B 1 106 ? -22.587 -59.522  -30.620 1.00 58.11  ? 107 ALA B O   1 
ATOM   3504  C CB  . ALA B 1 106 ? -23.531 -57.212  -28.860 1.00 62.19  ? 107 ALA B CB  1 
ATOM   3505  N N   . ASN B 1 107 ? -23.596 -58.180  -32.120 1.00 58.79  ? 108 ASN B N   1 
ATOM   3506  C CA  . ASN B 1 107 ? -23.880 -59.261  -33.060 1.00 57.55  ? 108 ASN B CA  1 
ATOM   3507  C C   . ASN B 1 107 ? -22.601 -59.904  -33.570 1.00 54.46  ? 108 ASN B C   1 
ATOM   3508  O O   . ASN B 1 107 ? -22.556 -61.105  -33.828 1.00 54.25  ? 108 ASN B O   1 
ATOM   3509  C CB  . ASN B 1 107 ? -24.707 -58.749  -34.241 1.00 57.49  ? 108 ASN B CB  1 
ATOM   3510  C CG  . ASN B 1 107 ? -26.121 -58.390  -33.848 1.00 60.37  ? 108 ASN B CG  1 
ATOM   3511  O OD1 . ASN B 1 107 ? -26.688 -58.976  -32.926 1.00 61.95  ? 108 ASN B OD1 1 
ATOM   3512  N ND2 . ASN B 1 107 ? -26.700 -57.419  -34.545 1.00 61.46  ? 108 ASN B ND2 1 
ATOM   3513  N N   . TYR B 1 108 ? -21.561 -59.090  -33.708 1.00 53.05  ? 109 TYR B N   1 
ATOM   3514  C CA  . TYR B 1 108 ? -20.271 -59.566  -34.188 1.00 51.65  ? 109 TYR B CA  1 
ATOM   3515  C C   . TYR B 1 108 ? -19.609 -60.489  -33.179 1.00 52.55  ? 109 TYR B C   1 
ATOM   3516  O O   . TYR B 1 108 ? -19.048 -61.521  -33.546 1.00 53.17  ? 109 TYR B O   1 
ATOM   3517  C CB  . TYR B 1 108 ? -19.353 -58.389  -34.498 1.00 49.24  ? 109 TYR B CB  1 
ATOM   3518  C CG  . TYR B 1 108 ? -19.909 -57.458  -35.545 1.00 49.29  ? 109 TYR B CG  1 
ATOM   3519  C CD1 . TYR B 1 108 ? -20.108 -57.895  -36.848 1.00 48.76  ? 109 TYR B CD1 1 
ATOM   3520  C CD2 . TYR B 1 108 ? -20.233 -56.142  -35.237 1.00 49.41  ? 109 TYR B CD2 1 
ATOM   3521  C CE1 . TYR B 1 108 ? -20.619 -57.054  -37.814 1.00 48.66  ? 109 TYR B CE1 1 
ATOM   3522  C CE2 . TYR B 1 108 ? -20.742 -55.289  -36.203 1.00 48.87  ? 109 TYR B CE2 1 
ATOM   3523  C CZ  . TYR B 1 108 ? -20.931 -55.752  -37.489 1.00 48.18  ? 109 TYR B CZ  1 
ATOM   3524  O OH  . TYR B 1 108 ? -21.433 -54.917  -38.456 1.00 47.62  ? 109 TYR B OH  1 
ATOM   3525  N N   . VAL B 1 109 ? -19.670 -60.107  -31.907 1.00 53.04  ? 110 VAL B N   1 
ATOM   3526  C CA  . VAL B 1 109 ? -19.095 -60.917  -30.843 1.00 54.20  ? 110 VAL B CA  1 
ATOM   3527  C C   . VAL B 1 109 ? -19.908 -62.192  -30.650 1.00 55.87  ? 110 VAL B C   1 
ATOM   3528  O O   . VAL B 1 109 ? -19.353 -63.287  -30.585 1.00 55.98  ? 110 VAL B O   1 
ATOM   3529  C CB  . VAL B 1 109 ? -19.028 -60.141  -29.511 1.00 55.33  ? 110 VAL B CB  1 
ATOM   3530  C CG1 . VAL B 1 109 ? -18.548 -61.046  -28.390 1.00 56.17  ? 110 VAL B CG1 1 
ATOM   3531  C CG2 . VAL B 1 109 ? -18.119 -58.927  -29.651 1.00 53.55  ? 110 VAL B CG2 1 
ATOM   3532  N N   . LYS B 1 110 ? -21.226 -62.040  -30.572 1.00 57.44  ? 111 LYS B N   1 
ATOM   3533  C CA  . LYS B 1 110 ? -22.118 -63.179  -30.393 1.00 58.58  ? 111 LYS B CA  1 
ATOM   3534  C C   . LYS B 1 110 ? -21.990 -64.165  -31.550 1.00 57.81  ? 111 LYS B C   1 
ATOM   3535  O O   . LYS B 1 110 ? -22.045 -65.378  -31.350 1.00 58.18  ? 111 LYS B O   1 
ATOM   3536  C CB  . LYS B 1 110 ? -23.568 -62.707  -30.259 1.00 60.62  ? 111 LYS B CB  1 
ATOM   3537  N N   . GLY B 1 111 ? -21.810 -63.634  -32.757 1.00 56.65  ? 112 GLY B N   1 
ATOM   3538  C CA  . GLY B 1 111 ? -21.685 -64.451  -33.951 1.00 55.97  ? 112 GLY B CA  1 
ATOM   3539  C C   . GLY B 1 111 ? -20.460 -65.345  -33.939 1.00 54.45  ? 112 GLY B C   1 
ATOM   3540  O O   . GLY B 1 111 ? -20.535 -66.516  -34.315 1.00 55.71  ? 112 GLY B O   1 
ATOM   3541  N N   . VAL B 1 112 ? -19.330 -64.796  -33.506 1.00 51.64  ? 113 VAL B N   1 
ATOM   3542  C CA  . VAL B 1 112 ? -18.091 -65.565  -33.409 1.00 48.77  ? 113 VAL B CA  1 
ATOM   3543  C C   . VAL B 1 112 ? -18.194 -66.644  -32.328 1.00 49.78  ? 113 VAL B C   1 
ATOM   3544  O O   . VAL B 1 112 ? -17.728 -67.768  -32.517 1.00 48.16  ? 113 VAL B O   1 
ATOM   3545  C CB  . VAL B 1 112 ? -16.887 -64.649  -33.113 1.00 45.98  ? 113 VAL B CB  1 
ATOM   3546  C CG1 . VAL B 1 112 ? -15.639 -65.471  -32.798 1.00 45.28  ? 113 VAL B CG1 1 
ATOM   3547  C CG2 . VAL B 1 112 ? -16.635 -63.718  -34.285 1.00 43.40  ? 113 VAL B CG2 1 
ATOM   3548  N N   . ILE B 1 113 ? -18.813 -66.296  -31.203 1.00 52.22  ? 114 ILE B N   1 
ATOM   3549  C CA  . ILE B 1 113 ? -19.019 -67.241  -30.110 1.00 55.11  ? 114 ILE B CA  1 
ATOM   3550  C C   . ILE B 1 113 ? -19.829 -68.440  -30.590 1.00 58.00  ? 114 ILE B C   1 
ATOM   3551  O O   . ILE B 1 113 ? -19.473 -69.590  -30.335 1.00 58.02  ? 114 ILE B O   1 
ATOM   3552  C CB  . ILE B 1 113 ? -19.743 -66.580  -28.917 1.00 56.37  ? 114 ILE B CB  1 
ATOM   3553  C CG1 . ILE B 1 113 ? -18.876 -65.479  -28.304 1.00 55.10  ? 114 ILE B CG1 1 
ATOM   3554  C CG2 . ILE B 1 113 ? -20.105 -67.614  -27.864 1.00 58.15  ? 114 ILE B CG2 1 
ATOM   3555  C CD1 . ILE B 1 113 ? -19.537 -64.763  -27.147 1.00 57.38  ? 114 ILE B CD1 1 
ATOM   3556  N N   . GLN B 1 114 ? -20.907 -68.150  -31.311 1.00 60.45  ? 115 GLN B N   1 
ATOM   3557  C CA  . GLN B 1 114 ? -21.822 -69.168  -31.817 1.00 62.55  ? 115 GLN B CA  1 
ATOM   3558  C C   . GLN B 1 114 ? -21.150 -70.202  -32.723 1.00 61.72  ? 115 GLN B C   1 
ATOM   3559  O O   . GLN B 1 114 ? -21.481 -71.386  -32.673 1.00 62.65  ? 115 GLN B O   1 
ATOM   3560  C CB  . GLN B 1 114 ? -22.971 -68.494  -32.573 1.00 63.24  ? 115 GLN B CB  1 
ATOM   3561  C CG  . GLN B 1 114 ? -24.006 -69.456  -33.116 1.00 64.88  ? 115 GLN B CG  1 
ATOM   3562  C CD  . GLN B 1 114 ? -24.680 -70.257  -32.023 1.00 66.86  ? 115 GLN B CD  1 
ATOM   3563  O OE1 . GLN B 1 114 ? -24.916 -69.756  -30.924 1.00 67.95  ? 115 GLN B OE1 1 
ATOM   3564  N NE2 . GLN B 1 114 ? -24.991 -71.513  -32.320 1.00 67.69  ? 115 GLN B NE2 1 
ATOM   3565  N N   . TYR B 1 115 ? -20.213 -69.756  -33.554 1.00 61.27  ? 116 TYR B N   1 
ATOM   3566  C CA  . TYR B 1 115 ? -19.581 -70.649  -34.521 1.00 61.14  ? 116 TYR B CA  1 
ATOM   3567  C C   . TYR B 1 115 ? -18.169 -71.074  -34.123 1.00 59.06  ? 116 TYR B C   1 
ATOM   3568  O O   . TYR B 1 115 ? -17.447 -71.663  -34.929 1.00 57.06  ? 116 TYR B O   1 
ATOM   3569  C CB  . TYR B 1 115 ? -19.543 -69.990  -35.902 1.00 61.11  ? 116 TYR B CB  1 
ATOM   3570  C CG  . TYR B 1 115 ? -20.908 -69.784  -36.517 1.00 64.84  ? 116 TYR B CG  1 
ATOM   3571  C CD1 . TYR B 1 115 ? -21.624 -70.855  -37.037 1.00 67.82  ? 116 TYR B CD1 1 
ATOM   3572  C CD2 . TYR B 1 115 ? -21.476 -68.519  -36.590 1.00 65.91  ? 116 TYR B CD2 1 
ATOM   3573  C CE1 . TYR B 1 115 ? -22.872 -70.673  -37.605 1.00 70.68  ? 116 TYR B CE1 1 
ATOM   3574  C CE2 . TYR B 1 115 ? -22.725 -68.326  -37.156 1.00 68.64  ? 116 TYR B CE2 1 
ATOM   3575  C CZ  . TYR B 1 115 ? -23.418 -69.407  -37.662 1.00 71.08  ? 116 TYR B CZ  1 
ATOM   3576  O OH  . TYR B 1 115 ? -24.660 -69.221  -38.227 1.00 73.93  ? 116 TYR B OH  1 
ATOM   3577  N N   . TYR B 1 116 ? -17.776 -70.782  -32.886 1.00 59.25  ? 117 TYR B N   1 
ATOM   3578  C CA  . TYR B 1 116 ? -16.448 -71.166  -32.419 1.00 57.74  ? 117 TYR B CA  1 
ATOM   3579  C C   . TYR B 1 116 ? -16.358 -72.689  -32.329 1.00 58.21  ? 117 TYR B C   1 
ATOM   3580  O O   . TYR B 1 116 ? -17.148 -73.319  -31.628 1.00 60.42  ? 117 TYR B O   1 
ATOM   3581  C CB  . TYR B 1 116 ? -16.127 -70.517  -31.072 1.00 57.62  ? 117 TYR B CB  1 
ATOM   3582  C CG  . TYR B 1 116 ? -14.669 -70.632  -30.697 1.00 56.12  ? 117 TYR B CG  1 
ATOM   3583  C CD1 . TYR B 1 116 ? -13.700 -69.894  -31.366 1.00 53.05  ? 117 TYR B CD1 1 
ATOM   3584  C CD2 . TYR B 1 116 ? -14.258 -71.486  -29.683 1.00 57.15  ? 117 TYR B CD2 1 
ATOM   3585  C CE1 . TYR B 1 116 ? -12.363 -70.000  -31.032 1.00 51.22  ? 117 TYR B CE1 1 
ATOM   3586  C CE2 . TYR B 1 116 ? -12.925 -71.598  -29.341 1.00 55.89  ? 117 TYR B CE2 1 
ATOM   3587  C CZ  . TYR B 1 116 ? -11.981 -70.854  -30.019 1.00 52.74  ? 117 TYR B CZ  1 
ATOM   3588  O OH  . TYR B 1 116 ? -10.652 -70.968  -29.680 1.00 50.91  ? 117 TYR B OH  1 
ATOM   3589  N N   . PRO B 1 117 ? -15.389 -73.279  -33.047 1.00 56.13  ? 118 PRO B N   1 
ATOM   3590  C CA  . PRO B 1 117 ? -15.306 -74.720  -33.317 1.00 57.13  ? 118 PRO B CA  1 
ATOM   3591  C C   . PRO B 1 117 ? -14.799 -75.582  -32.164 1.00 57.85  ? 118 PRO B C   1 
ATOM   3592  O O   . PRO B 1 117 ? -14.996 -76.795  -32.207 1.00 60.49  ? 118 PRO B O   1 
ATOM   3593  C CB  . PRO B 1 117 ? -14.323 -74.786  -34.487 1.00 55.43  ? 118 PRO B CB  1 
ATOM   3594  C CG  . PRO B 1 117 ? -13.424 -73.634  -34.261 1.00 52.90  ? 118 PRO B CG  1 
ATOM   3595  C CD  . PRO B 1 117 ? -14.285 -72.541  -33.687 1.00 52.92  ? 118 PRO B CD  1 
ATOM   3596  N N   . ALA B 1 118 ? -14.157 -74.982  -31.166 1.00 56.53  ? 119 ALA B N   1 
ATOM   3597  C CA  . ALA B 1 118 ? -13.569 -75.756  -30.075 1.00 58.17  ? 119 ALA B CA  1 
ATOM   3598  C C   . ALA B 1 118 ? -14.368 -75.631  -28.783 1.00 60.89  ? 119 ALA B C   1 
ATOM   3599  O O   . ALA B 1 118 ? -15.160 -74.702  -28.611 1.00 60.93  ? 119 ALA B O   1 
ATOM   3600  C CB  . ALA B 1 118 ? -12.125 -75.332  -29.840 1.00 55.78  ? 119 ALA B CB  1 
ATOM   3601  N N   . ALA B 1 119 ? -14.136 -76.575  -27.876 1.00 63.20  ? 120 ALA B N   1 
ATOM   3602  C CA  . ALA B 1 119 ? -14.858 -76.660  -26.613 1.00 65.90  ? 120 ALA B CA  1 
ATOM   3603  C C   . ALA B 1 119 ? -13.952 -77.291  -25.554 1.00 66.55  ? 120 ALA B C   1 
ATOM   3604  O O   . ALA B 1 119 ? -13.003 -77.993  -25.899 1.00 66.04  ? 120 ALA B O   1 
ATOM   3605  C CB  . ALA B 1 119 ? -16.141 -77.470  -26.791 1.00 69.00  ? 120 ALA B CB  1 
ATOM   3606  N N   . PRO B 1 120 ? -14.226 -77.042  -24.260 1.00 68.11  ? 121 PRO B N   1 
ATOM   3607  C CA  . PRO B 1 120 ? -15.296 -76.209  -23.699 1.00 69.16  ? 121 PRO B CA  1 
ATOM   3608  C C   . PRO B 1 120 ? -14.940 -74.727  -23.659 1.00 67.40  ? 121 PRO B C   1 
ATOM   3609  O O   . PRO B 1 120 ? -13.885 -74.351  -23.144 1.00 66.53  ? 121 PRO B O   1 
ATOM   3610  C CB  . PRO B 1 120 ? -15.459 -76.769  -22.283 1.00 71.53  ? 121 PRO B CB  1 
ATOM   3611  C CG  . PRO B 1 120 ? -14.101 -77.250  -21.926 1.00 70.27  ? 121 PRO B CG  1 
ATOM   3612  C CD  . PRO B 1 120 ? -13.473 -77.746  -23.204 1.00 68.86  ? 121 PRO B CD  1 
ATOM   3613  N N   . LEU B 1 121 ? -15.822 -73.898  -24.208 1.00 67.07  ? 122 LEU B N   1 
ATOM   3614  C CA  . LEU B 1 121 ? -15.647 -72.453  -24.165 1.00 64.46  ? 122 LEU B CA  1 
ATOM   3615  C C   . LEU B 1 121 ? -16.308 -71.880  -22.919 1.00 66.25  ? 122 LEU B C   1 
ATOM   3616  O O   . LEU B 1 121 ? -17.522 -71.992  -22.749 1.00 69.25  ? 122 LEU B O   1 
ATOM   3617  C CB  . LEU B 1 121 ? -16.230 -71.795  -25.415 1.00 63.11  ? 122 LEU B CB  1 
ATOM   3618  C CG  . LEU B 1 121 ? -15.976 -70.291  -25.531 1.00 60.53  ? 122 LEU B CG  1 
ATOM   3619  C CD1 . LEU B 1 121 ? -14.630 -70.028  -26.191 1.00 57.15  ? 122 LEU B CD1 1 
ATOM   3620  C CD2 . LEU B 1 121 ? -17.098 -69.606  -26.294 1.00 61.00  ? 122 LEU B CD2 1 
ATOM   3621  N N   . PRO B 1 122 ? -15.508 -71.265  -22.040 1.00 64.67  ? 123 PRO B N   1 
ATOM   3622  C CA  . PRO B 1 122 ? -16.028 -70.710  -20.787 1.00 65.97  ? 123 PRO B CA  1 
ATOM   3623  C C   . PRO B 1 122 ? -16.732 -69.377  -21.000 1.00 66.07  ? 123 PRO B C   1 
ATOM   3624  O O   . PRO B 1 122 ? -16.849 -68.913  -22.136 1.00 64.25  ? 123 PRO B O   1 
ATOM   3625  C CB  . PRO B 1 122 ? -14.768 -70.525  -19.943 1.00 64.99  ? 123 PRO B CB  1 
ATOM   3626  C CG  . PRO B 1 122 ? -13.701 -70.248  -20.950 1.00 61.69  ? 123 PRO B CG  1 
ATOM   3627  C CD  . PRO B 1 122 ? -14.053 -71.062  -22.173 1.00 61.46  ? 123 PRO B CD  1 
ATOM   3628  N N   . GLY B 1 123 ? -17.203 -68.777  -19.913 1.00 67.51  ? 124 GLY B N   1 
ATOM   3629  C CA  . GLY B 1 123 ? -17.735 -67.429  -19.959 1.00 66.96  ? 124 GLY B CA  1 
ATOM   3630  C C   . GLY B 1 123 ? -16.592 -66.459  -19.747 1.00 64.11  ? 124 GLY B C   1 
ATOM   3631  O O   . GLY B 1 123 ? -15.487 -66.874  -19.397 1.00 63.81  ? 124 GLY B O   1 
ATOM   3632  N N   . PHE B 1 124 ? -16.846 -65.171  -19.951 1.00 62.30  ? 125 PHE B N   1 
ATOM   3633  C CA  . PHE B 1 124 ? -15.793 -64.177  -19.805 1.00 60.50  ? 125 PHE B CA  1 
ATOM   3634  C C   . PHE B 1 124 ? -16.322 -62.757  -19.661 1.00 61.12  ? 125 PHE B C   1 
ATOM   3635  O O   . PHE B 1 124 ? -17.413 -62.431  -20.132 1.00 60.85  ? 125 PHE B O   1 
ATOM   3636  C CB  . PHE B 1 124 ? -14.833 -64.243  -21.000 1.00 57.96  ? 125 PHE B CB  1 
ATOM   3637  C CG  . PHE B 1 124 ? -15.491 -63.988  -22.332 1.00 57.83  ? 125 PHE B CG  1 
ATOM   3638  C CD1 . PHE B 1 124 ? -16.121 -65.014  -23.019 1.00 58.52  ? 125 PHE B CD1 1 
ATOM   3639  C CD2 . PHE B 1 124 ? -15.464 -62.725  -22.905 1.00 56.87  ? 125 PHE B CD2 1 
ATOM   3640  C CE1 . PHE B 1 124 ? -16.719 -64.782  -24.245 1.00 58.14  ? 125 PHE B CE1 1 
ATOM   3641  C CE2 . PHE B 1 124 ? -16.060 -62.487  -24.130 1.00 56.26  ? 125 PHE B CE2 1 
ATOM   3642  C CZ  . PHE B 1 124 ? -16.689 -63.517  -24.801 1.00 56.78  ? 125 PHE B CZ  1 
ATOM   3643  N N   . SER B 1 125 ? -15.534 -61.920  -18.993 1.00 62.14  ? 126 SER B N   1 
ATOM   3644  C CA  . SER B 1 125 ? -15.779 -60.486  -18.950 1.00 63.46  ? 126 SER B CA  1 
ATOM   3645  C C   . SER B 1 125 ? -14.775 -59.813  -19.878 1.00 60.93  ? 126 SER B C   1 
ATOM   3646  O O   . SER B 1 125 ? -13.618 -60.223  -19.937 1.00 60.45  ? 126 SER B O   1 
ATOM   3647  C CB  . SER B 1 125 ? -15.657 -59.948  -17.521 1.00 66.12  ? 126 SER B CB  1 
ATOM   3648  N N   . ALA B 1 126 ? -15.217 -58.799  -20.617 1.00 59.05  ? 127 ALA B N   1 
ATOM   3649  C CA  . ALA B 1 126 ? -14.346 -58.142  -21.587 1.00 53.97  ? 127 ALA B CA  1 
ATOM   3650  C C   . ALA B 1 126 ? -14.783 -56.714  -21.900 1.00 52.47  ? 127 ALA B C   1 
ATOM   3651  O O   . ALA B 1 126 ? -15.975 -56.413  -21.958 1.00 54.65  ? 127 ALA B O   1 
ATOM   3652  C CB  . ALA B 1 126 ? -14.284 -58.961  -22.873 1.00 52.50  ? 127 ALA B CB  1 
ATOM   3653  N N   . VAL B 1 127 ? -13.801 -55.840  -22.096 1.00 49.28  ? 128 VAL B N   1 
ATOM   3654  C CA  . VAL B 1 127 ? -14.050 -54.487  -22.576 1.00 48.16  ? 128 VAL B CA  1 
ATOM   3655  C C   . VAL B 1 127 ? -13.534 -54.347  -24.007 1.00 46.56  ? 128 VAL B C   1 
ATOM   3656  O O   . VAL B 1 127 ? -12.403 -54.732  -24.305 1.00 44.39  ? 128 VAL B O   1 
ATOM   3657  C CB  . VAL B 1 127 ? -13.393 -53.430  -21.668 1.00 48.21  ? 128 VAL B CB  1 
ATOM   3658  C CG1 . VAL B 1 127 ? -13.177 -52.119  -22.417 1.00 47.27  ? 128 VAL B CG1 1 
ATOM   3659  C CG2 . VAL B 1 127 ? -14.247 -53.209  -20.426 1.00 51.19  ? 128 VAL B CG2 1 
ATOM   3660  N N   . VAL B 1 128 ? -14.379 -53.808  -24.884 1.00 47.54  ? 129 VAL B N   1 
ATOM   3661  C CA  . VAL B 1 128 ? -14.057 -53.676  -26.303 1.00 47.55  ? 129 VAL B CA  1 
ATOM   3662  C C   . VAL B 1 128 ? -13.822 -52.222  -26.703 1.00 48.62  ? 129 VAL B C   1 
ATOM   3663  O O   . VAL B 1 128 ? -14.687 -51.366  -26.512 1.00 50.40  ? 129 VAL B O   1 
ATOM   3664  C CB  . VAL B 1 128 ? -15.184 -54.255  -27.187 1.00 48.09  ? 129 VAL B CB  1 
ATOM   3665  C CG1 . VAL B 1 128 ? -14.899 -53.992  -28.652 1.00 46.20  ? 129 VAL B CG1 1 
ATOM   3666  C CG2 . VAL B 1 128 ? -15.360 -55.742  -26.926 1.00 48.44  ? 129 VAL B CG2 1 
ATOM   3667  N N   . VAL B 1 129 ? -12.647 -51.947  -27.257 1.00 47.15  ? 130 VAL B N   1 
ATOM   3668  C CA  . VAL B 1 129 ? -12.337 -50.624  -27.786 1.00 46.19  ? 130 VAL B CA  1 
ATOM   3669  C C   . VAL B 1 129 ? -11.839 -50.757  -29.218 1.00 43.68  ? 130 VAL B C   1 
ATOM   3670  O O   . VAL B 1 129 ? -11.361 -51.816  -29.617 1.00 41.88  ? 130 VAL B O   1 
ATOM   3671  C CB  . VAL B 1 129 ? -11.273 -49.897  -26.943 1.00 47.57  ? 130 VAL B CB  1 
ATOM   3672  C CG1 . VAL B 1 129 ? -11.786 -49.647  -25.523 1.00 48.89  ? 130 VAL B CG1 1 
ATOM   3673  C CG2 . VAL B 1 129 ? -9.985  -50.700  -26.914 1.00 47.17  ? 130 VAL B CG2 1 
ATOM   3674  N N   . SER B 1 130 ? -11.949 -49.684  -29.990 1.00 44.09  ? 131 SER B N   1 
ATOM   3675  C CA  . SER B 1 130 ? -11.482 -49.710  -31.369 1.00 43.69  ? 131 SER B CA  1 
ATOM   3676  C C   . SER B 1 130 ? -11.124 -48.317  -31.868 1.00 44.59  ? 131 SER B C   1 
ATOM   3677  O O   . SER B 1 130 ? -11.718 -47.323  -31.448 1.00 48.60  ? 131 SER B O   1 
ATOM   3678  C CB  . SER B 1 130 ? -12.539 -50.336  -32.280 1.00 43.85  ? 131 SER B CB  1 
ATOM   3679  O OG  . SER B 1 130 ? -12.050 -50.445  -33.602 1.00 43.17  ? 131 SER B OG  1 
ATOM   3680  N N   . SER B 1 131 ? -10.136 -48.256  -32.753 1.00 41.45  ? 132 SER B N   1 
ATOM   3681  C CA  . SER B 1 131 ? -9.770  -47.011  -33.416 1.00 41.56  ? 132 SER B CA  1 
ATOM   3682  C C   . SER B 1 131 ? -10.116 -47.081  -34.906 1.00 42.23  ? 132 SER B C   1 
ATOM   3683  O O   . SER B 1 131 ? -9.878  -46.134  -35.659 1.00 43.96  ? 132 SER B O   1 
ATOM   3684  C CB  . SER B 1 131 ? -8.283  -46.715  -33.226 1.00 39.07  ? 132 SER B CB  1 
ATOM   3685  O OG  . SER B 1 131 ? -7.487  -47.808  -33.644 1.00 36.24  ? 132 SER B OG  1 
ATOM   3686  N N   . VAL B 1 132 ? -10.671 -48.211  -35.330 1.00 40.86  ? 133 VAL B N   1 
ATOM   3687  C CA  . VAL B 1 132 ? -11.143 -48.352  -36.702 1.00 40.65  ? 133 VAL B CA  1 
ATOM   3688  C C   . VAL B 1 132 ? -12.460 -47.596  -36.820 1.00 43.00  ? 133 VAL B C   1 
ATOM   3689  O O   . VAL B 1 132 ? -13.370 -47.828  -36.022 1.00 44.44  ? 133 VAL B O   1 
ATOM   3690  C CB  . VAL B 1 132 ? -11.344 -49.830  -37.099 1.00 38.94  ? 133 VAL B CB  1 
ATOM   3691  C CG1 . VAL B 1 132 ? -11.562 -49.954  -38.601 1.00 37.51  ? 133 VAL B CG1 1 
ATOM   3692  C CG2 . VAL B 1 132 ? -10.156 -50.678  -36.655 1.00 36.86  ? 133 VAL B CG2 1 
ATOM   3693  N N   . PRO B 1 133 ? -12.561 -46.671  -37.793 1.00 43.36  ? 134 PRO B N   1 
ATOM   3694  C CA  . PRO B 1 133 ? -13.814 -45.921  -37.941 1.00 45.79  ? 134 PRO B CA  1 
ATOM   3695  C C   . PRO B 1 133 ? -14.978 -46.876  -38.193 1.00 46.23  ? 134 PRO B C   1 
ATOM   3696  O O   . PRO B 1 133 ? -14.995 -47.559  -39.217 1.00 43.75  ? 134 PRO B O   1 
ATOM   3697  C CB  . PRO B 1 133 ? -13.553 -45.015  -39.155 1.00 45.88  ? 134 PRO B CB  1 
ATOM   3698  C CG  . PRO B 1 133 ? -12.442 -45.687  -39.909 1.00 43.35  ? 134 PRO B CG  1 
ATOM   3699  C CD  . PRO B 1 133 ? -11.587 -46.341  -38.849 1.00 41.59  ? 134 PRO B CD  1 
ATOM   3700  N N   . LEU B 1 134 ? -15.921 -46.930  -37.256 1.00 48.78  ? 135 LEU B N   1 
ATOM   3701  C CA  . LEU B 1 134 ? -17.002 -47.911  -37.302 1.00 50.94  ? 135 LEU B CA  1 
ATOM   3702  C C   . LEU B 1 134 ? -17.841 -47.778  -38.573 1.00 51.58  ? 135 LEU B C   1 
ATOM   3703  O O   . LEU B 1 134 ? -18.601 -46.824  -38.735 1.00 54.13  ? 135 LEU B O   1 
ATOM   3704  C CB  . LEU B 1 134 ? -17.894 -47.780  -36.059 1.00 53.81  ? 135 LEU B CB  1 
ATOM   3705  C CG  . LEU B 1 134 ? -17.215 -47.866  -34.683 1.00 54.08  ? 135 LEU B CG  1 
ATOM   3706  C CD1 . LEU B 1 134 ? -18.253 -47.968  -33.573 1.00 56.66  ? 135 LEU B CD1 1 
ATOM   3707  C CD2 . LEU B 1 134 ? -16.227 -49.028  -34.601 1.00 51.78  ? 135 LEU B CD2 1 
ATOM   3708  N N   . GLY B 1 135 ? -17.687 -48.742  -39.476 1.00 50.43  ? 136 GLY B N   1 
ATOM   3709  C CA  . GLY B 1 135 ? -18.419 -48.748  -40.731 1.00 50.99  ? 136 GLY B CA  1 
ATOM   3710  C C   . GLY B 1 135 ? -17.919 -47.722  -41.733 1.00 50.66  ? 136 GLY B C   1 
ATOM   3711  O O   . GLY B 1 135 ? -18.699 -47.183  -42.514 1.00 51.78  ? 136 GLY B O   1 
ATOM   3712  N N   . GLY B 1 136 ? -16.616 -47.455  -41.716 1.00 49.01  ? 137 GLY B N   1 
ATOM   3713  C CA  . GLY B 1 136 ? -16.031 -46.456  -42.596 1.00 47.44  ? 137 GLY B CA  1 
ATOM   3714  C C   . GLY B 1 136 ? -15.332 -47.038  -43.814 1.00 45.05  ? 137 GLY B C   1 
ATOM   3715  O O   . GLY B 1 136 ? -14.699 -46.312  -44.584 1.00 45.44  ? 137 GLY B O   1 
ATOM   3716  N N   . GLY B 1 137 ? -15.444 -48.351  -43.989 1.00 41.58  ? 138 GLY B N   1 
ATOM   3717  C CA  . GLY B 1 137 ? -14.838 -49.020  -45.126 1.00 38.47  ? 138 GLY B CA  1 
ATOM   3718  C C   . GLY B 1 137 ? -13.469 -49.618  -44.848 1.00 36.75  ? 138 GLY B C   1 
ATOM   3719  O O   . GLY B 1 137 ? -12.781 -50.048  -45.771 1.00 36.63  ? 138 GLY B O   1 
ATOM   3720  N N   . LEU B 1 138 ? -13.073 -49.652  -43.578 1.00 35.69  ? 139 LEU B N   1 
ATOM   3721  C CA  . LEU B 1 138 ? -11.771 -50.194  -43.194 1.00 35.18  ? 139 LEU B CA  1 
ATOM   3722  C C   . LEU B 1 138 ? -11.911 -51.482  -42.376 1.00 35.42  ? 139 LEU B C   1 
ATOM   3723  O O   . LEU B 1 138 ? -10.997 -51.866  -41.642 1.00 35.14  ? 139 LEU B O   1 
ATOM   3724  C CB  . LEU B 1 138 ? -10.971 -49.144  -42.410 1.00 35.04  ? 139 LEU B CB  1 
ATOM   3725  C CG  . LEU B 1 138 ? -10.704 -47.850  -43.184 1.00 34.67  ? 139 LEU B CG  1 
ATOM   3726  C CD1 . LEU B 1 138 ? -9.910  -46.856  -42.361 1.00 33.89  ? 139 LEU B CD1 1 
ATOM   3727  C CD2 . LEU B 1 138 ? -9.987  -48.156  -44.498 1.00 34.19  ? 139 LEU B CD2 1 
ATOM   3728  N N   . SER B 1 139 ? -13.065 -52.132  -42.512 1.00 35.89  ? 140 SER B N   1 
ATOM   3729  C CA  . SER B 1 139 ? -13.341 -53.439  -41.911 1.00 35.30  ? 140 SER B CA  1 
ATOM   3730  C C   . SER B 1 139 ? -13.298 -53.435  -40.383 1.00 35.86  ? 140 SER B C   1 
ATOM   3731  O O   . SER B 1 139 ? -12.633 -54.272  -39.772 1.00 33.81  ? 140 SER B O   1 
ATOM   3732  C CB  . SER B 1 139 ? -12.361 -54.489  -42.442 1.00 34.52  ? 140 SER B CB  1 
ATOM   3733  O OG  . SER B 1 139 ? -12.251 -54.424  -43.856 1.00 33.38  ? 140 SER B OG  1 
ATOM   3734  N N   . SER B 1 140 ? -14.017 -52.501  -39.771 1.00 38.06  ? 141 SER B N   1 
ATOM   3735  C CA  . SER B 1 140 ? -14.123 -52.457  -38.319 1.00 39.64  ? 141 SER B CA  1 
ATOM   3736  C C   . SER B 1 140 ? -14.732 -53.747  -37.770 1.00 40.33  ? 141 SER B C   1 
ATOM   3737  O O   . SER B 1 140 ? -14.281 -54.275  -36.750 1.00 36.88  ? 141 SER B O   1 
ATOM   3738  C CB  . SER B 1 140 ? -14.953 -51.249  -37.881 1.00 41.34  ? 141 SER B CB  1 
ATOM   3739  O OG  . SER B 1 140 ? -16.215 -51.238  -38.525 1.00 43.24  ? 141 SER B OG  1 
ATOM   3740  N N   . SER B 1 141 ? -15.746 -54.259  -38.460 1.00 42.52  ? 142 SER B N   1 
ATOM   3741  C CA  . SER B 1 141 ? -16.438 -55.465  -38.013 1.00 43.45  ? 142 SER B CA  1 
ATOM   3742  C C   . SER B 1 141 ? -15.531 -56.689  -38.071 1.00 41.29  ? 142 SER B C   1 
ATOM   3743  O O   . SER B 1 141 ? -15.561 -57.527  -37.176 1.00 40.92  ? 142 SER B O   1 
ATOM   3744  C CB  . SER B 1 141 ? -17.698 -55.705  -38.849 1.00 44.45  ? 142 SER B CB  1 
ATOM   3745  O OG  . SER B 1 141 ? -17.383 -55.935  -40.208 1.00 43.37  ? 142 SER B OG  1 
ATOM   3746  N N   . ALA B 1 142 ? -14.728 -56.790  -39.126 1.00 39.91  ? 143 ALA B N   1 
ATOM   3747  C CA  . ALA B 1 142 ? -13.769 -57.885  -39.243 1.00 37.31  ? 143 ALA B CA  1 
ATOM   3748  C C   . ALA B 1 142 ? -12.742 -57.826  -38.118 1.00 36.00  ? 143 ALA B C   1 
ATOM   3749  O O   . ALA B 1 142 ? -12.328 -58.857  -37.582 1.00 35.14  ? 143 ALA B O   1 
ATOM   3750  C CB  . ALA B 1 142 ? -13.077 -57.848  -40.591 1.00 35.79  ? 143 ALA B CB  1 
ATOM   3751  N N   . SER B 1 143 ? -12.326 -56.616  -37.763 1.00 35.82  ? 144 SER B N   1 
ATOM   3752  C CA  . SER B 1 143 ? -11.387 -56.451  -36.664 1.00 35.68  ? 144 SER B CA  1 
ATOM   3753  C C   . SER B 1 143 ? -12.043 -56.935  -35.372 1.00 36.44  ? 144 SER B C   1 
ATOM   3754  O O   . SER B 1 143 ? -11.428 -57.655  -34.593 1.00 36.27  ? 144 SER B O   1 
ATOM   3755  C CB  . SER B 1 143 ? -10.931 -54.994  -36.541 1.00 36.13  ? 144 SER B CB  1 
ATOM   3756  O OG  . SER B 1 143 ? -11.992 -54.156  -36.116 1.00 39.08  ? 144 SER B OG  1 
ATOM   3757  N N   . LEU B 1 144 ? -13.306 -56.566  -35.173 1.00 38.06  ? 145 LEU B N   1 
ATOM   3758  C CA  . LEU B 1 144 ? -14.057 -56.993  -33.993 1.00 39.72  ? 145 LEU B CA  1 
ATOM   3759  C C   . LEU B 1 144 ? -14.241 -58.511  -33.960 1.00 40.71  ? 145 LEU B C   1 
ATOM   3760  O O   . LEU B 1 144 ? -14.080 -59.139  -32.913 1.00 43.50  ? 145 LEU B O   1 
ATOM   3761  C CB  . LEU B 1 144 ? -15.420 -56.297  -33.944 1.00 40.31  ? 145 LEU B CB  1 
ATOM   3762  C CG  . LEU B 1 144 ? -16.304 -56.602  -32.730 1.00 42.71  ? 145 LEU B CG  1 
ATOM   3763  C CD1 . LEU B 1 144 ? -15.543 -56.389  -31.424 1.00 42.48  ? 145 LEU B CD1 1 
ATOM   3764  C CD2 . LEU B 1 144 ? -17.569 -55.754  -32.760 1.00 43.76  ? 145 LEU B CD2 1 
ATOM   3765  N N   . GLU B 1 145 ? -14.573 -59.095  -35.107 1.00 39.83  ? 146 GLU B N   1 
ATOM   3766  C CA  . GLU B 1 145 ? -14.749 -60.543  -35.207 1.00 39.89  ? 146 GLU B CA  1 
ATOM   3767  C C   . GLU B 1 145 ? -13.459 -61.295  -34.891 1.00 36.65  ? 146 GLU B C   1 
ATOM   3768  O O   . GLU B 1 145 ? -13.441 -62.193  -34.049 1.00 35.42  ? 146 GLU B O   1 
ATOM   3769  C CB  . GLU B 1 145 ? -15.244 -60.923  -36.602 1.00 41.13  ? 146 GLU B CB  1 
ATOM   3770  C CG  . GLU B 1 145 ? -16.661 -60.478  -36.894 1.00 43.20  ? 146 GLU B CG  1 
ATOM   3771  C CD  . GLU B 1 145 ? -16.924 -60.280  -38.380 1.00 42.79  ? 146 GLU B CD  1 
ATOM   3772  O OE1 . GLU B 1 145 ? -15.970 -60.371  -39.184 1.00 41.20  ? 146 GLU B OE1 1 
ATOM   3773  O OE2 . GLU B 1 145 ? -18.091 -60.036  -38.741 1.00 43.47  ? 146 GLU B OE2 1 
ATOM   3774  N N   . VAL B 1 146 ? -12.380 -60.916  -35.566 1.00 35.21  ? 147 VAL B N   1 
ATOM   3775  C CA  . VAL B 1 146 ? -11.100 -61.593  -35.402 1.00 34.49  ? 147 VAL B CA  1 
ATOM   3776  C C   . VAL B 1 146 ? -10.538 -61.410  -33.988 1.00 35.69  ? 147 VAL B C   1 
ATOM   3777  O O   . VAL B 1 146 ? -9.997  -62.350  -33.404 1.00 36.38  ? 147 VAL B O   1 
ATOM   3778  C CB  . VAL B 1 146 ? -10.074 -61.101  -36.444 1.00 31.95  ? 147 VAL B CB  1 
ATOM   3779  C CG1 . VAL B 1 146 ? -8.686  -61.638  -36.127 1.00 32.07  ? 147 VAL B CG1 1 
ATOM   3780  C CG2 . VAL B 1 146 ? -10.499 -61.538  -37.838 1.00 30.62  ? 147 VAL B CG2 1 
ATOM   3781  N N   . ALA B 1 147 ? -10.676 -60.207  -33.436 1.00 35.79  ? 148 ALA B N   1 
ATOM   3782  C CA  . ALA B 1 147 ? -10.219 -59.948  -32.075 1.00 35.58  ? 148 ALA B CA  1 
ATOM   3783  C C   . ALA B 1 147 ? -10.980 -60.826  -31.094 1.00 36.47  ? 148 ALA B C   1 
ATOM   3784  O O   . ALA B 1 147 ? -10.397 -61.361  -30.150 1.00 38.73  ? 148 ALA B O   1 
ATOM   3785  C CB  . ALA B 1 147 ? -10.385 -58.483  -31.716 1.00 36.58  ? 148 ALA B CB  1 
ATOM   3786  N N   . THR B 1 148 ? -12.280 -60.974  -31.329 1.00 36.64  ? 149 THR B N   1 
ATOM   3787  C CA  . THR B 1 148 ? -13.117 -61.833  -30.503 1.00 39.34  ? 149 THR B CA  1 
ATOM   3788  C C   . THR B 1 148 ? -12.659 -63.281  -30.612 1.00 40.44  ? 149 THR B C   1 
ATOM   3789  O O   . THR B 1 148 ? -12.497 -63.963  -29.600 1.00 41.90  ? 149 THR B O   1 
ATOM   3790  C CB  . THR B 1 148 ? -14.604 -61.739  -30.895 1.00 40.30  ? 149 THR B CB  1 
ATOM   3791  O OG1 . THR B 1 148 ? -15.065 -60.395  -30.713 1.00 40.52  ? 149 THR B OG1 1 
ATOM   3792  C CG2 . THR B 1 148 ? -15.442 -62.673  -30.030 1.00 42.04  ? 149 THR B CG2 1 
ATOM   3793  N N   . TYR B 1 149 ? -12.440 -63.743  -31.841 1.00 39.54  ? 150 TYR B N   1 
ATOM   3794  C CA  . TYR B 1 149 ? -11.968 -65.105  -32.069 1.00 40.10  ? 150 TYR B CA  1 
ATOM   3795  C C   . TYR B 1 149 ? -10.627 -65.330  -31.380 1.00 38.84  ? 150 TYR B C   1 
ATOM   3796  O O   . TYR B 1 149 ? -10.406 -66.363  -30.747 1.00 40.02  ? 150 TYR B O   1 
ATOM   3797  C CB  . TYR B 1 149 ? -11.840 -65.408  -33.569 1.00 40.41  ? 150 TYR B CB  1 
ATOM   3798  C CG  . TYR B 1 149 ? -11.688 -66.885  -33.854 1.00 42.37  ? 150 TYR B CG  1 
ATOM   3799  C CD1 . TYR B 1 149 ? -10.461 -67.521  -33.701 1.00 42.62  ? 150 TYR B CD1 1 
ATOM   3800  C CD2 . TYR B 1 149 ? -12.775 -67.650  -34.256 1.00 44.79  ? 150 TYR B CD2 1 
ATOM   3801  C CE1 . TYR B 1 149 ? -10.321 -68.871  -33.942 1.00 44.18  ? 150 TYR B CE1 1 
ATOM   3802  C CE2 . TYR B 1 149 ? -12.644 -69.007  -34.503 1.00 46.19  ? 150 TYR B CE2 1 
ATOM   3803  C CZ  . TYR B 1 149 ? -11.414 -69.611  -34.345 1.00 46.15  ? 150 TYR B CZ  1 
ATOM   3804  O OH  . TYR B 1 149 ? -11.275 -70.960  -34.587 1.00 47.86  ? 150 TYR B OH  1 
ATOM   3805  N N   . THR B 1 150 ? -9.735  -64.356  -31.519 1.00 37.34  ? 151 THR B N   1 
ATOM   3806  C CA  . THR B 1 150 ? -8.402  -64.428  -30.934 1.00 37.25  ? 151 THR B CA  1 
ATOM   3807  C C   . THR B 1 150 ? -8.481  -64.554  -29.413 1.00 38.42  ? 151 THR B C   1 
ATOM   3808  O O   . THR B 1 150 ? -7.738  -65.323  -28.803 1.00 39.30  ? 151 THR B O   1 
ATOM   3809  C CB  . THR B 1 150 ? -7.573  -63.189  -31.314 1.00 36.25  ? 151 THR B CB  1 
ATOM   3810  O OG1 . THR B 1 150 ? -7.436  -63.135  -32.742 1.00 36.56  ? 151 THR B OG1 1 
ATOM   3811  C CG2 . THR B 1 150 ? -6.196  -63.238  -30.677 1.00 35.29  ? 151 THR B CG2 1 
ATOM   3812  N N   . PHE B 1 151 ? -9.403  -63.807  -28.817 1.00 38.86  ? 152 PHE B N   1 
ATOM   3813  C CA  . PHE B 1 151 ? -9.625  -63.845  -27.379 1.00 40.56  ? 152 PHE B CA  1 
ATOM   3814  C C   . PHE B 1 151 ? -10.143 -65.210  -26.940 1.00 42.76  ? 152 PHE B C   1 
ATOM   3815  O O   . PHE B 1 151 ? -9.698  -65.752  -25.926 1.00 43.33  ? 152 PHE B O   1 
ATOM   3816  C CB  . PHE B 1 151 ? -10.607 -62.746  -26.967 1.00 41.44  ? 152 PHE B CB  1 
ATOM   3817  C CG  . PHE B 1 151 ? -10.805 -62.634  -25.482 1.00 43.45  ? 152 PHE B CG  1 
ATOM   3818  C CD1 . PHE B 1 151 ? -9.915  -61.911  -24.705 1.00 43.40  ? 152 PHE B CD1 1 
ATOM   3819  C CD2 . PHE B 1 151 ? -11.881 -63.249  -24.863 1.00 45.35  ? 152 PHE B CD2 1 
ATOM   3820  C CE1 . PHE B 1 151 ? -10.092 -61.808  -23.336 1.00 44.86  ? 152 PHE B CE1 1 
ATOM   3821  C CE2 . PHE B 1 151 ? -12.064 -63.142  -23.497 1.00 46.72  ? 152 PHE B CE2 1 
ATOM   3822  C CZ  . PHE B 1 151 ? -11.169 -62.420  -22.735 1.00 46.19  ? 152 PHE B CZ  1 
ATOM   3823  N N   . LEU B 1 152 ? -11.082 -65.766  -27.705 1.00 44.36  ? 153 LEU B N   1 
ATOM   3824  C CA  . LEU B 1 152 ? -11.660 -67.068  -27.375 1.00 45.97  ? 153 LEU B CA  1 
ATOM   3825  C C   . LEU B 1 152 ? -10.598 -68.161  -27.434 1.00 45.23  ? 153 LEU B C   1 
ATOM   3826  O O   . LEU B 1 152 ? -10.674 -69.152  -26.709 1.00 46.28  ? 153 LEU B O   1 
ATOM   3827  C CB  . LEU B 1 152 ? -12.818 -67.409  -28.317 1.00 45.82  ? 153 LEU B CB  1 
ATOM   3828  C CG  . LEU B 1 152 ? -14.019 -66.459  -28.338 1.00 45.97  ? 153 LEU B CG  1 
ATOM   3829  C CD1 . LEU B 1 152 ? -15.120 -66.989  -29.253 1.00 46.78  ? 153 LEU B CD1 1 
ATOM   3830  C CD2 . LEU B 1 152 ? -14.548 -66.218  -26.934 1.00 46.21  ? 153 LEU B CD2 1 
ATOM   3831  N N   . GLN B 1 153 ? -9.611  -67.969  -28.306 1.00 42.87  ? 154 GLN B N   1 
ATOM   3832  C CA  . GLN B 1 153 ? -8.508  -68.914  -28.442 1.00 41.67  ? 154 GLN B CA  1 
ATOM   3833  C C   . GLN B 1 153 ? -7.725  -69.070  -27.146 1.00 42.76  ? 154 GLN B C   1 
ATOM   3834  O O   . GLN B 1 153 ? -7.213  -70.145  -26.846 1.00 44.34  ? 154 GLN B O   1 
ATOM   3835  C CB  . GLN B 1 153 ? -7.564  -68.481  -29.560 1.00 38.06  ? 154 GLN B CB  1 
ATOM   3836  C CG  . GLN B 1 153 ? -8.079  -68.799  -30.943 1.00 38.51  ? 154 GLN B CG  1 
ATOM   3837  C CD  . GLN B 1 153 ? -7.135  -68.329  -32.024 1.00 37.14  ? 154 GLN B CD  1 
ATOM   3838  O OE1 . GLN B 1 153 ? -7.283  -67.226  -32.557 1.00 37.09  ? 154 GLN B OE1 1 
ATOM   3839  N NE2 . GLN B 1 153 ? -6.148  -69.156  -32.346 1.00 36.12  ? 154 GLN B NE2 1 
ATOM   3840  N N   . GLN B 1 154 ? -7.617  -67.991  -26.384 1.00 42.68  ? 155 GLN B N   1 
ATOM   3841  C CA  . GLN B 1 154 ? -6.919  -68.056  -25.110 1.00 45.16  ? 155 GLN B CA  1 
ATOM   3842  C C   . GLN B 1 154 ? -7.793  -68.729  -24.062 1.00 48.44  ? 155 GLN B C   1 
ATOM   3843  O O   . GLN B 1 154 ? -7.292  -69.391  -23.155 1.00 50.94  ? 155 GLN B O   1 
ATOM   3844  C CB  . GLN B 1 154 ? -6.510  -66.662  -24.654 1.00 44.06  ? 155 GLN B CB  1 
ATOM   3845  C CG  . GLN B 1 154 ? -5.519  -65.975  -25.582 1.00 40.34  ? 155 GLN B CG  1 
ATOM   3846  C CD  . GLN B 1 154 ? -4.143  -66.586  -25.484 1.00 39.84  ? 155 GLN B CD  1 
ATOM   3847  O OE1 . GLN B 1 154 ? -3.699  -66.957  -24.398 1.00 41.84  ? 155 GLN B OE1 1 
ATOM   3848  N NE2 . GLN B 1 154 ? -3.462  -66.711  -26.620 1.00 37.53  ? 155 GLN B NE2 1 
ATOM   3849  N N   . LEU B 1 155 ? -9.105  -68.560  -24.193 1.00 50.03  ? 156 LEU B N   1 
ATOM   3850  C CA  . LEU B 1 155 ? -10.043 -69.219  -23.294 1.00 54.16  ? 156 LEU B CA  1 
ATOM   3851  C C   . LEU B 1 155 ? -10.149 -70.705  -23.626 1.00 56.04  ? 156 LEU B C   1 
ATOM   3852  O O   . LEU B 1 155 ? -10.165 -71.549  -22.734 1.00 57.83  ? 156 LEU B O   1 
ATOM   3853  C CB  . LEU B 1 155 ? -11.419 -68.556  -23.371 1.00 54.38  ? 156 LEU B CB  1 
ATOM   3854  C CG  . LEU B 1 155 ? -11.463 -67.087  -22.950 1.00 53.00  ? 156 LEU B CG  1 
ATOM   3855  C CD1 . LEU B 1 155 ? -12.879 -66.545  -23.035 1.00 54.51  ? 156 LEU B CD1 1 
ATOM   3856  C CD2 . LEU B 1 155 ? -10.903 -66.913  -21.549 1.00 52.64  ? 156 LEU B CD2 1 
ATOM   3857  N N   . CYS B 1 156 ? -10.218 -71.015  -24.916 1.00 57.25  ? 157 CYS B N   1 
ATOM   3858  C CA  . CYS B 1 156 ? -10.301 -72.399  -25.365 1.00 59.42  ? 157 CYS B CA  1 
ATOM   3859  C C   . CYS B 1 156 ? -9.631  -72.566  -26.725 1.00 58.23  ? 157 CYS B C   1 
ATOM   3860  O O   . CYS B 1 156 ? -10.269 -72.377  -27.763 1.00 56.85  ? 157 CYS B O   1 
ATOM   3861  C CB  . CYS B 1 156 ? -11.760 -72.857  -25.431 1.00 61.36  ? 157 CYS B CB  1 
ATOM   3862  S SG  . CYS B 1 156 ? -11.978 -74.581  -25.931 1.00 68.34  ? 157 CYS B SG  1 
ATOM   3863  N N   . PRO B 1 157 ? -8.338  -72.927  -26.717 1.00 58.47  ? 158 PRO B N   1 
ATOM   3864  C CA  . PRO B 1 157 ? -7.514  -73.070  -27.924 1.00 57.83  ? 158 PRO B CA  1 
ATOM   3865  C C   . PRO B 1 157 ? -8.122  -74.014  -28.955 1.00 58.61  ? 158 PRO B C   1 
ATOM   3866  O O   . PRO B 1 157 ? -8.472  -75.145  -28.618 1.00 60.54  ? 158 PRO B O   1 
ATOM   3867  C CB  . PRO B 1 157 ? -6.196  -73.639  -27.385 1.00 58.53  ? 158 PRO B CB  1 
ATOM   3868  C CG  . PRO B 1 157 ? -6.157  -73.222  -25.954 1.00 59.37  ? 158 PRO B CG  1 
ATOM   3869  C CD  . PRO B 1 157 ? -7.582  -73.243  -25.491 1.00 59.88  ? 158 PRO B CD  1 
ATOM   3870  N N   . ASP B 1 158 ? -8.252  -73.556  -30.194 1.00 57.87  ? 159 ASP B N   1 
ATOM   3871  C CA  . ASP B 1 158 ? -8.707  -74.437  -31.259 1.00 59.16  ? 159 ASP B CA  1 
ATOM   3872  C C   . ASP B 1 158 ? -7.527  -75.260  -31.762 1.00 59.78  ? 159 ASP B C   1 
ATOM   3873  O O   . ASP B 1 158 ? -6.395  -75.069  -31.321 1.00 59.80  ? 159 ASP B O   1 
ATOM   3874  C CB  . ASP B 1 158 ? -9.366  -73.646  -32.406 1.00 58.55  ? 159 ASP B CB  1 
ATOM   3875  C CG  . ASP B 1 158 ? -8.416  -72.662  -33.100 1.00 57.27  ? 159 ASP B CG  1 
ATOM   3876  O OD1 . ASP B 1 158 ? -7.184  -72.862  -33.103 1.00 57.86  ? 159 ASP B OD1 1 
ATOM   3877  O OD2 . ASP B 1 158 ? -8.919  -71.674  -33.672 1.00 56.04  ? 159 ASP B OD2 1 
ATOM   3878  N N   . SER B 1 159 ? -7.791  -76.174  -32.683 1.00 60.41  ? 160 SER B N   1 
ATOM   3879  C CA  . SER B 1 159 ? -6.717  -76.925  -33.313 1.00 60.94  ? 160 SER B CA  1 
ATOM   3880  C C   . SER B 1 159 ? -6.841  -76.756  -34.812 1.00 59.99  ? 160 SER B C   1 
ATOM   3881  O O   . SER B 1 159 ? -6.610  -77.688  -35.578 1.00 61.87  ? 160 SER B O   1 
ATOM   3882  C CB  . SER B 1 159 ? -6.771  -78.399  -32.917 1.00 63.06  ? 160 SER B CB  1 
ATOM   3883  O OG  . SER B 1 159 ? -6.636  -78.546  -31.515 1.00 63.82  ? 160 SER B OG  1 
ATOM   3884  N N   . GLY B 1 160 ? -7.206  -75.546  -35.222 1.00 56.93  ? 161 GLY B N   1 
ATOM   3885  C CA  . GLY B 1 160 ? -7.554  -75.291  -36.603 1.00 54.98  ? 161 GLY B CA  1 
ATOM   3886  C C   . GLY B 1 160 ? -6.564  -74.462  -37.393 1.00 52.11  ? 161 GLY B C   1 
ATOM   3887  O O   . GLY B 1 160 ? -5.493  -74.096  -36.904 1.00 50.21  ? 161 GLY B O   1 
ATOM   3888  N N   . THR B 1 161 ? -6.950  -74.171  -38.632 1.00 50.53  ? 162 THR B N   1 
ATOM   3889  C CA  . THR B 1 161 ? -6.123  -73.432  -39.573 1.00 48.66  ? 162 THR B CA  1 
ATOM   3890  C C   . THR B 1 161 ? -6.573  -71.981  -39.694 1.00 44.76  ? 162 THR B C   1 
ATOM   3891  O O   . THR B 1 161 ? -7.665  -71.620  -39.260 1.00 43.60  ? 162 THR B O   1 
ATOM   3892  C CB  . THR B 1 161 ? -6.168  -74.074  -40.968 1.00 51.09  ? 162 THR B CB  1 
ATOM   3893  O OG1 . THR B 1 161 ? -7.532  -74.164  -41.398 1.00 52.62  ? 162 THR B OG1 1 
ATOM   3894  C CG2 . THR B 1 161 ? -5.569  -75.466  -40.935 1.00 53.24  ? 162 THR B CG2 1 
ATOM   3895  N N   . ILE B 1 162 ? -5.731  -71.159  -40.306 1.00 43.42  ? 163 ILE B N   1 
ATOM   3896  C CA  . ILE B 1 162 ? -6.037  -69.746  -40.488 1.00 42.81  ? 163 ILE B CA  1 
ATOM   3897  C C   . ILE B 1 162 ? -7.283  -69.529  -41.354 1.00 44.75  ? 163 ILE B C   1 
ATOM   3898  O O   . ILE B 1 162 ? -8.059  -68.605  -41.111 1.00 44.73  ? 163 ILE B O   1 
ATOM   3899  C CB  . ILE B 1 162 ? -4.843  -69.000  -41.113 1.00 41.75  ? 163 ILE B CB  1 
ATOM   3900  N N   . ALA B 1 163 ? -7.478  -70.379  -42.359 1.00 45.44  ? 164 ALA B N   1 
ATOM   3901  C CA  . ALA B 1 163 ? -8.649  -70.252  -43.222 1.00 46.15  ? 164 ALA B CA  1 
ATOM   3902  C C   . ALA B 1 163 ? -9.916  -70.608  -42.456 1.00 46.35  ? 164 ALA B C   1 
ATOM   3903  O O   . ALA B 1 163 ? -10.958 -69.987  -42.650 1.00 47.04  ? 164 ALA B O   1 
ATOM   3904  C CB  . ALA B 1 163 ? -8.510  -71.130  -44.464 1.00 47.62  ? 164 ALA B CB  1 
ATOM   3905  N N   . ALA B 1 164 ? -9.820  -71.607  -41.584 1.00 47.28  ? 165 ALA B N   1 
ATOM   3906  C CA  . ALA B 1 164 ? -10.962 -72.028  -40.780 1.00 47.59  ? 165 ALA B CA  1 
ATOM   3907  C C   . ALA B 1 164 ? -11.404 -70.909  -39.843 1.00 46.86  ? 165 ALA B C   1 
ATOM   3908  O O   . ALA B 1 164 ? -12.599 -70.671  -39.664 1.00 47.80  ? 165 ALA B O   1 
ATOM   3909  C CB  . ALA B 1 164 ? -10.624 -73.276  -39.995 1.00 48.23  ? 165 ALA B CB  1 
ATOM   3910  N N   . ARG B 1 165 ? -10.434 -70.218  -39.255 1.00 45.29  ? 166 ARG B N   1 
ATOM   3911  C CA  . ARG B 1 165 ? -10.734 -69.114  -38.352 1.00 43.75  ? 166 ARG B CA  1 
ATOM   3912  C C   . ARG B 1 165 ? -11.432 -67.968  -39.083 1.00 41.41  ? 166 ARG B C   1 
ATOM   3913  O O   . ARG B 1 165 ? -12.396 -67.395  -38.570 1.00 41.02  ? 166 ARG B O   1 
ATOM   3914  C CB  . ARG B 1 165 ? -9.457  -68.607  -37.681 1.00 43.52  ? 166 ARG B CB  1 
ATOM   3915  C CG  . ARG B 1 165 ? -8.726  -69.668  -36.882 1.00 45.94  ? 166 ARG B CG  1 
ATOM   3916  C CD  . ARG B 1 165 ? -7.595  -69.064  -36.081 1.00 46.15  ? 166 ARG B CD  1 
ATOM   3917  N NE  . ARG B 1 165 ? -7.038  -70.029  -35.143 1.00 47.76  ? 166 ARG B NE  1 
ATOM   3918  C CZ  . ARG B 1 165 ? -5.854  -70.610  -35.292 1.00 48.60  ? 166 ARG B CZ  1 
ATOM   3919  N NH1 . ARG B 1 165 ? -5.098  -70.310  -36.340 1.00 48.14  ? 166 ARG B NH1 1 
ATOM   3920  N NH2 . ARG B 1 165 ? -5.423  -71.484  -34.389 1.00 48.85  ? 166 ARG B NH2 1 
ATOM   3921  N N   . ALA B 1 166 ? -10.944 -67.645  -40.278 1.00 39.47  ? 167 ALA B N   1 
ATOM   3922  C CA  . ALA B 1 166 ? -11.524 -66.576  -41.088 1.00 41.00  ? 167 ALA B CA  1 
ATOM   3923  C C   . ALA B 1 166 ? -12.925 -66.940  -41.571 1.00 44.63  ? 167 ALA B C   1 
ATOM   3924  O O   . ALA B 1 166 ? -13.792 -66.073  -41.677 1.00 45.65  ? 167 ALA B O   1 
ATOM   3925  C CB  . ALA B 1 166 ? -10.620 -66.254  -42.274 1.00 38.57  ? 167 ALA B CB  1 
ATOM   3926  N N   . GLN B 1 167 ? -13.143 -68.219  -41.864 1.00 45.74  ? 168 GLN B N   1 
ATOM   3927  C CA  . GLN B 1 167 ? -14.463 -68.687  -42.279 1.00 46.35  ? 168 GLN B CA  1 
ATOM   3928  C C   . GLN B 1 167 ? -15.475 -68.539  -41.142 1.00 47.21  ? 168 GLN B C   1 
ATOM   3929  O O   . GLN B 1 167 ? -16.637 -68.208  -41.378 1.00 47.87  ? 168 GLN B O   1 
ATOM   3930  C CB  . GLN B 1 167 ? -14.400 -70.143  -42.747 1.00 46.82  ? 168 GLN B CB  1 
ATOM   3931  N N   . VAL B 1 168 ? -15.027 -68.786  -39.913 1.00 46.46  ? 169 VAL B N   1 
ATOM   3932  C CA  . VAL B 1 168 ? -15.878 -68.613  -38.737 1.00 47.20  ? 169 VAL B CA  1 
ATOM   3933  C C   . VAL B 1 168 ? -16.292 -67.150  -38.573 1.00 46.49  ? 169 VAL B C   1 
ATOM   3934  O O   . VAL B 1 168 ? -17.473 -66.843  -38.391 1.00 47.72  ? 169 VAL B O   1 
ATOM   3935  C CB  . VAL B 1 168 ? -15.175 -69.088  -37.445 1.00 47.54  ? 169 VAL B CB  1 
ATOM   3936  C CG1 . VAL B 1 168 ? -15.929 -68.605  -36.211 1.00 47.38  ? 169 VAL B CG1 1 
ATOM   3937  C CG2 . VAL B 1 168 ? -15.039 -70.604  -37.436 1.00 49.11  ? 169 VAL B CG2 1 
ATOM   3938  N N   . CYS B 1 169 ? -15.317 -66.251  -38.647 1.00 44.06  ? 170 CYS B N   1 
ATOM   3939  C CA  . CYS B 1 169 ? -15.596 -64.825  -38.545 1.00 43.96  ? 170 CYS B CA  1 
ATOM   3940  C C   . CYS B 1 169 ? -16.442 -64.346  -39.728 1.00 45.10  ? 170 CYS B C   1 
ATOM   3941  O O   . CYS B 1 169 ? -17.286 -63.462  -39.575 1.00 43.99  ? 170 CYS B O   1 
ATOM   3942  C CB  . CYS B 1 169 ? -14.293 -64.029  -38.461 1.00 42.18  ? 170 CYS B CB  1 
ATOM   3943  S SG  . CYS B 1 169 ? -13.347 -64.326  -36.943 1.00 38.90  ? 170 CYS B SG  1 
ATOM   3944  N N   . GLN B 1 170 ? -16.215 -64.942  -40.897 1.00 46.71  ? 171 GLN B N   1 
ATOM   3945  C CA  . GLN B 1 170 ? -16.972 -64.607  -42.103 1.00 49.08  ? 171 GLN B CA  1 
ATOM   3946  C C   . GLN B 1 170 ? -18.446 -64.970  -41.948 1.00 51.62  ? 171 GLN B C   1 
ATOM   3947  O O   . GLN B 1 170 ? -19.329 -64.185  -42.294 1.00 51.08  ? 171 GLN B O   1 
ATOM   3948  C CB  . GLN B 1 170 ? -16.382 -65.318  -43.323 1.00 49.64  ? 171 GLN B CB  1 
ATOM   3949  C CG  . GLN B 1 170 ? -17.082 -65.002  -44.640 1.00 51.05  ? 171 GLN B CG  1 
ATOM   3950  C CD  . GLN B 1 170 ? -16.571 -65.855  -45.792 1.00 52.75  ? 171 GLN B CD  1 
ATOM   3951  O OE1 . GLN B 1 170 ? -15.974 -66.911  -45.578 1.00 54.27  ? 171 GLN B OE1 1 
ATOM   3952  N NE2 . GLN B 1 170 ? -16.801 -65.398  -47.019 1.00 52.09  ? 171 GLN B NE2 1 
ATOM   3953  N N   . GLN B 1 171 ? -18.703 -66.164  -41.423 1.00 54.36  ? 172 GLN B N   1 
ATOM   3954  C CA  . GLN B 1 171 ? -20.067 -66.644  -41.221 1.00 58.25  ? 172 GLN B CA  1 
ATOM   3955  C C   . GLN B 1 171 ? -20.775 -65.815  -40.155 1.00 57.29  ? 172 GLN B C   1 
ATOM   3956  O O   . GLN B 1 171 ? -21.996 -65.665  -40.177 1.00 58.00  ? 172 GLN B O   1 
ATOM   3957  C CB  . GLN B 1 171 ? -20.068 -68.123  -40.831 1.00 62.89  ? 172 GLN B CB  1 
ATOM   3958  C CG  . GLN B 1 171 ? -21.438 -68.778  -40.859 1.00 68.47  ? 172 GLN B CG  1 
ATOM   3959  C CD  . GLN B 1 171 ? -21.762 -69.375  -42.219 1.00 72.35  ? 172 GLN B CD  1 
ATOM   3960  O OE1 . GLN B 1 171 ? -20.896 -69.472  -43.090 1.00 72.57  ? 172 GLN B OE1 1 
ATOM   3961  N NE2 . GLN B 1 171 ? -23.018 -69.764  -42.412 1.00 75.29  ? 172 GLN B NE2 1 
ATOM   3962  N N   . ALA B 1 172 ? -19.997 -65.273  -39.226 1.00 56.00  ? 173 ALA B N   1 
ATOM   3963  C CA  . ALA B 1 172 ? -20.529 -64.347  -38.236 1.00 54.85  ? 173 ALA B CA  1 
ATOM   3964  C C   . ALA B 1 172 ? -21.021 -63.075  -38.922 1.00 54.04  ? 173 ALA B C   1 
ATOM   3965  O O   . ALA B 1 172 ? -22.086 -62.553  -38.594 1.00 54.23  ? 173 ALA B O   1 
ATOM   3966  C CB  . ALA B 1 172 ? -19.473 -64.020  -37.189 1.00 53.19  ? 173 ALA B CB  1 
ATOM   3967  N N   . GLU B 1 173 ? -20.233 -62.580  -39.871 1.00 53.07  ? 174 GLU B N   1 
ATOM   3968  C CA  . GLU B 1 173 ? -20.622 -61.414  -40.651 1.00 53.51  ? 174 GLU B CA  1 
ATOM   3969  C C   . GLU B 1 173 ? -21.860 -61.724  -41.492 1.00 54.38  ? 174 GLU B C   1 
ATOM   3970  O O   . GLU B 1 173 ? -22.785 -60.918  -41.565 1.00 54.58  ? 174 GLU B O   1 
ATOM   3971  C CB  . GLU B 1 173 ? -19.467 -60.956  -41.543 1.00 52.95  ? 174 GLU B CB  1 
ATOM   3972  C CG  . GLU B 1 173 ? -19.799 -59.775  -42.438 1.00 54.69  ? 174 GLU B CG  1 
ATOM   3973  C CD  . GLU B 1 173 ? -19.489 -58.435  -41.801 1.00 55.54  ? 174 GLU B CD  1 
ATOM   3974  O OE1 . GLU B 1 173 ? -19.740 -57.400  -42.450 1.00 56.36  ? 174 GLU B OE1 1 
ATOM   3975  O OE2 . GLU B 1 173 ? -18.988 -58.411  -40.659 1.00 55.70  ? 174 GLU B OE2 1 
ATOM   3976  N N   . HIS B 1 174 ? -21.876 -62.901  -42.113 1.00 55.15  ? 175 HIS B N   1 
ATOM   3977  C CA  . HIS B 1 174 ? -23.001 -63.327  -42.942 1.00 57.17  ? 175 HIS B CA  1 
ATOM   3978  C C   . HIS B 1 174 ? -24.295 -63.472  -42.145 1.00 59.62  ? 175 HIS B C   1 
ATOM   3979  O O   . HIS B 1 174 ? -25.315 -62.871  -42.485 1.00 60.75  ? 175 HIS B O   1 
ATOM   3980  C CB  . HIS B 1 174 ? -22.692 -64.661  -43.628 1.00 58.03  ? 175 HIS B CB  1 
ATOM   3981  C CG  . HIS B 1 174 ? -21.843 -64.539  -44.856 1.00 56.84  ? 175 HIS B CG  1 
ATOM   3982  N ND1 . HIS B 1 174 ? -22.225 -65.054  -46.076 1.00 57.95  ? 175 HIS B ND1 1 
ATOM   3983  C CD2 . HIS B 1 174 ? -20.629 -63.972  -45.050 1.00 54.95  ? 175 HIS B CD2 1 
ATOM   3984  C CE1 . HIS B 1 174 ? -21.283 -64.809  -46.970 1.00 56.92  ? 175 HIS B CE1 1 
ATOM   3985  N NE2 . HIS B 1 174 ? -20.304 -64.153  -46.373 1.00 54.78  ? 175 HIS B NE2 1 
ATOM   3986  N N   . SER B 1 175 ? -24.243 -64.274  -41.084 1.00 59.97  ? 176 SER B N   1 
ATOM   3987  C CA  . SER B 1 175 ? -25.452 -64.701  -40.383 1.00 62.57  ? 176 SER B CA  1 
ATOM   3988  C C   . SER B 1 175 ? -25.911 -63.758  -39.269 1.00 62.16  ? 176 SER B C   1 
ATOM   3989  O O   . SER B 1 175 ? -27.104 -63.686  -38.972 1.00 64.52  ? 176 SER B O   1 
ATOM   3990  C CB  . SER B 1 175 ? -25.244 -66.101  -39.799 1.00 64.49  ? 176 SER B CB  1 
ATOM   3991  O OG  . SER B 1 175 ? -24.880 -67.026  -40.808 1.00 65.44  ? 176 SER B OG  1 
ATOM   3992  N N   . PHE B 1 176 ? -24.978 -63.046  -38.647 1.00 58.77  ? 177 PHE B N   1 
ATOM   3993  C CA  . PHE B 1 176 ? -25.328 -62.181  -37.525 1.00 58.45  ? 177 PHE B CA  1 
ATOM   3994  C C   . PHE B 1 176 ? -25.316 -60.701  -37.890 1.00 57.66  ? 177 PHE B C   1 
ATOM   3995  O O   . PHE B 1 176 ? -25.839 -59.873  -37.146 1.00 58.21  ? 177 PHE B O   1 
ATOM   3996  C CB  . PHE B 1 176 ? -24.384 -62.429  -36.346 1.00 57.81  ? 177 PHE B CB  1 
ATOM   3997  C CG  . PHE B 1 176 ? -24.768 -63.607  -35.498 1.00 59.81  ? 177 PHE B CG  1 
ATOM   3998  C CD1 . PHE B 1 176 ? -24.697 -64.895  -36.003 1.00 60.48  ? 177 PHE B CD1 1 
ATOM   3999  C CD2 . PHE B 1 176 ? -25.195 -63.427  -34.192 1.00 61.01  ? 177 PHE B CD2 1 
ATOM   4000  C CE1 . PHE B 1 176 ? -25.048 -65.981  -35.222 1.00 62.13  ? 177 PHE B CE1 1 
ATOM   4001  C CE2 . PHE B 1 176 ? -25.547 -64.508  -33.406 1.00 62.44  ? 177 PHE B CE2 1 
ATOM   4002  C CZ  . PHE B 1 176 ? -25.473 -65.786  -33.922 1.00 62.99  ? 177 PHE B CZ  1 
ATOM   4003  N N   . ALA B 1 177 ? -24.725 -60.367  -39.033 1.00 57.16  ? 178 ALA B N   1 
ATOM   4004  C CA  . ALA B 1 177 ? -24.651 -58.973  -39.462 1.00 56.97  ? 178 ALA B CA  1 
ATOM   4005  C C   . ALA B 1 177 ? -25.341 -58.748  -40.804 1.00 56.92  ? 178 ALA B C   1 
ATOM   4006  O O   . ALA B 1 177 ? -25.470 -57.613  -41.256 1.00 56.75  ? 178 ALA B O   1 
ATOM   4007  C CB  . ALA B 1 177 ? -23.201 -58.519  -39.536 1.00 54.90  ? 178 ALA B CB  1 
ATOM   4008  N N   . GLY B 1 178 ? -25.771 -59.832  -41.440 1.00 57.48  ? 179 GLY B N   1 
ATOM   4009  C CA  . GLY B 1 178 ? -26.507 -59.746  -42.689 1.00 58.67  ? 179 GLY B CA  1 
ATOM   4010  C C   . GLY B 1 178 ? -25.697 -59.316  -43.900 1.00 57.75  ? 179 GLY B C   1 
ATOM   4011  O O   . GLY B 1 178 ? -26.266 -59.009  -44.948 1.00 58.74  ? 179 GLY B O   1 
ATOM   4012  N N   . MET B 1 179 ? -24.372 -59.298  -43.767 1.00 55.75  ? 180 MET B N   1 
ATOM   4013  C CA  . MET B 1 179 ? -23.498 -58.878  -44.864 1.00 54.13  ? 180 MET B CA  1 
ATOM   4014  C C   . MET B 1 179 ? -22.691 -60.046  -45.435 1.00 51.70  ? 180 MET B C   1 
ATOM   4015  O O   . MET B 1 179 ? -21.762 -60.535  -44.790 1.00 50.27  ? 180 MET B O   1 
ATOM   4016  C CB  . MET B 1 179 ? -22.550 -57.769  -44.397 1.00 53.30  ? 180 MET B CB  1 
ATOM   4017  N N   . PRO B 1 180 ? -23.038 -60.485  -46.656 1.00 50.95  ? 181 PRO B N   1 
ATOM   4018  C CA  . PRO B 1 180 ? -22.417 -61.644  -47.313 1.00 50.85  ? 181 PRO B CA  1 
ATOM   4019  C C   . PRO B 1 180 ? -21.034 -61.352  -47.903 1.00 50.01  ? 181 PRO B C   1 
ATOM   4020  O O   . PRO B 1 180 ? -20.846 -61.432  -49.116 1.00 51.70  ? 181 PRO B O   1 
ATOM   4021  C CB  . PRO B 1 180 ? -23.413 -61.981  -48.426 1.00 52.05  ? 181 PRO B CB  1 
ATOM   4022  C CG  . PRO B 1 180 ? -24.029 -60.666  -48.771 1.00 51.52  ? 181 PRO B CG  1 
ATOM   4023  C CD  . PRO B 1 180 ? -24.116 -59.899  -47.475 1.00 51.77  ? 181 PRO B CD  1 
ATOM   4024  N N   . CYS B 1 181 ? -20.076 -61.037  -47.041 1.00 48.44  ? 182 CYS B N   1 
ATOM   4025  C CA  . CYS B 1 181 ? -18.739 -60.640  -47.473 1.00 45.96  ? 182 CYS B CA  1 
ATOM   4026  C C   . CYS B 1 181 ? -17.903 -61.798  -48.009 1.00 44.27  ? 182 CYS B C   1 
ATOM   4027  O O   . CYS B 1 181 ? -18.178 -62.962  -47.721 1.00 43.94  ? 182 CYS B O   1 
ATOM   4028  C CB  . CYS B 1 181 ? -17.995 -59.994  -46.305 1.00 44.37  ? 182 CYS B CB  1 
ATOM   4029  S SG  . CYS B 1 181 ? -17.714 -61.143  -44.927 1.00 44.65  ? 182 CYS B SG  1 
ATOM   4030  N N   . GLY B 1 182 ? -16.863 -61.462  -48.770 1.00 42.97  ? 183 GLY B N   1 
ATOM   4031  C CA  . GLY B 1 182 ? -15.838 -62.424  -49.133 1.00 42.91  ? 183 GLY B CA  1 
ATOM   4032  C C   . GLY B 1 182 ? -14.883 -62.662  -47.974 1.00 43.06  ? 183 GLY B C   1 
ATOM   4033  O O   . GLY B 1 182 ? -15.170 -62.278  -46.836 1.00 41.94  ? 183 GLY B O   1 
ATOM   4034  N N   . ILE B 1 183 ? -13.738 -63.280  -48.253 1.00 43.59  ? 184 ILE B N   1 
ATOM   4035  C CA  . ILE B 1 183 ? -12.816 -63.683  -47.188 1.00 43.90  ? 184 ILE B CA  1 
ATOM   4036  C C   . ILE B 1 183 ? -11.711 -62.674  -46.878 1.00 40.71  ? 184 ILE B C   1 
ATOM   4037  O O   . ILE B 1 183 ? -10.986 -62.838  -45.895 1.00 40.21  ? 184 ILE B O   1 
ATOM   4038  C CB  . ILE B 1 183 ? -12.126 -65.019  -47.523 1.00 47.33  ? 184 ILE B CB  1 
ATOM   4039  C CG1 . ILE B 1 183 ? -11.464 -64.943  -48.902 1.00 47.66  ? 184 ILE B CG1 1 
ATOM   4040  C CG2 . ILE B 1 183 ? -13.124 -66.166  -47.474 1.00 50.98  ? 184 ILE B CG2 1 
ATOM   4041  C CD1 . ILE B 1 183 ? -10.180 -65.737  -49.012 1.00 48.31  ? 184 ILE B CD1 1 
ATOM   4042  N N   . MET B 1 184 ? -11.567 -61.647  -47.711 1.00 38.03  ? 185 MET B N   1 
ATOM   4043  C CA  . MET B 1 184 ? -10.418 -60.752  -47.592 1.00 36.36  ? 185 MET B CA  1 
ATOM   4044  C C   . MET B 1 184 ? -10.245 -60.120  -46.207 1.00 34.54  ? 185 MET B C   1 
ATOM   4045  O O   . MET B 1 184 ? -9.184  -60.248  -45.601 1.00 31.94  ? 185 MET B O   1 
ATOM   4046  C CB  . MET B 1 184 ? -10.491 -59.631  -48.621 1.00 36.48  ? 185 MET B CB  1 
ATOM   4047  C CG  . MET B 1 184 ? -9.401  -58.595  -48.415 1.00 35.59  ? 185 MET B CG  1 
ATOM   4048  S SD  . MET B 1 184 ? -9.354  -57.322  -49.686 1.00 35.00  ? 185 MET B SD  1 
ATOM   4049  C CE  . MET B 1 184 ? -11.040 -56.726  -49.612 1.00 31.26  ? 185 MET B CE  1 
ATOM   4050  N N   . ASP B 1 185 ? -11.279 -59.438  -45.721 1.00 34.81  ? 186 ASP B N   1 
ATOM   4051  C CA  . ASP B 1 185 ? -11.160 -58.622  -44.516 1.00 34.01  ? 186 ASP B CA  1 
ATOM   4052  C C   . ASP B 1 185 ? -10.774 -59.458  -43.295 1.00 34.09  ? 186 ASP B C   1 
ATOM   4053  O O   . ASP B 1 185 ? -9.954  -59.034  -42.487 1.00 33.40  ? 186 ASP B O   1 
ATOM   4054  C CB  . ASP B 1 185 ? -12.464 -57.866  -44.244 1.00 33.56  ? 186 ASP B CB  1 
ATOM   4055  C CG  . ASP B 1 185 ? -12.912 -57.020  -45.427 1.00 35.09  ? 186 ASP B CG  1 
ATOM   4056  O OD1 . ASP B 1 185 ? -12.106 -56.811  -46.363 1.00 35.40  ? 186 ASP B OD1 1 
ATOM   4057  O OD2 . ASP B 1 185 ? -14.074 -56.559  -45.414 1.00 35.27  ? 186 ASP B OD2 1 
ATOM   4058  N N   . GLN B 1 186 ? -11.347 -60.650  -43.172 1.00 35.97  ? 187 GLN B N   1 
ATOM   4059  C CA  . GLN B 1 186 ? -11.017 -61.531  -42.056 1.00 37.32  ? 187 GLN B CA  1 
ATOM   4060  C C   . GLN B 1 186 ? -9.597  -62.082  -42.177 1.00 37.88  ? 187 GLN B C   1 
ATOM   4061  O O   . GLN B 1 186 ? -8.850  -62.120  -41.195 1.00 37.21  ? 187 GLN B O   1 
ATOM   4062  C CB  . GLN B 1 186 ? -12.021 -62.684  -41.959 1.00 39.73  ? 187 GLN B CB  1 
ATOM   4063  C CG  . GLN B 1 186 ? -13.413 -62.276  -41.498 1.00 41.98  ? 187 GLN B CG  1 
ATOM   4064  C CD  . GLN B 1 186 ? -14.217 -61.579  -42.582 1.00 42.90  ? 187 GLN B CD  1 
ATOM   4065  O OE1 . GLN B 1 186 ? -13.852 -61.609  -43.758 1.00 42.56  ? 187 GLN B OE1 1 
ATOM   4066  N NE2 . GLN B 1 186 ? -15.315 -60.938  -42.188 1.00 44.24  ? 187 GLN B NE2 1 
ATOM   4067  N N   . PHE B 1 187 ? -9.230  -62.510  -43.383 1.00 37.89  ? 188 PHE B N   1 
ATOM   4068  C CA  . PHE B 1 187 ? -7.905  -63.072  -43.634 1.00 37.66  ? 188 PHE B CA  1 
ATOM   4069  C C   . PHE B 1 187 ? -6.780  -62.095  -43.303 1.00 34.37  ? 188 PHE B C   1 
ATOM   4070  O O   . PHE B 1 187 ? -5.798  -62.471  -42.664 1.00 34.15  ? 188 PHE B O   1 
ATOM   4071  C CB  . PHE B 1 187 ? -7.767  -63.508  -45.096 1.00 40.28  ? 188 PHE B CB  1 
ATOM   4072  C CG  . PHE B 1 187 ? -7.828  -64.996  -45.304 1.00 44.15  ? 188 PHE B CG  1 
ATOM   4073  C CD1 . PHE B 1 187 ? -6.667  -65.735  -45.458 1.00 45.23  ? 188 PHE B CD1 1 
ATOM   4074  C CD2 . PHE B 1 187 ? -9.047  -65.651  -45.378 1.00 47.04  ? 188 PHE B CD2 1 
ATOM   4075  C CE1 . PHE B 1 187 ? -6.718  -67.100  -45.661 1.00 47.10  ? 188 PHE B CE1 1 
ATOM   4076  C CE2 . PHE B 1 187 ? -9.105  -67.021  -45.583 1.00 48.50  ? 188 PHE B CE2 1 
ATOM   4077  C CZ  . PHE B 1 187 ? -7.938  -67.745  -45.724 1.00 48.92  ? 188 PHE B CZ  1 
ATOM   4078  N N   . ILE B 1 188 ? -6.921  -60.847  -43.749 1.00 32.70  ? 189 ILE B N   1 
ATOM   4079  C CA  . ILE B 1 188 ? -5.882  -59.847  -43.520 1.00 32.09  ? 189 ILE B CA  1 
ATOM   4080  C C   . ILE B 1 188 ? -5.806  -59.482  -42.027 1.00 31.85  ? 189 ILE B C   1 
ATOM   4081  O O   . ILE B 1 188 ? -4.721  -59.283  -41.483 1.00 29.35  ? 189 ILE B O   1 
ATOM   4082  C CB  . ILE B 1 188 ? -6.119  -58.580  -44.386 1.00 29.24  ? 189 ILE B CB  1 
ATOM   4083  C CG1 . ILE B 1 188 ? -5.001  -57.551  -44.193 1.00 28.82  ? 189 ILE B CG1 1 
ATOM   4084  C CG2 . ILE B 1 188 ? -7.472  -57.964  -44.096 1.00 29.31  ? 189 ILE B CG2 1 
ATOM   4085  C CD1 . ILE B 1 188 ? -3.630  -58.052  -44.589 1.00 30.69  ? 189 ILE B CD1 1 
ATOM   4086  N N   . SER B 1 189 ? -6.956  -59.427  -41.363 1.00 30.90  ? 190 SER B N   1 
ATOM   4087  C CA  . SER B 1 189 ? -6.986  -59.078  -39.950 1.00 32.22  ? 190 SER B CA  1 
ATOM   4088  C C   . SER B 1 189 ? -6.289  -60.161  -39.131 1.00 31.77  ? 190 SER B C   1 
ATOM   4089  O O   . SER B 1 189 ? -5.575  -59.869  -38.175 1.00 32.36  ? 190 SER B O   1 
ATOM   4090  C CB  . SER B 1 189 ? -8.422  -58.877  -39.464 1.00 32.02  ? 190 SER B CB  1 
ATOM   4091  O OG  . SER B 1 189 ? -8.425  -58.285  -38.176 1.00 31.93  ? 190 SER B OG  1 
ATOM   4092  N N   . LEU B 1 190 ? -6.487  -61.412  -39.535 1.00 32.07  ? 191 LEU B N   1 
ATOM   4093  C CA  . LEU B 1 190 ? -5.815  -62.541  -38.909 1.00 33.33  ? 191 LEU B CA  1 
ATOM   4094  C C   . LEU B 1 190 ? -4.328  -62.606  -39.244 1.00 33.94  ? 191 LEU B C   1 
ATOM   4095  O O   . LEU B 1 190 ? -3.501  -62.836  -38.363 1.00 33.35  ? 191 LEU B O   1 
ATOM   4096  C CB  . LEU B 1 190 ? -6.480  -63.855  -39.333 1.00 34.58  ? 191 LEU B CB  1 
ATOM   4097  C CG  . LEU B 1 190 ? -7.772  -64.255  -38.622 1.00 35.27  ? 191 LEU B CG  1 
ATOM   4098  C CD1 . LEU B 1 190 ? -8.554  -65.241  -39.470 1.00 35.92  ? 191 LEU B CD1 1 
ATOM   4099  C CD2 . LEU B 1 190 ? -7.455  -64.859  -37.261 1.00 35.54  ? 191 LEU B CD2 1 
ATOM   4100  N N   . MET B 1 191 ? -3.992  -62.412  -40.519 1.00 34.16  ? 192 MET B N   1 
ATOM   4101  C CA  . MET B 1 191 ? -2.669  -62.786  -41.017 1.00 36.97  ? 192 MET B CA  1 
ATOM   4102  C C   . MET B 1 191 ? -1.743  -61.631  -41.392 1.00 35.02  ? 192 MET B C   1 
ATOM   4103  O O   . MET B 1 191 ? -0.646  -61.865  -41.901 1.00 35.60  ? 192 MET B O   1 
ATOM   4104  C CB  . MET B 1 191 ? -2.818  -63.702  -42.239 1.00 41.61  ? 192 MET B CB  1 
ATOM   4105  C CG  . MET B 1 191 ? -3.415  -65.060  -41.917 1.00 45.70  ? 192 MET B CG  1 
ATOM   4106  S SD  . MET B 1 191 ? -2.573  -65.874  -40.546 1.00 106.71 ? 192 MET B SD  1 
ATOM   4107  C CE  . MET B 1 191 ? -0.888  -65.914  -41.154 1.00 44.21  ? 192 MET B CE  1 
ATOM   4108  N N   . GLY B 1 192 ? -2.172  -60.397  -41.157 1.00 32.36  ? 193 GLY B N   1 
ATOM   4109  C CA  . GLY B 1 192 ? -1.314  -59.256  -41.425 1.00 31.04  ? 193 GLY B CA  1 
ATOM   4110  C C   . GLY B 1 192 ? -0.011  -59.342  -40.646 1.00 30.87  ? 193 GLY B C   1 
ATOM   4111  O O   . GLY B 1 192 ? 0.041   -59.951  -39.583 1.00 30.53  ? 193 GLY B O   1 
ATOM   4112  N N   . GLN B 1 193 ? 1.050   -58.766  -41.195 1.00 31.37  ? 194 GLN B N   1 
ATOM   4113  C CA  . GLN B 1 193 ? 2.318   -58.642  -40.490 1.00 32.37  ? 194 GLN B CA  1 
ATOM   4114  C C   . GLN B 1 193 ? 2.893   -57.257  -40.750 1.00 33.38  ? 194 GLN B C   1 
ATOM   4115  O O   . GLN B 1 193 ? 2.742   -56.715  -41.846 1.00 33.07  ? 194 GLN B O   1 
ATOM   4116  C CB  . GLN B 1 193 ? 3.317   -59.724  -40.922 1.00 33.85  ? 194 GLN B CB  1 
ATOM   4117  C CG  . GLN B 1 193 ? 2.875   -61.162  -40.654 1.00 37.35  ? 194 GLN B CG  1 
ATOM   4118  C CD  . GLN B 1 193 ? 2.764   -61.498  -39.169 1.00 41.54  ? 194 GLN B CD  1 
ATOM   4119  O OE1 . GLN B 1 193 ? 3.194   -60.731  -38.305 1.00 41.81  ? 194 GLN B OE1 1 
ATOM   4120  N NE2 . GLN B 1 193 ? 2.182   -62.653  -38.871 1.00 43.78  ? 194 GLN B NE2 1 
ATOM   4121  N N   . LYS B 1 194 ? 3.540   -56.684  -39.738 1.00 35.17  ? 195 LYS B N   1 
ATOM   4122  C CA  . LYS B 1 194 ? 4.154   -55.366  -39.870 1.00 35.50  ? 195 LYS B CA  1 
ATOM   4123  C C   . LYS B 1 194 ? 5.149   -55.341  -41.021 1.00 34.66  ? 195 LYS B C   1 
ATOM   4124  O O   . LYS B 1 194 ? 5.950   -56.260  -41.182 1.00 34.62  ? 195 LYS B O   1 
ATOM   4125  C CB  . LYS B 1 194 ? 4.850   -54.954  -38.567 1.00 38.06  ? 195 LYS B CB  1 
ATOM   4126  C CG  . LYS B 1 194 ? 5.689   -53.689  -38.701 1.00 40.30  ? 195 LYS B CG  1 
ATOM   4127  C CD  . LYS B 1 194 ? 6.123   -53.153  -37.350 1.00 43.48  ? 195 LYS B CD  1 
ATOM   4128  C CE  . LYS B 1 194 ? 6.958   -51.888  -37.507 1.00 45.51  ? 195 LYS B CE  1 
ATOM   4129  N NZ  . LYS B 1 194 ? 7.419   -51.376  -36.187 1.00 47.90  ? 195 LYS B NZ  1 
ATOM   4130  N N   . GLY B 1 195 ? 5.083   -54.291  -41.831 1.00 34.30  ? 196 GLY B N   1 
ATOM   4131  C CA  . GLY B 1 195 ? 6.005   -54.139  -42.937 1.00 35.39  ? 196 GLY B CA  1 
ATOM   4132  C C   . GLY B 1 195 ? 5.726   -55.066  -44.108 1.00 35.42  ? 196 GLY B C   1 
ATOM   4133  O O   . GLY B 1 195 ? 6.601   -55.270  -44.949 1.00 34.99  ? 196 GLY B O   1 
ATOM   4134  N N   . HIS B 1 196 ? 4.520   -55.630  -44.165 1.00 35.34  ? 197 HIS B N   1 
ATOM   4135  C CA  . HIS B 1 196 ? 4.137   -56.485  -45.291 1.00 35.68  ? 197 HIS B CA  1 
ATOM   4136  C C   . HIS B 1 196 ? 2.714   -56.241  -45.772 1.00 36.57  ? 197 HIS B C   1 
ATOM   4137  O O   . HIS B 1 196 ? 1.823   -55.952  -44.977 1.00 35.58  ? 197 HIS B O   1 
ATOM   4138  C CB  . HIS B 1 196 ? 4.259   -57.967  -44.936 1.00 36.11  ? 197 HIS B CB  1 
ATOM   4139  C CG  . HIS B 1 196 ? 5.652   -58.412  -44.618 1.00 38.97  ? 197 HIS B CG  1 
ATOM   4140  N ND1 . HIS B 1 196 ? 6.196   -58.307  -43.356 1.00 39.71  ? 197 HIS B ND1 1 
ATOM   4141  C CD2 . HIS B 1 196 ? 6.600   -58.992  -45.391 1.00 39.56  ? 197 HIS B CD2 1 
ATOM   4142  C CE1 . HIS B 1 196 ? 7.427   -58.790  -43.369 1.00 40.42  ? 197 HIS B CE1 1 
ATOM   4143  N NE2 . HIS B 1 196 ? 7.695   -59.214  -44.591 1.00 40.37  ? 197 HIS B NE2 1 
ATOM   4144  N N   . ALA B 1 197 ? 2.513   -56.379  -47.082 1.00 37.67  ? 198 ALA B N   1 
ATOM   4145  C CA  . ALA B 1 197 ? 1.177   -56.534  -47.638 1.00 36.81  ? 198 ALA B CA  1 
ATOM   4146  C C   . ALA B 1 197 ? 0.912   -58.026  -47.808 1.00 37.62  ? 198 ALA B C   1 
ATOM   4147  O O   . ALA B 1 197 ? 1.850   -58.826  -47.905 1.00 37.61  ? 198 ALA B O   1 
ATOM   4148  C CB  . ALA B 1 197 ? 1.043   -55.798  -48.969 1.00 36.67  ? 198 ALA B CB  1 
ATOM   4149  N N   . LEU B 1 198 ? -0.361  -58.405  -47.841 1.00 36.22  ? 199 LEU B N   1 
ATOM   4150  C CA  . LEU B 1 198 ? -0.721  -59.811  -47.971 1.00 35.36  ? 199 LEU B CA  1 
ATOM   4151  C C   . LEU B 1 198 ? -1.366  -60.090  -49.326 1.00 33.29  ? 199 LEU B C   1 
ATOM   4152  O O   . LEU B 1 198 ? -2.453  -59.603  -49.611 1.00 31.99  ? 199 LEU B O   1 
ATOM   4153  C CB  . LEU B 1 198 ? -1.670  -60.222  -46.843 1.00 36.63  ? 199 LEU B CB  1 
ATOM   4154  C CG  . LEU B 1 198 ? -1.979  -61.705  -46.642 1.00 38.59  ? 199 LEU B CG  1 
ATOM   4155  C CD1 . LEU B 1 198 ? -0.749  -62.451  -46.161 1.00 40.64  ? 199 LEU B CD1 1 
ATOM   4156  C CD2 . LEU B 1 198 ? -3.118  -61.881  -45.649 1.00 38.63  ? 199 LEU B CD2 1 
ATOM   4157  N N   . LEU B 1 199 ? -0.689  -60.869  -50.159 1.00 33.40  ? 200 LEU B N   1 
ATOM   4158  C CA  . LEU B 1 199 ? -1.277  -61.308  -51.416 1.00 34.77  ? 200 LEU B CA  1 
ATOM   4159  C C   . LEU B 1 199 ? -2.092  -62.571  -51.174 1.00 34.74  ? 200 LEU B C   1 
ATOM   4160  O O   . LEU B 1 199 ? -1.533  -63.622  -50.882 1.00 36.28  ? 200 LEU B O   1 
ATOM   4161  C CB  . LEU B 1 199 ? -0.195  -61.564  -52.465 1.00 36.15  ? 200 LEU B CB  1 
ATOM   4162  C CG  . LEU B 1 199 ? -0.680  -62.018  -53.845 1.00 37.18  ? 200 LEU B CG  1 
ATOM   4163  C CD1 . LEU B 1 199 ? -1.499  -60.921  -54.531 1.00 37.62  ? 200 LEU B CD1 1 
ATOM   4164  C CD2 . LEU B 1 199 ? 0.501   -62.432  -54.705 1.00 36.76  ? 200 LEU B CD2 1 
ATOM   4165  N N   . ILE B 1 200 ? -3.413  -62.465  -51.279 1.00 33.39  ? 201 ILE B N   1 
ATOM   4166  C CA  . ILE B 1 200 ? -4.276  -63.611  -51.029 1.00 34.29  ? 201 ILE B CA  1 
ATOM   4167  C C   . ILE B 1 200 ? -4.881  -64.167  -52.312 1.00 34.49  ? 201 ILE B C   1 
ATOM   4168  O O   . ILE B 1 200 ? -5.599  -63.470  -53.031 1.00 34.72  ? 201 ILE B O   1 
ATOM   4169  C CB  . ILE B 1 200 ? -5.430  -63.265  -50.073 1.00 35.01  ? 201 ILE B CB  1 
ATOM   4170  C CG1 . ILE B 1 200 ? -4.896  -62.716  -48.747 1.00 34.87  ? 201 ILE B CG1 1 
ATOM   4171  C CG2 . ILE B 1 200 ? -6.310  -64.488  -49.847 1.00 35.60  ? 201 ILE B CG2 1 
ATOM   4172  C CD1 . ILE B 1 200 ? -5.958  -62.071  -47.895 1.00 34.41  ? 201 ILE B CD1 1 
ATOM   4173  N N   . ASP B 1 201 ? -4.585  -65.429  -52.588 1.00 35.22  ? 202 ASP B N   1 
ATOM   4174  C CA  . ASP B 1 201 ? -5.235  -66.153  -53.670 1.00 36.43  ? 202 ASP B CA  1 
ATOM   4175  C C   . ASP B 1 201 ? -6.514  -66.748  -53.106 1.00 37.41  ? 202 ASP B C   1 
ATOM   4176  O O   . ASP B 1 201 ? -6.476  -67.744  -52.393 1.00 38.68  ? 202 ASP B O   1 
ATOM   4177  C CB  . ASP B 1 201 ? -4.312  -67.240  -54.221 1.00 37.66  ? 202 ASP B CB  1 
ATOM   4178  C CG  . ASP B 1 201 ? -4.857  -67.908  -55.477 1.00 38.82  ? 202 ASP B CG  1 
ATOM   4179  O OD1 . ASP B 1 201 ? -6.089  -68.078  -55.601 1.00 39.23  ? 202 ASP B OD1 1 
ATOM   4180  O OD2 . ASP B 1 201 ? -4.033  -68.281  -56.337 1.00 39.73  ? 202 ASP B OD2 1 
ATOM   4181  N N   . CYS B 1 202 ? -7.648  -66.138  -53.418 1.00 37.56  ? 203 CYS B N   1 
ATOM   4182  C CA  . CYS B 1 202 ? -8.909  -66.562  -52.830 1.00 38.49  ? 203 CYS B CA  1 
ATOM   4183  C C   . CYS B 1 202 ? -9.476  -67.822  -53.478 1.00 40.75  ? 203 CYS B C   1 
ATOM   4184  O O   . CYS B 1 202 ? -10.596 -68.228  -53.171 1.00 43.35  ? 203 CYS B O   1 
ATOM   4185  C CB  . CYS B 1 202 ? -9.922  -65.426  -52.905 1.00 36.49  ? 203 CYS B CB  1 
ATOM   4186  S SG  . CYS B 1 202 ? -9.332  -63.906  -52.137 1.00 34.80  ? 203 CYS B SG  1 
ATOM   4187  N N   . ARG B 1 203 ? -8.707  -68.440  -54.368 1.00 40.54  ? 204 ARG B N   1 
ATOM   4188  C CA  . ARG B 1 203 ? -9.076  -69.747  -54.901 1.00 42.67  ? 204 ARG B CA  1 
ATOM   4189  C C   . ARG B 1 203 ? -8.358  -70.856  -54.136 1.00 43.08  ? 204 ARG B C   1 
ATOM   4190  O O   . ARG B 1 203 ? -8.994  -71.714  -53.525 1.00 44.13  ? 204 ARG B O   1 
ATOM   4191  C CB  . ARG B 1 203 ? -8.754  -69.847  -56.394 1.00 44.68  ? 204 ARG B CB  1 
ATOM   4192  C CG  . ARG B 1 203 ? -9.069  -71.213  -56.995 1.00 48.40  ? 204 ARG B CG  1 
ATOM   4193  C CD  . ARG B 1 203 ? -8.888  -71.223  -58.514 1.00 51.09  ? 204 ARG B CD  1 
ATOM   4194  N NE  . ARG B 1 203 ? -7.497  -71.001  -58.900 1.00 51.73  ? 204 ARG B NE  1 
ATOM   4195  C CZ  . ARG B 1 203 ? -7.068  -70.941  -60.157 1.00 51.79  ? 204 ARG B CZ  1 
ATOM   4196  N NH1 . ARG B 1 203 ? -7.925  -71.089  -61.155 1.00 53.15  ? 204 ARG B NH1 1 
ATOM   4197  N NH2 . ARG B 1 203 ? -5.783  -70.737  -60.414 1.00 51.13  ? 204 ARG B NH2 1 
ATOM   4198  N N   . SER B 1 204 ? -7.029  -70.829  -54.174 1.00 42.54  ? 205 SER B N   1 
ATOM   4199  C CA  . SER B 1 204 ? -6.214  -71.853  -53.531 1.00 44.17  ? 205 SER B CA  1 
ATOM   4200  C C   . SER B 1 204 ? -6.014  -71.582  -52.039 1.00 43.17  ? 205 SER B C   1 
ATOM   4201  O O   . SER B 1 204 ? -5.523  -72.443  -51.307 1.00 44.24  ? 205 SER B O   1 
ATOM   4202  C CB  . SER B 1 204 ? -4.854  -71.953  -54.224 1.00 44.99  ? 205 SER B CB  1 
ATOM   4203  O OG  . SER B 1 204 ? -4.132  -70.738  -54.097 1.00 43.58  ? 205 SER B OG  1 
ATOM   4204  N N   . LEU B 1 205 ? -6.393  -70.380  -51.609 1.00 43.37  ? 206 LEU B N   1 
ATOM   4205  C CA  . LEU B 1 205 ? -6.211  -69.923  -50.227 1.00 44.73  ? 206 LEU B CA  1 
ATOM   4206  C C   . LEU B 1 205 ? -4.735  -69.891  -49.830 1.00 45.33  ? 206 LEU B C   1 
ATOM   4207  O O   . LEU B 1 205 ? -4.394  -69.954  -48.649 1.00 45.32  ? 206 LEU B O   1 
ATOM   4208  C CB  . LEU B 1 205 ? -7.017  -70.791  -49.256 1.00 45.90  ? 206 LEU B CB  1 
ATOM   4209  C CG  . LEU B 1 205 ? -8.526  -70.750  -49.519 1.00 47.38  ? 206 LEU B CG  1 
ATOM   4210  C CD1 . LEU B 1 205 ? -9.285  -71.590  -48.505 1.00 48.48  ? 206 LEU B CD1 1 
ATOM   4211  C CD2 . LEU B 1 205 ? -9.040  -69.310  -49.530 1.00 46.04  ? 206 LEU B CD2 1 
ATOM   4212  N N   . GLU B 1 206 ? -3.865  -69.782  -50.830 1.00 45.91  ? 207 GLU B N   1 
ATOM   4213  C CA  . GLU B 1 206 ? -2.458  -69.509  -50.589 1.00 46.38  ? 207 GLU B CA  1 
ATOM   4214  C C   . GLU B 1 206 ? -2.290  -68.019  -50.313 1.00 44.44  ? 207 GLU B C   1 
ATOM   4215  O O   . GLU B 1 206 ? -2.935  -67.183  -50.948 1.00 44.09  ? 207 GLU B O   1 
ATOM   4216  C CB  . GLU B 1 206 ? -1.594  -69.940  -51.781 1.00 48.61  ? 207 GLU B CB  1 
ATOM   4217  C CG  . GLU B 1 206 ? -0.135  -69.489  -51.682 1.00 50.05  ? 207 GLU B CG  1 
ATOM   4218  C CD  . GLU B 1 206 ? 0.802   -70.247  -52.613 1.00 52.69  ? 207 GLU B CD  1 
ATOM   4219  O OE1 . GLU B 1 206 ? 0.424   -71.334  -53.107 1.00 54.37  ? 207 GLU B OE1 1 
ATOM   4220  O OE2 . GLU B 1 206 ? 1.928   -69.752  -52.845 1.00 52.58  ? 207 GLU B OE2 1 
ATOM   4221  N N   . THR B 1 207 ? -1.437  -67.688  -49.351 1.00 42.65  ? 208 THR B N   1 
ATOM   4222  C CA  . THR B 1 207 ? -1.165  -66.296  -49.028 1.00 40.85  ? 208 THR B CA  1 
ATOM   4223  C C   . THR B 1 207 ? 0.330   -66.016  -49.064 1.00 41.53  ? 208 THR B C   1 
ATOM   4224  O O   . THR B 1 207 ? 1.139   -66.819  -48.593 1.00 42.35  ? 208 THR B O   1 
ATOM   4225  C CB  . THR B 1 207 ? -1.709  -65.920  -47.645 1.00 39.48  ? 208 THR B CB  1 
ATOM   4226  O OG1 . THR B 1 207 ? -1.212  -66.851  -46.678 1.00 41.60  ? 208 THR B OG1 1 
ATOM   4227  C CG2 . THR B 1 207 ? -3.224  -65.957  -47.640 1.00 38.29  ? 208 THR B CG2 1 
ATOM   4228  N N   . SER B 1 208 ? 0.693   -64.872  -49.628 1.00 41.80  ? 209 SER B N   1 
ATOM   4229  C CA  . SER B 1 208 ? 2.085   -64.459  -49.647 1.00 43.24  ? 209 SER B CA  1 
ATOM   4230  C C   . SER B 1 208 ? 2.267   -63.150  -48.893 1.00 40.78  ? 209 SER B C   1 
ATOM   4231  O O   . SER B 1 208 ? 1.526   -62.191  -49.103 1.00 40.01  ? 209 SER B O   1 
ATOM   4232  C CB  . SER B 1 208 ? 2.591   -64.318  -51.080 1.00 45.70  ? 209 SER B CB  1 
ATOM   4233  O OG  . SER B 1 208 ? 2.563   -65.567  -51.750 1.00 49.07  ? 209 SER B OG  1 
ATOM   4234  N N   . LEU B 1 209 ? 3.256   -63.127  -48.008 1.00 38.80  ? 210 LEU B N   1 
ATOM   4235  C CA  . LEU B 1 209 ? 3.612   -61.915  -47.291 1.00 38.55  ? 210 LEU B CA  1 
ATOM   4236  C C   . LEU B 1 209 ? 4.605   -61.118  -48.115 1.00 38.06  ? 210 LEU B C   1 
ATOM   4237  O O   . LEU B 1 209 ? 5.775   -61.481  -48.210 1.00 39.10  ? 210 LEU B O   1 
ATOM   4238  C CB  . LEU B 1 209 ? 4.192   -62.251  -45.914 1.00 40.03  ? 210 LEU B CB  1 
ATOM   4239  C CG  . LEU B 1 209 ? 3.171   -62.772  -44.906 1.00 41.65  ? 210 LEU B CG  1 
ATOM   4240  C CD1 . LEU B 1 209 ? 3.864   -63.438  -43.731 1.00 43.76  ? 210 LEU B CD1 1 
ATOM   4241  C CD2 . LEU B 1 209 ? 2.295   -61.626  -44.428 1.00 41.56  ? 210 LEU B CD2 1 
ATOM   4242  N N   . VAL B 1 210 ? 4.130   -60.036  -48.720 1.00 37.97  ? 211 VAL B N   1 
ATOM   4243  C CA  . VAL B 1 210 ? 4.961   -59.230  -49.598 1.00 39.09  ? 211 VAL B CA  1 
ATOM   4244  C C   . VAL B 1 210 ? 5.572   -58.058  -48.849 1.00 40.52  ? 211 VAL B C   1 
ATOM   4245  O O   . VAL B 1 210 ? 4.851   -57.207  -48.328 1.00 39.72  ? 211 VAL B O   1 
ATOM   4246  C CB  . VAL B 1 210 ? 4.163   -58.696  -50.802 1.00 39.43  ? 211 VAL B CB  1 
ATOM   4247  C CG1 . VAL B 1 210 ? 5.061   -57.864  -51.699 1.00 40.56  ? 211 VAL B CG1 1 
ATOM   4248  C CG2 . VAL B 1 210 ? 3.554   -59.848  -51.583 1.00 39.45  ? 211 VAL B CG2 1 
ATOM   4249  N N   . PRO B 1 211 ? 6.911   -58.016  -48.792 1.00 43.53  ? 212 PRO B N   1 
ATOM   4250  C CA  . PRO B 1 211 ? 7.654   -56.951  -48.114 1.00 44.85  ? 212 PRO B CA  1 
ATOM   4251  C C   . PRO B 1 211 ? 7.222   -55.568  -48.581 1.00 46.17  ? 212 PRO B C   1 
ATOM   4252  O O   . PRO B 1 211 ? 7.291   -55.257  -49.770 1.00 46.27  ? 212 PRO B O   1 
ATOM   4253  C CB  . PRO B 1 211 ? 9.105   -57.235  -48.504 1.00 46.82  ? 212 PRO B CB  1 
ATOM   4254  C CG  . PRO B 1 211 ? 9.136   -58.706  -48.745 1.00 47.51  ? 212 PRO B CG  1 
ATOM   4255  C CD  . PRO B 1 211 ? 7.809   -59.030  -49.372 1.00 45.58  ? 212 PRO B CD  1 
ATOM   4256  N N   . LEU B 1 212 ? 6.765   -54.755  -47.638 1.00 48.45  ? 213 LEU B N   1 
ATOM   4257  C CA  . LEU B 1 212 ? 6.287   -53.416  -47.933 1.00 51.05  ? 213 LEU B CA  1 
ATOM   4258  C C   . LEU B 1 212 ? 6.961   -52.457  -46.959 1.00 54.61  ? 213 LEU B C   1 
ATOM   4259  O O   . LEU B 1 212 ? 6.319   -51.861  -46.093 1.00 53.68  ? 213 LEU B O   1 
ATOM   4260  C CB  . LEU B 1 212 ? 4.760   -53.360  -47.830 1.00 51.52  ? 213 LEU B CB  1 
ATOM   4261  C CG  . LEU B 1 212 ? 3.995   -52.066  -48.102 1.00 52.59  ? 213 LEU B CG  1 
ATOM   4262  C CD1 . LEU B 1 212 ? 4.293   -51.541  -49.493 1.00 53.17  ? 213 LEU B CD1 1 
ATOM   4263  C CD2 . LEU B 1 212 ? 2.508   -52.315  -47.933 1.00 53.08  ? 213 LEU B CD2 1 
ATOM   4264  N N   . SER B 1 213 ? 8.277   -52.339  -47.097 1.00 58.23  ? 214 SER B N   1 
ATOM   4265  C CA  . SER B 1 213 ? 9.073   -51.542  -46.177 1.00 61.69  ? 214 SER B CA  1 
ATOM   4266  C C   . SER B 1 213 ? 9.979   -50.575  -46.921 1.00 63.87  ? 214 SER B C   1 
ATOM   4267  O O   . SER B 1 213 ? 11.129  -50.891  -47.229 1.00 66.76  ? 214 SER B O   1 
ATOM   4268  C CB  . SER B 1 213 ? 9.909   -52.445  -45.272 1.00 62.94  ? 214 SER B CB  1 
ATOM   4269  N N   . ASP B 1 214 ? 9.443   -49.398  -47.214 1.00 62.24  ? 215 ASP B N   1 
ATOM   4270  C CA  . ASP B 1 214 ? 10.223  -48.323  -47.802 1.00 61.47  ? 215 ASP B CA  1 
ATOM   4271  C C   . ASP B 1 214 ? 9.788   -47.030  -47.139 1.00 60.46  ? 215 ASP B C   1 
ATOM   4272  O O   . ASP B 1 214 ? 8.687   -46.544  -47.391 1.00 60.12  ? 215 ASP B O   1 
ATOM   4273  C CB  . ASP B 1 214 ? 10.024  -48.261  -49.317 1.00 60.37  ? 215 ASP B CB  1 
ATOM   4274  C CG  . ASP B 1 214 ? 11.018  -47.338  -50.008 1.00 60.80  ? 215 ASP B CG  1 
ATOM   4275  O OD1 . ASP B 1 214 ? 11.594  -46.452  -49.340 1.00 60.74  ? 215 ASP B OD1 1 
ATOM   4276  O OD2 . ASP B 1 214 ? 11.220  -47.501  -51.230 1.00 61.13  ? 215 ASP B OD2 1 
ATOM   4277  N N   . PRO B 1 215 ? 10.651  -46.474  -46.277 1.00 60.66  ? 216 PRO B N   1 
ATOM   4278  C CA  . PRO B 1 215 ? 10.333  -45.254  -45.528 1.00 59.97  ? 216 PRO B CA  1 
ATOM   4279  C C   . PRO B 1 215 ? 10.075  -44.060  -46.443 1.00 58.27  ? 216 PRO B C   1 
ATOM   4280  O O   . PRO B 1 215 ? 9.426   -43.101  -46.032 1.00 58.10  ? 216 PRO B O   1 
ATOM   4281  C CB  . PRO B 1 215 ? 11.584  -45.031  -44.666 1.00 62.42  ? 216 PRO B CB  1 
ATOM   4282  C CG  . PRO B 1 215 ? 12.672  -45.780  -45.364 1.00 63.55  ? 216 PRO B CG  1 
ATOM   4283  C CD  . PRO B 1 215 ? 12.006  -46.970  -45.983 1.00 62.22  ? 216 PRO B CD  1 
ATOM   4284  N N   . LYS B 1 216 ? 10.571  -44.130  -47.674 1.00 57.79  ? 217 LYS B N   1 
ATOM   4285  C CA  . LYS B 1 216 ? 10.335  -43.079  -48.657 1.00 56.74  ? 217 LYS B CA  1 
ATOM   4286  C C   . LYS B 1 216 ? 8.940   -43.200  -49.268 1.00 54.47  ? 217 LYS B C   1 
ATOM   4287  O O   . LYS B 1 216 ? 8.492   -42.316  -50.000 1.00 54.88  ? 217 LYS B O   1 
ATOM   4288  C CB  . LYS B 1 216 ? 11.398  -43.126  -49.756 1.00 57.48  ? 217 LYS B CB  1 
ATOM   4289  N N   . LEU B 1 217 ? 8.258   -44.300  -48.961 1.00 51.57  ? 218 LEU B N   1 
ATOM   4290  C CA  . LEU B 1 217 ? 6.923   -44.550  -49.494 1.00 48.13  ? 218 LEU B CA  1 
ATOM   4291  C C   . LEU B 1 217 ? 5.873   -44.454  -48.397 1.00 47.13  ? 218 LEU B C   1 
ATOM   4292  O O   . LEU B 1 217 ? 6.100   -44.891  -47.269 1.00 47.06  ? 218 LEU B O   1 
ATOM   4293  C CB  . LEU B 1 217 ? 6.857   -45.924  -50.162 1.00 45.97  ? 218 LEU B CB  1 
ATOM   4294  N N   . ALA B 1 218 ? 4.719   -43.890  -48.734 1.00 46.17  ? 219 ALA B N   1 
ATOM   4295  C CA  . ALA B 1 218 ? 3.640   -43.736  -47.768 1.00 44.83  ? 219 ALA B CA  1 
ATOM   4296  C C   . ALA B 1 218 ? 2.316   -44.232  -48.328 1.00 43.54  ? 219 ALA B C   1 
ATOM   4297  O O   . ALA B 1 218 ? 2.103   -44.237  -49.538 1.00 42.43  ? 219 ALA B O   1 
ATOM   4298  C CB  . ALA B 1 218 ? 3.517   -42.281  -47.338 1.00 45.17  ? 219 ALA B CB  1 
ATOM   4299  N N   . VAL B 1 219 ? 1.428   -44.652  -47.437 1.00 43.04  ? 220 VAL B N   1 
ATOM   4300  C CA  . VAL B 1 219 ? 0.074   -45.016  -47.824 1.00 40.30  ? 220 VAL B CA  1 
ATOM   4301  C C   . VAL B 1 219 ? -0.906  -44.094  -47.111 1.00 38.01  ? 220 VAL B C   1 
ATOM   4302  O O   . VAL B 1 219 ? -1.006  -44.117  -45.882 1.00 36.54  ? 220 VAL B O   1 
ATOM   4303  C CB  . VAL B 1 219 ? -0.246  -46.482  -47.478 1.00 40.48  ? 220 VAL B CB  1 
ATOM   4304  C CG1 . VAL B 1 219 ? -1.689  -46.803  -47.821 1.00 38.72  ? 220 VAL B CG1 1 
ATOM   4305  C CG2 . VAL B 1 219 ? 0.710   -47.419  -48.202 1.00 40.61  ? 220 VAL B CG2 1 
ATOM   4306  N N   . LEU B 1 220 ? -1.615  -43.272  -47.877 1.00 35.94  ? 221 LEU B N   1 
ATOM   4307  C CA  . LEU B 1 220 ? -2.559  -42.328  -47.293 1.00 35.64  ? 221 LEU B CA  1 
ATOM   4308  C C   . LEU B 1 220 ? -3.994  -42.803  -47.481 1.00 34.82  ? 221 LEU B C   1 
ATOM   4309  O O   . LEU B 1 220 ? -4.462  -43.000  -48.612 1.00 34.98  ? 221 LEU B O   1 
ATOM   4310  C CB  . LEU B 1 220 ? -2.380  -40.934  -47.901 1.00 36.71  ? 221 LEU B CB  1 
ATOM   4311  C CG  . LEU B 1 220 ? -3.375  -39.861  -47.448 1.00 38.59  ? 221 LEU B CG  1 
ATOM   4312  C CD1 . LEU B 1 220 ? -3.161  -39.486  -45.983 1.00 39.53  ? 221 LEU B CD1 1 
ATOM   4313  C CD2 . LEU B 1 220 ? -3.304  -38.622  -48.343 1.00 40.03  ? 221 LEU B CD2 1 
ATOM   4314  N N   . ILE B 1 221 ? -4.685  -42.994  -46.363 1.00 35.70  ? 222 ILE B N   1 
ATOM   4315  C CA  . ILE B 1 221 ? -6.089  -43.376  -46.383 1.00 33.70  ? 222 ILE B CA  1 
ATOM   4316  C C   . ILE B 1 221 ? -6.938  -42.144  -46.152 1.00 34.99  ? 222 ILE B C   1 
ATOM   4317  O O   . ILE B 1 221 ? -6.757  -41.437  -45.157 1.00 41.89  ? 222 ILE B O   1 
ATOM   4318  C CB  . ILE B 1 221 ? -6.428  -44.441  -45.310 1.00 37.48  ? 222 ILE B CB  1 
ATOM   4319  C CG1 . ILE B 1 221 ? -5.666  -45.742  -45.569 1.00 37.39  ? 222 ILE B CG1 1 
ATOM   4320  C CG2 . ILE B 1 221 ? -7.924  -44.715  -45.283 1.00 36.38  ? 222 ILE B CG2 1 
ATOM   4321  C CD1 . ILE B 1 221 ? -4.329  -45.818  -44.891 1.00 39.99  ? 222 ILE B CD1 1 
ATOM   4322  N N   . THR B 1 222 ? -7.857  -41.879  -47.074 1.00 35.16  ? 223 THR B N   1 
ATOM   4323  C CA  . THR B 1 222 ? -8.755  -40.743  -46.940 1.00 36.64  ? 223 THR B CA  1 
ATOM   4324  C C   . THR B 1 222 ? -10.208 -41.197  -46.832 1.00 38.69  ? 223 THR B C   1 
ATOM   4325  O O   . THR B 1 222 ? -10.760 -41.784  -47.765 1.00 37.34  ? 223 THR B O   1 
ATOM   4326  C CB  . THR B 1 222 ? -8.614  -39.765  -48.122 1.00 36.72  ? 223 THR B CB  1 
ATOM   4327  O OG1 . THR B 1 222 ? -7.234  -39.419  -48.295 1.00 36.08  ? 223 THR B OG1 1 
ATOM   4328  C CG2 . THR B 1 222 ? -9.427  -38.503  -47.868 1.00 38.55  ? 223 THR B CG2 1 
ATOM   4329  N N   . ASN B 1 223 ? -10.817 -40.920  -45.683 1.00 38.93  ? 224 ASN B N   1 
ATOM   4330  C CA  . ASN B 1 223 ? -12.224 -41.226  -45.451 1.00 40.20  ? 224 ASN B CA  1 
ATOM   4331  C C   . ASN B 1 223 ? -13.119 -40.110  -45.984 1.00 44.80  ? 224 ASN B C   1 
ATOM   4332  O O   . ASN B 1 223 ? -12.995 -38.952  -45.580 1.00 42.86  ? 224 ASN B O   1 
ATOM   4333  C CB  . ASN B 1 223 ? -12.482 -41.449  -43.955 1.00 42.23  ? 224 ASN B CB  1 
ATOM   4334  C CG  . ASN B 1 223 ? -13.808 -42.145  -43.677 1.00 43.29  ? 224 ASN B CG  1 
ATOM   4335  O OD1 . ASN B 1 223 ? -14.732 -42.108  -44.493 1.00 43.10  ? 224 ASN B OD1 1 
ATOM   4336  N ND2 . ASN B 1 223 ? -13.906 -42.783  -42.512 1.00 43.50  ? 224 ASN B ND2 1 
ATOM   4337  N N   . SER B 1 224 ? -14.020 -40.469  -46.893 1.00 41.75  ? 225 SER B N   1 
ATOM   4338  C CA  . SER B 1 224 ? -14.972 -39.519  -47.458 1.00 45.26  ? 225 SER B CA  1 
ATOM   4339  C C   . SER B 1 224 ? -16.020 -39.124  -46.430 1.00 47.90  ? 225 SER B C   1 
ATOM   4340  O O   . SER B 1 224 ? -16.709 -38.114  -46.588 1.00 47.61  ? 225 SER B O   1 
ATOM   4341  C CB  . SER B 1 224 ? -15.663 -40.115  -48.683 1.00 43.02  ? 225 SER B CB  1 
ATOM   4342  O OG  . SER B 1 224 ? -16.451 -41.233  -48.312 1.00 43.29  ? 225 SER B OG  1 
ATOM   4343  N N   . ASN B 1 225 ? -16.143 -39.947  -45.391 1.00 45.94  ? 226 ASN B N   1 
ATOM   4344  C CA  . ASN B 1 225 ? -17.138 -39.753  -44.345 1.00 51.84  ? 226 ASN B CA  1 
ATOM   4345  C C   . ASN B 1 225 ? -18.559 -39.669  -44.901 1.00 54.56  ? 226 ASN B C   1 
ATOM   4346  O O   . ASN B 1 225 ? -19.401 -38.942  -44.377 1.00 56.81  ? 226 ASN B O   1 
ATOM   4347  C CB  . ASN B 1 225 ? -16.804 -38.504  -43.526 1.00 49.89  ? 226 ASN B CB  1 
ATOM   4348  C CG  . ASN B 1 225 ? -15.518 -38.661  -42.736 1.00 48.71  ? 226 ASN B CG  1 
ATOM   4349  O OD1 . ASN B 1 225 ? -15.368 -39.606  -41.958 1.00 48.42  ? 226 ASN B OD1 1 
ATOM   4350  N ND2 . ASN B 1 225 ? -14.573 -37.752  -42.953 1.00 48.17  ? 226 ASN B ND2 1 
ATOM   4351  N N   . VAL B 1 226 ? -18.813 -40.411  -45.976 1.00 55.36  ? 227 VAL B N   1 
ATOM   4352  C CA  . VAL B 1 226 ? -20.170 -40.603  -46.475 1.00 57.97  ? 227 VAL B CA  1 
ATOM   4353  C C   . VAL B 1 226 ? -20.446 -42.093  -46.653 1.00 58.51  ? 227 VAL B C   1 
ATOM   4354  O O   . VAL B 1 226 ? -19.520 -42.899  -46.761 1.00 55.94  ? 227 VAL B O   1 
ATOM   4355  C CB  . VAL B 1 226 ? -20.422 -39.870  -47.819 1.00 55.03  ? 227 VAL B CB  1 
ATOM   4356  C CG1 . VAL B 1 226 ? -20.071 -38.392  -47.705 1.00 56.02  ? 227 VAL B CG1 1 
ATOM   4357  C CG2 . VAL B 1 226 ? -19.642 -40.524  -48.944 1.00 52.30  ? 227 VAL B CG2 1 
ATOM   4358  N N   . ARG B 1 227 ? -21.726 -42.450  -46.667 1.00 63.06  ? 228 ARG B N   1 
ATOM   4359  C CA  . ARG B 1 227 ? -22.148 -43.827  -46.897 1.00 64.29  ? 228 ARG B CA  1 
ATOM   4360  C C   . ARG B 1 227 ? -23.532 -43.842  -47.540 1.00 69.26  ? 228 ARG B C   1 
ATOM   4361  O O   . ARG B 1 227 ? -24.550 -43.753  -46.851 1.00 72.75  ? 228 ARG B O   1 
ATOM   4362  C CB  . ARG B 1 227 ? -22.155 -44.622  -45.589 1.00 64.51  ? 228 ARG B CB  1 
ATOM   4363  N N   . HIS B 1 228 ? -23.561 -43.944  -48.865 1.00 69.30  ? 229 HIS B N   1 
ATOM   4364  C CA  . HIS B 1 228 ? -24.814 -43.922  -49.612 1.00 71.56  ? 229 HIS B CA  1 
ATOM   4365  C C   . HIS B 1 228 ? -25.496 -45.286  -49.593 1.00 72.24  ? 229 HIS B C   1 
ATOM   4366  O O   . HIS B 1 228 ? -26.358 -45.550  -48.754 1.00 74.30  ? 229 HIS B O   1 
ATOM   4367  C CB  . HIS B 1 228 ? -24.566 -43.475  -51.055 1.00 70.51  ? 229 HIS B CB  1 
ATOM   4368  N N   . SER B 1 233 ? -26.469 -53.397  -49.736 1.00 71.42  ? 234 SER B N   1 
ATOM   4369  C CA  . SER B 1 233 ? -27.629 -53.352  -50.620 1.00 72.92  ? 234 SER B CA  1 
ATOM   4370  C C   . SER B 1 233 ? -27.268 -53.800  -52.034 1.00 70.60  ? 234 SER B C   1 
ATOM   4371  O O   . SER B 1 233 ? -27.826 -54.769  -52.550 1.00 71.58  ? 234 SER B O   1 
ATOM   4372  C CB  . SER B 1 233 ? -28.225 -51.942  -50.651 1.00 74.56  ? 234 SER B CB  1 
ATOM   4373  N N   . GLU B 1 234 ? -26.333 -53.088  -52.657 1.00 67.36  ? 235 GLU B N   1 
ATOM   4374  C CA  . GLU B 1 234 ? -25.888 -53.428  -54.005 1.00 64.64  ? 235 GLU B CA  1 
ATOM   4375  C C   . GLU B 1 234 ? -24.740 -54.431  -53.978 1.00 60.73  ? 235 GLU B C   1 
ATOM   4376  O O   . GLU B 1 234 ? -24.337 -54.948  -55.018 1.00 59.68  ? 235 GLU B O   1 
ATOM   4377  C CB  . GLU B 1 234 ? -25.468 -52.170  -54.768 1.00 64.23  ? 235 GLU B CB  1 
ATOM   4378  C CG  . GLU B 1 234 ? -26.611 -51.212  -55.038 1.00 67.68  ? 235 GLU B CG  1 
ATOM   4379  C CD  . GLU B 1 234 ? -27.722 -51.857  -55.843 1.00 70.99  ? 235 GLU B CD  1 
ATOM   4380  O OE1 . GLU B 1 234 ? -27.412 -52.550  -56.838 1.00 70.35  ? 235 GLU B OE1 1 
ATOM   4381  O OE2 . GLU B 1 234 ? -28.903 -51.684  -55.472 1.00 74.21  ? 235 GLU B OE2 1 
ATOM   4382  N N   . TYR B 1 235 ? -24.212 -54.700  -52.788 1.00 58.82  ? 236 TYR B N   1 
ATOM   4383  C CA  . TYR B 1 235 ? -23.145 -55.683  -52.645 1.00 55.58  ? 236 TYR B CA  1 
ATOM   4384  C C   . TYR B 1 235 ? -23.617 -57.087  -53.055 1.00 57.46  ? 236 TYR B C   1 
ATOM   4385  O O   . TYR B 1 235 ? -22.971 -57.722  -53.891 1.00 56.47  ? 236 TYR B O   1 
ATOM   4386  C CB  . TYR B 1 235 ? -22.593 -55.685  -51.212 1.00 53.22  ? 236 TYR B CB  1 
ATOM   4387  C CG  . TYR B 1 235 ? -21.337 -56.512  -51.034 1.00 49.99  ? 236 TYR B CG  1 
ATOM   4388  C CD1 . TYR B 1 235 ? -20.080 -55.947  -51.210 1.00 46.93  ? 236 TYR B CD1 1 
ATOM   4389  C CD2 . TYR B 1 235 ? -21.409 -57.857  -50.687 1.00 50.62  ? 236 TYR B CD2 1 
ATOM   4390  C CE1 . TYR B 1 235 ? -18.930 -56.695  -51.051 1.00 45.90  ? 236 TYR B CE1 1 
ATOM   4391  C CE2 . TYR B 1 235 ? -20.262 -58.616  -50.524 1.00 49.88  ? 236 TYR B CE2 1 
ATOM   4392  C CZ  . TYR B 1 235 ? -19.025 -58.028  -50.704 1.00 47.51  ? 236 TYR B CZ  1 
ATOM   4393  O OH  . TYR B 1 235 ? -17.880 -58.776  -50.543 1.00 40.76  ? 236 TYR B OH  1 
ATOM   4394  N N   . PRO B 1 236 ? -24.746 -57.575  -52.494 1.00 60.12  ? 237 PRO B N   1 
ATOM   4395  C CA  . PRO B 1 236 ? -25.160 -58.912  -52.940 1.00 61.39  ? 237 PRO B CA  1 
ATOM   4396  C C   . PRO B 1 236 ? -25.686 -58.918  -54.371 1.00 62.06  ? 237 PRO B C   1 
ATOM   4397  O O   . PRO B 1 236 ? -25.753 -59.975  -54.998 1.00 62.77  ? 237 PRO B O   1 
ATOM   4398  C CB  . PRO B 1 236 ? -26.271 -59.281  -51.953 1.00 63.86  ? 237 PRO B CB  1 
ATOM   4399  C CG  . PRO B 1 236 ? -26.838 -57.978  -51.539 1.00 64.54  ? 237 PRO B CG  1 
ATOM   4400  C CD  . PRO B 1 236 ? -25.669 -57.038  -51.475 1.00 61.78  ? 237 PRO B CD  1 
ATOM   4401  N N   . VAL B 1 237 ? -26.062 -57.749  -54.877 1.00 62.51  ? 238 VAL B N   1 
ATOM   4402  C CA  . VAL B 1 237 ? -26.487 -57.627  -56.265 1.00 62.18  ? 238 VAL B CA  1 
ATOM   4403  C C   . VAL B 1 237 ? -25.313 -57.922  -57.195 1.00 59.05  ? 238 VAL B C   1 
ATOM   4404  O O   . VAL B 1 237 ? -25.431 -58.725  -58.121 1.00 58.89  ? 238 VAL B O   1 
ATOM   4405  C CB  . VAL B 1 237 ? -27.055 -56.224  -56.567 1.00 63.31  ? 238 VAL B CB  1 
ATOM   4406  C CG1 . VAL B 1 237 ? -27.468 -56.115  -58.030 1.00 63.17  ? 238 VAL B CG1 1 
ATOM   4407  C CG2 . VAL B 1 237 ? -28.234 -55.921  -55.654 1.00 66.02  ? 238 VAL B CG2 1 
ATOM   4408  N N   . ARG B 1 238 ? -24.180 -57.274  -56.935 1.00 56.93  ? 239 ARG B N   1 
ATOM   4409  C CA  . ARG B 1 238 ? -22.959 -57.511  -57.701 1.00 54.91  ? 239 ARG B CA  1 
ATOM   4410  C C   . ARG B 1 238 ? -22.546 -58.980  -57.643 1.00 55.03  ? 239 ARG B C   1 
ATOM   4411  O O   . ARG B 1 238 ? -22.200 -59.574  -58.665 1.00 55.80  ? 239 ARG B O   1 
ATOM   4412  C CB  . ARG B 1 238 ? -21.817 -56.627  -57.190 1.00 51.57  ? 239 ARG B CB  1 
ATOM   4413  C CG  . ARG B 1 238 ? -22.033 -55.134  -57.398 1.00 50.72  ? 239 ARG B CG  1 
ATOM   4414  C CD  . ARG B 1 238 ? -22.168 -54.783  -58.871 1.00 50.24  ? 239 ARG B CD  1 
ATOM   4415  N NE  . ARG B 1 238 ? -22.289 -53.343  -59.081 1.00 49.88  ? 239 ARG B NE  1 
ATOM   4416  C CZ  . ARG B 1 238 ? -23.432 -52.668  -59.010 1.00 50.86  ? 239 ARG B CZ  1 
ATOM   4417  N NH1 . ARG B 1 238 ? -24.563 -53.301  -58.736 1.00 52.29  ? 239 ARG B NH1 1 
ATOM   4418  N NH2 . ARG B 1 238 ? -23.443 -51.359  -59.212 1.00 51.87  ? 239 ARG B NH2 1 
ATOM   4419  N N   . ARG B 1 239 ? -22.587 -59.558  -56.444 1.00 54.48  ? 240 ARG B N   1 
ATOM   4420  C CA  . ARG B 1 239 ? -22.254 -60.967  -56.258 1.00 53.67  ? 240 ARG B CA  1 
ATOM   4421  C C   . ARG B 1 239 ? -23.127 -61.853  -57.141 1.00 54.96  ? 240 ARG B C   1 
ATOM   4422  O O   . ARG B 1 239 ? -22.627 -62.745  -57.825 1.00 54.68  ? 240 ARG B O   1 
ATOM   4423  C CB  . ARG B 1 239 ? -22.404 -61.380  -54.789 1.00 53.19  ? 240 ARG B CB  1 
ATOM   4424  C CG  . ARG B 1 239 ? -21.319 -60.836  -53.868 1.00 51.54  ? 240 ARG B CG  1 
ATOM   4425  C CD  . ARG B 1 239 ? -21.181 -61.679  -52.598 1.00 51.98  ? 240 ARG B CD  1 
ATOM   4426  N NE  . ARG B 1 239 ? -20.765 -63.049  -52.890 1.00 51.35  ? 240 ARG B NE  1 
ATOM   4427  C CZ  . ARG B 1 239 ? -20.262 -63.891  -51.990 1.00 51.42  ? 240 ARG B CZ  1 
ATOM   4428  N NH1 . ARG B 1 239 ? -20.102 -63.505  -50.730 1.00 52.27  ? 240 ARG B NH1 1 
ATOM   4429  N NH2 . ARG B 1 239 ? -19.913 -65.121  -52.350 1.00 50.39  ? 240 ARG B NH2 1 
ATOM   4430  N N   . ARG B 1 240 ? -24.431 -61.594  -57.127 1.00 56.61  ? 241 ARG B N   1 
ATOM   4431  C CA  . ARG B 1 240 ? -25.370 -62.346  -57.950 1.00 59.47  ? 241 ARG B CA  1 
ATOM   4432  C C   . ARG B 1 240 ? -25.074 -62.178  -59.444 1.00 60.03  ? 241 ARG B C   1 
ATOM   4433  O O   . ARG B 1 240 ? -25.118 -63.145  -60.203 1.00 61.10  ? 241 ARG B O   1 
ATOM   4434  C CB  . ARG B 1 240 ? -26.806 -61.914  -57.646 1.00 61.61  ? 241 ARG B CB  1 
ATOM   4435  N N   . GLN B 1 241 ? -24.768 -60.951  -59.855 1.00 60.17  ? 242 GLN B N   1 
ATOM   4436  C CA  . GLN B 1 241 ? -24.462 -60.657  -61.255 1.00 60.88  ? 242 GLN B CA  1 
ATOM   4437  C C   . GLN B 1 241 ? -23.230 -61.422  -61.737 1.00 59.66  ? 242 GLN B C   1 
ATOM   4438  O O   . GLN B 1 241 ? -23.220 -61.964  -62.842 1.00 60.66  ? 242 GLN B O   1 
ATOM   4439  C CB  . GLN B 1 241 ? -24.256 -59.152  -61.454 1.00 60.71  ? 242 GLN B CB  1 
ATOM   4440  C CG  . GLN B 1 241 ? -25.526 -58.320  -61.317 1.00 63.65  ? 242 GLN B CG  1 
ATOM   4441  C CD  . GLN B 1 241 ? -25.249 -56.825  -61.294 1.00 63.80  ? 242 GLN B CD  1 
ATOM   4442  O OE1 . GLN B 1 241 ? -24.097 -56.394  -61.333 1.00 62.04  ? 242 GLN B OE1 1 
ATOM   4443  N NE2 . GLN B 1 241 ? -26.309 -56.027  -61.234 1.00 66.08  ? 242 GLN B NE2 1 
ATOM   4444  N N   . CYS B 1 242 ? -22.196 -61.464  -60.902 1.00 57.81  ? 243 CYS B N   1 
ATOM   4445  C CA  . CYS B 1 242 ? -20.979 -62.202  -61.223 1.00 56.81  ? 243 CYS B CA  1 
ATOM   4446  C C   . CYS B 1 242 ? -21.264 -63.691  -61.379 1.00 59.62  ? 243 CYS B C   1 
ATOM   4447  O O   . CYS B 1 242 ? -20.689 -64.358  -62.240 1.00 58.80  ? 243 CYS B O   1 
ATOM   4448  C CB  . CYS B 1 242 ? -19.917 -61.984  -60.144 1.00 54.16  ? 243 CYS B CB  1 
ATOM   4449  S SG  . CYS B 1 242 ? -19.236 -60.317  -60.112 1.00 46.04  ? 243 CYS B SG  1 
ATOM   4450  N N   . GLU B 1 243 ? -22.151 -64.205  -60.534 1.00 63.53  ? 244 GLU B N   1 
ATOM   4451  C CA  . GLU B 1 243 ? -22.547 -65.605  -60.597 1.00 67.55  ? 244 GLU B CA  1 
ATOM   4452  C C   . GLU B 1 243 ? -23.316 -65.894  -61.884 1.00 68.15  ? 244 GLU B C   1 
ATOM   4453  O O   . GLU B 1 243 ? -23.230 -66.990  -62.432 1.00 69.37  ? 244 GLU B O   1 
ATOM   4454  C CB  . GLU B 1 243 ? -23.390 -65.980  -59.375 1.00 71.44  ? 244 GLU B CB  1 
ATOM   4455  C CG  . GLU B 1 243 ? -22.624 -65.953  -58.062 1.00 72.91  ? 244 GLU B CG  1 
ATOM   4456  C CD  . GLU B 1 243 ? -23.490 -66.311  -56.868 1.00 76.71  ? 244 GLU B CD  1 
ATOM   4457  O OE1 . GLU B 1 243 ? -24.070 -67.419  -56.865 1.00 79.93  ? 244 GLU B OE1 1 
ATOM   4458  O OE2 . GLU B 1 243 ? -23.584 -65.489  -55.930 1.00 76.49  ? 244 GLU B OE2 1 
ATOM   4459  N N   . GLU B 1 244 ? -24.059 -64.901  -62.365 1.00 67.87  ? 245 GLU B N   1 
ATOM   4460  C CA  . GLU B 1 244 ? -24.838 -65.046  -63.593 1.00 69.42  ? 245 GLU B CA  1 
ATOM   4461  C C   . GLU B 1 244 ? -23.940 -65.212  -64.817 1.00 68.37  ? 245 GLU B C   1 
ATOM   4462  O O   . GLU B 1 244 ? -24.122 -66.139  -65.604 1.00 69.26  ? 245 GLU B O   1 
ATOM   4463  C CB  . GLU B 1 244 ? -25.764 -63.843  -63.785 1.00 70.26  ? 245 GLU B CB  1 
ATOM   4464  N N   . VAL B 1 245 ? -22.970 -64.315  -64.969 1.00 66.95  ? 246 VAL B N   1 
ATOM   4465  C CA  . VAL B 1 245 ? -22.055 -64.361  -66.108 1.00 67.38  ? 246 VAL B CA  1 
ATOM   4466  C C   . VAL B 1 245 ? -21.199 -65.618  -66.075 1.00 67.46  ? 246 VAL B C   1 
ATOM   4467  O O   . VAL B 1 245 ? -20.962 -66.246  -67.109 1.00 68.41  ? 246 VAL B O   1 
ATOM   4468  C CB  . VAL B 1 245 ? -21.143 -63.122  -66.148 1.00 65.69  ? 246 VAL B CB  1 
ATOM   4469  C CG1 . VAL B 1 245 ? -20.031 -63.298  -67.176 1.00 65.03  ? 246 VAL B CG1 1 
ATOM   4470  C CG2 . VAL B 1 245 ? -21.964 -61.895  -66.461 1.00 66.46  ? 246 VAL B CG2 1 
ATOM   4471  N N   . ALA B 1 246 ? -20.742 -65.980  -64.879 1.00 66.40  ? 247 ALA B N   1 
ATOM   4472  C CA  . ALA B 1 246 ? -19.991 -67.214  -64.688 1.00 65.61  ? 247 ALA B CA  1 
ATOM   4473  C C   . ALA B 1 246 ? -20.758 -68.408  -65.254 1.00 67.50  ? 247 ALA B C   1 
ATOM   4474  O O   . ALA B 1 246 ? -20.182 -69.267  -65.922 1.00 66.87  ? 247 ALA B O   1 
ATOM   4475  C CB  . ALA B 1 246 ? -19.689 -67.428  -63.217 1.00 64.92  ? 247 ALA B CB  1 
ATOM   4476  N N   . ARG B 1 247 ? -22.060 -68.444  -64.988 1.00 70.50  ? 248 ARG B N   1 
ATOM   4477  C CA  . ARG B 1 247 ? -22.914 -69.526  -65.464 1.00 74.67  ? 248 ARG B CA  1 
ATOM   4478  C C   . ARG B 1 247 ? -23.085 -69.461  -66.978 1.00 77.45  ? 248 ARG B C   1 
ATOM   4479  O O   . ARG B 1 247 ? -23.136 -70.489  -67.651 1.00 80.15  ? 248 ARG B O   1 
ATOM   4480  C CB  . ARG B 1 247 ? -24.282 -69.474  -64.778 1.00 76.11  ? 248 ARG B CB  1 
ATOM   4481  N N   . ALA B 1 248 ? -23.164 -68.243  -67.505 1.00 76.91  ? 249 ALA B N   1 
ATOM   4482  C CA  . ALA B 1 248 ? -23.371 -68.028  -68.933 1.00 78.75  ? 249 ALA B CA  1 
ATOM   4483  C C   . ALA B 1 248 ? -22.154 -68.437  -69.760 1.00 78.94  ? 249 ALA B C   1 
ATOM   4484  O O   . ALA B 1 248 ? -22.255 -68.625  -70.971 1.00 80.99  ? 249 ALA B O   1 
ATOM   4485  C CB  . ALA B 1 248 ? -23.719 -66.569  -69.198 1.00 77.55  ? 249 ALA B CB  1 
ATOM   4486  N N   . LEU B 1 249 ? -21.007 -68.581  -69.102 1.00 76.64  ? 250 LEU B N   1 
ATOM   4487  C CA  . LEU B 1 249 ? -19.763 -68.880  -69.803 1.00 75.72  ? 250 LEU B CA  1 
ATOM   4488  C C   . LEU B 1 249 ? -19.222 -70.268  -69.471 1.00 75.98  ? 250 LEU B C   1 
ATOM   4489  O O   . LEU B 1 249 ? -18.136 -70.638  -69.917 1.00 76.08  ? 250 LEU B O   1 
ATOM   4490  C CB  . LEU B 1 249 ? -18.708 -67.821  -69.480 1.00 72.86  ? 250 LEU B CB  1 
ATOM   4491  N N   . GLY B 1 250 ? -19.982 -71.029  -68.690 1.00 62.37  ? 251 GLY B N   1 
ATOM   4492  C CA  . GLY B 1 250 ? -19.596 -72.383  -68.337 1.00 63.88  ? 251 GLY B CA  1 
ATOM   4493  C C   . GLY B 1 250 ? -18.259 -72.461  -67.624 1.00 63.30  ? 251 GLY B C   1 
ATOM   4494  O O   . GLY B 1 250 ? -17.379 -73.228  -68.016 1.00 64.80  ? 251 GLY B O   1 
ATOM   4495  N N   . ALA B 1 251 ? -18.104 -71.653  -66.580 1.00 60.64  ? 252 ALA B N   1 
ATOM   4496  C CA  . ALA B 1 251 ? -16.891 -71.659  -65.778 1.00 58.04  ? 252 ALA B CA  1 
ATOM   4497  C C   . ALA B 1 251 ? -17.261 -71.613  -64.304 1.00 56.58  ? 252 ALA B C   1 
ATOM   4498  O O   . ALA B 1 251 ? -18.300 -71.062  -63.938 1.00 56.40  ? 252 ALA B O   1 
ATOM   4499  C CB  . ALA B 1 251 ? -15.995 -70.486  -66.148 1.00 56.60  ? 252 ALA B CB  1 
ATOM   4500  N N   . ALA B 1 252 ? -16.416 -72.201  -63.462 1.00 55.72  ? 253 ALA B N   1 
ATOM   4501  C CA  . ALA B 1 252 ? -16.686 -72.263  -62.031 1.00 54.77  ? 253 ALA B CA  1 
ATOM   4502  C C   . ALA B 1 252 ? -16.782 -70.860  -61.442 1.00 51.75  ? 253 ALA B C   1 
ATOM   4503  O O   . ALA B 1 252 ? -17.690 -70.557  -60.666 1.00 52.40  ? 253 ALA B O   1 
ATOM   4504  C CB  . ALA B 1 252 ? -15.609 -73.069  -61.321 1.00 55.90  ? 253 ALA B CB  1 
ATOM   4505  N N   . SER B 1 253 ? -15.843 -70.005  -61.826 1.00 48.07  ? 254 SER B N   1 
ATOM   4506  C CA  . SER B 1 253 ? -15.840 -68.618  -61.386 1.00 44.33  ? 254 SER B CA  1 
ATOM   4507  C C   . SER B 1 253 ? -15.112 -67.757  -62.409 1.00 43.77  ? 254 SER B C   1 
ATOM   4508  O O   . SER B 1 253 ? -14.478 -68.276  -63.327 1.00 45.88  ? 254 SER B O   1 
ATOM   4509  C CB  . SER B 1 253 ? -15.172 -68.484  -60.018 1.00 42.06  ? 254 SER B CB  1 
ATOM   4510  O OG  . SER B 1 253 ? -13.764 -68.539  -60.150 1.00 40.49  ? 254 SER B OG  1 
ATOM   4511  N N   . LEU B 1 254 ? -15.187 -66.441  -62.239 1.00 41.48  ? 255 LEU B N   1 
ATOM   4512  C CA  . LEU B 1 254 ? -14.531 -65.518  -63.158 1.00 39.69  ? 255 LEU B CA  1 
ATOM   4513  C C   . LEU B 1 254 ? -13.009 -65.632  -63.079 1.00 40.77  ? 255 LEU B C   1 
ATOM   4514  O O   . LEU B 1 254 ? -12.297 -65.124  -63.942 1.00 37.85  ? 255 LEU B O   1 
ATOM   4515  C CB  . LEU B 1 254 ? -14.979 -64.085  -62.873 1.00 38.87  ? 255 LEU B CB  1 
ATOM   4516  C CG  . LEU B 1 254 ? -16.491 -63.881  -63.000 1.00 39.98  ? 255 LEU B CG  1 
ATOM   4517  C CD1 . LEU B 1 254 ? -16.893 -62.461  -62.648 1.00 39.39  ? 255 LEU B CD1 1 
ATOM   4518  C CD2 . LEU B 1 254 ? -16.966 -64.240  -64.411 1.00 40.17  ? 255 LEU B CD2 1 
ATOM   4519  N N   . ARG B 1 255 ? -12.511 -66.298  -62.039 1.00 38.46  ? 256 ARG B N   1 
ATOM   4520  C CA  . ARG B 1 255 ? -11.089 -66.609  -61.953 1.00 38.53  ? 256 ARG B CA  1 
ATOM   4521  C C   . ARG B 1 255 ? -10.691 -67.503  -63.129 1.00 39.21  ? 256 ARG B C   1 
ATOM   4522  O O   . ARG B 1 255 ? -9.560  -67.446  -63.614 1.00 39.28  ? 256 ARG B O   1 
ATOM   4523  C CB  . ARG B 1 255 ? -10.758 -67.287  -60.616 1.00 38.91  ? 256 ARG B CB  1 
ATOM   4524  C CG  . ARG B 1 255 ? -9.312  -67.752  -60.474 1.00 39.09  ? 256 ARG B CG  1 
ATOM   4525  C CD  . ARG B 1 255 ? -8.320  -66.594  -60.548 1.00 38.44  ? 256 ARG B CD  1 
ATOM   4526  N NE  . ARG B 1 255 ? -6.958  -67.027  -60.238 1.00 41.94  ? 256 ARG B NE  1 
ATOM   4527  C CZ  . ARG B 1 255 ? -6.481  -67.182  -59.005 1.00 42.24  ? 256 ARG B CZ  1 
ATOM   4528  N NH1 . ARG B 1 255 ? -7.254  -66.934  -57.958 1.00 38.74  ? 256 ARG B NH1 1 
ATOM   4529  N NH2 . ARG B 1 255 ? -5.231  -67.586  -58.817 1.00 39.26  ? 256 ARG B NH2 1 
ATOM   4530  N N   . GLU B 1 256 ? -11.639 -68.312  -63.593 1.00 39.92  ? 257 GLU B N   1 
ATOM   4531  C CA  . GLU B 1 256 ? -11.391 -69.246  -64.685 1.00 42.98  ? 257 GLU B CA  1 
ATOM   4532  C C   . GLU B 1 256 ? -11.531 -68.588  -66.052 1.00 41.80  ? 257 GLU B C   1 
ATOM   4533  O O   . GLU B 1 256 ? -11.134 -69.164  -67.059 1.00 42.82  ? 257 GLU B O   1 
ATOM   4534  C CB  . GLU B 1 256 ? -12.345 -70.441  -64.599 1.00 44.37  ? 257 GLU B CB  1 
ATOM   4535  C CG  . GLU B 1 256 ? -12.381 -71.108  -63.238 1.00 46.66  ? 257 GLU B CG  1 
ATOM   4536  C CD  . GLU B 1 256 ? -11.010 -71.551  -62.774 1.00 48.25  ? 257 GLU B CD  1 
ATOM   4537  O OE1 . GLU B 1 256 ? -10.204 -71.987  -63.625 1.00 48.02  ? 257 GLU B OE1 1 
ATOM   4538  O OE2 . GLU B 1 256 ? -10.734 -71.452  -61.556 1.00 49.32  ? 257 GLU B OE2 1 
ATOM   4539  N N   . VAL B 1 257 ? -12.094 -67.383  -66.077 1.00 41.75  ? 258 VAL B N   1 
ATOM   4540  C CA  . VAL B 1 257 ? -12.356 -66.671  -67.323 1.00 43.60  ? 258 VAL B CA  1 
ATOM   4541  C C   . VAL B 1 257 ? -11.185 -65.782  -67.745 1.00 42.46  ? 258 VAL B C   1 
ATOM   4542  O O   . VAL B 1 257 ? -10.682 -64.979  -66.963 1.00 42.50  ? 258 VAL B O   1 
ATOM   4543  C CB  . VAL B 1 257 ? -13.630 -65.811  -67.208 1.00 45.12  ? 258 VAL B CB  1 
ATOM   4544  C CG1 . VAL B 1 257 ? -13.796 -64.925  -68.440 1.00 38.80  ? 258 VAL B CG1 1 
ATOM   4545  C CG2 . VAL B 1 257 ? -14.855 -66.699  -67.007 1.00 39.88  ? 258 VAL B CG2 1 
ATOM   4546  N N   . GLN B 1 258 ? -10.763 -65.935  -68.995 1.00 42.63  ? 259 GLN B N   1 
ATOM   4547  C CA  . GLN B 1 258 ? -9.671  -65.147  -69.553 1.00 42.24  ? 259 GLN B CA  1 
ATOM   4548  C C   . GLN B 1 258 ? -10.199 -63.847  -70.173 1.00 40.50  ? 259 GLN B C   1 
ATOM   4549  O O   . GLN B 1 258 ? -11.265 -63.835  -70.786 1.00 40.60  ? 259 GLN B O   1 
ATOM   4550  C CB  . GLN B 1 258 ? -8.911  -65.976  -70.589 1.00 44.08  ? 259 GLN B CB  1 
ATOM   4551  C CG  . GLN B 1 258 ? -7.717  -65.285  -71.209 1.00 45.37  ? 259 GLN B CG  1 
ATOM   4552  C CD  . GLN B 1 258 ? -7.513  -65.704  -72.653 1.00 47.95  ? 259 GLN B CD  1 
ATOM   4553  O OE1 . GLN B 1 258 ? -8.008  -65.054  -73.571 1.00 48.37  ? 259 GLN B OE1 1 
ATOM   4554  N NE2 . GLN B 1 258 ? -6.794  -66.801  -72.859 1.00 49.51  ? 259 GLN B NE2 1 
ATOM   4555  N N   . LEU B 1 259 ? -9.448  -62.760  -70.010 1.00 38.15  ? 260 LEU B N   1 
ATOM   4556  C CA  . LEU B 1 259 ? -9.911  -61.435  -70.416 1.00 37.47  ? 260 LEU B CA  1 
ATOM   4557  C C   . LEU B 1 259 ? -10.170 -61.330  -71.915 1.00 37.99  ? 260 LEU B C   1 
ATOM   4558  O O   . LEU B 1 259 ? -11.209 -60.829  -72.333 1.00 37.71  ? 260 LEU B O   1 
ATOM   4559  C CB  . LEU B 1 259 ? -8.903  -60.363  -70.002 1.00 36.99  ? 260 LEU B CB  1 
ATOM   4560  C CG  . LEU B 1 259 ? -9.372  -58.930  -70.255 1.00 36.29  ? 260 LEU B CG  1 
ATOM   4561  C CD1 . LEU B 1 259 ? -10.714 -58.695  -69.578 1.00 35.65  ? 260 LEU B CD1 1 
ATOM   4562  C CD2 . LEU B 1 259 ? -8.341  -57.914  -69.765 1.00 36.02  ? 260 LEU B CD2 1 
ATOM   4563  N N   . GLU B 1 260 ? -9.216  -61.795  -72.711 1.00 38.85  ? 261 GLU B N   1 
ATOM   4564  C CA  . GLU B 1 260 ? -9.349  -61.742  -74.164 1.00 39.57  ? 261 GLU B CA  1 
ATOM   4565  C C   . GLU B 1 260 ? -10.538 -62.582  -74.625 1.00 40.11  ? 261 GLU B C   1 
ATOM   4566  O O   . GLU B 1 260 ? -11.307 -62.155  -75.484 1.00 40.21  ? 261 GLU B O   1 
ATOM   4567  C CB  . GLU B 1 260 ? -8.056  -62.208  -74.842 1.00 40.61  ? 261 GLU B CB  1 
ATOM   4568  C CG  . GLU B 1 260 ? -6.895  -61.217  -74.733 1.00 40.38  ? 261 GLU B CG  1 
ATOM   4569  C CD  . GLU B 1 260 ? -6.406  -61.011  -73.295 1.00 44.05  ? 261 GLU B CD  1 
ATOM   4570  O OE1 . GLU B 1 260 ? -6.331  -62.004  -72.537 1.00 39.75  ? 261 GLU B OE1 1 
ATOM   4571  O OE2 . GLU B 1 260 ? -6.105  -59.853  -72.928 1.00 39.00  ? 261 GLU B OE2 1 
ATOM   4572  N N   . GLU B 1 261 ? -10.704 -63.762  -74.031 1.00 40.55  ? 262 GLU B N   1 
ATOM   4573  C CA  . GLU B 1 261 ? -11.817 -64.645  -74.376 1.00 43.27  ? 262 GLU B CA  1 
ATOM   4574  C C   . GLU B 1 261 ? -13.161 -64.030  -73.995 1.00 41.92  ? 262 GLU B C   1 
ATOM   4575  O O   . GLU B 1 261 ? -14.150 -64.175  -74.718 1.00 41.05  ? 262 GLU B O   1 
ATOM   4576  C CB  . GLU B 1 261 ? -11.643 -66.013  -73.707 1.00 46.56  ? 262 GLU B CB  1 
ATOM   4577  C CG  . GLU B 1 261 ? -10.545 -66.858  -74.346 1.00 50.06  ? 262 GLU B CG  1 
ATOM   4578  C CD  . GLU B 1 261 ? -10.332 -68.198  -73.660 1.00 52.57  ? 262 GLU B CD  1 
ATOM   4579  O OE1 . GLU B 1 261 ? -10.817 -68.378  -72.524 1.00 52.00  ? 262 GLU B OE1 1 
ATOM   4580  O OE2 . GLU B 1 261 ? -9.682  -69.077  -74.269 1.00 54.50  ? 262 GLU B OE2 1 
ATOM   4581  N N   . LEU B 1 262 ? -13.184 -63.329  -72.866 1.00 39.40  ? 263 LEU B N   1 
ATOM   4582  C CA  . LEU B 1 262 ? -14.383 -62.627  -72.418 1.00 43.47  ? 263 LEU B CA  1 
ATOM   4583  C C   . LEU B 1 262 ? -14.846 -61.572  -73.425 1.00 43.53  ? 263 LEU B C   1 
ATOM   4584  O O   . LEU B 1 262 ? -16.036 -61.457  -73.716 1.00 41.12  ? 263 LEU B O   1 
ATOM   4585  C CB  . LEU B 1 262 ? -14.136 -61.957  -71.065 1.00 37.66  ? 263 LEU B CB  1 
ATOM   4586  C CG  . LEU B 1 262 ? -15.203 -60.946  -70.643 1.00 36.87  ? 263 LEU B CG  1 
ATOM   4587  C CD1 . LEU B 1 262 ? -16.516 -61.644  -70.317 1.00 37.34  ? 263 LEU B CD1 1 
ATOM   4588  C CD2 . LEU B 1 262 ? -14.724 -60.111  -69.463 1.00 35.98  ? 263 LEU B CD2 1 
ATOM   4589  N N   . GLU B 1 263 ? -13.898 -60.798  -73.941 1.00 46.06  ? 264 GLU B N   1 
ATOM   4590  C CA  . GLU B 1 263 ? -14.217 -59.663  -74.803 1.00 49.07  ? 264 GLU B CA  1 
ATOM   4591  C C   . GLU B 1 263 ? -14.807 -60.104  -76.133 1.00 49.28  ? 264 GLU B C   1 
ATOM   4592  O O   . GLU B 1 263 ? -15.413 -59.303  -76.844 1.00 50.20  ? 264 GLU B O   1 
ATOM   4593  C CB  . GLU B 1 263 ? -12.972 -58.812  -75.044 1.00 52.74  ? 264 GLU B CB  1 
ATOM   4594  C CG  . GLU B 1 263 ? -13.048 -57.434  -74.422 1.00 55.99  ? 264 GLU B CG  1 
ATOM   4595  C CD  . GLU B 1 263 ? -11.690 -56.932  -73.976 1.00 60.16  ? 264 GLU B CD  1 
ATOM   4596  O OE1 . GLU B 1 263 ? -10.723 -57.055  -74.757 1.00 63.42  ? 264 GLU B OE1 1 
ATOM   4597  O OE2 . GLU B 1 263 ? -11.587 -56.423  -72.840 1.00 60.11  ? 264 GLU B OE2 1 
ATOM   4598  N N   . ALA B 1 264 ? -14.627 -61.379  -76.459 1.00 49.55  ? 265 ALA B N   1 
ATOM   4599  C CA  . ALA B 1 264 ? -15.196 -61.952  -77.667 1.00 50.52  ? 265 ALA B CA  1 
ATOM   4600  C C   . ALA B 1 264 ? -16.480 -62.718  -77.357 1.00 50.89  ? 265 ALA B C   1 
ATOM   4601  O O   . ALA B 1 264 ? -17.007 -63.429  -78.213 1.00 53.41  ? 265 ALA B O   1 
ATOM   4602  C CB  . ALA B 1 264 ? -14.185 -62.865  -78.345 1.00 51.98  ? 265 ALA B CB  1 
ATOM   4603  N N   . ALA B 1 265 ? -16.986 -62.566  -76.136 1.00 48.06  ? 266 ALA B N   1 
ATOM   4604  C CA  . ALA B 1 265 ? -18.169 -63.309  -75.708 1.00 46.68  ? 266 ALA B CA  1 
ATOM   4605  C C   . ALA B 1 265 ? -19.360 -62.398  -75.413 1.00 44.04  ? 266 ALA B C   1 
ATOM   4606  O O   . ALA B 1 265 ? -20.259 -62.771  -74.661 1.00 42.42  ? 266 ALA B O   1 
ATOM   4607  C CB  . ALA B 1 265 ? -17.842 -64.156  -74.488 1.00 46.48  ? 266 ALA B CB  1 
ATOM   4608  N N   . ARG B 1 266 ? -19.370 -61.218  -76.023 1.00 44.58  ? 267 ARG B N   1 
ATOM   4609  C CA  . ARG B 1 266 ? -20.423 -60.231  -75.796 1.00 44.85  ? 267 ARG B CA  1 
ATOM   4610  C C   . ARG B 1 266 ? -21.835 -60.745  -76.095 1.00 42.97  ? 267 ARG B C   1 
ATOM   4611  O O   . ARG B 1 266 ? -22.797 -60.334  -75.443 1.00 41.46  ? 267 ARG B O   1 
ATOM   4612  C CB  . ARG B 1 266 ? -20.155 -58.976  -76.633 1.00 47.60  ? 267 ARG B CB  1 
ATOM   4613  C CG  . ARG B 1 266 ? -19.120 -58.034  -76.029 1.00 49.09  ? 267 ARG B CG  1 
ATOM   4614  C CD  . ARG B 1 266 ? -18.910 -56.809  -76.909 1.00 51.30  ? 267 ARG B CD  1 
ATOM   4615  N NE  . ARG B 1 266 ? -17.932 -55.882  -76.345 1.00 52.47  ? 267 ARG B NE  1 
ATOM   4616  C CZ  . ARG B 1 266 ? -18.231 -54.909  -75.490 1.00 53.51  ? 267 ARG B CZ  1 
ATOM   4617  N NH1 . ARG B 1 266 ? -19.484 -54.732  -75.090 1.00 54.15  ? 267 ARG B NH1 1 
ATOM   4618  N NH2 . ARG B 1 266 ? -17.275 -54.112  -75.032 1.00 53.74  ? 267 ARG B NH2 1 
ATOM   4619  N N   . ASP B 1 267 ? -21.971 -61.641  -77.068 1.00 41.95  ? 268 ASP B N   1 
ATOM   4620  C CA  . ASP B 1 267 ? -23.299 -62.128  -77.427 1.00 42.86  ? 268 ASP B CA  1 
ATOM   4621  C C   . ASP B 1 267 ? -23.782 -63.242  -76.500 1.00 44.29  ? 268 ASP B C   1 
ATOM   4622  O O   . ASP B 1 267 ? -24.926 -63.677  -76.592 1.00 46.14  ? 268 ASP B O   1 
ATOM   4623  C CB  . ASP B 1 267 ? -23.323 -62.603  -78.882 1.00 44.49  ? 268 ASP B CB  1 
ATOM   4624  C CG  . ASP B 1 267 ? -23.238 -61.452  -79.867 1.00 43.96  ? 268 ASP B CG  1 
ATOM   4625  O OD1 . ASP B 1 267 ? -24.226 -60.694  -79.982 1.00 43.37  ? 268 ASP B OD1 1 
ATOM   4626  O OD2 . ASP B 1 267 ? -22.184 -61.302  -80.519 1.00 44.35  ? 268 ASP B OD2 1 
ATOM   4627  N N   . LEU B 1 268 ? -22.916 -63.694  -75.598 1.00 43.76  ? 269 LEU B N   1 
ATOM   4628  C CA  . LEU B 1 268 ? -23.297 -64.726  -74.640 1.00 43.90  ? 269 LEU B CA  1 
ATOM   4629  C C   . LEU B 1 268 ? -23.938 -64.146  -73.383 1.00 42.87  ? 269 LEU B C   1 
ATOM   4630  O O   . LEU B 1 268 ? -24.699 -64.829  -72.703 1.00 43.95  ? 269 LEU B O   1 
ATOM   4631  C CB  . LEU B 1 268 ? -22.082 -65.568  -74.243 1.00 45.21  ? 269 LEU B CB  1 
ATOM   4632  C CG  . LEU B 1 268 ? -21.455 -66.481  -75.299 1.00 47.35  ? 269 LEU B CG  1 
ATOM   4633  C CD1 . LEU B 1 268 ? -20.290 -67.249  -74.688 1.00 48.82  ? 269 LEU B CD1 1 
ATOM   4634  C CD2 . LEU B 1 268 ? -22.488 -67.434  -75.876 1.00 47.59  ? 269 LEU B CD2 1 
ATOM   4635  N N   . VAL B 1 269 ? -23.629 -62.891  -73.070 1.00 41.49  ? 270 VAL B N   1 
ATOM   4636  C CA  . VAL B 1 269 ? -24.024 -62.321  -71.780 1.00 41.21  ? 270 VAL B CA  1 
ATOM   4637  C C   . VAL B 1 269 ? -24.679 -60.946  -71.888 1.00 41.98  ? 270 VAL B C   1 
ATOM   4638  O O   . VAL B 1 269 ? -24.537 -60.255  -72.896 1.00 41.76  ? 270 VAL B O   1 
ATOM   4639  C CB  . VAL B 1 269 ? -22.812 -62.193  -70.836 1.00 40.23  ? 270 VAL B CB  1 
ATOM   4640  C CG1 . VAL B 1 269 ? -22.162 -63.548  -70.616 1.00 40.49  ? 270 VAL B CG1 1 
ATOM   4641  C CG2 . VAL B 1 269 ? -21.807 -61.199  -71.395 1.00 38.59  ? 270 VAL B CG2 1 
ATOM   4642  N N   . SER B 1 270 ? -25.384 -60.552  -70.829 1.00 42.73  ? 271 SER B N   1 
ATOM   4643  C CA  . SER B 1 270 ? -26.012 -59.235  -70.767 1.00 43.66  ? 271 SER B CA  1 
ATOM   4644  C C   . SER B 1 270 ? -24.971 -58.124  -70.882 1.00 40.64  ? 271 SER B C   1 
ATOM   4645  O O   . SER B 1 270 ? -23.790 -58.342  -70.612 1.00 41.26  ? 271 SER B O   1 
ATOM   4646  C CB  . SER B 1 270 ? -26.801 -59.072  -69.464 1.00 45.89  ? 271 SER B CB  1 
ATOM   4647  O OG  . SER B 1 270 ? -25.934 -58.959  -68.345 1.00 46.36  ? 271 SER B OG  1 
ATOM   4648  N N   . LYS B 1 271 ? -25.416 -56.938  -71.285 1.00 40.67  ? 272 LYS B N   1 
ATOM   4649  C CA  . LYS B 1 271 ? -24.534 -55.782  -71.384 1.00 40.40  ? 272 LYS B CA  1 
ATOM   4650  C C   . LYS B 1 271 ? -23.945 -55.409  -70.020 1.00 40.11  ? 272 LYS B C   1 
ATOM   4651  O O   . LYS B 1 271 ? -22.742 -55.172  -69.897 1.00 38.16  ? 272 LYS B O   1 
ATOM   4652  C CB  . LYS B 1 271 ? -25.285 -54.590  -71.980 1.00 42.69  ? 272 LYS B CB  1 
ATOM   4653  N N   . GLU B 1 272 ? -24.793 -55.373  -68.998 1.00 42.04  ? 273 GLU B N   1 
ATOM   4654  C CA  . GLU B 1 272 ? -24.332 -55.066  -67.649 1.00 44.60  ? 273 GLU B CA  1 
ATOM   4655  C C   . GLU B 1 272 ? -23.417 -56.172  -67.137 1.00 42.46  ? 273 GLU B C   1 
ATOM   4656  O O   . GLU B 1 272 ? -22.368 -55.897  -66.555 1.00 42.50  ? 273 GLU B O   1 
ATOM   4657  C CB  . GLU B 1 272 ? -25.519 -54.872  -66.704 1.00 49.77  ? 273 GLU B CB  1 
ATOM   4658  C CG  . GLU B 1 272 ? -25.131 -54.543  -65.270 1.00 53.28  ? 273 GLU B CG  1 
ATOM   4659  C CD  . GLU B 1 272 ? -26.297 -53.995  -64.468 1.00 57.05  ? 273 GLU B CD  1 
ATOM   4660  O OE1 . GLU B 1 272 ? -26.501 -52.761  -64.474 1.00 58.53  ? 273 GLU B OE1 1 
ATOM   4661  O OE2 . GLU B 1 272 ? -27.017 -54.802  -63.844 1.00 58.52  ? 273 GLU B OE2 1 
ATOM   4662  N N   . GLY B 1 273 ? -23.811 -57.421  -67.374 1.00 40.84  ? 274 GLY B N   1 
ATOM   4663  C CA  . GLY B 1 273 ? -23.033 -58.568  -66.938 1.00 38.32  ? 274 GLY B CA  1 
ATOM   4664  C C   . GLY B 1 273 ? -21.623 -58.597  -67.501 1.00 37.22  ? 274 GLY B C   1 
ATOM   4665  O O   . GLY B 1 273 ? -20.672 -58.972  -66.810 1.00 37.08  ? 274 GLY B O   1 
ATOM   4666  N N   . PHE B 1 274 ? -21.491 -58.192  -68.760 1.00 37.64  ? 275 PHE B N   1 
ATOM   4667  C CA  . PHE B 1 274 ? -20.199 -58.145  -69.438 1.00 36.99  ? 275 PHE B CA  1 
ATOM   4668  C C   . PHE B 1 274 ? -19.255 -57.144  -68.780 1.00 36.68  ? 275 PHE B C   1 
ATOM   4669  O O   . PHE B 1 274 ? -18.068 -57.415  -68.603 1.00 36.34  ? 275 PHE B O   1 
ATOM   4670  C CB  . PHE B 1 274 ? -20.392 -57.787  -70.917 1.00 36.23  ? 275 PHE B CB  1 
ATOM   4671  C CG  . PHE B 1 274 ? -19.106 -57.602  -71.673 1.00 35.94  ? 275 PHE B CG  1 
ATOM   4672  C CD1 . PHE B 1 274 ? -18.475 -58.682  -72.267 1.00 48.04  ? 275 PHE B CD1 1 
ATOM   4673  C CD2 . PHE B 1 274 ? -18.532 -56.345  -71.800 1.00 43.01  ? 275 PHE B CD2 1 
ATOM   4674  C CE1 . PHE B 1 274 ? -17.288 -58.515  -72.970 1.00 47.04  ? 275 PHE B CE1 1 
ATOM   4675  C CE2 . PHE B 1 274 ? -17.347 -56.169  -72.498 1.00 43.42  ? 275 PHE B CE2 1 
ATOM   4676  C CZ  . PHE B 1 274 ? -16.725 -57.252  -73.082 1.00 45.21  ? 275 PHE B CZ  1 
ATOM   4677  N N   . ARG B 1 275 ? -19.791 -55.980  -68.439 1.00 35.08  ? 276 ARG B N   1 
ATOM   4678  C CA  . ARG B 1 275 ? -18.999 -54.924  -67.830 1.00 39.94  ? 276 ARG B CA  1 
ATOM   4679  C C   . ARG B 1 275 ? -18.568 -55.307  -66.412 1.00 37.90  ? 276 ARG B C   1 
ATOM   4680  O O   . ARG B 1 275 ? -17.450 -55.006  -65.992 1.00 35.54  ? 276 ARG B O   1 
ATOM   4681  C CB  . ARG B 1 275 ? -19.790 -53.614  -67.828 1.00 41.27  ? 276 ARG B CB  1 
ATOM   4682  C CG  . ARG B 1 275 ? -20.038 -53.054  -69.230 1.00 42.28  ? 276 ARG B CG  1 
ATOM   4683  C CD  . ARG B 1 275 ? -21.143 -52.005  -69.251 1.00 44.03  ? 276 ARG B CD  1 
ATOM   4684  N NE  . ARG B 1 275 ? -21.012 -51.064  -68.148 1.00 44.94  ? 276 ARG B NE  1 
ATOM   4685  C CZ  . ARG B 1 275 ? -21.988 -50.777  -67.292 1.00 47.21  ? 276 ARG B CZ  1 
ATOM   4686  N NH1 . ARG B 1 275 ? -23.181 -51.345  -67.428 1.00 47.37  ? 276 ARG B NH1 1 
ATOM   4687  N NH2 . ARG B 1 275 ? -21.773 -49.918  -66.304 1.00 48.04  ? 276 ARG B NH2 1 
ATOM   4688  N N   . ARG B 1 276 ? -19.452 -55.986  -65.684 1.00 38.88  ? 277 ARG B N   1 
ATOM   4689  C CA  . ARG B 1 276 ? -19.115 -56.487  -64.352 1.00 38.02  ? 277 ARG B CA  1 
ATOM   4690  C C   . ARG B 1 276 ? -17.981 -57.497  -64.446 1.00 36.76  ? 277 ARG B C   1 
ATOM   4691  O O   . ARG B 1 276 ? -17.011 -57.433  -63.691 1.00 36.49  ? 277 ARG B O   1 
ATOM   4692  C CB  . ARG B 1 276 ? -20.331 -57.132  -63.684 1.00 39.78  ? 277 ARG B CB  1 
ATOM   4693  C CG  . ARG B 1 276 ? -21.539 -56.219  -63.531 1.00 42.23  ? 277 ARG B CG  1 
ATOM   4694  C CD  . ARG B 1 276 ? -21.236 -55.017  -62.660 1.00 42.57  ? 277 ARG B CD  1 
ATOM   4695  N NE  . ARG B 1 276 ? -22.449 -54.273  -62.323 1.00 43.81  ? 277 ARG B NE  1 
ATOM   4696  C CZ  . ARG B 1 276 ? -22.762 -53.079  -62.818 1.00 43.85  ? 277 ARG B CZ  1 
ATOM   4697  N NH1 . ARG B 1 276 ? -21.946 -52.474  -63.670 1.00 42.15  ? 277 ARG B NH1 1 
ATOM   4698  N NH2 . ARG B 1 276 ? -23.888 -52.483  -62.447 1.00 45.37  ? 277 ARG B NH2 1 
ATOM   4699  N N   . ALA B 1 277 ? -18.105 -58.424  -65.391 1.00 36.40  ? 278 ALA B N   1 
ATOM   4700  C CA  . ALA B 1 277 ? -17.110 -59.475  -65.567 1.00 35.04  ? 278 ALA B CA  1 
ATOM   4701  C C   . ALA B 1 277 ? -15.790 -58.903  -66.068 1.00 34.74  ? 278 ALA B C   1 
ATOM   4702  O O   . ALA B 1 277 ? -14.721 -59.403  -65.724 1.00 35.10  ? 278 ALA B O   1 
ATOM   4703  C CB  . ALA B 1 277 ? -17.626 -60.544  -66.524 1.00 34.51  ? 278 ALA B CB  1 
ATOM   4704  N N   . ARG B 1 278 ? -15.864 -57.855  -66.882 1.00 34.38  ? 279 ARG B N   1 
ATOM   4705  C CA  . ARG B 1 278 ? -14.656 -57.215  -67.392 1.00 33.82  ? 279 ARG B CA  1 
ATOM   4706  C C   . ARG B 1 278 ? -13.873 -56.566  -66.254 1.00 33.81  ? 279 ARG B C   1 
ATOM   4707  O O   . ARG B 1 278 ? -12.644 -56.665  -66.199 1.00 34.86  ? 279 ARG B O   1 
ATOM   4708  C CB  . ARG B 1 278 ? -14.993 -56.176  -68.464 1.00 33.28  ? 279 ARG B CB  1 
ATOM   4709  C CG  . ARG B 1 278 ? -13.759 -55.527  -69.085 1.00 33.34  ? 279 ARG B CG  1 
ATOM   4710  C CD  . ARG B 1 278 ? -14.115 -54.708  -70.323 1.00 34.06  ? 279 ARG B CD  1 
ATOM   4711  N NE  . ARG B 1 278 ? -15.074 -53.649  -70.025 1.00 34.29  ? 279 ARG B NE  1 
ATOM   4712  C CZ  . ARG B 1 278 ? -15.654 -52.884  -70.945 1.00 35.73  ? 279 ARG B CZ  1 
ATOM   4713  N NH1 . ARG B 1 278 ? -15.378 -53.063  -72.233 1.00 35.56  ? 279 ARG B NH1 1 
ATOM   4714  N NH2 . ARG B 1 278 ? -16.520 -51.948  -70.578 1.00 35.36  ? 279 ARG B NH2 1 
ATOM   4715  N N   . HIS B 1 279 ? -14.575 -55.904  -65.344 1.00 33.30  ? 280 HIS B N   1 
ATOM   4716  C CA  . HIS B 1 279 ? -13.891 -55.377  -64.172 1.00 33.71  ? 280 HIS B CA  1 
ATOM   4717  C C   . HIS B 1 279 ? -13.190 -56.489  -63.404 1.00 32.83  ? 280 HIS B C   1 
ATOM   4718  O O   . HIS B 1 279 ? -11.986 -56.417  -63.152 1.00 33.49  ? 280 HIS B O   1 
ATOM   4719  C CB  . HIS B 1 279 ? -14.832 -54.665  -63.212 1.00 33.74  ? 280 HIS B CB  1 
ATOM   4720  C CG  . HIS B 1 279 ? -14.250 -54.546  -61.841 1.00 34.75  ? 280 HIS B CG  1 
ATOM   4721  N ND1 . HIS B 1 279 ? -13.218 -53.682  -61.551 1.00 34.89  ? 280 HIS B ND1 1 
ATOM   4722  C CD2 . HIS B 1 279 ? -14.482 -55.252  -60.709 1.00 33.52  ? 280 HIS B CD2 1 
ATOM   4723  C CE1 . HIS B 1 279 ? -12.866 -53.830  -60.286 1.00 32.52  ? 280 HIS B CE1 1 
ATOM   4724  N NE2 . HIS B 1 279 ? -13.620 -54.774  -59.753 1.00 32.85  ? 280 HIS B NE2 1 
ATOM   4725  N N   . VAL B 1 280 ? -13.953 -57.515  -63.037 1.00 32.44  ? 281 VAL B N   1 
ATOM   4726  C CA  . VAL B 1 280 ? -13.439 -58.594  -62.194 1.00 33.02  ? 281 VAL B CA  1 
ATOM   4727  C C   . VAL B 1 280 ? -12.248 -59.308  -62.830 1.00 34.15  ? 281 VAL B C   1 
ATOM   4728  O O   . VAL B 1 280 ? -11.214 -59.492  -62.182 1.00 33.70  ? 281 VAL B O   1 
ATOM   4729  C CB  . VAL B 1 280 ? -14.537 -59.630  -61.875 1.00 33.82  ? 281 VAL B CB  1 
ATOM   4730  C CG1 . VAL B 1 280 ? -13.950 -60.817  -61.116 1.00 34.70  ? 281 VAL B CG1 1 
ATOM   4731  C CG2 . VAL B 1 280 ? -15.660 -58.982  -61.067 1.00 33.53  ? 281 VAL B CG2 1 
ATOM   4732  N N   . VAL B 1 281 ? -12.387 -59.696  -64.098 1.00 31.43  ? 282 VAL B N   1 
ATOM   4733  C CA  . VAL B 1 281 ? -11.326 -60.425  -64.784 1.00 31.67  ? 282 VAL B CA  1 
ATOM   4734  C C   . VAL B 1 281 ? -10.100 -59.541  -64.984 1.00 31.59  ? 282 VAL B C   1 
ATOM   4735  O O   . VAL B 1 281 ? -8.969  -59.990  -64.812 1.00 34.89  ? 282 VAL B O   1 
ATOM   4736  C CB  . VAL B 1 281 ? -11.803 -60.980  -66.152 1.00 33.56  ? 282 VAL B CB  1 
ATOM   4737  C CG1 . VAL B 1 281 ? -10.639 -61.568  -66.928 1.00 32.71  ? 282 VAL B CG1 1 
ATOM   4738  C CG2 . VAL B 1 281 ? -12.877 -62.038  -65.943 1.00 34.45  ? 282 VAL B CG2 1 
ATOM   4739  N N   . GLY B 1 282 ? -10.326 -58.280  -65.336 1.00 31.58  ? 283 GLY B N   1 
ATOM   4740  C CA  . GLY B 1 282 ? -9.238  -57.325  -65.455 1.00 32.24  ? 283 GLY B CA  1 
ATOM   4741  C C   . GLY B 1 282 ? -8.586  -57.015  -64.109 1.00 31.19  ? 283 GLY B C   1 
ATOM   4742  O O   . GLY B 1 282 ? -7.368  -56.857  -64.022 1.00 31.33  ? 283 GLY B O   1 
ATOM   4743  N N   . GLU B 1 283 ? -9.389  -56.943  -63.053 1.00 30.79  ? 284 GLU B N   1 
ATOM   4744  C CA  . GLU B 1 283 ? -8.856  -56.608  -61.728 1.00 37.36  ? 284 GLU B CA  1 
ATOM   4745  C C   . GLU B 1 283 ? -7.935  -57.711  -61.204 1.00 36.83  ? 284 GLU B C   1 
ATOM   4746  O O   . GLU B 1 283 ? -6.882  -57.422  -60.635 1.00 37.77  ? 284 GLU B O   1 
ATOM   4747  C CB  . GLU B 1 283 ? -9.988  -56.345  -60.733 1.00 30.18  ? 284 GLU B CB  1 
ATOM   4748  C CG  . GLU B 1 283 ? -9.521  -55.873  -59.358 1.00 34.41  ? 284 GLU B CG  1 
ATOM   4749  C CD  . GLU B 1 283 ? -9.207  -54.387  -59.296 1.00 34.57  ? 284 GLU B CD  1 
ATOM   4750  O OE1 . GLU B 1 283 ? -9.088  -53.746  -60.367 1.00 35.24  ? 284 GLU B OE1 1 
ATOM   4751  O OE2 . GLU B 1 283 ? -9.088  -53.859  -58.165 1.00 34.38  ? 284 GLU B OE2 1 
ATOM   4752  N N   . ILE B 1 284 ? -8.331  -58.967  -61.405 1.00 34.92  ? 285 ILE B N   1 
ATOM   4753  C CA  . ILE B 1 284 ? -7.500  -60.115  -61.042 1.00 35.09  ? 285 ILE B CA  1 
ATOM   4754  C C   . ILE B 1 284 ? -6.133  -60.034  -61.716 1.00 34.29  ? 285 ILE B C   1 
ATOM   4755  O O   . ILE B 1 284 ? -5.093  -60.249  -61.085 1.00 33.94  ? 285 ILE B O   1 
ATOM   4756  C CB  . ILE B 1 284 ? -8.179  -61.446  -61.429 1.00 36.82  ? 285 ILE B CB  1 
ATOM   4757  C CG1 . ILE B 1 284 ? -9.415  -61.688  -60.558 1.00 37.93  ? 285 ILE B CG1 1 
ATOM   4758  C CG2 . ILE B 1 284 ? -7.201  -62.609  -61.294 1.00 37.22  ? 285 ILE B CG2 1 
ATOM   4759  C CD1 . ILE B 1 284 ? -10.194 -62.933  -60.945 1.00 38.95  ? 285 ILE B CD1 1 
ATOM   4760  N N   . ARG B 1 285 ? -6.148  -59.712  -63.004 1.00 34.18  ? 286 ARG B N   1 
ATOM   4761  C CA  . ARG B 1 285 ? -4.924  -59.522  -63.769 1.00 33.74  ? 286 ARG B CA  1 
ATOM   4762  C C   . ARG B 1 285 ? -4.121  -58.346  -63.218 1.00 32.66  ? 286 ARG B C   1 
ATOM   4763  O O   . ARG B 1 285 ? -2.904  -58.436  -63.053 1.00 33.33  ? 286 ARG B O   1 
ATOM   4764  C CB  . ARG B 1 285 ? -5.251  -59.295  -65.255 1.00 32.52  ? 286 ARG B CB  1 
ATOM   4765  C CG  . ARG B 1 285 ? -4.033  -59.132  -66.157 1.00 33.84  ? 286 ARG B CG  1 
ATOM   4766  C CD  . ARG B 1 285 ? -4.427  -59.045  -67.643 1.00 34.75  ? 286 ARG B CD  1 
ATOM   4767  N NE  . ARG B 1 285 ? -4.782  -60.346  -68.212 1.00 36.50  ? 286 ARG B NE  1 
ATOM   4768  C CZ  . ARG B 1 285 ? -5.186  -60.534  -69.472 1.00 37.49  ? 286 ARG B CZ  1 
ATOM   4769  N NH1 . ARG B 1 285 ? -5.289  -59.505  -70.307 1.00 35.10  ? 286 ARG B NH1 1 
ATOM   4770  N NH2 . ARG B 1 285 ? -5.487  -61.755  -69.900 1.00 37.70  ? 286 ARG B NH2 1 
ATOM   4771  N N   . ARG B 1 286 ? -4.806  -57.241  -62.938 1.00 32.20  ? 287 ARG B N   1 
ATOM   4772  C CA  . ARG B 1 286 ? -4.134  -56.045  -62.438 1.00 32.55  ? 287 ARG B CA  1 
ATOM   4773  C C   . ARG B 1 286 ? -3.459  -56.318  -61.096 1.00 32.81  ? 287 ARG B C   1 
ATOM   4774  O O   . ARG B 1 286 ? -2.378  -55.796  -60.820 1.00 34.41  ? 287 ARG B O   1 
ATOM   4775  C CB  . ARG B 1 286 ? -5.119  -54.875  -62.306 1.00 32.20  ? 287 ARG B CB  1 
ATOM   4776  C CG  . ARG B 1 286 ? -5.483  -54.186  -63.628 1.00 33.82  ? 287 ARG B CG  1 
ATOM   4777  C CD  . ARG B 1 286 ? -6.311  -52.916  -63.390 1.00 32.81  ? 287 ARG B CD  1 
ATOM   4778  N NE  . ARG B 1 286 ? -7.654  -53.218  -62.900 1.00 31.98  ? 287 ARG B NE  1 
ATOM   4779  C CZ  . ARG B 1 286 ? -8.695  -53.462  -63.690 1.00 32.34  ? 287 ARG B CZ  1 
ATOM   4780  N NH1 . ARG B 1 286 ? -8.545  -53.433  -65.009 1.00 32.51  ? 287 ARG B NH1 1 
ATOM   4781  N NH2 . ARG B 1 286 ? -9.883  -53.735  -63.166 1.00 31.09  ? 287 ARG B NH2 1 
ATOM   4782  N N   . THR B 1 287 ? -4.093  -57.148  -60.275 1.00 33.04  ? 288 THR B N   1 
ATOM   4783  C CA  . THR B 1 287 ? -3.596  -57.436  -58.924 1.00 32.90  ? 288 THR B CA  1 
ATOM   4784  C C   . THR B 1 287 ? -2.338  -58.303  -58.957 1.00 33.73  ? 288 THR B C   1 
ATOM   4785  O O   . THR B 1 287 ? -1.413  -58.098  -58.167 1.00 34.96  ? 288 THR B O   1 
ATOM   4786  C CB  . THR B 1 287 ? -4.676  -58.123  -58.074 1.00 33.74  ? 288 THR B CB  1 
ATOM   4787  O OG1 . THR B 1 287 ? -5.831  -57.280  -58.014 1.00 35.41  ? 288 THR B OG1 1 
ATOM   4788  C CG2 . THR B 1 287 ? -4.179  -58.383  -56.642 1.00 35.43  ? 288 THR B CG2 1 
ATOM   4789  N N   . ALA B 1 288 ? -2.299  -59.266  -59.877 1.00 33.90  ? 289 ALA B N   1 
ATOM   4790  C CA  . ALA B 1 288 ? -1.095  -60.062  -60.076 1.00 34.11  ? 289 ALA B CA  1 
ATOM   4791  C C   . ALA B 1 288 ? 0.044   -59.154  -60.519 1.00 35.19  ? 289 ALA B C   1 
ATOM   4792  O O   . ALA B 1 288 ? 1.160   -59.244  -60.007 1.00 36.12  ? 289 ALA B O   1 
ATOM   4793  C CB  . ALA B 1 288 ? -1.334  -61.166  -61.099 1.00 32.94  ? 289 ALA B CB  1 
ATOM   4794  N N   . GLN B 1 289 ? -0.254  -58.262  -61.458 1.00 33.11  ? 290 GLN B N   1 
ATOM   4795  C CA  . GLN B 1 289 ? 0.734   -57.326  -61.980 1.00 34.78  ? 290 GLN B CA  1 
ATOM   4796  C C   . GLN B 1 289 ? 1.162   -56.314  -60.913 1.00 35.63  ? 290 GLN B C   1 
ATOM   4797  O O   . GLN B 1 289 ? 2.316   -55.880  -60.881 1.00 34.43  ? 290 GLN B O   1 
ATOM   4798  C CB  . GLN B 1 289 ? 0.178   -56.596  -63.207 1.00 33.97  ? 290 GLN B CB  1 
ATOM   4799  C CG  . GLN B 1 289 ? -0.087  -57.498  -64.413 1.00 34.98  ? 290 GLN B CG  1 
ATOM   4800  C CD  . GLN B 1 289 ? -0.745  -56.752  -65.563 1.00 36.14  ? 290 GLN B CD  1 
ATOM   4801  O OE1 . GLN B 1 289 ? -1.184  -55.613  -65.407 1.00 37.38  ? 290 GLN B OE1 1 
ATOM   4802  N NE2 . GLN B 1 289 ? -0.813  -57.390  -66.725 1.00 36.43  ? 290 GLN B NE2 1 
ATOM   4803  N N   . ALA B 1 290 ? 0.226   -55.943  -60.046 1.00 34.09  ? 291 ALA B N   1 
ATOM   4804  C CA  . ALA B 1 290 ? 0.509   -54.994  -58.970 1.00 34.27  ? 291 ALA B CA  1 
ATOM   4805  C C   . ALA B 1 290 ? 1.466   -55.579  -57.937 1.00 35.74  ? 291 ALA B C   1 
ATOM   4806  O O   . ALA B 1 290 ? 2.368   -54.892  -57.459 1.00 36.88  ? 291 ALA B O   1 
ATOM   4807  C CB  . ALA B 1 290 ? -0.781  -54.554  -58.300 1.00 32.61  ? 291 ALA B CB  1 
ATOM   4808  N N   . ALA B 1 291 ? 1.264   -56.846  -57.592 1.00 36.19  ? 292 ALA B N   1 
ATOM   4809  C CA  . ALA B 1 291 ? 2.140   -57.515  -56.638 1.00 37.89  ? 292 ALA B CA  1 
ATOM   4810  C C   . ALA B 1 291 ? 3.544   -57.631  -57.216 1.00 39.32  ? 292 ALA B C   1 
ATOM   4811  O O   . ALA B 1 291 ? 4.530   -57.452  -56.504 1.00 38.65  ? 292 ALA B O   1 
ATOM   4812  C CB  . ALA B 1 291 ? 1.594   -58.886  -56.273 1.00 38.20  ? 292 ALA B CB  1 
ATOM   4813  N N   . ALA B 1 292 ? 3.623   -57.911  -58.516 1.00 39.94  ? 293 ALA B N   1 
ATOM   4814  C CA  . ALA B 1 292 ? 4.904   -58.021  -59.207 1.00 41.78  ? 293 ALA B CA  1 
ATOM   4815  C C   . ALA B 1 292 ? 5.639   -56.683  -59.218 1.00 42.21  ? 293 ALA B C   1 
ATOM   4816  O O   . ALA B 1 292 ? 6.863   -56.636  -59.091 1.00 43.27  ? 293 ALA B O   1 
ATOM   4817  C CB  . ALA B 1 292 ? 4.702   -58.530  -60.637 1.00 42.89  ? 293 ALA B CB  1 
ATOM   4818  N N   . ALA B 1 293 ? 4.887   -55.597  -59.371 1.00 41.11  ? 294 ALA B N   1 
ATOM   4819  C CA  . ALA B 1 293 ? 5.463   -54.256  -59.343 1.00 42.30  ? 294 ALA B CA  1 
ATOM   4820  C C   . ALA B 1 293 ? 5.929   -53.886  -57.937 1.00 43.49  ? 294 ALA B C   1 
ATOM   4821  O O   . ALA B 1 293 ? 6.897   -53.144  -57.764 1.00 43.68  ? 294 ALA B O   1 
ATOM   4822  C CB  . ALA B 1 293 ? 4.458   -53.237  -59.848 1.00 41.86  ? 294 ALA B CB  1 
ATOM   4823  N N   . LEU B 1 294 ? 5.229   -54.400  -56.935 1.00 44.11  ? 295 LEU B N   1 
ATOM   4824  C CA  . LEU B 1 294 ? 5.583   -54.119  -55.551 1.00 47.71  ? 295 LEU B CA  1 
ATOM   4825  C C   . LEU B 1 294 ? 6.939   -54.737  -55.207 1.00 49.70  ? 295 LEU B C   1 
ATOM   4826  O O   . LEU B 1 294 ? 7.721   -54.160  -54.449 1.00 50.41  ? 295 LEU B O   1 
ATOM   4827  C CB  . LEU B 1 294 ? 4.499   -54.641  -54.605 1.00 47.98  ? 295 LEU B CB  1 
ATOM   4828  C CG  . LEU B 1 294 ? 4.282   -53.837  -53.328 1.00 50.62  ? 295 LEU B CG  1 
ATOM   4829  C CD1 . LEU B 1 294 ? 4.075   -52.369  -53.664 1.00 50.66  ? 295 LEU B CD1 1 
ATOM   4830  C CD2 . LEU B 1 294 ? 3.093   -54.386  -52.552 1.00 50.85  ? 295 LEU B CD2 1 
ATOM   4831  N N   . ARG B 1 295 ? 7.214   -55.902  -55.784 1.00 50.97  ? 296 ARG B N   1 
ATOM   4832  C CA  . ARG B 1 295 ? 8.441   -56.639  -55.499 1.00 54.15  ? 296 ARG B CA  1 
ATOM   4833  C C   . ARG B 1 295 ? 9.695   -55.936  -56.016 1.00 56.63  ? 296 ARG B C   1 
ATOM   4834  O O   . ARG B 1 295 ? 10.726  -55.934  -55.344 1.00 57.80  ? 296 ARG B O   1 
ATOM   4835  C CB  . ARG B 1 295 ? 8.357   -58.049  -56.089 1.00 55.59  ? 296 ARG B CB  1 
ATOM   4836  C CG  . ARG B 1 295 ? 7.238   -58.889  -55.496 1.00 55.38  ? 296 ARG B CG  1 
ATOM   4837  C CD  . ARG B 1 295 ? 7.314   -60.342  -55.943 1.00 55.79  ? 296 ARG B CD  1 
ATOM   4838  N NE  . ARG B 1 295 ? 6.304   -61.156  -55.272 1.00 54.51  ? 296 ARG B NE  1 
ATOM   4839  C CZ  . ARG B 1 295 ? 5.161   -61.548  -55.827 1.00 53.59  ? 296 ARG B CZ  1 
ATOM   4840  N NH1 . ARG B 1 295 ? 4.877   -61.215  -57.083 1.00 54.01  ? 296 ARG B NH1 1 
ATOM   4841  N NH2 . ARG B 1 295 ? 4.304   -62.281  -55.131 1.00 52.04  ? 296 ARG B NH2 1 
ATOM   4842  N N   . ARG B 1 296 ? 9.615   -55.347  -57.207 1.00 57.28  ? 297 ARG B N   1 
ATOM   4843  C CA  . ARG B 1 296 ? 10.760  -54.631  -57.767 1.00 59.21  ? 297 ARG B CA  1 
ATOM   4844  C C   . ARG B 1 296 ? 10.750  -53.157  -57.365 1.00 59.58  ? 297 ARG B C   1 
ATOM   4845  O O   . ARG B 1 296 ? 11.581  -52.375  -57.823 1.00 61.70  ? 297 ARG B O   1 
ATOM   4846  C CB  . ARG B 1 296 ? 10.795  -54.763  -59.292 1.00 60.31  ? 297 ARG B CB  1 
ATOM   4847  C CG  . ARG B 1 296 ? 9.434   -54.729  -59.963 1.00 59.46  ? 297 ARG B CG  1 
ATOM   4848  C CD  . ARG B 1 296 ? 9.539   -54.975  -61.465 1.00 60.76  ? 297 ARG B CD  1 
ATOM   4849  N NE  . ARG B 1 296 ? 8.249   -55.377  -62.016 1.00 60.17  ? 297 ARG B NE  1 
ATOM   4850  C CZ  . ARG B 1 296 ? 7.345   -54.536  -62.504 1.00 59.72  ? 297 ARG B CZ  1 
ATOM   4851  N NH1 . ARG B 1 296 ? 7.590   -53.234  -62.535 1.00 59.70  ? 297 ARG B NH1 1 
ATOM   4852  N NH2 . ARG B 1 296 ? 6.196   -55.002  -62.970 1.00 60.26  ? 297 ARG B NH2 1 
ATOM   4853  N N   . GLY B 1 297 ? 9.808   -52.786  -56.504 1.00 57.55  ? 298 GLY B N   1 
ATOM   4854  C CA  . GLY B 1 297 ? 9.727   -51.428  -56.001 1.00 56.56  ? 298 GLY B CA  1 
ATOM   4855  C C   . GLY B 1 297 ? 9.292   -50.422  -57.048 1.00 56.32  ? 298 GLY B C   1 
ATOM   4856  O O   . GLY B 1 297 ? 9.578   -49.231  -56.926 1.00 57.66  ? 298 GLY B O   1 
ATOM   4857  N N   . ASP B 1 298 ? 8.600   -50.898  -58.080 1.00 53.92  ? 299 ASP B N   1 
ATOM   4858  C CA  . ASP B 1 298 ? 8.077   -50.022  -59.123 1.00 53.21  ? 299 ASP B CA  1 
ATOM   4859  C C   . ASP B 1 298 ? 6.775   -49.374  -58.663 1.00 52.28  ? 299 ASP B C   1 
ATOM   4860  O O   . ASP B 1 298 ? 5.685   -49.838  -59.000 1.00 51.70  ? 299 ASP B O   1 
ATOM   4861  C CB  . ASP B 1 298 ? 7.852   -50.801  -60.421 1.00 52.24  ? 299 ASP B CB  1 
ATOM   4862  C CG  . ASP B 1 298 ? 7.687   -49.894  -61.634 1.00 53.17  ? 299 ASP B CG  1 
ATOM   4863  O OD1 . ASP B 1 298 ? 7.526   -48.666  -61.460 1.00 53.94  ? 299 ASP B OD1 1 
ATOM   4864  O OD2 . ASP B 1 298 ? 7.709   -50.415  -62.768 1.00 52.67  ? 299 ASP B OD2 1 
ATOM   4865  N N   . TYR B 1 299 ? 6.897   -48.298  -57.895 1.00 51.82  ? 300 TYR B N   1 
ATOM   4866  C CA  . TYR B 1 299 ? 5.738   -47.630  -57.319 1.00 50.84  ? 300 TYR B CA  1 
ATOM   4867  C C   . TYR B 1 299 ? 4.904   -46.906  -58.370 1.00 49.56  ? 300 TYR B C   1 
ATOM   4868  O O   . TYR B 1 299 ? 3.676   -46.872  -58.283 1.00 48.50  ? 300 TYR B O   1 
ATOM   4869  C CB  . TYR B 1 299 ? 6.190   -46.651  -56.238 1.00 51.83  ? 300 TYR B CB  1 
ATOM   4870  C CG  . TYR B 1 299 ? 6.895   -47.332  -55.089 1.00 53.74  ? 300 TYR B CG  1 
ATOM   4871  C CD1 . TYR B 1 299 ? 6.544   -48.619  -54.706 1.00 53.56  ? 300 TYR B CD1 1 
ATOM   4872  C CD2 . TYR B 1 299 ? 7.921   -46.699  -54.401 1.00 55.78  ? 300 TYR B CD2 1 
ATOM   4873  C CE1 . TYR B 1 299 ? 7.181   -49.253  -53.666 1.00 54.64  ? 300 TYR B CE1 1 
ATOM   4874  C CE2 . TYR B 1 299 ? 8.568   -47.326  -53.351 1.00 57.58  ? 300 TYR B CE2 1 
ATOM   4875  C CZ  . TYR B 1 299 ? 8.192   -48.604  -52.990 1.00 57.26  ? 300 TYR B CZ  1 
ATOM   4876  O OH  . TYR B 1 299 ? 8.825   -49.241  -51.953 1.00 58.40  ? 300 TYR B OH  1 
ATOM   4877  N N   . ARG B 1 300 ? 5.574   -46.330  -59.361 1.00 50.28  ? 301 ARG B N   1 
ATOM   4878  C CA  . ARG B 1 300 ? 4.888   -45.598  -60.420 1.00 50.46  ? 301 ARG B CA  1 
ATOM   4879  C C   . ARG B 1 300 ? 3.972   -46.510  -61.235 1.00 49.40  ? 301 ARG B C   1 
ATOM   4880  O O   . ARG B 1 300 ? 2.909   -46.087  -61.689 1.00 49.16  ? 301 ARG B O   1 
ATOM   4881  C CB  . ARG B 1 300 ? 5.902   -44.913  -61.339 1.00 52.39  ? 301 ARG B CB  1 
ATOM   4882  N N   . ALA B 1 301 ? 4.384   -47.762  -61.418 1.00 47.89  ? 302 ALA B N   1 
ATOM   4883  C CA  . ALA B 1 301 ? 3.562   -48.729  -62.140 1.00 45.12  ? 302 ALA B CA  1 
ATOM   4884  C C   . ALA B 1 301 ? 2.440   -49.237  -61.244 1.00 42.19  ? 302 ALA B C   1 
ATOM   4885  O O   . ALA B 1 301 ? 1.325   -49.483  -61.705 1.00 41.18  ? 302 ALA B O   1 
ATOM   4886  C CB  . ALA B 1 301 ? 4.406   -49.887  -62.641 1.00 44.64  ? 302 ALA B CB  1 
ATOM   4887  N N   . PHE B 1 302 ? 2.746   -49.402  -59.961 1.00 40.18  ? 303 PHE B N   1 
ATOM   4888  C CA  . PHE B 1 302 ? 1.736   -49.812  -58.998 1.00 37.95  ? 303 PHE B CA  1 
ATOM   4889  C C   . PHE B 1 302 ? 0.618   -48.776  -58.983 1.00 36.89  ? 303 PHE B C   1 
ATOM   4890  O O   . PHE B 1 302 ? -0.562  -49.121  -59.032 1.00 35.64  ? 303 PHE B O   1 
ATOM   4891  C CB  . PHE B 1 302 ? 2.345   -49.976  -57.602 1.00 37.14  ? 303 PHE B CB  1 
ATOM   4892  C CG  . PHE B 1 302 ? 1.451   -50.693  -56.623 1.00 35.32  ? 303 PHE B CG  1 
ATOM   4893  C CD1 . PHE B 1 302 ? 0.413   -50.028  -55.990 1.00 32.80  ? 303 PHE B CD1 1 
ATOM   4894  C CD2 . PHE B 1 302 ? 1.662   -52.031  -56.325 1.00 34.95  ? 303 PHE B CD2 1 
ATOM   4895  C CE1 . PHE B 1 302 ? -0.410  -50.690  -55.087 1.00 33.65  ? 303 PHE B CE1 1 
ATOM   4896  C CE2 . PHE B 1 302 ? 0.848   -52.699  -55.425 1.00 32.20  ? 303 PHE B CE2 1 
ATOM   4897  C CZ  . PHE B 1 302 ? -0.190  -52.026  -54.803 1.00 31.71  ? 303 PHE B CZ  1 
ATOM   4898  N N   . GLY B 1 303 ? 1.006   -47.505  -58.930 1.00 38.13  ? 304 GLY B N   1 
ATOM   4899  C CA  . GLY B 1 303 ? 0.056   -46.409  -58.886 1.00 38.11  ? 304 GLY B CA  1 
ATOM   4900  C C   . GLY B 1 303 ? -0.818  -46.327  -60.125 1.00 37.69  ? 304 GLY B C   1 
ATOM   4901  O O   . GLY B 1 303 ? -2.000  -45.992  -60.038 1.00 36.68  ? 304 GLY B O   1 
ATOM   4902  N N   . ARG B 1 304 ? -0.240  -46.629  -61.283 1.00 37.96  ? 305 ARG B N   1 
ATOM   4903  C CA  . ARG B 1 304 ? -1.006  -46.641  -62.521 1.00 38.33  ? 305 ARG B CA  1 
ATOM   4904  C C   . ARG B 1 304 ? -2.095  -47.711  -62.454 1.00 37.13  ? 305 ARG B C   1 
ATOM   4905  O O   . ARG B 1 304 ? -3.230  -47.486  -62.878 1.00 36.70  ? 305 ARG B O   1 
ATOM   4906  C CB  . ARG B 1 304 ? -0.090  -46.882  -63.726 1.00 39.79  ? 305 ARG B CB  1 
ATOM   4907  N N   . LEU B 1 305 ? -1.739  -48.871  -61.913 1.00 33.96  ? 306 LEU B N   1 
ATOM   4908  C CA  . LEU B 1 305 ? -2.677  -49.979  -61.783 1.00 33.08  ? 306 LEU B CA  1 
ATOM   4909  C C   . LEU B 1 305 ? -3.811  -49.660  -60.814 1.00 36.37  ? 306 LEU B C   1 
ATOM   4910  O O   . LEU B 1 305 ? -4.951  -50.077  -61.027 1.00 32.05  ? 306 LEU B O   1 
ATOM   4911  C CB  . LEU B 1 305 ? -1.942  -51.241  -61.339 1.00 32.83  ? 306 LEU B CB  1 
ATOM   4912  C CG  . LEU B 1 305 ? -0.993  -51.818  -62.394 1.00 36.53  ? 306 LEU B CG  1 
ATOM   4913  C CD1 . LEU B 1 305 ? -0.059  -52.847  -61.771 1.00 35.78  ? 306 LEU B CD1 1 
ATOM   4914  C CD2 . LEU B 1 305 ? -1.781  -52.429  -63.558 1.00 36.36  ? 306 LEU B CD2 1 
ATOM   4915  N N   . MET B 1 306 ? -3.494  -48.933  -59.744 1.00 36.34  ? 307 MET B N   1 
ATOM   4916  C CA  . MET B 1 306 ? -4.515  -48.470  -58.812 1.00 34.90  ? 307 MET B CA  1 
ATOM   4917  C C   . MET B 1 306 ? -5.533  -47.576  -59.516 1.00 32.57  ? 307 MET B C   1 
ATOM   4918  O O   . MET B 1 306 ? -6.738  -47.729  -59.323 1.00 32.26  ? 307 MET B O   1 
ATOM   4919  C CB  . MET B 1 306 ? -3.884  -47.706  -57.642 1.00 35.18  ? 307 MET B CB  1 
ATOM   4920  C CG  . MET B 1 306 ? -2.915  -48.524  -56.793 1.00 32.17  ? 307 MET B CG  1 
ATOM   4921  S SD  . MET B 1 306 ? -2.130  -47.506  -55.524 1.00 37.52  ? 307 MET B SD  1 
ATOM   4922  C CE  . MET B 1 306 ? -3.569  -47.056  -54.553 1.00 32.39  ? 307 MET B CE  1 
ATOM   4923  N N   . VAL B 1 307 ? -5.040  -46.634  -60.315 1.00 33.38  ? 308 VAL B N   1 
ATOM   4924  C CA  . VAL B 1 307 ? -5.910  -45.706  -61.026 1.00 33.94  ? 308 VAL B CA  1 
ATOM   4925  C C   . VAL B 1 307 ? -6.797  -46.480  -62.000 1.00 34.55  ? 308 VAL B C   1 
ATOM   4926  O O   . VAL B 1 307 ? -7.996  -46.225  -62.095 1.00 33.69  ? 308 VAL B O   1 
ATOM   4927  C CB  . VAL B 1 307 ? -5.102  -44.625  -61.786 1.00 35.46  ? 308 VAL B CB  1 
ATOM   4928  C CG1 . VAL B 1 307 ? -6.027  -43.731  -62.609 1.00 35.73  ? 308 VAL B CG1 1 
ATOM   4929  C CG2 . VAL B 1 307 ? -4.282  -43.789  -60.811 1.00 35.84  ? 308 VAL B CG2 1 
ATOM   4930  N N   . GLU B 1 308 ? -6.204  -47.444  -62.698 1.00 33.45  ? 309 GLU B N   1 
ATOM   4931  C CA  . GLU B 1 308 ? -6.961  -48.301  -63.607 1.00 35.81  ? 309 GLU B CA  1 
ATOM   4932  C C   . GLU B 1 308 ? -8.032  -49.081  -62.854 1.00 34.77  ? 309 GLU B C   1 
ATOM   4933  O O   . GLU B 1 308 ? -9.153  -49.235  -63.340 1.00 32.51  ? 309 GLU B O   1 
ATOM   4934  C CB  . GLU B 1 308 ? -6.031  -49.262  -64.344 1.00 38.95  ? 309 GLU B CB  1 
ATOM   4935  C CG  . GLU B 1 308 ? -5.039  -48.575  -65.273 1.00 43.73  ? 309 GLU B CG  1 
ATOM   4936  C CD  . GLU B 1 308 ? -4.158  -49.562  -66.018 1.00 48.67  ? 309 GLU B CD  1 
ATOM   4937  O OE1 . GLU B 1 308 ? -4.506  -50.763  -66.053 1.00 49.69  ? 309 GLU B OE1 1 
ATOM   4938  O OE2 . GLU B 1 308 ? -3.120  -49.139  -66.573 1.00 51.29  ? 309 GLU B OE2 1 
ATOM   4939  N N   . SER B 1 309 ? -7.681  -49.560  -61.661 1.00 33.41  ? 310 SER B N   1 
ATOM   4940  C CA  . SER B 1 309 ? -8.629  -50.241  -60.788 1.00 32.41  ? 310 SER B CA  1 
ATOM   4941  C C   . SER B 1 309 ? -9.798  -49.334  -60.426 1.00 33.67  ? 310 SER B C   1 
ATOM   4942  O O   . SER B 1 309 ? -10.951 -49.766  -60.429 1.00 31.59  ? 310 SER B O   1 
ATOM   4943  C CB  . SER B 1 309 ? -7.931  -50.732  -59.508 1.00 30.96  ? 310 SER B CB  1 
ATOM   4944  O OG  . SER B 1 309 ? -8.867  -51.108  -58.507 1.00 30.61  ? 310 SER B OG  1 
ATOM   4945  N N   . HIS B 1 310 ? -9.502  -48.078  -60.102 1.00 34.11  ? 311 HIS B N   1 
ATOM   4946  C CA  . HIS B 1 310 ? -10.559 -47.150  -59.718 1.00 33.76  ? 311 HIS B CA  1 
ATOM   4947  C C   . HIS B 1 310 ? -11.498 -46.848  -60.886 1.00 33.65  ? 311 HIS B C   1 
ATOM   4948  O O   . HIS B 1 310 ? -12.718 -46.833  -60.722 1.00 33.36  ? 311 HIS B O   1 
ATOM   4949  C CB  . HIS B 1 310 ? -9.992  -45.837  -59.181 1.00 33.61  ? 311 HIS B CB  1 
ATOM   4950  C CG  . HIS B 1 310 ? -11.054 -44.850  -58.817 1.00 33.92  ? 311 HIS B CG  1 
ATOM   4951  N ND1 . HIS B 1 310 ? -11.784 -44.942  -57.650 1.00 33.84  ? 311 HIS B ND1 1 
ATOM   4952  C CD2 . HIS B 1 310 ? -11.558 -43.790  -59.492 1.00 34.86  ? 311 HIS B CD2 1 
ATOM   4953  C CE1 . HIS B 1 310 ? -12.667 -43.962  -57.609 1.00 34.73  ? 311 HIS B CE1 1 
ATOM   4954  N NE2 . HIS B 1 310 ? -12.553 -43.248  -58.715 1.00 35.36  ? 311 HIS B NE2 1 
ATOM   4955  N N   . ARG B 1 311 ? -10.928 -46.596  -62.059 1.00 33.51  ? 312 ARG B N   1 
ATOM   4956  C CA  . ARG B 1 311 ? -11.742 -46.319  -63.242 1.00 35.42  ? 312 ARG B CA  1 
ATOM   4957  C C   . ARG B 1 311 ? -12.642 -47.513  -63.550 1.00 35.26  ? 312 ARG B C   1 
ATOM   4958  O O   . ARG B 1 311 ? -13.819 -47.351  -63.879 1.00 35.18  ? 312 ARG B O   1 
ATOM   4959  C CB  . ARG B 1 311 ? -10.860 -45.992  -64.448 1.00 36.52  ? 312 ARG B CB  1 
ATOM   4960  N N   . SER B 1 312 ? -12.081 -48.711  -63.413 1.00 34.89  ? 313 SER B N   1 
ATOM   4961  C CA  . SER B 1 312 ? -12.824 -49.943  -63.647 1.00 34.77  ? 313 SER B CA  1 
ATOM   4962  C C   . SER B 1 312 ? -13.965 -50.106  -62.643 1.00 34.02  ? 313 SER B C   1 
ATOM   4963  O O   . SER B 1 312 ? -15.082 -50.468  -63.018 1.00 33.99  ? 313 SER B O   1 
ATOM   4964  C CB  . SER B 1 312 ? -11.887 -51.147  -63.585 1.00 34.19  ? 313 SER B CB  1 
ATOM   4965  O OG  . SER B 1 312 ? -12.600 -52.356  -63.773 1.00 34.97  ? 313 SER B OG  1 
ATOM   4966  N N   . LEU B 1 313 ? -13.683 -49.829  -61.372 1.00 33.47  ? 314 LEU B N   1 
ATOM   4967  C CA  . LEU B 1 313 ? -14.703 -49.889  -60.333 1.00 34.06  ? 314 LEU B CA  1 
ATOM   4968  C C   . LEU B 1 313 ? -15.771 -48.820  -60.553 1.00 35.35  ? 314 LEU B C   1 
ATOM   4969  O O   . LEU B 1 313 ? -16.965 -49.071  -60.378 1.00 36.92  ? 314 LEU B O   1 
ATOM   4970  C CB  . LEU B 1 313 ? -14.068 -49.724  -58.946 1.00 35.55  ? 314 LEU B CB  1 
ATOM   4971  C CG  . LEU B 1 313 ? -13.306 -50.937  -58.403 1.00 36.40  ? 314 LEU B CG  1 
ATOM   4972  C CD1 . LEU B 1 313 ? -12.333 -50.521  -57.303 1.00 31.08  ? 314 LEU B CD1 1 
ATOM   4973  C CD2 . LEU B 1 313 ? -14.275 -51.993  -57.887 1.00 35.63  ? 314 LEU B CD2 1 
ATOM   4974  N N   . ARG B 1 314 ? -15.335 -47.624  -60.932 1.00 35.62  ? 315 ARG B N   1 
ATOM   4975  C CA  . ARG B 1 314 ? -16.253 -46.514  -61.161 1.00 38.37  ? 315 ARG B CA  1 
ATOM   4976  C C   . ARG B 1 314 ? -17.156 -46.750  -62.374 1.00 39.24  ? 315 ARG B C   1 
ATOM   4977  O O   . ARG B 1 314 ? -18.369 -46.538  -62.300 1.00 40.16  ? 315 ARG B O   1 
ATOM   4978  C CB  . ARG B 1 314 ? -15.474 -45.206  -61.345 1.00 39.90  ? 315 ARG B CB  1 
ATOM   4979  C CG  . ARG B 1 314 ? -16.349 -43.968  -61.535 1.00 41.61  ? 315 ARG B CG  1 
ATOM   4980  C CD  . ARG B 1 314 ? -15.532 -42.797  -62.061 1.00 42.35  ? 315 ARG B CD  1 
ATOM   4981  N NE  . ARG B 1 314 ? -14.961 -43.103  -63.370 1.00 43.15  ? 315 ARG B NE  1 
ATOM   4982  C CZ  . ARG B 1 314 ? -13.863 -42.539  -63.862 1.00 42.79  ? 315 ARG B CZ  1 
ATOM   4983  N NH1 . ARG B 1 314 ? -13.202 -41.631  -63.154 1.00 43.07  ? 315 ARG B NH1 1 
ATOM   4984  N NH2 . ARG B 1 314 ? -13.421 -42.891  -65.061 1.00 42.15  ? 315 ARG B NH2 1 
ATOM   4985  N N   . ASP B 1 315 ? -16.570 -47.194  -63.483 1.00 38.45  ? 316 ASP B N   1 
ATOM   4986  C CA  . ASP B 1 315 ? -17.301 -47.251  -64.749 1.00 40.71  ? 316 ASP B CA  1 
ATOM   4987  C C   . ASP B 1 315 ? -17.907 -48.619  -65.086 1.00 39.94  ? 316 ASP B C   1 
ATOM   4988  O O   . ASP B 1 315 ? -19.034 -48.692  -65.574 1.00 41.83  ? 316 ASP B O   1 
ATOM   4989  C CB  . ASP B 1 315 ? -16.389 -46.807  -65.897 1.00 42.47  ? 316 ASP B CB  1 
ATOM   4990  C CG  . ASP B 1 315 ? -15.971 -45.351  -65.781 1.00 44.07  ? 316 ASP B CG  1 
ATOM   4991  O OD1 . ASP B 1 315 ? -16.719 -44.557  -65.172 1.00 44.07  ? 316 ASP B OD1 1 
ATOM   4992  O OD2 . ASP B 1 315 ? -14.890 -44.999  -66.296 1.00 45.22  ? 316 ASP B OD2 1 
ATOM   4993  N N   . ASP B 1 316 ? -17.165 -49.695  -64.842 1.00 36.54  ? 317 ASP B N   1 
ATOM   4994  C CA  . ASP B 1 316 ? -17.639 -51.031  -65.200 1.00 35.29  ? 317 ASP B CA  1 
ATOM   4995  C C   . ASP B 1 316 ? -18.433 -51.710  -64.085 1.00 38.42  ? 317 ASP B C   1 
ATOM   4996  O O   . ASP B 1 316 ? -19.478 -52.309  -64.340 1.00 34.47  ? 317 ASP B O   1 
ATOM   4997  C CB  . ASP B 1 316 ? -16.465 -51.921  -65.613 1.00 34.09  ? 317 ASP B CB  1 
ATOM   4998  C CG  . ASP B 1 316 ? -16.206 -51.882  -67.113 1.00 35.23  ? 317 ASP B CG  1 
ATOM   4999  O OD1 . ASP B 1 316 ? -17.074 -51.365  -67.844 1.00 34.94  ? 317 ASP B OD1 1 
ATOM   5000  O OD2 . ASP B 1 316 ? -15.148 -52.373  -67.561 1.00 37.03  ? 317 ASP B OD2 1 
ATOM   5001  N N   . TYR B 1 317 ? -17.946 -51.612  -62.850 1.00 36.11  ? 318 TYR B N   1 
ATOM   5002  C CA  . TYR B 1 317 ? -18.593 -52.297  -61.736 1.00 36.33  ? 318 TYR B CA  1 
ATOM   5003  C C   . TYR B 1 317 ? -19.597 -51.383  -61.047 1.00 37.47  ? 318 TYR B C   1 
ATOM   5004  O O   . TYR B 1 317 ? -20.502 -51.853  -60.354 1.00 36.74  ? 318 TYR B O   1 
ATOM   5005  C CB  . TYR B 1 317 ? -17.549 -52.794  -60.735 1.00 35.73  ? 318 TYR B CB  1 
ATOM   5006  C CG  . TYR B 1 317 ? -17.878 -54.134  -60.114 1.00 37.05  ? 318 TYR B CG  1 
ATOM   5007  C CD1 . TYR B 1 317 ? -17.872 -55.297  -60.879 1.00 32.40  ? 318 TYR B CD1 1 
ATOM   5008  C CD2 . TYR B 1 317 ? -18.172 -54.242  -58.757 1.00 37.82  ? 318 TYR B CD2 1 
ATOM   5009  C CE1 . TYR B 1 317 ? -18.168 -56.526  -60.316 1.00 35.27  ? 318 TYR B CE1 1 
ATOM   5010  C CE2 . TYR B 1 317 ? -18.467 -55.468  -58.184 1.00 32.49  ? 318 TYR B CE2 1 
ATOM   5011  C CZ  . TYR B 1 317 ? -18.460 -56.606  -58.965 1.00 35.70  ? 318 TYR B CZ  1 
ATOM   5012  O OH  . TYR B 1 317 ? -18.750 -57.824  -58.396 1.00 35.75  ? 318 TYR B OH  1 
ATOM   5013  N N   . GLU B 1 318 ? -19.426 -50.079  -61.249 1.00 39.08  ? 319 GLU B N   1 
ATOM   5014  C CA  . GLU B 1 318 ? -20.304 -49.065  -60.668 1.00 41.19  ? 319 GLU B CA  1 
ATOM   5015  C C   . GLU B 1 318 ? -20.486 -49.227  -59.160 1.00 41.58  ? 319 GLU B C   1 
ATOM   5016  O O   . GLU B 1 318 ? -21.595 -49.478  -58.683 1.00 42.58  ? 319 GLU B O   1 
ATOM   5017  C CB  . GLU B 1 318 ? -21.670 -49.093  -61.354 1.00 43.23  ? 319 GLU B CB  1 
ATOM   5018  C CG  . GLU B 1 318 ? -21.631 -48.701  -62.820 1.00 44.39  ? 319 GLU B CG  1 
ATOM   5019  C CD  . GLU B 1 318 ? -23.005 -48.694  -63.450 1.00 46.45  ? 319 GLU B CD  1 
ATOM   5020  O OE1 . GLU B 1 318 ? -23.717 -47.677  -63.306 1.00 47.61  ? 319 GLU B OE1 1 
ATOM   5021  O OE2 . GLU B 1 318 ? -23.372 -49.704  -64.090 1.00 47.23  ? 319 GLU B OE2 1 
ATOM   5022  N N   . VAL B 1 319 ? -19.400 -49.094  -58.407 1.00 40.03  ? 320 VAL B N   1 
ATOM   5023  C CA  . VAL B 1 319 ? -19.503 -49.137  -56.953 1.00 39.22  ? 320 VAL B CA  1 
ATOM   5024  C C   . VAL B 1 319 ? -18.795 -47.947  -56.322 1.00 39.47  ? 320 VAL B C   1 
ATOM   5025  O O   . VAL B 1 319 ? -18.579 -47.917  -55.114 1.00 40.28  ? 320 VAL B O   1 
ATOM   5026  C CB  . VAL B 1 319 ? -18.929 -50.446  -56.370 1.00 38.09  ? 320 VAL B CB  1 
ATOM   5027  C CG1 . VAL B 1 319 ? -19.779 -51.638  -56.803 1.00 38.39  ? 320 VAL B CG1 1 
ATOM   5028  C CG2 . VAL B 1 319 ? -17.477 -50.630  -56.788 1.00 35.95  ? 320 VAL B CG2 1 
ATOM   5029  N N   . SER B 1 320 ? -18.434 -46.963  -57.138 1.00 38.79  ? 321 SER B N   1 
ATOM   5030  C CA  . SER B 1 320 ? -17.874 -45.733  -56.601 1.00 38.71  ? 321 SER B CA  1 
ATOM   5031  C C   . SER B 1 320 ? -18.993 -44.734  -56.327 1.00 39.70  ? 321 SER B C   1 
ATOM   5032  O O   . SER B 1 320 ? -20.174 -45.078  -56.397 1.00 41.18  ? 321 SER B O   1 
ATOM   5033  C CB  . SER B 1 320 ? -16.841 -45.134  -57.556 1.00 39.00  ? 321 SER B CB  1 
ATOM   5034  O OG  . SER B 1 320 ? -16.189 -44.021  -56.959 1.00 38.65  ? 321 SER B OG  1 
ATOM   5035  N N   . CYS B 1 321 ? -18.615 -43.502  -56.007 1.00 39.06  ? 322 CYS B N   1 
ATOM   5036  C CA  . CYS B 1 321 ? -19.580 -42.430  -55.804 1.00 41.83  ? 322 CYS B CA  1 
ATOM   5037  C C   . CYS B 1 321 ? -18.892 -41.102  -56.102 1.00 42.58  ? 322 CYS B C   1 
ATOM   5038  O O   . CYS B 1 321 ? -17.662 -41.055  -56.167 1.00 42.89  ? 322 CYS B O   1 
ATOM   5039  C CB  . CYS B 1 321 ? -20.140 -42.469  -54.375 1.00 42.67  ? 322 CYS B CB  1 
ATOM   5040  S SG  . CYS B 1 321 ? -18.928 -42.207  -53.071 1.00 45.05  ? 322 CYS B SG  1 
ATOM   5041  N N   . PRO B 1 322 ? -19.671 -40.024  -56.307 1.00 44.09  ? 323 PRO B N   1 
ATOM   5042  C CA  . PRO B 1 322 ? -19.046 -38.735  -56.630 1.00 44.75  ? 323 PRO B CA  1 
ATOM   5043  C C   . PRO B 1 322 ? -17.986 -38.319  -55.615 1.00 43.76  ? 323 PRO B C   1 
ATOM   5044  O O   . PRO B 1 322 ? -16.946 -37.788  -56.004 1.00 42.02  ? 323 PRO B O   1 
ATOM   5045  C CB  . PRO B 1 322 ? -20.229 -37.765  -56.618 1.00 47.77  ? 323 PRO B CB  1 
ATOM   5046  C CG  . PRO B 1 322 ? -21.384 -38.607  -57.041 1.00 48.00  ? 323 PRO B CG  1 
ATOM   5047  C CD  . PRO B 1 322 ? -21.143 -39.950  -56.392 1.00 46.12  ? 323 PRO B CD  1 
ATOM   5048  N N   . GLU B 1 323 ? -18.242 -38.587  -54.338 1.00 43.21  ? 324 GLU B N   1 
ATOM   5049  C CA  . GLU B 1 323 ? -17.289 -38.270  -53.280 1.00 43.76  ? 324 GLU B CA  1 
ATOM   5050  C C   . GLU B 1 323 ? -15.955 -38.979  -53.498 1.00 40.30  ? 324 GLU B C   1 
ATOM   5051  O O   . GLU B 1 323 ? -14.909 -38.333  -53.574 1.00 41.48  ? 324 GLU B O   1 
ATOM   5052  C CB  . GLU B 1 323 ? -17.863 -38.642  -51.912 1.00 44.90  ? 324 GLU B CB  1 
ATOM   5053  C CG  . GLU B 1 323 ? -19.035 -37.783  -51.467 1.00 47.70  ? 324 GLU B CG  1 
ATOM   5054  C CD  . GLU B 1 323 ? -20.363 -38.232  -52.043 1.00 49.24  ? 324 GLU B CD  1 
ATOM   5055  O OE1 . GLU B 1 323 ? -20.387 -39.200  -52.835 1.00 47.91  ? 324 GLU B OE1 1 
ATOM   5056  O OE2 . GLU B 1 323 ? -21.389 -37.614  -51.692 1.00 52.56  ? 324 GLU B OE2 1 
ATOM   5057  N N   . LEU B 1 324 ? -15.998 -40.304  -53.603 1.00 39.04  ? 325 LEU B N   1 
ATOM   5058  C CA  . LEU B 1 324 ? -14.799 -41.093  -53.870 1.00 38.82  ? 325 LEU B CA  1 
ATOM   5059  C C   . LEU B 1 324 ? -14.091 -40.633  -55.145 1.00 39.71  ? 325 LEU B C   1 
ATOM   5060  O O   . LEU B 1 324 ? -12.867 -40.511  -55.167 1.00 39.47  ? 325 LEU B O   1 
ATOM   5061  C CB  . LEU B 1 324 ? -15.144 -42.582  -53.980 1.00 37.61  ? 325 LEU B CB  1 
ATOM   5062  C CG  . LEU B 1 324 ? -15.551 -43.333  -52.708 1.00 37.88  ? 325 LEU B CG  1 
ATOM   5063  C CD1 . LEU B 1 324 ? -16.020 -44.737  -53.052 1.00 37.09  ? 325 LEU B CD1 1 
ATOM   5064  C CD2 . LEU B 1 324 ? -14.417 -43.374  -51.689 1.00 37.47  ? 325 LEU B CD2 1 
ATOM   5065  N N   . ASP B 1 325 ? -14.862 -40.383  -56.203 1.00 41.46  ? 326 ASP B N   1 
ATOM   5066  C CA  . ASP B 1 325 ? -14.292 -39.942  -57.474 1.00 42.25  ? 326 ASP B CA  1 
ATOM   5067  C C   . ASP B 1 325 ? -13.551 -38.621  -57.311 1.00 43.25  ? 326 ASP B C   1 
ATOM   5068  O O   . ASP B 1 325 ? -12.426 -38.466  -57.786 1.00 43.45  ? 326 ASP B O   1 
ATOM   5069  C CB  . ASP B 1 325 ? -15.380 -39.798  -58.545 1.00 43.78  ? 326 ASP B CB  1 
ATOM   5070  C CG  . ASP B 1 325 ? -15.963 -41.132  -58.972 1.00 43.42  ? 326 ASP B CG  1 
ATOM   5071  O OD1 . ASP B 1 325 ? -15.276 -42.166  -58.825 1.00 43.38  ? 326 ASP B OD1 1 
ATOM   5072  O OD2 . ASP B 1 325 ? -17.112 -41.143  -59.457 1.00 43.24  ? 326 ASP B OD2 1 
ATOM   5073  N N   . GLN B 1 326 ? -14.186 -37.672  -56.634 1.00 40.81  ? 327 GLN B N   1 
ATOM   5074  C CA  . GLN B 1 326 ? -13.584 -36.365  -56.419 1.00 46.57  ? 327 GLN B CA  1 
ATOM   5075  C C   . GLN B 1 326 ? -12.317 -36.474  -55.565 1.00 44.53  ? 327 GLN B C   1 
ATOM   5076  O O   . GLN B 1 326 ? -11.330 -35.781  -55.820 1.00 44.78  ? 327 GLN B O   1 
ATOM   5077  C CB  . GLN B 1 326 ? -14.591 -35.415  -55.769 1.00 50.03  ? 327 GLN B CB  1 
ATOM   5078  C CG  . GLN B 1 326 ? -14.108 -33.979  -55.672 1.00 53.34  ? 327 GLN B CG  1 
ATOM   5079  C CD  . GLN B 1 326 ? -15.143 -33.050  -55.064 1.00 54.94  ? 327 GLN B CD  1 
ATOM   5080  O OE1 . GLN B 1 326 ? -15.733 -33.348  -54.021 1.00 54.96  ? 327 GLN B OE1 1 
ATOM   5081  N NE2 . GLN B 1 326 ? -15.375 -31.920  -55.719 1.00 55.78  ? 327 GLN B NE2 1 
ATOM   5082  N N   . LEU B 1 327 ? -12.341 -37.353  -54.565 1.00 41.14  ? 328 LEU B N   1 
ATOM   5083  C CA  . LEU B 1 327 ? -11.168 -37.571  -53.722 1.00 39.83  ? 328 LEU B CA  1 
ATOM   5084  C C   . LEU B 1 327 ? -10.010 -38.157  -54.520 1.00 38.98  ? 328 LEU B C   1 
ATOM   5085  O O   . LEU B 1 327 ? -8.857  -37.785  -54.321 1.00 39.19  ? 328 LEU B O   1 
ATOM   5086  C CB  . LEU B 1 327 ? -11.508 -38.492  -52.547 1.00 38.98  ? 328 LEU B CB  1 
ATOM   5087  C CG  . LEU B 1 327 ? -12.350 -37.892  -51.423 1.00 41.69  ? 328 LEU B CG  1 
ATOM   5088  C CD1 . LEU B 1 327 ? -12.699 -38.965  -50.416 1.00 39.08  ? 328 LEU B CD1 1 
ATOM   5089  C CD2 . LEU B 1 327 ? -11.608 -36.746  -50.749 1.00 40.99  ? 328 LEU B CD2 1 
ATOM   5090  N N   . VAL B 1 328 ? -10.324 -39.077  -55.427 1.00 38.16  ? 329 VAL B N   1 
ATOM   5091  C CA  . VAL B 1 328 ? -9.304  -39.727  -56.242 1.00 37.46  ? 329 VAL B CA  1 
ATOM   5092  C C   . VAL B 1 328 ? -8.652  -38.727  -57.202 1.00 40.48  ? 329 VAL B C   1 
ATOM   5093  O O   . VAL B 1 328 ? -7.425  -38.667  -57.309 1.00 40.73  ? 329 VAL B O   1 
ATOM   5094  C CB  . VAL B 1 328 ? -9.899  -40.919  -57.024 1.00 40.18  ? 329 VAL B CB  1 
ATOM   5095  C CG1 . VAL B 1 328 ? -8.990  -41.330  -58.180 1.00 40.30  ? 329 VAL B CG1 1 
ATOM   5096  C CG2 . VAL B 1 328 ? -10.149 -42.094  -56.084 1.00 35.48  ? 329 VAL B CG2 1 
ATOM   5097  N N   . GLU B 1 329 ? -9.473  -37.925  -57.872 1.00 39.49  ? 330 GLU B N   1 
ATOM   5098  C CA  . GLU B 1 329 ? -8.969  -36.901  -58.783 1.00 43.97  ? 330 GLU B CA  1 
ATOM   5099  C C   . GLU B 1 329 ? -8.115  -35.865  -58.046 1.00 44.45  ? 330 GLU B C   1 
ATOM   5100  O O   . GLU B 1 329 ? -7.063  -35.447  -58.536 1.00 44.87  ? 330 GLU B O   1 
ATOM   5101  C CB  . GLU B 1 329 ? -10.129 -36.209  -59.506 1.00 44.66  ? 330 GLU B CB  1 
ATOM   5102  N N   . ALA B 1 330 ? -8.569  -35.456  -56.867 1.00 44.55  ? 331 ALA B N   1 
ATOM   5103  C CA  . ALA B 1 330 ? -7.834  -34.475  -56.074 1.00 45.87  ? 331 ALA B CA  1 
ATOM   5104  C C   . ALA B 1 330 ? -6.431  -34.980  -55.746 1.00 44.99  ? 331 ALA B C   1 
ATOM   5105  O O   . ALA B 1 330 ? -5.446  -34.255  -55.907 1.00 46.30  ? 331 ALA B O   1 
ATOM   5106  C CB  . ALA B 1 330 ? -8.597  -34.142  -54.797 1.00 43.37  ? 331 ALA B CB  1 
ATOM   5107  N N   . ALA B 1 331 ? -6.350  -36.232  -55.301 1.00 42.54  ? 332 ALA B N   1 
ATOM   5108  C CA  . ALA B 1 331 ? -5.081  -36.848  -54.931 1.00 41.24  ? 332 ALA B CA  1 
ATOM   5109  C C   . ALA B 1 331 ? -4.134  -36.966  -56.122 1.00 41.48  ? 332 ALA B C   1 
ATOM   5110  O O   . ALA B 1 331 ? -2.936  -36.725  -55.991 1.00 41.93  ? 332 ALA B O   1 
ATOM   5111  C CB  . ALA B 1 331 ? -5.320  -38.224  -54.312 1.00 39.15  ? 332 ALA B CB  1 
ATOM   5112  N N   . LEU B 1 332 ? -4.680  -37.336  -57.279 1.00 41.70  ? 333 LEU B N   1 
ATOM   5113  C CA  . LEU B 1 332 ? -3.880  -37.525  -58.489 1.00 43.22  ? 333 LEU B CA  1 
ATOM   5114  C C   . LEU B 1 332 ? -3.250  -36.223  -58.975 1.00 45.00  ? 333 LEU B C   1 
ATOM   5115  O O   . LEU B 1 332 ? -2.227  -36.238  -59.659 1.00 46.49  ? 333 LEU B O   1 
ATOM   5116  C CB  . LEU B 1 332 ? -4.732  -38.140  -59.606 1.00 42.23  ? 333 LEU B CB  1 
ATOM   5117  C CG  . LEU B 1 332 ? -5.129  -39.607  -59.400 1.00 40.75  ? 333 LEU B CG  1 
ATOM   5118  C CD1 . LEU B 1 332 ? -5.815  -40.179  -60.630 1.00 40.20  ? 333 LEU B CD1 1 
ATOM   5119  C CD2 . LEU B 1 332 ? -3.916  -40.446  -59.016 1.00 40.69  ? 333 LEU B CD2 1 
ATOM   5120  N N   . ALA B 1 333 ? -3.856  -35.098  -58.616 1.00 45.20  ? 334 ALA B N   1 
ATOM   5121  C CA  . ALA B 1 333 ? -3.322  -33.799  -59.006 1.00 48.02  ? 334 ALA B CA  1 
ATOM   5122  C C   . ALA B 1 333 ? -2.092  -33.423  -58.181 1.00 48.72  ? 334 ALA B C   1 
ATOM   5123  O O   . ALA B 1 333 ? -1.348  -32.515  -58.550 1.00 49.65  ? 334 ALA B O   1 
ATOM   5124  C CB  . ALA B 1 333 ? -4.392  -32.728  -58.875 1.00 49.72  ? 334 ALA B CB  1 
ATOM   5125  N N   . VAL B 1 334 ? -1.880  -34.127  -57.071 1.00 48.15  ? 335 VAL B N   1 
ATOM   5126  C CA  . VAL B 1 334 ? -0.791  -33.811  -56.147 1.00 50.39  ? 335 VAL B CA  1 
ATOM   5127  C C   . VAL B 1 334 ? 0.539   -34.454  -56.542 1.00 50.99  ? 335 VAL B C   1 
ATOM   5128  O O   . VAL B 1 334 ? 0.618   -35.670  -56.713 1.00 51.00  ? 335 VAL B O   1 
ATOM   5129  C CB  . VAL B 1 334 ? -1.135  -34.259  -54.711 1.00 50.22  ? 335 VAL B CB  1 
ATOM   5130  C CG1 . VAL B 1 334 ? -0.007  -33.900  -53.758 1.00 51.19  ? 335 VAL B CG1 1 
ATOM   5131  C CG2 . VAL B 1 334 ? -2.447  -33.635  -54.260 1.00 51.06  ? 335 VAL B CG2 1 
ATOM   5132  N N   . PRO B 1 335 ? 1.594   -33.635  -56.675 1.00 51.80  ? 336 PRO B N   1 
ATOM   5133  C CA  . PRO B 1 335 ? 2.935   -34.144  -56.982 1.00 50.92  ? 336 PRO B CA  1 
ATOM   5134  C C   . PRO B 1 335 ? 3.437   -35.068  -55.878 1.00 49.73  ? 336 PRO B C   1 
ATOM   5135  O O   . PRO B 1 335 ? 3.308   -34.734  -54.702 1.00 49.33  ? 336 PRO B O   1 
ATOM   5136  C CB  . PRO B 1 335 ? 3.791   -32.873  -57.062 1.00 52.79  ? 336 PRO B CB  1 
ATOM   5137  C CG  . PRO B 1 335 ? 2.820   -31.752  -57.240 1.00 54.23  ? 336 PRO B CG  1 
ATOM   5138  C CD  . PRO B 1 335 ? 1.578   -32.171  -56.524 1.00 53.30  ? 336 PRO B CD  1 
ATOM   5139  N N   . GLY B 1 336 ? 3.995   -36.214  -56.253 1.00 49.36  ? 337 GLY B N   1 
ATOM   5140  C CA  . GLY B 1 336 ? 4.440   -37.197  -55.283 1.00 47.41  ? 337 GLY B CA  1 
ATOM   5141  C C   . GLY B 1 336 ? 3.490   -38.376  -55.175 1.00 45.64  ? 337 GLY B C   1 
ATOM   5142  O O   . GLY B 1 336 ? 3.876   -39.456  -54.732 1.00 44.45  ? 337 GLY B O   1 
ATOM   5143  N N   . VAL B 1 337 ? 2.244   -38.168  -55.589 1.00 46.66  ? 338 VAL B N   1 
ATOM   5144  C CA  . VAL B 1 337 ? 1.233   -39.225  -55.574 1.00 45.04  ? 338 VAL B CA  1 
ATOM   5145  C C   . VAL B 1 337 ? 1.416   -40.202  -56.733 1.00 44.04  ? 338 VAL B C   1 
ATOM   5146  O O   . VAL B 1 337 ? 1.357   -39.812  -57.901 1.00 43.72  ? 338 VAL B O   1 
ATOM   5147  C CB  . VAL B 1 337 ? -0.191  -38.631  -55.633 1.00 44.43  ? 338 VAL B CB  1 
ATOM   5148  C CG1 . VAL B 1 337 ? -1.223  -39.718  -55.933 1.00 42.43  ? 338 VAL B CG1 1 
ATOM   5149  C CG2 . VAL B 1 337 ? -0.509  -37.909  -54.327 1.00 44.00  ? 338 VAL B CG2 1 
ATOM   5150  N N   . TYR B 1 338 ? 1.637   -41.473  -56.407 1.00 41.95  ? 339 TYR B N   1 
ATOM   5151  C CA  . TYR B 1 338 ? 1.828   -42.497  -57.434 1.00 41.82  ? 339 TYR B CA  1 
ATOM   5152  C C   . TYR B 1 338 ? 0.503   -42.949  -58.029 1.00 40.22  ? 339 TYR B C   1 
ATOM   5153  O O   . TYR B 1 338 ? 0.394   -43.166  -59.234 1.00 40.48  ? 339 TYR B O   1 
ATOM   5154  C CB  . TYR B 1 338 ? 2.569   -43.707  -56.867 1.00 42.16  ? 339 TYR B CB  1 
ATOM   5155  C CG  . TYR B 1 338 ? 3.990   -43.407  -56.468 1.00 44.77  ? 339 TYR B CG  1 
ATOM   5156  C CD1 . TYR B 1 338 ? 4.964   -43.177  -57.430 1.00 46.29  ? 339 TYR B CD1 1 
ATOM   5157  C CD2 . TYR B 1 338 ? 4.357   -43.351  -55.130 1.00 45.40  ? 339 TYR B CD2 1 
ATOM   5158  C CE1 . TYR B 1 338 ? 6.267   -42.898  -57.068 1.00 48.41  ? 339 TYR B CE1 1 
ATOM   5159  C CE2 . TYR B 1 338 ? 5.657   -43.074  -54.759 1.00 46.82  ? 339 TYR B CE2 1 
ATOM   5160  C CZ  . TYR B 1 338 ? 6.607   -42.848  -55.731 1.00 48.35  ? 339 TYR B CZ  1 
ATOM   5161  O OH  . TYR B 1 338 ? 7.903   -42.571  -55.366 1.00 50.25  ? 339 TYR B OH  1 
ATOM   5162  N N   . GLY B 1 339 ? -0.500  -43.098  -57.173 1.00 38.10  ? 340 GLY B N   1 
ATOM   5163  C CA  . GLY B 1 339 ? -1.811  -43.521  -57.621 1.00 36.94  ? 340 GLY B CA  1 
ATOM   5164  C C   . GLY B 1 339 ? -2.816  -43.428  -56.496 1.00 35.71  ? 340 GLY B C   1 
ATOM   5165  O O   . GLY B 1 339 ? -2.445  -43.305  -55.332 1.00 35.06  ? 340 GLY B O   1 
ATOM   5166  N N   . SER B 1 340 ? -4.095  -43.484  -56.842 1.00 35.81  ? 341 SER B N   1 
ATOM   5167  C CA  . SER B 1 340 ? -5.144  -43.452  -55.833 1.00 35.97  ? 341 SER B CA  1 
ATOM   5168  C C   . SER B 1 340 ? -6.382  -44.157  -56.364 1.00 34.42  ? 341 SER B C   1 
ATOM   5169  O O   . SER B 1 340 ? -6.577  -44.250  -57.571 1.00 36.27  ? 341 SER B O   1 
ATOM   5170  C CB  . SER B 1 340 ? -5.469  -42.009  -55.426 1.00 36.69  ? 341 SER B CB  1 
ATOM   5171  O OG  . SER B 1 340 ? -6.374  -41.975  -54.335 1.00 35.67  ? 341 SER B OG  1 
ATOM   5172  N N   . ARG B 1 341 ? -7.206  -44.660  -55.452 1.00 33.36  ? 342 ARG B N   1 
ATOM   5173  C CA  . ARG B 1 341 ? -8.380  -45.442  -55.810 1.00 33.76  ? 342 ARG B CA  1 
ATOM   5174  C C   . ARG B 1 341 ? -9.289  -45.593  -54.606 1.00 33.31  ? 342 ARG B C   1 
ATOM   5175  O O   . ARG B 1 341 ? -8.827  -45.547  -53.463 1.00 34.57  ? 342 ARG B O   1 
ATOM   5176  C CB  . ARG B 1 341 ? -7.973  -46.830  -56.320 1.00 34.71  ? 342 ARG B CB  1 
ATOM   5177  C CG  . ARG B 1 341 ? -7.209  -47.653  -55.278 1.00 35.14  ? 342 ARG B CG  1 
ATOM   5178  C CD  . ARG B 1 341 ? -6.858  -49.049  -55.780 1.00 35.97  ? 342 ARG B CD  1 
ATOM   5179  N NE  . ARG B 1 341 ? -8.056  -49.849  -55.995 1.00 35.85  ? 342 ARG B NE  1 
ATOM   5180  C CZ  . ARG B 1 341 ? -8.595  -50.658  -55.091 1.00 34.85  ? 342 ARG B CZ  1 
ATOM   5181  N NH1 . ARG B 1 341 ? -8.037  -50.815  -53.893 1.00 33.74  ? 342 ARG B NH1 1 
ATOM   5182  N NH2 . ARG B 1 341 ? -9.696  -51.326  -55.396 1.00 34.32  ? 342 ARG B NH2 1 
ATOM   5183  N N   . MET B 1 342 ? -10.580 -45.782  -54.855 1.00 33.69  ? 343 MET B N   1 
ATOM   5184  C CA  . MET B 1 342 ? -11.479 -46.197  -53.786 1.00 34.60  ? 343 MET B CA  1 
ATOM   5185  C C   . MET B 1 342 ? -11.009 -47.539  -53.243 1.00 34.81  ? 343 MET B C   1 
ATOM   5186  O O   . MET B 1 342 ? -10.442 -48.351  -53.980 1.00 35.39  ? 343 MET B O   1 
ATOM   5187  C CB  . MET B 1 342 ? -12.922 -46.304  -54.277 1.00 35.24  ? 343 MET B CB  1 
ATOM   5188  C CG  . MET B 1 342 ? -13.115 -47.270  -55.446 1.00 35.50  ? 343 MET B CG  1 
ATOM   5189  S SD  . MET B 1 342 ? -14.765 -48.010  -55.470 1.00 37.55  ? 343 MET B SD  1 
ATOM   5190  C CE  . MET B 1 342 ? -14.596 -49.233  -54.175 1.00 40.97  ? 343 MET B CE  1 
ATOM   5191  N N   . THR B 1 343 ? -11.240 -47.776  -51.957 1.00 31.91  ? 344 THR B N   1 
ATOM   5192  C CA  . THR B 1 343 ? -10.865 -49.047  -51.349 1.00 31.27  ? 344 THR B CA  1 
ATOM   5193  C C   . THR B 1 343 ? -12.084 -49.650  -50.655 1.00 31.42  ? 344 THR B C   1 
ATOM   5194  O O   . THR B 1 343 ? -12.989 -48.926  -50.237 1.00 32.08  ? 344 THR B O   1 
ATOM   5195  C CB  . THR B 1 343 ? -9.689  -48.875  -50.349 1.00 35.99  ? 344 THR B CB  1 
ATOM   5196  O OG1 . THR B 1 343 ? -9.027  -50.131  -50.155 1.00 35.87  ? 344 THR B OG1 1 
ATOM   5197  C CG2 . THR B 1 343 ? -10.176 -48.335  -49.010 1.00 35.68  ? 344 THR B CG2 1 
ATOM   5198  N N   . GLY B 1 344 ? -12.125 -50.974  -50.562 1.00 32.10  ? 345 GLY B N   1 
ATOM   5199  C CA  . GLY B 1 344 ? -13.251 -51.651  -49.937 1.00 33.38  ? 345 GLY B CA  1 
ATOM   5200  C C   . GLY B 1 344 ? -14.456 -51.816  -50.851 1.00 34.78  ? 345 GLY B C   1 
ATOM   5201  O O   . GLY B 1 344 ? -14.324 -51.803  -52.078 1.00 33.14  ? 345 GLY B O   1 
ATOM   5202  N N   . GLY B 1 345 ? -15.635 -51.965  -50.252 1.00 37.70  ? 346 GLY B N   1 
ATOM   5203  C CA  . GLY B 1 345 ? -16.851 -52.254  -50.999 1.00 40.45  ? 346 GLY B CA  1 
ATOM   5204  C C   . GLY B 1 345 ? -17.321 -51.170  -51.957 1.00 42.25  ? 346 GLY B C   1 
ATOM   5205  O O   . GLY B 1 345 ? -17.808 -51.464  -53.054 1.00 43.78  ? 346 GLY B O   1 
ATOM   5206  N N   . GLY B 1 346 ? -17.192 -49.915  -51.544 1.00 41.48  ? 347 GLY B N   1 
ATOM   5207  C CA  . GLY B 1 346 ? -17.603 -48.799  -52.375 1.00 40.79  ? 347 GLY B CA  1 
ATOM   5208  C C   . GLY B 1 346 ? -18.795 -48.037  -51.832 1.00 42.27  ? 347 GLY B C   1 
ATOM   5209  O O   . GLY B 1 346 ? -19.182 -48.221  -50.677 1.00 42.87  ? 347 GLY B O   1 
ATOM   5210  N N   . PHE B 1 347 ? -19.362 -47.173  -52.673 1.00 42.25  ? 348 PHE B N   1 
ATOM   5211  C CA  . PHE B 1 347 ? -20.523 -46.352  -52.326 1.00 42.95  ? 348 PHE B CA  1 
ATOM   5212  C C   . PHE B 1 347 ? -20.239 -45.452  -51.135 1.00 43.75  ? 348 PHE B C   1 
ATOM   5213  O O   . PHE B 1 347 ? -21.143 -45.110  -50.371 1.00 45.62  ? 348 PHE B O   1 
ATOM   5214  C CB  . PHE B 1 347 ? -21.743 -47.229  -52.035 1.00 44.33  ? 348 PHE B CB  1 
ATOM   5215  C CG  . PHE B 1 347 ? -22.089 -48.166  -53.149 1.00 45.74  ? 348 PHE B CG  1 
ATOM   5216  C CD1 . PHE B 1 347 ? -22.735 -47.703  -54.287 1.00 47.25  ? 348 PHE B CD1 1 
ATOM   5217  C CD2 . PHE B 1 347 ? -21.765 -49.509  -53.067 1.00 45.59  ? 348 PHE B CD2 1 
ATOM   5218  C CE1 . PHE B 1 347 ? -23.053 -48.566  -55.321 1.00 47.84  ? 348 PHE B CE1 1 
ATOM   5219  C CE2 . PHE B 1 347 ? -22.081 -50.377  -54.098 1.00 46.31  ? 348 PHE B CE2 1 
ATOM   5220  C CZ  . PHE B 1 347 ? -22.725 -49.903  -55.226 1.00 46.76  ? 348 PHE B CZ  1 
ATOM   5221  N N   . GLY B 1 348 ? -18.979 -45.060  -50.991 1.00 41.94  ? 349 GLY B N   1 
ATOM   5222  C CA  . GLY B 1 348 ? -18.558 -44.264  -49.856 1.00 41.50  ? 349 GLY B CA  1 
ATOM   5223  C C   . GLY B 1 348 ? -17.326 -44.877  -49.225 1.00 38.74  ? 349 GLY B C   1 
ATOM   5224  O O   . GLY B 1 348 ? -16.627 -45.670  -49.854 1.00 37.86  ? 349 GLY B O   1 
ATOM   5225  N N   . GLY B 1 349 ? -17.053 -44.514  -47.980 1.00 38.97  ? 350 GLY B N   1 
ATOM   5226  C CA  . GLY B 1 349 ? -15.895 -45.057  -47.299 1.00 36.59  ? 350 GLY B CA  1 
ATOM   5227  C C   . GLY B 1 349 ? -14.621 -44.371  -47.749 1.00 36.27  ? 350 GLY B C   1 
ATOM   5228  O O   . GLY B 1 349 ? -14.605 -43.159  -47.968 1.00 37.62  ? 350 GLY B O   1 
ATOM   5229  N N   . CYS B 1 350 ? -13.557 -45.148  -47.914 1.00 36.17  ? 351 CYS B N   1 
ATOM   5230  C CA  . CYS B 1 350 ? -12.223 -44.574  -48.060 1.00 37.62  ? 351 CYS B CA  1 
ATOM   5231  C C   . CYS B 1 350 ? -11.570 -44.765  -49.414 1.00 37.61  ? 351 CYS B C   1 
ATOM   5232  O O   . CYS B 1 350 ? -11.891 -45.692  -50.154 1.00 38.55  ? 351 CYS B O   1 
ATOM   5233  C CB  . CYS B 1 350 ? -11.286 -45.161  -47.005 1.00 36.73  ? 351 CYS B CB  1 
ATOM   5234  S SG  . CYS B 1 350 ? -11.713 -44.745  -45.307 1.00 37.43  ? 351 CYS B SG  1 
ATOM   5235  N N   . THR B 1 351 ? -10.633 -43.873  -49.713 1.00 34.32  ? 352 THR B N   1 
ATOM   5236  C CA  . THR B 1 351 ? -9.701  -44.061  -50.814 1.00 35.46  ? 352 THR B CA  1 
ATOM   5237  C C   . THR B 1 351 ? -8.337  -44.400  -50.239 1.00 35.77  ? 352 THR B C   1 
ATOM   5238  O O   . THR B 1 351 ? -8.017  -44.016  -49.110 1.00 35.90  ? 352 THR B O   1 
ATOM   5239  C CB  . THR B 1 351 ? -9.561  -42.811  -51.691 1.00 36.88  ? 352 THR B CB  1 
ATOM   5240  O OG1 . THR B 1 351 ? -8.890  -41.783  -50.949 1.00 35.47  ? 352 THR B OG1 1 
ATOM   5241  C CG2 . THR B 1 351 ? -10.926 -42.311  -52.166 1.00 37.45  ? 352 THR B CG2 1 
ATOM   5242  N N   . VAL B 1 352 ? -7.533  -45.115  -51.014 1.00 35.23  ? 353 VAL B N   1 
ATOM   5243  C CA  . VAL B 1 352 ? -6.162  -45.381  -50.623 1.00 34.48  ? 353 VAL B CA  1 
ATOM   5244  C C   . VAL B 1 352 ? -5.237  -44.725  -51.639 1.00 35.98  ? 353 VAL B C   1 
ATOM   5245  O O   . VAL B 1 352 ? -5.483  -44.771  -52.842 1.00 36.94  ? 353 VAL B O   1 
ATOM   5246  C CB  . VAL B 1 352 ? -5.880  -46.900  -50.503 1.00 35.45  ? 353 VAL B CB  1 
ATOM   5247  C CG1 . VAL B 1 352 ? -6.119  -47.621  -51.820 1.00 31.49  ? 353 VAL B CG1 1 
ATOM   5248  C CG2 . VAL B 1 352 ? -4.469  -47.148  -49.999 1.00 34.60  ? 353 VAL B CG2 1 
ATOM   5249  N N   . THR B 1 353 ? -4.192  -44.076  -51.147 1.00 36.79  ? 354 THR B N   1 
ATOM   5250  C CA  . THR B 1 353 ? -3.278  -43.357  -52.017 1.00 37.21  ? 354 THR B CA  1 
ATOM   5251  C C   . THR B 1 353 ? -1.847  -43.772  -51.723 1.00 37.89  ? 354 THR B C   1 
ATOM   5252  O O   . THR B 1 353 ? -1.424  -43.800  -50.564 1.00 38.14  ? 354 THR B O   1 
ATOM   5253  C CB  . THR B 1 353 ? -3.417  -41.830  -51.849 1.00 37.56  ? 354 THR B CB  1 
ATOM   5254  O OG1 . THR B 1 353 ? -4.767  -41.433  -52.125 1.00 35.69  ? 354 THR B OG1 1 
ATOM   5255  C CG2 . THR B 1 353 ? -2.469  -41.097  -52.787 1.00 38.66  ? 354 THR B CG2 1 
ATOM   5256  N N   . LEU B 1 354 ? -1.109  -44.104  -52.775 1.00 38.89  ? 355 LEU B N   1 
ATOM   5257  C CA  . LEU B 1 354 ? 0.304   -44.431  -52.645 1.00 41.07  ? 355 LEU B CA  1 
ATOM   5258  C C   . LEU B 1 354 ? 1.118   -43.222  -53.078 1.00 41.73  ? 355 LEU B C   1 
ATOM   5259  O O   . LEU B 1 354 ? 0.915   -42.698  -54.168 1.00 41.08  ? 355 LEU B O   1 
ATOM   5260  C CB  . LEU B 1 354 ? 0.659   -45.657  -53.485 1.00 42.57  ? 355 LEU B CB  1 
ATOM   5261  C CG  . LEU B 1 354 ? 2.023   -46.290  -53.221 1.00 44.02  ? 355 LEU B CG  1 
ATOM   5262  C CD1 . LEU B 1 354 ? 2.108   -46.760  -51.781 1.00 44.49  ? 355 LEU B CD1 1 
ATOM   5263  C CD2 . LEU B 1 354 ? 2.274   -47.442  -54.180 1.00 44.90  ? 355 LEU B CD2 1 
ATOM   5264  N N   . LEU B 1 355 ? 2.031   -42.771  -52.224 1.00 43.02  ? 356 LEU B N   1 
ATOM   5265  C CA  . LEU B 1 355 ? 2.732   -41.520  -52.488 1.00 45.14  ? 356 LEU B CA  1 
ATOM   5266  C C   . LEU B 1 355 ? 4.067   -41.417  -51.764 1.00 45.83  ? 356 LEU B C   1 
ATOM   5267  O O   . LEU B 1 355 ? 4.315   -42.125  -50.790 1.00 46.83  ? 356 LEU B O   1 
ATOM   5268  C CB  . LEU B 1 355 ? 1.853   -40.328  -52.098 1.00 45.78  ? 356 LEU B CB  1 
ATOM   5269  C CG  . LEU B 1 355 ? 1.704   -39.975  -50.614 1.00 45.44  ? 356 LEU B CG  1 
ATOM   5270  C CD1 . LEU B 1 355 ? 1.037   -38.617  -50.467 1.00 46.30  ? 356 LEU B CD1 1 
ATOM   5271  C CD2 . LEU B 1 355 ? 0.927   -41.028  -49.831 1.00 43.94  ? 356 LEU B CD2 1 
ATOM   5272  N N   . GLU B 1 356 ? 4.924   -40.529  -52.255 1.00 47.44  ? 357 GLU B N   1 
ATOM   5273  C CA  . GLU B 1 356 ? 6.174   -40.222  -51.576 1.00 49.32  ? 357 GLU B CA  1 
ATOM   5274  C C   . GLU B 1 356 ? 5.859   -39.651  -50.200 1.00 49.58  ? 357 GLU B C   1 
ATOM   5275  O O   . GLU B 1 356 ? 4.948   -38.838  -50.059 1.00 49.87  ? 357 GLU B O   1 
ATOM   5276  C CB  . GLU B 1 356 ? 7.013   -39.239  -52.395 1.00 51.26  ? 357 GLU B CB  1 
ATOM   5277  N N   . ALA B 1 357 ? 6.598   -40.093  -49.190 1.00 50.17  ? 358 ALA B N   1 
ATOM   5278  C CA  . ALA B 1 357 ? 6.350   -39.673  -47.811 1.00 51.11  ? 358 ALA B CA  1 
ATOM   5279  C C   . ALA B 1 357 ? 6.394   -38.154  -47.665 1.00 54.17  ? 358 ALA B C   1 
ATOM   5280  O O   . ALA B 1 357 ? 5.605   -37.573  -46.925 1.00 53.99  ? 358 ALA B O   1 
ATOM   5281  C CB  . ALA B 1 357 ? 7.357   -40.320  -46.875 1.00 50.32  ? 358 ALA B CB  1 
ATOM   5282  N N   . SER B 1 358 ? 7.309   -37.519  -48.392 1.00 57.08  ? 359 SER B N   1 
ATOM   5283  C CA  . SER B 1 358 ? 7.498   -36.071  -48.323 1.00 59.54  ? 359 SER B CA  1 
ATOM   5284  C C   . SER B 1 358 ? 6.237   -35.303  -48.703 1.00 57.58  ? 359 SER B C   1 
ATOM   5285  O O   . SER B 1 358 ? 5.997   -34.200  -48.212 1.00 58.89  ? 359 SER B O   1 
ATOM   5286  C CB  . SER B 1 358 ? 8.642   -35.642  -49.246 1.00 63.22  ? 359 SER B CB  1 
ATOM   5287  O OG  . SER B 1 358 ? 9.673   -36.611  -49.270 1.00 64.86  ? 359 SER B OG  1 
ATOM   5288  N N   . ALA B 1 359 ? 5.436   -35.898  -49.579 1.00 54.03  ? 360 ALA B N   1 
ATOM   5289  C CA  . ALA B 1 359 ? 4.312   -35.203  -50.194 1.00 50.92  ? 360 ALA B CA  1 
ATOM   5290  C C   . ALA B 1 359 ? 3.014   -35.328  -49.404 1.00 47.53  ? 360 ALA B C   1 
ATOM   5291  O O   . ALA B 1 359 ? 2.000   -34.736  -49.775 1.00 48.21  ? 360 ALA B O   1 
ATOM   5292  C CB  . ALA B 1 359 ? 4.107   -35.717  -51.607 1.00 50.19  ? 360 ALA B CB  1 
ATOM   5293  N N   . ALA B 1 360 ? 3.043   -36.099  -48.324 1.00 44.98  ? 361 ALA B N   1 
ATOM   5294  C CA  . ALA B 1 360 ? 1.834   -36.345  -47.541 1.00 45.32  ? 361 ALA B CA  1 
ATOM   5295  C C   . ALA B 1 360 ? 1.175   -35.069  -46.985 1.00 48.13  ? 361 ALA B C   1 
ATOM   5296  O O   . ALA B 1 360 ? -0.050  -34.948  -47.041 1.00 47.31  ? 361 ALA B O   1 
ATOM   5297  C CB  . ALA B 1 360 ? 2.135   -37.321  -46.408 1.00 44.26  ? 361 ALA B CB  1 
ATOM   5298  N N   . PRO B 1 361 ? 1.966   -34.116  -46.446 1.00 51.90  ? 362 PRO B N   1 
ATOM   5299  C CA  . PRO B 1 361 ? 1.274   -32.919  -45.950 1.00 53.79  ? 362 PRO B CA  1 
ATOM   5300  C C   . PRO B 1 361 ? 0.678   -32.064  -47.066 1.00 55.26  ? 362 PRO B C   1 
ATOM   5301  O O   . PRO B 1 361 ? -0.393  -31.489  -46.876 1.00 56.27  ? 362 PRO B O   1 
ATOM   5302  C CB  . PRO B 1 361 ? 2.378   -32.156  -45.208 1.00 55.48  ? 362 PRO B CB  1 
ATOM   5303  C CG  . PRO B 1 361 ? 3.379   -33.203  -44.837 1.00 54.97  ? 362 PRO B CG  1 
ATOM   5304  C CD  . PRO B 1 361 ? 3.376   -34.139  -46.014 1.00 53.54  ? 362 PRO B CD  1 
ATOM   5305  N N   . HIS B 1 362 ? 1.365   -31.982  -48.202 1.00 55.49  ? 363 HIS B N   1 
ATOM   5306  C CA  . HIS B 1 362 ? 0.837   -31.289  -49.372 1.00 57.11  ? 363 HIS B CA  1 
ATOM   5307  C C   . HIS B 1 362 ? -0.427  -31.983  -49.864 1.00 54.44  ? 363 HIS B C   1 
ATOM   5308  O O   . HIS B 1 362 ? -1.424  -31.330  -50.173 1.00 53.57  ? 363 HIS B O   1 
ATOM   5309  C CB  . HIS B 1 362 ? 1.887   -31.238  -50.486 1.00 59.57  ? 363 HIS B CB  1 
ATOM   5310  C CG  . HIS B 1 362 ? 1.439   -30.490  -51.710 1.00 62.86  ? 363 HIS B CG  1 
ATOM   5311  N ND1 . HIS B 1 362 ? 0.322   -29.694  -51.730 1.00 64.66  ? 363 HIS B ND1 1 
ATOM   5312  C CD2 . HIS B 1 362 ? 1.976   -30.432  -52.954 1.00 63.31  ? 363 HIS B CD2 1 
ATOM   5313  C CE1 . HIS B 1 362 ? 0.179   -29.168  -52.941 1.00 64.19  ? 363 HIS B CE1 1 
ATOM   5314  N NE2 . HIS B 1 362 ? 1.168   -29.599  -53.694 1.00 63.79  ? 363 HIS B NE2 1 
ATOM   5315  N N   . ALA B 1 363 ? -0.377  -33.312  -49.924 1.00 52.98  ? 364 ALA B N   1 
ATOM   5316  C CA  . ALA B 1 363 ? -1.504  -34.112  -50.389 1.00 52.29  ? 364 ALA B CA  1 
ATOM   5317  C C   . ALA B 1 363 ? -2.748  -33.879  -49.540 1.00 52.64  ? 364 ALA B C   1 
ATOM   5318  O O   . ALA B 1 363 ? -3.820  -33.597  -50.071 1.00 53.86  ? 364 ALA B O   1 
ATOM   5319  C CB  . ALA B 1 363 ? -1.138  -35.591  -50.392 1.00 50.89  ? 364 ALA B CB  1 
ATOM   5320  N N   . MET B 1 364 ? -2.599  -33.995  -48.224 1.00 52.47  ? 365 MET B N   1 
ATOM   5321  C CA  . MET B 1 364 ? -3.722  -33.807  -47.311 1.00 52.04  ? 365 MET B CA  1 
ATOM   5322  C C   . MET B 1 364 ? -4.331  -32.411  -47.431 1.00 54.11  ? 365 MET B C   1 
ATOM   5323  O O   . MET B 1 364 ? -5.551  -32.266  -47.500 1.00 54.82  ? 365 MET B O   1 
ATOM   5324  C CB  . MET B 1 364 ? -3.287  -34.064  -45.868 1.00 50.11  ? 365 MET B CB  1 
ATOM   5325  C CG  . MET B 1 364 ? -3.101  -35.533  -45.527 1.00 47.37  ? 365 MET B CG  1 
ATOM   5326  S SD  . MET B 1 364 ? -2.583  -35.755  -43.813 1.00 46.47  ? 365 MET B SD  1 
ATOM   5327  C CE  . MET B 1 364 ? -0.960  -34.997  -43.868 1.00 48.75  ? 365 MET B CE  1 
ATOM   5328  N N   . ARG B 1 365 ? -3.480  -31.389  -47.461 1.00 54.91  ? 366 ARG B N   1 
ATOM   5329  C CA  . ARG B 1 365 ? -3.948  -30.012  -47.583 1.00 57.75  ? 366 ARG B CA  1 
ATOM   5330  C C   . ARG B 1 365 ? -4.728  -29.812  -48.874 1.00 58.65  ? 366 ARG B C   1 
ATOM   5331  O O   . ARG B 1 365 ? -5.778  -29.170  -48.887 1.00 60.68  ? 366 ARG B O   1 
ATOM   5332  C CB  . ARG B 1 365 ? -2.771  -29.035  -47.526 1.00 59.59  ? 366 ARG B CB  1 
ATOM   5333  N N   . HIS B 1 366 ? -4.213  -30.379  -49.959 1.00 57.38  ? 367 HIS B N   1 
ATOM   5334  C CA  . HIS B 1 366 ? -4.831  -30.223  -51.269 1.00 56.93  ? 367 HIS B CA  1 
ATOM   5335  C C   . HIS B 1 366 ? -6.146  -30.986  -51.369 1.00 54.25  ? 367 HIS B C   1 
ATOM   5336  O O   . HIS B 1 366 ? -7.129  -30.479  -51.912 1.00 54.51  ? 367 HIS B O   1 
ATOM   5337  C CB  . HIS B 1 366 ? -3.874  -30.689  -52.366 1.00 57.44  ? 367 HIS B CB  1 
ATOM   5338  C CG  . HIS B 1 366 ? -4.351  -30.377  -53.749 1.00 58.82  ? 367 HIS B CG  1 
ATOM   5339  N ND1 . HIS B 1 366 ? -5.263  -31.165  -54.418 1.00 58.22  ? 367 HIS B ND1 1 
ATOM   5340  C CD2 . HIS B 1 366 ? -4.050  -29.355  -54.584 1.00 60.34  ? 367 HIS B CD2 1 
ATOM   5341  C CE1 . HIS B 1 366 ? -5.501  -30.642  -55.608 1.00 58.40  ? 367 HIS B CE1 1 
ATOM   5342  N NE2 . HIS B 1 366 ? -4.777  -29.545  -55.733 1.00 60.24  ? 367 HIS B NE2 1 
ATOM   5343  N N   . ILE B 1 367 ? -6.155  -32.209  -50.847 1.00 51.35  ? 368 ILE B N   1 
ATOM   5344  C CA  . ILE B 1 367 ? -7.337  -33.058  -50.915 1.00 50.70  ? 368 ILE B CA  1 
ATOM   5345  C C   . ILE B 1 367 ? -8.507  -32.454  -50.139 1.00 53.44  ? 368 ILE B C   1 
ATOM   5346  O O   . ILE B 1 367 ? -9.637  -32.446  -50.623 1.00 53.72  ? 368 ILE B O   1 
ATOM   5347  C CB  . ILE B 1 367 ? -7.039  -34.473  -50.382 1.00 47.91  ? 368 ILE B CB  1 
ATOM   5348  C CG1 . ILE B 1 367 ? -6.170  -35.241  -51.379 1.00 46.47  ? 368 ILE B CG1 1 
ATOM   5349  C CG2 . ILE B 1 367 ? -8.328  -35.238  -50.129 1.00 46.72  ? 368 ILE B CG2 1 
ATOM   5350  C CD1 . ILE B 1 367 ? -5.534  -36.490  -50.793 1.00 45.55  ? 368 ILE B CD1 1 
ATOM   5351  N N   . GLN B 1 368 ? -8.235  -31.936  -48.945 1.00 55.37  ? 369 GLN B N   1 
ATOM   5352  C CA  . GLN B 1 368 ? -9.298  -31.387  -48.108 1.00 57.81  ? 369 GLN B CA  1 
ATOM   5353  C C   . GLN B 1 368 ? -9.892  -30.115  -48.705 1.00 59.34  ? 369 GLN B C   1 
ATOM   5354  O O   . GLN B 1 368 ? -11.091 -29.867  -48.585 1.00 59.32  ? 369 GLN B O   1 
ATOM   5355  C CB  . GLN B 1 368 ? -8.783  -31.103  -46.696 1.00 59.08  ? 369 GLN B CB  1 
ATOM   5356  C CG  . GLN B 1 368 ? -9.866  -30.644  -45.725 1.00 60.98  ? 369 GLN B CG  1 
ATOM   5357  C CD  . GLN B 1 368 ? -10.807 -31.767  -45.316 1.00 60.73  ? 369 GLN B CD  1 
ATOM   5358  O OE1 . GLN B 1 368 ? -11.795 -32.047  -45.997 1.00 60.11  ? 369 GLN B OE1 1 
ATOM   5359  N NE2 . GLN B 1 368 ? -10.509 -32.408  -44.188 1.00 60.82  ? 369 GLN B NE2 1 
ATOM   5360  N N   . GLU B 1 369 ? -9.051  -29.315  -49.350 1.00 61.15  ? 370 GLU B N   1 
ATOM   5361  C CA  . GLU B 1 369 ? -9.499  -28.054  -49.934 1.00 63.80  ? 370 GLU B CA  1 
ATOM   5362  C C   . GLU B 1 369 ? -10.284 -28.276  -51.224 1.00 63.77  ? 370 GLU B C   1 
ATOM   5363  O O   . GLU B 1 369 ? -11.182 -27.500  -51.553 1.00 65.42  ? 370 GLU B O   1 
ATOM   5364  C CB  . GLU B 1 369 ? -8.306  -27.133  -50.202 1.00 65.35  ? 370 GLU B CB  1 
ATOM   5365  N N   . HIS B 1 370 ? -9.945  -29.336  -51.951 1.00 61.65  ? 371 HIS B N   1 
ATOM   5366  C CA  . HIS B 1 370 ? -10.592 -29.610  -53.229 1.00 60.60  ? 371 HIS B CA  1 
ATOM   5367  C C   . HIS B 1 370 ? -11.687 -30.665  -53.087 1.00 59.13  ? 371 HIS B C   1 
ATOM   5368  O O   . HIS B 1 370 ? -12.187 -31.183  -54.083 1.00 59.20  ? 371 HIS B O   1 
ATOM   5369  C CB  . HIS B 1 370 ? -9.560  -30.056  -54.268 1.00 58.95  ? 371 HIS B CB  1 
ATOM   5370  N N   . TYR B 1 371 ? -12.053 -30.979  -51.847 1.00 56.73  ? 372 TYR B N   1 
ATOM   5371  C CA  . TYR B 1 371 ? -13.134 -31.925  -51.583 1.00 54.21  ? 372 TYR B CA  1 
ATOM   5372  C C   . TYR B 1 371 ? -14.330 -31.224  -50.953 1.00 56.27  ? 372 TYR B C   1 
ATOM   5373  O O   . TYR B 1 371 ? -14.182 -30.457  -49.998 1.00 58.42  ? 372 TYR B O   1 
ATOM   5374  C CB  . TYR B 1 371 ? -12.647 -33.056  -50.679 1.00 50.56  ? 372 TYR B CB  1 
ATOM   5375  C CG  . TYR B 1 371 ? -13.713 -34.040  -50.256 1.00 49.03  ? 372 TYR B CG  1 
ATOM   5376  C CD1 . TYR B 1 371 ? -14.548 -34.644  -51.190 1.00 48.39  ? 372 TYR B CD1 1 
ATOM   5377  C CD2 . TYR B 1 371 ? -13.861 -34.392  -48.920 1.00 49.01  ? 372 TYR B CD2 1 
ATOM   5378  C CE1 . TYR B 1 371 ? -15.518 -35.555  -50.797 1.00 47.65  ? 372 TYR B CE1 1 
ATOM   5379  C CE2 . TYR B 1 371 ? -14.821 -35.299  -48.519 1.00 47.89  ? 372 TYR B CE2 1 
ATOM   5380  C CZ  . TYR B 1 371 ? -15.647 -35.878  -49.455 1.00 47.27  ? 372 TYR B CZ  1 
ATOM   5381  O OH  . TYR B 1 371 ? -16.600 -36.783  -49.040 1.00 46.15  ? 372 TYR B OH  1 
ATOM   5382  N N   . GLY B 1 372 ? -15.515 -31.499  -51.487 1.00 56.26  ? 373 GLY B N   1 
ATOM   5383  C CA  . GLY B 1 372 ? -16.731 -30.841  -51.043 1.00 58.39  ? 373 GLY B CA  1 
ATOM   5384  C C   . GLY B 1 372 ? -17.128 -31.148  -49.611 1.00 57.93  ? 373 GLY B C   1 
ATOM   5385  O O   . GLY B 1 372 ? -17.726 -30.316  -48.932 1.00 60.03  ? 373 GLY B O   1 
ATOM   5386  N N   . GLY B 1 373 ? -16.796 -32.345  -49.145 1.00 55.50  ? 374 GLY B N   1 
ATOM   5387  C CA  . GLY B 1 373 ? -17.176 -32.758  -47.809 1.00 54.68  ? 374 GLY B CA  1 
ATOM   5388  C C   . GLY B 1 373 ? -16.072 -32.555  -46.795 1.00 53.95  ? 374 GLY B C   1 
ATOM   5389  O O   . GLY B 1 373 ? -15.169 -31.738  -46.988 1.00 54.05  ? 374 GLY B O   1 
ATOM   5390  N N   . THR B 1 374 ? -16.159 -33.301  -45.700 1.00 52.77  ? 375 THR B N   1 
ATOM   5391  C CA  . THR B 1 374 ? -15.136 -33.287  -44.667 1.00 51.87  ? 375 THR B CA  1 
ATOM   5392  C C   . THR B 1 374 ? -14.323 -34.570  -44.731 1.00 48.82  ? 375 THR B C   1 
ATOM   5393  O O   . THR B 1 374 ? -14.841 -35.660  -44.484 1.00 47.31  ? 375 THR B O   1 
ATOM   5394  C CB  . THR B 1 374 ? -15.746 -33.134  -43.260 1.00 53.30  ? 375 THR B CB  1 
ATOM   5395  O OG1 . THR B 1 374 ? -16.325 -31.830  -43.129 1.00 55.52  ? 375 THR B OG1 1 
ATOM   5396  C CG2 . THR B 1 374 ? -14.677 -33.320  -42.195 1.00 53.12  ? 375 THR B CG2 1 
ATOM   5397  N N   . ALA B 1 375 ? -13.047 -34.436  -45.072 1.00 48.96  ? 376 ALA B N   1 
ATOM   5398  C CA  . ALA B 1 375 ? -12.171 -35.592  -45.210 1.00 47.64  ? 376 ALA B CA  1 
ATOM   5399  C C   . ALA B 1 375 ? -11.431 -35.902  -43.913 1.00 49.31  ? 376 ALA B C   1 
ATOM   5400  O O   . ALA B 1 375 ? -11.085 -34.999  -43.152 1.00 52.27  ? 376 ALA B O   1 
ATOM   5401  C CB  . ALA B 1 375 ? -11.179 -35.364  -46.342 1.00 47.16  ? 376 ALA B CB  1 
ATOM   5402  N N   . THR B 1 376 ? -11.207 -37.188  -43.663 1.00 46.90  ? 377 THR B N   1 
ATOM   5403  C CA  . THR B 1 376 ? -10.355 -37.631  -42.567 1.00 45.50  ? 377 THR B CA  1 
ATOM   5404  C C   . THR B 1 376 ? -9.183  -38.410  -43.158 1.00 42.73  ? 377 THR B C   1 
ATOM   5405  O O   . THR B 1 376 ? -9.370  -39.228  -44.061 1.00 41.48  ? 377 THR B O   1 
ATOM   5406  C CB  . THR B 1 376 ? -11.119 -38.516  -41.555 1.00 45.64  ? 377 THR B CB  1 
ATOM   5407  O OG1 . THR B 1 376 ? -12.231 -37.790  -41.017 1.00 47.50  ? 377 THR B OG1 1 
ATOM   5408  C CG2 . THR B 1 376 ? -10.203 -38.949  -40.412 1.00 45.76  ? 377 THR B CG2 1 
ATOM   5409  N N   . PHE B 1 377 ? -7.978  -38.147  -42.661 1.00 41.46  ? 378 PHE B N   1 
ATOM   5410  C CA  . PHE B 1 377 ? -6.784  -38.808  -43.170 1.00 39.81  ? 378 PHE B CA  1 
ATOM   5411  C C   . PHE B 1 377 ? -6.140  -39.743  -42.153 1.00 41.23  ? 378 PHE B C   1 
ATOM   5412  O O   . PHE B 1 377 ? -6.069  -39.431  -40.961 1.00 41.53  ? 378 PHE B O   1 
ATOM   5413  C CB  . PHE B 1 377 ? -5.749  -37.775  -43.612 1.00 40.54  ? 378 PHE B CB  1 
ATOM   5414  C CG  . PHE B 1 377 ? -6.257  -36.803  -44.637 1.00 40.76  ? 378 PHE B CG  1 
ATOM   5415  C CD1 . PHE B 1 377 ? -6.419  -37.189  -45.962 1.00 43.84  ? 378 PHE B CD1 1 
ATOM   5416  C CD2 . PHE B 1 377 ? -6.562  -35.500  -44.280 1.00 42.33  ? 378 PHE B CD2 1 
ATOM   5417  C CE1 . PHE B 1 377 ? -6.880  -36.292  -46.909 1.00 40.96  ? 378 PHE B CE1 1 
ATOM   5418  C CE2 . PHE B 1 377 ? -7.025  -34.594  -45.224 1.00 46.75  ? 378 PHE B CE2 1 
ATOM   5419  C CZ  . PHE B 1 377 ? -7.186  -34.993  -46.543 1.00 42.55  ? 378 PHE B CZ  1 
ATOM   5420  N N   . TYR B 1 378 ? -5.671  -40.887  -42.642 1.00 41.03  ? 379 TYR B N   1 
ATOM   5421  C CA  . TYR B 1 378 ? -4.793  -41.767  -41.881 1.00 41.34  ? 379 TYR B CA  1 
ATOM   5422  C C   . TYR B 1 378 ? -3.529  -42.038  -42.686 1.00 41.73  ? 379 TYR B C   1 
ATOM   5423  O O   . TYR B 1 378 ? -3.604  -42.440  -43.849 1.00 41.79  ? 379 TYR B O   1 
ATOM   5424  C CB  . TYR B 1 378 ? -5.472  -43.096  -41.551 1.00 40.44  ? 379 TYR B CB  1 
ATOM   5425  C CG  . TYR B 1 378 ? -6.799  -42.977  -40.852 1.00 42.05  ? 379 TYR B CG  1 
ATOM   5426  C CD1 . TYR B 1 378 ? -6.867  -42.868  -39.471 1.00 44.19  ? 379 TYR B CD1 1 
ATOM   5427  C CD2 . TYR B 1 378 ? -7.988  -42.996  -41.570 1.00 42.95  ? 379 TYR B CD2 1 
ATOM   5428  C CE1 . TYR B 1 378 ? -8.079  -42.765  -38.823 1.00 46.04  ? 379 TYR B CE1 1 
ATOM   5429  C CE2 . TYR B 1 378 ? -9.208  -42.894  -40.932 1.00 45.42  ? 379 TYR B CE2 1 
ATOM   5430  C CZ  . TYR B 1 378 ? -9.246  -42.779  -39.555 1.00 47.12  ? 379 TYR B CZ  1 
ATOM   5431  O OH  . TYR B 1 378 ? -10.452 -42.678  -38.905 1.00 49.83  ? 379 TYR B OH  1 
ATOM   5432  N N   . LEU B 1 379 ? -2.376  -41.803  -42.074 1.00 41.91  ? 380 LEU B N   1 
ATOM   5433  C CA  . LEU B 1 379 ? -1.108  -42.265  -42.619 1.00 43.77  ? 380 LEU B CA  1 
ATOM   5434  C C   . LEU B 1 379 ? -0.737  -43.559  -41.917 1.00 45.82  ? 380 LEU B C   1 
ATOM   5435  O O   . LEU B 1 379 ? -0.418  -43.544  -40.731 1.00 46.97  ? 380 LEU B O   1 
ATOM   5436  C CB  . LEU B 1 379 ? -0.006  -41.227  -42.422 1.00 44.81  ? 380 LEU B CB  1 
ATOM   5437  C CG  . LEU B 1 379 ? 0.056   -40.054  -43.391 1.00 45.96  ? 380 LEU B CG  1 
ATOM   5438  C CD1 . LEU B 1 379 ? 1.212   -39.134  -43.021 1.00 46.84  ? 380 LEU B CD1 1 
ATOM   5439  C CD2 . LEU B 1 379 ? 0.203   -40.574  -44.815 1.00 44.59  ? 380 LEU B CD2 1 
ATOM   5440  N N   . SER B 1 380 ? -0.777  -44.682  -42.624 1.00 47.12  ? 381 SER B N   1 
ATOM   5441  C CA  . SER B 1 380 ? -0.560  -45.949  -41.934 1.00 49.07  ? 381 SER B CA  1 
ATOM   5442  C C   . SER B 1 380 ? 0.598   -46.780  -42.469 1.00 48.08  ? 381 SER B C   1 
ATOM   5443  O O   . SER B 1 380 ? 0.804   -46.898  -43.678 1.00 47.11  ? 381 SER B O   1 
ATOM   5444  C CB  . SER B 1 380 ? -1.832  -46.798  -41.971 1.00 50.61  ? 381 SER B CB  1 
ATOM   5445  O OG  . SER B 1 380 ? -1.775  -47.825  -40.989 1.00 51.32  ? 381 SER B OG  1 
ATOM   5446  N N   . GLN B 1 381 ? 1.347   -47.350  -41.533 1.00 48.17  ? 382 GLN B N   1 
ATOM   5447  C CA  . GLN B 1 381 ? 2.314   -48.398  -41.818 1.00 48.14  ? 382 GLN B CA  1 
ATOM   5448  C C   . GLN B 1 381 ? 1.575   -49.707  -42.077 1.00 42.80  ? 382 GLN B C   1 
ATOM   5449  O O   . GLN B 1 381 ? 0.468   -49.905  -41.578 1.00 42.12  ? 382 GLN B O   1 
ATOM   5450  C CB  . GLN B 1 381 ? 3.275   -48.581  -40.633 1.00 53.39  ? 382 GLN B CB  1 
ATOM   5451  C CG  . GLN B 1 381 ? 4.433   -47.600  -40.527 1.00 57.87  ? 382 GLN B CG  1 
ATOM   5452  C CD  . GLN B 1 381 ? 5.658   -48.239  -39.889 1.00 60.98  ? 382 GLN B CD  1 
ATOM   5453  O OE1 . GLN B 1 381 ? 5.610   -49.387  -39.446 1.00 61.64  ? 382 GLN B OE1 1 
ATOM   5454  N NE2 . GLN B 1 381 ? 6.756   -47.494  -39.829 1.00 62.82  ? 382 GLN B NE2 1 
ATOM   5455  N N   . ALA B 1 382 ? 2.189   -50.604  -42.839 1.00 38.68  ? 383 ALA B N   1 
ATOM   5456  C CA  . ALA B 1 382 ? 1.750   -51.990  -42.856 1.00 34.94  ? 383 ALA B CA  1 
ATOM   5457  C C   . ALA B 1 382 ? 1.876   -52.540  -41.436 1.00 35.92  ? 383 ALA B C   1 
ATOM   5458  O O   . ALA B 1 382 ? 2.962   -52.516  -40.857 1.00 37.46  ? 383 ALA B O   1 
ATOM   5459  C CB  . ALA B 1 382 ? 2.577   -52.806  -43.824 1.00 34.13  ? 383 ALA B CB  1 
ATOM   5460  N N   . ALA B 1 383 ? 0.773   -53.020  -40.871 1.00 34.02  ? 384 ALA B N   1 
ATOM   5461  C CA  . ALA B 1 383 ? 0.746   -53.395  -39.459 1.00 34.02  ? 384 ALA B CA  1 
ATOM   5462  C C   . ALA B 1 383 ? 0.575   -54.897  -39.234 1.00 34.35  ? 384 ALA B C   1 
ATOM   5463  O O   . ALA B 1 383 ? 0.314   -55.653  -40.173 1.00 32.27  ? 384 ALA B O   1 
ATOM   5464  C CB  . ALA B 1 383 ? -0.361  -52.636  -38.750 1.00 32.83  ? 384 ALA B CB  1 
ATOM   5465  N N   . ASP B 1 384 ? 0.736   -55.316  -37.978 1.00 33.11  ? 385 ASP B N   1 
ATOM   5466  C CA  . ASP B 1 384 ? 0.541   -56.709  -37.584 1.00 36.35  ? 385 ASP B CA  1 
ATOM   5467  C C   . ASP B 1 384 ? -0.916  -57.135  -37.696 1.00 32.80  ? 385 ASP B C   1 
ATOM   5468  O O   . ASP B 1 384 ? -1.819  -56.305  -37.610 1.00 32.63  ? 385 ASP B O   1 
ATOM   5469  C CB  . ASP B 1 384 ? 1.009   -56.937  -36.140 1.00 36.21  ? 385 ASP B CB  1 
ATOM   5470  C CG  . ASP B 1 384 ? 2.518   -57.011  -36.015 1.00 37.62  ? 385 ASP B CG  1 
ATOM   5471  O OD1 . ASP B 1 384 ? 3.183   -57.428  -36.990 1.00 36.48  ? 385 ASP B OD1 1 
ATOM   5472  O OD2 . ASP B 1 384 ? 3.035   -56.655  -34.933 1.00 38.73  ? 385 ASP B OD2 1 
ATOM   5473  N N   . GLY B 1 385 ? -1.138  -58.436  -37.865 1.00 32.82  ? 386 GLY B N   1 
ATOM   5474  C CA  . GLY B 1 385 ? -2.463  -59.005  -37.714 1.00 36.92  ? 386 GLY B CA  1 
ATOM   5475  C C   . GLY B 1 385 ? -2.789  -59.216  -36.240 1.00 40.62  ? 386 GLY B C   1 
ATOM   5476  O O   . GLY B 1 385 ? -2.261  -58.517  -35.368 1.00 34.64  ? 386 GLY B O   1 
ATOM   5477  N N   . ALA B 1 386 ? -3.647  -60.193  -35.959 1.00 36.13  ? 387 ALA B N   1 
ATOM   5478  C CA  . ALA B 1 386 ? -4.123  -60.437  -34.600 1.00 39.02  ? 387 ALA B CA  1 
ATOM   5479  C C   . ALA B 1 386 ? -2.996  -60.862  -33.660 1.00 39.55  ? 387 ALA B C   1 
ATOM   5480  O O   . ALA B 1 386 ? -2.165  -61.689  -34.014 1.00 35.10  ? 387 ALA B O   1 
ATOM   5481  C CB  . ALA B 1 386 ? -5.220  -61.492  -34.612 1.00 37.93  ? 387 ALA B CB  1 
ATOM   5482  N N   . LYS B 1 387 ? -2.964  -60.293  -32.460 1.00 39.36  ? 388 LYS B N   1 
ATOM   5483  C CA  . LYS B 1 387 ? -1.963  -60.713  -31.488 1.00 41.20  ? 388 LYS B CA  1 
ATOM   5484  C C   . LYS B 1 387 ? -2.487  -60.730  -30.059 1.00 41.10  ? 388 LYS B C   1 
ATOM   5485  O O   . LYS B 1 387 ? -3.605  -60.293  -29.786 1.00 40.58  ? 388 LYS B O   1 
ATOM   5486  C CB  . LYS B 1 387 ? -0.713  -59.831  -31.584 1.00 42.64  ? 388 LYS B CB  1 
ATOM   5487  C CG  . LYS B 1 387 ? -0.961  -58.353  -31.791 1.00 43.31  ? 388 LYS B CG  1 
ATOM   5488  C CD  . LYS B 1 387 ? 0.312   -57.680  -32.309 1.00 43.02  ? 388 LYS B CD  1 
ATOM   5489  C CE  . LYS B 1 387 ? 0.144   -56.175  -32.438 1.00 42.17  ? 388 LYS B CE  1 
ATOM   5490  N NZ  . LYS B 1 387 ? 1.386   -55.523  -32.944 1.00 41.88  ? 388 LYS B NZ  1 
ATOM   5491  N N   . VAL B 1 388 ? -1.662  -61.262  -29.161 1.00 41.56  ? 389 VAL B N   1 
ATOM   5492  C CA  . VAL B 1 388 ? -2.018  -61.453  -27.760 1.00 42.08  ? 389 VAL B CA  1 
ATOM   5493  C C   . VAL B 1 388 ? -0.970  -60.838  -26.838 1.00 42.52  ? 389 VAL B C   1 
ATOM   5494  O O   . VAL B 1 388 ? 0.231   -60.942  -27.094 1.00 42.34  ? 389 VAL B O   1 
ATOM   5495  C CB  . VAL B 1 388 ? -2.165  -62.959  -27.419 1.00 48.30  ? 389 VAL B CB  1 
ATOM   5496  C CG1 . VAL B 1 388 ? -2.408  -63.171  -25.918 1.00 50.41  ? 389 VAL B CG1 1 
ATOM   5497  C CG2 . VAL B 1 388 ? -3.276  -63.591  -28.238 1.00 48.68  ? 389 VAL B CG2 1 
ATOM   5498  N N   . LEU B 1 389 ? -1.426  -60.189  -25.772 1.00 40.00  ? 390 LEU B N   1 
ATOM   5499  C CA  . LEU B 1 389 ? -0.533  -59.764  -24.705 1.00 40.78  ? 390 LEU B CA  1 
ATOM   5500  C C   . LEU B 1 389 ? -1.096  -60.201  -23.358 1.00 41.94  ? 390 LEU B C   1 
ATOM   5501  O O   . LEU B 1 389 ? -2.184  -59.781  -22.963 1.00 42.19  ? 390 LEU B O   1 
ATOM   5502  C CB  . LEU B 1 389 ? -0.323  -58.251  -24.717 1.00 43.27  ? 390 LEU B CB  1 
ATOM   5503  C CG  . LEU B 1 389 ? 0.547   -57.750  -23.562 1.00 45.28  ? 390 LEU B CG  1 
ATOM   5504  C CD1 . LEU B 1 389 ? 1.966   -58.292  -23.680 1.00 45.41  ? 390 LEU B CD1 1 
ATOM   5505  C CD2 . LEU B 1 389 ? 0.548   -56.228  -23.492 1.00 46.78  ? 390 LEU B CD2 1 
ATOM   5506  N N   . CYS B 1 390 ? -0.356  -61.059  -22.667 1.00 42.79  ? 391 CYS B N   1 
ATOM   5507  C CA  . CYS B 1 390 ? -0.757  -61.511  -21.338 1.00 44.98  ? 391 CYS B CA  1 
ATOM   5508  C C   . CYS B 1 390 ? -0.556  -60.392  -20.323 1.00 46.38  ? 391 CYS B C   1 
ATOM   5509  O O   . CYS B 1 390 ? 0.502   -59.764  -20.285 1.00 46.06  ? 391 CYS B O   1 
ATOM   5510  C CB  . CYS B 1 390 ? 0.033   -62.759  -20.933 1.00 45.45  ? 391 CYS B CB  1 
ATOM   5511  S SG  . CYS B 1 390 ? -0.081  -64.122  -22.136 1.00 44.47  ? 391 CYS B SG  1 
ATOM   5512  N N   . LEU B 1 391 ? -1.577  -60.136  -19.510 1.00 47.23  ? 392 LEU B N   1 
ATOM   5513  C CA  . LEU B 1 391 ? -1.512  -59.059  -18.529 1.00 48.56  ? 392 LEU B CA  1 
ATOM   5514  C C   . LEU B 1 391 ? -1.338  -59.618  -17.122 1.00 51.28  ? 392 LEU B C   1 
ATOM   5515  O O   . LEU B 1 391 ? -1.474  -60.824  -16.904 1.00 53.21  ? 392 LEU B O   1 
ATOM   5516  C CB  . LEU B 1 391 ? -2.766  -58.183  -18.595 1.00 49.33  ? 392 LEU B CB  1 
ATOM   5517  C CG  . LEU B 1 391 ? -3.150  -57.623  -19.972 1.00 49.56  ? 392 LEU B CG  1 
ATOM   5518  C CD1 . LEU B 1 391 ? -4.395  -56.751  -19.870 1.00 50.27  ? 392 LEU B CD1 1 
ATOM   5519  C CD2 . LEU B 1 391 ? -1.994  -56.852  -20.604 1.00 48.09  ? 392 LEU B CD2 1 
ATOM   5520  O OXT . LEU B 1 391 ? -1.053  -58.876  -16.178 1.00 50.98  ? 392 LEU B OXT 1 
ATOM   5521  N N   . ALA C 1 1   ? 5.965   -99.229  -32.688 1.00 85.60  ? 2   ALA C N   1 
ATOM   5522  C CA  . ALA C 1 1   ? 6.812   -99.054  -31.515 1.00 84.68  ? 2   ALA C CA  1 
ATOM   5523  C C   . ALA C 1 1   ? 7.931   -98.050  -31.778 1.00 82.07  ? 2   ALA C C   1 
ATOM   5524  O O   . ALA C 1 1   ? 8.395   -97.373  -30.863 1.00 79.84  ? 2   ALA C O   1 
ATOM   5525  C CB  . ALA C 1 1   ? 7.390   -100.384 -31.082 1.00 86.89  ? 2   ALA C CB  1 
ATOM   5526  N N   . ALA C 1 2   ? 8.358   -97.952  -33.033 1.00 82.77  ? 3   ALA C N   1 
ATOM   5527  C CA  . ALA C 1 2   ? 9.404   -97.007  -33.404 1.00 81.03  ? 3   ALA C CA  1 
ATOM   5528  C C   . ALA C 1 2   ? 8.820   -95.629  -33.719 1.00 78.75  ? 3   ALA C C   1 
ATOM   5529  O O   . ALA C 1 2   ? 9.538   -94.720  -34.138 1.00 76.06  ? 3   ALA C O   1 
ATOM   5530  C CB  . ALA C 1 2   ? 10.195  -97.534  -34.592 1.00 82.38  ? 3   ALA C CB  1 
ATOM   5531  N N   . LEU C 1 3   ? 7.514   -95.483  -33.514 1.00 79.23  ? 4   LEU C N   1 
ATOM   5532  C CA  . LEU C 1 3   ? 6.827   -94.224  -33.785 1.00 77.17  ? 4   LEU C CA  1 
ATOM   5533  C C   . LEU C 1 3   ? 6.690   -93.371  -32.529 1.00 75.21  ? 4   LEU C C   1 
ATOM   5534  O O   . LEU C 1 3   ? 6.073   -93.787  -31.548 1.00 76.66  ? 4   LEU C O   1 
ATOM   5535  C CB  . LEU C 1 3   ? 5.445   -94.486  -34.384 1.00 79.15  ? 4   LEU C CB  1 
ATOM   5536  N N   . ARG C 1 4   ? 7.268   -92.176  -32.563 1.00 71.81  ? 5   ARG C N   1 
ATOM   5537  C CA  . ARG C 1 4   ? 7.128   -91.237  -31.460 1.00 69.15  ? 5   ARG C CA  1 
ATOM   5538  C C   . ARG C 1 4   ? 5.936   -90.317  -31.706 1.00 67.73  ? 5   ARG C C   1 
ATOM   5539  O O   . ARG C 1 4   ? 5.838   -89.681  -32.756 1.00 67.24  ? 5   ARG C O   1 
ATOM   5540  C CB  . ARG C 1 4   ? 8.408   -90.418  -31.278 1.00 67.13  ? 5   ARG C CB  1 
ATOM   5541  N N   . GLN C 1 5   ? 5.025   -90.266  -30.741 1.00 66.99  ? 6   GLN C N   1 
ATOM   5542  C CA  . GLN C 1 5   ? 3.876   -89.375  -30.821 1.00 65.50  ? 6   GLN C CA  1 
ATOM   5543  C C   . GLN C 1 5   ? 4.211   -88.046  -30.153 1.00 62.95  ? 6   GLN C C   1 
ATOM   5544  O O   . GLN C 1 5   ? 4.870   -88.023  -29.112 1.00 62.34  ? 6   GLN C O   1 
ATOM   5545  C CB  . GLN C 1 5   ? 2.647   -90.012  -30.170 1.00 67.21  ? 6   GLN C CB  1 
ATOM   5546  N N   . PRO C 1 6   ? 3.763   -86.931  -30.758 1.00 61.22  ? 7   PRO C N   1 
ATOM   5547  C CA  . PRO C 1 6   ? 4.075   -85.572  -30.296 1.00 57.83  ? 7   PRO C CA  1 
ATOM   5548  C C   . PRO C 1 6   ? 3.781   -85.321  -28.812 1.00 55.58  ? 7   PRO C C   1 
ATOM   5549  O O   . PRO C 1 6   ? 4.605   -84.694  -28.143 1.00 53.51  ? 7   PRO C O   1 
ATOM   5550  C CB  . PRO C 1 6   ? 3.183   -84.685  -31.182 1.00 57.96  ? 7   PRO C CB  1 
ATOM   5551  C CG  . PRO C 1 6   ? 2.238   -85.611  -31.875 1.00 60.10  ? 7   PRO C CG  1 
ATOM   5552  C CD  . PRO C 1 6   ? 2.948   -86.913  -31.981 1.00 61.82  ? 7   PRO C CD  1 
ATOM   5553  N N   . GLN C 1 7   ? 2.637   -85.797  -28.322 1.00 55.87  ? 8   GLN C N   1 
ATOM   5554  C CA  . GLN C 1 7   ? 2.239   -85.619  -26.921 1.00 55.05  ? 8   GLN C CA  1 
ATOM   5555  C C   . GLN C 1 7   ? 2.337   -84.160  -26.473 1.00 52.35  ? 8   GLN C C   1 
ATOM   5556  O O   . GLN C 1 7   ? 2.972   -83.848  -25.460 1.00 51.61  ? 8   GLN C O   1 
ATOM   5557  C CB  . GLN C 1 7   ? 3.092   -86.505  -26.006 1.00 55.49  ? 8   GLN C CB  1 
ATOM   5558  N N   . VAL C 1 8   ? 1.700   -83.273  -27.230 1.00 49.59  ? 9   VAL C N   1 
ATOM   5559  C CA  . VAL C 1 8   ? 1.826   -81.838  -27.007 1.00 46.80  ? 9   VAL C CA  1 
ATOM   5560  C C   . VAL C 1 8   ? 1.249   -81.389  -25.666 1.00 45.82  ? 9   VAL C C   1 
ATOM   5561  O O   . VAL C 1 8   ? 1.878   -80.624  -24.940 1.00 45.02  ? 9   VAL C O   1 
ATOM   5562  C CB  . VAL C 1 8   ? 1.140   -81.046  -28.137 1.00 45.81  ? 9   VAL C CB  1 
ATOM   5563  C CG1 . VAL C 1 8   ? 1.346   -79.552  -27.944 1.00 43.66  ? 9   VAL C CG1 1 
ATOM   5564  C CG2 . VAL C 1 8   ? 1.673   -81.493  -29.488 1.00 45.91  ? 9   VAL C CG2 1 
ATOM   5565  N N   . ALA C 1 9   ? 0.051   -81.864  -25.345 1.00 47.79  ? 10  ALA C N   1 
ATOM   5566  C CA  . ALA C 1 9   ? -0.622  -81.473  -24.110 1.00 49.95  ? 10  ALA C CA  1 
ATOM   5567  C C   . ALA C 1 9   ? 0.176   -81.889  -22.873 1.00 51.54  ? 10  ALA C C   1 
ATOM   5568  O O   . ALA C 1 9   ? 0.292   -81.123  -21.916 1.00 51.01  ? 10  ALA C O   1 
ATOM   5569  C CB  . ALA C 1 9   ? -2.021  -82.069  -24.063 1.00 52.10  ? 10  ALA C CB  1 
ATOM   5570  N N   . GLU C 1 10  ? 0.725   -83.102  -22.905 1.00 53.75  ? 11  GLU C N   1 
ATOM   5571  C CA  . GLU C 1 10  ? 1.538   -83.619  -21.804 1.00 55.25  ? 11  GLU C CA  1 
ATOM   5572  C C   . GLU C 1 10  ? 2.769   -82.751  -21.577 1.00 51.95  ? 11  GLU C C   1 
ATOM   5573  O O   . GLU C 1 10  ? 3.174   -82.517  -20.437 1.00 52.15  ? 11  GLU C O   1 
ATOM   5574  C CB  . GLU C 1 10  ? 1.970   -85.064  -22.074 1.00 58.30  ? 11  GLU C CB  1 
ATOM   5575  C CG  . GLU C 1 10  ? 0.848   -86.093  -22.006 1.00 63.06  ? 11  GLU C CG  1 
ATOM   5576  C CD  . GLU C 1 10  ? -0.038  -86.096  -23.241 1.00 65.62  ? 11  GLU C CD  1 
ATOM   5577  O OE1 . GLU C 1 10  ? 0.319   -85.436  -24.242 1.00 65.34  ? 11  GLU C OE1 1 
ATOM   5578  O OE2 . GLU C 1 10  ? -1.096  -86.761  -23.212 1.00 68.07  ? 11  GLU C OE2 1 
ATOM   5579  N N   . LEU C 1 11  ? 3.357   -82.279  -22.671 1.00 48.41  ? 12  LEU C N   1 
ATOM   5580  C CA  . LEU C 1 11  ? 4.551   -81.445  -22.611 1.00 44.91  ? 12  LEU C CA  1 
ATOM   5581  C C   . LEU C 1 11  ? 4.282   -80.168  -21.821 1.00 42.58  ? 12  LEU C C   1 
ATOM   5582  O O   . LEU C 1 11  ? 5.073   -79.781  -20.961 1.00 40.99  ? 12  LEU C O   1 
ATOM   5583  C CB  . LEU C 1 11  ? 5.030   -81.108  -24.022 1.00 43.35  ? 12  LEU C CB  1 
ATOM   5584  C CG  . LEU C 1 11  ? 6.390   -80.431  -24.189 1.00 41.81  ? 12  LEU C CG  1 
ATOM   5585  C CD1 . LEU C 1 11  ? 7.512   -81.334  -23.690 1.00 41.95  ? 12  LEU C CD1 1 
ATOM   5586  C CD2 . LEU C 1 11  ? 6.605   -80.060  -25.651 1.00 40.55  ? 12  LEU C CD2 1 
ATOM   5587  N N   . LEU C 1 12  ? 3.153   -79.527  -22.113 1.00 41.53  ? 13  LEU C N   1 
ATOM   5588  C CA  . LEU C 1 12  ? 2.754   -78.309  -21.417 1.00 39.44  ? 13  LEU C CA  1 
ATOM   5589  C C   . LEU C 1 12  ? 2.502   -78.558  -19.930 1.00 40.95  ? 13  LEU C C   1 
ATOM   5590  O O   . LEU C 1 12  ? 2.926   -77.774  -19.078 1.00 39.04  ? 13  LEU C O   1 
ATOM   5591  C CB  . LEU C 1 12  ? 1.502   -77.716  -22.063 1.00 38.14  ? 13  LEU C CB  1 
ATOM   5592  C CG  . LEU C 1 12  ? 0.898   -76.493  -21.370 1.00 37.32  ? 13  LEU C CG  1 
ATOM   5593  C CD1 . LEU C 1 12  ? 1.909   -75.359  -21.301 1.00 34.22  ? 13  LEU C CD1 1 
ATOM   5594  C CD2 . LEU C 1 12  ? -0.375  -76.046  -22.082 1.00 38.51  ? 13  LEU C CD2 1 
ATOM   5595  N N   . ALA C 1 13  ? 1.809   -79.652  -19.632 1.00 43.97  ? 14  ALA C N   1 
ATOM   5596  C CA  . ALA C 1 13  ? 1.468   -80.002  -18.258 1.00 46.67  ? 14  ALA C CA  1 
ATOM   5597  C C   . ALA C 1 13  ? 2.721   -80.257  -17.433 1.00 46.22  ? 14  ALA C C   1 
ATOM   5598  O O   . ALA C 1 13  ? 2.839   -79.779  -16.307 1.00 46.27  ? 14  ALA C O   1 
ATOM   5599  C CB  . ALA C 1 13  ? 0.560   -81.225  -18.230 1.00 49.20  ? 14  ALA C CB  1 
ATOM   5600  N N   . GLU C 1 14  ? 3.652   -81.012  -18.008 1.00 45.35  ? 15  GLU C N   1 
ATOM   5601  C CA  . GLU C 1 14  ? 4.911   -81.323  -17.346 1.00 43.94  ? 15  GLU C CA  1 
ATOM   5602  C C   . GLU C 1 14  ? 5.683   -80.050  -17.026 1.00 42.04  ? 15  GLU C C   1 
ATOM   5603  O O   . GLU C 1 14  ? 6.238   -79.911  -15.938 1.00 42.51  ? 15  GLU C O   1 
ATOM   5604  C CB  . GLU C 1 14  ? 5.762   -82.250  -18.215 1.00 43.91  ? 15  GLU C CB  1 
ATOM   5605  N N   . ALA C 1 15  ? 5.703   -79.122  -17.976 1.00 40.65  ? 16  ALA C N   1 
ATOM   5606  C CA  . ALA C 1 15  ? 6.393   -77.851  -17.793 1.00 39.91  ? 16  ALA C CA  1 
ATOM   5607  C C   . ALA C 1 15  ? 5.776   -77.037  -16.655 1.00 40.95  ? 16  ALA C C   1 
ATOM   5608  O O   . ALA C 1 15  ? 6.492   -76.413  -15.870 1.00 41.24  ? 16  ALA C O   1 
ATOM   5609  C CB  . ALA C 1 15  ? 6.374   -77.053  -19.083 1.00 39.80  ? 16  ALA C CB  1 
ATOM   5610  N N   . ARG C 1 16  ? 4.449   -77.049  -16.569 1.00 40.79  ? 17  ARG C N   1 
ATOM   5611  C CA  . ARG C 1 16  ? 3.746   -76.278  -15.553 1.00 42.77  ? 17  ARG C CA  1 
ATOM   5612  C C   . ARG C 1 16  ? 3.940   -76.894  -14.172 1.00 44.13  ? 17  ARG C C   1 
ATOM   5613  O O   . ARG C 1 16  ? 4.144   -76.182  -13.189 1.00 44.96  ? 17  ARG C O   1 
ATOM   5614  C CB  . ARG C 1 16  ? 2.259   -76.176  -15.895 1.00 45.72  ? 17  ARG C CB  1 
ATOM   5615  C CG  . ARG C 1 16  ? 1.993   -75.387  -17.170 1.00 46.07  ? 17  ARG C CG  1 
ATOM   5616  C CD  . ARG C 1 16  ? 0.544   -75.479  -17.614 1.00 48.69  ? 17  ARG C CD  1 
ATOM   5617  N NE  . ARG C 1 16  ? -0.357  -74.737  -16.738 1.00 51.82  ? 17  ARG C NE  1 
ATOM   5618  C CZ  . ARG C 1 16  ? -1.606  -74.414  -17.060 1.00 53.19  ? 17  ARG C CZ  1 
ATOM   5619  N NH1 . ARG C 1 16  ? -2.361  -73.735  -16.206 1.00 53.98  ? 17  ARG C NH1 1 
ATOM   5620  N NH2 . ARG C 1 16  ? -2.098  -74.766  -18.242 1.00 52.63  ? 17  ARG C NH2 1 
ATOM   5621  N N   . ARG C 1 17  ? 3.884   -78.220  -14.110 1.00 44.55  ? 18  ARG C N   1 
ATOM   5622  C CA  . ARG C 1 17  ? 4.127   -78.942  -12.867 1.00 46.36  ? 18  ARG C CA  1 
ATOM   5623  C C   . ARG C 1 17  ? 5.538   -78.665  -12.358 1.00 45.26  ? 18  ARG C C   1 
ATOM   5624  O O   . ARG C 1 17  ? 5.731   -78.333  -11.195 1.00 46.32  ? 18  ARG C O   1 
ATOM   5625  C CB  . ARG C 1 17  ? 3.920   -80.443  -13.068 1.00 47.69  ? 18  ARG C CB  1 
ATOM   5626  N N   . ALA C 1 18  ? 6.518   -78.783  -13.246 1.00 43.20  ? 19  ALA C N   1 
ATOM   5627  C CA  . ALA C 1 18  ? 7.907   -78.536  -12.883 1.00 41.61  ? 19  ALA C CA  1 
ATOM   5628  C C   . ALA C 1 18  ? 8.124   -77.106  -12.403 1.00 40.63  ? 19  ALA C C   1 
ATOM   5629  O O   . ALA C 1 18  ? 8.880   -76.881  -11.463 1.00 39.46  ? 19  ALA C O   1 
ATOM   5630  C CB  . ALA C 1 18  ? 8.819   -78.839  -14.056 1.00 40.46  ? 19  ALA C CB  1 
ATOM   5631  N N   . PHE C 1 19  ? 7.471   -76.138  -13.045 1.00 40.23  ? 20  PHE C N   1 
ATOM   5632  C CA  . PHE C 1 19  ? 7.626   -74.744  -12.635 1.00 40.21  ? 20  PHE C CA  1 
ATOM   5633  C C   . PHE C 1 19  ? 7.120   -74.509  -11.217 1.00 41.56  ? 20  PHE C C   1 
ATOM   5634  O O   . PHE C 1 19  ? 7.772   -73.826  -10.424 1.00 41.58  ? 20  PHE C O   1 
ATOM   5635  C CB  . PHE C 1 19  ? 6.900   -73.796  -13.593 1.00 39.32  ? 20  PHE C CB  1 
ATOM   5636  C CG  . PHE C 1 19  ? 7.163   -72.340  -13.311 1.00 39.76  ? 20  PHE C CG  1 
ATOM   5637  C CD1 . PHE C 1 19  ? 6.433   -71.659  -12.346 1.00 40.55  ? 20  PHE C CD1 1 
ATOM   5638  C CD2 . PHE C 1 19  ? 8.142   -71.652  -14.007 1.00 39.61  ? 20  PHE C CD2 1 
ATOM   5639  C CE1 . PHE C 1 19  ? 6.677   -70.325  -12.077 1.00 40.72  ? 20  PHE C CE1 1 
ATOM   5640  C CE2 . PHE C 1 19  ? 8.389   -70.315  -13.744 1.00 39.95  ? 20  PHE C CE2 1 
ATOM   5641  C CZ  . PHE C 1 19  ? 7.656   -69.653  -12.772 1.00 40.08  ? 20  PHE C CZ  1 
ATOM   5642  N N   . ARG C 1 20  ? 5.943   -75.049  -10.918 1.00 44.22  ? 21  ARG C N   1 
ATOM   5643  C CA  . ARG C 1 20  ? 5.327   -74.871  -9.610  1.00 49.63  ? 21  ARG C CA  1 
ATOM   5644  C C   . ARG C 1 20  ? 6.216   -75.422  -8.498  1.00 50.37  ? 21  ARG C C   1 
ATOM   5645  O O   . ARG C 1 20  ? 6.360   -74.807  -7.443  1.00 51.17  ? 21  ARG C O   1 
ATOM   5646  C CB  . ARG C 1 20  ? 3.954   -75.546  -9.569  1.00 53.21  ? 21  ARG C CB  1 
ATOM   5647  N N   . GLU C 1 21  ? 6.818   -76.579  -8.748  1.00 50.63  ? 22  GLU C N   1 
ATOM   5648  C CA  . GLU C 1 21  ? 7.691   -77.214  -7.771  1.00 53.07  ? 22  GLU C CA  1 
ATOM   5649  C C   . GLU C 1 21  ? 8.999   -76.451  -7.605  1.00 50.47  ? 22  GLU C C   1 
ATOM   5650  O O   . GLU C 1 21  ? 9.491   -76.281  -6.490  1.00 53.50  ? 22  GLU C O   1 
ATOM   5651  C CB  . GLU C 1 21  ? 7.985   -78.660  -8.173  1.00 56.74  ? 22  GLU C CB  1 
ATOM   5652  C CG  . GLU C 1 21  ? 6.750   -79.511  -8.420  1.00 61.97  ? 22  GLU C CG  1 
ATOM   5653  C CD  . GLU C 1 21  ? 7.096   -80.941  -8.807  1.00 65.89  ? 22  GLU C CD  1 
ATOM   5654  O OE1 . GLU C 1 21  ? 8.280   -81.205  -9.111  1.00 66.14  ? 22  GLU C OE1 1 
ATOM   5655  O OE2 . GLU C 1 21  ? 6.185   -81.799  -8.810  1.00 68.41  ? 22  GLU C OE2 1 
ATOM   5656  N N   . GLU C 1 22  ? 9.559   -75.992  -8.719  1.00 46.02  ? 23  GLU C N   1 
ATOM   5657  C CA  . GLU C 1 22  ? 10.861  -75.337  -8.699  1.00 44.06  ? 23  GLU C CA  1 
ATOM   5658  C C   . GLU C 1 22  ? 10.817  -73.930  -8.103  1.00 43.89  ? 23  GLU C C   1 
ATOM   5659  O O   . GLU C 1 22  ? 11.740  -73.520  -7.401  1.00 44.96  ? 23  GLU C O   1 
ATOM   5660  C CB  . GLU C 1 22  ? 11.439  -75.276  -10.114 1.00 42.76  ? 23  GLU C CB  1 
ATOM   5661  C CG  . GLU C 1 22  ? 12.782  -74.570  -10.217 1.00 41.97  ? 23  GLU C CG  1 
ATOM   5662  C CD  . GLU C 1 22  ? 13.935  -75.410  -9.697  1.00 42.47  ? 23  GLU C CD  1 
ATOM   5663  O OE1 . GLU C 1 22  ? 13.703  -76.569  -9.286  1.00 43.15  ? 23  GLU C OE1 1 
ATOM   5664  O OE2 . GLU C 1 22  ? 15.079  -74.909  -9.707  1.00 43.00  ? 23  GLU C OE2 1 
ATOM   5665  N N   . PHE C 1 23  ? 9.745   -73.195  -8.376  1.00 42.07  ? 24  PHE C N   1 
ATOM   5666  C CA  . PHE C 1 23  ? 9.680   -71.790  -7.990  1.00 43.67  ? 24  PHE C CA  1 
ATOM   5667  C C   . PHE C 1 23  ? 8.620   -71.493  -6.932  1.00 47.47  ? 24  PHE C C   1 
ATOM   5668  O O   . PHE C 1 23  ? 8.541   -70.371  -6.426  1.00 51.09  ? 24  PHE C O   1 
ATOM   5669  C CB  . PHE C 1 23  ? 9.440   -70.921  -9.227  1.00 42.21  ? 24  PHE C CB  1 
ATOM   5670  C CG  . PHE C 1 23  ? 10.551  -70.992  -10.232 1.00 39.84  ? 24  PHE C CG  1 
ATOM   5671  C CD1 . PHE C 1 23  ? 11.769  -70.376  -9.981  1.00 39.82  ? 24  PHE C CD1 1 
ATOM   5672  C CD2 . PHE C 1 23  ? 10.387  -71.685  -11.417 1.00 37.47  ? 24  PHE C CD2 1 
ATOM   5673  C CE1 . PHE C 1 23  ? 12.799  -70.441  -10.904 1.00 37.40  ? 24  PHE C CE1 1 
ATOM   5674  C CE2 . PHE C 1 23  ? 11.408  -71.753  -12.344 1.00 35.83  ? 24  PHE C CE2 1 
ATOM   5675  C CZ  . PHE C 1 23  ? 12.615  -71.134  -12.089 1.00 36.54  ? 24  PHE C CZ  1 
ATOM   5676  N N   . GLY C 1 24  ? 7.811   -72.492  -6.595  1.00 46.70  ? 25  GLY C N   1 
ATOM   5677  C CA  . GLY C 1 24  ? 6.868   -72.359  -5.496  1.00 47.88  ? 25  GLY C CA  1 
ATOM   5678  C C   . GLY C 1 24  ? 5.610   -71.575  -5.817  1.00 48.65  ? 25  GLY C C   1 
ATOM   5679  O O   . GLY C 1 24  ? 4.864   -71.194  -4.915  1.00 50.12  ? 25  GLY C O   1 
ATOM   5680  N N   . ALA C 1 25  ? 5.370   -71.335  -7.103  1.00 47.78  ? 26  ALA C N   1 
ATOM   5681  C CA  . ALA C 1 25  ? 4.173   -70.621  -7.541  1.00 49.35  ? 26  ALA C CA  1 
ATOM   5682  C C   . ALA C 1 25  ? 3.791   -71.021  -8.959  1.00 47.39  ? 26  ALA C C   1 
ATOM   5683  O O   . ALA C 1 25  ? 4.595   -71.606  -9.684  1.00 46.29  ? 26  ALA C O   1 
ATOM   5684  C CB  . ALA C 1 25  ? 4.386   -69.116  -7.458  1.00 49.74  ? 26  ALA C CB  1 
ATOM   5685  N N   . GLU C 1 26  ? 2.561   -70.698  -9.351  1.00 48.80  ? 27  GLU C N   1 
ATOM   5686  C CA  . GLU C 1 26  ? 2.094   -70.964  -10.707 1.00 49.33  ? 27  GLU C CA  1 
ATOM   5687  C C   . GLU C 1 26  ? 2.716   -69.998  -11.712 1.00 46.55  ? 27  GLU C C   1 
ATOM   5688  O O   . GLU C 1 26  ? 2.845   -68.803  -11.436 1.00 46.85  ? 27  GLU C O   1 
ATOM   5689  C CB  . GLU C 1 26  ? 0.566   -70.871  -10.778 1.00 53.20  ? 27  GLU C CB  1 
ATOM   5690  C CG  . GLU C 1 26  ? -0.163  -71.965  -10.013 1.00 57.78  ? 27  GLU C CG  1 
ATOM   5691  C CD  . GLU C 1 26  ? 0.019   -73.334  -10.641 1.00 59.03  ? 27  GLU C CD  1 
ATOM   5692  O OE1 . GLU C 1 26  ? 0.295   -73.405  -11.857 1.00 57.92  ? 27  GLU C OE1 1 
ATOM   5693  O OE2 . GLU C 1 26  ? -0.114  -74.341  -9.918  1.00 61.85  ? 27  GLU C OE2 1 
ATOM   5694  N N   . PRO C 1 27  ? 3.106   -70.517  -12.887 1.00 43.99  ? 28  PRO C N   1 
ATOM   5695  C CA  . PRO C 1 27  ? 3.632   -69.679  -13.969 1.00 41.53  ? 28  PRO C CA  1 
ATOM   5696  C C   . PRO C 1 27  ? 2.546   -68.783  -14.551 1.00 41.08  ? 28  PRO C C   1 
ATOM   5697  O O   . PRO C 1 27  ? 1.382   -69.183  -14.571 1.00 41.19  ? 28  PRO C O   1 
ATOM   5698  C CB  . PRO C 1 27  ? 4.115   -70.699  -14.998 1.00 40.37  ? 28  PRO C CB  1 
ATOM   5699  C CG  . PRO C 1 27  ? 3.259   -71.895  -14.763 1.00 42.10  ? 28  PRO C CG  1 
ATOM   5700  C CD  . PRO C 1 27  ? 3.033   -71.937  -13.275 1.00 43.57  ? 28  PRO C CD  1 
ATOM   5701  N N   . GLU C 1 28  ? 2.926   -67.594  -15.010 1.00 41.14  ? 29  GLU C N   1 
ATOM   5702  C CA  . GLU C 1 28  ? 1.966   -66.603  -15.487 1.00 43.78  ? 29  GLU C CA  1 
ATOM   5703  C C   . GLU C 1 28  ? 1.618   -66.779  -16.962 1.00 45.60  ? 29  GLU C C   1 
ATOM   5704  O O   . GLU C 1 28  ? 0.532   -66.396  -17.396 1.00 47.70  ? 29  GLU C O   1 
ATOM   5705  C CB  . GLU C 1 28  ? 2.505   -65.190  -15.253 1.00 44.71  ? 29  GLU C CB  1 
ATOM   5706  N N   . LEU C 1 29  ? 2.531   -67.356  -17.736 1.00 44.11  ? 30  LEU C N   1 
ATOM   5707  C CA  . LEU C 1 29  ? 2.250   -67.581  -19.144 1.00 44.83  ? 30  LEU C CA  1 
ATOM   5708  C C   . LEU C 1 29  ? 3.033   -68.746  -19.734 1.00 41.64  ? 30  LEU C C   1 
ATOM   5709  O O   . LEU C 1 29  ? 4.001   -69.233  -19.148 1.00 41.52  ? 30  LEU C O   1 
ATOM   5710  C CB  . LEU C 1 29  ? 2.527   -66.305  -19.946 1.00 47.72  ? 30  LEU C CB  1 
ATOM   5711  C CG  . LEU C 1 29  ? 3.974   -65.816  -20.021 1.00 49.34  ? 30  LEU C CG  1 
ATOM   5712  C CD1 . LEU C 1 29  ? 4.564   -66.103  -21.399 1.00 48.30  ? 30  LEU C CD1 1 
ATOM   5713  C CD2 . LEU C 1 29  ? 4.060   -64.338  -19.684 1.00 50.57  ? 30  LEU C CD2 1 
ATOM   5714  N N   . ALA C 1 30  ? 2.582   -69.187  -20.901 1.00 39.86  ? 31  ALA C N   1 
ATOM   5715  C CA  . ALA C 1 30  ? 3.217   -70.262  -21.646 1.00 38.29  ? 31  ALA C CA  1 
ATOM   5716  C C   . ALA C 1 30  ? 3.427   -69.833  -23.086 1.00 36.59  ? 31  ALA C C   1 
ATOM   5717  O O   . ALA C 1 30  ? 2.578   -69.151  -23.662 1.00 36.62  ? 31  ALA C O   1 
ATOM   5718  C CB  . ALA C 1 30  ? 2.373   -71.518  -21.594 1.00 38.40  ? 31  ALA C CB  1 
ATOM   5719  N N   . VAL C 1 31  ? 4.562   -70.220  -23.661 1.00 34.98  ? 32  VAL C N   1 
ATOM   5720  C CA  . VAL C 1 31  ? 4.778   -70.074  -25.096 1.00 33.09  ? 32  VAL C CA  1 
ATOM   5721  C C   . VAL C 1 31  ? 5.364   -71.353  -25.671 1.00 33.73  ? 32  VAL C C   1 
ATOM   5722  O O   . VAL C 1 31  ? 5.875   -72.209  -24.941 1.00 34.50  ? 32  VAL C O   1 
ATOM   5723  C CB  . VAL C 1 31  ? 5.726   -68.905  -25.446 1.00 30.47  ? 32  VAL C CB  1 
ATOM   5724  C CG1 . VAL C 1 31  ? 5.186   -67.585  -24.913 1.00 30.15  ? 32  VAL C CG1 1 
ATOM   5725  C CG2 . VAL C 1 31  ? 7.132   -69.185  -24.935 1.00 28.69  ? 32  VAL C CG2 1 
ATOM   5726  N N   . SER C 1 32  ? 5.284   -71.477  -26.987 1.00 32.76  ? 33  SER C N   1 
ATOM   5727  C CA  . SER C 1 32  ? 5.883   -72.605  -27.679 1.00 32.83  ? 33  SER C CA  1 
ATOM   5728  C C   . SER C 1 32  ? 6.422   -72.168  -29.029 1.00 31.85  ? 33  SER C C   1 
ATOM   5729  O O   . SER C 1 32  ? 5.966   -71.178  -29.605 1.00 31.54  ? 33  SER C O   1 
ATOM   5730  C CB  . SER C 1 32  ? 4.870   -73.742  -27.860 1.00 34.26  ? 33  SER C CB  1 
ATOM   5731  O OG  . SER C 1 32  ? 3.754   -73.329  -28.633 1.00 35.17  ? 33  SER C OG  1 
ATOM   5732  N N   . ALA C 1 33  ? 7.414   -72.902  -29.517 1.00 30.66  ? 34  ALA C N   1 
ATOM   5733  C CA  . ALA C 1 33  ? 7.900   -72.741  -30.878 1.00 28.56  ? 34  ALA C CA  1 
ATOM   5734  C C   . ALA C 1 33  ? 8.386   -74.093  -31.348 1.00 28.34  ? 34  ALA C C   1 
ATOM   5735  O O   . ALA C 1 33  ? 9.079   -74.800  -30.608 1.00 29.44  ? 34  ALA C O   1 
ATOM   5736  C CB  . ALA C 1 33  ? 9.003   -71.701  -30.959 1.00 26.19  ? 34  ALA C CB  1 
ATOM   5737  N N   . PRO C 1 34  ? 8.014   -74.463  -32.582 1.00 30.01  ? 35  PRO C N   1 
ATOM   5738  C CA  . PRO C 1 34  ? 8.226   -75.812  -33.112 1.00 29.09  ? 35  PRO C CA  1 
ATOM   5739  C C   . PRO C 1 34  ? 9.622   -76.045  -33.672 1.00 29.64  ? 35  PRO C C   1 
ATOM   5740  O O   . PRO C 1 34  ? 10.325  -75.094  -34.020 1.00 30.32  ? 35  PRO C O   1 
ATOM   5741  C CB  . PRO C 1 34  ? 7.190   -75.901  -34.236 1.00 27.80  ? 35  PRO C CB  1 
ATOM   5742  C CG  . PRO C 1 34  ? 7.108   -74.491  -34.755 1.00 27.26  ? 35  PRO C CG  1 
ATOM   5743  C CD  . PRO C 1 34  ? 7.290   -73.599  -33.534 1.00 26.54  ? 35  PRO C CD  1 
ATOM   5744  N N   . GLY C 1 35  ? 10.008  -77.313  -33.756 1.00 29.33  ? 36  GLY C N   1 
ATOM   5745  C CA  . GLY C 1 35  ? 11.135  -77.712  -34.577 1.00 32.36  ? 36  GLY C CA  1 
ATOM   5746  C C   . GLY C 1 35  ? 10.653  -77.749  -36.020 1.00 32.94  ? 36  GLY C C   1 
ATOM   5747  O O   . GLY C 1 35  ? 9.501   -77.410  -36.288 1.00 34.43  ? 36  GLY C O   1 
ATOM   5748  N N   . ARG C 1 36  ? 11.509  -78.161  -36.952 1.00 35.31  ? 37  ARG C N   1 
ATOM   5749  C CA  . ARG C 1 36  ? 11.151  -78.106  -38.375 1.00 36.43  ? 37  ARG C CA  1 
ATOM   5750  C C   . ARG C 1 36  ? 11.628  -79.329  -39.158 1.00 36.07  ? 37  ARG C C   1 
ATOM   5751  O O   . ARG C 1 36  ? 12.567  -80.020  -38.750 1.00 35.13  ? 37  ARG C O   1 
ATOM   5752  C CB  . ARG C 1 36  ? 11.758  -76.861  -39.029 1.00 39.92  ? 37  ARG C CB  1 
ATOM   5753  C CG  . ARG C 1 36  ? 13.012  -77.203  -39.841 1.00 46.37  ? 37  ARG C CG  1 
ATOM   5754  C CD  . ARG C 1 36  ? 13.879  -76.008  -40.162 1.00 50.27  ? 37  ARG C CD  1 
ATOM   5755  N NE  . ARG C 1 36  ? 15.162  -76.340  -40.801 1.00 52.74  ? 37  ARG C NE  1 
ATOM   5756  C CZ  . ARG C 1 36  ? 16.036  -77.263  -40.390 1.00 55.78  ? 37  ARG C CZ  1 
ATOM   5757  N NH1 . ARG C 1 36  ? 17.160  -77.450  -41.063 1.00 58.45  ? 37  ARG C NH1 1 
ATOM   5758  N NH2 . ARG C 1 36  ? 15.805  -78.011  -39.322 1.00 56.83  ? 37  ARG C NH2 1 
ATOM   5759  N N   . VAL C 1 37  ? 10.977  -79.573  -40.293 1.00 36.77  ? 38  VAL C N   1 
ATOM   5760  C CA  . VAL C 1 37  ? 11.540  -80.405  -41.348 1.00 39.55  ? 38  VAL C CA  1 
ATOM   5761  C C   . VAL C 1 37  ? 11.638  -79.553  -42.618 1.00 40.41  ? 38  VAL C C   1 
ATOM   5762  O O   . VAL C 1 37  ? 10.783  -78.705  -42.870 1.00 40.67  ? 38  VAL C O   1 
ATOM   5763  C CB  . VAL C 1 37  ? 10.693  -81.671  -41.612 1.00 41.74  ? 38  VAL C CB  1 
ATOM   5764  C CG1 . VAL C 1 37  ? 9.333   -81.306  -42.199 1.00 41.62  ? 38  VAL C CG1 1 
ATOM   5765  C CG2 . VAL C 1 37  ? 11.429  -82.621  -42.543 1.00 43.38  ? 38  VAL C CG2 1 
ATOM   5766  N N   . ASN C 1 38  ? 12.694  -79.739  -43.401 1.00 41.01  ? 39  ASN C N   1 
ATOM   5767  C CA  . ASN C 1 38  ? 12.789  -79.035  -44.672 1.00 42.00  ? 39  ASN C CA  1 
ATOM   5768  C C   . ASN C 1 38  ? 12.457  -79.975  -45.822 1.00 41.64  ? 39  ASN C C   1 
ATOM   5769  O O   . ASN C 1 38  ? 13.198  -80.913  -46.102 1.00 42.14  ? 39  ASN C O   1 
ATOM   5770  C CB  . ASN C 1 38  ? 14.178  -78.424  -44.874 1.00 44.19  ? 39  ASN C CB  1 
ATOM   5771  C CG  . ASN C 1 38  ? 14.219  -77.463  -46.050 1.00 46.61  ? 39  ASN C CG  1 
ATOM   5772  O OD1 . ASN C 1 38  ? 13.179  -76.984  -46.506 1.00 47.85  ? 39  ASN C OD1 1 
ATOM   5773  N ND2 . ASN C 1 38  ? 15.418  -77.181  -46.550 1.00 47.53  ? 39  ASN C ND2 1 
ATOM   5774  N N   . LEU C 1 39  ? 11.331  -79.724  -46.476 1.00 41.90  ? 40  LEU C N   1 
ATOM   5775  C CA  . LEU C 1 39  ? 10.878  -80.580  -47.566 1.00 43.43  ? 40  LEU C CA  1 
ATOM   5776  C C   . LEU C 1 39  ? 11.891  -80.597  -48.706 1.00 45.37  ? 40  LEU C C   1 
ATOM   5777  O O   . LEU C 1 39  ? 12.213  -81.653  -49.248 1.00 48.98  ? 40  LEU C O   1 
ATOM   5778  C CB  . LEU C 1 39  ? 9.513   -80.116  -48.075 1.00 44.06  ? 40  LEU C CB  1 
ATOM   5779  C CG  . LEU C 1 39  ? 8.410   -80.013  -47.019 1.00 42.97  ? 40  LEU C CG  1 
ATOM   5780  C CD1 . LEU C 1 39  ? 7.098   -79.527  -47.644 1.00 42.71  ? 40  LEU C CD1 1 
ATOM   5781  C CD2 . LEU C 1 39  ? 8.216   -81.347  -46.323 1.00 40.11  ? 40  LEU C CD2 1 
ATOM   5782  N N   . ILE C 1 40  ? 12.395  -79.418  -49.054 1.00 43.82  ? 41  ILE C N   1 
ATOM   5783  C CA  . ILE C 1 40  ? 13.350  -79.272  -50.143 1.00 43.80  ? 41  ILE C CA  1 
ATOM   5784  C C   . ILE C 1 40  ? 13.994  -77.898  -50.069 1.00 42.95  ? 41  ILE C C   1 
ATOM   5785  O O   . ILE C 1 40  ? 13.395  -76.951  -49.558 1.00 41.38  ? 41  ILE C O   1 
ATOM   5786  C CB  . ILE C 1 40  ? 12.682  -79.455  -51.536 1.00 49.28  ? 41  ILE C CB  1 
ATOM   5787  N N   . GLY C 1 41  ? 15.214  -77.790  -50.581 1.00 46.58  ? 42  GLY C N   1 
ATOM   5788  C CA  . GLY C 1 41  ? 15.916  -76.521  -50.593 1.00 47.55  ? 42  GLY C CA  1 
ATOM   5789  C C   . GLY C 1 41  ? 16.987  -76.484  -49.530 1.00 48.22  ? 42  GLY C C   1 
ATOM   5790  O O   . GLY C 1 41  ? 16.971  -75.630  -48.641 1.00 48.53  ? 42  GLY C O   1 
ATOM   5791  N N   . GLU C 1 42  ? 17.924  -77.422  -49.620 1.00 48.95  ? 43  GLU C N   1 
ATOM   5792  C CA  . GLU C 1 42  ? 18.953  -77.562  -48.596 1.00 47.17  ? 43  GLU C CA  1 
ATOM   5793  C C   . GLU C 1 42  ? 20.195  -76.757  -48.927 1.00 48.90  ? 43  GLU C C   1 
ATOM   5794  O O   . GLU C 1 42  ? 20.622  -76.703  -50.079 1.00 52.38  ? 43  GLU C O   1 
ATOM   5795  C CB  . GLU C 1 42  ? 19.335  -79.026  -48.413 1.00 47.09  ? 43  GLU C CB  1 
ATOM   5796  C CG  . GLU C 1 42  ? 19.478  -79.435  -46.954 1.00 45.04  ? 43  GLU C CG  1 
ATOM   5797  C CD  . GLU C 1 42  ? 18.172  -79.301  -46.200 1.00 43.19  ? 43  GLU C CD  1 
ATOM   5798  O OE1 . GLU C 1 42  ? 18.013  -78.316  -45.447 1.00 40.56  ? 43  GLU C OE1 1 
ATOM   5799  O OE2 . GLU C 1 42  ? 17.297  -80.176  -46.376 1.00 44.67  ? 43  GLU C OE2 1 
ATOM   5800  N N   . HIS C 1 43  ? 20.769  -76.145  -47.897 1.00 46.63  ? 44  HIS C N   1 
ATOM   5801  C CA  . HIS C 1 43  ? 21.981  -75.348  -48.027 1.00 48.43  ? 44  HIS C CA  1 
ATOM   5802  C C   . HIS C 1 43  ? 21.832  -74.261  -49.084 1.00 49.41  ? 44  HIS C C   1 
ATOM   5803  O O   . HIS C 1 43  ? 22.770  -73.957  -49.820 1.00 47.32  ? 44  HIS C O   1 
ATOM   5804  C CB  . HIS C 1 43  ? 23.174  -76.249  -48.342 1.00 51.08  ? 44  HIS C CB  1 
ATOM   5805  C CG  . HIS C 1 43  ? 23.611  -77.082  -47.178 1.00 50.37  ? 44  HIS C CG  1 
ATOM   5806  N ND1 . HIS C 1 43  ? 24.367  -76.574  -46.144 1.00 49.03  ? 44  HIS C ND1 1 
ATOM   5807  C CD2 . HIS C 1 43  ? 23.381  -78.381  -46.873 1.00 50.75  ? 44  HIS C CD2 1 
ATOM   5808  C CE1 . HIS C 1 43  ? 24.593  -77.526  -45.256 1.00 48.93  ? 44  HIS C CE1 1 
ATOM   5809  N NE2 . HIS C 1 43  ? 24.004  -78.633  -45.674 1.00 49.56  ? 44  HIS C NE2 1 
ATOM   5810  N N   . THR C 1 44  ? 20.640  -73.679  -49.139 1.00 48.20  ? 45  THR C N   1 
ATOM   5811  C CA  . THR C 1 44  ? 20.356  -72.587  -50.053 1.00 49.61  ? 45  THR C CA  1 
ATOM   5812  C C   . THR C 1 44  ? 20.067  -71.298  -49.301 1.00 47.37  ? 45  THR C C   1 
ATOM   5813  O O   . THR C 1 44  ? 20.199  -70.213  -49.864 1.00 44.29  ? 45  THR C O   1 
ATOM   5814  C CB  . THR C 1 44  ? 19.156  -72.903  -50.962 1.00 50.87  ? 45  THR C CB  1 
ATOM   5815  O OG1 . THR C 1 44  ? 18.119  -73.514  -50.182 1.00 50.74  ? 45  THR C OG1 1 
ATOM   5816  C CG2 . THR C 1 44  ? 19.569  -73.844  -52.075 1.00 52.39  ? 45  THR C CG2 1 
ATOM   5817  N N   . ASP C 1 45  ? 19.686  -71.405  -48.030 1.00 45.13  ? 46  ASP C N   1 
ATOM   5818  C CA  . ASP C 1 45  ? 19.204  -70.221  -47.328 1.00 43.71  ? 46  ASP C CA  1 
ATOM   5819  C C   . ASP C 1 45  ? 20.323  -69.189  -47.152 1.00 47.60  ? 46  ASP C C   1 
ATOM   5820  O O   . ASP C 1 45  ? 20.088  -67.991  -47.319 1.00 47.47  ? 46  ASP C O   1 
ATOM   5821  C CB  . ASP C 1 45  ? 18.546  -70.593  -45.984 1.00 37.81  ? 46  ASP C CB  1 
ATOM   5822  C CG  . ASP C 1 45  ? 19.506  -71.244  -44.979 1.00 37.48  ? 46  ASP C CG  1 
ATOM   5823  O OD1 . ASP C 1 45  ? 20.631  -71.646  -45.341 1.00 38.88  ? 46  ASP C OD1 1 
ATOM   5824  O OD2 . ASP C 1 45  ? 19.102  -71.365  -43.803 1.00 36.36  ? 46  ASP C OD2 1 
ATOM   5825  N N   . TYR C 1 46  ? 21.544  -69.647  -46.872 1.00 50.25  ? 47  TYR C N   1 
ATOM   5826  C CA  . TYR C 1 46  ? 22.675  -68.730  -46.712 1.00 51.35  ? 47  TYR C CA  1 
ATOM   5827  C C   . TYR C 1 46  ? 23.331  -68.347  -48.053 1.00 57.29  ? 47  TYR C C   1 
ATOM   5828  O O   . TYR C 1 46  ? 24.337  -67.621  -48.082 1.00 58.98  ? 47  TYR C O   1 
ATOM   5829  C CB  . TYR C 1 46  ? 23.733  -69.314  -45.770 1.00 53.56  ? 47  TYR C CB  1 
ATOM   5830  C CG  . TYR C 1 46  ? 24.248  -70.697  -46.115 1.00 53.02  ? 47  TYR C CG  1 
ATOM   5831  C CD1 . TYR C 1 46  ? 25.240  -70.872  -47.069 1.00 55.29  ? 47  TYR C CD1 1 
ATOM   5832  C CD2 . TYR C 1 46  ? 23.783  -71.822  -45.441 1.00 50.21  ? 47  TYR C CD2 1 
ATOM   5833  C CE1 . TYR C 1 46  ? 25.727  -72.129  -47.373 1.00 55.33  ? 47  TYR C CE1 1 
ATOM   5834  C CE2 . TYR C 1 46  ? 24.268  -73.082  -45.733 1.00 50.58  ? 47  TYR C CE2 1 
ATOM   5835  C CZ  . TYR C 1 46  ? 25.240  -73.230  -46.702 1.00 53.60  ? 47  TYR C CZ  1 
ATOM   5836  O OH  . TYR C 1 46  ? 25.722  -74.486  -46.995 1.00 55.26  ? 47  TYR C OH  1 
ATOM   5837  N N   . ASN C 1 47  ? 22.763  -68.839  -49.152 1.00 57.18  ? 48  ASN C N   1 
ATOM   5838  C CA  . ASN C 1 47  ? 23.110  -68.368  -50.486 1.00 58.85  ? 48  ASN C CA  1 
ATOM   5839  C C   . ASN C 1 47  ? 21.973  -67.526  -51.060 1.00 60.12  ? 48  ASN C C   1 
ATOM   5840  O O   . ASN C 1 47  ? 21.848  -67.369  -52.274 1.00 63.08  ? 48  ASN C O   1 
ATOM   5841  C CB  . ASN C 1 47  ? 23.427  -69.541  -51.425 1.00 60.39  ? 48  ASN C CB  1 
ATOM   5842  C CG  . ASN C 1 47  ? 24.405  -70.534  -50.825 1.00 60.60  ? 48  ASN C CG  1 
ATOM   5843  O OD1 . ASN C 1 47  ? 24.106  -71.729  -50.711 1.00 59.75  ? 48  ASN C OD1 1 
ATOM   5844  N ND2 . ASN C 1 47  ? 25.569  -70.036  -50.398 1.00 62.24  ? 48  ASN C ND2 1 
ATOM   5845  N N   . GLN C 1 48  ? 21.139  -67.011  -50.162 1.00 59.09  ? 49  GLN C N   1 
ATOM   5846  C CA  . GLN C 1 48  ? 19.989  -66.187  -50.512 1.00 59.12  ? 49  GLN C CA  1 
ATOM   5847  C C   . GLN C 1 48  ? 19.047  -66.902  -51.469 1.00 56.66  ? 49  GLN C C   1 
ATOM   5848  O O   . GLN C 1 48  ? 18.448  -66.275  -52.341 1.00 55.69  ? 49  GLN C O   1 
ATOM   5849  C CB  . GLN C 1 48  ? 20.437  -64.863  -51.129 1.00 63.06  ? 49  GLN C CB  1 
ATOM   5850  C CG  . GLN C 1 48  ? 21.356  -64.049  -50.241 1.00 65.13  ? 49  GLN C CG  1 
ATOM   5851  C CD  . GLN C 1 48  ? 21.628  -62.673  -50.806 1.00 68.55  ? 49  GLN C CD  1 
ATOM   5852  O OE1 . GLN C 1 48  ? 20.941  -62.223  -51.721 1.00 70.36  ? 49  GLN C OE1 1 
ATOM   5853  N NE2 . GLN C 1 48  ? 22.643  -62.003  -50.274 1.00 69.89  ? 49  GLN C NE2 1 
ATOM   5854  N N   . GLY C 1 49  ? 18.908  -68.212  -51.291 1.00 54.66  ? 50  GLY C N   1 
ATOM   5855  C CA  . GLY C 1 49  ? 18.094  -69.022  -52.177 1.00 53.72  ? 50  GLY C CA  1 
ATOM   5856  C C   . GLY C 1 49  ? 16.660  -69.224  -51.726 1.00 51.57  ? 50  GLY C C   1 
ATOM   5857  O O   . GLY C 1 49  ? 16.054  -68.349  -51.112 1.00 51.03  ? 50  GLY C O   1 
ATOM   5858  N N   . LEU C 1 50  ? 16.115  -70.391  -52.050 1.00 51.93  ? 51  LEU C N   1 
ATOM   5859  C CA  . LEU C 1 50  ? 14.744  -70.742  -51.705 1.00 49.69  ? 51  LEU C CA  1 
ATOM   5860  C C   . LEU C 1 50  ? 14.734  -71.981  -50.819 1.00 49.01  ? 51  LEU C C   1 
ATOM   5861  O O   . LEU C 1 50  ? 15.515  -72.910  -51.029 1.00 49.63  ? 51  LEU C O   1 
ATOM   5862  C CB  . LEU C 1 50  ? 13.916  -70.994  -52.969 1.00 49.62  ? 51  LEU C CB  1 
ATOM   5863  C CG  . LEU C 1 50  ? 13.732  -69.830  -53.945 1.00 49.62  ? 51  LEU C CG  1 
ATOM   5864  C CD1 . LEU C 1 50  ? 13.287  -70.338  -55.312 1.00 51.99  ? 51  LEU C CD1 1 
ATOM   5865  C CD2 . LEU C 1 50  ? 12.725  -68.832  -53.406 1.00 47.29  ? 51  LEU C CD2 1 
ATOM   5866  N N   . VAL C 1 51  ? 13.859  -71.987  -49.820 1.00 46.73  ? 52  VAL C N   1 
ATOM   5867  C CA  . VAL C 1 51  ? 13.678  -73.163  -48.978 1.00 44.56  ? 52  VAL C CA  1 
ATOM   5868  C C   . VAL C 1 51  ? 12.190  -73.434  -48.800 1.00 43.47  ? 52  VAL C C   1 
ATOM   5869  O O   . VAL C 1 51  ? 11.366  -72.525  -48.919 1.00 43.24  ? 52  VAL C O   1 
ATOM   5870  C CB  . VAL C 1 51  ? 14.347  -72.996  -47.597 1.00 42.55  ? 52  VAL C CB  1 
ATOM   5871  C CG1 . VAL C 1 51  ? 15.844  -72.775  -47.753 1.00 42.64  ? 52  VAL C CG1 1 
ATOM   5872  C CG2 . VAL C 1 51  ? 13.705  -71.853  -46.820 1.00 40.47  ? 52  VAL C CG2 1 
ATOM   5873  N N   . LEU C 1 52  ? 11.847  -74.688  -48.530 1.00 42.04  ? 53  LEU C N   1 
ATOM   5874  C CA  . LEU C 1 52  ? 10.451  -75.057  -48.324 1.00 41.17  ? 53  LEU C CA  1 
ATOM   5875  C C   . LEU C 1 52  ? 10.288  -75.928  -47.076 1.00 40.01  ? 53  LEU C C   1 
ATOM   5876  O O   . LEU C 1 52  ? 10.031  -77.126  -47.182 1.00 42.83  ? 53  LEU C O   1 
ATOM   5877  C CB  . LEU C 1 52  ? 9.911   -75.783  -49.561 1.00 41.95  ? 53  LEU C CB  1 
ATOM   5878  C CG  . LEU C 1 52  ? 8.408   -76.026  -49.718 1.00 42.45  ? 53  LEU C CG  1 
ATOM   5879  C CD1 . LEU C 1 52  ? 7.618   -74.737  -49.521 1.00 41.71  ? 53  LEU C CD1 1 
ATOM   5880  C CD2 . LEU C 1 52  ? 8.121   -76.621  -51.097 1.00 44.90  ? 53  LEU C CD2 1 
ATOM   5881  N N   . PRO C 1 53  ? 10.452  -75.331  -45.884 1.00 36.27  ? 54  PRO C N   1 
ATOM   5882  C CA  . PRO C 1 53  ? 10.252  -76.116  -44.665 1.00 37.37  ? 54  PRO C CA  1 
ATOM   5883  C C   . PRO C 1 53  ? 8.792   -76.146  -44.227 1.00 39.43  ? 54  PRO C C   1 
ATOM   5884  O O   . PRO C 1 53  ? 7.975   -75.369  -44.725 1.00 40.15  ? 54  PRO C O   1 
ATOM   5885  C CB  . PRO C 1 53  ? 11.104  -75.369  -43.632 1.00 35.86  ? 54  PRO C CB  1 
ATOM   5886  C CG  . PRO C 1 53  ? 10.963  -73.930  -44.056 1.00 34.30  ? 54  PRO C CG  1 
ATOM   5887  C CD  . PRO C 1 53  ? 10.962  -73.981  -45.587 1.00 34.50  ? 54  PRO C CD  1 
ATOM   5888  N N   . MET C 1 54  ? 8.469   -77.043  -43.303 1.00 42.10  ? 55  MET C N   1 
ATOM   5889  C CA  . MET C 1 54  ? 7.202   -76.958  -42.590 1.00 42.97  ? 55  MET C CA  1 
ATOM   5890  C C   . MET C 1 54  ? 7.454   -77.171  -41.102 1.00 40.37  ? 55  MET C C   1 
ATOM   5891  O O   . MET C 1 54  ? 8.392   -77.870  -40.713 1.00 42.23  ? 55  MET C O   1 
ATOM   5892  C CB  . MET C 1 54  ? 6.187   -77.973  -43.124 1.00 44.68  ? 55  MET C CB  1 
ATOM   5893  C CG  . MET C 1 54  ? 6.248   -79.349  -42.480 1.00 45.34  ? 55  MET C CG  1 
ATOM   5894  S SD  . MET C 1 54  ? 4.972   -80.455  -43.129 1.00 49.00  ? 55  MET C SD  1 
ATOM   5895  C CE  . MET C 1 54  ? 5.146   -81.852  -42.025 1.00 48.80  ? 55  MET C CE  1 
ATOM   5896  N N   . ALA C 1 55  ? 6.620   -76.557  -40.272 1.00 37.99  ? 56  ALA C N   1 
ATOM   5897  C CA  . ALA C 1 55  ? 6.767   -76.660  -38.824 1.00 36.93  ? 56  ALA C CA  1 
ATOM   5898  C C   . ALA C 1 55  ? 6.236   -77.992  -38.324 1.00 38.16  ? 56  ALA C C   1 
ATOM   5899  O O   . ALA C 1 55  ? 5.337   -78.578  -38.932 1.00 39.54  ? 56  ALA C O   1 
ATOM   5900  C CB  . ALA C 1 55  ? 6.053   -75.517  -38.133 1.00 36.05  ? 56  ALA C CB  1 
ATOM   5901  N N   . LEU C 1 56  ? 6.790   -78.462  -37.209 1.00 36.36  ? 57  LEU C N   1 
ATOM   5902  C CA  . LEU C 1 56  ? 6.416   -79.755  -36.653 1.00 38.67  ? 57  LEU C CA  1 
ATOM   5903  C C   . LEU C 1 56  ? 5.577   -79.617  -35.394 1.00 38.49  ? 57  LEU C C   1 
ATOM   5904  O O   . LEU C 1 56  ? 5.480   -78.535  -34.814 1.00 38.75  ? 57  LEU C O   1 
ATOM   5905  C CB  . LEU C 1 56  ? 7.664   -80.587  -36.348 1.00 38.87  ? 57  LEU C CB  1 
ATOM   5906  C CG  . LEU C 1 56  ? 8.539   -80.918  -37.557 1.00 39.37  ? 57  LEU C CG  1 
ATOM   5907  C CD1 . LEU C 1 56  ? 9.698   -81.822  -37.155 1.00 39.04  ? 57  LEU C CD1 1 
ATOM   5908  C CD2 . LEU C 1 56  ? 7.696   -81.565  -38.640 1.00 40.44  ? 57  LEU C CD2 1 
ATOM   5909  N N   . GLU C 1 57  ? 4.957   -80.718  -34.984 1.00 39.53  ? 58  GLU C N   1 
ATOM   5910  C CA  . GLU C 1 57  ? 4.253   -80.760  -33.712 1.00 41.22  ? 58  GLU C CA  1 
ATOM   5911  C C   . GLU C 1 57  ? 5.254   -80.986  -32.583 1.00 39.52  ? 58  GLU C C   1 
ATOM   5912  O O   . GLU C 1 57  ? 4.913   -80.877  -31.407 1.00 39.92  ? 58  GLU C O   1 
ATOM   5913  C CB  . GLU C 1 57  ? 3.184   -81.852  -33.707 1.00 46.19  ? 58  GLU C CB  1 
ATOM   5914  C CG  . GLU C 1 57  ? 2.012   -81.578  -34.632 1.00 50.45  ? 58  GLU C CG  1 
ATOM   5915  C CD  . GLU C 1 57  ? 0.805   -82.429  -34.294 1.00 55.07  ? 58  GLU C CD  1 
ATOM   5916  O OE1 . GLU C 1 57  ? 0.572   -83.434  -34.997 1.00 57.13  ? 58  GLU C OE1 1 
ATOM   5917  O OE2 . GLU C 1 57  ? 0.093   -82.094  -33.321 1.00 56.19  ? 58  GLU C OE2 1 
ATOM   5918  N N   . LEU C 1 58  ? 6.487   -81.323  -32.949 1.00 38.23  ? 59  LEU C N   1 
ATOM   5919  C CA  . LEU C 1 58  ? 7.581   -81.349  -31.986 1.00 36.43  ? 59  LEU C CA  1 
ATOM   5920  C C   . LEU C 1 58  ? 7.984   -79.904  -31.728 1.00 36.92  ? 59  LEU C C   1 
ATOM   5921  O O   . LEU C 1 58  ? 8.159   -79.126  -32.671 1.00 37.25  ? 59  LEU C O   1 
ATOM   5922  C CB  . LEU C 1 58  ? 8.761   -82.171  -32.502 1.00 35.90  ? 59  LEU C CB  1 
ATOM   5923  C CG  . LEU C 1 58  ? 8.418   -83.576  -33.007 1.00 38.28  ? 59  LEU C CG  1 
ATOM   5924  C CD1 . LEU C 1 58  ? 9.650   -84.254  -33.576 1.00 39.16  ? 59  LEU C CD1 1 
ATOM   5925  C CD2 . LEU C 1 58  ? 7.803   -84.417  -31.901 1.00 38.96  ? 59  LEU C CD2 1 
ATOM   5926  N N   . MET C 1 59  ? 8.112   -79.537  -30.457 1.00 36.47  ? 60  MET C N   1 
ATOM   5927  C CA  . MET C 1 59  ? 8.254   -78.133  -30.101 1.00 35.50  ? 60  MET C CA  1 
ATOM   5928  C C   . MET C 1 59  ? 9.030   -77.919  -28.805 1.00 34.63  ? 60  MET C C   1 
ATOM   5929  O O   . MET C 1 59  ? 9.314   -78.861  -28.061 1.00 34.63  ? 60  MET C O   1 
ATOM   5930  C CB  . MET C 1 59  ? 6.871   -77.487  -29.974 1.00 36.31  ? 60  MET C CB  1 
ATOM   5931  C CG  . MET C 1 59  ? 6.002   -78.135  -28.904 1.00 37.63  ? 60  MET C CG  1 
ATOM   5932  S SD  . MET C 1 59  ? 4.450   -77.276  -28.569 1.00 47.05  ? 60  MET C SD  1 
ATOM   5933  C CE  . MET C 1 59  ? 3.577   -77.539  -30.106 1.00 40.93  ? 60  MET C CE  1 
ATOM   5934  N N   . THR C 1 60  ? 9.375   -76.664  -28.554 1.00 33.14  ? 61  THR C N   1 
ATOM   5935  C CA  . THR C 1 60  ? 9.953   -76.263  -27.280 1.00 32.36  ? 61  THR C CA  1 
ATOM   5936  C C   . THR C 1 60  ? 8.961   -75.351  -26.574 1.00 34.08  ? 61  THR C C   1 
ATOM   5937  O O   . THR C 1 60  ? 8.398   -74.440  -27.187 1.00 34.75  ? 61  THR C O   1 
ATOM   5938  C CB  . THR C 1 60  ? 11.303  -75.544  -27.458 1.00 29.36  ? 61  THR C CB  1 
ATOM   5939  O OG1 . THR C 1 60  ? 12.267  -76.463  -27.990 1.00 31.08  ? 61  THR C OG1 1 
ATOM   5940  C CG2 . THR C 1 60  ? 11.808  -74.995  -26.113 1.00 26.62  ? 61  THR C CG2 1 
ATOM   5941  N N   . VAL C 1 61  ? 8.733   -75.612  -25.293 1.00 36.61  ? 62  VAL C N   1 
ATOM   5942  C CA  . VAL C 1 61  ? 7.789   -74.829  -24.511 1.00 37.29  ? 62  VAL C CA  1 
ATOM   5943  C C   . VAL C 1 61  ? 8.495   -74.100  -23.372 1.00 38.07  ? 62  VAL C C   1 
ATOM   5944  O O   . VAL C 1 61  ? 9.264   -74.702  -22.622 1.00 39.61  ? 62  VAL C O   1 
ATOM   5945  C CB  . VAL C 1 61  ? 6.671   -75.723  -23.930 1.00 38.61  ? 62  VAL C CB  1 
ATOM   5946  C CG1 . VAL C 1 61  ? 5.810   -74.943  -22.940 1.00 39.39  ? 62  VAL C CG1 1 
ATOM   5947  C CG2 . VAL C 1 61  ? 5.824   -76.321  -25.049 1.00 37.91  ? 62  VAL C CG2 1 
ATOM   5948  N N   . LEU C 1 62  ? 8.253   -72.799  -23.260 1.00 37.08  ? 63  LEU C N   1 
ATOM   5949  C CA  . LEU C 1 62  ? 8.659   -72.063  -22.074 1.00 36.42  ? 63  LEU C CA  1 
ATOM   5950  C C   . LEU C 1 62  ? 7.435   -71.707  -21.268 1.00 37.63  ? 63  LEU C C   1 
ATOM   5951  O O   . LEU C 1 62  ? 6.417   -71.280  -21.805 1.00 36.56  ? 63  LEU C O   1 
ATOM   5952  C CB  . LEU C 1 62  ? 9.442   -70.795  -22.410 1.00 35.24  ? 63  LEU C CB  1 
ATOM   5953  C CG  . LEU C 1 62  ? 10.959  -70.969  -22.400 1.00 35.76  ? 63  LEU C CG  1 
ATOM   5954  C CD1 . LEU C 1 62  ? 11.408  -71.721  -23.648 1.00 34.83  ? 63  LEU C CD1 1 
ATOM   5955  C CD2 . LEU C 1 62  ? 11.670  -69.633  -22.273 1.00 36.05  ? 63  LEU C CD2 1 
ATOM   5956  N N   . VAL C 1 63  ? 7.551   -71.908  -19.966 1.00 39.70  ? 64  VAL C N   1 
ATOM   5957  C CA  . VAL C 1 63  ? 6.506   -71.567  -19.028 1.00 38.87  ? 64  VAL C CA  1 
ATOM   5958  C C   . VAL C 1 63  ? 7.182   -70.741  -17.939 1.00 39.46  ? 64  VAL C C   1 
ATOM   5959  O O   . VAL C 1 63  ? 8.256   -71.104  -17.459 1.00 38.79  ? 64  VAL C O   1 
ATOM   5960  C CB  . VAL C 1 63  ? 5.812   -72.846  -18.495 1.00 44.61  ? 64  VAL C CB  1 
ATOM   5961  C CG1 . VAL C 1 63  ? 5.853   -72.932  -16.988 1.00 46.16  ? 64  VAL C CG1 1 
ATOM   5962  C CG2 . VAL C 1 63  ? 4.386   -72.933  -19.020 1.00 44.82  ? 64  VAL C CG2 1 
ATOM   5963  N N   . GLY C 1 64  ? 6.597   -69.598  -17.592 1.00 38.40  ? 65  GLY C N   1 
ATOM   5964  C CA  . GLY C 1 64  ? 7.283   -68.681  -16.704 1.00 37.42  ? 65  GLY C CA  1 
ATOM   5965  C C   . GLY C 1 64  ? 6.551   -67.440  -16.235 1.00 37.48  ? 65  GLY C C   1 
ATOM   5966  O O   . GLY C 1 64  ? 5.374   -67.236  -16.529 1.00 34.68  ? 65  GLY C O   1 
ATOM   5967  N N   . SER C 1 65  ? 7.276   -66.614  -15.482 1.00 39.21  ? 66  SER C N   1 
ATOM   5968  C CA  . SER C 1 65  ? 6.742   -65.393  -14.888 1.00 39.67  ? 66  SER C CA  1 
ATOM   5969  C C   . SER C 1 65  ? 7.834   -64.338  -14.782 1.00 40.17  ? 66  SER C C   1 
ATOM   5970  O O   . SER C 1 65  ? 9.002   -64.671  -14.582 1.00 41.10  ? 66  SER C O   1 
ATOM   5971  C CB  . SER C 1 65  ? 6.161   -65.671  -13.500 1.00 40.06  ? 66  SER C CB  1 
ATOM   5972  O OG  . SER C 1 65  ? 5.329   -66.814  -13.508 1.00 40.41  ? 66  SER C OG  1 
ATOM   5973  N N   . PRO C 1 66  ? 7.458   -63.057  -14.904 1.00 38.53  ? 67  PRO C N   1 
ATOM   5974  C CA  . PRO C 1 66  ? 8.453   -61.989  -14.777 1.00 38.90  ? 67  PRO C CA  1 
ATOM   5975  C C   . PRO C 1 66  ? 8.969   -61.876  -13.341 1.00 40.90  ? 67  PRO C C   1 
ATOM   5976  O O   . PRO C 1 66  ? 8.232   -62.199  -12.407 1.00 42.17  ? 67  PRO C O   1 
ATOM   5977  C CB  . PRO C 1 66  ? 7.674   -60.736  -15.184 1.00 40.23  ? 67  PRO C CB  1 
ATOM   5978  C CG  . PRO C 1 66  ? 6.254   -61.057  -14.836 1.00 40.56  ? 67  PRO C CG  1 
ATOM   5979  C CD  . PRO C 1 66  ? 6.093   -62.531  -15.083 1.00 38.40  ? 67  PRO C CD  1 
ATOM   5980  N N   . ARG C 1 67  ? 10.218  -61.449  -13.175 1.00 41.55  ? 68  ARG C N   1 
ATOM   5981  C CA  . ARG C 1 67  ? 10.771  -61.179  -11.849 1.00 43.46  ? 68  ARG C CA  1 
ATOM   5982  C C   . ARG C 1 67  ? 10.960  -59.681  -11.673 1.00 45.11  ? 68  ARG C C   1 
ATOM   5983  O O   . ARG C 1 67  ? 10.910  -58.923  -12.643 1.00 43.12  ? 68  ARG C O   1 
ATOM   5984  C CB  . ARG C 1 67  ? 12.104  -61.904  -11.647 1.00 43.09  ? 68  ARG C CB  1 
ATOM   5985  C CG  . ARG C 1 67  ? 12.013  -63.421  -11.678 1.00 41.76  ? 68  ARG C CG  1 
ATOM   5986  C CD  . ARG C 1 67  ? 13.401  -64.045  -11.654 1.00 41.18  ? 68  ARG C CD  1 
ATOM   5987  N NE  . ARG C 1 67  ? 14.098  -63.794  -10.390 1.00 41.51  ? 68  ARG C NE  1 
ATOM   5988  C CZ  . ARG C 1 67  ? 14.290  -64.710  -9.448  1.00 41.36  ? 68  ARG C CZ  1 
ATOM   5989  N NH1 . ARG C 1 67  ? 13.841  -65.946  -9.625  1.00 38.10  ? 68  ARG C NH1 1 
ATOM   5990  N NH2 . ARG C 1 67  ? 14.937  -64.392  -8.328  1.00 42.90  ? 68  ARG C NH2 1 
ATOM   5991  N N   . LYS C 1 68  ? 11.194  -59.254  -10.439 1.00 49.52  ? 69  LYS C N   1 
ATOM   5992  C CA  . LYS C 1 68  ? 11.358  -57.836  -10.166 1.00 52.20  ? 69  LYS C CA  1 
ATOM   5993  C C   . LYS C 1 68  ? 12.810  -57.493  -9.875  1.00 52.46  ? 69  LYS C C   1 
ATOM   5994  O O   . LYS C 1 68  ? 13.156  -56.321  -9.721  1.00 55.27  ? 69  LYS C O   1 
ATOM   5995  C CB  . LYS C 1 68  ? 10.473  -57.411  -8.992  1.00 54.90  ? 69  LYS C CB  1 
ATOM   5996  N N   . ASP C 1 69  ? 13.662  -58.512  -9.806  1.00 49.31  ? 70  ASP C N   1 
ATOM   5997  C CA  . ASP C 1 69  ? 15.030  -58.303  -9.335  1.00 48.35  ? 70  ASP C CA  1 
ATOM   5998  C C   . ASP C 1 69  ? 16.066  -58.305  -10.459 1.00 46.38  ? 70  ASP C C   1 
ATOM   5999  O O   . ASP C 1 69  ? 17.268  -58.274  -10.201 1.00 47.64  ? 70  ASP C O   1 
ATOM   6000  C CB  . ASP C 1 69  ? 15.392  -59.351  -8.271  1.00 48.02  ? 70  ASP C CB  1 
ATOM   6001  C CG  . ASP C 1 69  ? 15.311  -60.788  -8.783  1.00 46.10  ? 70  ASP C CG  1 
ATOM   6002  O OD1 . ASP C 1 69  ? 14.857  -61.019  -9.923  1.00 44.38  ? 70  ASP C OD1 1 
ATOM   6003  O OD2 . ASP C 1 69  ? 15.695  -61.702  -8.017  1.00 46.86  ? 70  ASP C OD2 1 
ATOM   6004  N N   . GLY C 1 70  ? 15.600  -58.326  -11.704 1.00 44.48  ? 71  GLY C N   1 
ATOM   6005  C CA  . GLY C 1 70  ? 16.497  -58.247  -12.842 1.00 44.08  ? 71  GLY C CA  1 
ATOM   6006  C C   . GLY C 1 70  ? 17.368  -59.480  -13.005 1.00 45.11  ? 71  GLY C C   1 
ATOM   6007  O O   . GLY C 1 70  ? 18.443  -59.419  -13.608 1.00 47.35  ? 71  GLY C O   1 
ATOM   6008  N N   . LEU C 1 71  ? 16.904  -60.606  -12.473 1.00 41.96  ? 72  LEU C N   1 
ATOM   6009  C CA  . LEU C 1 71  ? 17.621  -61.865  -12.621 1.00 39.42  ? 72  LEU C CA  1 
ATOM   6010  C C   . LEU C 1 71  ? 16.846  -62.823  -13.511 1.00 38.59  ? 72  LEU C C   1 
ATOM   6011  O O   . LEU C 1 71  ? 15.617  -62.802  -13.535 1.00 39.38  ? 72  LEU C O   1 
ATOM   6012  C CB  . LEU C 1 71  ? 17.875  -62.509  -11.249 1.00 39.45  ? 72  LEU C CB  1 
ATOM   6013  N N   . VAL C 1 72  ? 17.572  -63.659  -14.246 1.00 34.98  ? 73  VAL C N   1 
ATOM   6014  C CA  . VAL C 1 72  ? 16.958  -64.724  -15.020 1.00 35.09  ? 73  VAL C CA  1 
ATOM   6015  C C   . VAL C 1 72  ? 17.260  -66.055  -14.353 1.00 34.09  ? 73  VAL C C   1 
ATOM   6016  O O   . VAL C 1 72  ? 18.416  -66.362  -14.066 1.00 34.84  ? 73  VAL C O   1 
ATOM   6017  C CB  . VAL C 1 72  ? 17.459  -64.740  -16.484 1.00 33.33  ? 73  VAL C CB  1 
ATOM   6018  C CG1 . VAL C 1 72  ? 16.796  -65.868  -17.263 1.00 31.91  ? 73  VAL C CG1 1 
ATOM   6019  C CG2 . VAL C 1 72  ? 17.190  -63.397  -17.152 1.00 32.70  ? 73  VAL C CG2 1 
ATOM   6020  N N   . SER C 1 73  ? 16.218  -66.838  -14.095 1.00 34.24  ? 74  SER C N   1 
ATOM   6021  C CA  . SER C 1 73  ? 16.378  -68.128  -13.428 1.00 35.38  ? 74  SER C CA  1 
ATOM   6022  C C   . SER C 1 73  ? 15.743  -69.243  -14.251 1.00 35.24  ? 74  SER C C   1 
ATOM   6023  O O   . SER C 1 73  ? 14.524  -69.272  -14.433 1.00 36.17  ? 74  SER C O   1 
ATOM   6024  C CB  . SER C 1 73  ? 15.765  -68.087  -12.025 1.00 36.23  ? 74  SER C CB  1 
ATOM   6025  O OG  . SER C 1 73  ? 16.036  -69.283  -11.314 1.00 36.58  ? 74  SER C OG  1 
ATOM   6026  N N   . LEU C 1 74  ? 16.569  -70.167  -14.732 1.00 33.46  ? 75  LEU C N   1 
ATOM   6027  C CA  . LEU C 1 74  ? 16.102  -71.179  -15.671 1.00 33.59  ? 75  LEU C CA  1 
ATOM   6028  C C   . LEU C 1 74  ? 16.191  -72.589  -15.125 1.00 34.89  ? 75  LEU C C   1 
ATOM   6029  O O   . LEU C 1 74  ? 17.102  -72.922  -14.364 1.00 37.00  ? 75  LEU C O   1 
ATOM   6030  C CB  . LEU C 1 74  ? 16.899  -71.104  -16.973 1.00 31.17  ? 75  LEU C CB  1 
ATOM   6031  C CG  . LEU C 1 74  ? 17.011  -69.725  -17.612 1.00 30.28  ? 75  LEU C CG  1 
ATOM   6032  C CD1 . LEU C 1 74  ? 17.918  -69.792  -18.835 1.00 29.28  ? 75  LEU C CD1 1 
ATOM   6033  C CD2 . LEU C 1 74  ? 15.635  -69.213  -17.980 1.00 31.29  ? 75  LEU C CD2 1 
ATOM   6034  N N   . LEU C 1 75  ? 15.226  -73.409  -15.526 1.00 34.48  ? 76  LEU C N   1 
ATOM   6035  C CA  . LEU C 1 75  ? 15.272  -74.849  -15.305 1.00 34.38  ? 76  LEU C CA  1 
ATOM   6036  C C   . LEU C 1 75  ? 14.857  -75.566  -16.578 1.00 33.97  ? 76  LEU C C   1 
ATOM   6037  O O   . LEU C 1 75  ? 13.808  -75.270  -17.144 1.00 32.00  ? 76  LEU C O   1 
ATOM   6038  C CB  . LEU C 1 75  ? 14.355  -75.268  -14.156 1.00 35.01  ? 76  LEU C CB  1 
ATOM   6039  C CG  . LEU C 1 75  ? 14.097  -76.777  -14.077 1.00 35.26  ? 76  LEU C CG  1 
ATOM   6040  C CD1 . LEU C 1 75  ? 15.382  -77.538  -13.744 1.00 34.61  ? 76  LEU C CD1 1 
ATOM   6041  C CD2 . LEU C 1 75  ? 12.995  -77.106  -13.070 1.00 36.66  ? 76  LEU C CD2 1 
ATOM   6042  N N   . THR C 1 76  ? 15.671  -76.508  -17.034 1.00 34.97  ? 77  THR C N   1 
ATOM   6043  C CA  . THR C 1 76  ? 15.239  -77.363  -18.124 1.00 35.77  ? 77  THR C CA  1 
ATOM   6044  C C   . THR C 1 76  ? 15.067  -78.785  -17.612 1.00 39.71  ? 77  THR C C   1 
ATOM   6045  O O   . THR C 1 76  ? 15.817  -79.250  -16.743 1.00 40.75  ? 77  THR C O   1 
ATOM   6046  C CB  . THR C 1 76  ? 16.219  -77.330  -19.320 1.00 35.05  ? 77  THR C CB  1 
ATOM   6047  O OG1 . THR C 1 76  ? 15.642  -78.030  -20.435 1.00 34.13  ? 77  THR C OG1 1 
ATOM   6048  C CG2 . THR C 1 76  ? 17.557  -77.953  -18.951 1.00 34.99  ? 77  THR C CG2 1 
ATOM   6049  N N   . THR C 1 77  ? 14.044  -79.460  -18.121 1.00 42.21  ? 78  THR C N   1 
ATOM   6050  C CA  . THR C 1 77  ? 13.815  -80.855  -17.779 1.00 47.21  ? 78  THR C CA  1 
ATOM   6051  C C   . THR C 1 77  ? 13.966  -81.715  -19.021 1.00 49.87  ? 78  THR C C   1 
ATOM   6052  O O   . THR C 1 77  ? 13.636  -82.900  -19.013 1.00 52.40  ? 78  THR C O   1 
ATOM   6053  C CB  . THR C 1 77  ? 12.424  -81.080  -17.166 1.00 49.95  ? 78  THR C CB  1 
ATOM   6054  O OG1 . THR C 1 77  ? 11.420  -80.881  -18.168 1.00 50.75  ? 78  THR C OG1 1 
ATOM   6055  C CG2 . THR C 1 77  ? 12.185  -80.120  -16.007 1.00 50.73  ? 78  THR C CG2 1 
ATOM   6056  N N   . SER C 1 78  ? 14.465  -81.111  -20.091 1.00 50.41  ? 79  SER C N   1 
ATOM   6057  C CA  . SER C 1 78  ? 14.697  -81.848  -21.322 1.00 53.47  ? 79  SER C CA  1 
ATOM   6058  C C   . SER C 1 78  ? 15.823  -82.858  -21.121 1.00 56.96  ? 79  SER C C   1 
ATOM   6059  O O   . SER C 1 78  ? 16.978  -82.478  -20.919 1.00 57.57  ? 79  SER C O   1 
ATOM   6060  C CB  . SER C 1 78  ? 15.025  -80.894  -22.477 1.00 52.10  ? 79  SER C CB  1 
ATOM   6061  N N   . GLU C 1 79  ? 15.477  -84.144  -21.145 1.00 58.93  ? 80  GLU C N   1 
ATOM   6062  C CA  . GLU C 1 79  ? 16.481  -85.200  -21.115 1.00 59.56  ? 80  GLU C CA  1 
ATOM   6063  C C   . GLU C 1 79  ? 17.364  -85.023  -22.338 1.00 58.07  ? 80  GLU C C   1 
ATOM   6064  O O   . GLU C 1 79  ? 16.867  -84.820  -23.442 1.00 57.92  ? 80  GLU C O   1 
ATOM   6065  C CB  . GLU C 1 79  ? 15.834  -86.588  -21.099 1.00 61.14  ? 80  GLU C CB  1 
ATOM   6066  N N   . GLY C 1 80  ? 18.673  -85.074  -22.138 1.00 56.73  ? 81  GLY C N   1 
ATOM   6067  C CA  . GLY C 1 80  ? 19.597  -84.819  -23.224 1.00 54.54  ? 81  GLY C CA  1 
ATOM   6068  C C   . GLY C 1 80  ? 20.381  -83.544  -22.993 1.00 51.93  ? 81  GLY C C   1 
ATOM   6069  O O   . GLY C 1 80  ? 21.562  -83.465  -23.337 1.00 53.33  ? 81  GLY C O   1 
ATOM   6070  N N   . ALA C 1 81  ? 19.727  -82.549  -22.398 1.00 47.98  ? 82  ALA C N   1 
ATOM   6071  C CA  . ALA C 1 81  ? 20.386  -81.292  -22.045 1.00 45.66  ? 82  ALA C CA  1 
ATOM   6072  C C   . ALA C 1 81  ? 21.568  -81.548  -21.110 1.00 42.55  ? 82  ALA C C   1 
ATOM   6073  O O   . ALA C 1 81  ? 21.483  -82.388  -20.219 1.00 43.43  ? 82  ALA C O   1 
ATOM   6074  C CB  . ALA C 1 81  ? 19.393  -80.330  -21.396 1.00 45.24  ? 82  ALA C CB  1 
ATOM   6075  N N   . ASP C 1 82  ? 22.668  -80.830  -21.321 1.00 40.39  ? 83  ASP C N   1 
ATOM   6076  C CA  . ASP C 1 82  ? 23.869  -81.016  -20.510 1.00 42.10  ? 83  ASP C CA  1 
ATOM   6077  C C   . ASP C 1 82  ? 23.736  -80.333  -19.144 1.00 43.41  ? 83  ASP C C   1 
ATOM   6078  O O   . ASP C 1 82  ? 22.920  -79.427  -18.965 1.00 43.62  ? 83  ASP C O   1 
ATOM   6079  C CB  . ASP C 1 82  ? 25.101  -80.492  -21.249 1.00 41.28  ? 83  ASP C CB  1 
ATOM   6080  C CG  . ASP C 1 82  ? 24.923  -79.068  -21.740 1.00 40.43  ? 83  ASP C CG  1 
ATOM   6081  O OD1 . ASP C 1 82  ? 23.786  -78.703  -22.111 1.00 39.90  ? 83  ASP C OD1 1 
ATOM   6082  O OD2 . ASP C 1 82  ? 25.918  -78.312  -21.747 1.00 39.94  ? 83  ASP C OD2 1 
ATOM   6083  N N   . GLU C 1 83  ? 24.547  -80.778  -18.188 1.00 44.97  ? 84  GLU C N   1 
ATOM   6084  C CA  . GLU C 1 83  ? 24.452  -80.323  -16.803 1.00 46.19  ? 84  GLU C CA  1 
ATOM   6085  C C   . GLU C 1 83  ? 25.167  -78.985  -16.579 1.00 43.70  ? 84  GLU C C   1 
ATOM   6086  O O   . GLU C 1 83  ? 26.153  -78.684  -17.248 1.00 43.28  ? 84  GLU C O   1 
ATOM   6087  C CB  . GLU C 1 83  ? 25.023  -81.395  -15.859 1.00 50.84  ? 84  GLU C CB  1 
ATOM   6088  C CG  . GLU C 1 83  ? 24.225  -82.695  -15.814 1.00 55.39  ? 84  GLU C CG  1 
ATOM   6089  C CD  . GLU C 1 83  ? 22.782  -82.495  -15.367 1.00 58.71  ? 84  GLU C CD  1 
ATOM   6090  O OE1 . GLU C 1 83  ? 22.551  -81.700  -14.430 1.00 60.66  ? 84  GLU C OE1 1 
ATOM   6091  O OE2 . GLU C 1 83  ? 21.878  -83.131  -15.954 1.00 59.58  ? 84  GLU C OE2 1 
ATOM   6092  N N   . PRO C 1 84  ? 24.674  -78.176  -15.627 1.00 42.70  ? 85  PRO C N   1 
ATOM   6093  C CA  . PRO C 1 84  ? 23.505  -78.430  -14.777 1.00 41.51  ? 85  PRO C CA  1 
ATOM   6094  C C   . PRO C 1 84  ? 22.187  -78.112  -15.478 1.00 39.50  ? 85  PRO C C   1 
ATOM   6095  O O   . PRO C 1 84  ? 22.185  -77.367  -16.453 1.00 37.85  ? 85  PRO C O   1 
ATOM   6096  C CB  . PRO C 1 84  ? 23.732  -77.484  -13.598 1.00 42.28  ? 85  PRO C CB  1 
ATOM   6097  C CG  . PRO C 1 84  ? 24.452  -76.330  -14.205 1.00 42.10  ? 85  PRO C CG  1 
ATOM   6098  C CD  . PRO C 1 84  ? 25.351  -76.918  -15.261 1.00 42.96  ? 85  PRO C CD  1 
ATOM   6099  N N   . GLN C 1 85  ? 21.083  -78.657  -14.977 1.00 40.05  ? 86  GLN C N   1 
ATOM   6100  C CA  . GLN C 1 85  ? 19.775  -78.397  -15.574 1.00 40.79  ? 86  GLN C CA  1 
ATOM   6101  C C   . GLN C 1 85  ? 19.247  -77.013  -15.188 1.00 39.92  ? 86  GLN C C   1 
ATOM   6102  O O   . GLN C 1 85  ? 18.171  -76.606  -15.620 1.00 39.81  ? 86  GLN C O   1 
ATOM   6103  C CB  . GLN C 1 85  ? 18.773  -79.479  -15.160 1.00 42.70  ? 86  GLN C CB  1 
ATOM   6104  N N   . ARG C 1 86  ? 20.007  -76.298  -14.368 1.00 39.38  ? 87  ARG C N   1 
ATOM   6105  C CA  . ARG C 1 86  ? 19.620  -74.962  -13.932 1.00 36.88  ? 87  ARG C CA  1 
ATOM   6106  C C   . ARG C 1 86  ? 20.725  -73.948  -14.177 1.00 37.68  ? 87  ARG C C   1 
ATOM   6107  O O   . ARG C 1 86  ? 21.912  -74.273  -14.107 1.00 37.51  ? 87  ARG C O   1 
ATOM   6108  C CB  . ARG C 1 86  ? 19.265  -74.959  -12.448 1.00 35.97  ? 87  ARG C CB  1 
ATOM   6109  C CG  . ARG C 1 86  ? 18.048  -75.775  -12.072 1.00 35.58  ? 87  ARG C CG  1 
ATOM   6110  C CD  . ARG C 1 86  ? 18.000  -75.944  -10.559 1.00 36.89  ? 87  ARG C CD  1 
ATOM   6111  N NE  . ARG C 1 86  ? 16.810  -76.652  -10.102 1.00 36.08  ? 87  ARG C NE  1 
ATOM   6112  C CZ  . ARG C 1 86  ? 16.701  -77.975  -10.063 1.00 36.48  ? 87  ARG C CZ  1 
ATOM   6113  N NH1 . ARG C 1 86  ? 17.708  -78.735  -10.466 1.00 36.25  ? 87  ARG C NH1 1 
ATOM   6114  N NH2 . ARG C 1 86  ? 15.582  -78.538  -9.626  1.00 37.29  ? 87  ARG C NH2 1 
ATOM   6115  N N   . LEU C 1 87  ? 20.323  -72.712  -14.447 1.00 38.39  ? 88  LEU C N   1 
ATOM   6116  C CA  . LEU C 1 87  ? 21.266  -71.608  -14.557 1.00 39.55  ? 88  LEU C CA  1 
ATOM   6117  C C   . LEU C 1 87  ? 20.597  -70.294  -14.192 1.00 39.06  ? 88  LEU C C   1 
ATOM   6118  O O   . LEU C 1 87  ? 19.459  -70.040  -14.582 1.00 38.77  ? 88  LEU C O   1 
ATOM   6119  C CB  . LEU C 1 87  ? 21.842  -71.514  -15.973 1.00 39.68  ? 88  LEU C CB  1 
ATOM   6120  C CG  . LEU C 1 87  ? 23.004  -70.526  -16.085 1.00 40.75  ? 88  LEU C CG  1 
ATOM   6121  C CD1 . LEU C 1 87  ? 24.190  -70.990  -15.246 1.00 41.52  ? 88  LEU C CD1 1 
ATOM   6122  C CD2 . LEU C 1 87  ? 23.408  -70.330  -17.537 1.00 40.77  ? 88  LEU C CD2 1 
ATOM   6123  N N   . GLN C 1 88  ? 21.306  -69.462  -13.437 1.00 39.51  ? 89  GLN C N   1 
ATOM   6124  C CA  . GLN C 1 88  ? 20.829  -68.122  -13.136 1.00 38.01  ? 89  GLN C CA  1 
ATOM   6125  C C   . GLN C 1 88  ? 21.872  -67.092  -13.541 1.00 37.96  ? 89  GLN C C   1 
ATOM   6126  O O   . GLN C 1 88  ? 23.076  -67.337  -13.439 1.00 36.68  ? 89  GLN C O   1 
ATOM   6127  C CB  . GLN C 1 88  ? 20.491  -67.971  -11.651 1.00 37.67  ? 89  GLN C CB  1 
ATOM   6128  C CG  . GLN C 1 88  ? 19.489  -68.983  -11.138 1.00 36.85  ? 89  GLN C CG  1 
ATOM   6129  C CD  . GLN C 1 88  ? 20.157  -70.186  -10.502 1.00 38.35  ? 89  GLN C CD  1 
ATOM   6130  O OE1 . GLN C 1 88  ? 21.311  -70.117  -10.078 1.00 37.33  ? 89  GLN C OE1 1 
ATOM   6131  N NE2 . GLN C 1 88  ? 19.428  -71.293  -10.420 1.00 39.27  ? 89  GLN C NE2 1 
ATOM   6132  N N   . PHE C 1 89  ? 21.402  -65.941  -14.007 1.00 38.08  ? 90  PHE C N   1 
ATOM   6133  C CA  . PHE C 1 89  ? 22.295  -64.864  -14.404 1.00 38.90  ? 90  PHE C CA  1 
ATOM   6134  C C   . PHE C 1 89  ? 21.562  -63.534  -14.384 1.00 38.31  ? 90  PHE C C   1 
ATOM   6135  O O   . PHE C 1 89  ? 20.357  -63.482  -14.625 1.00 38.19  ? 90  PHE C O   1 
ATOM   6136  C CB  . PHE C 1 89  ? 22.890  -65.135  -15.795 1.00 39.67  ? 90  PHE C CB  1 
ATOM   6137  C CG  . PHE C 1 89  ? 21.873  -65.531  -16.840 1.00 40.50  ? 90  PHE C CG  1 
ATOM   6138  C CD1 . PHE C 1 89  ? 21.537  -66.862  -17.029 1.00 40.73  ? 90  PHE C CD1 1 
ATOM   6139  C CD2 . PHE C 1 89  ? 21.278  -64.575  -17.649 1.00 40.30  ? 90  PHE C CD2 1 
ATOM   6140  C CE1 . PHE C 1 89  ? 20.616  -67.234  -17.987 1.00 39.38  ? 90  PHE C CE1 1 
ATOM   6141  C CE2 . PHE C 1 89  ? 20.354  -64.938  -18.611 1.00 39.51  ? 90  PHE C CE2 1 
ATOM   6142  C CZ  . PHE C 1 89  ? 20.023  -66.270  -18.783 1.00 39.14  ? 90  PHE C CZ  1 
ATOM   6143  N N   . PRO C 1 90  ? 22.284  -62.447  -14.079 1.00 40.07  ? 91  PRO C N   1 
ATOM   6144  C CA  . PRO C 1 90  ? 21.644  -61.134  -14.179 1.00 42.87  ? 91  PRO C CA  1 
ATOM   6145  C C   . PRO C 1 90  ? 21.354  -60.788  -15.639 1.00 45.30  ? 91  PRO C C   1 
ATOM   6146  O O   . PRO C 1 90  ? 22.023  -61.308  -16.535 1.00 44.53  ? 91  PRO C O   1 
ATOM   6147  C CB  . PRO C 1 90  ? 22.685  -60.177  -13.581 1.00 44.36  ? 91  PRO C CB  1 
ATOM   6148  C CG  . PRO C 1 90  ? 23.705  -61.059  -12.897 1.00 43.81  ? 91  PRO C CG  1 
ATOM   6149  C CD  . PRO C 1 90  ? 23.685  -62.352  -13.638 1.00 40.75  ? 91  PRO C CD  1 
ATOM   6150  N N   . LEU C 1 91  ? 20.354  -59.945  -15.872 1.00 47.23  ? 92  LEU C N   1 
ATOM   6151  C CA  . LEU C 1 91  ? 20.131  -59.386  -17.196 1.00 47.85  ? 92  LEU C CA  1 
ATOM   6152  C C   . LEU C 1 91  ? 21.383  -58.650  -17.644 1.00 48.97  ? 92  LEU C C   1 
ATOM   6153  O O   . LEU C 1 91  ? 22.094  -58.081  -16.821 1.00 50.53  ? 92  LEU C O   1 
ATOM   6154  C CB  . LEU C 1 91  ? 18.934  -58.436  -17.198 1.00 49.52  ? 92  LEU C CB  1 
ATOM   6155  C CG  . LEU C 1 91  ? 17.558  -59.033  -16.908 1.00 49.42  ? 92  LEU C CG  1 
ATOM   6156  C CD1 . LEU C 1 91  ? 16.591  -57.925  -16.537 1.00 50.98  ? 92  LEU C CD1 1 
ATOM   6157  C CD2 . LEU C 1 91  ? 17.049  -59.813  -18.108 1.00 47.97  ? 92  LEU C CD2 1 
ATOM   6158  N N   . PRO C 1 92  ? 21.670  -58.674  -18.952 1.00 48.51  ? 93  PRO C N   1 
ATOM   6159  C CA  . PRO C 1 92  ? 22.815  -57.910  -19.457 1.00 50.30  ? 93  PRO C CA  1 
ATOM   6160  C C   . PRO C 1 92  ? 22.618  -56.404  -19.297 1.00 51.91  ? 93  PRO C C   1 
ATOM   6161  O O   . PRO C 1 92  ? 21.488  -55.918  -19.229 1.00 50.35  ? 93  PRO C O   1 
ATOM   6162  C CB  . PRO C 1 92  ? 22.876  -58.301  -20.939 1.00 48.95  ? 93  PRO C CB  1 
ATOM   6163  C CG  . PRO C 1 92  ? 21.492  -58.754  -21.272 1.00 47.53  ? 93  PRO C CG  1 
ATOM   6164  C CD  . PRO C 1 92  ? 20.982  -59.417  -20.021 1.00 47.19  ? 93  PRO C CD  1 
ATOM   6165  N N   . THR C 1 93  ? 23.724  -55.676  -19.219 1.00 55.95  ? 94  THR C N   1 
ATOM   6166  C CA  . THR C 1 93  ? 23.689  -54.223  -19.156 1.00 61.26  ? 94  THR C CA  1 
ATOM   6167  C C   . THR C 1 93  ? 24.738  -53.665  -20.099 1.00 66.03  ? 94  THR C C   1 
ATOM   6168  O O   . THR C 1 93  ? 25.487  -54.422  -20.718 1.00 65.24  ? 94  THR C O   1 
ATOM   6169  C CB  . THR C 1 93  ? 23.957  -53.692  -17.731 1.00 63.69  ? 94  THR C CB  1 
ATOM   6170  O OG1 . THR C 1 93  ? 25.269  -54.087  -17.309 1.00 64.85  ? 94  THR C OG1 1 
ATOM   6171  C CG2 . THR C 1 93  ? 22.926  -54.224  -16.746 1.00 63.26  ? 94  THR C CG2 1 
ATOM   6172  N N   . ALA C 1 94  ? 24.799  -52.342  -20.206 1.00 71.30  ? 95  ALA C N   1 
ATOM   6173  C CA  . ALA C 1 94  ? 25.866  -51.703  -20.960 1.00 75.83  ? 95  ALA C CA  1 
ATOM   6174  C C   . ALA C 1 94  ? 27.194  -51.992  -20.273 1.00 78.92  ? 95  ALA C C   1 
ATOM   6175  O O   . ALA C 1 94  ? 28.239  -52.081  -20.917 1.00 80.11  ? 95  ALA C O   1 
ATOM   6176  C CB  . ALA C 1 94  ? 25.628  -50.207  -21.076 1.00 78.71  ? 95  ALA C CB  1 
ATOM   6177  N N   . GLN C 1 95  ? 27.135  -52.153  -18.955 1.00 80.44  ? 96  GLN C N   1 
ATOM   6178  C CA  . GLN C 1 95  ? 28.316  -52.466  -18.161 1.00 81.96  ? 96  GLN C CA  1 
ATOM   6179  C C   . GLN C 1 95  ? 28.761  -53.912  -18.366 1.00 79.74  ? 96  GLN C C   1 
ATOM   6180  O O   . GLN C 1 95  ? 29.952  -54.183  -18.520 1.00 82.03  ? 96  GLN C O   1 
ATOM   6181  C CB  . GLN C 1 95  ? 28.045  -52.202  -16.677 1.00 83.72  ? 96  GLN C CB  1 
ATOM   6182  N N   . ARG C 1 96  ? 27.807  -54.839  -18.373 1.00 74.89  ? 97  ARG C N   1 
ATOM   6183  C CA  . ARG C 1 96  ? 28.128  -56.256  -18.522 1.00 70.62  ? 97  ARG C CA  1 
ATOM   6184  C C   . ARG C 1 96  ? 27.204  -56.973  -19.508 1.00 67.02  ? 97  ARG C C   1 
ATOM   6185  O O   . ARG C 1 96  ? 25.981  -56.933  -19.374 1.00 64.86  ? 97  ARG C O   1 
ATOM   6186  C CB  . ARG C 1 96  ? 28.070  -56.955  -17.163 1.00 71.45  ? 97  ARG C CB  1 
ATOM   6187  N N   . SER C 1 97  ? 27.799  -57.634  -20.496 1.00 65.34  ? 98  SER C N   1 
ATOM   6188  C CA  . SER C 1 97  ? 27.033  -58.436  -21.441 1.00 61.67  ? 98  SER C CA  1 
ATOM   6189  C C   . SER C 1 97  ? 27.142  -59.912  -21.086 1.00 57.39  ? 98  SER C C   1 
ATOM   6190  O O   . SER C 1 97  ? 28.152  -60.352  -20.537 1.00 59.51  ? 98  SER C O   1 
ATOM   6191  C CB  . SER C 1 97  ? 27.517  -58.202  -22.874 1.00 62.57  ? 98  SER C CB  1 
ATOM   6192  O OG  . SER C 1 97  ? 28.794  -58.779  -23.078 1.00 63.93  ? 98  SER C OG  1 
ATOM   6193  N N   . LEU C 1 98  ? 26.097  -60.673  -21.392 1.00 51.48  ? 99  LEU C N   1 
ATOM   6194  C CA  . LEU C 1 98  ? 26.120  -62.115  -21.184 1.00 47.04  ? 99  LEU C CA  1 
ATOM   6195  C C   . LEU C 1 98  ? 27.191  -62.755  -22.054 1.00 46.28  ? 99  LEU C C   1 
ATOM   6196  O O   . LEU C 1 98  ? 27.649  -62.162  -23.029 1.00 47.59  ? 99  LEU C O   1 
ATOM   6197  C CB  . LEU C 1 98  ? 24.755  -62.732  -21.489 1.00 44.18  ? 99  LEU C CB  1 
ATOM   6198  C CG  . LEU C 1 98  ? 23.570  -62.247  -20.653 1.00 42.58  ? 99  LEU C CG  1 
ATOM   6199  C CD1 . LEU C 1 98  ? 22.286  -62.917  -21.132 1.00 39.76  ? 99  LEU C CD1 1 
ATOM   6200  C CD2 . LEU C 1 98  ? 23.806  -62.520  -19.173 1.00 42.89  ? 99  LEU C CD2 1 
ATOM   6201  N N   . GLU C 1 99  ? 27.590  -63.967  -21.700 1.00 45.85  ? 100 GLU C N   1 
ATOM   6202  C CA  . GLU C 1 99  ? 28.617  -64.674  -22.451 1.00 46.62  ? 100 GLU C CA  1 
ATOM   6203  C C   . GLU C 1 99  ? 28.269  -66.152  -22.529 1.00 46.54  ? 100 GLU C C   1 
ATOM   6204  O O   . GLU C 1 99  ? 27.632  -66.690  -21.624 1.00 45.70  ? 100 GLU C O   1 
ATOM   6205  C CB  . GLU C 1 99  ? 29.994  -64.477  -21.806 1.00 47.61  ? 100 GLU C CB  1 
ATOM   6206  N N   . PRO C 1 100 ? 28.671  -66.815  -23.621 1.00 48.52  ? 101 PRO C N   1 
ATOM   6207  C CA  . PRO C 1 100 ? 28.394  -68.247  -23.732 1.00 48.39  ? 101 PRO C CA  1 
ATOM   6208  C C   . PRO C 1 100 ? 29.293  -69.073  -22.819 1.00 48.08  ? 101 PRO C C   1 
ATOM   6209  O O   . PRO C 1 100 ? 30.397  -68.646  -22.485 1.00 48.62  ? 101 PRO C O   1 
ATOM   6210  C CB  . PRO C 1 100 ? 28.681  -68.545  -25.208 1.00 49.53  ? 101 PRO C CB  1 
ATOM   6211  C CG  . PRO C 1 100 ? 29.663  -67.501  -25.614 1.00 51.08  ? 101 PRO C CG  1 
ATOM   6212  C CD  . PRO C 1 100 ? 29.282  -66.269  -24.847 1.00 50.73  ? 101 PRO C CD  1 
ATOM   6213  N N   . GLY C 1 101 ? 28.815  -70.247  -22.420 1.00 47.66  ? 102 GLY C N   1 
ATOM   6214  C CA  . GLY C 1 101 ? 29.596  -71.145  -21.593 1.00 48.72  ? 102 GLY C CA  1 
ATOM   6215  C C   . GLY C 1 101 ? 28.829  -72.386  -21.182 1.00 49.42  ? 102 GLY C C   1 
ATOM   6216  O O   . GLY C 1 101 ? 28.157  -73.016  -21.998 1.00 49.39  ? 102 GLY C O   1 
ATOM   6217  N N   . THR C 1 102 ? 28.932  -72.728  -19.903 1.00 51.36  ? 103 THR C N   1 
ATOM   6218  C CA  . THR C 1 102 ? 28.303  -73.918  -19.342 1.00 51.43  ? 103 THR C CA  1 
ATOM   6219  C C   . THR C 1 102 ? 27.050  -73.528  -18.566 1.00 47.46  ? 103 THR C C   1 
ATOM   6220  O O   . THR C 1 102 ? 27.070  -72.564  -17.805 1.00 48.49  ? 103 THR C O   1 
ATOM   6221  C CB  . THR C 1 102 ? 29.282  -74.671  -18.406 1.00 56.95  ? 103 THR C CB  1 
ATOM   6222  O OG1 . THR C 1 102 ? 30.559  -74.793  -19.045 1.00 60.43  ? 103 THR C OG1 1 
ATOM   6223  C CG2 . THR C 1 102 ? 28.759  -76.057  -18.040 1.00 57.01  ? 103 THR C CG2 1 
ATOM   6224  N N   . PRO C 1 103 ? 25.944  -74.259  -18.767 1.00 43.95  ? 104 PRO C N   1 
ATOM   6225  C CA  . PRO C 1 103 ? 25.766  -75.352  -19.728 1.00 42.86  ? 104 PRO C CA  1 
ATOM   6226  C C   . PRO C 1 103 ? 25.399  -74.831  -21.119 1.00 42.30  ? 104 PRO C C   1 
ATOM   6227  O O   . PRO C 1 103 ? 24.947  -73.692  -21.243 1.00 40.49  ? 104 PRO C O   1 
ATOM   6228  C CB  . PRO C 1 103 ? 24.620  -76.156  -19.120 1.00 41.25  ? 104 PRO C CB  1 
ATOM   6229  C CG  . PRO C 1 103 ? 23.799  -75.124  -18.429 1.00 40.70  ? 104 PRO C CG  1 
ATOM   6230  C CD  . PRO C 1 103 ? 24.759  -74.091  -17.909 1.00 42.71  ? 104 PRO C CD  1 
ATOM   6231  N N   . ARG C 1 104 ? 25.579  -75.664  -22.140 1.00 44.13  ? 105 ARG C N   1 
ATOM   6232  C CA  . ARG C 1 104 ? 25.419  -75.234  -23.527 1.00 45.05  ? 105 ARG C CA  1 
ATOM   6233  C C   . ARG C 1 104 ? 23.979  -74.872  -23.883 1.00 42.66  ? 105 ARG C C   1 
ATOM   6234  O O   . ARG C 1 104 ? 23.749  -73.942  -24.652 1.00 42.43  ? 105 ARG C O   1 
ATOM   6235  C CB  . ARG C 1 104 ? 25.929  -76.318  -24.483 1.00 48.44  ? 105 ARG C CB  1 
ATOM   6236  C CG  . ARG C 1 104 ? 27.428  -76.578  -24.385 1.00 53.26  ? 105 ARG C CG  1 
ATOM   6237  C CD  . ARG C 1 104 ? 27.940  -77.388  -25.572 1.00 57.65  ? 105 ARG C CD  1 
ATOM   6238  N NE  . ARG C 1 104 ? 27.329  -78.712  -25.645 1.00 60.61  ? 105 ARG C NE  1 
ATOM   6239  C CZ  . ARG C 1 104 ? 27.631  -79.627  -26.562 1.00 63.74  ? 105 ARG C CZ  1 
ATOM   6240  N NH1 . ARG C 1 104 ? 28.537  -79.361  -27.496 1.00 65.50  ? 105 ARG C NH1 1 
ATOM   6241  N NH2 . ARG C 1 104 ? 27.020  -80.806  -26.552 1.00 64.11  ? 105 ARG C NH2 1 
ATOM   6242  N N   . TRP C 1 105 ? 23.013  -75.593  -23.320 1.00 41.25  ? 106 TRP C N   1 
ATOM   6243  C CA  . TRP C 1 105 ? 21.611  -75.365  -23.661 1.00 40.04  ? 106 TRP C CA  1 
ATOM   6244  C C   . TRP C 1 105 ? 21.178  -73.950  -23.301 1.00 37.74  ? 106 TRP C C   1 
ATOM   6245  O O   . TRP C 1 105 ? 20.287  -73.380  -23.939 1.00 35.97  ? 106 TRP C O   1 
ATOM   6246  C CB  . TRP C 1 105 ? 20.702  -76.389  -22.966 1.00 41.27  ? 106 TRP C CB  1 
ATOM   6247  C CG  . TRP C 1 105 ? 20.732  -76.341  -21.466 1.00 43.50  ? 106 TRP C CG  1 
ATOM   6248  C CD1 . TRP C 1 105 ? 21.497  -77.110  -20.633 1.00 44.71  ? 106 TRP C CD1 1 
ATOM   6249  C CD2 . TRP C 1 105 ? 19.949  -75.487  -20.607 1.00 44.20  ? 106 TRP C CD2 1 
ATOM   6250  N NE1 . TRP C 1 105 ? 21.241  -76.787  -19.321 1.00 45.87  ? 106 TRP C NE1 1 
ATOM   6251  C CE2 . TRP C 1 105 ? 20.305  -75.797  -19.284 1.00 45.78  ? 106 TRP C CE2 1 
ATOM   6252  C CE3 . TRP C 1 105 ? 18.993  -74.499  -20.853 1.00 44.13  ? 106 TRP C CE3 1 
ATOM   6253  C CZ2 . TRP C 1 105 ? 19.726  -75.139  -18.190 1.00 46.75  ? 106 TRP C CZ2 1 
ATOM   6254  C CZ3 . TRP C 1 105 ? 18.426  -73.850  -19.762 1.00 44.80  ? 106 TRP C CZ3 1 
ATOM   6255  C CH2 . TRP C 1 105 ? 18.794  -74.172  -18.453 1.00 46.30  ? 106 TRP C CH2 1 
ATOM   6256  N N   . ALA C 1 106 ? 21.819  -73.383  -22.284 1.00 36.48  ? 107 ALA C N   1 
ATOM   6257  C CA  . ALA C 1 106 ? 21.465  -72.055  -21.807 1.00 35.63  ? 107 ALA C CA  1 
ATOM   6258  C C   . ALA C 1 106 ? 21.997  -70.955  -22.719 1.00 35.23  ? 107 ALA C C   1 
ATOM   6259  O O   . ALA C 1 106 ? 21.502  -69.828  -22.682 1.00 34.97  ? 107 ALA C O   1 
ATOM   6260  C CB  . ALA C 1 106 ? 21.977  -71.853  -20.385 1.00 36.56  ? 107 ALA C CB  1 
ATOM   6261  N N   . ASN C 1 107 ? 23.001  -71.278  -23.530 1.00 36.11  ? 108 ASN C N   1 
ATOM   6262  C CA  . ASN C 1 107 ? 23.594  -70.298  -24.442 1.00 37.18  ? 108 ASN C CA  1 
ATOM   6263  C C   . ASN C 1 107 ? 22.589  -69.744  -25.445 1.00 37.13  ? 108 ASN C C   1 
ATOM   6264  O O   . ASN C 1 107 ? 22.682  -68.583  -25.859 1.00 36.69  ? 108 ASN C O   1 
ATOM   6265  C CB  . ASN C 1 107 ? 24.782  -70.908  -25.191 1.00 38.59  ? 108 ASN C CB  1 
ATOM   6266  C CG  . ASN C 1 107 ? 25.973  -71.164  -24.282 1.00 40.12  ? 108 ASN C CG  1 
ATOM   6267  O OD1 . ASN C 1 107 ? 26.097  -70.552  -23.224 1.00 40.61  ? 108 ASN C OD1 1 
ATOM   6268  N ND2 . ASN C 1 107 ? 26.857  -72.065  -24.697 1.00 40.78  ? 108 ASN C ND2 1 
ATOM   6269  N N   . TYR C 1 108 ? 21.633  -70.578  -25.836 1.00 37.01  ? 109 TYR C N   1 
ATOM   6270  C CA  . TYR C 1 108 ? 20.609  -70.152  -26.782 1.00 37.48  ? 109 TYR C CA  1 
ATOM   6271  C C   . TYR C 1 108 ? 19.706  -69.107  -26.144 1.00 36.25  ? 109 TYR C C   1 
ATOM   6272  O O   . TYR C 1 108 ? 19.347  -68.117  -26.774 1.00 37.73  ? 109 TYR C O   1 
ATOM   6273  C CB  . TYR C 1 108 ? 19.784  -71.346  -27.264 1.00 37.80  ? 109 TYR C CB  1 
ATOM   6274  C CG  . TYR C 1 108 ? 20.608  -72.428  -27.922 1.00 38.68  ? 109 TYR C CG  1 
ATOM   6275  C CD1 . TYR C 1 108 ? 21.160  -72.238  -29.183 1.00 40.38  ? 109 TYR C CD1 1 
ATOM   6276  C CD2 . TYR C 1 108 ? 20.826  -73.642  -27.288 1.00 39.48  ? 109 TYR C CD2 1 
ATOM   6277  C CE1 . TYR C 1 108 ? 21.914  -73.222  -29.787 1.00 41.00  ? 109 TYR C CE1 1 
ATOM   6278  C CE2 . TYR C 1 108 ? 21.574  -74.636  -27.886 1.00 40.60  ? 109 TYR C CE2 1 
ATOM   6279  C CZ  . TYR C 1 108 ? 22.116  -74.422  -29.135 1.00 41.43  ? 109 TYR C CZ  1 
ATOM   6280  O OH  . TYR C 1 108 ? 22.863  -75.413  -29.730 1.00 42.48  ? 109 TYR C OH  1 
ATOM   6281  N N   . VAL C 1 109 ? 19.343  -69.331  -24.888 1.00 33.52  ? 110 VAL C N   1 
ATOM   6282  C CA  . VAL C 1 109 ? 18.486  -68.393  -24.179 1.00 32.01  ? 110 VAL C CA  1 
ATOM   6283  C C   . VAL C 1 109 ? 19.246  -67.100  -23.914 1.00 32.90  ? 110 VAL C C   1 
ATOM   6284  O O   . VAL C 1 109 ? 18.727  -66.007  -24.153 1.00 31.55  ? 110 VAL C O   1 
ATOM   6285  C CB  . VAL C 1 109 ? 17.972  -68.990  -22.858 1.00 30.84  ? 110 VAL C CB  1 
ATOM   6286  C CG1 . VAL C 1 109 ? 17.032  -68.013  -22.154 1.00 29.27  ? 110 VAL C CG1 1 
ATOM   6287  C CG2 . VAL C 1 109 ? 17.272  -70.319  -23.125 1.00 29.14  ? 110 VAL C CG2 1 
ATOM   6288  N N   . LYS C 1 110 ? 20.480  -67.236  -23.427 1.00 34.83  ? 111 LYS C N   1 
ATOM   6289  C CA  . LYS C 1 110 ? 21.373  -66.099  -23.221 1.00 37.20  ? 111 LYS C CA  1 
ATOM   6290  C C   . LYS C 1 110 ? 21.498  -65.218  -24.459 1.00 37.38  ? 111 LYS C C   1 
ATOM   6291  O O   . LYS C 1 110 ? 21.432  -63.993  -24.362 1.00 39.36  ? 111 LYS C O   1 
ATOM   6292  C CB  . LYS C 1 110 ? 22.770  -66.573  -22.822 1.00 39.43  ? 111 LYS C CB  1 
ATOM   6293  C CG  . LYS C 1 110 ? 22.912  -67.095  -21.407 1.00 41.43  ? 111 LYS C CG  1 
ATOM   6294  C CD  . LYS C 1 110 ? 24.317  -67.648  -21.237 1.00 44.30  ? 111 LYS C CD  1 
ATOM   6295  C CE  . LYS C 1 110 ? 24.705  -67.824  -19.793 1.00 47.51  ? 111 LYS C CE  1 
ATOM   6296  N NZ  . LYS C 1 110 ? 26.129  -68.257  -19.686 1.00 49.67  ? 111 LYS C NZ  1 
ATOM   6297  N N   . GLY C 1 111 ? 21.699  -65.850  -25.614 1.00 35.86  ? 112 GLY C N   1 
ATOM   6298  C CA  . GLY C 1 111 ? 21.931  -65.128  -26.853 1.00 34.88  ? 112 GLY C CA  1 
ATOM   6299  C C   . GLY C 1 111 ? 20.744  -64.289  -27.273 1.00 33.51  ? 112 GLY C C   1 
ATOM   6300  O O   . GLY C 1 111 ? 20.887  -63.117  -27.624 1.00 33.49  ? 112 GLY C O   1 
ATOM   6301  N N   . VAL C 1 112 ? 19.565  -64.895  -27.237 1.00 29.22  ? 113 VAL C N   1 
ATOM   6302  C CA  . VAL C 1 112 ? 18.336  -64.190  -27.570 1.00 30.51  ? 113 VAL C CA  1 
ATOM   6303  C C   . VAL C 1 112 ? 18.108  -63.012  -26.624 1.00 31.94  ? 113 VAL C C   1 
ATOM   6304  O O   . VAL C 1 112 ? 17.766  -61.915  -27.068 1.00 35.08  ? 113 VAL C O   1 
ATOM   6305  C CB  . VAL C 1 112 ? 17.130  -65.142  -27.527 1.00 28.53  ? 113 VAL C CB  1 
ATOM   6306  C CG1 . VAL C 1 112 ? 15.830  -64.380  -27.748 1.00 27.47  ? 113 VAL C CG1 1 
ATOM   6307  C CG2 . VAL C 1 112 ? 17.306  -66.246  -28.568 1.00 28.21  ? 113 VAL C CG2 1 
ATOM   6308  N N   . ILE C 1 113 ? 18.312  -63.240  -25.325 1.00 31.01  ? 114 ILE C N   1 
ATOM   6309  C CA  . ILE C 1 113 ? 18.216  -62.170  -24.330 1.00 31.09  ? 114 ILE C CA  1 
ATOM   6310  C C   . ILE C 1 113 ? 19.195  -61.039  -24.637 1.00 33.75  ? 114 ILE C C   1 
ATOM   6311  O O   . ILE C 1 113 ? 18.832  -59.865  -24.612 1.00 34.76  ? 114 ILE C O   1 
ATOM   6312  C CB  . ILE C 1 113 ? 18.490  -62.698  -22.898 1.00 33.93  ? 114 ILE C CB  1 
ATOM   6313  C CG1 . ILE C 1 113 ? 17.384  -63.658  -22.459 1.00 32.72  ? 114 ILE C CG1 1 
ATOM   6314  C CG2 . ILE C 1 113 ? 18.613  -61.546  -21.903 1.00 34.08  ? 114 ILE C CG2 1 
ATOM   6315  C CD1 . ILE C 1 113 ? 17.670  -64.350  -21.144 1.00 32.81  ? 114 ILE C CD1 1 
ATOM   6316  N N   . GLN C 1 114 ? 20.438  -61.410  -24.934 1.00 34.90  ? 115 GLN C N   1 
ATOM   6317  C CA  . GLN C 1 114 ? 21.501  -60.449  -25.207 1.00 36.53  ? 115 GLN C CA  1 
ATOM   6318  C C   . GLN C 1 114 ? 21.192  -59.558  -26.405 1.00 37.17  ? 115 GLN C C   1 
ATOM   6319  O O   . GLN C 1 114 ? 21.532  -58.375  -26.413 1.00 38.50  ? 115 GLN C O   1 
ATOM   6320  C CB  . GLN C 1 114 ? 22.826  -61.177  -25.449 1.00 37.15  ? 115 GLN C CB  1 
ATOM   6321  C CG  . GLN C 1 114 ? 24.002  -60.239  -25.703 1.00 39.99  ? 115 GLN C CG  1 
ATOM   6322  C CD  . GLN C 1 114 ? 24.330  -59.399  -24.484 1.00 41.33  ? 115 GLN C CD  1 
ATOM   6323  O OE1 . GLN C 1 114 ? 24.188  -59.860  -23.359 1.00 40.97  ? 115 GLN C OE1 1 
ATOM   6324  N NE2 . GLN C 1 114 ? 24.764  -58.162  -24.703 1.00 43.19  ? 115 GLN C NE2 1 
ATOM   6325  N N   . TYR C 1 115 ? 20.551  -60.127  -27.420 1.00 37.13  ? 116 TYR C N   1 
ATOM   6326  C CA  . TYR C 1 115 ? 20.297  -59.380  -28.641 1.00 38.70  ? 116 TYR C CA  1 
ATOM   6327  C C   . TYR C 1 115 ? 18.841  -58.950  -28.783 1.00 37.82  ? 116 TYR C C   1 
ATOM   6328  O O   . TYR C 1 115 ? 18.440  -58.460  -29.838 1.00 35.93  ? 116 TYR C O   1 
ATOM   6329  C CB  . TYR C 1 115 ? 20.731  -60.202  -29.856 1.00 40.53  ? 116 TYR C CB  1 
ATOM   6330  C CG  . TYR C 1 115 ? 22.205  -60.536  -29.829 1.00 42.40  ? 116 TYR C CG  1 
ATOM   6331  C CD1 . TYR C 1 115 ? 23.160  -59.529  -29.822 1.00 43.81  ? 116 TYR C CD1 1 
ATOM   6332  C CD2 . TYR C 1 115 ? 22.642  -61.853  -29.805 1.00 42.41  ? 116 TYR C CD2 1 
ATOM   6333  C CE1 . TYR C 1 115 ? 24.509  -59.823  -29.795 1.00 45.00  ? 116 TYR C CE1 1 
ATOM   6334  C CE2 . TYR C 1 115 ? 23.993  -62.157  -29.774 1.00 43.68  ? 116 TYR C CE2 1 
ATOM   6335  C CZ  . TYR C 1 115 ? 24.920  -61.136  -29.772 1.00 44.55  ? 116 TYR C CZ  1 
ATOM   6336  O OH  . TYR C 1 115 ? 26.263  -61.429  -29.744 1.00 46.49  ? 116 TYR C OH  1 
ATOM   6337  N N   . TYR C 1 116 ? 18.054  -59.114  -27.720 1.00 37.29  ? 117 TYR C N   1 
ATOM   6338  C CA  . TYR C 1 116 ? 16.666  -58.659  -27.753 1.00 37.48  ? 117 TYR C CA  1 
ATOM   6339  C C   . TYR C 1 116 ? 16.618  -57.141  -27.931 1.00 41.31  ? 117 TYR C C   1 
ATOM   6340  O O   . TYR C 1 116 ? 17.269  -56.409  -27.187 1.00 44.21  ? 117 TYR C O   1 
ATOM   6341  C CB  . TYR C 1 116 ? 15.917  -59.076  -26.488 1.00 35.63  ? 117 TYR C CB  1 
ATOM   6342  C CG  . TYR C 1 116 ? 14.424  -58.921  -26.625 1.00 35.15  ? 117 TYR C CG  1 
ATOM   6343  C CD1 . TYR C 1 116 ? 13.705  -59.743  -27.486 1.00 33.21  ? 117 TYR C CD1 1 
ATOM   6344  C CD2 . TYR C 1 116 ? 13.732  -57.946  -25.916 1.00 35.54  ? 117 TYR C CD2 1 
ATOM   6345  C CE1 . TYR C 1 116 ? 12.342  -59.609  -27.633 1.00 33.52  ? 117 TYR C CE1 1 
ATOM   6346  C CE2 . TYR C 1 116 ? 12.359  -57.805  -26.057 1.00 35.99  ? 117 TYR C CE2 1 
ATOM   6347  C CZ  . TYR C 1 116 ? 11.672  -58.644  -26.917 1.00 35.33  ? 117 TYR C CZ  1 
ATOM   6348  O OH  . TYR C 1 116 ? 10.310  -58.522  -27.074 1.00 36.23  ? 117 TYR C OH  1 
ATOM   6349  N N   . PRO C 1 117 ? 15.851  -56.666  -28.928 1.00 42.58  ? 118 PRO C N   1 
ATOM   6350  C CA  . PRO C 1 117 ? 15.863  -55.254  -29.342 1.00 44.66  ? 118 PRO C CA  1 
ATOM   6351  C C   . PRO C 1 117 ? 15.062  -54.284  -28.466 1.00 46.95  ? 118 PRO C C   1 
ATOM   6352  O O   . PRO C 1 117 ? 15.328  -53.080  -28.518 1.00 49.96  ? 118 PRO C O   1 
ATOM   6353  C CB  . PRO C 1 117 ? 15.253  -55.306  -30.747 1.00 44.62  ? 118 PRO C CB  1 
ATOM   6354  C CG  . PRO C 1 117 ? 14.342  -56.481  -30.709 1.00 42.24  ? 118 PRO C CG  1 
ATOM   6355  C CD  . PRO C 1 117 ? 15.025  -57.496  -29.824 1.00 41.06  ? 118 PRO C CD  1 
ATOM   6356  N N   . ALA C 1 118 ? 14.102  -54.774  -27.689 1.00 44.66  ? 119 ALA C N   1 
ATOM   6357  C CA  . ALA C 1 118 ? 13.215  -53.871  -26.956 1.00 43.99  ? 119 ALA C CA  1 
ATOM   6358  C C   . ALA C 1 118 ? 13.582  -53.752  -25.477 1.00 43.62  ? 119 ALA C C   1 
ATOM   6359  O O   . ALA C 1 118 ? 14.214  -54.638  -24.905 1.00 42.17  ? 119 ALA C O   1 
ATOM   6360  C CB  . ALA C 1 118 ? 11.770  -54.324  -27.102 1.00 43.18  ? 119 ALA C CB  1 
ATOM   6361  N N   . ALA C 1 119 ? 13.165  -52.645  -24.872 1.00 45.50  ? 120 ALA C N   1 
ATOM   6362  C CA  . ALA C 1 119 ? 13.455  -52.340  -23.476 1.00 46.09  ? 120 ALA C CA  1 
ATOM   6363  C C   . ALA C 1 119 ? 12.263  -51.600  -22.867 1.00 47.85  ? 120 ALA C C   1 
ATOM   6364  O O   . ALA C 1 119 ? 11.527  -50.925  -23.585 1.00 47.99  ? 120 ALA C O   1 
ATOM   6365  C CB  . ALA C 1 119 ? 14.730  -51.507  -23.370 1.00 46.75  ? 120 ALA C CB  1 
ATOM   6366  N N   . PRO C 1 120 ? 12.065  -51.717  -21.542 1.00 49.20  ? 121 PRO C N   1 
ATOM   6367  C CA  . PRO C 1 120 ? 12.876  -52.468  -20.577 1.00 48.20  ? 121 PRO C CA  1 
ATOM   6368  C C   . PRO C 1 120 ? 12.473  -53.935  -20.451 1.00 44.29  ? 121 PRO C C   1 
ATOM   6369  O O   . PRO C 1 120 ? 11.298  -54.257  -20.266 1.00 43.58  ? 121 PRO C O   1 
ATOM   6370  C CB  . PRO C 1 120 ? 12.622  -51.724  -19.264 1.00 51.04  ? 121 PRO C CB  1 
ATOM   6371  C CG  . PRO C 1 120 ? 11.229  -51.230  -19.395 1.00 51.76  ? 121 PRO C CG  1 
ATOM   6372  C CD  . PRO C 1 120 ? 11.004  -50.942  -20.871 1.00 51.14  ? 121 PRO C CD  1 
ATOM   6373  N N   . LEU C 1 121 ? 13.462  -54.813  -20.557 1.00 42.04  ? 122 LEU C N   1 
ATOM   6374  C CA  . LEU C 1 121 ? 13.257  -56.237  -20.347 1.00 41.72  ? 122 LEU C CA  1 
ATOM   6375  C C   . LEU C 1 121 ? 13.472  -56.586  -18.875 1.00 43.40  ? 122 LEU C C   1 
ATOM   6376  O O   . LEU C 1 121 ? 14.568  -56.408  -18.348 1.00 44.34  ? 122 LEU C O   1 
ATOM   6377  C CB  . LEU C 1 121 ? 14.206  -57.042  -21.237 1.00 41.53  ? 122 LEU C CB  1 
ATOM   6378  C CG  . LEU C 1 121 ? 14.014  -58.554  -21.327 1.00 40.02  ? 122 LEU C CG  1 
ATOM   6379  C CD1 . LEU C 1 121 ? 12.706  -58.886  -22.024 1.00 38.24  ? 122 LEU C CD1 1 
ATOM   6380  C CD2 . LEU C 1 121 ? 15.197  -59.189  -22.044 1.00 38.94  ? 122 LEU C CD2 1 
ATOM   6381  N N   . PRO C 1 122 ? 12.415  -57.057  -18.197 1.00 42.71  ? 123 PRO C N   1 
ATOM   6382  C CA  . PRO C 1 122 ? 12.538  -57.456  -16.796 1.00 42.72  ? 123 PRO C CA  1 
ATOM   6383  C C   . PRO C 1 122 ? 13.166  -58.837  -16.687 1.00 38.89  ? 123 PRO C C   1 
ATOM   6384  O O   . PRO C 1 122 ? 13.292  -59.527  -17.698 1.00 37.05  ? 123 PRO C O   1 
ATOM   6385  C CB  . PRO C 1 122 ? 11.090  -57.472  -16.314 1.00 44.12  ? 123 PRO C CB  1 
ATOM   6386  C CG  . PRO C 1 122 ? 10.325  -57.881  -17.534 1.00 42.96  ? 123 PRO C CG  1 
ATOM   6387  C CD  . PRO C 1 122 ? 11.049  -57.267  -18.709 1.00 43.25  ? 123 PRO C CD  1 
ATOM   6388  N N   . GLY C 1 123 ? 13.560  -59.235  -15.484 1.00 37.40  ? 124 GLY C N   1 
ATOM   6389  C CA  . GLY C 1 123 ? 14.036  -60.587  -15.274 1.00 36.61  ? 124 GLY C CA  1 
ATOM   6390  C C   . GLY C 1 123 ? 12.867  -61.552  -15.323 1.00 36.95  ? 124 GLY C C   1 
ATOM   6391  O O   . GLY C 1 123 ? 11.712  -61.132  -15.406 1.00 37.81  ? 124 GLY C O   1 
ATOM   6392  N N   . PHE C 1 124 ? 13.153  -62.846  -15.277 1.00 33.75  ? 125 PHE C N   1 
ATOM   6393  C CA  . PHE C 1 124 ? 12.081  -63.829  -15.276 1.00 35.32  ? 125 PHE C CA  1 
ATOM   6394  C C   . PHE C 1 124 ? 12.537  -65.191  -14.790 1.00 36.27  ? 125 PHE C C   1 
ATOM   6395  O O   . PHE C 1 124 ? 13.727  -65.502  -14.778 1.00 35.85  ? 125 PHE C O   1 
ATOM   6396  C CB  . PHE C 1 124 ? 11.460  -63.960  -16.681 1.00 33.60  ? 125 PHE C CB  1 
ATOM   6397  C CG  . PHE C 1 124 ? 12.425  -64.417  -17.744 1.00 34.82  ? 125 PHE C CG  1 
ATOM   6398  C CD1 . PHE C 1 124 ? 13.210  -63.500  -18.432 1.00 34.57  ? 125 PHE C CD1 1 
ATOM   6399  C CD2 . PHE C 1 124 ? 12.524  -65.762  -18.080 1.00 34.88  ? 125 PHE C CD2 1 
ATOM   6400  C CE1 . PHE C 1 124 ? 14.088  -63.914  -19.418 1.00 32.87  ? 125 PHE C CE1 1 
ATOM   6401  C CE2 . PHE C 1 124 ? 13.401  -66.183  -19.067 1.00 34.70  ? 125 PHE C CE2 1 
ATOM   6402  C CZ  . PHE C 1 124 ? 14.185  -65.255  -19.735 1.00 34.20  ? 125 PHE C CZ  1 
ATOM   6403  N N   . SER C 1 125 ? 11.566  -65.991  -14.371 1.00 33.07  ? 126 SER C N   1 
ATOM   6404  C CA  . SER C 1 125 ? 11.796  -67.386  -14.047 1.00 36.18  ? 126 SER C CA  1 
ATOM   6405  C C   . SER C 1 125 ? 11.106  -68.227  -15.108 1.00 35.48  ? 126 SER C C   1 
ATOM   6406  O O   . SER C 1 125 ? 9.989   -67.916  -15.510 1.00 33.96  ? 126 SER C O   1 
ATOM   6407  C CB  . SER C 1 125 ? 11.260  -67.723  -12.656 1.00 35.13  ? 126 SER C CB  1 
ATOM   6408  O OG  . SER C 1 125 ? 11.897  -66.943  -11.656 1.00 36.36  ? 126 SER C OG  1 
ATOM   6409  N N   . ALA C 1 126 ? 11.761  -69.285  -15.563 1.00 34.41  ? 127 ALA C N   1 
ATOM   6410  C CA  . ALA C 1 126 ? 11.185  -70.098  -16.624 1.00 33.26  ? 127 ALA C CA  1 
ATOM   6411  C C   . ALA C 1 126 ? 11.630  -71.547  -16.552 1.00 33.67  ? 127 ALA C C   1 
ATOM   6412  O O   . ALA C 1 126 ? 12.757  -71.855  -16.150 1.00 34.54  ? 127 ALA C O   1 
ATOM   6413  C CB  . ALA C 1 126 ? 11.538  -69.511  -17.996 1.00 32.22  ? 127 ALA C CB  1 
ATOM   6414  N N   . VAL C 1 127 ? 10.718  -72.432  -16.937 1.00 32.14  ? 128 VAL C N   1 
ATOM   6415  C CA  . VAL C 1 127 ? 11.046  -73.824  -17.189 1.00 31.88  ? 128 VAL C CA  1 
ATOM   6416  C C   . VAL C 1 127 ? 11.084  -74.051  -18.704 1.00 32.64  ? 128 VAL C C   1 
ATOM   6417  O O   . VAL C 1 127 ? 10.216  -73.582  -19.437 1.00 30.52  ? 128 VAL C O   1 
ATOM   6418  C CB  . VAL C 1 127 ? 10.037  -74.775  -16.522 1.00 31.05  ? 128 VAL C CB  1 
ATOM   6419  C CG1 . VAL C 1 127 ? 10.172  -76.185  -17.069 1.00 31.03  ? 128 VAL C CG1 1 
ATOM   6420  C CG2 . VAL C 1 127 ? 10.234  -74.772  -15.014 1.00 33.53  ? 128 VAL C CG2 1 
ATOM   6421  N N   . VAL C 1 128 ? 12.117  -74.746  -19.162 1.00 34.69  ? 129 VAL C N   1 
ATOM   6422  C CA  . VAL C 1 128 ? 12.276  -75.061  -20.569 1.00 34.31  ? 129 VAL C CA  1 
ATOM   6423  C C   . VAL C 1 128 ? 12.107  -76.560  -20.793 1.00 34.84  ? 129 VAL C C   1 
ATOM   6424  O O   . VAL C 1 128 ? 12.774  -77.368  -20.145 1.00 36.12  ? 129 VAL C O   1 
ATOM   6425  C CB  . VAL C 1 128 ? 13.655  -74.621  -21.087 1.00 34.66  ? 129 VAL C CB  1 
ATOM   6426  C CG1 . VAL C 1 128 ? 13.858  -75.083  -22.527 1.00 33.52  ? 129 VAL C CG1 1 
ATOM   6427  C CG2 . VAL C 1 128 ? 13.810  -73.115  -20.962 1.00 35.16  ? 129 VAL C CG2 1 
ATOM   6428  N N   . VAL C 1 129 ? 11.195  -76.924  -21.690 1.00 34.79  ? 130 VAL C N   1 
ATOM   6429  C CA  . VAL C 1 129 ? 11.010  -78.315  -22.096 1.00 36.39  ? 130 VAL C CA  1 
ATOM   6430  C C   . VAL C 1 129 ? 10.933  -78.399  -23.620 1.00 35.67  ? 130 VAL C C   1 
ATOM   6431  O O   . VAL C 1 129 ? 10.632  -77.410  -24.284 1.00 34.29  ? 130 VAL C O   1 
ATOM   6432  C CB  . VAL C 1 129 ? 9.732   -78.936  -21.491 1.00 39.00  ? 130 VAL C CB  1 
ATOM   6433  C CG1 . VAL C 1 129 ? 9.777   -78.896  -19.979 1.00 41.28  ? 130 VAL C CG1 1 
ATOM   6434  C CG2 . VAL C 1 129 ? 8.495   -78.213  -21.999 1.00 38.75  ? 130 VAL C CG2 1 
ATOM   6435  N N   . SER C 1 130 ? 11.205  -79.578  -24.171 1.00 36.63  ? 131 SER C N   1 
ATOM   6436  C CA  . SER C 1 130 ? 11.164  -79.752  -25.613 1.00 38.51  ? 131 SER C CA  1 
ATOM   6437  C C   . SER C 1 130 ? 10.931  -81.207  -26.018 1.00 39.01  ? 131 SER C C   1 
ATOM   6438  O O   . SER C 1 130 ? 11.450  -82.128  -25.390 1.00 39.40  ? 131 SER C O   1 
ATOM   6439  C CB  . SER C 1 130 ? 12.461  -79.239  -26.244 1.00 39.24  ? 131 SER C CB  1 
ATOM   6440  O OG  . SER C 1 130 ? 12.415  -79.356  -27.658 1.00 39.84  ? 131 SER C OG  1 
ATOM   6441  N N   . SER C 1 131 ? 10.148  -81.396  -27.077 1.00 38.22  ? 132 SER C N   1 
ATOM   6442  C CA  . SER C 1 131 ? 9.911   -82.716  -27.657 1.00 39.19  ? 132 SER C CA  1 
ATOM   6443  C C   . SER C 1 131 ? 10.711  -82.879  -28.948 1.00 41.22  ? 132 SER C C   1 
ATOM   6444  O O   . SER C 1 131 ? 10.671  -83.928  -29.594 1.00 43.30  ? 132 SER C O   1 
ATOM   6445  C CB  . SER C 1 131 ? 8.420   -82.928  -27.930 1.00 39.23  ? 132 SER C CB  1 
ATOM   6446  O OG  . SER C 1 131 ? 7.929   -81.960  -28.848 1.00 38.66  ? 132 SER C OG  1 
ATOM   6447  N N   . VAL C 1 132 ? 11.419  -81.823  -29.334 1.00 40.70  ? 133 VAL C N   1 
ATOM   6448  C CA  . VAL C 1 132 ? 12.328  -81.894  -30.470 1.00 40.46  ? 133 VAL C CA  1 
ATOM   6449  C C   . VAL C 1 132 ? 13.590  -82.639  -30.055 1.00 39.73  ? 133 VAL C C   1 
ATOM   6450  O O   . VAL C 1 132 ? 14.243  -82.246  -29.093 1.00 39.49  ? 133 VAL C O   1 
ATOM   6451  C CB  . VAL C 1 132 ? 12.713  -80.497  -30.988 1.00 39.13  ? 133 VAL C CB  1 
ATOM   6452  C CG1 . VAL C 1 132 ? 13.355  -80.601  -32.365 1.00 39.30  ? 133 VAL C CG1 1 
ATOM   6453  C CG2 . VAL C 1 132 ? 11.492  -79.588  -31.033 1.00 38.79  ? 133 VAL C CG2 1 
ATOM   6454  N N   . PRO C 1 133 ? 13.936  -83.716  -30.778 1.00 39.40  ? 134 PRO C N   1 
ATOM   6455  C CA  . PRO C 1 133 ? 15.148  -84.485  -30.466 1.00 40.58  ? 134 PRO C CA  1 
ATOM   6456  C C   . PRO C 1 133 ? 16.369  -83.576  -30.482 1.00 42.11  ? 134 PRO C C   1 
ATOM   6457  O O   . PRO C 1 133 ? 16.672  -82.990  -31.522 1.00 40.70  ? 134 PRO C O   1 
ATOM   6458  C CB  . PRO C 1 133 ? 15.210  -85.528  -31.588 1.00 40.57  ? 134 PRO C CB  1 
ATOM   6459  C CG  . PRO C 1 133 ? 14.378  -84.942  -32.703 1.00 39.31  ? 134 PRO C CG  1 
ATOM   6460  C CD  . PRO C 1 133 ? 13.287  -84.181  -32.016 1.00 38.61  ? 134 PRO C CD  1 
ATOM   6461  N N   . LEU C 1 134 ? 17.038  -83.451  -29.337 1.00 45.11  ? 135 LEU C N   1 
ATOM   6462  C CA  . LEU C 1 134 ? 18.109  -82.471  -29.170 1.00 46.90  ? 135 LEU C CA  1 
ATOM   6463  C C   . LEU C 1 134 ? 19.271  -82.754  -30.111 1.00 48.44  ? 135 LEU C C   1 
ATOM   6464  O O   . LEU C 1 134 ? 19.889  -83.810  -30.043 1.00 50.60  ? 135 LEU C O   1 
ATOM   6465  C CB  . LEU C 1 134 ? 18.598  -82.447  -27.717 1.00 47.34  ? 135 LEU C CB  1 
ATOM   6466  C CG  . LEU C 1 134 ? 17.568  -82.094  -26.636 1.00 47.03  ? 135 LEU C CG  1 
ATOM   6467  C CD1 . LEU C 1 134 ? 18.253  -81.774  -25.302 1.00 47.04  ? 135 LEU C CD1 1 
ATOM   6468  C CD2 . LEU C 1 134 ? 16.679  -80.942  -27.076 1.00 45.66  ? 135 LEU C CD2 1 
ATOM   6469  N N   . GLY C 1 135 ? 19.554  -81.803  -30.998 1.00 47.53  ? 136 GLY C N   1 
ATOM   6470  C CA  . GLY C 1 135 ? 20.606  -81.970  -31.984 1.00 47.74  ? 136 GLY C CA  1 
ATOM   6471  C C   . GLY C 1 135 ? 20.333  -83.137  -32.914 1.00 48.24  ? 136 GLY C C   1 
ATOM   6472  O O   . GLY C 1 135 ? 21.255  -83.837  -33.327 1.00 49.44  ? 136 GLY C O   1 
ATOM   6473  N N   . GLY C 1 136 ? 19.060  -83.339  -33.244 1.00 46.85  ? 137 GLY C N   1 
ATOM   6474  C CA  . GLY C 1 136 ? 18.649  -84.460  -34.070 1.00 47.52  ? 137 GLY C CA  1 
ATOM   6475  C C   . GLY C 1 136 ? 18.344  -84.107  -35.513 1.00 47.89  ? 137 GLY C C   1 
ATOM   6476  O O   . GLY C 1 136 ? 17.943  -84.971  -36.290 1.00 50.23  ? 137 GLY C O   1 
ATOM   6477  N N   . GLY C 1 137 ? 18.523  -82.839  -35.874 1.00 45.48  ? 138 GLY C N   1 
ATOM   6478  C CA  . GLY C 1 137 ? 18.370  -82.412  -37.255 1.00 44.95  ? 138 GLY C CA  1 
ATOM   6479  C C   . GLY C 1 137 ? 17.051  -81.723  -37.556 1.00 42.80  ? 138 GLY C C   1 
ATOM   6480  O O   . GLY C 1 137 ? 16.730  -81.459  -38.721 1.00 42.82  ? 138 GLY C O   1 
ATOM   6481  N N   . LEU C 1 138 ? 16.286  -81.428  -36.509 1.00 39.75  ? 139 LEU C N   1 
ATOM   6482  C CA  . LEU C 1 138 ? 14.966  -80.833  -36.678 1.00 38.49  ? 139 LEU C CA  1 
ATOM   6483  C C   . LEU C 1 138 ? 14.860  -79.468  -36.009 1.00 35.41  ? 139 LEU C C   1 
ATOM   6484  O O   . LEU C 1 138 ? 13.768  -79.044  -35.629 1.00 34.69  ? 139 LEU C O   1 
ATOM   6485  C CB  . LEU C 1 138 ? 13.888  -81.774  -36.132 1.00 38.63  ? 139 LEU C CB  1 
ATOM   6486  C CG  . LEU C 1 138 ? 13.814  -83.157  -36.788 1.00 40.10  ? 139 LEU C CG  1 
ATOM   6487  C CD1 . LEU C 1 138 ? 12.765  -84.011  -36.106 1.00 40.01  ? 139 LEU C CD1 1 
ATOM   6488  C CD2 . LEU C 1 138 ? 13.539  -83.055  -38.292 1.00 41.85  ? 139 LEU C CD2 1 
ATOM   6489  N N   . SER C 1 139 ? 16.001  -78.795  -35.882 1.00 35.02  ? 140 SER C N   1 
ATOM   6490  C CA  . SER C 1 139 ? 16.087  -77.441  -35.322 1.00 33.37  ? 140 SER C CA  1 
ATOM   6491  C C   . SER C 1 139 ? 15.597  -77.341  -33.873 1.00 33.96  ? 140 SER C C   1 
ATOM   6492  O O   . SER C 1 139 ? 14.752  -76.507  -33.560 1.00 35.07  ? 140 SER C O   1 
ATOM   6493  C CB  . SER C 1 139 ? 15.302  -76.450  -36.198 1.00 32.70  ? 140 SER C CB  1 
ATOM   6494  O OG  . SER C 1 139 ? 15.728  -76.517  -37.559 1.00 34.94  ? 140 SER C OG  1 
ATOM   6495  N N   . SER C 1 140 ? 16.132  -78.171  -32.984 1.00 34.63  ? 141 SER C N   1 
ATOM   6496  C CA  . SER C 1 140 ? 15.826  -78.030  -31.557 1.00 34.68  ? 141 SER C CA  1 
ATOM   6497  C C   . SER C 1 140 ? 16.244  -76.649  -31.064 1.00 34.32  ? 141 SER C C   1 
ATOM   6498  O O   . SER C 1 140 ? 15.490  -75.970  -30.367 1.00 33.67  ? 141 SER C O   1 
ATOM   6499  C CB  . SER C 1 140 ? 16.517  -79.125  -30.729 1.00 34.58  ? 141 SER C CB  1 
ATOM   6500  O OG  . SER C 1 140 ? 17.917  -79.149  -30.959 1.00 36.22  ? 141 SER C OG  1 
ATOM   6501  N N   . SER C 1 141 ? 17.440  -76.225  -31.450 1.00 34.79  ? 142 SER C N   1 
ATOM   6502  C CA  . SER C 1 141 ? 17.958  -74.946  -30.988 1.00 34.72  ? 142 SER C CA  1 
ATOM   6503  C C   . SER C 1 141 ? 17.191  -73.759  -31.563 1.00 32.07  ? 142 SER C C   1 
ATOM   6504  O O   . SER C 1 141 ? 16.957  -72.774  -30.853 1.00 31.49  ? 142 SER C O   1 
ATOM   6505  C CB  . SER C 1 141 ? 19.445  -74.818  -31.315 1.00 37.22  ? 142 SER C CB  1 
ATOM   6506  O OG  . SER C 1 141 ? 19.696  -74.859  -32.698 1.00 39.15  ? 142 SER C OG  1 
ATOM   6507  N N   . ALA C 1 142 ? 16.790  -73.840  -32.833 1.00 30.68  ? 143 ALA C N   1 
ATOM   6508  C CA  . ALA C 1 142 ? 15.968  -72.783  -33.407 1.00 28.22  ? 143 ALA C CA  1 
ATOM   6509  C C   . ALA C 1 142 ? 14.663  -72.658  -32.633 1.00 27.34  ? 143 ALA C C   1 
ATOM   6510  O O   . ALA C 1 142 ? 14.204  -71.549  -32.361 1.00 27.51  ? 143 ALA C O   1 
ATOM   6511  C CB  . ALA C 1 142 ? 15.682  -73.043  -34.899 1.00 28.82  ? 143 ALA C CB  1 
ATOM   6512  N N   . SER C 1 143 ? 14.069  -73.793  -32.272 1.00 27.89  ? 144 SER C N   1 
ATOM   6513  C CA  . SER C 1 143 ? 12.812  -73.768  -31.529 1.00 29.56  ? 144 SER C CA  1 
ATOM   6514  C C   . SER C 1 143 ? 13.008  -73.164  -30.137 1.00 29.06  ? 144 SER C C   1 
ATOM   6515  O O   . SER C 1 143 ? 12.128  -72.473  -29.635 1.00 30.02  ? 144 SER C O   1 
ATOM   6516  C CB  . SER C 1 143 ? 12.206  -75.171  -31.415 1.00 30.71  ? 144 SER C CB  1 
ATOM   6517  O OG  . SER C 1 143 ? 12.943  -75.985  -30.521 1.00 33.37  ? 144 SER C OG  1 
ATOM   6518  N N   . LEU C 1 144 ? 14.156  -73.421  -29.515 1.00 29.57  ? 145 LEU C N   1 
ATOM   6519  C CA  . LEU C 1 144 ? 14.438  -72.846  -28.198 1.00 28.28  ? 145 LEU C CA  1 
ATOM   6520  C C   . LEU C 1 144 ? 14.670  -71.347  -28.324 1.00 29.02  ? 145 LEU C C   1 
ATOM   6521  O O   . LEU C 1 144 ? 14.161  -70.562  -27.524 1.00 28.17  ? 145 LEU C O   1 
ATOM   6522  C CB  . LEU C 1 144 ? 15.648  -73.520  -27.547 1.00 28.23  ? 145 LEU C CB  1 
ATOM   6523  C CG  . LEU C 1 144 ? 16.187  -72.894  -26.253 1.00 28.33  ? 145 LEU C CG  1 
ATOM   6524  C CD1 . LEU C 1 144 ? 15.095  -72.758  -25.199 1.00 26.77  ? 145 LEU C CD1 1 
ATOM   6525  C CD2 . LEU C 1 144 ? 17.350  -73.724  -25.723 1.00 26.62  ? 145 LEU C CD2 1 
ATOM   6526  N N   . GLU C 1 145 ? 15.422  -70.955  -29.349 1.00 29.84  ? 146 GLU C N   1 
ATOM   6527  C CA  . GLU C 1 145 ? 15.668  -69.544  -29.617 1.00 30.33  ? 146 GLU C CA  1 
ATOM   6528  C C   . GLU C 1 145 ? 14.364  -68.776  -29.822 1.00 32.12  ? 146 GLU C C   1 
ATOM   6529  O O   . GLU C 1 145 ? 14.165  -67.709  -29.240 1.00 32.84  ? 146 GLU C O   1 
ATOM   6530  C CB  . GLU C 1 145 ? 16.569  -69.381  -30.842 1.00 30.43  ? 146 GLU C CB  1 
ATOM   6531  C CG  . GLU C 1 145 ? 18.006  -69.811  -30.619 1.00 30.57  ? 146 GLU C CG  1 
ATOM   6532  C CD  . GLU C 1 145 ? 18.726  -70.169  -31.906 1.00 32.83  ? 146 GLU C CD  1 
ATOM   6533  O OE1 . GLU C 1 145 ? 18.137  -70.020  -33.002 1.00 32.76  ? 146 GLU C OE1 1 
ATOM   6534  O OE2 . GLU C 1 145 ? 19.894  -70.597  -31.818 1.00 35.87  ? 146 GLU C OE2 1 
ATOM   6535  N N   . VAL C 1 146 ? 13.474  -69.325  -30.644 1.00 30.67  ? 147 VAL C N   1 
ATOM   6536  C CA  . VAL C 1 146 ? 12.231  -68.638  -30.981 1.00 28.95  ? 147 VAL C CA  1 
ATOM   6537  C C   . VAL C 1 146 ? 11.223  -68.686  -29.829 1.00 28.95  ? 147 VAL C C   1 
ATOM   6538  O O   . VAL C 1 146 ? 10.510  -67.709  -29.582 1.00 29.34  ? 147 VAL C O   1 
ATOM   6539  C CB  . VAL C 1 146 ? 11.605  -69.231  -32.267 1.00 31.66  ? 147 VAL C CB  1 
ATOM   6540  C CG1 . VAL C 1 146 ? 10.227  -68.629  -32.532 1.00 31.64  ? 147 VAL C CG1 1 
ATOM   6541  C CG2 . VAL C 1 146 ? 12.528  -68.982  -33.451 1.00 29.29  ? 147 VAL C CG2 1 
ATOM   6542  N N   . ALA C 1 147 ? 11.174  -69.808  -29.114 1.00 29.29  ? 148 ALA C N   1 
ATOM   6543  C CA  . ALA C 1 147 ? 10.357  -69.890  -27.904 1.00 28.93  ? 148 ALA C CA  1 
ATOM   6544  C C   . ALA C 1 147 ? 10.815  -68.848  -26.883 1.00 29.12  ? 148 ALA C C   1 
ATOM   6545  O O   . ALA C 1 147 ? 9.995   -68.199  -26.229 1.00 28.52  ? 148 ALA C O   1 
ATOM   6546  C CB  . ALA C 1 147 ? 10.415  -71.294  -27.301 1.00 29.36  ? 148 ALA C CB  1 
ATOM   6547  N N   . THR C 1 148 ? 12.128  -68.684  -26.755 1.00 29.25  ? 149 THR C N   1 
ATOM   6548  C CA  . THR C 1 148 ? 12.668  -67.676  -25.849 1.00 29.45  ? 149 THR C CA  1 
ATOM   6549  C C   . THR C 1 148 ? 12.279  -66.286  -26.325 1.00 29.61  ? 149 THR C C   1 
ATOM   6550  O O   . THR C 1 148 ? 11.822  -65.463  -25.528 1.00 31.90  ? 149 THR C O   1 
ATOM   6551  C CB  . THR C 1 148 ? 14.208  -67.770  -25.725 1.00 30.65  ? 149 THR C CB  1 
ATOM   6552  O OG1 . THR C 1 148 ? 14.566  -69.033  -25.152 1.00 31.35  ? 149 THR C OG1 1 
ATOM   6553  C CG2 . THR C 1 148 ? 14.749  -66.655  -24.845 1.00 26.69  ? 149 THR C CG2 1 
ATOM   6554  N N   . TYR C 1 149 ? 12.451  -66.027  -27.623 1.00 27.55  ? 150 TYR C N   1 
ATOM   6555  C CA  . TYR C 1 149 ? 12.093  -64.729  -28.182 1.00 26.80  ? 150 TYR C CA  1 
ATOM   6556  C C   . TYR C 1 149 ? 10.621  -64.432  -27.921 1.00 27.28  ? 150 TYR C C   1 
ATOM   6557  O O   . TYR C 1 149 ? 10.276  -63.358  -27.427 1.00 28.86  ? 150 TYR C O   1 
ATOM   6558  C CB  . TYR C 1 149 ? 12.379  -64.648  -29.700 1.00 26.92  ? 150 TYR C CB  1 
ATOM   6559  C CG  . TYR C 1 149 ? 12.401  -63.208  -30.174 1.00 26.76  ? 150 TYR C CG  1 
ATOM   6560  C CD1 . TYR C 1 149 ? 11.219  -62.502  -30.373 1.00 26.82  ? 150 TYR C CD1 1 
ATOM   6561  C CD2 . TYR C 1 149 ? 13.603  -62.538  -30.368 1.00 27.47  ? 150 TYR C CD2 1 
ATOM   6562  C CE1 . TYR C 1 149 ? 11.234  -61.171  -30.766 1.00 27.84  ? 150 TYR C CE1 1 
ATOM   6563  C CE2 . TYR C 1 149 ? 13.628  -61.207  -30.766 1.00 28.26  ? 150 TYR C CE2 1 
ATOM   6564  C CZ  . TYR C 1 149 ? 12.443  -60.532  -30.960 1.00 28.26  ? 150 TYR C CZ  1 
ATOM   6565  O OH  . TYR C 1 149 ? 12.457  -59.216  -31.349 1.00 29.19  ? 150 TYR C OH  1 
ATOM   6566  N N   . THR C 1 150 ? 9.760   -65.383  -28.271 1.00 26.64  ? 151 THR C N   1 
ATOM   6567  C CA  . THR C 1 150 ? 8.319   -65.245  -28.066 1.00 27.78  ? 151 THR C CA  1 
ATOM   6568  C C   . THR C 1 150 ? 7.980   -64.946  -26.600 1.00 29.22  ? 151 THR C C   1 
ATOM   6569  O O   . THR C 1 150 ? 7.059   -64.183  -26.305 1.00 29.89  ? 151 THR C O   1 
ATOM   6570  C CB  . THR C 1 150 ? 7.575   -66.520  -28.513 1.00 29.49  ? 151 THR C CB  1 
ATOM   6571  O OG1 . THR C 1 150 ? 7.952   -66.842  -29.855 1.00 31.53  ? 151 THR C OG1 1 
ATOM   6572  C CG2 . THR C 1 150 ? 6.071   -66.326  -28.456 1.00 30.16  ? 151 THR C CG2 1 
ATOM   6573  N N   . PHE C 1 151 ? 8.735   -65.547  -25.686 1.00 29.84  ? 152 PHE C N   1 
ATOM   6574  C CA  . PHE C 1 151 ? 8.555   -65.288  -24.258 1.00 31.50  ? 152 PHE C CA  1 
ATOM   6575  C C   . PHE C 1 151 ? 8.888   -63.835  -23.917 1.00 32.99  ? 152 PHE C C   1 
ATOM   6576  O O   . PHE C 1 151 ? 8.084   -63.146  -23.293 1.00 33.87  ? 152 PHE C O   1 
ATOM   6577  C CB  . PHE C 1 151 ? 9.414   -66.242  -23.429 1.00 31.00  ? 152 PHE C CB  1 
ATOM   6578  C CG  . PHE C 1 151 ? 9.061   -66.263  -21.969 1.00 33.20  ? 152 PHE C CG  1 
ATOM   6579  C CD1 . PHE C 1 151 ? 8.100   -67.138  -21.490 1.00 34.80  ? 152 PHE C CD1 1 
ATOM   6580  C CD2 . PHE C 1 151 ? 9.702   -65.422  -21.074 1.00 33.95  ? 152 PHE C CD2 1 
ATOM   6581  C CE1 . PHE C 1 151 ? 7.777   -67.167  -20.140 1.00 36.35  ? 152 PHE C CE1 1 
ATOM   6582  C CE2 . PHE C 1 151 ? 9.382   -65.442  -19.725 1.00 35.74  ? 152 PHE C CE2 1 
ATOM   6583  C CZ  . PHE C 1 151 ? 8.417   -66.315  -19.260 1.00 36.91  ? 152 PHE C CZ  1 
ATOM   6584  N N   . LEU C 1 152 ? 10.061  -63.368  -24.344 1.00 27.46  ? 153 LEU C N   1 
ATOM   6585  C CA  . LEU C 1 152 ? 10.482  -61.989  -24.073 1.00 31.08  ? 153 LEU C CA  1 
ATOM   6586  C C   . LEU C 1 152 ? 9.498   -60.938  -24.605 1.00 31.79  ? 153 LEU C C   1 
ATOM   6587  O O   . LEU C 1 152 ? 9.316   -59.890  -23.979 1.00 34.74  ? 153 LEU C O   1 
ATOM   6588  C CB  . LEU C 1 152 ? 11.871  -61.728  -24.662 1.00 29.42  ? 153 LEU C CB  1 
ATOM   6589  C CG  . LEU C 1 152 ? 13.005  -62.658  -24.237 1.00 30.06  ? 153 LEU C CG  1 
ATOM   6590  C CD1 . LEU C 1 152 ? 14.313  -62.176  -24.841 1.00 28.62  ? 153 LEU C CD1 1 
ATOM   6591  C CD2 . LEU C 1 152 ? 13.109  -62.751  -22.701 1.00 29.27  ? 153 LEU C CD2 1 
ATOM   6592  N N   . GLN C 1 153 ? 8.874   -61.217  -25.751 1.00 30.47  ? 154 GLN C N   1 
ATOM   6593  C CA  . GLN C 1 153 ? 7.859   -60.331  -26.331 1.00 30.37  ? 154 GLN C CA  1 
ATOM   6594  C C   . GLN C 1 153 ? 6.698   -60.105  -25.380 1.00 31.94  ? 154 GLN C C   1 
ATOM   6595  O O   . GLN C 1 153 ? 6.145   -59.009  -25.307 1.00 32.95  ? 154 GLN C O   1 
ATOM   6596  C CB  . GLN C 1 153 ? 7.314   -60.899  -27.650 1.00 28.38  ? 154 GLN C CB  1 
ATOM   6597  C CG  . GLN C 1 153 ? 8.241   -60.775  -28.834 1.00 27.49  ? 154 GLN C CG  1 
ATOM   6598  C CD  . GLN C 1 153 ? 7.683   -61.472  -30.058 1.00 27.85  ? 154 GLN C CD  1 
ATOM   6599  O OE1 . GLN C 1 153 ? 8.046   -62.608  -30.352 1.00 28.71  ? 154 GLN C OE1 1 
ATOM   6600  N NE2 . GLN C 1 153 ? 6.785   -60.797  -30.770 1.00 28.49  ? 154 GLN C NE2 1 
ATOM   6601  N N   . GLN C 1 154 ? 6.318   -61.157  -24.663 1.00 31.99  ? 155 GLN C N   1 
ATOM   6602  C CA  . GLN C 1 154 ? 5.277   -61.041  -23.651 1.00 33.41  ? 155 GLN C CA  1 
ATOM   6603  C C   . GLN C 1 154 ? 5.774   -60.212  -22.470 1.00 35.46  ? 155 GLN C C   1 
ATOM   6604  O O   . GLN C 1 154 ? 4.993   -59.524  -21.812 1.00 37.91  ? 155 GLN C O   1 
ATOM   6605  C CB  . GLN C 1 154 ? 4.824   -62.425  -23.182 1.00 34.22  ? 155 GLN C CB  1 
ATOM   6606  C CG  . GLN C 1 154 ? 4.004   -63.172  -24.225 1.00 35.00  ? 155 GLN C CG  1 
ATOM   6607  C CD  . GLN C 1 154 ? 2.754   -62.410  -24.613 1.00 35.33  ? 155 GLN C CD  1 
ATOM   6608  O OE1 . GLN C 1 154 ? 2.019   -61.922  -23.748 1.00 36.81  ? 155 GLN C OE1 1 
ATOM   6609  N NE2 . GLN C 1 154 ? 2.514   -62.283  -25.915 1.00 33.30  ? 155 GLN C NE2 1 
ATOM   6610  N N   . LEU C 1 155 ? 7.075   -60.268  -22.207 1.00 34.75  ? 156 LEU C N   1 
ATOM   6611  C CA  . LEU C 1 155 ? 7.646   -59.495  -21.104 1.00 35.18  ? 156 LEU C CA  1 
ATOM   6612  C C   . LEU C 1 155 ? 7.846   -58.051  -21.529 1.00 36.90  ? 156 LEU C C   1 
ATOM   6613  O O   . LEU C 1 155 ? 7.773   -57.142  -20.711 1.00 38.29  ? 156 LEU C O   1 
ATOM   6614  C CB  . LEU C 1 155 ? 8.976   -60.088  -20.642 1.00 32.76  ? 156 LEU C CB  1 
ATOM   6615  C CG  . LEU C 1 155 ? 8.970   -61.505  -20.075 1.00 32.70  ? 156 LEU C CG  1 
ATOM   6616  C CD1 . LEU C 1 155 ? 10.392  -61.926  -19.750 1.00 33.38  ? 156 LEU C CD1 1 
ATOM   6617  C CD2 . LEU C 1 155 ? 8.093   -61.601  -18.831 1.00 33.26  ? 156 LEU C CD2 1 
ATOM   6618  N N   . CYS C 1 156 ? 8.096   -57.850  -22.820 1.00 36.27  ? 157 CYS C N   1 
ATOM   6619  C CA  . CYS C 1 156 ? 8.420   -56.528  -23.334 1.00 36.45  ? 157 CYS C CA  1 
ATOM   6620  C C   . CYS C 1 156 ? 8.280   -56.490  -24.859 1.00 36.76  ? 157 CYS C C   1 
ATOM   6621  O O   . CYS C 1 156 ? 9.253   -56.726  -25.584 1.00 35.57  ? 157 CYS C O   1 
ATOM   6622  C CB  . CYS C 1 156 ? 9.837   -56.135  -22.906 1.00 35.99  ? 157 CYS C CB  1 
ATOM   6623  S SG  . CYS C 1 156 ? 10.416  -54.558  -23.527 1.00 46.41  ? 157 CYS C SG  1 
ATOM   6624  N N   . PRO C 1 157 ? 7.061   -56.197  -25.345 1.00 38.33  ? 158 PRO C N   1 
ATOM   6625  C CA  . PRO C 1 157 ? 6.729   -56.182  -26.777 1.00 37.64  ? 158 PRO C CA  1 
ATOM   6626  C C   . PRO C 1 157 ? 7.774   -55.430  -27.596 1.00 37.81  ? 158 PRO C C   1 
ATOM   6627  O O   . PRO C 1 157 ? 8.240   -54.375  -27.158 1.00 37.93  ? 158 PRO C O   1 
ATOM   6628  C CB  . PRO C 1 157 ? 5.377   -55.467  -26.815 1.00 39.44  ? 158 PRO C CB  1 
ATOM   6629  C CG  . PRO C 1 157 ? 4.769   -55.760  -25.481 1.00 40.28  ? 158 PRO C CG  1 
ATOM   6630  C CD  . PRO C 1 157 ? 5.922   -55.772  -24.508 1.00 39.80  ? 158 PRO C CD  1 
ATOM   6631  N N   . ASP C 1 158 ? 8.140   -55.968  -28.758 1.00 37.30  ? 159 ASP C N   1 
ATOM   6632  C CA  . ASP C 1 158 ? 9.287   -55.451  -29.503 1.00 38.50  ? 159 ASP C CA  1 
ATOM   6633  C C   . ASP C 1 158 ? 8.941   -54.514  -30.666 1.00 41.05  ? 159 ASP C C   1 
ATOM   6634  O O   . ASP C 1 158 ? 9.843   -53.941  -31.281 1.00 42.30  ? 159 ASP C O   1 
ATOM   6635  C CB  . ASP C 1 158 ? 10.136  -56.621  -30.021 1.00 37.90  ? 159 ASP C CB  1 
ATOM   6636  C CG  . ASP C 1 158 ? 9.400   -57.494  -31.042 1.00 37.27  ? 159 ASP C CG  1 
ATOM   6637  O OD1 . ASP C 1 158 ? 8.182   -57.312  -31.257 1.00 38.35  ? 159 ASP C OD1 1 
ATOM   6638  O OD2 . ASP C 1 158 ? 10.053  -58.385  -31.623 1.00 36.16  ? 159 ASP C OD2 1 
ATOM   6639  N N   . SER C 1 159 ? 7.653   -54.358  -30.961 1.00 41.69  ? 160 SER C N   1 
ATOM   6640  C CA  . SER C 1 159 ? 7.203   -53.498  -32.065 1.00 45.50  ? 160 SER C CA  1 
ATOM   6641  C C   . SER C 1 159 ? 7.976   -53.724  -33.368 1.00 44.46  ? 160 SER C C   1 
ATOM   6642  O O   . SER C 1 159 ? 8.159   -52.795  -34.155 1.00 46.87  ? 160 SER C O   1 
ATOM   6643  C CB  . SER C 1 159 ? 7.315   -52.021  -31.670 1.00 50.23  ? 160 SER C CB  1 
ATOM   6644  O OG  . SER C 1 159 ? 6.590   -51.748  -30.483 1.00 52.66  ? 160 SER C OG  1 
ATOM   6645  N N   . GLY C 1 160 ? 8.427   -54.954  -33.592 1.00 41.88  ? 161 GLY C N   1 
ATOM   6646  C CA  . GLY C 1 160 ? 9.303   -55.247  -34.713 1.00 41.73  ? 161 GLY C CA  1 
ATOM   6647  C C   . GLY C 1 160 ? 8.672   -56.096  -35.801 1.00 40.81  ? 161 GLY C C   1 
ATOM   6648  O O   . GLY C 1 160 ? 7.455   -56.287  -35.830 1.00 39.40  ? 161 GLY C O   1 
ATOM   6649  N N   . THR C 1 161 ? 9.511   -56.605  -36.700 1.00 41.55  ? 162 THR C N   1 
ATOM   6650  C CA  . THR C 1 161 ? 9.050   -57.401  -37.831 1.00 40.92  ? 162 THR C CA  1 
ATOM   6651  C C   . THR C 1 161 ? 9.538   -58.837  -37.709 1.00 39.81  ? 162 THR C C   1 
ATOM   6652  O O   . THR C 1 161 ? 10.460  -59.116  -36.946 1.00 39.03  ? 162 THR C O   1 
ATOM   6653  C CB  . THR C 1 161 ? 9.539   -56.821  -39.170 1.00 42.83  ? 162 THR C CB  1 
ATOM   6654  O OG1 . THR C 1 161 ? 10.952  -57.027  -39.295 1.00 42.89  ? 162 THR C OG1 1 
ATOM   6655  C CG2 . THR C 1 161 ? 9.238   -55.328  -39.247 1.00 44.13  ? 162 THR C CG2 1 
ATOM   6656  N N   . ILE C 1 162 ? 8.930   -59.737  -38.477 1.00 39.78  ? 163 ILE C N   1 
ATOM   6657  C CA  . ILE C 1 162 ? 9.265   -61.155  -38.421 1.00 39.36  ? 163 ILE C CA  1 
ATOM   6658  C C   . ILE C 1 162 ? 10.727  -61.412  -38.780 1.00 38.99  ? 163 ILE C C   1 
ATOM   6659  O O   . ILE C 1 162 ? 11.396  -62.224  -38.145 1.00 39.17  ? 163 ILE C O   1 
ATOM   6660  C CB  . ILE C 1 162 ? 8.362   -61.981  -39.363 1.00 40.29  ? 163 ILE C CB  1 
ATOM   6661  N N   . ALA C 1 163 ? 11.221  -60.712  -39.796 1.00 37.69  ? 164 ALA C N   1 
ATOM   6662  C CA  . ALA C 1 163 ? 12.604  -60.874  -40.231 1.00 37.94  ? 164 ALA C CA  1 
ATOM   6663  C C   . ALA C 1 163 ? 13.592  -60.471  -39.134 1.00 36.98  ? 164 ALA C C   1 
ATOM   6664  O O   . ALA C 1 163 ? 14.598  -61.146  -38.915 1.00 36.92  ? 164 ALA C O   1 
ATOM   6665  C CB  . ALA C 1 163 ? 12.858  -60.066  -41.492 1.00 39.94  ? 164 ALA C CB  1 
ATOM   6666  N N   . ALA C 1 164 ? 13.305  -59.367  -38.453 1.00 36.50  ? 165 ALA C N   1 
ATOM   6667  C CA  . ALA C 1 164 ? 14.180  -58.892  -37.387 1.00 36.25  ? 165 ALA C CA  1 
ATOM   6668  C C   . ALA C 1 164 ? 14.285  -59.931  -36.276 1.00 34.46  ? 165 ALA C C   1 
ATOM   6669  O O   . ALA C 1 164 ? 15.376  -60.203  -35.772 1.00 35.19  ? 165 ALA C O   1 
ATOM   6670  C CB  . ALA C 1 164 ? 13.684  -57.567  -36.836 1.00 36.41  ? 165 ALA C CB  1 
ATOM   6671  N N   . ARG C 1 165 ? 13.152  -60.523  -35.914 1.00 33.00  ? 166 ARG C N   1 
ATOM   6672  C CA  . ARG C 1 165 ? 13.122  -61.538  -34.866 1.00 33.08  ? 166 ARG C CA  1 
ATOM   6673  C C   . ARG C 1 165 ? 13.957  -62.751  -35.250 1.00 33.33  ? 166 ARG C C   1 
ATOM   6674  O O   . ARG C 1 165 ? 14.740  -63.256  -34.446 1.00 33.60  ? 166 ARG C O   1 
ATOM   6675  C CB  . ARG C 1 165 ? 11.681  -61.957  -34.570 1.00 33.10  ? 166 ARG C CB  1 
ATOM   6676  C CG  . ARG C 1 165 ? 10.786  -60.791  -34.195 1.00 33.90  ? 166 ARG C CG  1 
ATOM   6677  C CD  . ARG C 1 165 ? 9.353   -61.214  -33.912 1.00 33.75  ? 166 ARG C CD  1 
ATOM   6678  N NE  . ARG C 1 165 ? 8.578   -60.085  -33.401 1.00 36.69  ? 166 ARG C NE  1 
ATOM   6679  C CZ  . ARG C 1 165 ? 7.349   -59.768  -33.796 1.00 38.74  ? 166 ARG C CZ  1 
ATOM   6680  N NH1 . ARG C 1 165 ? 6.726   -60.501  -34.711 1.00 39.37  ? 166 ARG C NH1 1 
ATOM   6681  N NH2 . ARG C 1 165 ? 6.738   -58.713  -33.271 1.00 39.04  ? 166 ARG C NH2 1 
ATOM   6682  N N   . ALA C 1 166 ? 13.783  -63.214  -36.483 1.00 33.41  ? 167 ALA C N   1 
ATOM   6683  C CA  . ALA C 1 166 ? 14.568  -64.324  -37.011 1.00 32.43  ? 167 ALA C CA  1 
ATOM   6684  C C   . ALA C 1 166 ? 16.062  -64.027  -36.942 1.00 32.31  ? 167 ALA C C   1 
ATOM   6685  O O   . ALA C 1 166 ? 16.858  -64.894  -36.585 1.00 32.81  ? 167 ALA C O   1 
ATOM   6686  C CB  . ALA C 1 166 ? 14.155  -64.631  -38.458 1.00 30.91  ? 167 ALA C CB  1 
ATOM   6687  N N   . GLN C 1 167 ? 16.435  -62.800  -37.291 1.00 33.64  ? 168 GLN C N   1 
ATOM   6688  C CA  . GLN C 1 167 ? 17.835  -62.395  -37.284 1.00 35.59  ? 168 GLN C CA  1 
ATOM   6689  C C   . GLN C 1 167 ? 18.399  -62.310  -35.863 1.00 36.49  ? 168 GLN C C   1 
ATOM   6690  O O   . GLN C 1 167 ? 19.585  -62.563  -35.651 1.00 38.59  ? 168 GLN C O   1 
ATOM   6691  C CB  . GLN C 1 167 ? 18.002  -61.054  -37.999 1.00 37.42  ? 168 GLN C CB  1 
ATOM   6692  N N   . VAL C 1 168 ? 17.557  -61.948  -34.897 1.00 35.07  ? 169 VAL C N   1 
ATOM   6693  C CA  . VAL C 1 168 ? 17.976  -61.944  -33.500 1.00 37.74  ? 169 VAL C CA  1 
ATOM   6694  C C   . VAL C 1 168 ? 18.337  -63.357  -33.068 1.00 36.94  ? 169 VAL C C   1 
ATOM   6695  O O   . VAL C 1 168 ? 19.401  -63.588  -32.489 1.00 37.94  ? 169 VAL C O   1 
ATOM   6696  C CB  . VAL C 1 168 ? 16.882  -61.386  -32.560 1.00 37.20  ? 169 VAL C CB  1 
ATOM   6697  C CG1 . VAL C 1 168 ? 17.193  -61.739  -31.110 1.00 37.78  ? 169 VAL C CG1 1 
ATOM   6698  C CG2 . VAL C 1 168 ? 16.749  -59.878  -32.730 1.00 37.42  ? 169 VAL C CG2 1 
ATOM   6699  N N   . CYS C 1 169 ? 17.458  -64.307  -33.376 1.00 34.94  ? 170 CYS C N   1 
ATOM   6700  C CA  . CYS C 1 169 ? 17.667  -65.688  -32.963 1.00 33.68  ? 170 CYS C CA  1 
ATOM   6701  C C   . CYS C 1 169 ? 18.839  -66.297  -33.718 1.00 32.86  ? 170 CYS C C   1 
ATOM   6702  O O   . CYS C 1 169 ? 19.614  -67.086  -33.165 1.00 32.65  ? 170 CYS C O   1 
ATOM   6703  C CB  . CYS C 1 169 ? 16.396  -66.506  -33.173 1.00 33.09  ? 170 CYS C CB  1 
ATOM   6704  S SG  . CYS C 1 169 ? 14.982  -65.877  -32.233 1.00 35.53  ? 170 CYS C SG  1 
ATOM   6705  N N   . GLN C 1 170 ? 18.977  -65.898  -34.977 1.00 34.28  ? 171 GLN C N   1 
ATOM   6706  C CA  . GLN C 1 170 ? 20.089  -66.341  -35.808 1.00 35.58  ? 171 GLN C CA  1 
ATOM   6707  C C   . GLN C 1 170 ? 21.417  -65.858  -35.235 1.00 37.79  ? 171 GLN C C   1 
ATOM   6708  O O   . GLN C 1 170 ? 22.399  -66.603  -35.202 1.00 38.39  ? 171 GLN C O   1 
ATOM   6709  C CB  . GLN C 1 170 ? 19.909  -65.838  -37.240 1.00 36.26  ? 171 GLN C CB  1 
ATOM   6710  C CG  . GLN C 1 170 ? 20.989  -66.283  -38.198 1.00 37.89  ? 171 GLN C CG  1 
ATOM   6711  C CD  . GLN C 1 170 ? 20.806  -65.666  -39.570 1.00 39.26  ? 171 GLN C CD  1 
ATOM   6712  O OE1 . GLN C 1 170 ? 20.078  -64.688  -39.721 1.00 40.27  ? 171 GLN C OE1 1 
ATOM   6713  N NE2 . GLN C 1 170 ? 21.457  -66.237  -40.576 1.00 38.43  ? 171 GLN C NE2 1 
ATOM   6714  N N   . GLN C 1 171 ? 21.439  -64.610  -34.776 1.00 39.69  ? 172 GLN C N   1 
ATOM   6715  C CA  . GLN C 1 171 ? 22.637  -64.037  -34.170 1.00 42.18  ? 172 GLN C CA  1 
ATOM   6716  C C   . GLN C 1 171 ? 22.993  -64.759  -32.873 1.00 41.20  ? 172 GLN C C   1 
ATOM   6717  O O   . GLN C 1 171 ? 24.168  -64.923  -32.545 1.00 42.95  ? 172 GLN C O   1 
ATOM   6718  C CB  . GLN C 1 171 ? 22.447  -62.540  -33.907 1.00 46.28  ? 172 GLN C CB  1 
ATOM   6719  C CG  . GLN C 1 171 ? 23.698  -61.824  -33.397 1.00 51.83  ? 172 GLN C CG  1 
ATOM   6720  C CD  . GLN C 1 171 ? 24.702  -61.510  -34.498 1.00 57.56  ? 172 GLN C CD  1 
ATOM   6721  O OE1 . GLN C 1 171 ? 24.727  -62.161  -35.541 1.00 59.03  ? 172 GLN C OE1 1 
ATOM   6722  N NE2 . GLN C 1 171 ? 25.538  -60.504  -34.264 1.00 60.81  ? 172 GLN C NE2 1 
ATOM   6723  N N   . ALA C 1 172 ? 21.973  -65.189  -32.137 1.00 38.14  ? 173 ALA C N   1 
ATOM   6724  C CA  . ALA C 1 172 ? 22.193  -65.977  -30.930 1.00 37.40  ? 173 ALA C CA  1 
ATOM   6725  C C   . ALA C 1 172 ? 22.865  -67.292  -31.300 1.00 39.81  ? 173 ALA C C   1 
ATOM   6726  O O   . ALA C 1 172 ? 23.782  -67.751  -30.619 1.00 40.99  ? 173 ALA C O   1 
ATOM   6727  C CB  . ALA C 1 172 ? 20.882  -66.230  -30.202 1.00 33.26  ? 173 ALA C CB  1 
ATOM   6728  N N   . GLU C 1 173 ? 22.411  -67.885  -32.399 1.00 40.78  ? 174 GLU C N   1 
ATOM   6729  C CA  . GLU C 1 173 ? 22.987  -69.122  -32.899 1.00 42.68  ? 174 GLU C CA  1 
ATOM   6730  C C   . GLU C 1 173 ? 24.446  -68.915  -33.290 1.00 42.43  ? 174 GLU C C   1 
ATOM   6731  O O   . GLU C 1 173 ? 25.310  -69.721  -32.947 1.00 42.63  ? 174 GLU C O   1 
ATOM   6732  C CB  . GLU C 1 173 ? 22.190  -69.639  -34.097 1.00 46.11  ? 174 GLU C CB  1 
ATOM   6733  C CG  . GLU C 1 173 ? 22.614  -71.016  -34.564 1.00 51.85  ? 174 GLU C CG  1 
ATOM   6734  C CD  . GLU C 1 173 ? 21.832  -72.118  -33.888 1.00 56.68  ? 174 GLU C CD  1 
ATOM   6735  O OE1 . GLU C 1 173 ? 22.447  -72.931  -33.164 1.00 58.24  ? 174 GLU C OE1 1 
ATOM   6736  O OE2 . GLU C 1 173 ? 20.600  -72.174  -34.093 1.00 58.47  ? 174 GLU C OE2 1 
ATOM   6737  N N   . HIS C 1 174 ? 24.708  -67.831  -34.014 1.00 42.97  ? 175 HIS C N   1 
ATOM   6738  C CA  . HIS C 1 174 ? 26.057  -67.504  -34.467 1.00 43.88  ? 175 HIS C CA  1 
ATOM   6739  C C   . HIS C 1 174 ? 26.996  -67.216  -33.296 1.00 43.84  ? 175 HIS C C   1 
ATOM   6740  O O   . HIS C 1 174 ? 28.049  -67.837  -33.168 1.00 45.75  ? 175 HIS C O   1 
ATOM   6741  C CB  . HIS C 1 174 ? 26.041  -66.290  -35.408 1.00 44.04  ? 175 HIS C CB  1 
ATOM   6742  C CG  . HIS C 1 174 ? 25.533  -66.583  -36.787 1.00 46.20  ? 175 HIS C CG  1 
ATOM   6743  N ND1 . HIS C 1 174 ? 26.085  -66.015  -37.915 1.00 48.64  ? 175 HIS C ND1 1 
ATOM   6744  C CD2 . HIS C 1 174 ? 24.516  -67.366  -37.220 1.00 45.35  ? 175 HIS C CD2 1 
ATOM   6745  C CE1 . HIS C 1 174 ? 25.437  -66.442  -38.984 1.00 48.84  ? 175 HIS C CE1 1 
ATOM   6746  N NE2 . HIS C 1 174 ? 24.478  -67.260  -38.590 1.00 47.58  ? 175 HIS C NE2 1 
ATOM   6747  N N   . SER C 1 175 ? 26.605  -66.269  -32.446 1.00 42.21  ? 176 SER C N   1 
ATOM   6748  C CA  . SER C 1 175 ? 27.503  -65.723  -31.433 1.00 43.81  ? 176 SER C CA  1 
ATOM   6749  C C   . SER C 1 175 ? 27.614  -66.577  -30.171 1.00 42.36  ? 176 SER C C   1 
ATOM   6750  O O   . SER C 1 175 ? 28.693  -66.704  -29.594 1.00 41.34  ? 176 SER C O   1 
ATOM   6751  C CB  . SER C 1 175 ? 27.053  -64.313  -31.046 1.00 45.02  ? 176 SER C CB  1 
ATOM   6752  O OG  . SER C 1 175 ? 27.028  -63.460  -32.176 1.00 46.04  ? 176 SER C OG  1 
ATOM   6753  N N   . PHE C 1 176 ? 26.502  -67.162  -29.742 1.00 41.20  ? 177 PHE C N   1 
ATOM   6754  C CA  . PHE C 1 176 ? 26.493  -67.891  -28.481 1.00 39.58  ? 177 PHE C CA  1 
ATOM   6755  C C   . PHE C 1 176 ? 26.555  -69.406  -28.653 1.00 38.73  ? 177 PHE C C   1 
ATOM   6756  O O   . PHE C 1 176 ? 26.869  -70.120  -27.708 1.00 37.45  ? 177 PHE C O   1 
ATOM   6757  C CB  . PHE C 1 176 ? 25.257  -67.503  -27.667 1.00 39.09  ? 177 PHE C CB  1 
ATOM   6758  C CG  . PHE C 1 176 ? 25.425  -66.225  -26.887 1.00 39.60  ? 177 PHE C CG  1 
ATOM   6759  C CD1 . PHE C 1 176 ? 25.444  -64.998  -27.535 1.00 40.39  ? 177 PHE C CD1 1 
ATOM   6760  C CD2 . PHE C 1 176 ? 25.567  -66.252  -25.510 1.00 39.34  ? 177 PHE C CD2 1 
ATOM   6761  C CE1 . PHE C 1 176 ? 25.604  -63.821  -26.820 1.00 40.96  ? 177 PHE C CE1 1 
ATOM   6762  C CE2 . PHE C 1 176 ? 25.729  -65.077  -24.786 1.00 40.11  ? 177 PHE C CE2 1 
ATOM   6763  C CZ  . PHE C 1 176 ? 25.746  -63.861  -25.437 1.00 40.69  ? 177 PHE C CZ  1 
ATOM   6764  N N   . ALA C 1 177 ? 26.270  -69.903  -29.853 1.00 39.51  ? 178 ALA C N   1 
ATOM   6765  C CA  . ALA C 1 177 ? 26.347  -71.342  -30.081 1.00 39.89  ? 178 ALA C CA  1 
ATOM   6766  C C   . ALA C 1 177 ? 27.413  -71.691  -31.115 1.00 42.59  ? 178 ALA C C   1 
ATOM   6767  O O   . ALA C 1 177 ? 27.647  -72.868  -31.404 1.00 43.49  ? 178 ALA C O   1 
ATOM   6768  C CB  . ALA C 1 177 ? 24.999  -71.884  -30.505 1.00 38.00  ? 178 ALA C CB  1 
ATOM   6769  N N   . GLY C 1 178 ? 28.057  -70.665  -31.663 1.00 43.13  ? 179 GLY C N   1 
ATOM   6770  C CA  . GLY C 1 178 ? 29.119  -70.856  -32.634 1.00 43.96  ? 179 GLY C CA  1 
ATOM   6771  C C   . GLY C 1 178 ? 28.680  -71.599  -33.884 1.00 43.39  ? 179 GLY C C   1 
ATOM   6772  O O   . GLY C 1 178 ? 29.460  -72.349  -34.471 1.00 44.77  ? 179 GLY C O   1 
ATOM   6773  N N   . MET C 1 179 ? 27.431  -71.394  -34.290 1.00 41.20  ? 180 MET C N   1 
ATOM   6774  C CA  . MET C 1 179 ? 26.892  -72.047  -35.482 1.00 41.88  ? 180 MET C CA  1 
ATOM   6775  C C   . MET C 1 179 ? 26.340  -71.015  -36.466 1.00 40.33  ? 180 MET C C   1 
ATOM   6776  O O   . MET C 1 179 ? 25.286  -70.432  -36.238 1.00 38.56  ? 180 MET C O   1 
ATOM   6777  C CB  . MET C 1 179 ? 25.806  -73.059  -35.093 1.00 40.91  ? 180 MET C CB  1 
ATOM   6778  C CG  . MET C 1 179 ? 24.980  -73.576  -36.259 1.00 40.96  ? 180 MET C CG  1 
ATOM   6779  S SD  . MET C 1 179 ? 25.954  -74.294  -37.601 1.00 62.58  ? 180 MET C SD  1 
ATOM   6780  C CE  . MET C 1 179 ? 26.533  -75.804  -36.845 1.00 46.42  ? 180 MET C CE  1 
ATOM   6781  N N   . PRO C 1 180 ? 27.064  -70.783  -37.569 1.00 42.10  ? 181 PRO C N   1 
ATOM   6782  C CA  . PRO C 1 180 ? 26.694  -69.731  -38.517 1.00 41.57  ? 181 PRO C CA  1 
ATOM   6783  C C   . PRO C 1 180 ? 25.573  -70.167  -39.460 1.00 41.27  ? 181 PRO C C   1 
ATOM   6784  O O   . PRO C 1 180 ? 25.794  -70.328  -40.660 1.00 43.06  ? 181 PRO C O   1 
ATOM   6785  C CB  . PRO C 1 180 ? 27.994  -69.484  -39.279 1.00 44.13  ? 181 PRO C CB  1 
ATOM   6786  C CG  . PRO C 1 180 ? 28.673  -70.807  -39.266 1.00 46.02  ? 181 PRO C CG  1 
ATOM   6787  C CD  . PRO C 1 180 ? 28.314  -71.463  -37.956 1.00 44.68  ? 181 PRO C CD  1 
ATOM   6788  N N   . CYS C 1 181 ? 24.380  -70.344  -38.905 1.00 39.90  ? 182 CYS C N   1 
ATOM   6789  C CA  . CYS C 1 181 ? 23.244  -70.847  -39.659 1.00 40.59  ? 182 CYS C CA  1 
ATOM   6790  C C   . CYS C 1 181 ? 22.645  -69.779  -40.565 1.00 40.93  ? 182 CYS C C   1 
ATOM   6791  O O   . CYS C 1 181 ? 22.874  -68.584  -40.373 1.00 41.61  ? 182 CYS C O   1 
ATOM   6792  C CB  . CYS C 1 181 ? 22.170  -71.372  -38.703 1.00 39.46  ? 182 CYS C CB  1 
ATOM   6793  S SG  . CYS C 1 181 ? 21.433  -70.093  -37.657 1.00 39.36  ? 182 CYS C SG  1 
ATOM   6794  N N   . GLY C 1 182 ? 21.871  -70.220  -41.551 1.00 40.20  ? 183 GLY C N   1 
ATOM   6795  C CA  . GLY C 1 182 ? 21.077  -69.312  -42.354 1.00 40.60  ? 183 GLY C CA  1 
ATOM   6796  C C   . GLY C 1 182 ? 19.817  -68.952  -41.589 1.00 38.95  ? 183 GLY C C   1 
ATOM   6797  O O   . GLY C 1 182 ? 19.709  -69.236  -40.397 1.00 36.57  ? 183 GLY C O   1 
ATOM   6798  N N   . ILE C 1 183 ? 18.848  -68.353  -42.271 1.00 39.16  ? 184 ILE C N   1 
ATOM   6799  C CA  . ILE C 1 183 ? 17.665  -67.844  -41.588 1.00 38.88  ? 184 ILE C CA  1 
ATOM   6800  C C   . ILE C 1 183 ? 16.480  -68.812  -41.578 1.00 38.54  ? 184 ILE C C   1 
ATOM   6801  O O   . ILE C 1 183 ? 15.467  -68.532  -40.934 1.00 37.74  ? 184 ILE C O   1 
ATOM   6802  C CB  . ILE C 1 183 ? 17.198  -66.515  -42.219 1.00 40.89  ? 184 ILE C CB  1 
ATOM   6803  N N   . MET C 1 184 ? 16.600  -69.940  -42.279 1.00 38.65  ? 185 MET C N   1 
ATOM   6804  C CA  . MET C 1 184 ? 15.460  -70.845  -42.466 1.00 38.15  ? 185 MET C CA  1 
ATOM   6805  C C   . MET C 1 184 ? 14.805  -71.310  -41.162 1.00 37.33  ? 185 MET C C   1 
ATOM   6806  O O   . MET C 1 184 ? 13.611  -71.094  -40.950 1.00 38.05  ? 185 MET C O   1 
ATOM   6807  C CB  . MET C 1 184 ? 15.866  -72.085  -43.274 1.00 37.90  ? 185 MET C CB  1 
ATOM   6808  C CG  . MET C 1 184 ? 14.772  -73.151  -43.289 1.00 36.97  ? 185 MET C CG  1 
ATOM   6809  S SD  . MET C 1 184 ? 15.067  -74.599  -44.323 1.00 37.79  ? 185 MET C SD  1 
ATOM   6810  C CE  . MET C 1 184 ? 16.591  -75.229  -43.634 1.00 38.04  ? 185 MET C CE  1 
ATOM   6811  N N   . ASP C 1 185 ? 15.587  -71.950  -40.299 1.00 36.87  ? 186 ASP C N   1 
ATOM   6812  C CA  . ASP C 1 185 ? 15.036  -72.616  -39.121 1.00 33.12  ? 186 ASP C CA  1 
ATOM   6813  C C   . ASP C 1 185 ? 14.320  -71.633  -38.207 1.00 31.91  ? 186 ASP C C   1 
ATOM   6814  O O   . ASP C 1 185 ? 13.256  -71.939  -37.669 1.00 30.73  ? 186 ASP C O   1 
ATOM   6815  C CB  . ASP C 1 185 ? 16.137  -73.351  -38.355 1.00 33.14  ? 186 ASP C CB  1 
ATOM   6816  C CG  . ASP C 1 185 ? 17.065  -74.130  -39.266 1.00 35.53  ? 186 ASP C CG  1 
ATOM   6817  O OD1 . ASP C 1 185 ? 16.730  -74.306  -40.457 1.00 37.04  ? 186 ASP C OD1 1 
ATOM   6818  O OD2 . ASP C 1 185 ? 18.113  -74.599  -38.785 1.00 34.98  ? 186 ASP C OD2 1 
ATOM   6819  N N   . GLN C 1 186 ? 14.897  -70.447  -38.052 1.00 33.58  ? 187 GLN C N   1 
ATOM   6820  C CA  . GLN C 1 186 ? 14.279  -69.401  -37.246 1.00 32.97  ? 187 GLN C CA  1 
ATOM   6821  C C   . GLN C 1 186 ? 12.975  -68.921  -37.868 1.00 32.66  ? 187 GLN C C   1 
ATOM   6822  O O   . GLN C 1 186 ? 11.977  -68.765  -37.165 1.00 30.33  ? 187 GLN C O   1 
ATOM   6823  C CB  . GLN C 1 186 ? 15.234  -68.215  -37.058 1.00 33.41  ? 187 GLN C CB  1 
ATOM   6824  C CG  . GLN C 1 186 ? 16.422  -68.481  -36.131 1.00 31.35  ? 187 GLN C CG  1 
ATOM   6825  C CD  . GLN C 1 186 ? 17.470  -69.391  -36.745 1.00 32.75  ? 187 GLN C CD  1 
ATOM   6826  O OE1 . GLN C 1 186 ? 17.536  -69.556  -37.967 1.00 32.60  ? 187 GLN C OE1 1 
ATOM   6827  N NE2 . GLN C 1 186 ? 18.296  -69.992  -35.897 1.00 33.48  ? 187 GLN C NE2 1 
ATOM   6828  N N   . PHE C 1 187 ? 12.971  -68.695  -39.183 1.00 36.12  ? 188 PHE C N   1 
ATOM   6829  C CA  . PHE C 1 187 ? 11.787  -68.126  -39.820 1.00 38.53  ? 188 PHE C CA  1 
ATOM   6830  C C   . PHE C 1 187 ? 10.621  -69.117  -39.813 1.00 34.89  ? 188 PHE C C   1 
ATOM   6831  O O   . PHE C 1 187 ? 9.471   -68.717  -39.613 1.00 33.55  ? 188 PHE C O   1 
ATOM   6832  C CB  . PHE C 1 187 ? 12.089  -67.664  -41.253 1.00 46.36  ? 188 PHE C CB  1 
ATOM   6833  C CG  . PHE C 1 187 ? 11.218  -66.521  -41.718 1.00 54.01  ? 188 PHE C CG  1 
ATOM   6834  C CD1 . PHE C 1 187 ? 11.778  -65.301  -42.065 1.00 57.10  ? 188 PHE C CD1 1 
ATOM   6835  C CD2 . PHE C 1 187 ? 9.839   -66.669  -41.813 1.00 57.81  ? 188 PHE C CD2 1 
ATOM   6836  C CE1 . PHE C 1 187 ? 10.979  -64.245  -42.489 1.00 59.15  ? 188 PHE C CE1 1 
ATOM   6837  C CE2 . PHE C 1 187 ? 9.032   -65.615  -42.229 1.00 59.86  ? 188 PHE C CE2 1 
ATOM   6838  C CZ  . PHE C 1 187 ? 9.604   -64.404  -42.575 1.00 60.24  ? 188 PHE C CZ  1 
ATOM   6839  N N   . ILE C 1 188 ? 10.899  -70.407  -39.997 1.00 31.89  ? 189 ILE C N   1 
ATOM   6840  C CA  . ILE C 1 188 ? 9.804   -71.379  -40.010 1.00 31.68  ? 189 ILE C CA  1 
ATOM   6841  C C   . ILE C 1 188 ? 9.251   -71.619  -38.600 1.00 30.92  ? 189 ILE C C   1 
ATOM   6842  O O   . ILE C 1 188 ? 8.049   -71.824  -38.426 1.00 31.30  ? 189 ILE C O   1 
ATOM   6843  C CB  . ILE C 1 188 ? 10.221  -72.730  -40.659 1.00 33.49  ? 189 ILE C CB  1 
ATOM   6844  C CG1 . ILE C 1 188 ? 9.048   -73.717  -40.654 1.00 33.44  ? 189 ILE C CG1 1 
ATOM   6845  C CG2 . ILE C 1 188 ? 11.439  -73.334  -39.976 1.00 29.33  ? 189 ILE C CG2 1 
ATOM   6846  C CD1 . ILE C 1 188 ? 7.775   -73.179  -41.311 1.00 33.74  ? 189 ILE C CD1 1 
ATOM   6847  N N   . SER C 1 189 ? 10.112  -71.572  -37.590 1.00 30.34  ? 190 SER C N   1 
ATOM   6848  C CA  . SER C 1 189 ? 9.643   -71.716  -36.214 1.00 29.47  ? 190 SER C CA  1 
ATOM   6849  C C   . SER C 1 189 ? 8.761   -70.528  -35.847 1.00 28.90  ? 190 SER C C   1 
ATOM   6850  O O   . SER C 1 189 ? 7.773   -70.668  -35.127 1.00 29.99  ? 190 SER C O   1 
ATOM   6851  C CB  . SER C 1 189 ? 10.820  -71.836  -35.246 1.00 31.65  ? 190 SER C CB  1 
ATOM   6852  O OG  . SER C 1 189 ? 10.364  -72.116  -33.932 1.00 33.67  ? 190 SER C OG  1 
ATOM   6853  N N   . LEU C 1 190 ? 9.112   -69.358  -36.371 1.00 28.64  ? 191 LEU C N   1 
ATOM   6854  C CA  . LEU C 1 190 ? 8.325   -68.152  -36.160 1.00 28.62  ? 191 LEU C CA  1 
ATOM   6855  C C   . LEU C 1 190 ? 6.994   -68.164  -36.906 1.00 31.92  ? 191 LEU C C   1 
ATOM   6856  O O   . LEU C 1 190 ? 5.944   -67.897  -36.322 1.00 33.74  ? 191 LEU C O   1 
ATOM   6857  C CB  . LEU C 1 190 ? 9.126   -66.915  -36.583 1.00 29.52  ? 191 LEU C CB  1 
ATOM   6858  C CG  . LEU C 1 190 ? 10.077  -66.308  -35.543 1.00 30.88  ? 191 LEU C CG  1 
ATOM   6859  C CD1 . LEU C 1 190 ? 11.046  -65.337  -36.196 1.00 32.13  ? 191 LEU C CD1 1 
ATOM   6860  C CD2 . LEU C 1 190 ? 9.290   -65.609  -34.448 1.00 30.76  ? 191 LEU C CD2 1 
ATOM   6861  N N   . MET C 1 191 ? 7.036   -68.474  -38.197 1.00 31.69  ? 192 MET C N   1 
ATOM   6862  C CA  . MET C 1 191 ? 5.904   -68.176  -39.061 1.00 32.25  ? 192 MET C CA  1 
ATOM   6863  C C   . MET C 1 191 ? 5.191   -69.386  -39.653 1.00 30.68  ? 192 MET C C   1 
ATOM   6864  O O   . MET C 1 191 ? 4.385   -69.242  -40.578 1.00 32.19  ? 192 MET C O   1 
ATOM   6865  C CB  . MET C 1 191 ? 6.364   -67.252  -40.195 1.00 35.95  ? 192 MET C CB  1 
ATOM   6866  C CG  . MET C 1 191 ? 6.749   -65.858  -39.711 1.00 38.21  ? 192 MET C CG  1 
ATOM   6867  S SD  . MET C 1 191 ? 5.445   -65.124  -38.708 1.00 105.55 ? 192 MET C SD  1 
ATOM   6868  C CE  . MET C 1 191 ? 4.066   -65.208  -39.848 1.00 48.47  ? 192 MET C CE  1 
ATOM   6869  N N   . GLY C 1 192 ? 5.481   -70.571  -39.131 1.00 30.35  ? 193 GLY C N   1 
ATOM   6870  C CA  . GLY C 1 192 ? 4.790   -71.764  -39.583 1.00 32.40  ? 193 GLY C CA  1 
ATOM   6871  C C   . GLY C 1 192 ? 3.306   -71.642  -39.297 1.00 32.41  ? 193 GLY C C   1 
ATOM   6872  O O   . GLY C 1 192 ? 2.897   -70.913  -38.390 1.00 29.62  ? 193 GLY C O   1 
ATOM   6873  N N   . GLN C 1 193 ? 2.492   -72.331  -40.086 1.00 34.62  ? 194 GLN C N   1 
ATOM   6874  C CA  . GLN C 1 193 ? 1.053   -72.357  -39.848 1.00 37.56  ? 194 GLN C CA  1 
ATOM   6875  C C   . GLN C 1 193 ? 0.543   -73.768  -40.057 1.00 39.16  ? 194 GLN C C   1 
ATOM   6876  O O   . GLN C 1 193 ? 0.974   -74.449  -40.990 1.00 40.74  ? 194 GLN C O   1 
ATOM   6877  C CB  . GLN C 1 193 ? 0.312   -71.382  -40.771 1.00 39.04  ? 194 GLN C CB  1 
ATOM   6878  C CG  . GLN C 1 193 ? 0.793   -69.932  -40.700 1.00 40.47  ? 194 GLN C CG  1 
ATOM   6879  C CD  . GLN C 1 193 ? 0.520   -69.265  -39.358 1.00 42.06  ? 194 GLN C CD  1 
ATOM   6880  O OE1 . GLN C 1 193 ? -0.219  -69.791  -38.525 1.00 43.49  ? 194 GLN C OE1 1 
ATOM   6881  N NE2 . GLN C 1 193 ? 1.120   -68.096  -39.148 1.00 41.16  ? 194 GLN C NE2 1 
ATOM   6882  N N   . LYS C 1 194 ? -0.368  -74.210  -39.192 1.00 39.19  ? 195 LYS C N   1 
ATOM   6883  C CA  . LYS C 1 194 ? -0.925  -75.551  -39.317 1.00 41.78  ? 195 LYS C CA  1 
ATOM   6884  C C   . LYS C 1 194 ? -1.487  -75.772  -40.719 1.00 40.99  ? 195 LYS C C   1 
ATOM   6885  O O   . LYS C 1 194 ? -2.233  -74.940  -41.231 1.00 38.69  ? 195 LYS C O   1 
ATOM   6886  C CB  . LYS C 1 194 ? -2.021  -75.802  -38.278 1.00 44.91  ? 195 LYS C CB  1 
ATOM   6887  C CG  . LYS C 1 194 ? -2.733  -77.132  -38.497 1.00 49.30  ? 195 LYS C CG  1 
ATOM   6888  C CD  . LYS C 1 194 ? -3.757  -77.463  -37.422 1.00 52.03  ? 195 LYS C CD  1 
ATOM   6889  C CE  . LYS C 1 194 ? -4.489  -78.757  -37.786 1.00 55.56  ? 195 LYS C CE  1 
ATOM   6890  N NZ  . LYS C 1 194 ? -5.272  -79.334  -36.656 1.00 57.21  ? 195 LYS C NZ  1 
ATOM   6891  N N   . GLY C 1 195 ? -1.102  -76.884  -41.338 1.00 42.65  ? 196 GLY C N   1 
ATOM   6892  C CA  . GLY C 1 195 ? -1.636  -77.264  -42.633 1.00 45.23  ? 196 GLY C CA  1 
ATOM   6893  C C   . GLY C 1 195 ? -0.961  -76.581  -43.806 1.00 45.10  ? 196 GLY C C   1 
ATOM   6894  O O   . GLY C 1 195 ? -1.444  -76.658  -44.933 1.00 48.16  ? 196 GLY C O   1 
ATOM   6895  N N   . HIS C 1 196 ? 0.154   -75.908  -43.544 1.00 43.32  ? 197 HIS C N   1 
ATOM   6896  C CA  . HIS C 1 196 ? 0.903   -75.233  -44.594 1.00 45.45  ? 197 HIS C CA  1 
ATOM   6897  C C   . HIS C 1 196 ? 2.383   -75.578  -44.570 1.00 43.11  ? 197 HIS C C   1 
ATOM   6898  O O   . HIS C 1 196 ? 2.961   -75.839  -43.511 1.00 43.34  ? 197 HIS C O   1 
ATOM   6899  C CB  . HIS C 1 196 ? 0.752   -73.710  -44.485 1.00 46.15  ? 197 HIS C CB  1 
ATOM   6900  C CG  . HIS C 1 196 ? -0.660  -73.226  -44.608 1.00 49.40  ? 197 HIS C CG  1 
ATOM   6901  N ND1 . HIS C 1 196 ? -1.586  -73.369  -43.604 1.00 50.96  ? 197 HIS C ND1 1 
ATOM   6902  C CD2 . HIS C 1 196 ? -1.298  -72.602  -45.630 1.00 52.44  ? 197 HIS C CD2 1 
ATOM   6903  C CE1 . HIS C 1 196 ? -2.738  -72.850  -43.992 1.00 50.56  ? 197 HIS C CE1 1 
ATOM   6904  N NE2 . HIS C 1 196 ? -2.591  -72.383  -45.218 1.00 51.04  ? 197 HIS C NE2 1 
ATOM   6905  N N   . ALA C 1 197 ? 2.990   -75.581  -45.749 1.00 41.71  ? 198 ALA C N   1 
ATOM   6906  C CA  . ALA C 1 197 ? 4.434   -75.478  -45.849 1.00 42.17  ? 198 ALA C CA  1 
ATOM   6907  C C   . ALA C 1 197 ? 4.734   -74.000  -46.031 1.00 42.00  ? 198 ALA C C   1 
ATOM   6908  O O   . ALA C 1 197 ? 3.834   -73.225  -46.352 1.00 42.84  ? 198 ALA C O   1 
ATOM   6909  C CB  . ALA C 1 197 ? 4.975   -76.300  -47.004 1.00 42.65  ? 198 ALA C CB  1 
ATOM   6910  N N   . LEU C 1 198 ? 5.981   -73.602  -45.821 1.00 40.51  ? 199 LEU C N   1 
ATOM   6911  C CA  . LEU C 1 198 ? 6.350   -72.200  -45.965 1.00 40.80  ? 199 LEU C CA  1 
ATOM   6912  C C   . LEU C 1 198 ? 7.452   -72.035  -47.003 1.00 43.18  ? 199 LEU C C   1 
ATOM   6913  O O   . LEU C 1 198 ? 8.588   -72.444  -46.779 1.00 44.68  ? 199 LEU C O   1 
ATOM   6914  C CB  . LEU C 1 198 ? 6.798   -71.622  -44.618 1.00 41.47  ? 199 LEU C CB  1 
ATOM   6915  C CG  . LEU C 1 198 ? 7.014   -70.108  -44.535 1.00 42.84  ? 199 LEU C CG  1 
ATOM   6916  C CD1 . LEU C 1 198 ? 5.734   -69.362  -44.883 1.00 43.47  ? 199 LEU C CD1 1 
ATOM   6917  C CD2 . LEU C 1 198 ? 7.514   -69.701  -43.161 1.00 42.47  ? 199 LEU C CD2 1 
ATOM   6918  N N   . LEU C 1 199 ? 7.113   -71.456  -48.151 1.00 42.86  ? 200 LEU C N   1 
ATOM   6919  C CA  . LEU C 1 199 ? 8.130   -71.104  -49.131 1.00 43.93  ? 200 LEU C CA  1 
ATOM   6920  C C   . LEU C 1 199 ? 8.817   -69.816  -48.692 1.00 43.23  ? 200 LEU C C   1 
ATOM   6921  O O   . LEU C 1 199 ? 8.179   -68.769  -48.578 1.00 44.19  ? 200 LEU C O   1 
ATOM   6922  C CB  . LEU C 1 199 ? 7.525   -70.940  -50.528 1.00 46.21  ? 200 LEU C CB  1 
ATOM   6923  C CG  . LEU C 1 199 ? 8.516   -70.666  -51.662 1.00 47.82  ? 200 LEU C CG  1 
ATOM   6924  C CD1 . LEU C 1 199 ? 9.505   -71.814  -51.805 1.00 47.66  ? 200 LEU C CD1 1 
ATOM   6925  C CD2 . LEU C 1 199 ? 7.785   -70.421  -52.975 1.00 49.60  ? 200 LEU C CD2 1 
ATOM   6926  N N   . ILE C 1 200 ? 10.116  -69.894  -48.437 1.00 40.61  ? 201 ILE C N   1 
ATOM   6927  C CA  . ILE C 1 200 ? 10.863  -68.718  -48.021 1.00 40.74  ? 201 ILE C CA  1 
ATOM   6928  C C   . ILE C 1 200 ? 11.843  -68.274  -49.098 1.00 42.45  ? 201 ILE C C   1 
ATOM   6929  O O   . ILE C 1 200 ? 12.683  -69.054  -49.550 1.00 44.91  ? 201 ILE C O   1 
ATOM   6930  C CB  . ILE C 1 200 ? 11.640  -68.970  -46.709 1.00 39.93  ? 201 ILE C CB  1 
ATOM   6931  C CG1 . ILE C 1 200 ? 10.699  -69.474  -45.612 1.00 37.27  ? 201 ILE C CG1 1 
ATOM   6932  C CG2 . ILE C 1 200 ? 12.354  -67.700  -46.259 1.00 40.41  ? 201 ILE C CG2 1 
ATOM   6933  C CD1 . ILE C 1 200 ? 11.418  -69.904  -44.351 1.00 37.18  ? 201 ILE C CD1 1 
ATOM   6934  N N   . ASP C 1 201 ? 11.725  -67.019  -49.513 1.00 40.33  ? 202 ASP C N   1 
ATOM   6935  C CA  . ASP C 1 201 ? 12.709  -66.423  -50.402 1.00 43.19  ? 202 ASP C CA  1 
ATOM   6936  C C   . ASP C 1 201 ? 13.737  -65.739  -49.514 1.00 44.04  ? 202 ASP C C   1 
ATOM   6937  O O   . ASP C 1 201 ? 13.443  -64.717  -48.898 1.00 43.40  ? 202 ASP C O   1 
ATOM   6938  C CB  . ASP C 1 201 ? 12.048  -65.436  -51.384 1.00 43.27  ? 202 ASP C CB  1 
ATOM   6939  C CG  . ASP C 1 201 ? 12.992  -64.964  -52.479 1.00 45.44  ? 202 ASP C CG  1 
ATOM   6940  O OD1 . ASP C 1 201 ? 14.174  -64.688  -52.183 1.00 43.84  ? 202 ASP C OD1 1 
ATOM   6941  O OD2 . ASP C 1 201 ? 12.545  -64.868  -53.649 1.00 48.67  ? 202 ASP C OD2 1 
ATOM   6942  N N   . CYS C 1 202 ? 14.938  -66.307  -49.437 1.00 46.11  ? 203 CYS C N   1 
ATOM   6943  C CA  . CYS C 1 202 ? 15.942  -65.821  -48.492 1.00 47.91  ? 203 CYS C CA  1 
ATOM   6944  C C   . CYS C 1 202 ? 16.762  -64.671  -49.064 1.00 49.85  ? 203 CYS C C   1 
ATOM   6945  O O   . CYS C 1 202 ? 17.805  -64.308  -48.519 1.00 51.21  ? 203 CYS C O   1 
ATOM   6946  C CB  . CYS C 1 202 ? 16.867  -66.959  -48.061 1.00 49.31  ? 203 CYS C CB  1 
ATOM   6947  S SG  . CYS C 1 202 ? 16.001  -68.374  -47.353 1.00 45.34  ? 203 CYS C SG  1 
ATOM   6948  N N   . ARG C 1 203 ? 16.287  -64.105  -50.168 1.00 50.13  ? 204 ARG C N   1 
ATOM   6949  C CA  . ARG C 1 203 ? 16.885  -62.901  -50.723 1.00 51.97  ? 204 ARG C CA  1 
ATOM   6950  C C   . ARG C 1 203 ? 16.014  -61.693  -50.404 1.00 52.69  ? 204 ARG C C   1 
ATOM   6951  O O   . ARG C 1 203 ? 16.463  -60.742  -49.764 1.00 53.67  ? 204 ARG C O   1 
ATOM   6952  C CB  . ARG C 1 203 ? 17.077  -63.033  -52.238 1.00 52.60  ? 204 ARG C CB  1 
ATOM   6953  C CG  . ARG C 1 203 ? 17.704  -61.804  -52.874 1.00 54.82  ? 204 ARG C CG  1 
ATOM   6954  C CD  . ARG C 1 203 ? 18.023  -62.016  -54.346 1.00 56.90  ? 204 ARG C CD  1 
ATOM   6955  N NE  . ARG C 1 203 ? 16.831  -62.286  -55.146 1.00 56.62  ? 204 ARG C NE  1 
ATOM   6956  C CZ  . ARG C 1 203 ? 16.854  -62.538  -56.452 1.00 59.52  ? 204 ARG C CZ  1 
ATOM   6957  N NH1 . ARG C 1 203 ? 18.009  -62.551  -57.104 1.00 61.93  ? 204 ARG C NH1 1 
ATOM   6958  N NH2 . ARG C 1 203 ? 15.725  -62.773  -57.108 1.00 59.46  ? 204 ARG C NH2 1 
ATOM   6959  N N   . SER C 1 204 ? 14.762  -61.746  -50.851 1.00 52.38  ? 205 SER C N   1 
ATOM   6960  C CA  . SER C 1 204 ? 13.814  -60.653  -50.654 1.00 50.82  ? 205 SER C CA  1 
ATOM   6961  C C   . SER C 1 204 ? 13.112  -60.740  -49.301 1.00 47.21  ? 205 SER C C   1 
ATOM   6962  O O   . SER C 1 204 ? 12.504  -59.768  -48.850 1.00 47.21  ? 205 SER C O   1 
ATOM   6963  C CB  . SER C 1 204 ? 12.771  -60.649  -51.775 1.00 51.01  ? 205 SER C CB  1 
ATOM   6964  O OG  . SER C 1 204 ? 11.987  -61.829  -51.731 1.00 49.44  ? 205 SER C OG  1 
ATOM   6965  N N   . LEU C 1 205 ? 13.198  -61.913  -48.676 1.00 44.76  ? 206 LEU C N   1 
ATOM   6966  C CA  . LEU C 1 205 ? 12.542  -62.213  -47.397 1.00 42.30  ? 206 LEU C CA  1 
ATOM   6967  C C   . LEU C 1 205 ? 11.015  -62.236  -47.519 1.00 41.88  ? 206 LEU C C   1 
ATOM   6968  O O   . LEU C 1 205 ? 10.301  -62.127  -46.516 1.00 40.31  ? 206 LEU C O   1 
ATOM   6969  C CB  . LEU C 1 205 ? 12.982  -61.230  -46.303 1.00 41.64  ? 206 LEU C CB  1 
ATOM   6970  C CG  . LEU C 1 205 ? 14.472  -61.263  -45.942 1.00 43.28  ? 206 LEU C CG  1 
ATOM   6971  C CD1 . LEU C 1 205 ? 14.741  -60.532  -44.627 1.00 43.17  ? 206 LEU C CD1 1 
ATOM   6972  C CD2 . LEU C 1 205 ? 14.997  -62.695  -45.870 1.00 42.53  ? 206 LEU C CD2 1 
ATOM   6973  N N   . GLU C 1 206 ? 10.522  -62.391  -48.748 1.00 44.46  ? 207 GLU C N   1 
ATOM   6974  C CA  . GLU C 1 206 ? 9.110   -62.678  -48.977 1.00 44.15  ? 207 GLU C CA  1 
ATOM   6975  C C   . GLU C 1 206 ? 8.837   -64.139  -48.597 1.00 43.55  ? 207 GLU C C   1 
ATOM   6976  O O   . GLU C 1 206 ? 9.679   -65.011  -48.814 1.00 43.74  ? 207 GLU C O   1 
ATOM   6977  C CB  . GLU C 1 206 ? 8.718   -62.405  -50.444 1.00 45.35  ? 207 GLU C CB  1 
ATOM   6978  C CG  . GLU C 1 206 ? 7.257   -62.728  -50.783 1.00 46.30  ? 207 GLU C CG  1 
ATOM   6979  C CD  . GLU C 1 206 ? 6.840   -62.307  -52.194 1.00 49.53  ? 207 GLU C CD  1 
ATOM   6980  O OE1 . GLU C 1 206 ? 7.585   -61.548  -52.853 1.00 51.81  ? 207 GLU C OE1 1 
ATOM   6981  O OE2 . GLU C 1 206 ? 5.755   -62.741  -52.646 1.00 49.88  ? 207 GLU C OE2 1 
ATOM   6982  N N   . THR C 1 207 ? 7.672   -64.402  -48.013 1.00 42.58  ? 208 THR C N   1 
ATOM   6983  C CA  . THR C 1 207 ? 7.291   -65.770  -47.675 1.00 43.31  ? 208 THR C CA  1 
ATOM   6984  C C   . THR C 1 207 ? 5.916   -66.130  -48.229 1.00 44.90  ? 208 THR C C   1 
ATOM   6985  O O   . THR C 1 207 ? 5.044   -65.272  -48.359 1.00 46.47  ? 208 THR C O   1 
ATOM   6986  C CB  . THR C 1 207 ? 7.292   -65.993  -46.151 1.00 43.35  ? 208 THR C CB  1 
ATOM   6987  O OG1 . THR C 1 207 ? 6.470   -65.004  -45.519 1.00 45.17  ? 208 THR C OG1 1 
ATOM   6988  C CG2 . THR C 1 207 ? 8.703   -65.883  -45.610 1.00 42.26  ? 208 THR C CG2 1 
ATOM   6989  N N   . SER C 1 208 ? 5.725   -67.401  -48.565 1.00 45.38  ? 209 SER C N   1 
ATOM   6990  C CA  . SER C 1 208 ? 4.419   -67.866  -49.013 1.00 47.23  ? 209 SER C CA  1 
ATOM   6991  C C   . SER C 1 208 ? 3.942   -69.052  -48.194 1.00 45.95  ? 209 SER C C   1 
ATOM   6992  O O   . SER C 1 208 ? 4.673   -70.025  -48.012 1.00 45.49  ? 209 SER C O   1 
ATOM   6993  C CB  . SER C 1 208 ? 4.447   -68.245  -50.493 1.00 49.76  ? 209 SER C CB  1 
ATOM   6994  O OG  . SER C 1 208 ? 4.580   -67.101  -51.310 1.00 52.46  ? 209 SER C OG  1 
ATOM   6995  N N   . LEU C 1 209 ? 2.710   -68.961  -47.707 1.00 44.82  ? 210 LEU C N   1 
ATOM   6996  C CA  . LEU C 1 209 ? 2.075   -70.071  -47.018 1.00 44.59  ? 210 LEU C CA  1 
ATOM   6997  C C   . LEU C 1 209 ? 1.405   -70.976  -48.033 1.00 46.64  ? 210 LEU C C   1 
ATOM   6998  O O   . LEU C 1 209 ? 0.350   -70.644  -48.580 1.00 49.99  ? 210 LEU C O   1 
ATOM   6999  C CB  . LEU C 1 209 ? 1.068   -69.564  -45.988 1.00 44.49  ? 210 LEU C CB  1 
ATOM   7000  C CG  . LEU C 1 209 ? 1.721   -69.015  -44.717 1.00 43.48  ? 210 LEU C CG  1 
ATOM   7001  C CD1 . LEU C 1 209 ? 0.716   -68.255  -43.865 1.00 43.36  ? 210 LEU C CD1 1 
ATOM   7002  C CD2 . LEU C 1 209 ? 2.346   -70.152  -43.926 1.00 43.25  ? 210 LEU C CD2 1 
ATOM   7003  N N   . VAL C 1 210 ? 2.036   -72.110  -48.307 1.00 46.68  ? 211 VAL C N   1 
ATOM   7004  C CA  . VAL C 1 210 ? 1.528   -73.029  -49.316 1.00 49.73  ? 211 VAL C CA  1 
ATOM   7005  C C   . VAL C 1 210 ? 0.722   -74.134  -48.655 1.00 50.19  ? 211 VAL C C   1 
ATOM   7006  O O   . VAL C 1 210 ? 1.275   -74.940  -47.905 1.00 48.70  ? 211 VAL C O   1 
ATOM   7007  C CB  . VAL C 1 210 ? 2.667   -73.648  -50.147 1.00 51.60  ? 211 VAL C CB  1 
ATOM   7008  C CG1 . VAL C 1 210 ? 2.103   -74.594  -51.192 1.00 54.42  ? 211 VAL C CG1 1 
ATOM   7009  C CG2 . VAL C 1 210 ? 3.495   -72.556  -50.803 1.00 51.74  ? 211 VAL C CG2 1 
ATOM   7010  N N   . PRO C 1 211 ? -0.594  -74.161  -48.919 1.00 52.03  ? 212 PRO C N   1 
ATOM   7011  C CA  . PRO C 1 211 ? -1.502  -75.159  -48.346 1.00 53.59  ? 212 PRO C CA  1 
ATOM   7012  C C   . PRO C 1 211 ? -0.993  -76.584  -48.516 1.00 56.57  ? 212 PRO C C   1 
ATOM   7013  O O   . PRO C 1 211 ? -0.644  -77.000  -49.621 1.00 58.31  ? 212 PRO C O   1 
ATOM   7014  C CB  . PRO C 1 211 ? -2.794  -74.942  -49.134 1.00 53.55  ? 212 PRO C CB  1 
ATOM   7015  C CG  . PRO C 1 211 ? -2.766  -73.495  -49.463 1.00 52.47  ? 212 PRO C CG  1 
ATOM   7016  C CD  . PRO C 1 211 ? -1.319  -73.180  -49.747 1.00 52.35  ? 212 PRO C CD  1 
ATOM   7017  N N   . LEU C 1 212 ? -0.946  -77.315  -47.410 1.00 59.43  ? 213 LEU C N   1 
ATOM   7018  C CA  . LEU C 1 212 ? -0.471  -78.689  -47.408 1.00 61.90  ? 213 LEU C CA  1 
ATOM   7019  C C   . LEU C 1 212 ? -1.482  -79.554  -46.667 1.00 65.19  ? 213 LEU C C   1 
ATOM   7020  O O   . LEU C 1 212 ? -1.130  -80.326  -45.777 1.00 65.69  ? 213 LEU C O   1 
ATOM   7021  C CB  . LEU C 1 212 ? 0.913   -78.776  -46.761 1.00 60.24  ? 213 LEU C CB  1 
ATOM   7022  C CG  . LEU C 1 212 ? 1.752   -80.037  -46.965 1.00 61.41  ? 213 LEU C CG  1 
ATOM   7023  C CD1 . LEU C 1 212 ? 1.849   -80.371  -48.439 1.00 63.50  ? 213 LEU C CD1 1 
ATOM   7024  C CD2 . LEU C 1 212 ? 3.139   -79.859  -46.359 1.00 60.05  ? 213 LEU C CD2 1 
ATOM   7025  N N   . SER C 1 213 ? -2.749  -79.397  -47.032 1.00 68.16  ? 214 SER C N   1 
ATOM   7026  C CA  . SER C 1 213 ? -3.831  -80.142  -46.401 1.00 70.62  ? 214 SER C CA  1 
ATOM   7027  C C   . SER C 1 213 ? -4.435  -81.158  -47.366 1.00 73.29  ? 214 SER C C   1 
ATOM   7028  O O   . SER C 1 213 ? -5.346  -80.844  -48.130 1.00 75.44  ? 214 SER C O   1 
ATOM   7029  C CB  . SER C 1 213 ? -4.916  -79.189  -45.894 1.00 70.81  ? 214 SER C CB  1 
ATOM   7030  N N   . ASP C 1 214 ? -3.905  -82.375  -47.327 1.00 73.30  ? 215 ASP C N   1 
ATOM   7031  C CA  . ASP C 1 214 ? -4.431  -83.487  -48.109 1.00 74.48  ? 215 ASP C CA  1 
ATOM   7032  C C   . ASP C 1 214 ? -4.173  -84.761  -47.323 1.00 74.46  ? 215 ASP C C   1 
ATOM   7033  O O   . ASP C 1 214 ? -3.029  -85.196  -47.206 1.00 74.49  ? 215 ASP C O   1 
ATOM   7034  C CB  . ASP C 1 214 ? -3.778  -83.553  -49.494 1.00 74.68  ? 215 ASP C CB  1 
ATOM   7035  C CG  . ASP C 1 214 ? -4.404  -84.614  -50.398 1.00 76.50  ? 215 ASP C CG  1 
ATOM   7036  O OD1 . ASP C 1 214 ? -5.188  -85.456  -49.910 1.00 76.92  ? 215 ASP C OD1 1 
ATOM   7037  O OD2 . ASP C 1 214 ? -4.100  -84.610  -51.610 1.00 77.33  ? 215 ASP C OD2 1 
ATOM   7038  N N   . PRO C 1 215 ? -5.240  -85.365  -46.779 1.00 75.18  ? 216 PRO C N   1 
ATOM   7039  C CA  . PRO C 1 215 ? -5.114  -86.580  -45.966 1.00 75.48  ? 216 PRO C CA  1 
ATOM   7040  C C   . PRO C 1 215 ? -4.437  -87.721  -46.722 1.00 76.04  ? 216 PRO C C   1 
ATOM   7041  O O   . PRO C 1 215 ? -3.895  -88.632  -46.097 1.00 76.44  ? 216 PRO C O   1 
ATOM   7042  C CB  . PRO C 1 215 ? -6.568  -86.937  -45.633 1.00 77.13  ? 216 PRO C CB  1 
ATOM   7043  C CG  . PRO C 1 215 ? -7.335  -85.667  -45.827 1.00 76.90  ? 216 PRO C CG  1 
ATOM   7044  C CD  . PRO C 1 215 ? -6.643  -84.948  -46.940 1.00 76.32  ? 216 PRO C CD  1 
ATOM   7045  N N   . LYS C 1 216 ? -4.460  -87.657  -48.051 1.00 75.96  ? 217 LYS C N   1 
ATOM   7046  C CA  . LYS C 1 216 ? -3.854  -88.691  -48.883 1.00 75.99  ? 217 LYS C CA  1 
ATOM   7047  C C   . LYS C 1 216 ? -2.329  -88.577  -48.936 1.00 73.93  ? 217 LYS C C   1 
ATOM   7048  O O   . LYS C 1 216 ? -1.635  -89.560  -49.201 1.00 74.08  ? 217 LYS C O   1 
ATOM   7049  C CB  . LYS C 1 216 ? -4.429  -88.635  -50.300 1.00 77.34  ? 217 LYS C CB  1 
ATOM   7050  N N   . LEU C 1 217 ? -1.810  -87.378  -48.683 1.00 71.17  ? 218 LEU C N   1 
ATOM   7051  C CA  . LEU C 1 217 ? -0.370  -87.142  -48.734 1.00 68.63  ? 218 LEU C CA  1 
ATOM   7052  C C   . LEU C 1 217 ? 0.220   -87.017  -47.334 1.00 66.07  ? 218 LEU C C   1 
ATOM   7053  O O   . LEU C 1 217 ? -0.303  -86.284  -46.494 1.00 65.50  ? 218 LEU C O   1 
ATOM   7054  C CB  . LEU C 1 217 ? -0.060  -85.884  -49.548 1.00 67.97  ? 218 LEU C CB  1 
ATOM   7055  N N   . ALA C 1 218 ? 1.315   -87.728  -47.086 1.00 65.17  ? 219 ALA C N   1 
ATOM   7056  C CA  . ALA C 1 218 ? 1.930   -87.734  -45.763 1.00 63.27  ? 219 ALA C CA  1 
ATOM   7057  C C   . ALA C 1 218 ? 3.416   -87.400  -45.808 1.00 61.83  ? 219 ALA C C   1 
ATOM   7058  O O   . ALA C 1 218 ? 4.086   -87.596  -46.824 1.00 63.38  ? 219 ALA C O   1 
ATOM   7059  C CB  . ALA C 1 218 ? 1.722   -89.082  -45.092 1.00 63.93  ? 219 ALA C CB  1 
ATOM   7060  N N   . VAL C 1 219 ? 3.917   -86.897  -44.685 1.00 58.48  ? 220 VAL C N   1 
ATOM   7061  C CA  . VAL C 1 219 ? 5.328   -86.584  -44.528 1.00 55.61  ? 220 VAL C CA  1 
ATOM   7062  C C   . VAL C 1 219 ? 5.925   -87.473  -43.447 1.00 54.33  ? 220 VAL C C   1 
ATOM   7063  O O   . VAL C 1 219 ? 5.587   -87.338  -42.270 1.00 53.32  ? 220 VAL C O   1 
ATOM   7064  C CB  . VAL C 1 219 ? 5.550   -85.104  -44.152 1.00 53.45  ? 220 VAL C CB  1 
ATOM   7065  C CG1 . VAL C 1 219 ? 7.033   -84.781  -44.115 1.00 51.08  ? 220 VAL C CG1 1 
ATOM   7066  C CG2 . VAL C 1 219 ? 4.824   -84.187  -45.129 1.00 54.60  ? 220 VAL C CG2 1 
ATOM   7067  N N   . LEU C 1 220 ? 6.803   -88.386  -43.849 1.00 53.76  ? 221 LEU C N   1 
ATOM   7068  C CA  . LEU C 1 220 ? 7.445   -89.291  -42.906 1.00 52.31  ? 221 LEU C CA  1 
ATOM   7069  C C   . LEU C 1 220 ? 8.868   -88.843  -42.586 1.00 49.38  ? 221 LEU C C   1 
ATOM   7070  O O   . LEU C 1 220 ? 9.722   -88.771  -43.469 1.00 49.20  ? 221 LEU C O   1 
ATOM   7071  C CB  . LEU C 1 220 ? 7.457   -90.718  -43.456 1.00 54.68  ? 221 LEU C CB  1 
ATOM   7072  C CG  . LEU C 1 220 ? 8.182   -91.764  -42.603 1.00 54.05  ? 221 LEU C CG  1 
ATOM   7073  C CD1 . LEU C 1 220 ? 7.361   -92.143  -41.376 1.00 53.50  ? 221 LEU C CD1 1 
ATOM   7074  C CD2 . LEU C 1 220 ? 8.518   -92.989  -43.431 1.00 55.07  ? 221 LEU C CD2 1 
ATOM   7075  N N   . ILE C 1 221 ? 9.115   -88.534  -41.318 1.00 48.16  ? 222 ILE C N   1 
ATOM   7076  C CA  . ILE C 1 221 ? 10.453  -88.161  -40.873 1.00 46.52  ? 222 ILE C CA  1 
ATOM   7077  C C   . ILE C 1 221 ? 11.129  -89.343  -40.189 1.00 46.35  ? 222 ILE C C   1 
ATOM   7078  O O   . ILE C 1 221 ? 10.536  -89.986  -39.325 1.00 46.47  ? 222 ILE C O   1 
ATOM   7079  C CB  . ILE C 1 221 ? 10.417  -86.963  -39.909 1.00 44.47  ? 222 ILE C CB  1 
ATOM   7080  C CG1 . ILE C 1 221 ? 9.780   -85.752  -40.590 1.00 44.74  ? 222 ILE C CG1 1 
ATOM   7081  C CG2 . ILE C 1 221 ? 11.822  -86.624  -39.417 1.00 42.59  ? 222 ILE C CG2 1 
ATOM   7082  C CD1 . ILE C 1 221 ? 9.640   -84.557  -39.683 1.00 43.31  ? 222 ILE C CD1 1 
ATOM   7083  N N   . THR C 1 222 ? 12.367  -89.629  -40.576 1.00 46.76  ? 223 THR C N   1 
ATOM   7084  C CA  . THR C 1 222 ? 13.098  -90.744  -39.989 1.00 47.66  ? 223 THR C CA  1 
ATOM   7085  C C   . THR C 1 222 ? 14.415  -90.297  -39.374 1.00 47.50  ? 223 THR C C   1 
ATOM   7086  O O   . THR C 1 222 ? 15.311  -89.842  -40.083 1.00 48.33  ? 223 THR C O   1 
ATOM   7087  C CB  . THR C 1 222 ? 13.391  -91.840  -41.030 1.00 49.16  ? 223 THR C CB  1 
ATOM   7088  O OG1 . THR C 1 222 ? 12.172  -92.231  -41.671 1.00 50.54  ? 223 THR C OG1 1 
ATOM   7089  C CG2 . THR C 1 222 ? 14.029  -93.051  -40.363 1.00 48.76  ? 223 THR C CG2 1 
ATOM   7090  N N   . ASN C 1 223 ? 14.530  -90.438  -38.057 1.00 46.09  ? 224 ASN C N   1 
ATOM   7091  C CA  . ASN C 1 223 ? 15.763  -90.097  -37.358 1.00 46.26  ? 224 ASN C CA  1 
ATOM   7092  C C   . ASN C 1 223 ? 16.764  -91.242  -37.429 1.00 49.29  ? 224 ASN C C   1 
ATOM   7093  O O   . ASN C 1 223 ? 16.508  -92.335  -36.926 1.00 50.14  ? 224 ASN C O   1 
ATOM   7094  C CB  . ASN C 1 223 ? 15.478  -89.736  -35.898 1.00 43.50  ? 224 ASN C CB  1 
ATOM   7095  C CG  . ASN C 1 223 ? 16.638  -88.999  -35.233 1.00 41.96  ? 224 ASN C CG  1 
ATOM   7096  O OD1 . ASN C 1 223 ? 17.797  -89.142  -35.629 1.00 42.33  ? 224 ASN C OD1 1 
ATOM   7097  N ND2 . ASN C 1 223 ? 16.324  -88.207  -34.211 1.00 39.29  ? 224 ASN C ND2 1 
ATOM   7098  N N   . SER C 1 224 ? 17.904  -90.978  -38.058 1.00 51.12  ? 225 SER C N   1 
ATOM   7099  C CA  . SER C 1 224 ? 18.980  -91.955  -38.161 1.00 53.40  ? 225 SER C CA  1 
ATOM   7100  C C   . SER C 1 224 ? 19.564  -92.278  -36.793 1.00 55.07  ? 225 SER C C   1 
ATOM   7101  O O   . SER C 1 224 ? 20.206  -93.314  -36.611 1.00 56.84  ? 225 SER C O   1 
ATOM   7102  C CB  . SER C 1 224 ? 20.084  -91.432  -39.077 1.00 52.99  ? 225 SER C CB  1 
ATOM   7103  O OG  . SER C 1 224 ? 20.706  -90.294  -38.500 1.00 50.54  ? 225 SER C OG  1 
ATOM   7104  N N   . ASN C 1 225 ? 19.335  -91.373  -35.844 1.00 54.25  ? 226 ASN C N   1 
ATOM   7105  C CA  . ASN C 1 225 ? 19.919  -91.447  -34.509 1.00 53.19  ? 226 ASN C CA  1 
ATOM   7106  C C   . ASN C 1 225 ? 21.438  -91.498  -34.557 1.00 55.08  ? 226 ASN C C   1 
ATOM   7107  O O   . ASN C 1 225 ? 22.077  -92.115  -33.708 1.00 55.46  ? 226 ASN C O   1 
ATOM   7108  C CB  . ASN C 1 225 ? 19.373  -92.649  -33.738 1.00 52.67  ? 226 ASN C CB  1 
ATOM   7109  C CG  . ASN C 1 225 ? 17.953  -92.433  -33.260 1.00 52.13  ? 226 ASN C CG  1 
ATOM   7110  O OD1 . ASN C 1 225 ? 17.003  -92.974  -33.829 1.00 53.65  ? 226 ASN C OD1 1 
ATOM   7111  N ND2 . ASN C 1 225 ? 17.798  -91.632  -32.212 1.00 50.91  ? 226 ASN C ND2 1 
ATOM   7112  N N   . VAL C 1 226 ? 22.011  -90.852  -35.566 1.00 56.84  ? 227 VAL C N   1 
ATOM   7113  C CA  . VAL C 1 226 ? 23.448  -90.643  -35.613 1.00 61.07  ? 227 VAL C CA  1 
ATOM   7114  C C   . VAL C 1 226 ? 23.734  -89.163  -35.818 1.00 62.61  ? 227 VAL C C   1 
ATOM   7115  O O   . VAL C 1 226 ? 22.902  -88.419  -36.341 1.00 61.36  ? 227 VAL C O   1 
ATOM   7116  C CB  . VAL C 1 226 ? 24.134  -91.457  -36.738 1.00 63.61  ? 227 VAL C CB  1 
ATOM   7117  C CG1 . VAL C 1 226 ? 23.670  -92.907  -36.719 1.00 65.88  ? 227 VAL C CG1 1 
ATOM   7118  C CG2 . VAL C 1 226 ? 23.873  -90.831  -38.098 1.00 64.90  ? 227 VAL C CG2 1 
ATOM   7119  N N   . ARG C 1 227 ? 24.912  -88.739  -35.381 1.00 66.20  ? 228 ARG C N   1 
ATOM   7120  C CA  . ARG C 1 227 ? 25.401  -87.401  -35.665 1.00 70.39  ? 228 ARG C CA  1 
ATOM   7121  C C   . ARG C 1 227 ? 26.918  -87.452  -35.703 1.00 75.71  ? 228 ARG C C   1 
ATOM   7122  O O   . ARG C 1 227 ? 27.574  -87.386  -34.663 1.00 75.97  ? 228 ARG C O   1 
ATOM   7123  C CB  . ARG C 1 227 ? 24.921  -86.392  -34.622 1.00 69.01  ? 228 ARG C CB  1 
ATOM   7124  C CG  . ARG C 1 227 ? 24.984  -84.949  -35.097 1.00 69.84  ? 228 ARG C CG  1 
ATOM   7125  C CD  . ARG C 1 227 ? 24.439  -83.987  -34.042 1.00 69.23  ? 228 ARG C CD  1 
ATOM   7126  N NE  . ARG C 1 227 ? 24.898  -82.606  -34.223 1.00 70.55  ? 228 ARG C NE  1 
ATOM   7127  C CZ  . ARG C 1 227 ? 26.170  -82.211  -34.311 1.00 72.61  ? 228 ARG C CZ  1 
ATOM   7128  N NH1 . ARG C 1 227 ? 27.171  -83.077  -34.191 1.00 73.97  ? 228 ARG C NH1 1 
ATOM   7129  N NH2 . ARG C 1 227 ? 26.444  -80.923  -34.484 1.00 72.89  ? 228 ARG C NH2 1 
ATOM   7130  N N   . HIS C 1 228 ? 27.469  -87.595  -36.903 1.00 80.65  ? 229 HIS C N   1 
ATOM   7131  C CA  . HIS C 1 228 ? 28.913  -87.657  -37.081 1.00 85.39  ? 229 HIS C CA  1 
ATOM   7132  C C   . HIS C 1 228 ? 29.569  -86.382  -36.568 1.00 88.17  ? 229 HIS C C   1 
ATOM   7133  O O   . HIS C 1 228 ? 28.909  -85.355  -36.414 1.00 87.42  ? 229 HIS C O   1 
ATOM   7134  C CB  . HIS C 1 228 ? 29.266  -87.880  -38.553 1.00 87.18  ? 229 HIS C CB  1 
ATOM   7135  N N   . SER C 1 229 ? 30.866  -86.456  -36.295 1.00 91.98  ? 230 SER C N   1 
ATOM   7136  C CA  . SER C 1 229 ? 31.604  -85.301  -35.806 1.00 93.74  ? 230 SER C CA  1 
ATOM   7137  C C   . SER C 1 229 ? 32.117  -84.457  -36.964 1.00 96.97  ? 230 SER C C   1 
ATOM   7138  O O   . SER C 1 229 ? 32.749  -83.424  -36.736 1.00 97.72  ? 230 SER C O   1 
ATOM   7139  C CB  . SER C 1 229 ? 32.776  -85.741  -34.929 1.00 94.66  ? 230 SER C CB  1 
ATOM   7140  O OG  . SER C 1 229 ? 33.818  -86.280  -35.723 1.00 97.13  ? 230 SER C OG  1 
ATOM   7141  N N   . LEU C 1 230 ? 31.824  -84.906  -38.189 1.00 98.54  ? 231 LEU C N   1 
ATOM   7142  C CA  . LEU C 1 230 ? 32.342  -84.314  -39.433 1.00 100.02 ? 231 LEU C CA  1 
ATOM   7143  C C   . LEU C 1 230 ? 32.499  -82.777  -39.382 1.00 99.46  ? 231 LEU C C   1 
ATOM   7144  O O   . LEU C 1 230 ? 33.650  -82.340  -39.456 1.00 100.88 ? 231 LEU C O   1 
ATOM   7145  C CB  . LEU C 1 230 ? 31.481  -84.735  -40.634 1.00 100.62 ? 231 LEU C CB  1 
ATOM   7146  N N   . ALA C 1 231 ? 31.475  -81.913  -39.244 1.00 96.11  ? 232 ALA C N   1 
ATOM   7147  C CA  . ALA C 1 231 ? 29.998  -82.027  -39.306 1.00 92.62  ? 232 ALA C CA  1 
ATOM   7148  C C   . ALA C 1 231 ? 29.553  -80.682  -38.775 1.00 88.60  ? 232 ALA C C   1 
ATOM   7149  O O   . ALA C 1 231 ? 29.052  -79.828  -39.508 1.00 88.62  ? 232 ALA C O   1 
ATOM   7150  C CB  . ALA C 1 231 ? 29.405  -83.131  -38.464 1.00 91.59  ? 232 ALA C CB  1 
ATOM   7151  N N   . SER C 1 232 ? 29.768  -80.521  -37.472 1.00 84.26  ? 233 SER C N   1 
ATOM   7152  C CA  . SER C 1 232 ? 29.803  -79.219  -36.829 1.00 80.05  ? 233 SER C CA  1 
ATOM   7153  C C   . SER C 1 232 ? 30.808  -78.313  -37.540 1.00 77.96  ? 233 SER C C   1 
ATOM   7154  O O   . SER C 1 232 ? 30.612  -77.105  -37.638 1.00 78.20  ? 233 SER C O   1 
ATOM   7155  C CB  . SER C 1 232 ? 30.167  -79.377  -35.346 1.00 79.07  ? 233 SER C CB  1 
ATOM   7156  O OG  . SER C 1 232 ? 30.993  -78.316  -34.902 1.00 79.68  ? 233 SER C OG  1 
ATOM   7157  N N   . SER C 1 233 ? 31.885  -78.912  -38.039 1.00 75.21  ? 234 SER C N   1 
ATOM   7158  C CA  . SER C 1 233 ? 32.969  -78.171  -38.674 1.00 72.58  ? 234 SER C CA  1 
ATOM   7159  C C   . SER C 1 233 ? 32.848  -78.060  -40.196 1.00 69.85  ? 234 SER C C   1 
ATOM   7160  O O   . SER C 1 233 ? 33.435  -77.162  -40.794 1.00 71.76  ? 234 SER C O   1 
ATOM   7161  C CB  . SER C 1 233 ? 34.311  -78.818  -38.319 1.00 73.46  ? 234 SER C CB  1 
ATOM   7162  O OG  . SER C 1 233 ? 34.404  -80.124  -38.866 1.00 73.92  ? 234 SER C OG  1 
ATOM   7163  N N   . GLU C 1 234 ? 32.094  -78.959  -40.822 1.00 65.05  ? 235 GLU C N   1 
ATOM   7164  C CA  . GLU C 1 234 ? 31.982  -78.962  -42.282 1.00 62.70  ? 235 GLU C CA  1 
ATOM   7165  C C   . GLU C 1 234 ? 30.968  -77.941  -42.805 1.00 58.22  ? 235 GLU C C   1 
ATOM   7166  O O   . GLU C 1 234 ? 31.151  -77.387  -43.889 1.00 59.61  ? 235 GLU C O   1 
ATOM   7167  C CB  . GLU C 1 234 ? 31.617  -80.358  -42.791 1.00 62.87  ? 235 GLU C CB  1 
ATOM   7168  C CG  . GLU C 1 234 ? 32.810  -81.267  -43.007 1.00 65.21  ? 235 GLU C CG  1 
ATOM   7169  C CD  . GLU C 1 234 ? 33.811  -80.687  -43.986 1.00 68.21  ? 235 GLU C CD  1 
ATOM   7170  O OE1 . GLU C 1 234 ? 33.496  -80.618  -45.192 1.00 70.32  ? 235 GLU C OE1 1 
ATOM   7171  O OE2 . GLU C 1 234 ? 34.917  -80.302  -43.553 1.00 68.95  ? 235 GLU C OE2 1 
ATOM   7172  N N   . TYR C 1 235 ? 29.904  -77.705  -42.040 1.00 52.96  ? 236 TYR C N   1 
ATOM   7173  C CA  . TYR C 1 235 ? 28.896  -76.702  -42.395 1.00 50.37  ? 236 TYR C CA  1 
ATOM   7174  C C   . TYR C 1 235 ? 29.525  -75.327  -42.680 1.00 50.99  ? 236 TYR C C   1 
ATOM   7175  O O   . TYR C 1 235 ? 29.209  -74.715  -43.698 1.00 51.32  ? 236 TYR C O   1 
ATOM   7176  C CB  . TYR C 1 235 ? 27.830  -76.590  -41.288 1.00 47.13  ? 236 TYR C CB  1 
ATOM   7177  C CG  . TYR C 1 235 ? 26.672  -75.656  -41.603 1.00 45.44  ? 236 TYR C CG  1 
ATOM   7178  C CD1 . TYR C 1 235 ? 26.786  -74.280  -41.420 1.00 43.84  ? 236 TYR C CD1 1 
ATOM   7179  C CD2 . TYR C 1 235 ? 25.457  -76.154  -42.055 1.00 40.41  ? 236 TYR C CD2 1 
ATOM   7180  C CE1 . TYR C 1 235 ? 25.731  -73.429  -41.699 1.00 43.31  ? 236 TYR C CE1 1 
ATOM   7181  C CE2 . TYR C 1 235 ? 24.394  -75.308  -42.336 1.00 42.09  ? 236 TYR C CE2 1 
ATOM   7182  C CZ  . TYR C 1 235 ? 24.536  -73.947  -42.159 1.00 42.26  ? 236 TYR C CZ  1 
ATOM   7183  O OH  . TYR C 1 235 ? 23.481  -73.101  -42.442 1.00 39.10  ? 236 TYR C OH  1 
ATOM   7184  N N   . PRO C 1 236 ? 30.417  -74.833  -41.794 1.00 52.18  ? 237 PRO C N   1 
ATOM   7185  C CA  . PRO C 1 236 ? 31.033  -73.544  -42.136 1.00 53.80  ? 237 PRO C CA  1 
ATOM   7186  C C   . PRO C 1 236 ? 31.910  -73.615  -43.382 1.00 56.49  ? 237 PRO C C   1 
ATOM   7187  O O   . PRO C 1 236 ? 32.012  -72.626  -44.105 1.00 58.06  ? 237 PRO C O   1 
ATOM   7188  C CB  . PRO C 1 236 ? 31.888  -73.220  -40.905 1.00 53.04  ? 237 PRO C CB  1 
ATOM   7189  C CG  . PRO C 1 236 ? 31.312  -74.031  -39.812 1.00 51.61  ? 237 PRO C CG  1 
ATOM   7190  C CD  . PRO C 1 236 ? 30.832  -75.287  -40.455 1.00 51.23  ? 237 PRO C CD  1 
ATOM   7191  N N   . VAL C 1 237 ? 32.539  -74.763  -43.619 1.00 57.60  ? 238 VAL C N   1 
ATOM   7192  C CA  . VAL C 1 237 ? 33.416  -74.926  -44.774 1.00 60.04  ? 238 VAL C CA  1 
ATOM   7193  C C   . VAL C 1 237 ? 32.626  -74.753  -46.063 1.00 60.36  ? 238 VAL C C   1 
ATOM   7194  O O   . VAL C 1 237 ? 33.103  -74.140  -47.015 1.00 62.13  ? 238 VAL C O   1 
ATOM   7195  C CB  . VAL C 1 237 ? 34.110  -76.301  -44.781 1.00 61.32  ? 238 VAL C CB  1 
ATOM   7196  N N   . ARG C 1 238 ? 31.409  -75.285  -46.078 1.00 58.63  ? 239 ARG C N   1 
ATOM   7197  C CA  . ARG C 1 238 ? 30.532  -75.141  -47.233 1.00 58.78  ? 239 ARG C CA  1 
ATOM   7198  C C   . ARG C 1 238 ? 30.159  -73.681  -47.480 1.00 58.99  ? 239 ARG C C   1 
ATOM   7199  O O   . ARG C 1 238 ? 30.107  -73.235  -48.630 1.00 59.58  ? 239 ARG C O   1 
ATOM   7200  C CB  . ARG C 1 238 ? 29.265  -75.979  -47.055 1.00 56.08  ? 239 ARG C CB  1 
ATOM   7201  C CG  . ARG C 1 238 ? 29.509  -77.476  -47.038 1.00 55.73  ? 239 ARG C CG  1 
ATOM   7202  C CD  . ARG C 1 238 ? 30.113  -77.962  -48.349 1.00 57.72  ? 239 ARG C CD  1 
ATOM   7203  N NE  . ARG C 1 238 ? 30.351  -79.401  -48.314 1.00 58.34  ? 239 ARG C NE  1 
ATOM   7204  C CZ  . ARG C 1 238 ? 31.442  -79.962  -47.801 1.00 59.72  ? 239 ARG C CZ  1 
ATOM   7205  N NH1 . ARG C 1 238 ? 32.400  -79.204  -47.286 1.00 60.25  ? 239 ARG C NH1 1 
ATOM   7206  N NH2 . ARG C 1 238 ? 31.575  -81.280  -47.801 1.00 60.76  ? 239 ARG C NH2 1 
ATOM   7207  N N   . ARG C 1 239 ? 29.898  -72.939  -46.406 1.00 57.85  ? 240 ARG C N   1 
ATOM   7208  C CA  . ARG C 1 239 ? 29.527  -71.533  -46.534 1.00 59.29  ? 240 ARG C CA  1 
ATOM   7209  C C   . ARG C 1 239 ? 30.645  -70.712  -47.163 1.00 62.99  ? 240 ARG C C   1 
ATOM   7210  O O   . ARG C 1 239 ? 30.405  -69.921  -48.079 1.00 63.94  ? 240 ARG C O   1 
ATOM   7211  C CB  . ARG C 1 239 ? 29.158  -70.935  -45.176 1.00 56.58  ? 240 ARG C CB  1 
ATOM   7212  C CG  . ARG C 1 239 ? 27.789  -71.339  -44.669 1.00 55.17  ? 240 ARG C CG  1 
ATOM   7213  C CD  . ARG C 1 239 ? 27.250  -70.327  -43.663 1.00 53.53  ? 240 ARG C CD  1 
ATOM   7214  N NE  . ARG C 1 239 ? 27.199  -68.980  -44.226 1.00 53.60  ? 240 ARG C NE  1 
ATOM   7215  C CZ  . ARG C 1 239 ? 26.438  -67.998  -43.752 1.00 51.40  ? 240 ARG C CZ  1 
ATOM   7216  N NH1 . ARG C 1 239 ? 25.654  -68.210  -42.702 1.00 48.58  ? 240 ARG C NH1 1 
ATOM   7217  N NH2 . ARG C 1 239 ? 26.457  -66.805  -44.331 1.00 52.38  ? 240 ARG C NH2 1 
ATOM   7218  N N   . ARG C 1 240 ? 31.863  -70.909  -46.669 1.00 64.52  ? 241 ARG C N   1 
ATOM   7219  C CA  . ARG C 1 240 ? 33.017  -70.143  -47.124 1.00 68.69  ? 241 ARG C CA  1 
ATOM   7220  C C   . ARG C 1 240 ? 33.293  -70.341  -48.614 1.00 73.11  ? 241 ARG C C   1 
ATOM   7221  O O   . ARG C 1 240 ? 33.699  -69.404  -49.310 1.00 75.93  ? 241 ARG C O   1 
ATOM   7222  C CB  . ARG C 1 240 ? 34.254  -70.523  -46.308 1.00 69.53  ? 241 ARG C CB  1 
ATOM   7223  N N   . GLN C 1 241 ? 33.064  -71.558  -49.102 1.00 73.34  ? 242 GLN C N   1 
ATOM   7224  C CA  . GLN C 1 241 ? 33.285  -71.872  -50.511 1.00 75.41  ? 242 GLN C CA  1 
ATOM   7225  C C   . GLN C 1 241 ? 32.368  -71.031  -51.400 1.00 75.81  ? 242 GLN C C   1 
ATOM   7226  O O   . GLN C 1 241 ? 32.795  -70.511  -52.429 1.00 78.84  ? 242 GLN C O   1 
ATOM   7227  C CB  . GLN C 1 241 ? 33.058  -73.363  -50.777 1.00 75.55  ? 242 GLN C CB  1 
ATOM   7228  C CG  . GLN C 1 241 ? 34.012  -74.311  -50.062 1.00 76.87  ? 242 GLN C CG  1 
ATOM   7229  C CD  . GLN C 1 241 ? 33.782  -75.758  -50.459 1.00 77.83  ? 242 GLN C CD  1 
ATOM   7230  O OE1 . GLN C 1 241 ? 33.475  -76.055  -51.614 1.00 80.61  ? 242 GLN C OE1 1 
ATOM   7231  N NE2 . GLN C 1 241 ? 33.908  -76.662  -49.499 1.00 75.67  ? 242 GLN C NE2 1 
ATOM   7232  N N   . CYS C 1 242 ? 31.111  -70.892  -50.982 1.00 73.10  ? 243 CYS C N   1 
ATOM   7233  C CA  . CYS C 1 242 ? 30.122  -70.100  -51.712 1.00 73.65  ? 243 CYS C CA  1 
ATOM   7234  C C   . CYS C 1 242 ? 30.538  -68.637  -51.813 1.00 75.26  ? 243 CYS C C   1 
ATOM   7235  O O   . CYS C 1 242 ? 30.446  -68.024  -52.883 1.00 77.74  ? 243 CYS C O   1 
ATOM   7236  C CB  . CYS C 1 242 ? 28.757  -70.185  -51.037 1.00 71.58  ? 243 CYS C CB  1 
ATOM   7237  S SG  . CYS C 1 242 ? 28.117  -71.850  -50.894 1.00 56.62  ? 243 CYS C SG  1 
ATOM   7238  N N   . GLU C 1 243 ? 30.985  -68.080  -50.689 1.00 74.66  ? 244 GLU C N   1 
ATOM   7239  C CA  . GLU C 1 243 ? 31.407  -66.686  -50.621 1.00 75.66  ? 244 GLU C CA  1 
ATOM   7240  C C   . GLU C 1 243 ? 32.536  -66.434  -51.607 1.00 79.47  ? 244 GLU C C   1 
ATOM   7241  O O   . GLU C 1 243 ? 32.601  -65.383  -52.243 1.00 80.89  ? 244 GLU C O   1 
ATOM   7242  C CB  . GLU C 1 243 ? 31.845  -66.328  -49.199 1.00 73.60  ? 244 GLU C CB  1 
ATOM   7243  N N   . GLU C 1 244 ? 33.415  -67.423  -51.740 1.00 81.52  ? 245 GLU C N   1 
ATOM   7244  C CA  . GLU C 1 244 ? 34.557  -67.325  -52.637 1.00 84.67  ? 245 GLU C CA  1 
ATOM   7245  C C   . GLU C 1 244 ? 34.137  -67.454  -54.097 1.00 86.45  ? 245 GLU C C   1 
ATOM   7246  O O   . GLU C 1 244 ? 34.641  -66.733  -54.961 1.00 88.46  ? 245 GLU C O   1 
ATOM   7247  C CB  . GLU C 1 244 ? 35.596  -68.392  -52.290 1.00 85.17  ? 245 GLU C CB  1 
ATOM   7248  N N   . VAL C 1 245 ? 33.218  -68.374  -54.374 1.00 85.22  ? 246 VAL C N   1 
ATOM   7249  C CA  . VAL C 1 245 ? 32.723  -68.555  -55.734 1.00 85.70  ? 246 VAL C CA  1 
ATOM   7250  C C   . VAL C 1 245 ? 32.023  -67.294  -56.221 1.00 86.33  ? 246 VAL C C   1 
ATOM   7251  O O   . VAL C 1 245 ? 32.315  -66.795  -57.309 1.00 89.48  ? 246 VAL C O   1 
ATOM   7252  C CB  . VAL C 1 245 ? 31.756  -69.744  -55.833 1.00 83.33  ? 246 VAL C CB  1 
ATOM   7253  C CG1 . VAL C 1 245 ? 31.105  -69.791  -57.211 1.00 84.72  ? 246 VAL C CG1 1 
ATOM   7254  C CG2 . VAL C 1 245 ? 32.493  -71.027  -55.551 1.00 83.07  ? 246 VAL C CG2 1 
ATOM   7255  N N   . ALA C 1 246 ? 31.109  -66.780  -55.405 1.00 83.80  ? 247 ALA C N   1 
ATOM   7256  C CA  . ALA C 1 246 ? 30.367  -65.571  -55.739 1.00 84.08  ? 247 ALA C CA  1 
ATOM   7257  C C   . ALA C 1 246 ? 31.302  -64.385  -55.956 1.00 86.89  ? 247 ALA C C   1 
ATOM   7258  O O   . ALA C 1 246 ? 31.058  -63.541  -56.821 1.00 88.06  ? 247 ALA C O   1 
ATOM   7259  C CB  . ALA C 1 246 ? 29.355  -65.255  -54.649 1.00 80.88  ? 247 ALA C CB  1 
ATOM   7260  N N   . ARG C 1 247 ? 32.376  -64.330  -55.174 1.00 88.03  ? 248 ARG C N   1 
ATOM   7261  C CA  . ARG C 1 247 ? 33.347  -63.247  -55.280 1.00 90.92  ? 248 ARG C CA  1 
ATOM   7262  C C   . ARG C 1 247 ? 34.125  -63.333  -56.587 1.00 95.45  ? 248 ARG C C   1 
ATOM   7263  O O   . ARG C 1 247 ? 34.557  -62.317  -57.131 1.00 97.80  ? 248 ARG C O   1 
ATOM   7264  C CB  . ARG C 1 247 ? 34.311  -63.271  -54.093 1.00 90.64  ? 248 ARG C CB  1 
ATOM   7265  N N   . ALA C 1 248 ? 34.296  -64.550  -57.090 1.00 96.64  ? 249 ALA C N   1 
ATOM   7266  C CA  . ALA C 1 248 ? 35.045  -64.772  -58.320 1.00 99.76  ? 249 ALA C CA  1 
ATOM   7267  C C   . ALA C 1 248 ? 34.186  -64.522  -59.555 1.00 100.59 ? 249 ALA C C   1 
ATOM   7268  O O   . ALA C 1 248 ? 34.706  -64.369  -60.661 1.00 103.37 ? 249 ALA C O   1 
ATOM   7269  C CB  . ALA C 1 248 ? 35.608  -66.186  -58.348 1.00 100.36 ? 249 ALA C CB  1 
ATOM   7270  N N   . LEU C 1 249 ? 32.871  -64.477  -59.363 1.00 97.60  ? 250 LEU C N   1 
ATOM   7271  C CA  . LEU C 1 249 ? 31.948  -64.324  -60.483 1.00 97.42  ? 250 LEU C CA  1 
ATOM   7272  C C   . LEU C 1 249 ? 31.337  -62.926  -60.542 1.00 96.34  ? 250 LEU C C   1 
ATOM   7273  O O   . LEU C 1 249 ? 30.527  -62.630  -61.422 1.00 96.16  ? 250 LEU C O   1 
ATOM   7274  C CB  . LEU C 1 249 ? 30.840  -65.379  -60.409 1.00 95.34  ? 250 LEU C CB  1 
ATOM   7275  C CG  . LEU C 1 249 ? 31.120  -66.732  -61.075 1.00 96.36  ? 250 LEU C CG  1 
ATOM   7276  C CD1 . LEU C 1 249 ? 32.303  -67.448  -60.442 1.00 97.14  ? 250 LEU C CD1 1 
ATOM   7277  C CD2 . LEU C 1 249 ? 29.882  -67.616  -61.037 1.00 94.09  ? 250 LEU C CD2 1 
ATOM   7278  N N   . GLY C 1 250 ? 31.732  -62.069  -59.607 1.00 95.60  ? 251 GLY C N   1 
ATOM   7279  C CA  . GLY C 1 250 ? 31.246  -60.702  -59.574 1.00 95.90  ? 251 GLY C CA  1 
ATOM   7280  C C   . GLY C 1 250 ? 29.877  -60.579  -58.935 1.00 93.81  ? 251 GLY C C   1 
ATOM   7281  O O   . GLY C 1 250 ? 29.341  -59.479  -58.800 1.00 93.97  ? 251 GLY C O   1 
ATOM   7282  N N   . ALA C 1 251 ? 29.309  -61.715  -58.541 1.00 91.64  ? 252 ALA C N   1 
ATOM   7283  C CA  . ALA C 1 251 ? 28.009  -61.733  -57.886 1.00 88.12  ? 252 ALA C CA  1 
ATOM   7284  C C   . ALA C 1 251 ? 28.156  -61.434  -56.400 1.00 85.46  ? 252 ALA C C   1 
ATOM   7285  O O   . ALA C 1 251 ? 29.233  -61.599  -55.829 1.00 86.44  ? 252 ALA C O   1 
ATOM   7286  C CB  . ALA C 1 251 ? 27.327  -63.077  -58.095 1.00 86.86  ? 252 ALA C CB  1 
ATOM   7287  N N   . ALA C 1 252 ? 27.072  -60.983  -55.779 1.00 81.84  ? 253 ALA C N   1 
ATOM   7288  C CA  . ALA C 1 252 ? 27.068  -60.739  -54.342 1.00 78.34  ? 253 ALA C CA  1 
ATOM   7289  C C   . ALA C 1 252 ? 26.522  -61.964  -53.621 1.00 75.29  ? 253 ALA C C   1 
ATOM   7290  O O   . ALA C 1 252 ? 26.611  -62.076  -52.396 1.00 73.76  ? 253 ALA C O   1 
ATOM   7291  C CB  . ALA C 1 252 ? 26.246  -59.505  -54.008 1.00 77.12  ? 253 ALA C CB  1 
ATOM   7292  N N   . SER C 1 253 ? 25.964  -62.881  -54.406 1.00 74.25  ? 254 SER C N   1 
ATOM   7293  C CA  . SER C 1 253 ? 25.352  -64.099  -53.892 1.00 71.54  ? 254 SER C CA  1 
ATOM   7294  C C   . SER C 1 253 ? 25.145  -65.097  -55.026 1.00 69.28  ? 254 SER C C   1 
ATOM   7295  O O   . SER C 1 253 ? 25.180  -64.725  -56.199 1.00 71.43  ? 254 SER C O   1 
ATOM   7296  C CB  . SER C 1 253 ? 24.020  -63.790  -53.211 1.00 71.52  ? 254 SER C CB  1 
ATOM   7297  O OG  . SER C 1 253 ? 23.120  -64.874  -53.352 1.00 72.07  ? 254 SER C OG  1 
ATOM   7298  N N   . LEU C 1 254 ? 24.919  -66.360  -54.675 1.00 65.00  ? 255 LEU C N   1 
ATOM   7299  C CA  . LEU C 1 254 ? 24.811  -67.418  -55.675 1.00 63.57  ? 255 LEU C CA  1 
ATOM   7300  C C   . LEU C 1 254 ? 23.448  -67.466  -56.353 1.00 63.46  ? 255 LEU C C   1 
ATOM   7301  O O   . LEU C 1 254 ? 23.348  -67.920  -57.493 1.00 65.41  ? 255 LEU C O   1 
ATOM   7302  C CB  . LEU C 1 254 ? 25.120  -68.781  -55.054 1.00 61.41  ? 255 LEU C CB  1 
ATOM   7303  C CG  . LEU C 1 254 ? 26.571  -69.252  -55.151 1.00 62.14  ? 255 LEU C CG  1 
ATOM   7304  C CD1 . LEU C 1 254 ? 26.681  -70.716  -54.763 1.00 61.01  ? 255 LEU C CD1 1 
ATOM   7305  C CD2 . LEU C 1 254 ? 27.123  -69.025  -56.555 1.00 65.17  ? 255 LEU C CD2 1 
ATOM   7306  N N   . ARG C 1 255 ? 22.402  -67.001  -55.673 1.00 61.60  ? 256 ARG C N   1 
ATOM   7307  C CA  . ARG C 1 255 ? 21.084  -66.976  -56.302 1.00 61.73  ? 256 ARG C CA  1 
ATOM   7308  C C   . ARG C 1 255 ? 21.121  -66.107  -57.563 1.00 63.69  ? 256 ARG C C   1 
ATOM   7309  O O   . ARG C 1 255 ? 20.404  -66.375  -58.528 1.00 63.81  ? 256 ARG C O   1 
ATOM   7310  C CB  . ARG C 1 255 ? 20.006  -66.462  -55.348 1.00 59.53  ? 256 ARG C CB  1 
ATOM   7311  C CG  . ARG C 1 255 ? 18.616  -66.512  -55.968 1.00 61.10  ? 256 ARG C CG  1 
ATOM   7312  C CD  . ARG C 1 255 ? 17.622  -65.674  -55.220 1.00 61.65  ? 256 ARG C CD  1 
ATOM   7313  N NE  . ARG C 1 255 ? 16.265  -65.861  -55.724 1.00 62.79  ? 256 ARG C NE  1 
ATOM   7314  C CZ  . ARG C 1 255 ? 15.233  -66.197  -54.959 1.00 61.54  ? 256 ARG C CZ  1 
ATOM   7315  N NH1 . ARG C 1 255 ? 15.415  -66.398  -53.661 1.00 60.29  ? 256 ARG C NH1 1 
ATOM   7316  N NH2 . ARG C 1 255 ? 14.026  -66.345  -55.490 1.00 61.75  ? 256 ARG C NH2 1 
ATOM   7317  N N   . GLU C 1 256 ? 21.962  -65.074  -57.542 1.00 65.43  ? 257 GLU C N   1 
ATOM   7318  C CA  . GLU C 1 256 ? 22.207  -64.239  -58.718 1.00 69.25  ? 257 GLU C CA  1 
ATOM   7319  C C   . GLU C 1 256 ? 22.686  -65.104  -59.872 1.00 69.46  ? 257 GLU C C   1 
ATOM   7320  O O   . GLU C 1 256 ? 22.191  -65.005  -60.994 1.00 71.49  ? 257 GLU C O   1 
ATOM   7321  C CB  . GLU C 1 256 ? 23.253  -63.161  -58.419 1.00 72.95  ? 257 GLU C CB  1 
ATOM   7322  C CG  . GLU C 1 256 ? 22.888  -62.216  -57.290 1.00 73.80  ? 257 GLU C CG  1 
ATOM   7323  C CD  . GLU C 1 256 ? 21.680  -61.368  -57.611 1.00 74.72  ? 257 GLU C CD  1 
ATOM   7324  O OE1 . GLU C 1 256 ? 21.528  -60.973  -58.784 1.00 76.47  ? 257 GLU C OE1 1 
ATOM   7325  O OE2 . GLU C 1 256 ? 20.882  -61.102  -56.687 1.00 73.62  ? 257 GLU C OE2 1 
ATOM   7326  N N   . VAL C 1 257 ? 23.659  -65.956  -59.571 1.00 68.60  ? 258 VAL C N   1 
ATOM   7327  C CA  . VAL C 1 257 ? 24.271  -66.833  -60.557 1.00 70.12  ? 258 VAL C CA  1 
ATOM   7328  C C   . VAL C 1 257 ? 23.298  -67.891  -61.060 1.00 69.13  ? 258 VAL C C   1 
ATOM   7329  O O   . VAL C 1 257 ? 22.741  -68.662  -60.279 1.00 67.16  ? 258 VAL C O   1 
ATOM   7330  C CB  . VAL C 1 257 ? 25.514  -67.533  -59.982 1.00 70.37  ? 258 VAL C CB  1 
ATOM   7331  C CG1 . VAL C 1 257 ? 26.058  -68.546  -60.974 1.00 72.72  ? 258 VAL C CG1 1 
ATOM   7332  C CG2 . VAL C 1 257 ? 26.576  -66.507  -59.612 1.00 70.93  ? 258 VAL C CG2 1 
ATOM   7333  N N   . GLN C 1 258 ? 23.101  -67.913  -62.373 1.00 70.81  ? 259 GLN C N   1 
ATOM   7334  C CA  . GLN C 1 258 ? 22.277  -68.925  -63.018 1.00 70.92  ? 259 GLN C CA  1 
ATOM   7335  C C   . GLN C 1 258 ? 23.109  -70.154  -63.362 1.00 72.36  ? 259 GLN C C   1 
ATOM   7336  O O   . GLN C 1 258 ? 24.323  -70.059  -63.546 1.00 74.54  ? 259 GLN C O   1 
ATOM   7337  C CB  . GLN C 1 258 ? 21.625  -68.360  -64.284 1.00 71.85  ? 259 GLN C CB  1 
ATOM   7338  N N   . LEU C 1 259 ? 22.443  -71.301  -63.448 1.00 71.67  ? 260 LEU C N   1 
ATOM   7339  C CA  . LEU C 1 259 ? 23.078  -72.563  -63.817 1.00 72.82  ? 260 LEU C CA  1 
ATOM   7340  C C   . LEU C 1 259 ? 23.927  -72.416  -65.083 1.00 78.64  ? 260 LEU C C   1 
ATOM   7341  O O   . LEU C 1 259 ? 25.100  -72.801  -65.105 1.00 79.78  ? 260 LEU C O   1 
ATOM   7342  C CB  . LEU C 1 259 ? 22.006  -73.639  -64.017 1.00 71.19  ? 260 LEU C CB  1 
ATOM   7343  C CG  . LEU C 1 259 ? 22.307  -75.132  -63.846 1.00 71.77  ? 260 LEU C CG  1 
ATOM   7344  C CD1 . LEU C 1 259 ? 21.030  -75.928  -64.064 1.00 71.51  ? 260 LEU C CD1 1 
ATOM   7345  C CD2 . LEU C 1 259 ? 23.404  -75.638  -64.772 1.00 74.90  ? 260 LEU C CD2 1 
ATOM   7346  N N   . GLU C 1 260 ? 23.322  -71.858  -66.130 1.00 81.02  ? 261 GLU C N   1 
ATOM   7347  C CA  . GLU C 1 260 ? 23.994  -71.670  -67.412 1.00 84.73  ? 261 GLU C CA  1 
ATOM   7348  C C   . GLU C 1 260 ? 25.205  -70.749  -67.290 1.00 86.49  ? 261 GLU C C   1 
ATOM   7349  O O   . GLU C 1 260 ? 26.225  -70.959  -67.949 1.00 88.29  ? 261 GLU C O   1 
ATOM   7350  C CB  . GLU C 1 260 ? 23.015  -71.109  -68.447 1.00 85.84  ? 261 GLU C CB  1 
ATOM   7351  N N   . GLU C 1 261 ? 25.085  -69.731  -66.443 1.00 86.41  ? 262 GLU C N   1 
ATOM   7352  C CA  . GLU C 1 261 ? 26.170  -68.785  -66.208 1.00 88.69  ? 262 GLU C CA  1 
ATOM   7353  C C   . GLU C 1 261 ? 27.403  -69.473  -65.627 1.00 89.99  ? 262 GLU C C   1 
ATOM   7354  O O   . GLU C 1 261 ? 28.535  -69.137  -65.977 1.00 91.63  ? 262 GLU C O   1 
ATOM   7355  C CB  . GLU C 1 261 ? 25.708  -67.666  -65.269 1.00 86.79  ? 262 GLU C CB  1 
ATOM   7356  N N   . LEU C 1 262 ? 27.173  -70.442  -64.747 1.00 89.55  ? 263 LEU C N   1 
ATOM   7357  C CA  . LEU C 1 262 ? 28.258  -71.129  -64.052 1.00 90.85  ? 263 LEU C CA  1 
ATOM   7358  C C   . LEU C 1 262 ? 29.011  -72.089  -64.966 1.00 94.07  ? 263 LEU C C   1 
ATOM   7359  O O   . LEU C 1 262 ? 30.214  -72.296  -64.802 1.00 95.06  ? 263 LEU C O   1 
ATOM   7360  C CB  . LEU C 1 262 ? 27.716  -71.889  -62.839 1.00 88.15  ? 263 LEU C CB  1 
ATOM   7361  N N   . GLU C 1 263 ? 28.296  -72.677  -65.921 1.00 95.82  ? 264 GLU C N   1 
ATOM   7362  C CA  . GLU C 1 263 ? 28.896  -73.623  -66.857 1.00 99.49  ? 264 GLU C CA  1 
ATOM   7363  C C   . GLU C 1 263 ? 29.942  -72.941  -67.730 1.00 103.37 ? 264 GLU C C   1 
ATOM   7364  O O   . GLU C 1 263 ? 31.079  -73.401  -67.828 1.00 104.72 ? 264 GLU C O   1 
ATOM   7365  C CB  . GLU C 1 263 ? 27.820  -74.268  -67.733 1.00 99.74  ? 264 GLU C CB  1 
ATOM   7366  N N   . ALA C 1 264 ? 29.549  -71.834  -68.354 1.00 105.56 ? 265 ALA C N   1 
ATOM   7367  C CA  . ALA C 1 264 ? 30.442  -71.079  -69.226 1.00 109.84 ? 265 ALA C CA  1 
ATOM   7368  C C   . ALA C 1 264 ? 31.320  -70.111  -68.434 1.00 110.56 ? 265 ALA C C   1 
ATOM   7369  O O   . ALA C 1 264 ? 31.696  -69.049  -68.933 1.00 112.25 ? 265 ALA C O   1 
ATOM   7370  C CB  . ALA C 1 264 ? 29.640  -70.326  -70.275 1.00 110.98 ? 265 ALA C CB  1 
ATOM   7371  N N   . ALA C 1 265 ? 31.636  -70.484  -67.198 1.00 109.28 ? 266 ALA C N   1 
ATOM   7372  C CA  . ALA C 1 265 ? 32.521  -69.696  -66.347 1.00 109.40 ? 266 ALA C CA  1 
ATOM   7373  C C   . ALA C 1 265 ? 33.256  -70.615  -65.379 1.00 109.05 ? 266 ALA C C   1 
ATOM   7374  O O   . ALA C 1 265 ? 33.848  -70.163  -64.398 1.00 107.55 ? 266 ALA C O   1 
ATOM   7375  C CB  . ALA C 1 265 ? 31.737  -68.637  -65.593 1.00 106.81 ? 266 ALA C CB  1 
ATOM   7376  N N   . ARG C 1 266 ? 33.212  -71.909  -65.676 1.00 111.08 ? 267 ARG C N   1 
ATOM   7377  C CA  . ARG C 1 266 ? 33.809  -72.941  -64.834 1.00 111.98 ? 267 ARG C CA  1 
ATOM   7378  C C   . ARG C 1 266 ? 35.301  -72.727  -64.571 1.00 115.30 ? 267 ARG C C   1 
ATOM   7379  O O   . ARG C 1 266 ? 35.782  -72.959  -63.461 1.00 114.07 ? 267 ARG C O   1 
ATOM   7380  C CB  . ARG C 1 266 ? 33.587  -74.315  -65.472 1.00 113.01 ? 267 ARG C CB  1 
ATOM   7381  C CG  . ARG C 1 266 ? 34.493  -75.417  -64.947 1.00 112.98 ? 267 ARG C CG  1 
ATOM   7382  C CD  . ARG C 1 266 ? 33.884  -76.785  -65.196 1.00 112.13 ? 267 ARG C CD  1 
ATOM   7383  N NE  . ARG C 1 266 ? 32.901  -76.755  -66.275 1.00 112.37 ? 267 ARG C NE  1 
ATOM   7384  C CZ  . ARG C 1 266 ? 32.067  -77.751  -66.553 1.00 111.83 ? 267 ARG C CZ  1 
ATOM   7385  N NH1 . ARG C 1 266 ? 32.099  -78.863  -65.831 1.00 110.75 ? 267 ARG C NH1 1 
ATOM   7386  N NH2 . ARG C 1 266 ? 31.202  -77.638  -67.554 1.00 112.47 ? 267 ARG C NH2 1 
ATOM   7387  N N   . ASP C 1 267 ? 36.025  -72.264  -65.584 1.00 119.76 ? 268 ASP C N   1 
ATOM   7388  C CA  . ASP C 1 267 ? 37.472  -72.101  -65.476 1.00 123.72 ? 268 ASP C CA  1 
ATOM   7389  C C   . ASP C 1 267 ? 37.876  -70.860  -64.677 1.00 124.73 ? 268 ASP C C   1 
ATOM   7390  O O   . ASP C 1 267 ? 39.043  -70.468  -64.679 1.00 127.92 ? 268 ASP C O   1 
ATOM   7391  C CB  . ASP C 1 267 ? 38.100  -72.044  -66.870 1.00 127.36 ? 268 ASP C CB  1 
ATOM   7392  N N   . LEU C 1 268 ? 36.913  -70.246  -63.996 1.00 122.37 ? 269 LEU C N   1 
ATOM   7393  C CA  . LEU C 1 268 ? 37.189  -69.066  -63.184 1.00 121.58 ? 269 LEU C CA  1 
ATOM   7394  C C   . LEU C 1 268 ? 37.277  -69.428  -61.704 1.00 119.32 ? 269 LEU C C   1 
ATOM   7395  O O   . LEU C 1 268 ? 37.776  -68.649  -60.891 1.00 118.40 ? 269 LEU C O   1 
ATOM   7396  C CB  . LEU C 1 268 ? 36.115  -68.000  -63.406 1.00 120.05 ? 269 LEU C CB  1 
ATOM   7397  N N   . VAL C 1 269 ? 36.789  -70.617  -61.363 1.00 118.35 ? 270 VAL C N   1 
ATOM   7398  C CA  . VAL C 1 269 ? 36.821  -71.099  -59.987 1.00 116.41 ? 270 VAL C CA  1 
ATOM   7399  C C   . VAL C 1 269 ? 37.416  -72.504  -59.918 1.00 117.24 ? 270 VAL C C   1 
ATOM   7400  O O   . VAL C 1 269 ? 37.745  -73.094  -60.947 1.00 119.49 ? 270 VAL C O   1 
ATOM   7401  C CB  . VAL C 1 269 ? 35.415  -71.106  -59.358 1.00 113.18 ? 270 VAL C CB  1 
ATOM   7402  N N   . SER C 1 270 ? 37.541  -73.036  -58.704 1.00 115.16 ? 271 SER C N   1 
ATOM   7403  C CA  . SER C 1 270 ? 38.191  -74.328  -58.477 1.00 115.76 ? 271 SER C CA  1 
ATOM   7404  C C   . SER C 1 270 ? 37.404  -75.508  -59.048 1.00 116.11 ? 271 SER C C   1 
ATOM   7405  O O   . SER C 1 270 ? 36.407  -75.324  -59.743 1.00 115.01 ? 271 SER C O   1 
ATOM   7406  C CB  . SER C 1 270 ? 38.420  -74.544  -56.978 1.00 112.89 ? 271 SER C CB  1 
ATOM   7407  N N   . LYS C 1 271 ? 37.867  -76.721  -58.754 1.00 102.54 ? 272 LYS C N   1 
ATOM   7408  C CA  . LYS C 1 271 ? 37.208  -77.934  -59.232 1.00 104.27 ? 272 LYS C CA  1 
ATOM   7409  C C   . LYS C 1 271 ? 36.055  -78.317  -58.314 1.00 101.74 ? 272 LYS C C   1 
ATOM   7410  O O   . LYS C 1 271 ? 35.132  -79.028  -58.719 1.00 103.30 ? 272 LYS C O   1 
ATOM   7411  C CB  . LYS C 1 271 ? 38.205  -79.089  -59.341 1.00 105.64 ? 272 LYS C CB  1 
ATOM   7412  N N   . GLU C 1 272 ? 36.095  -77.824  -57.080 1.00 97.51  ? 273 GLU C N   1 
ATOM   7413  C CA  . GLU C 1 272 ? 34.948  -77.947  -56.190 1.00 94.12  ? 273 GLU C CA  1 
ATOM   7414  C C   . GLU C 1 272 ? 33.935  -76.858  -56.543 1.00 91.33  ? 273 GLU C C   1 
ATOM   7415  O O   . GLU C 1 272 ? 33.164  -76.397  -55.705 1.00 87.73  ? 273 GLU C O   1 
ATOM   7416  C CB  . GLU C 1 272 ? 35.377  -77.879  -54.727 1.00 92.28  ? 273 GLU C CB  1 
ATOM   7417  C CG  . GLU C 1 272 ? 36.350  -78.991  -54.359 1.00 93.04  ? 273 GLU C CG  1 
ATOM   7418  C CD  . GLU C 1 272 ? 36.127  -79.545  -52.968 1.00 91.34  ? 273 GLU C CD  1 
ATOM   7419  O OE1 . GLU C 1 272 ? 36.279  -78.785  -51.988 1.00 89.43  ? 273 GLU C OE1 1 
ATOM   7420  O OE2 . GLU C 1 272 ? 35.800  -80.746  -52.855 1.00 92.02  ? 273 GLU C OE2 1 
ATOM   7421  N N   . PHE C 1 274 ? 33.968  -76.476  -57.822 1.00 92.49  ? 275 PHE C N   1 
ATOM   7422  C CA  . PHE C 1 274 ? 32.913  -75.761  -58.539 1.00 90.58  ? 275 PHE C CA  1 
ATOM   7423  C C   . PHE C 1 274 ? 31.612  -76.547  -58.436 1.00 87.07  ? 275 PHE C C   1 
ATOM   7424  O O   . PHE C 1 274 ? 30.525  -76.047  -58.736 1.00 85.07  ? 275 PHE C O   1 
ATOM   7425  C CB  . PHE C 1 274 ? 33.354  -75.558  -59.998 1.00 94.09  ? 275 PHE C CB  1 
ATOM   7426  C CG  . PHE C 1 274 ? 32.232  -75.481  -60.995 1.00 96.60  ? 275 PHE C CG  1 
ATOM   7427  C CD1 . PHE C 1 274 ? 31.634  -74.269  -61.289 1.00 97.77  ? 275 PHE C CD1 1 
ATOM   7428  C CD2 . PHE C 1 274 ? 31.814  -76.615  -61.680 1.00 98.03  ? 275 PHE C CD2 1 
ATOM   7429  C CE1 . PHE C 1 274 ? 30.616  -74.192  -62.219 1.00 99.94  ? 275 PHE C CE1 1 
ATOM   7430  C CE2 . PHE C 1 274 ? 30.799  -76.545  -62.610 1.00 100.39 ? 275 PHE C CE2 1 
ATOM   7431  C CZ  . PHE C 1 274 ? 30.200  -75.332  -62.881 1.00 101.31 ? 275 PHE C CZ  1 
ATOM   7432  N N   . ARG C 1 275 ? 31.761  -77.802  -58.029 1.00 86.27  ? 276 ARG C N   1 
ATOM   7433  C CA  . ARG C 1 275 ? 30.673  -78.628  -57.540 1.00 84.89  ? 276 ARG C CA  1 
ATOM   7434  C C   . ARG C 1 275 ? 29.745  -77.874  -56.578 1.00 80.39  ? 276 ARG C C   1 
ATOM   7435  O O   . ARG C 1 275 ? 28.554  -77.755  -56.841 1.00 80.78  ? 276 ARG C O   1 
ATOM   7436  C CB  . ARG C 1 275 ? 31.244  -79.873  -56.851 1.00 84.99  ? 276 ARG C CB  1 
ATOM   7437  N N   . ARG C 1 276 ? 30.286  -77.367  -55.474 1.00 76.71  ? 277 ARG C N   1 
ATOM   7438  C CA  . ARG C 1 276 ? 29.460  -76.740  -54.437 1.00 73.04  ? 277 ARG C CA  1 
ATOM   7439  C C   . ARG C 1 276 ? 28.484  -75.699  -55.001 1.00 71.49  ? 277 ARG C C   1 
ATOM   7440  O O   . ARG C 1 276 ? 27.313  -75.668  -54.619 1.00 70.90  ? 277 ARG C O   1 
ATOM   7441  C CB  . ARG C 1 276 ? 30.344  -76.094  -53.366 1.00 70.83  ? 277 ARG C CB  1 
ATOM   7442  N N   . ALA C 1 277 ? 28.959  -74.871  -55.927 1.00 70.19  ? 278 ALA C N   1 
ATOM   7443  C CA  . ALA C 1 277 ? 28.111  -73.850  -56.537 1.00 69.38  ? 278 ALA C CA  1 
ATOM   7444  C C   . ALA C 1 277 ? 27.058  -74.472  -57.453 1.00 67.93  ? 278 ALA C C   1 
ATOM   7445  O O   . ALA C 1 277 ? 26.025  -73.863  -57.728 1.00 66.90  ? 278 ALA C O   1 
ATOM   7446  C CB  . ALA C 1 277 ? 28.955  -72.846  -57.311 1.00 71.68  ? 278 ALA C CB  1 
ATOM   7447  N N   . ARG C 1 278 ? 27.323  -75.688  -57.919 1.00 68.22  ? 279 ARG C N   1 
ATOM   7448  C CA  . ARG C 1 278 ? 26.382  -76.391  -58.783 1.00 69.99  ? 279 ARG C CA  1 
ATOM   7449  C C   . ARG C 1 278 ? 25.185  -76.887  -57.989 1.00 67.63  ? 279 ARG C C   1 
ATOM   7450  O O   . ARG C 1 278 ? 24.063  -76.892  -58.488 1.00 68.97  ? 279 ARG C O   1 
ATOM   7451  C CB  . ARG C 1 278 ? 27.061  -77.562  -59.495 1.00 73.52  ? 279 ARG C CB  1 
ATOM   7452  N N   . HIS C 1 279 ? 25.419  -77.310  -56.752 1.00 65.62  ? 280 HIS C N   1 
ATOM   7453  C CA  . HIS C 1 279 ? 24.312  -77.733  -55.909 1.00 62.42  ? 280 HIS C CA  1 
ATOM   7454  C C   . HIS C 1 279 ? 23.381  -76.569  -55.608 1.00 59.09  ? 280 HIS C C   1 
ATOM   7455  O O   . HIS C 1 279 ? 22.181  -76.666  -55.832 1.00 59.45  ? 280 HIS C O   1 
ATOM   7456  C CB  . HIS C 1 279 ? 24.790  -78.336  -54.590 1.00 60.54  ? 280 HIS C CB  1 
ATOM   7457  C CG  . HIS C 1 279 ? 23.695  -78.460  -53.578 1.00 58.97  ? 280 HIS C CG  1 
ATOM   7458  N ND1 . HIS C 1 279 ? 22.751  -79.463  -53.623 1.00 59.80  ? 280 HIS C ND1 1 
ATOM   7459  C CD2 . HIS C 1 279 ? 23.355  -77.670  -52.533 1.00 55.84  ? 280 HIS C CD2 1 
ATOM   7460  C CE1 . HIS C 1 279 ? 21.892  -79.301  -52.634 1.00 57.59  ? 280 HIS C CE1 1 
ATOM   7461  N NE2 . HIS C 1 279 ? 22.236  -78.220  -51.957 1.00 56.06  ? 280 HIS C NE2 1 
ATOM   7462  N N   . VAL C 1 280 ? 23.937  -75.471  -55.103 1.00 56.76  ? 281 VAL C N   1 
ATOM   7463  C CA  . VAL C 1 280 ? 23.124  -74.335  -54.677 1.00 56.74  ? 281 VAL C CA  1 
ATOM   7464  C C   . VAL C 1 280 ? 22.298  -73.757  -55.821 1.00 58.97  ? 281 VAL C C   1 
ATOM   7465  O O   . VAL C 1 280 ? 21.077  -73.647  -55.707 1.00 58.82  ? 281 VAL C O   1 
ATOM   7466  C CB  . VAL C 1 280 ? 23.988  -73.213  -54.073 1.00 56.94  ? 281 VAL C CB  1 
ATOM   7467  N N   . VAL C 1 281 ? 22.964  -73.398  -56.918 1.00 61.49  ? 282 VAL C N   1 
ATOM   7468  C CA  . VAL C 1 281 ? 22.284  -72.839  -58.084 1.00 63.02  ? 282 VAL C CA  1 
ATOM   7469  C C   . VAL C 1 281 ? 21.197  -73.784  -58.582 1.00 64.59  ? 282 VAL C C   1 
ATOM   7470  O O   . VAL C 1 281 ? 20.082  -73.359  -58.881 1.00 65.28  ? 282 VAL C O   1 
ATOM   7471  C CB  . VAL C 1 281 ? 23.268  -72.549  -59.234 1.00 65.76  ? 282 VAL C CB  1 
ATOM   7472  N N   . GLY C 1 282 ? 21.525  -75.069  -58.656 1.00 63.32  ? 283 GLY C N   1 
ATOM   7473  C CA  . GLY C 1 282 ? 20.559  -76.078  -59.046 1.00 68.80  ? 283 GLY C CA  1 
ATOM   7474  C C   . GLY C 1 282 ? 19.428  -76.205  -58.045 1.00 68.13  ? 283 GLY C C   1 
ATOM   7475  O O   . GLY C 1 282 ? 18.258  -76.157  -58.424 1.00 63.55  ? 283 GLY C O   1 
ATOM   7476  N N   . GLU C 1 283 ? 19.783  -76.347  -56.766 1.00 65.75  ? 284 GLU C N   1 
ATOM   7477  C CA  . GLU C 1 283 ? 18.812  -76.551  -55.691 1.00 59.10  ? 284 GLU C CA  1 
ATOM   7478  C C   . GLU C 1 283 ? 17.815  -75.407  -55.593 1.00 57.26  ? 284 GLU C C   1 
ATOM   7479  O O   . GLU C 1 283 ? 16.627  -75.630  -55.365 1.00 57.13  ? 284 GLU C O   1 
ATOM   7480  C CB  . GLU C 1 283 ? 19.529  -76.727  -54.346 1.00 58.08  ? 284 GLU C CB  1 
ATOM   7481  C CG  . GLU C 1 283 ? 18.617  -77.061  -53.170 1.00 57.69  ? 284 GLU C CG  1 
ATOM   7482  C CD  . GLU C 1 283 ? 18.219  -78.521  -53.128 1.00 55.68  ? 284 GLU C CD  1 
ATOM   7483  O OE1 . GLU C 1 283 ? 18.539  -79.256  -54.087 1.00 58.07  ? 284 GLU C OE1 1 
ATOM   7484  O OE2 . GLU C 1 283 ? 17.600  -78.938  -52.125 1.00 54.44  ? 284 GLU C OE2 1 
ATOM   7485  N N   . ILE C 1 284 ? 18.307  -74.183  -55.757 1.00 60.80  ? 285 ILE C N   1 
ATOM   7486  C CA  . ILE C 1 284 ? 17.446  -73.005  -55.787 1.00 59.18  ? 285 ILE C CA  1 
ATOM   7487  C C   . ILE C 1 284 ? 16.383  -73.145  -56.871 1.00 60.71  ? 285 ILE C C   1 
ATOM   7488  O O   . ILE C 1 284 ? 15.205  -72.883  -56.631 1.00 58.64  ? 285 ILE C O   1 
ATOM   7489  C CB  . ILE C 1 284 ? 18.260  -71.716  -56.021 1.00 59.54  ? 285 ILE C CB  1 
ATOM   7490  C CG1 . ILE C 1 284 ? 19.084  -71.388  -54.776 1.00 57.25  ? 285 ILE C CG1 1 
ATOM   7491  C CG2 . ILE C 1 284 ? 17.338  -70.545  -56.387 1.00 57.36  ? 285 ILE C CG2 1 
ATOM   7492  C CD1 . ILE C 1 284 ? 20.086  -70.280  -54.980 1.00 57.97  ? 285 ILE C CD1 1 
ATOM   7493  N N   . ARG C 1 285 ? 16.799  -73.575  -58.060 1.00 62.53  ? 286 ARG C N   1 
ATOM   7494  C CA  . ARG C 1 285 ? 15.862  -73.807  -59.154 1.00 65.05  ? 286 ARG C CA  1 
ATOM   7495  C C   . ARG C 1 285 ? 14.945  -74.996  -58.859 1.00 65.04  ? 286 ARG C C   1 
ATOM   7496  O O   . ARG C 1 285 ? 13.754  -74.958  -59.168 1.00 65.26  ? 286 ARG C O   1 
ATOM   7497  C CB  . ARG C 1 285 ? 16.612  -74.032  -60.470 1.00 67.24  ? 286 ARG C CB  1 
ATOM   7498  N N   . ARG C 1 286 ? 15.502  -76.042  -58.253 1.00 64.48  ? 287 ARG C N   1 
ATOM   7499  C CA  . ARG C 1 286 ? 14.727  -77.232  -57.905 1.00 65.50  ? 287 ARG C CA  1 
ATOM   7500  C C   . ARG C 1 286 ? 13.603  -76.908  -56.925 1.00 67.94  ? 287 ARG C C   1 
ATOM   7501  O O   . ARG C 1 286 ? 12.515  -77.486  -56.999 1.00 67.01  ? 287 ARG C O   1 
ATOM   7502  C CB  . ARG C 1 286 ? 15.629  -78.313  -57.306 1.00 64.33  ? 287 ARG C CB  1 
ATOM   7503  C CG  . ARG C 1 286 ? 16.675  -78.862  -58.253 1.00 66.93  ? 287 ARG C CG  1 
ATOM   7504  C CD  . ARG C 1 286 ? 17.349  -80.098  -57.682 1.00 68.72  ? 287 ARG C CD  1 
ATOM   7505  N NE  . ARG C 1 286 ? 18.450  -79.767  -56.784 1.00 68.25  ? 287 ARG C NE  1 
ATOM   7506  C CZ  . ARG C 1 286 ? 19.696  -79.547  -57.190 1.00 68.38  ? 287 ARG C CZ  1 
ATOM   7507  N NH1 . ARG C 1 286 ? 19.992  -79.617  -58.484 1.00 69.96  ? 287 ARG C NH1 1 
ATOM   7508  N NH2 . ARG C 1 286 ? 20.643  -79.250  -56.308 1.00 65.13  ? 287 ARG C NH2 1 
ATOM   7509  N N   . THR C 1 287 ? 13.872  -75.981  -56.011 1.00 59.09  ? 288 THR C N   1 
ATOM   7510  C CA  . THR C 1 287 ? 12.899  -75.600  -54.997 1.00 56.99  ? 288 THR C CA  1 
ATOM   7511  C C   . THR C 1 287 ? 11.778  -74.788  -55.622 1.00 76.08  ? 288 THR C C   1 
ATOM   7512  O O   . THR C 1 287 ? 10.601  -75.008  -55.328 1.00 57.87  ? 288 THR C O   1 
ATOM   7513  C CB  . THR C 1 287 ? 13.553  -74.788  -53.859 1.00 54.27  ? 288 THR C CB  1 
ATOM   7514  O OG1 . THR C 1 287 ? 14.685  -75.505  -53.353 1.00 53.67  ? 288 THR C OG1 1 
ATOM   7515  C CG2 . THR C 1 287 ? 12.558  -74.536  -52.730 1.00 52.03  ? 288 THR C CG2 1 
ATOM   7516  N N   . ALA C 1 288 ? 12.159  -73.857  -56.493 1.00 73.36  ? 289 ALA C N   1 
ATOM   7517  C CA  . ALA C 1 288 ? 11.198  -73.030  -57.215 1.00 71.39  ? 289 ALA C CA  1 
ATOM   7518  C C   . ALA C 1 288 ? 10.232  -73.890  -58.010 1.00 73.16  ? 289 ALA C C   1 
ATOM   7519  O O   . ALA C 1 288 ? 9.064   -73.544  -58.126 1.00 75.34  ? 289 ALA C O   1 
ATOM   7520  C CB  . ALA C 1 288 ? 11.910  -72.054  -58.134 1.00 61.83  ? 289 ALA C CB  1 
ATOM   7521  N N   . GLN C 1 289 ? 10.713  -75.013  -58.540 1.00 72.15  ? 290 GLN C N   1 
ATOM   7522  C CA  . GLN C 1 289 ? 9.863   -75.948  -59.275 1.00 71.13  ? 290 GLN C CA  1 
ATOM   7523  C C   . GLN C 1 289 ? 9.088   -76.876  -58.333 1.00 67.72  ? 290 GLN C C   1 
ATOM   7524  O O   . GLN C 1 289 ? 8.029   -77.387  -58.690 1.00 67.53  ? 290 GLN C O   1 
ATOM   7525  C CB  . GLN C 1 289 ? 10.702  -76.769  -60.267 1.00 71.43  ? 290 GLN C CB  1 
ATOM   7526  C CG  . GLN C 1 289 ? 11.386  -75.919  -61.336 1.00 72.56  ? 290 GLN C CG  1 
ATOM   7527  C CD  . GLN C 1 289 ? 12.083  -76.738  -62.408 1.00 76.22  ? 290 GLN C CD  1 
ATOM   7528  O OE1 . GLN C 1 289 ? 12.101  -77.969  -62.360 1.00 77.85  ? 290 GLN C OE1 1 
ATOM   7529  N NE2 . GLN C 1 289 ? 12.660  -76.052  -63.389 1.00 77.51  ? 290 GLN C NE2 1 
ATOM   7530  N N   . ALA C 1 290 ? 9.598   -77.057  -57.118 1.00 63.34  ? 291 ALA C N   1 
ATOM   7531  C CA  . ALA C 1 290 ? 8.956   -77.927  -56.131 1.00 65.72  ? 291 ALA C CA  1 
ATOM   7532  C C   . ALA C 1 290 ? 7.669   -77.326  -55.546 1.00 60.99  ? 291 ALA C C   1 
ATOM   7533  O O   . ALA C 1 290 ? 6.662   -78.021  -55.401 1.00 61.77  ? 291 ALA C O   1 
ATOM   7534  C CB  . ALA C 1 290 ? 9.939   -78.255  -55.012 1.00 64.81  ? 291 ALA C CB  1 
ATOM   7535  N N   . ALA C 1 291 ? 7.705   -76.041  -55.202 1.00 59.84  ? 292 ALA C N   1 
ATOM   7536  C CA  . ALA C 1 291 ? 6.534   -75.352  -54.652 1.00 58.75  ? 292 ALA C CA  1 
ATOM   7537  C C   . ALA C 1 291 ? 5.359   -75.330  -55.640 1.00 61.43  ? 292 ALA C C   1 
ATOM   7538  O O   . ALA C 1 291 ? 4.227   -75.652  -55.282 1.00 62.70  ? 292 ALA C O   1 
ATOM   7539  C CB  . ALA C 1 291 ? 6.907   -73.936  -54.255 1.00 57.04  ? 292 ALA C CB  1 
ATOM   7540  N N   . ALA C 1 292 ? 5.636   -74.935  -56.880 1.00 62.52  ? 293 ALA C N   1 
ATOM   7541  C CA  . ALA C 1 292 ? 4.622   -74.910  -57.936 1.00 67.02  ? 293 ALA C CA  1 
ATOM   7542  C C   . ALA C 1 292 ? 4.044   -76.302  -58.130 1.00 66.90  ? 293 ALA C C   1 
ATOM   7543  O O   . ALA C 1 292 ? 2.834   -76.468  -58.257 1.00 67.83  ? 293 ALA C O   1 
ATOM   7544  C CB  . ALA C 1 292 ? 5.212   -74.386  -59.237 1.00 67.23  ? 293 ALA C CB  1 
ATOM   7545  N N   . ALA C 1 293 ? 4.924   -77.300  -58.134 1.00 70.47  ? 294 ALA C N   1 
ATOM   7546  C CA  . ALA C 1 293 ? 4.507   -78.695  -58.136 1.00 71.35  ? 294 ALA C CA  1 
ATOM   7547  C C   . ALA C 1 293 ? 3.529   -78.968  -56.995 1.00 70.38  ? 294 ALA C C   1 
ATOM   7548  O O   . ALA C 1 293 ? 2.494   -79.601  -57.196 1.00 72.03  ? 294 ALA C O   1 
ATOM   7549  C CB  . ALA C 1 293 ? 5.713   -79.610  -58.031 1.00 72.01  ? 294 ALA C CB  1 
ATOM   7550  N N   . LEU C 1 294 ? 3.858   -78.471  -55.803 1.00 67.73  ? 295 LEU C N   1 
ATOM   7551  C CA  . LEU C 1 294 ? 3.011   -78.661  -54.628 1.00 65.73  ? 295 LEU C CA  1 
ATOM   7552  C C   . LEU C 1 294 ? 1.635   -78.017  -54.823 1.00 65.33  ? 295 LEU C C   1 
ATOM   7553  O O   . LEU C 1 294 ? 0.607   -78.613  -54.493 1.00 65.68  ? 295 LEU C O   1 
ATOM   7554  C CB  . LEU C 1 294 ? 3.694   -78.090  -53.380 1.00 64.13  ? 295 LEU C CB  1 
ATOM   7555  C CG  . LEU C 1 294 ? 3.075   -78.465  -52.034 1.00 63.75  ? 295 LEU C CG  1 
ATOM   7556  C CD1 . LEU C 1 294 ? 3.060   -79.976  -51.874 1.00 65.37  ? 295 LEU C CD1 1 
ATOM   7557  C CD2 . LEU C 1 294 ? 3.828   -77.809  -50.880 1.00 61.99  ? 295 LEU C CD2 1 
ATOM   7558  N N   . ARG C 1 295 ? 1.623   -76.803  -55.366 1.00 64.86  ? 296 ARG C N   1 
ATOM   7559  C CA  . ARG C 1 295 ? 0.377   -76.104  -55.668 1.00 66.23  ? 296 ARG C CA  1 
ATOM   7560  C C   . ARG C 1 295 ? -0.475  -76.867  -56.679 1.00 71.06  ? 296 ARG C C   1 
ATOM   7561  O O   . ARG C 1 295 ? -1.701  -76.910  -56.565 1.00 72.84  ? 296 ARG C O   1 
ATOM   7562  C CB  . ARG C 1 295 ? 0.667   -74.702  -56.205 1.00 65.16  ? 296 ARG C CB  1 
ATOM   7563  C CG  . ARG C 1 295 ? 1.504   -73.835  -55.282 1.00 61.12  ? 296 ARG C CG  1 
ATOM   7564  C CD  . ARG C 1 295 ? 1.722   -72.462  -55.895 1.00 61.28  ? 296 ARG C CD  1 
ATOM   7565  N NE  . ARG C 1 295 ? 2.482   -71.580  -55.018 1.00 59.73  ? 296 ARG C NE  1 
ATOM   7566  C CZ  . ARG C 1 295 ? 3.784   -71.345  -55.141 1.00 59.14  ? 296 ARG C CZ  1 
ATOM   7567  N NH1 . ARG C 1 295 ? 4.478   -71.921  -56.114 1.00 61.47  ? 296 ARG C NH1 1 
ATOM   7568  N NH2 . ARG C 1 295 ? 4.389   -70.526  -54.295 1.00 55.82  ? 296 ARG C NH2 1 
ATOM   7569  N N   . ARG C 1 296 ? 0.180   -77.458  -57.673 1.00 72.76  ? 297 ARG C N   1 
ATOM   7570  C CA  . ARG C 1 296 ? -0.515  -78.242  -58.688 1.00 75.98  ? 297 ARG C CA  1 
ATOM   7571  C C   . ARG C 1 296 ? -0.884  -79.622  -58.160 1.00 76.79  ? 297 ARG C C   1 
ATOM   7572  O O   . ARG C 1 296 ? -1.628  -80.362  -58.804 1.00 79.03  ? 297 ARG C O   1 
ATOM   7573  C CB  . ARG C 1 296 ? 0.343   -78.389  -59.949 1.00 77.40  ? 297 ARG C CB  1 
ATOM   7574  C CG  . ARG C 1 296 ? 0.742   -77.080  -60.613 1.00 76.09  ? 297 ARG C CG  1 
ATOM   7575  C CD  . ARG C 1 296 ? 1.312   -77.320  -62.007 1.00 77.54  ? 297 ARG C CD  1 
ATOM   7576  N NE  . ARG C 1 296 ? 2.386   -78.310  -62.004 1.00 79.00  ? 297 ARG C NE  1 
ATOM   7577  C CZ  . ARG C 1 296 ? 3.682   -78.014  -61.974 1.00 77.41  ? 297 ARG C CZ  1 
ATOM   7578  N NH1 . ARG C 1 296 ? 4.078   -76.750  -61.950 1.00 77.68  ? 297 ARG C NH1 1 
ATOM   7579  N NH2 . ARG C 1 296 ? 4.583   -78.983  -61.975 1.00 77.71  ? 297 ARG C NH2 1 
ATOM   7580  N N   . GLY C 1 297 ? -0.357  -79.967  -56.989 1.00 74.30  ? 298 GLY C N   1 
ATOM   7581  C CA  . GLY C 1 297 ? -0.526  -81.301  -56.443 1.00 75.14  ? 298 GLY C CA  1 
ATOM   7582  C C   . GLY C 1 297 ? 0.293   -82.318  -57.220 1.00 77.41  ? 298 GLY C C   1 
ATOM   7583  O O   . GLY C 1 297 ? 0.055   -83.524  -57.137 1.00 78.66  ? 298 GLY C O   1 
ATOM   7584  N N   . ASP C 1 298 ? 1.264   -81.821  -57.980 1.00 76.99  ? 299 ASP C N   1 
ATOM   7585  C CA  . ASP C 1 298 ? 2.130   -82.671  -58.785 1.00 78.17  ? 299 ASP C CA  1 
ATOM   7586  C C   . ASP C 1 298 ? 3.185   -83.330  -57.905 1.00 74.46  ? 299 ASP C C   1 
ATOM   7587  O O   . ASP C 1 298 ? 4.369   -83.001  -57.976 1.00 73.54  ? 299 ASP C O   1 
ATOM   7588  C CB  . ASP C 1 298 ? 2.787   -81.858  -59.903 1.00 79.04  ? 299 ASP C CB  1 
ATOM   7589  C CG  . ASP C 1 298 ? 3.432   -82.730  -60.954 1.00 82.15  ? 299 ASP C CG  1 
ATOM   7590  O OD1 . ASP C 1 298 ? 3.215   -83.959  -60.918 1.00 83.62  ? 299 ASP C OD1 1 
ATOM   7591  O OD2 . ASP C 1 298 ? 4.147   -82.185  -61.821 1.00 83.33  ? 299 ASP C OD2 1 
ATOM   7592  N N   . TYR C 1 299 ? 2.736   -84.269  -57.080 1.00 74.22  ? 300 TYR C N   1 
ATOM   7593  C CA  . TYR C 1 299 ? 3.588   -84.915  -56.093 1.00 76.72  ? 300 TYR C CA  1 
ATOM   7594  C C   . TYR C 1 299 ? 4.734   -85.699  -56.720 1.00 77.83  ? 300 TYR C C   1 
ATOM   7595  O O   . TYR C 1 299 ? 5.840   -85.725  -56.177 1.00 73.08  ? 300 TYR C O   1 
ATOM   7596  C CB  . TYR C 1 299 ? 2.750   -85.839  -55.217 1.00 76.77  ? 300 TYR C CB  1 
ATOM   7597  C CG  . TYR C 1 299 ? 1.608   -85.140  -54.526 1.00 75.05  ? 300 TYR C CG  1 
ATOM   7598  C CD1 . TYR C 1 299 ? 1.790   -83.902  -53.918 1.00 71.60  ? 300 TYR C CD1 1 
ATOM   7599  C CD2 . TYR C 1 299 ? 0.342   -85.708  -54.493 1.00 76.57  ? 300 TYR C CD2 1 
ATOM   7600  C CE1 . TYR C 1 299 ? 0.744   -83.256  -53.288 1.00 69.64  ? 300 TYR C CE1 1 
ATOM   7601  C CE2 . TYR C 1 299 ? -0.710  -85.068  -53.864 1.00 75.29  ? 300 TYR C CE2 1 
ATOM   7602  C CZ  . TYR C 1 299 ? -0.502  -83.844  -53.264 1.00 71.89  ? 300 TYR C CZ  1 
ATOM   7603  O OH  . TYR C 1 299 ? -1.546  -83.205  -52.639 1.00 71.52  ? 300 TYR C OH  1 
ATOM   7604  N N   . ARG C 1 300 ? 4.464   -86.337  -57.858 1.00 80.03  ? 301 ARG C N   1 
ATOM   7605  C CA  . ARG C 1 300 ? 5.465   -87.147  -58.541 1.00 79.84  ? 301 ARG C CA  1 
ATOM   7606  C C   . ARG C 1 300 ? 6.693   -86.325  -58.913 1.00 78.90  ? 301 ARG C C   1 
ATOM   7607  O O   . ARG C 1 300 ? 7.825   -86.757  -58.701 1.00 78.63  ? 301 ARG C O   1 
ATOM   7608  C CB  . ARG C 1 300 ? 4.867   -87.793  -59.796 1.00 84.22  ? 301 ARG C CB  1 
ATOM   7609  N N   . ALA C 1 301 ? 6.463   -85.139  -59.467 1.00 78.50  ? 302 ALA C N   1 
ATOM   7610  C CA  . ALA C 1 301 ? 7.556   -84.239  -59.818 1.00 77.59  ? 302 ALA C CA  1 
ATOM   7611  C C   . ALA C 1 301 ? 8.244   -83.707  -58.559 1.00 74.10  ? 302 ALA C C   1 
ATOM   7612  O O   . ALA C 1 301 ? 9.460   -83.512  -58.539 1.00 73.40  ? 302 ALA C O   1 
ATOM   7613  C CB  . ALA C 1 301 ? 7.044   -83.088  -60.675 1.00 78.51  ? 302 ALA C CB  1 
ATOM   7614  N N   . PHE C 1 302 ? 7.453   -83.476  -57.515 1.00 72.04  ? 303 PHE C N   1 
ATOM   7615  C CA  . PHE C 1 302 ? 7.969   -82.990  -56.240 1.00 70.84  ? 303 PHE C CA  1 
ATOM   7616  C C   . PHE C 1 302 ? 9.039   -83.924  -55.695 1.00 71.57  ? 303 PHE C C   1 
ATOM   7617  O O   . PHE C 1 302 ? 10.179  -83.515  -55.474 1.00 69.93  ? 303 PHE C O   1 
ATOM   7618  C CB  . PHE C 1 302 ? 6.835   -82.846  -55.225 1.00 67.12  ? 303 PHE C CB  1 
ATOM   7619  N N   . GLY C 1 303 ? 8.662   -85.185  -55.498 1.00 75.30  ? 304 GLY C N   1 
ATOM   7620  C CA  . GLY C 1 303 ? 9.568   -86.192  -54.979 1.00 75.77  ? 304 GLY C CA  1 
ATOM   7621  C C   . GLY C 1 303 ? 10.802  -86.397  -55.835 1.00 76.29  ? 304 GLY C C   1 
ATOM   7622  O O   . GLY C 1 303 ? 11.890  -86.647  -55.315 1.00 76.78  ? 304 GLY C O   1 
ATOM   7623  N N   . ARG C 1 304 ? 10.634  -86.290  -57.149 1.00 76.64  ? 305 ARG C N   1 
ATOM   7624  C CA  . ARG C 1 304 ? 11.750  -86.440  -58.076 1.00 80.22  ? 305 ARG C CA  1 
ATOM   7625  C C   . ARG C 1 304 ? 12.766  -85.329  -57.859 1.00 75.22  ? 305 ARG C C   1 
ATOM   7626  O O   . ARG C 1 304 ? 13.974  -85.561  -57.891 1.00 73.34  ? 305 ARG C O   1 
ATOM   7627  C CB  . ARG C 1 304 ? 11.257  -86.436  -59.526 1.00 81.03  ? 305 ARG C CB  1 
ATOM   7628  N N   . LEU C 1 305 ? 12.266  -84.119  -57.637 1.00 73.95  ? 306 LEU C N   1 
ATOM   7629  C CA  . LEU C 1 305 ? 13.124  -82.991  -57.309 1.00 69.26  ? 306 LEU C CA  1 
ATOM   7630  C C   . LEU C 1 305 ? 13.821  -83.237  -55.971 1.00 67.60  ? 306 LEU C C   1 
ATOM   7631  O O   . LEU C 1 305 ? 14.973  -82.842  -55.785 1.00 65.72  ? 306 LEU C O   1 
ATOM   7632  C CB  . LEU C 1 305 ? 12.314  -81.691  -57.279 1.00 71.14  ? 306 LEU C CB  1 
ATOM   7633  C CG  . LEU C 1 305 ? 11.775  -81.246  -58.646 1.00 72.61  ? 306 LEU C CG  1 
ATOM   7634  C CD1 . LEU C 1 305 ? 10.672  -80.203  -58.511 1.00 68.99  ? 306 LEU C CD1 1 
ATOM   7635  C CD2 . LEU C 1 305 ? 12.899  -80.722  -59.532 1.00 71.07  ? 306 LEU C CD2 1 
ATOM   7636  N N   . MET C 1 306 ? 13.128  -83.917  -55.057 1.00 67.10  ? 307 MET C N   1 
ATOM   7637  C CA  . MET C 1 306 ? 13.695  -84.245  -53.744 1.00 67.80  ? 307 MET C CA  1 
ATOM   7638  C C   . MET C 1 306 ? 14.885  -85.191  -53.871 1.00 66.98  ? 307 MET C C   1 
ATOM   7639  O O   . MET C 1 306 ? 15.917  -84.999  -53.229 1.00 64.93  ? 307 MET C O   1 
ATOM   7640  C CB  . MET C 1 306 ? 12.643  -84.879  -52.829 1.00 66.85  ? 307 MET C CB  1 
ATOM   7641  C CG  . MET C 1 306 ? 11.479  -83.977  -52.471 1.00 66.44  ? 307 MET C CG  1 
ATOM   7642  S SD  . MET C 1 306 ? 10.323  -84.787  -51.348 1.00 61.46  ? 307 MET C SD  1 
ATOM   7643  C CE  . MET C 1 306 ? 11.281  -84.798  -49.828 1.00 58.63  ? 307 MET C CE  1 
ATOM   7644  N N   . VAL C 1 307 ? 14.726  -86.222  -54.694 1.00 71.13  ? 308 VAL C N   1 
ATOM   7645  C CA  . VAL C 1 307 ? 15.793  -87.186  -54.916 1.00 71.96  ? 308 VAL C CA  1 
ATOM   7646  C C   . VAL C 1 307 ? 16.953  -86.509  -55.631 1.00 72.19  ? 308 VAL C C   1 
ATOM   7647  O O   . VAL C 1 307 ? 18.111  -86.719  -55.284 1.00 68.73  ? 308 VAL C O   1 
ATOM   7648  C CB  . VAL C 1 307 ? 15.297  -88.388  -55.727 1.00 76.29  ? 308 VAL C CB  1 
ATOM   7649  C CG1 . VAL C 1 307 ? 16.421  -89.390  -55.944 1.00 78.71  ? 308 VAL C CG1 1 
ATOM   7650  C CG2 . VAL C 1 307 ? 14.125  -89.038  -55.017 1.00 76.07  ? 308 VAL C CG2 1 
ATOM   7651  N N   . GLU C 1 308 ? 16.632  -85.688  -56.627 1.00 73.74  ? 309 GLU C N   1 
ATOM   7652  C CA  . GLU C 1 308 ? 17.640  -84.865  -57.284 1.00 73.93  ? 309 GLU C CA  1 
ATOM   7653  C C   . GLU C 1 308 ? 18.367  -84.008  -56.245 1.00 67.24  ? 309 GLU C C   1 
ATOM   7654  O O   . GLU C 1 308 ? 19.590  -83.865  -56.287 1.00 66.95  ? 309 GLU C O   1 
ATOM   7655  C CB  . GLU C 1 308 ? 17.002  -83.984  -58.360 1.00 75.45  ? 309 GLU C CB  1 
ATOM   7656  N N   . SER C 1 309 ? 17.606  -83.455  -55.304 1.00 69.56  ? 310 SER C N   1 
ATOM   7657  C CA  . SER C 1 309 ? 18.180  -82.688  -54.201 1.00 61.97  ? 310 SER C CA  1 
ATOM   7658  C C   . SER C 1 309 ? 19.139  -83.541  -53.375 1.00 63.19  ? 310 SER C C   1 
ATOM   7659  O O   . SER C 1 309 ? 20.274  -83.137  -53.126 1.00 63.47  ? 310 SER C O   1 
ATOM   7660  C CB  . SER C 1 309 ? 17.074  -82.118  -53.307 1.00 59.93  ? 310 SER C CB  1 
ATOM   7661  O OG  . SER C 1 309 ? 17.606  -81.574  -52.108 1.00 63.79  ? 310 SER C OG  1 
ATOM   7662  N N   . HIS C 1 310 ? 18.685  -84.720  -52.960 1.00 61.96  ? 311 HIS C N   1 
ATOM   7663  C CA  . HIS C 1 310 ? 19.521  -85.620  -52.175 1.00 61.48  ? 311 HIS C CA  1 
ATOM   7664  C C   . HIS C 1 310 ? 20.798  -86.003  -52.917 1.00 65.42  ? 311 HIS C C   1 
ATOM   7665  O O   . HIS C 1 310 ? 21.889  -85.920  -52.356 1.00 61.75  ? 311 HIS C O   1 
ATOM   7666  C CB  . HIS C 1 310 ? 18.755  -86.885  -51.789 1.00 65.52  ? 311 HIS C CB  1 
ATOM   7667  C CG  . HIS C 1 310 ? 19.532  -87.806  -50.900 1.00 65.49  ? 311 HIS C CG  1 
ATOM   7668  N ND1 . HIS C 1 310 ? 19.382  -87.818  -49.530 1.00 64.61  ? 311 HIS C ND1 1 
ATOM   7669  C CD2 . HIS C 1 310 ? 20.474  -88.737  -51.183 1.00 67.72  ? 311 HIS C CD2 1 
ATOM   7670  C CE1 . HIS C 1 310 ? 20.195  -88.719  -49.007 1.00 65.09  ? 311 HIS C CE1 1 
ATOM   7671  N NE2 . HIS C 1 310 ? 20.869  -89.290  -49.988 1.00 66.99  ? 311 HIS C NE2 1 
ATOM   7672  N N   . ARG C 1 311 ? 20.658  -86.417  -54.176 1.00 65.80  ? 312 ARG C N   1 
ATOM   7673  C CA  . ARG C 1 311 ? 21.813  -86.801  -54.982 1.00 67.57  ? 312 ARG C CA  1 
ATOM   7674  C C   . ARG C 1 311 ? 22.810  -85.651  -55.066 1.00 66.23  ? 312 ARG C C   1 
ATOM   7675  O O   . ARG C 1 311 ? 24.020  -85.856  -54.971 1.00 66.15  ? 312 ARG C O   1 
ATOM   7676  C CB  . ARG C 1 311 ? 21.379  -87.232  -56.389 1.00 70.84  ? 312 ARG C CB  1 
ATOM   7677  N N   . SER C 1 312 ? 22.288  -84.440  -55.234 1.00 66.34  ? 313 SER C N   1 
ATOM   7678  C CA  . SER C 1 312 ? 23.119  -83.245  -55.272 1.00 65.18  ? 313 SER C CA  1 
ATOM   7679  C C   . SER C 1 312 ? 23.761  -83.003  -53.906 1.00 65.87  ? 313 SER C C   1 
ATOM   7680  O O   . SER C 1 312 ? 24.912  -82.583  -53.813 1.00 66.87  ? 313 SER C O   1 
ATOM   7681  C CB  . SER C 1 312 ? 22.289  -82.035  -55.706 1.00 63.51  ? 313 SER C CB  1 
ATOM   7682  O OG  . SER C 1 312 ? 23.088  -80.870  -55.817 1.00 62.46  ? 313 SER C OG  1 
ATOM   7683  N N   . LEU C 1 313 ? 23.016  -83.280  -52.843 1.00 65.40  ? 314 LEU C N   1 
ATOM   7684  C CA  . LEU C 1 313 ? 23.556  -83.163  -51.492 1.00 63.62  ? 314 LEU C CA  1 
ATOM   7685  C C   . LEU C 1 313 ? 24.592  -84.252  -51.214 1.00 65.61  ? 314 LEU C C   1 
ATOM   7686  O O   . LEU C 1 313 ? 25.606  -84.006  -50.560 1.00 64.37  ? 314 LEU C O   1 
ATOM   7687  C CB  . LEU C 1 313 ? 22.431  -83.234  -50.459 1.00 60.82  ? 314 LEU C CB  1 
ATOM   7688  C CG  . LEU C 1 313 ? 21.524  -82.010  -50.339 1.00 58.82  ? 314 LEU C CG  1 
ATOM   7689  C CD1 . LEU C 1 313 ? 20.251  -82.374  -49.599 1.00 57.95  ? 314 LEU C CD1 1 
ATOM   7690  C CD2 . LEU C 1 313 ? 22.251  -80.880  -49.628 1.00 56.25  ? 314 LEU C CD2 1 
ATOM   7691  N N   . ARG C 1 314 ? 24.331  -85.452  -51.724 1.00 68.73  ? 315 ARG C N   1 
ATOM   7692  C CA  . ARG C 1 314 ? 25.177  -86.612  -51.457 1.00 70.43  ? 315 ARG C CA  1 
ATOM   7693  C C   . ARG C 1 314 ? 26.455  -86.625  -52.298 1.00 71.05  ? 315 ARG C C   1 
ATOM   7694  O O   . ARG C 1 314 ? 27.550  -86.827  -51.774 1.00 69.36  ? 315 ARG C O   1 
ATOM   7695  C CB  . ARG C 1 314 ? 24.386  -87.901  -51.699 1.00 73.55  ? 315 ARG C CB  1 
ATOM   7696  C CG  . ARG C 1 314 ? 25.240  -89.155  -51.812 1.00 76.39  ? 315 ARG C CG  1 
ATOM   7697  C CD  . ARG C 1 314 ? 24.391  -90.377  -52.144 1.00 79.86  ? 315 ARG C CD  1 
ATOM   7698  N NE  . ARG C 1 314 ? 24.103  -90.475  -53.572 1.00 83.45  ? 315 ARG C NE  1 
ATOM   7699  C CZ  . ARG C 1 314 ? 23.339  -91.415  -54.122 1.00 86.53  ? 315 ARG C CZ  1 
ATOM   7700  N NH1 . ARG C 1 314 ? 22.779  -92.351  -53.366 1.00 86.97  ? 315 ARG C NH1 1 
ATOM   7701  N NH2 . ARG C 1 314 ? 23.138  -91.420  -55.433 1.00 88.78  ? 315 ARG C NH2 1 
ATOM   7702  N N   . ASP C 1 315 ? 26.316  -86.410  -53.603 1.00 73.53  ? 316 ASP C N   1 
ATOM   7703  C CA  . ASP C 1 315 ? 27.455  -86.530  -54.509 1.00 75.63  ? 316 ASP C CA  1 
ATOM   7704  C C   . ASP C 1 315 ? 28.140  -85.195  -54.776 1.00 75.09  ? 316 ASP C C   1 
ATOM   7705  O O   . ASP C 1 315 ? 29.355  -85.134  -54.974 1.00 76.97  ? 316 ASP C O   1 
ATOM   7706  C CB  . ASP C 1 315 ? 27.009  -87.153  -55.833 1.00 78.42  ? 316 ASP C CB  1 
ATOM   7707  C CG  . ASP C 1 315 ? 26.370  -88.514  -55.647 1.00 79.29  ? 316 ASP C CG  1 
ATOM   7708  O OD1 . ASP C 1 315 ? 26.624  -89.142  -54.602 1.00 78.13  ? 316 ASP C OD1 1 
ATOM   7709  O OD2 . ASP C 1 315 ? 25.612  -88.955  -56.537 1.00 81.00  ? 316 ASP C OD2 1 
ATOM   7710  N N   . ASP C 1 316 ? 27.358  -84.126  -54.770 1.00 72.92  ? 317 ASP C N   1 
ATOM   7711  C CA  . ASP C 1 316 ? 27.851  -82.838  -55.224 1.00 73.41  ? 317 ASP C CA  1 
ATOM   7712  C C   . ASP C 1 316 ? 28.189  -81.920  -54.045 1.00 71.19  ? 317 ASP C C   1 
ATOM   7713  O O   . ASP C 1 316 ? 29.227  -81.256  -54.045 1.00 72.42  ? 317 ASP C O   1 
ATOM   7714  C CB  . ASP C 1 316 ? 26.811  -82.207  -56.155 1.00 77.53  ? 317 ASP C CB  1 
ATOM   7715  C CG  . ASP C 1 316 ? 27.360  -81.054  -56.953 1.00 79.57  ? 317 ASP C CG  1 
ATOM   7716  O OD1 . ASP C 1 316 ? 28.204  -80.319  -56.416 1.00 78.72  ? 317 ASP C OD1 1 
ATOM   7717  O OD2 . ASP C 1 316 ? 26.963  -80.900  -58.130 1.00 81.63  ? 317 ASP C OD2 1 
ATOM   7718  N N   . TYR C 1 317 ? 27.325  -81.891  -53.037 1.00 68.61  ? 318 TYR C N   1 
ATOM   7719  C CA  . TYR C 1 317 ? 27.573  -81.051  -51.872 1.00 66.86  ? 318 TYR C CA  1 
ATOM   7720  C C   . TYR C 1 317 ? 28.328  -81.815  -50.789 1.00 66.82  ? 318 TYR C C   1 
ATOM   7721  O O   . TYR C 1 317 ? 29.008  -81.216  -49.953 1.00 65.17  ? 318 TYR C O   1 
ATOM   7722  C CB  . TYR C 1 317 ? 26.261  -80.504  -51.313 1.00 64.14  ? 318 TYR C CB  1 
ATOM   7723  C CG  . TYR C 1 317 ? 26.399  -79.099  -50.784 1.00 60.96  ? 318 TYR C CG  1 
ATOM   7724  C CD1 . TYR C 1 317 ? 26.695  -78.053  -51.641 1.00 60.84  ? 318 TYR C CD1 1 
ATOM   7725  C CD2 . TYR C 1 317 ? 26.241  -78.816  -49.433 1.00 58.40  ? 318 TYR C CD2 1 
ATOM   7726  C CE1 . TYR C 1 317 ? 26.830  -76.769  -51.177 1.00 58.80  ? 318 TYR C CE1 1 
ATOM   7727  C CE2 . TYR C 1 317 ? 26.376  -77.525  -48.957 1.00 56.33  ? 318 TYR C CE2 1 
ATOM   7728  C CZ  . TYR C 1 317 ? 26.666  -76.504  -49.837 1.00 56.98  ? 318 TYR C CZ  1 
ATOM   7729  O OH  . TYR C 1 317 ? 26.800  -75.217  -49.371 1.00 56.07  ? 318 TYR C OH  1 
ATOM   7730  N N   . GLU C 1 318 ? 28.193  -83.138  -50.819 1.00 69.18  ? 319 GLU C N   1 
ATOM   7731  C CA  . GLU C 1 318 ? 28.864  -84.036  -49.879 1.00 69.09  ? 319 GLU C CA  1 
ATOM   7732  C C   . GLU C 1 318 ? 28.549  -83.703  -48.428 1.00 64.34  ? 319 GLU C C   1 
ATOM   7733  O O   . GLU C 1 318 ? 29.452  -83.511  -47.611 1.00 63.28  ? 319 GLU C O   1 
ATOM   7734  C CB  . GLU C 1 318 ? 30.377  -84.011  -50.102 1.00 71.34  ? 319 GLU C CB  1 
ATOM   7735  C CG  . GLU C 1 318 ? 30.785  -84.351  -51.522 1.00 76.76  ? 319 GLU C CG  1 
ATOM   7736  C CD  . GLU C 1 318 ? 32.273  -84.568  -51.658 1.00 80.10  ? 319 GLU C CD  1 
ATOM   7737  O OE1 . GLU C 1 318 ? 32.715  -85.731  -51.538 1.00 82.45  ? 319 GLU C OE1 1 
ATOM   7738  O OE2 . GLU C 1 318 ? 33.001  -83.578  -51.876 1.00 80.54  ? 319 GLU C OE2 1 
ATOM   7739  N N   . VAL C 1 319 ? 27.263  -83.637  -48.107 1.00 61.36  ? 320 VAL C N   1 
ATOM   7740  C CA  . VAL C 1 319 ? 26.851  -83.407  -46.730 1.00 57.33  ? 320 VAL C CA  1 
ATOM   7741  C C   . VAL C 1 319 ? 25.924  -84.515  -46.259 1.00 55.95  ? 320 VAL C C   1 
ATOM   7742  O O   . VAL C 1 319 ? 25.305  -84.413  -45.203 1.00 54.10  ? 320 VAL C O   1 
ATOM   7743  C CB  . VAL C 1 319 ? 26.163  -82.047  -46.562 1.00 55.63  ? 320 VAL C CB  1 
ATOM   7744  C CG1 . VAL C 1 319 ? 27.162  -80.926  -46.788 1.00 55.54  ? 320 VAL C CG1 1 
ATOM   7745  C CG2 . VAL C 1 319 ? 24.989  -81.927  -47.515 1.00 56.40  ? 320 VAL C CG2 1 
ATOM   7746  N N   . SER C 1 320 ? 25.828  -85.578  -47.047 1.00 56.61  ? 321 SER C N   1 
ATOM   7747  C CA  . SER C 1 320 ? 25.104  -86.759  -46.604 1.00 55.94  ? 321 SER C CA  1 
ATOM   7748  C C   . SER C 1 320 ? 26.047  -87.667  -45.820 1.00 55.61  ? 321 SER C C   1 
ATOM   7749  O O   . SER C 1 320 ? 27.202  -87.318  -45.577 1.00 53.57  ? 321 SER C O   1 
ATOM   7750  C CB  . SER C 1 320 ? 24.497  -87.511  -47.788 1.00 56.70  ? 321 SER C CB  1 
ATOM   7751  O OG  . SER C 1 320 ? 23.701  -88.598  -47.347 1.00 56.33  ? 321 SER C OG  1 
ATOM   7752  N N   . CYS C 1 321 ? 25.539  -88.826  -45.423 1.00 56.63  ? 322 CYS C N   1 
ATOM   7753  C CA  . CYS C 1 321 ? 26.346  -89.847  -44.772 1.00 56.99  ? 322 CYS C CA  1 
ATOM   7754  C C   . CYS C 1 321 ? 25.724  -91.197  -45.113 1.00 59.86  ? 322 CYS C C   1 
ATOM   7755  O O   . CYS C 1 321 ? 24.553  -91.247  -45.499 1.00 61.59  ? 322 CYS C O   1 
ATOM   7756  C CB  . CYS C 1 321 ? 26.419  -89.613  -43.256 1.00 54.46  ? 322 CYS C CB  1 
ATOM   7757  S SG  . CYS C 1 321 ? 24.890  -89.914  -42.352 1.00 56.01  ? 322 CYS C SG  1 
ATOM   7758  N N   . PRO C 1 322 ? 26.507  -92.288  -45.014 1.00 60.73  ? 323 PRO C N   1 
ATOM   7759  C CA  . PRO C 1 322 ? 26.009  -93.618  -45.387 1.00 62.95  ? 323 PRO C CA  1 
ATOM   7760  C C   . PRO C 1 322 ? 24.672  -93.970  -44.739 1.00 62.23  ? 323 PRO C C   1 
ATOM   7761  O O   . PRO C 1 322 ? 23.833  -94.606  -45.380 1.00 63.84  ? 323 PRO C O   1 
ATOM   7762  C CB  . PRO C 1 322 ? 27.116  -94.551  -44.892 1.00 63.57  ? 323 PRO C CB  1 
ATOM   7763  C CG  . PRO C 1 322 ? 28.349  -93.729  -44.998 1.00 62.48  ? 323 PRO C CG  1 
ATOM   7764  C CD  . PRO C 1 322 ? 27.937  -92.324  -44.651 1.00 60.03  ? 323 PRO C CD  1 
ATOM   7765  N N   . GLU C 1 323 ? 24.478  -93.555  -43.492 1.00 59.47  ? 324 GLU C N   1 
ATOM   7766  C CA  . GLU C 1 323 ? 23.213  -93.774  -42.803 1.00 60.45  ? 324 GLU C CA  1 
ATOM   7767  C C   . GLU C 1 323 ? 22.061  -93.084  -43.539 1.00 60.29  ? 324 GLU C C   1 
ATOM   7768  O O   . GLU C 1 323 ? 21.006  -93.681  -43.756 1.00 62.64  ? 324 GLU C O   1 
ATOM   7769  C CB  . GLU C 1 323 ? 23.287  -93.272  -41.359 1.00 60.08  ? 324 GLU C CB  1 
ATOM   7770  C CG  . GLU C 1 323 ? 24.267  -94.029  -40.467 1.00 61.58  ? 324 GLU C CG  1 
ATOM   7771  C CD  . GLU C 1 323 ? 25.692  -93.514  -40.571 1.00 62.54  ? 324 GLU C CD  1 
ATOM   7772  O OE1 . GLU C 1 323 ? 26.031  -92.868  -41.585 1.00 63.61  ? 324 GLU C OE1 1 
ATOM   7773  O OE2 . GLU C 1 323 ? 26.474  -93.751  -39.627 1.00 62.33  ? 324 GLU C OE2 1 
ATOM   7774  N N   . LEU C 1 324 ? 22.270  -91.827  -43.921 1.00 57.45  ? 325 LEU C N   1 
ATOM   7775  C CA  . LEU C 1 324 ? 21.256  -91.065  -44.645 1.00 57.65  ? 325 LEU C CA  1 
ATOM   7776  C C   . LEU C 1 324 ? 21.054  -91.597  -46.060 1.00 59.99  ? 325 LEU C C   1 
ATOM   7777  O O   . LEU C 1 324 ? 19.926  -91.677  -46.546 1.00 59.78  ? 325 LEU C O   1 
ATOM   7778  C CB  . LEU C 1 324 ? 21.634  -89.585  -44.700 1.00 56.10  ? 325 LEU C CB  1 
ATOM   7779  C CG  . LEU C 1 324 ? 21.591  -88.806  -43.387 1.00 54.19  ? 325 LEU C CG  1 
ATOM   7780  C CD1 . LEU C 1 324 ? 22.258  -87.459  -43.573 1.00 53.05  ? 325 LEU C CD1 1 
ATOM   7781  C CD2 . LEU C 1 324 ? 20.152  -88.633  -42.923 1.00 54.01  ? 325 LEU C CD2 1 
ATOM   7782  N N   . ASP C 1 325 ? 22.154  -91.941  -46.723 1.00 60.91  ? 326 ASP C N   1 
ATOM   7783  C CA  . ASP C 1 325 ? 22.090  -92.526  -48.057 1.00 63.97  ? 326 ASP C CA  1 
ATOM   7784  C C   . ASP C 1 325 ? 21.277  -93.808  -48.037 1.00 67.60  ? 326 ASP C C   1 
ATOM   7785  O O   . ASP C 1 325 ? 20.451  -94.043  -48.919 1.00 70.90  ? 326 ASP C O   1 
ATOM   7786  C CB  . ASP C 1 325 ? 23.493  -92.806  -48.599 1.00 64.69  ? 326 ASP C CB  1 
ATOM   7787  C CG  . ASP C 1 325 ? 24.263  -91.540  -48.900 1.00 64.70  ? 326 ASP C CG  1 
ATOM   7788  O OD1 . ASP C 1 325 ? 23.618  -90.487  -49.092 1.00 64.07  ? 326 ASP C OD1 1 
ATOM   7789  O OD2 . ASP C 1 325 ? 25.511  -91.595  -48.941 1.00 65.75  ? 326 ASP C OD2 1 
ATOM   7790  N N   . GLN C 1 326 ? 21.513  -94.633  -47.022 1.00 64.16  ? 327 GLN C N   1 
ATOM   7791  C CA  . GLN C 1 326 ? 20.821  -95.910  -46.903 1.00 69.73  ? 327 GLN C CA  1 
ATOM   7792  C C   . GLN C 1 326 ? 19.332  -95.709  -46.651 1.00 69.93  ? 327 GLN C C   1 
ATOM   7793  O O   . GLN C 1 326 ? 18.500  -96.362  -47.279 1.00 68.00  ? 327 GLN C O   1 
ATOM   7794  C CB  . GLN C 1 326 ? 21.433  -96.756  -45.784 1.00 65.33  ? 327 GLN C CB  1 
ATOM   7795  N N   . LEU C 1 327 ? 19.003  -94.804  -45.734 1.00 67.83  ? 328 LEU C N   1 
ATOM   7796  C CA  . LEU C 1 327 ? 17.610  -94.510  -45.408 1.00 68.68  ? 328 LEU C CA  1 
ATOM   7797  C C   . LEU C 1 327 ? 16.856  -93.993  -46.627 1.00 71.61  ? 328 LEU C C   1 
ATOM   7798  O O   . LEU C 1 327 ? 15.712  -94.374  -46.865 1.00 72.20  ? 328 LEU C O   1 
ATOM   7799  C CB  . LEU C 1 327 ? 17.526  -93.489  -44.269 1.00 65.29  ? 328 LEU C CB  1 
ATOM   7800  C CG  . LEU C 1 327 ? 17.900  -93.949  -42.857 1.00 63.31  ? 328 LEU C CG  1 
ATOM   7801  C CD1 . LEU C 1 327 ? 18.107  -92.749  -41.951 1.00 60.77  ? 328 LEU C CD1 1 
ATOM   7802  C CD2 . LEU C 1 327 ? 16.834  -94.867  -42.283 1.00 63.45  ? 328 LEU C CD2 1 
ATOM   7803  N N   . VAL C 1 328 ? 17.505  -93.124  -47.395 1.00 74.61  ? 329 VAL C N   1 
ATOM   7804  C CA  . VAL C 1 328 ? 16.898  -92.562  -48.594 1.00 80.08  ? 329 VAL C CA  1 
ATOM   7805  C C   . VAL C 1 328 ? 16.759  -93.625  -49.678 1.00 85.80  ? 329 VAL C C   1 
ATOM   7806  O O   . VAL C 1 328 ? 15.713  -93.733  -50.315 1.00 87.53  ? 329 VAL C O   1 
ATOM   7807  C CB  . VAL C 1 328 ? 17.716  -91.377  -49.141 1.00 79.42  ? 329 VAL C CB  1 
ATOM   7808  N N   . GLU C 1 329 ? 17.814  -94.410  -49.878 1.00 88.99  ? 330 GLU C N   1 
ATOM   7809  C CA  . GLU C 1 329 ? 17.793  -95.488  -50.863 1.00 94.61  ? 330 GLU C CA  1 
ATOM   7810  C C   . GLU C 1 329 ? 16.723  -96.515  -50.512 1.00 99.80  ? 330 GLU C C   1 
ATOM   7811  O O   . GLU C 1 329 ? 16.046  -97.044  -51.393 1.00 105.16 ? 330 GLU C O   1 
ATOM   7812  C CB  . GLU C 1 329 ? 19.162  -96.164  -50.960 1.00 95.35  ? 330 GLU C CB  1 
ATOM   7813  N N   . ALA C 1 330 ? 16.572  -96.786  -49.220 1.00 94.61  ? 331 ALA C N   1 
ATOM   7814  C CA  . ALA C 1 330 ? 15.543  -97.703  -48.749 1.00 91.31  ? 331 ALA C CA  1 
ATOM   7815  C C   . ALA C 1 330 ? 14.153  -97.108  -48.943 1.00 91.04  ? 331 ALA C C   1 
ATOM   7816  O O   . ALA C 1 330 ? 13.209  -97.818  -49.288 1.00 94.57  ? 331 ALA C O   1 
ATOM   7817  C CB  . ALA C 1 330 ? 15.768  -98.054  -47.291 1.00 90.15  ? 331 ALA C CB  1 
ATOM   7818  N N   . ALA C 1 331 ? 14.030  -95.802  -48.723 1.00 84.68  ? 332 ALA C N   1 
ATOM   7819  C CA  . ALA C 1 331 ? 12.741  -95.135  -48.865 1.00 83.00  ? 332 ALA C CA  1 
ATOM   7820  C C   . ALA C 1 331 ? 12.234  -95.194  -50.306 1.00 82.54  ? 332 ALA C C   1 
ATOM   7821  O O   . ALA C 1 331 ? 11.052  -95.432  -50.549 1.00 82.39  ? 332 ALA C O   1 
ATOM   7822  C CB  . ALA C 1 331 ? 12.832  -93.697  -48.392 1.00 81.02  ? 332 ALA C CB  1 
ATOM   7823  N N   . LEU C 1 332 ? 13.138  -94.997  -51.259 1.00 82.24  ? 333 LEU C N   1 
ATOM   7824  C CA  . LEU C 1 332 ? 12.762  -94.923  -52.666 1.00 84.62  ? 333 LEU C CA  1 
ATOM   7825  C C   . LEU C 1 332 ? 12.365  -96.279  -53.251 1.00 89.39  ? 333 LEU C C   1 
ATOM   7826  O O   . LEU C 1 332 ? 11.956  -96.367  -54.410 1.00 91.81  ? 333 LEU C O   1 
ATOM   7827  C CB  . LEU C 1 332 ? 13.909  -94.323  -53.480 1.00 83.67  ? 333 LEU C CB  1 
ATOM   7828  C CG  . LEU C 1 332 ? 14.229  -92.863  -53.157 1.00 79.88  ? 333 LEU C CG  1 
ATOM   7829  C CD1 . LEU C 1 332 ? 15.400  -92.366  -53.991 1.00 80.30  ? 333 LEU C CD1 1 
ATOM   7830  C CD2 . LEU C 1 332 ? 12.996  -91.991  -53.361 1.00 78.59  ? 333 LEU C CD2 1 
ATOM   7831  N N   . ALA C 1 333 ? 12.480  -97.329  -52.444 1.00 90.36  ? 334 ALA C N   1 
ATOM   7832  C CA  . ALA C 1 333 ? 12.167  -98.680  -52.894 1.00 94.18  ? 334 ALA C CA  1 
ATOM   7833  C C   . ALA C 1 333 ? 10.687  -99.002  -52.714 1.00 94.82  ? 334 ALA C C   1 
ATOM   7834  O O   . ALA C 1 333 ? 10.114  -99.762  -53.493 1.00 97.85  ? 334 ALA C O   1 
ATOM   7835  C CB  . ALA C 1 333 ? 13.022  -99.692  -52.150 1.00 94.98  ? 334 ALA C CB  1 
ATOM   7836  N N   . VAL C 1 334 ? 10.075  -98.422  -51.687 1.00 91.47  ? 335 VAL C N   1 
ATOM   7837  C CA  . VAL C 1 334 ? 8.663   -98.660  -51.398 1.00 92.38  ? 335 VAL C CA  1 
ATOM   7838  C C   . VAL C 1 334 ? 7.745   -97.919  -52.374 1.00 92.73  ? 335 VAL C C   1 
ATOM   7839  O O   . VAL C 1 334 ? 7.851   -96.703  -52.538 1.00 91.66  ? 335 VAL C O   1 
ATOM   7840  C CB  . VAL C 1 334 ? 8.323   -98.261  -49.934 1.00 94.67  ? 335 VAL C CB  1 
ATOM   7841  C CG1 . VAL C 1 334 ? 6.897   -97.761  -49.804 1.00 93.49  ? 335 VAL C CG1 1 
ATOM   7842  C CG2 . VAL C 1 334 ? 8.546   -99.442  -49.001 1.00 95.13  ? 335 VAL C CG2 1 
ATOM   7843  N N   . PRO C 1 335 ? 6.859   -98.668  -53.052 1.00 95.08  ? 336 PRO C N   1 
ATOM   7844  C CA  . PRO C 1 335 ? 5.805   -98.103  -53.905 1.00 95.75  ? 336 PRO C CA  1 
ATOM   7845  C C   . PRO C 1 335 ? 4.891   -97.137  -53.155 1.00 92.51  ? 336 PRO C C   1 
ATOM   7846  O O   . PRO C 1 335 ? 4.357   -97.487  -52.104 1.00 91.68  ? 336 PRO C O   1 
ATOM   7847  C CB  . PRO C 1 335 ? 5.026   -99.338  -54.365 1.00 98.96  ? 336 PRO C CB  1 
ATOM   7848  C CG  . PRO C 1 335 ? 6.019   -100.438 -54.324 1.00 100.19 ? 336 PRO C CG  1 
ATOM   7849  C CD  . PRO C 1 335 ? 6.945   -100.134 -53.178 1.00 97.07  ? 336 PRO C CD  1 
ATOM   7850  N N   . GLY C 1 336 ? 4.711   -95.939  -53.703 1.00 91.19  ? 337 GLY C N   1 
ATOM   7851  C CA  . GLY C 1 336 ? 3.918   -94.913  -53.052 1.00 88.68  ? 337 GLY C CA  1 
ATOM   7852  C C   . GLY C 1 336 ? 4.773   -93.746  -52.593 1.00 85.63  ? 337 GLY C C   1 
ATOM   7853  O O   . GLY C 1 336 ? 4.269   -92.647  -52.351 1.00 84.71  ? 337 GLY C O   1 
ATOM   7854  N N   . VAL C 1 337 ? 6.074   -93.987  -52.468 1.00 83.55  ? 338 VAL C N   1 
ATOM   7855  C CA  . VAL C 1 337 ? 7.018   -92.937  -52.114 1.00 80.65  ? 338 VAL C CA  1 
ATOM   7856  C C   . VAL C 1 337 ? 7.357   -92.076  -53.326 1.00 76.32  ? 338 VAL C C   1 
ATOM   7857  O O   . VAL C 1 337 ? 7.880   -92.573  -54.326 1.00 86.05  ? 338 VAL C O   1 
ATOM   7858  C CB  . VAL C 1 337 ? 8.319   -93.521  -51.528 1.00 79.73  ? 338 VAL C CB  1 
ATOM   7859  C CG1 . VAL C 1 337 ? 9.413   -92.467  -51.500 1.00 77.63  ? 338 VAL C CG1 1 
ATOM   7860  C CG2 . VAL C 1 337 ? 8.072   -94.083  -50.136 1.00 73.52  ? 338 VAL C CG2 1 
ATOM   7861  N N   . TYR C 1 338 ? 7.055   -90.786  -53.233 1.00 74.34  ? 339 TYR C N   1 
ATOM   7862  C CA  . TYR C 1 338 ? 7.338   -89.847  -54.313 1.00 74.78  ? 339 TYR C CA  1 
ATOM   7863  C C   . TYR C 1 338 ? 8.812   -89.518  -54.404 1.00 74.67  ? 339 TYR C C   1 
ATOM   7864  O O   . TYR C 1 338 ? 9.379   -89.423  -55.493 1.00 75.49  ? 339 TYR C O   1 
ATOM   7865  C CB  . TYR C 1 338 ? 6.539   -88.565  -54.121 1.00 72.93  ? 339 TYR C CB  1 
ATOM   7866  C CG  . TYR C 1 338 ? 5.073   -88.767  -54.362 1.00 74.34  ? 339 TYR C CG  1 
ATOM   7867  C CD1 . TYR C 1 338 ? 4.594   -89.010  -55.642 1.00 77.31  ? 339 TYR C CD1 1 
ATOM   7868  C CD2 . TYR C 1 338 ? 4.167   -88.733  -53.313 1.00 76.85  ? 339 TYR C CD2 1 
ATOM   7869  C CE1 . TYR C 1 338 ? 3.256   -89.204  -55.872 1.00 82.85  ? 339 TYR C CE1 1 
ATOM   7870  C CE2 . TYR C 1 338 ? 2.821   -88.925  -53.535 1.00 78.73  ? 339 TYR C CE2 1 
ATOM   7871  C CZ  . TYR C 1 338 ? 2.374   -89.162  -54.816 1.00 81.78  ? 339 TYR C CZ  1 
ATOM   7872  O OH  . TYR C 1 338 ? 1.033   -89.351  -55.043 1.00 84.68  ? 339 TYR C OH  1 
ATOM   7873  N N   . GLY C 1 339 ? 9.421   -89.332  -53.242 1.00 71.20  ? 340 GLY C N   1 
ATOM   7874  C CA  . GLY C 1 339 ? 10.831  -89.038  -53.150 1.00 70.07  ? 340 GLY C CA  1 
ATOM   7875  C C   . GLY C 1 339 ? 11.242  -89.057  -51.695 1.00 67.38  ? 340 GLY C C   1 
ATOM   7876  O O   . GLY C 1 339 ? 10.400  -89.041  -50.796 1.00 66.14  ? 340 GLY C O   1 
ATOM   7877  N N   . SER C 1 340 ? 12.544  -89.102  -51.463 1.00 66.57  ? 341 SER C N   1 
ATOM   7878  C CA  . SER C 1 340 ? 13.075  -89.037  -50.118 1.00 64.02  ? 341 SER C CA  1 
ATOM   7879  C C   . SER C 1 340 ? 14.416  -88.342  -50.176 1.00 66.59  ? 341 SER C C   1 
ATOM   7880  O O   . SER C 1 340 ? 15.030  -88.256  -51.240 1.00 67.99  ? 341 SER C O   1 
ATOM   7881  C CB  . SER C 1 340 ? 13.213  -90.430  -49.510 1.00 64.88  ? 341 SER C CB  1 
ATOM   7882  O OG  . SER C 1 340 ? 13.591  -90.359  -48.145 1.00 62.43  ? 341 SER C OG  1 
ATOM   7883  N N   . ARG C 1 341 ? 14.868  -87.848  -49.032 1.00 60.08  ? 342 ARG C N   1 
ATOM   7884  C CA  . ARG C 1 341 ? 16.117  -87.116  -48.970 1.00 58.69  ? 342 ARG C CA  1 
ATOM   7885  C C   . ARG C 1 341 ? 16.515  -86.878  -47.530 1.00 60.47  ? 342 ARG C C   1 
ATOM   7886  O O   . ARG C 1 341 ? 15.679  -86.935  -46.630 1.00 54.93  ? 342 ARG C O   1 
ATOM   7887  C CB  . ARG C 1 341 ? 15.992  -85.778  -49.702 1.00 61.67  ? 342 ARG C CB  1 
ATOM   7888  C CG  . ARG C 1 341 ? 14.808  -84.941  -49.247 1.00 56.82  ? 342 ARG C CG  1 
ATOM   7889  C CD  . ARG C 1 341 ? 14.709  -83.652  -50.039 1.00 56.61  ? 342 ARG C CD  1 
ATOM   7890  N NE  . ARG C 1 341 ? 15.910  -82.846  -49.874 1.00 63.09  ? 342 ARG C NE  1 
ATOM   7891  C CZ  . ARG C 1 341 ? 16.089  -81.966  -48.895 1.00 59.56  ? 342 ARG C CZ  1 
ATOM   7892  N NH1 . ARG C 1 341 ? 15.135  -81.758  -47.997 1.00 56.97  ? 342 ARG C NH1 1 
ATOM   7893  N NH2 . ARG C 1 341 ? 17.222  -81.287  -48.821 1.00 51.47  ? 342 ARG C NH2 1 
ATOM   7894  N N   . MET C 1 342 ? 17.797  -86.618  -47.315 1.00 59.03  ? 343 MET C N   1 
ATOM   7895  C CA  . MET C 1 342 ? 18.225  -86.059  -46.047 1.00 55.65  ? 343 MET C CA  1 
ATOM   7896  C C   . MET C 1 342 ? 17.567  -84.697  -45.921 1.00 55.78  ? 343 MET C C   1 
ATOM   7897  O O   . MET C 1 342 ? 17.262  -84.055  -46.930 1.00 56.73  ? 343 MET C O   1 
ATOM   7898  C CB  . MET C 1 342 ? 19.745  -85.938  -45.973 1.00 53.02  ? 343 MET C CB  1 
ATOM   7899  C CG  . MET C 1 342 ? 20.356  -85.206  -47.149 1.00 53.55  ? 343 MET C CG  1 
ATOM   7900  S SD  . MET C 1 342 ? 21.942  -84.456  -46.759 1.00 50.94  ? 343 MET C SD  1 
ATOM   7901  C CE  . MET C 1 342 ? 21.411  -83.055  -45.780 1.00 48.05  ? 343 MET C CE  1 
ATOM   7902  N N   . THR C 1 343 ? 17.325  -84.268  -44.690 1.00 54.32  ? 344 THR C N   1 
ATOM   7903  C CA  . THR C 1 343 ? 16.794  -82.937  -44.452 1.00 52.90  ? 344 THR C CA  1 
ATOM   7904  C C   . THR C 1 343 ? 17.678  -82.237  -43.429 1.00 51.52  ? 344 THR C C   1 
ATOM   7905  O O   . THR C 1 343 ? 18.320  -82.888  -42.606 1.00 52.47  ? 344 THR C O   1 
ATOM   7906  C CB  . THR C 1 343 ? 15.329  -82.978  -43.966 1.00 52.49  ? 344 THR C CB  1 
ATOM   7907  O OG1 . THR C 1 343 ? 14.798  -81.648  -43.919 1.00 51.14  ? 344 THR C OG1 1 
ATOM   7908  C CG2 . THR C 1 343 ? 15.231  -83.611  -42.588 1.00 52.01  ? 344 THR C CG2 1 
ATOM   7909  N N   . GLY C 1 344 ? 17.726  -80.912  -43.493 1.00 50.38  ? 345 GLY C N   1 
ATOM   7910  C CA  . GLY C 1 344 ? 18.550  -80.142  -42.582 1.00 47.68  ? 345 GLY C CA  1 
ATOM   7911  C C   . GLY C 1 344 ? 20.026  -80.179  -42.942 1.00 48.63  ? 345 GLY C C   1 
ATOM   7912  O O   . GLY C 1 344 ? 20.386  -80.365  -44.101 1.00 50.31  ? 345 GLY C O   1 
ATOM   7913  N N   . GLY C 1 345 ? 20.881  -80.022  -41.936 1.00 47.26  ? 346 GLY C N   1 
ATOM   7914  C CA  . GLY C 1 345 ? 22.307  -79.844  -42.151 1.00 46.22  ? 346 GLY C CA  1 
ATOM   7915  C C   . GLY C 1 345 ? 23.030  -80.990  -42.826 1.00 46.33  ? 346 GLY C C   1 
ATOM   7916  O O   . GLY C 1 345 ? 23.838  -80.770  -43.730 1.00 46.96  ? 346 GLY C O   1 
ATOM   7917  N N   . GLY C 1 346 ? 22.749  -82.213  -42.385 1.00 46.09  ? 347 GLY C N   1 
ATOM   7918  C CA  . GLY C 1 346 ? 23.402  -83.392  -42.933 1.00 48.23  ? 347 GLY C CA  1 
ATOM   7919  C C   . GLY C 1 346 ? 24.353  -84.066  -41.959 1.00 47.77  ? 347 GLY C C   1 
ATOM   7920  O O   . GLY C 1 346 ? 24.345  -83.746  -40.770 1.00 44.71  ? 347 GLY C O   1 
ATOM   7921  N N   . PHE C 1 347 ? 25.160  -85.001  -42.463 1.00 50.31  ? 348 PHE C N   1 
ATOM   7922  C CA  . PHE C 1 347 ? 26.106  -85.774  -41.643 1.00 51.43  ? 348 PHE C CA  1 
ATOM   7923  C C   . PHE C 1 347 ? 25.400  -86.533  -40.523 1.00 50.02  ? 348 PHE C C   1 
ATOM   7924  O O   . PHE C 1 347 ? 26.010  -86.875  -39.513 1.00 49.92  ? 348 PHE C O   1 
ATOM   7925  C CB  . PHE C 1 347 ? 27.190  -84.866  -41.051 1.00 51.97  ? 348 PHE C CB  1 
ATOM   7926  C CG  . PHE C 1 347 ? 27.816  -83.948  -42.053 1.00 55.21  ? 348 PHE C CG  1 
ATOM   7927  C CD1 . PHE C 1 347 ? 28.651  -84.445  -43.038 1.00 58.93  ? 348 PHE C CD1 1 
ATOM   7928  C CD2 . PHE C 1 347 ? 27.565  -82.586  -42.015 1.00 55.55  ? 348 PHE C CD2 1 
ATOM   7929  C CE1 . PHE C 1 347 ? 29.222  -83.604  -43.973 1.00 61.22  ? 348 PHE C CE1 1 
ATOM   7930  C CE2 . PHE C 1 347 ? 28.134  -81.738  -42.943 1.00 57.58  ? 348 PHE C CE2 1 
ATOM   7931  C CZ  . PHE C 1 347 ? 28.963  -82.247  -43.925 1.00 60.30  ? 348 PHE C CZ  1 
ATOM   7932  N N   . GLY C 1 348 ? 24.115  -86.804  -40.719 1.00 49.40  ? 349 GLY C N   1 
ATOM   7933  C CA  . GLY C 1 348 ? 23.304  -87.461  -39.714 1.00 48.35  ? 349 GLY C CA  1 
ATOM   7934  C C   . GLY C 1 348 ? 21.948  -86.793  -39.626 1.00 48.23  ? 349 GLY C C   1 
ATOM   7935  O O   . GLY C 1 348 ? 21.527  -86.100  -40.553 1.00 50.53  ? 349 GLY C O   1 
ATOM   7936  N N   . GLY C 1 349 ? 21.258  -87.000  -38.513 1.00 45.82  ? 350 GLY C N   1 
ATOM   7937  C CA  . GLY C 1 349 ? 19.947  -86.412  -38.326 1.00 44.83  ? 350 GLY C CA  1 
ATOM   7938  C C   . GLY C 1 349 ? 18.850  -87.216  -38.994 1.00 46.32  ? 350 GLY C C   1 
ATOM   7939  O O   . GLY C 1 349 ? 18.805  -88.444  -38.880 1.00 47.29  ? 350 GLY C O   1 
ATOM   7940  N N   . CYS C 1 350 ? 17.972  -86.523  -39.712 1.00 46.22  ? 351 CYS C N   1 
ATOM   7941  C CA  . CYS C 1 350 ? 16.774  -87.150  -40.248 1.00 47.44  ? 351 CYS C CA  1 
ATOM   7942  C C   . CYS C 1 350 ? 16.680  -87.144  -41.766 1.00 48.06  ? 351 CYS C C   1 
ATOM   7943  O O   . CYS C 1 350 ? 17.305  -86.328  -42.444 1.00 47.82  ? 351 CYS C O   1 
ATOM   7944  C CB  . CYS C 1 350 ? 15.527  -86.468  -39.682 1.00 46.38  ? 351 CYS C CB  1 
ATOM   7945  S SG  . CYS C 1 350 ? 15.333  -86.622  -37.903 1.00 47.14  ? 351 CYS C SG  1 
ATOM   7946  N N   . THR C 1 351 ? 15.891  -88.079  -42.285 1.00 57.25  ? 352 THR C N   1 
ATOM   7947  C CA  . THR C 1 351 ? 15.446  -88.033  -43.668 1.00 56.55  ? 352 THR C CA  1 
ATOM   7948  C C   . THR C 1 351 ? 13.985  -87.620  -43.696 1.00 56.91  ? 352 THR C C   1 
ATOM   7949  O O   . THR C 1 351 ? 13.251  -87.837  -42.730 1.00 54.69  ? 352 THR C O   1 
ATOM   7950  C CB  . THR C 1 351 ? 15.591  -89.391  -44.393 1.00 55.04  ? 352 THR C CB  1 
ATOM   7951  O OG1 . THR C 1 351 ? 14.639  -90.324  -43.865 1.00 55.62  ? 352 THR C OG1 1 
ATOM   7952  C CG2 . THR C 1 351 ? 16.994  -89.944  -44.246 1.00 54.90  ? 352 THR C CG2 1 
ATOM   7953  N N   . VAL C 1 352 ? 13.568  -87.024  -44.805 1.00 55.69  ? 353 VAL C N   1 
ATOM   7954  C CA  . VAL C 1 352 ? 12.168  -86.685  -44.999 1.00 53.30  ? 353 VAL C CA  1 
ATOM   7955  C C   . VAL C 1 352 ? 11.669  -87.383  -46.259 1.00 56.22  ? 353 VAL C C   1 
ATOM   7956  O O   . VAL C 1 352 ? 12.384  -87.463  -47.258 1.00 57.59  ? 353 VAL C O   1 
ATOM   7957  C CB  . VAL C 1 352 ? 11.954  -85.156  -45.097 1.00 52.32  ? 353 VAL C CB  1 
ATOM   7958  C CG1 . VAL C 1 352 ? 12.807  -84.555  -46.204 1.00 53.45  ? 353 VAL C CG1 1 
ATOM   7959  C CG2 . VAL C 1 352 ? 10.483  -84.831  -45.302 1.00 55.68  ? 353 VAL C CG2 1 
ATOM   7960  N N   . THR C 1 353 ? 10.452  -87.913  -46.190 1.00 62.70  ? 354 THR C N   1 
ATOM   7961  C CA  . THR C 1 353 ? 9.870   -88.663  -47.299 1.00 65.00  ? 354 THR C CA  1 
ATOM   7962  C C   . THR C 1 353 ? 8.408   -88.293  -47.528 1.00 66.08  ? 354 THR C C   1 
ATOM   7963  O O   . THR C 1 353 ? 7.592   -88.377  -46.609 1.00 65.27  ? 354 THR C O   1 
ATOM   7964  C CB  . THR C 1 353 ? 9.955   -90.181  -47.054 1.00 61.89  ? 354 THR C CB  1 
ATOM   7965  O OG1 . THR C 1 353 ? 11.315  -90.558  -46.807 1.00 61.49  ? 354 THR C OG1 1 
ATOM   7966  C CG2 . THR C 1 353 ? 9.428   -90.948  -48.259 1.00 69.27  ? 354 THR C CG2 1 
ATOM   7967  N N   . LEU C 1 354 ? 8.078   -87.878  -48.749 1.00 68.09  ? 355 LEU C N   1 
ATOM   7968  C CA  . LEU C 1 354 ? 6.681   -87.670  -49.119 1.00 69.27  ? 355 LEU C CA  1 
ATOM   7969  C C   . LEU C 1 354 ? 6.155   -88.918  -49.813 1.00 74.16  ? 355 LEU C C   1 
ATOM   7970  O O   . LEU C 1 354 ? 6.822   -89.490  -50.678 1.00 74.17  ? 355 LEU C O   1 
ATOM   7971  C CB  . LEU C 1 354 ? 6.512   -86.441  -50.021 1.00 68.86  ? 355 LEU C CB  1 
ATOM   7972  N N   . LEU C 1 355 ? 4.955   -89.330  -49.419 1.00 78.49  ? 356 LEU C N   1 
ATOM   7973  C CA  . LEU C 1 355 ? 4.346   -90.559  -49.906 1.00 84.53  ? 356 LEU C CA  1 
ATOM   7974  C C   . LEU C 1 355 ? 2.841   -90.570  -49.697 1.00 86.95  ? 356 LEU C C   1 
ATOM   7975  O O   . LEU C 1 355 ? 2.299   -89.699  -49.019 1.00 84.41  ? 356 LEU C O   1 
ATOM   7976  C CB  . LEU C 1 355 ? 4.998   -91.766  -49.218 1.00 85.46  ? 356 LEU C CB  1 
ATOM   7977  C CG  . LEU C 1 355 ? 5.110   -91.804  -47.681 1.00 83.76  ? 356 LEU C CG  1 
ATOM   7978  C CD1 . LEU C 1 355 ? 3.823   -92.207  -47.004 1.00 84.28  ? 356 LEU C CD1 1 
ATOM   7979  C CD2 . LEU C 1 355 ? 6.200   -92.742  -47.243 1.00 84.09  ? 356 LEU C CD2 1 
ATOM   7980  N N   . GLU C 1 356 ? 2.177   -91.558  -50.288 1.00 92.24  ? 357 GLU C N   1 
ATOM   7981  C CA  . GLU C 1 356 ? 0.750   -91.763  -50.075 1.00 95.60  ? 357 GLU C CA  1 
ATOM   7982  C C   . GLU C 1 356 ? 0.521   -92.238  -48.644 1.00 95.69  ? 357 GLU C C   1 
ATOM   7983  O O   . GLU C 1 356 ? 0.998   -93.309  -48.259 1.00 97.03  ? 357 GLU C O   1 
ATOM   7984  C CB  . GLU C 1 356 ? 0.184   -92.778  -51.072 1.00 100.07 ? 357 GLU C CB  1 
ATOM   7985  C CG  . GLU C 1 356 ? 0.189   -92.324  -52.529 1.00 103.87 ? 357 GLU C CG  1 
ATOM   7986  C CD  . GLU C 1 356 ? -0.617  -91.056  -52.748 1.00 105.01 ? 357 GLU C CD  1 
ATOM   7987  O OE1 . GLU C 1 356 ? -1.677  -90.914  -52.111 1.00 105.05 ? 357 GLU C OE1 1 
ATOM   7988  O OE2 . GLU C 1 356 ? -0.197  -90.194  -53.545 1.00 106.05 ? 357 GLU C OE2 1 
ATOM   7989  N N   . ALA C 1 357 ? -0.208  -91.438  -47.869 1.00 93.78  ? 358 ALA C N   1 
ATOM   7990  C CA  . ALA C 1 357 ? -0.440  -91.687  -46.441 1.00 92.22  ? 358 ALA C CA  1 
ATOM   7991  C C   . ALA C 1 357 ? -0.707  -93.151  -46.083 1.00 94.30  ? 358 ALA C C   1 
ATOM   7992  O O   . ALA C 1 357 ? -0.277  -93.634  -45.036 1.00 92.77  ? 358 ALA C O   1 
ATOM   7993  C CB  . ALA C 1 357 ? -1.595  -90.821  -45.957 1.00 91.10  ? 358 ALA C CB  1 
ATOM   7994  N N   . SER C 1 358 ? -1.395  -93.859  -46.969 1.00 97.89  ? 359 SER C N   1 
ATOM   7995  C CA  . SER C 1 358 ? -1.697  -95.269  -46.744 1.00 100.46 ? 359 SER C CA  1 
ATOM   7996  C C   . SER C 1 358 ? -0.444  -96.147  -46.771 1.00 100.61 ? 359 SER C C   1 
ATOM   7997  O O   . SER C 1 358 ? -0.386  -97.171  -46.093 1.00 100.87 ? 359 SER C O   1 
ATOM   7998  C CB  . SER C 1 358 ? -2.702  -95.776  -47.783 1.00 103.48 ? 359 SER C CB  1 
ATOM   7999  O OG  . SER C 1 358 ? -2.186  -95.669  -49.098 1.00 104.74 ? 359 SER C OG  1 
ATOM   8000  N N   . ALA C 1 359 ? 0.556   -95.737  -47.547 1.00 101.42 ? 360 ALA C N   1 
ATOM   8001  C CA  . ALA C 1 359 ? 1.764   -96.538  -47.736 1.00 102.95 ? 360 ALA C CA  1 
ATOM   8002  C C   . ALA C 1 359 ? 2.844   -96.236  -46.699 1.00 100.48 ? 360 ALA C C   1 
ATOM   8003  O O   . ALA C 1 359 ? 3.952   -96.764  -46.779 1.00 100.35 ? 360 ALA C O   1 
ATOM   8004  C CB  . ALA C 1 359 ? 2.316   -96.326  -49.140 1.00 105.05 ? 360 ALA C CB  1 
ATOM   8005  N N   . ALA C 1 360 ? 2.521   -95.387  -45.729 1.00 98.25  ? 361 ALA C N   1 
ATOM   8006  C CA  . ALA C 1 360 ? 3.473   -95.023  -44.678 1.00 95.38  ? 361 ALA C CA  1 
ATOM   8007  C C   . ALA C 1 360 ? 3.838   -96.183  -43.735 1.00 95.67  ? 361 ALA C C   1 
ATOM   8008  O O   . ALA C 1 360 ? 5.012   -96.340  -43.395 1.00 93.30  ? 361 ALA C O   1 
ATOM   8009  C CB  . ALA C 1 360 ? 2.937   -93.842  -43.872 1.00 92.53  ? 361 ALA C CB  1 
ATOM   8010  N N   . PRO C 1 361 ? 2.847   -96.990  -43.296 1.00 98.68  ? 362 PRO C N   1 
ATOM   8011  C CA  . PRO C 1 361 ? 3.242   -98.104  -42.424 1.00 100.62 ? 362 PRO C CA  1 
ATOM   8012  C C   . PRO C 1 361 ? 4.123   -99.151  -43.110 1.00 104.28 ? 362 PRO C C   1 
ATOM   8013  O O   . PRO C 1 361 ? 4.989   -99.724  -42.450 1.00 103.13 ? 362 PRO C O   1 
ATOM   8014  C CB  . PRO C 1 361 ? 1.900   -98.717  -42.010 1.00 101.52 ? 362 PRO C CB  1 
ATOM   8015  C CG  . PRO C 1 361 ? 0.918   -97.621  -42.169 1.00 99.73  ? 362 PRO C CG  1 
ATOM   8016  C CD  . PRO C 1 361 ? 1.380   -96.862  -43.368 1.00 99.43  ? 362 PRO C CD  1 
ATOM   8017  N N   . HIS C 1 362 ? 3.912   -99.405  -44.398 1.00 109.21 ? 363 HIS C N   1 
ATOM   8018  C CA  . HIS C 1 362 ? 4.803   -100.311 -45.115 1.00 113.21 ? 363 HIS C CA  1 
ATOM   8019  C C   . HIS C 1 362 ? 6.178   -99.680  -45.199 1.00 113.11 ? 363 HIS C C   1 
ATOM   8020  O O   . HIS C 1 362 ? 7.198   -100.343 -45.010 1.00 113.76 ? 363 HIS C O   1 
ATOM   8021  C CB  . HIS C 1 362 ? 4.296   -100.627 -46.520 1.00 116.53 ? 363 HIS C CB  1 
ATOM   8022  C CG  . HIS C 1 362 ? 5.179   -101.573 -47.274 1.00 118.62 ? 363 HIS C CG  1 
ATOM   8023  N ND1 . HIS C 1 362 ? 5.263   -101.589 -48.644 1.00 120.81 ? 363 HIS C ND1 1 
ATOM   8024  C CD2 . HIS C 1 362 ? 6.008   -102.554 -46.833 1.00 119.12 ? 363 HIS C CD2 1 
ATOM   8025  C CE1 . HIS C 1 362 ? 6.121   -102.523 -49.025 1.00 122.57 ? 363 HIS C CE1 1 
ATOM   8026  N NE2 . HIS C 1 362 ? 6.582   -103.123 -47.938 1.00 121.59 ? 363 HIS C NE2 1 
ATOM   8027  N N   . ALA C 1 363 ? 6.184   -98.383  -45.485 1.00 113.91 ? 364 ALA C N   1 
ATOM   8028  C CA  . ALA C 1 363 ? 7.415   -97.616  -45.593 1.00 111.93 ? 364 ALA C CA  1 
ATOM   8029  C C   . ALA C 1 363 ? 8.138   -97.551  -44.256 1.00 109.65 ? 364 ALA C C   1 
ATOM   8030  O O   . ALA C 1 363 ? 9.348   -97.359  -44.211 1.00 108.70 ? 364 ALA C O   1 
ATOM   8031  C CB  . ALA C 1 363 ? 7.123   -96.217  -46.107 1.00 110.35 ? 364 ALA C CB  1 
ATOM   8032  N N   . MET C 1 364 ? 7.391   -97.705  -43.169 1.00 109.26 ? 365 MET C N   1 
ATOM   8033  C CA  . MET C 1 364 ? 7.991   -97.738  -41.845 1.00 107.45 ? 365 MET C CA  1 
ATOM   8034  C C   . MET C 1 364 ? 8.862   -98.979  -41.700 1.00 108.19 ? 365 MET C C   1 
ATOM   8035  O O   . MET C 1 364 ? 10.032  -98.886  -41.334 1.00 106.86 ? 365 MET C O   1 
ATOM   8036  C CB  . MET C 1 364 ? 6.914   -97.711  -40.759 1.00 107.31 ? 365 MET C CB  1 
ATOM   8037  N N   . ARG C 1 365 ? 8.285   -100.137 -42.005 1.00 110.37 ? 366 ARG C N   1 
ATOM   8038  C CA  . ARG C 1 365 ? 8.977   -101.414 -41.858 1.00 111.46 ? 366 ARG C CA  1 
ATOM   8039  C C   . ARG C 1 365 ? 10.207  -101.524 -42.757 1.00 111.77 ? 366 ARG C C   1 
ATOM   8040  O O   . ARG C 1 365 ? 11.317  -101.719 -42.264 1.00 110.05 ? 366 ARG C O   1 
ATOM   8041  C CB  . ARG C 1 365 ? 8.018   -102.571 -42.148 1.00 114.46 ? 366 ARG C CB  1 
ATOM   8042  N N   . HIS C 1 366 ? 10.001  -101.395 -44.069 1.00 113.92 ? 367 HIS C N   1 
ATOM   8043  C CA  . HIS C 1 366 ? 11.073  -101.551 -45.061 1.00 115.44 ? 367 HIS C CA  1 
ATOM   8044  C C   . HIS C 1 366 ? 12.238  -100.611 -44.772 1.00 112.41 ? 367 HIS C C   1 
ATOM   8045  O O   . HIS C 1 366 ? 13.401  -101.019 -44.822 1.00 113.36 ? 367 HIS C O   1 
ATOM   8046  C CB  . HIS C 1 366 ? 10.536  -101.309 -46.478 1.00 117.92 ? 367 HIS C CB  1 
ATOM   8047  C CG  . HIS C 1 366 ? 11.584  -101.305 -47.548 1.00 119.23 ? 367 HIS C CG  1 
ATOM   8048  N ND1 . HIS C 1 366 ? 12.691  -100.471 -47.533 1.00 117.44 ? 367 HIS C ND1 1 
ATOM   8049  C CD2 . HIS C 1 366 ? 11.713  -102.054 -48.667 1.00 122.02 ? 367 HIS C CD2 1 
ATOM   8050  C CE1 . HIS C 1 366 ? 13.433  -100.701 -48.592 1.00 119.04 ? 367 HIS C CE1 1 
ATOM   8051  N NE2 . HIS C 1 366 ? 12.862  -101.666 -49.303 1.00 121.81 ? 367 HIS C NE2 1 
ATOM   8052  N N   . ILE C 1 367 ? 11.922  -99.353  -44.479 1.00 109.38 ? 368 ILE C N   1 
ATOM   8053  C CA  . ILE C 1 367 ? 12.952  -98.375  -44.149 1.00 106.43 ? 368 ILE C CA  1 
ATOM   8054  C C   . ILE C 1 367 ? 13.695  -98.832  -42.904 1.00 105.47 ? 368 ILE C C   1 
ATOM   8055  O O   . ILE C 1 367 ? 14.922  -98.808  -42.860 1.00 105.09 ? 368 ILE C O   1 
ATOM   8056  C CB  . ILE C 1 367 ? 12.366  -96.972  -43.921 1.00 103.45 ? 368 ILE C CB  1 
ATOM   8057  N N   . GLN C 1 368 ? 12.936  -99.254  -41.898 1.00 99.36  ? 369 GLN C N   1 
ATOM   8058  C CA  . GLN C 1 368 ? 13.510  -99.806  -40.680 1.00 96.15  ? 369 GLN C CA  1 
ATOM   8059  C C   . GLN C 1 368 ? 14.241  -101.110 -40.986 1.00 97.34  ? 369 GLN C C   1 
ATOM   8060  O O   . GLN C 1 368 ? 15.341  -101.344 -40.484 1.00 96.98  ? 369 GLN C O   1 
ATOM   8061  C CB  . GLN C 1 368 ? 12.416  -100.029 -39.630 1.00 95.64  ? 369 GLN C CB  1 
ATOM   8062  C CG  . GLN C 1 368 ? 12.905  -100.451 -38.251 1.00 94.49  ? 369 GLN C CG  1 
ATOM   8063  C CD  . GLN C 1 368 ? 13.277  -101.915 -38.174 1.00 96.86  ? 369 GLN C CD  1 
ATOM   8064  O OE1 . GLN C 1 368 ? 12.608  -102.769 -38.756 1.00 99.74  ? 369 GLN C OE1 1 
ATOM   8065  N NE2 . GLN C 1 368 ? 14.353  -102.214 -37.459 1.00 95.78  ? 369 GLN C NE2 1 
ATOM   8066  N N   . GLU C 1 369 ? 13.621  -101.952 -41.811 1.00 98.11  ? 370 GLU C N   1 
ATOM   8067  C CA  . GLU C 1 369 ? 14.166  -103.263 -42.161 1.00 97.83  ? 370 GLU C CA  1 
ATOM   8068  C C   . GLU C 1 369 ? 15.567  -103.153 -42.743 1.00 94.55  ? 370 GLU C C   1 
ATOM   8069  O O   . GLU C 1 369 ? 16.465  -103.904 -42.368 1.00 94.56  ? 370 GLU C O   1 
ATOM   8070  C CB  . GLU C 1 369 ? 13.229  -103.972 -43.154 1.00 101.35 ? 370 GLU C CB  1 
ATOM   8071  C CG  . GLU C 1 369 ? 13.623  -105.390 -43.560 1.00 105.01 ? 370 GLU C CG  1 
ATOM   8072  C CD  . GLU C 1 369 ? 14.661  -105.438 -44.666 1.00 107.09 ? 370 GLU C CD  1 
ATOM   8073  O OE1 . GLU C 1 369 ? 14.765  -104.460 -45.439 1.00 106.70 ? 370 GLU C OE1 1 
ATOM   8074  O OE2 . GLU C 1 369 ? 15.373  -106.459 -44.761 1.00 109.24 ? 370 GLU C OE2 1 
ATOM   8075  N N   . HIS C 1 370 ? 15.749  -102.207 -43.657 1.00 91.73  ? 371 HIS C N   1 
ATOM   8076  C CA  . HIS C 1 370 ? 17.013  -102.065 -44.365 1.00 89.65  ? 371 HIS C CA  1 
ATOM   8077  C C   . HIS C 1 370 ? 17.949  -101.057 -43.706 1.00 84.18  ? 371 HIS C C   1 
ATOM   8078  O O   . HIS C 1 370 ? 18.967  -100.683 -44.287 1.00 84.84  ? 371 HIS C O   1 
ATOM   8079  C CB  . HIS C 1 370 ? 16.760  -101.660 -45.820 1.00 91.51  ? 371 HIS C CB  1 
ATOM   8080  N N   . TYR C 1 371 ? 17.616  -100.617 -42.495 1.00 78.80  ? 372 TYR C N   1 
ATOM   8081  C CA  . TYR C 1 371 ? 18.492  -99.695  -41.781 1.00 73.41  ? 372 TYR C CA  1 
ATOM   8082  C C   . TYR C 1 371 ? 19.309  -100.412 -40.715 1.00 72.40  ? 372 TYR C C   1 
ATOM   8083  O O   . TYR C 1 371 ? 18.763  -100.928 -39.739 1.00 71.77  ? 372 TYR C O   1 
ATOM   8084  C CB  . TYR C 1 371 ? 17.700  -98.554  -41.142 1.00 69.03  ? 372 TYR C CB  1 
ATOM   8085  C CG  . TYR C 1 371 ? 18.596  -97.492  -40.542 1.00 65.05  ? 372 TYR C CG  1 
ATOM   8086  C CD1 . TYR C 1 371 ? 19.666  -96.978  -41.263 1.00 64.04  ? 372 TYR C CD1 1 
ATOM   8087  C CD2 . TYR C 1 371 ? 18.374  -97.002  -39.262 1.00 62.48  ? 372 TYR C CD2 1 
ATOM   8088  C CE1 . TYR C 1 371 ? 20.493  -96.008  -40.727 1.00 61.48  ? 372 TYR C CE1 1 
ATOM   8089  C CE2 . TYR C 1 371 ? 19.195  -96.027  -38.717 1.00 59.75  ? 372 TYR C CE2 1 
ATOM   8090  C CZ  . TYR C 1 371 ? 20.253  -95.537  -39.454 1.00 59.52  ? 372 TYR C CZ  1 
ATOM   8091  O OH  . TYR C 1 371 ? 21.073  -94.571  -38.919 1.00 57.62  ? 372 TYR C OH  1 
ATOM   8092  N N   . GLY C 1 372 ? 20.623  -100.427 -40.911 1.00 72.45  ? 373 GLY C N   1 
ATOM   8093  C CA  . GLY C 1 372 ? 21.530  -101.101 -40.002 1.00 72.82  ? 373 GLY C CA  1 
ATOM   8094  C C   . GLY C 1 372 ? 21.546  -100.495 -38.614 1.00 70.78  ? 373 GLY C C   1 
ATOM   8095  O O   . GLY C 1 372 ? 21.784  -101.193 -37.628 1.00 71.45  ? 373 GLY C O   1 
ATOM   8096  N N   . GLY C 1 373 ? 21.296  -99.190  -38.538 1.00 68.08  ? 374 GLY C N   1 
ATOM   8097  C CA  . GLY C 1 373 ? 21.265  -98.494  -37.265 1.00 64.60  ? 374 GLY C CA  1 
ATOM   8098  C C   . GLY C 1 373 ? 19.880  -98.517  -36.650 1.00 64.24  ? 374 GLY C C   1 
ATOM   8099  O O   . GLY C 1 373 ? 19.063  -99.375  -36.976 1.00 65.71  ? 374 GLY C O   1 
ATOM   8100  N N   . THR C 1 374 ? 19.611  -97.567  -35.761 1.00 62.66  ? 375 THR C N   1 
ATOM   8101  C CA  . THR C 1 374 ? 18.316  -97.493  -35.092 1.00 62.53  ? 375 THR C CA  1 
ATOM   8102  C C   . THR C 1 374 ? 17.455  -96.377  -35.678 1.00 61.54  ? 375 THR C C   1 
ATOM   8103  O O   . THR C 1 374 ? 17.933  -95.266  -35.910 1.00 60.06  ? 375 THR C O   1 
ATOM   8104  C CB  . THR C 1 374 ? 18.481  -97.269  -33.578 1.00 60.83  ? 375 THR C CB  1 
ATOM   8105  O OG1 . THR C 1 374 ? 19.328  -98.289  -33.034 1.00 62.72  ? 375 THR C OG1 1 
ATOM   8106  C CG2 . THR C 1 374 ? 17.132  -97.308  -32.874 1.00 60.44  ? 375 THR C CG2 1 
ATOM   8107  N N   . ALA C 1 375 ? 16.183  -96.679  -35.909 1.00 61.75  ? 376 ALA C N   1 
ATOM   8108  C CA  . ALA C 1 375 ? 15.273  -95.720  -36.518 1.00 60.72  ? 376 ALA C CA  1 
ATOM   8109  C C   . ALA C 1 375 ? 14.237  -95.190  -35.529 1.00 59.30  ? 376 ALA C C   1 
ATOM   8110  O O   . ALA C 1 375 ? 13.695  -95.939  -34.714 1.00 60.47  ? 376 ALA C O   1 
ATOM   8111  C CB  . ALA C 1 375 ? 14.581  -96.347  -37.715 1.00 62.66  ? 376 ALA C CB  1 
ATOM   8112  N N   . THR C 1 376 ? 13.981  -93.888  -35.604 1.00 56.20  ? 377 THR C N   1 
ATOM   8113  C CA  . THR C 1 376 ? 12.873  -93.270  -34.888 1.00 55.03  ? 377 THR C CA  1 
ATOM   8114  C C   . THR C 1 376 ? 11.985  -92.556  -35.903 1.00 55.87  ? 377 THR C C   1 
ATOM   8115  O O   . THR C 1 376 ? 12.482  -91.849  -36.782 1.00 56.03  ? 377 THR C O   1 
ATOM   8116  C CB  . THR C 1 376 ? 13.360  -92.279  -33.811 1.00 53.17  ? 377 THR C CB  1 
ATOM   8117  O OG1 . THR C 1 376 ? 14.071  -92.989  -32.788 1.00 52.25  ? 377 THR C OG1 1 
ATOM   8118  C CG2 . THR C 1 376 ? 12.181  -91.548  -33.185 1.00 52.82  ? 377 THR C CG2 1 
ATOM   8119  N N   . PHE C 1 377 ? 10.674  -92.754  -35.796 1.00 56.14  ? 378 PHE C N   1 
ATOM   8120  C CA  . PHE C 1 377 ? 9.752   -92.211  -36.786 1.00 56.31  ? 378 PHE C CA  1 
ATOM   8121  C C   . PHE C 1 377 ? 8.908   -91.066  -36.262 1.00 56.25  ? 378 PHE C C   1 
ATOM   8122  O O   . PHE C 1 377 ? 8.513   -91.046  -35.096 1.00 55.63  ? 378 PHE C O   1 
ATOM   8123  C CB  . PHE C 1 377 ? 8.826   -93.308  -37.311 1.00 57.46  ? 378 PHE C CB  1 
ATOM   8124  C CG  . PHE C 1 377 ? 9.536   -94.385  -38.062 1.00 58.77  ? 378 PHE C CG  1 
ATOM   8125  C CD1 . PHE C 1 377 ? 10.206  -94.096  -39.237 1.00 59.24  ? 378 PHE C CD1 1 
ATOM   8126  C CD2 . PHE C 1 377 ? 9.532   -95.687  -37.597 1.00 60.15  ? 378 PHE C CD2 1 
ATOM   8127  C CE1 . PHE C 1 377 ? 10.865  -95.088  -39.934 1.00 61.79  ? 378 PHE C CE1 1 
ATOM   8128  C CE2 . PHE C 1 377 ? 10.186  -96.685  -38.288 1.00 62.23  ? 378 PHE C CE2 1 
ATOM   8129  C CZ  . PHE C 1 377 ? 10.853  -96.386  -39.460 1.00 63.12  ? 378 PHE C CZ  1 
ATOM   8130  N N   . TYR C 1 378 ? 8.641   -90.114  -37.150 1.00 56.71  ? 379 TYR C N   1 
ATOM   8131  C CA  . TYR C 1 378 ? 7.687   -89.049  -36.894 1.00 55.86  ? 379 TYR C CA  1 
ATOM   8132  C C   . TYR C 1 378 ? 6.744   -88.912  -38.081 1.00 57.38  ? 379 TYR C C   1 
ATOM   8133  O O   . TYR C 1 378 ? 7.165   -88.542  -39.176 1.00 57.32  ? 379 TYR C O   1 
ATOM   8134  C CB  . TYR C 1 378 ? 8.398   -87.719  -36.640 1.00 54.34  ? 379 TYR C CB  1 
ATOM   8135  C CG  . TYR C 1 378 ? 9.436   -87.770  -35.547 1.00 54.65  ? 379 TYR C CG  1 
ATOM   8136  C CD1 . TYR C 1 378 ? 9.064   -87.777  -34.209 1.00 54.68  ? 379 TYR C CD1 1 
ATOM   8137  C CD2 . TYR C 1 378 ? 10.789  -87.800  -35.851 1.00 54.87  ? 379 TYR C CD2 1 
ATOM   8138  C CE1 . TYR C 1 378 ? 10.014  -87.818  -33.204 1.00 54.10  ? 379 TYR C CE1 1 
ATOM   8139  C CE2 . TYR C 1 378 ? 11.742  -87.843  -34.856 1.00 54.58  ? 379 TYR C CE2 1 
ATOM   8140  C CZ  . TYR C 1 378 ? 11.351  -87.851  -33.536 1.00 54.48  ? 379 TYR C CZ  1 
ATOM   8141  O OH  . TYR C 1 378 ? 12.308  -87.894  -32.547 1.00 54.59  ? 379 TYR C OH  1 
ATOM   8142  N N   . LEU C 1 379 ? 5.472   -89.227  -37.866 1.00 59.11  ? 380 LEU C N   1 
ATOM   8143  C CA  . LEU C 1 379 ? 4.449   -88.936  -38.862 1.00 61.32  ? 380 LEU C CA  1 
ATOM   8144  C C   . LEU C 1 379 ? 3.917   -87.536  -38.590 1.00 59.88  ? 380 LEU C C   1 
ATOM   8145  O O   . LEU C 1 379 ? 3.153   -87.320  -37.650 1.00 58.64  ? 380 LEU C O   1 
ATOM   8146  C CB  . LEU C 1 379 ? 3.330   -89.974  -38.827 1.00 63.72  ? 380 LEU C CB  1 
ATOM   8147  C CG  . LEU C 1 379 ? 3.588   -91.204  -39.696 1.00 67.37  ? 380 LEU C CG  1 
ATOM   8148  C CD1 . LEU C 1 379 ? 2.506   -92.245  -39.475 1.00 70.09  ? 380 LEU C CD1 1 
ATOM   8149  C CD2 . LEU C 1 379 ? 3.667   -90.809  -41.166 1.00 68.90  ? 380 LEU C CD2 1 
ATOM   8150  N N   . SER C 1 380 ? 4.331   -86.587  -39.422 1.00 60.15  ? 381 SER C N   1 
ATOM   8151  C CA  . SER C 1 380 ? 4.224   -85.176  -39.073 1.00 58.00  ? 381 SER C CA  1 
ATOM   8152  C C   . SER C 1 380 ? 3.142   -84.422  -39.836 1.00 55.51  ? 381 SER C C   1 
ATOM   8153  O O   . SER C 1 380 ? 3.199   -84.308  -41.057 1.00 53.69  ? 381 SER C O   1 
ATOM   8154  C CB  . SER C 1 380 ? 5.572   -84.494  -39.309 1.00 59.27  ? 381 SER C CB  1 
ATOM   8155  O OG  . SER C 1 380 ? 6.639   -85.313  -38.856 1.00 61.06  ? 381 SER C OG  1 
ATOM   8156  N N   . GLN C 1 381 ? 2.162   -83.900  -39.108 1.00 55.79  ? 382 GLN C N   1 
ATOM   8157  C CA  . GLN C 1 381 ? 1.217   -82.963  -39.691 1.00 57.32  ? 382 GLN C CA  1 
ATOM   8158  C C   . GLN C 1 381 ? 1.848   -81.578  -39.675 1.00 53.12  ? 382 GLN C C   1 
ATOM   8159  O O   . GLN C 1 381 ? 2.548   -81.227  -38.726 1.00 50.07  ? 382 GLN C O   1 
ATOM   8160  C CB  . GLN C 1 381 ? -0.110  -82.961  -38.930 1.00 60.12  ? 382 GLN C CB  1 
ATOM   8161  C CG  . GLN C 1 381 ? -1.319  -83.250  -39.814 1.00 65.41  ? 382 GLN C CG  1 
ATOM   8162  C CD  . GLN C 1 381 ? -2.610  -82.709  -39.232 1.00 67.00  ? 382 GLN C CD  1 
ATOM   8163  O OE1 . GLN C 1 381 ? -2.650  -82.271  -38.081 1.00 66.68  ? 382 GLN C OE1 1 
ATOM   8164  N NE2 . GLN C 1 381 ? -3.671  -82.724  -40.031 1.00 68.61  ? 382 GLN C NE2 1 
ATOM   8165  N N   . ALA C 1 382 ? 1.620   -80.806  -40.735 1.00 51.75  ? 383 ALA C N   1 
ATOM   8166  C CA  . ALA C 1 382 ? 2.119   -79.437  -40.805 1.00 48.44  ? 383 ALA C CA  1 
ATOM   8167  C C   . ALA C 1 382 ? 1.537   -78.631  -39.651 1.00 45.73  ? 383 ALA C C   1 
ATOM   8168  O O   . ALA C 1 382 ? 0.326   -78.633  -39.439 1.00 46.75  ? 383 ALA C O   1 
ATOM   8169  C CB  . ALA C 1 382 ? 1.766   -78.803  -42.145 1.00 48.94  ? 383 ALA C CB  1 
ATOM   8170  N N   . ALA C 1 383 ? 2.397   -77.947  -38.902 1.00 42.56  ? 384 ALA C N   1 
ATOM   8171  C CA  . ALA C 1 383 ? 1.982   -77.375  -37.621 1.00 40.48  ? 384 ALA C CA  1 
ATOM   8172  C C   . ALA C 1 383 ? 2.154   -75.861  -37.517 1.00 39.16  ? 384 ALA C C   1 
ATOM   8173  O O   . ALA C 1 383 ? 2.815   -75.233  -38.341 1.00 37.74  ? 384 ALA C O   1 
ATOM   8174  C CB  . ALA C 1 383 ? 2.741   -78.053  -36.490 1.00 39.20  ? 384 ALA C CB  1 
ATOM   8175  N N   . ASP C 1 384 ? 1.544   -75.289  -36.483 1.00 40.79  ? 385 ASP C N   1 
ATOM   8176  C CA  . ASP C 1 384 ? 1.669   -73.867  -36.179 1.00 41.42  ? 385 ASP C CA  1 
ATOM   8177  C C   . ASP C 1 384 ? 3.096   -73.448  -35.854 1.00 39.68  ? 385 ASP C C   1 
ATOM   8178  O O   . ASP C 1 384 ? 3.927   -74.271  -35.463 1.00 39.98  ? 385 ASP C O   1 
ATOM   8179  C CB  . ASP C 1 384 ? 0.775   -73.493  -34.996 1.00 41.87  ? 385 ASP C CB  1 
ATOM   8180  C CG  . ASP C 1 384 ? -0.690  -73.445  -35.360 1.00 44.00  ? 385 ASP C CG  1 
ATOM   8181  O OD1 . ASP C 1 384 ? -1.004  -73.261  -36.558 1.00 44.33  ? 385 ASP C OD1 1 
ATOM   8182  O OD2 . ASP C 1 384 ? -1.526  -73.583  -34.440 1.00 43.79  ? 385 ASP C OD2 1 
ATOM   8183  N N   . GLY C 1 385 ? 3.360   -72.154  -36.004 1.00 36.71  ? 386 GLY C N   1 
ATOM   8184  C CA  . GLY C 1 385 ? 4.625   -71.574  -35.603 1.00 35.86  ? 386 GLY C CA  1 
ATOM   8185  C C   . GLY C 1 385 ? 4.562   -71.157  -34.144 1.00 33.70  ? 386 GLY C C   1 
ATOM   8186  O O   . GLY C 1 385 ? 3.930   -71.835  -33.331 1.00 32.04  ? 386 GLY C O   1 
ATOM   8187  N N   . ALA C 1 386 ? 5.201   -70.039  -33.814 1.00 33.56  ? 387 ALA C N   1 
ATOM   8188  C CA  . ALA C 1 386 ? 5.262   -69.575  -32.424 1.00 33.65  ? 387 ALA C CA  1 
ATOM   8189  C C   . ALA C 1 386 ? 3.870   -69.242  -31.904 1.00 36.52  ? 387 ALA C C   1 
ATOM   8190  O O   . ALA C 1 386 ? 3.082   -68.604  -32.597 1.00 36.05  ? 387 ALA C O   1 
ATOM   8191  C CB  . ALA C 1 386 ? 6.173   -68.365  -32.302 1.00 31.12  ? 387 ALA C CB  1 
ATOM   8192  N N   . LYS C 1 387 ? 3.570   -69.680  -30.685 1.00 36.21  ? 388 LYS C N   1 
ATOM   8193  C CA  . LYS C 1 387 ? 2.258   -69.446  -30.100 1.00 38.13  ? 388 LYS C CA  1 
ATOM   8194  C C   . LYS C 1 387 ? 2.371   -69.020  -28.640 1.00 38.33  ? 388 LYS C C   1 
ATOM   8195  O O   . LYS C 1 387 ? 3.359   -69.313  -27.970 1.00 37.37  ? 388 LYS C O   1 
ATOM   8196  C CB  . LYS C 1 387 ? 1.382   -70.701  -30.218 1.00 41.07  ? 388 LYS C CB  1 
ATOM   8197  C CG  . LYS C 1 387 ? 0.848   -70.950  -31.629 1.00 44.75  ? 388 LYS C CG  1 
ATOM   8198  C CD  . LYS C 1 387 ? -0.271  -71.991  -31.648 1.00 46.02  ? 388 LYS C CD  1 
ATOM   8199  C CE  . LYS C 1 387 ? 0.260   -73.399  -31.416 1.00 47.27  ? 388 LYS C CE  1 
ATOM   8200  N NZ  . LYS C 1 387 ? -0.752  -74.438  -31.772 1.00 48.69  ? 388 LYS C NZ  1 
ATOM   8201  N N   . VAL C 1 388 ? 1.350   -68.314  -28.167 1.00 37.27  ? 389 VAL C N   1 
ATOM   8202  C CA  . VAL C 1 388 ? 1.292   -67.831  -26.798 1.00 35.57  ? 389 VAL C CA  1 
ATOM   8203  C C   . VAL C 1 388 ? 0.012   -68.336  -26.153 1.00 35.77  ? 389 VAL C C   1 
ATOM   8204  O O   . VAL C 1 388 ? -1.033  -68.400  -26.807 1.00 34.91  ? 389 VAL C O   1 
ATOM   8205  C CB  . VAL C 1 388 ? 1.331   -66.282  -26.736 1.00 42.02  ? 389 VAL C CB  1 
ATOM   8206  C CG1 . VAL C 1 388 ? 1.271   -65.790  -25.293 1.00 41.38  ? 389 VAL C CG1 1 
ATOM   8207  C CG2 . VAL C 1 388 ? 2.573   -65.753  -27.423 1.00 42.59  ? 389 VAL C CG2 1 
ATOM   8208  N N   . LEU C 1 389 ? 0.096   -68.702  -24.876 1.00 37.48  ? 390 LEU C N   1 
ATOM   8209  C CA  . LEU C 1 389 ? -1.080  -69.060  -24.098 1.00 38.93  ? 390 LEU C CA  1 
ATOM   8210  C C   . LEU C 1 389 ? -0.959  -68.483  -22.690 1.00 41.49  ? 390 LEU C C   1 
ATOM   8211  O O   . LEU C 1 389 ? -0.115  -68.915  -21.906 1.00 42.11  ? 390 LEU C O   1 
ATOM   8212  C CB  . LEU C 1 389 ? -1.260  -70.577  -24.039 1.00 39.41  ? 390 LEU C CB  1 
ATOM   8213  C CG  . LEU C 1 389 ? -2.515  -71.052  -23.297 1.00 40.68  ? 390 LEU C CG  1 
ATOM   8214  C CD1 . LEU C 1 389 ? -3.775  -70.612  -24.035 1.00 41.05  ? 390 LEU C CD1 1 
ATOM   8215  C CD2 . LEU C 1 389 ? -2.511  -72.566  -23.071 1.00 40.38  ? 390 LEU C CD2 1 
ATOM   8216  N N   . CYS C 1 390 ? -1.793  -67.496  -22.381 1.00 41.48  ? 391 CYS C N   1 
ATOM   8217  C CA  . CYS C 1 390 ? -1.762  -66.853  -21.077 1.00 42.89  ? 391 CYS C CA  1 
ATOM   8218  C C   . CYS C 1 390 ? -2.344  -67.806  -20.041 1.00 44.13  ? 391 CYS C C   1 
ATOM   8219  O O   . CYS C 1 390 ? -3.351  -68.466  -20.295 1.00 44.39  ? 391 CYS C O   1 
ATOM   8220  C CB  . CYS C 1 390 ? -2.535  -65.533  -21.106 1.00 42.89  ? 391 CYS C CB  1 
ATOM   8221  S SG  . CYS C 1 390 ? -2.060  -64.429  -22.476 1.00 45.51  ? 391 CYS C SG  1 
ATOM   8222  N N   . LEU C 1 391 ? -1.699  -67.896  -18.884 1.00 45.70  ? 392 LEU C N   1 
ATOM   8223  C CA  . LEU C 1 391 ? -2.134  -68.834  -17.852 1.00 47.65  ? 392 LEU C CA  1 
ATOM   8224  C C   . LEU C 1 391 ? -2.712  -68.106  -16.645 1.00 48.91  ? 392 LEU C C   1 
ATOM   8225  O O   . LEU C 1 391 ? -2.565  -66.889  -16.516 1.00 46.98  ? 392 LEU C O   1 
ATOM   8226  C CB  . LEU C 1 391 ? -0.970  -69.732  -17.421 1.00 48.17  ? 392 LEU C CB  1 
ATOM   8227  C CG  . LEU C 1 391 ? -0.311  -70.540  -18.542 1.00 47.52  ? 392 LEU C CG  1 
ATOM   8228  C CD1 . LEU C 1 391 ? 0.904   -71.303  -18.032 1.00 47.44  ? 392 LEU C CD1 1 
ATOM   8229  C CD2 . LEU C 1 391 ? -1.313  -71.490  -19.174 1.00 47.28  ? 392 LEU C CD2 1 
ATOM   8230  O OXT . LEU C 1 391 ? -3.339  -68.720  -15.776 1.00 52.22  ? 392 LEU C OXT 1 
ATOM   8231  N N   . GLN D 1 7   ? 20.571  2.578    -7.910  1.00 92.24  ? 8   GLN D N   1 
ATOM   8232  C CA  . GLN D 1 7   ? 21.917  2.408    -7.374  1.00 91.85  ? 8   GLN D CA  1 
ATOM   8233  C C   . GLN D 1 7   ? 22.145  0.975    -6.897  1.00 92.34  ? 8   GLN D C   1 
ATOM   8234  O O   . GLN D 1 7   ? 21.306  0.400    -6.203  1.00 94.22  ? 8   GLN D O   1 
ATOM   8235  C CB  . GLN D 1 7   ? 22.168  3.392    -6.230  1.00 93.04  ? 8   GLN D CB  1 
ATOM   8236  N N   . VAL D 1 8   ? 23.294  0.416    -7.268  1.00 90.04  ? 9   VAL D N   1 
ATOM   8237  C CA  . VAL D 1 8   ? 23.604  -0.990   -7.018  1.00 88.90  ? 9   VAL D CA  1 
ATOM   8238  C C   . VAL D 1 8   ? 23.765  -1.332   -5.539  1.00 89.26  ? 9   VAL D C   1 
ATOM   8239  O O   . VAL D 1 8   ? 23.391  -2.423   -5.104  1.00 89.91  ? 9   VAL D O   1 
ATOM   8240  C CB  . VAL D 1 8   ? 24.896  -1.405   -7.747  1.00 86.81  ? 9   VAL D CB  1 
ATOM   8241  N N   . ALA D 1 9   ? 24.329  -0.401   -4.776  1.00 88.41  ? 10  ALA D N   1 
ATOM   8242  C CA  . ALA D 1 9   ? 24.651  -0.641   -3.373  1.00 88.53  ? 10  ALA D CA  1 
ATOM   8243  C C   . ALA D 1 9   ? 23.421  -1.013   -2.551  1.00 88.97  ? 10  ALA D C   1 
ATOM   8244  O O   . ALA D 1 9   ? 23.499  -1.847   -1.649  1.00 90.26  ? 10  ALA D O   1 
ATOM   8245  C CB  . ALA D 1 9   ? 25.331  0.582    -2.776  1.00 88.91  ? 10  ALA D CB  1 
ATOM   8246  N N   . GLU D 1 10  ? 22.285  -0.403   -2.874  1.00 87.48  ? 11  GLU D N   1 
ATOM   8247  C CA  . GLU D 1 10  ? 21.060  -0.618   -2.111  1.00 88.14  ? 11  GLU D CA  1 
ATOM   8248  C C   . GLU D 1 10  ? 20.446  -1.998   -2.357  1.00 87.55  ? 11  GLU D C   1 
ATOM   8249  O O   . GLU D 1 10  ? 19.492  -2.386   -1.683  1.00 89.43  ? 11  GLU D O   1 
ATOM   8250  C CB  . GLU D 1 10  ? 20.037  0.473    -2.440  1.00 88.13  ? 11  GLU D CB  1 
ATOM   8251  N N   . LEU D 1 11  ? 20.996  -2.734   -3.319  1.00 84.54  ? 12  LEU D N   1 
ATOM   8252  C CA  . LEU D 1 11  ? 20.490  -4.064   -3.655  1.00 83.43  ? 12  LEU D CA  1 
ATOM   8253  C C   . LEU D 1 11  ? 21.184  -5.161   -2.854  1.00 81.81  ? 12  LEU D C   1 
ATOM   8254  O O   . LEU D 1 11  ? 20.542  -6.095   -2.374  1.00 83.40  ? 12  LEU D O   1 
ATOM   8255  C CB  . LEU D 1 11  ? 20.657  -4.344   -5.151  1.00 82.26  ? 12  LEU D CB  1 
ATOM   8256  C CG  . LEU D 1 11  ? 19.589  -3.835   -6.119  1.00 82.68  ? 12  LEU D CG  1 
ATOM   8257  C CD1 . LEU D 1 11  ? 19.640  -2.322   -6.261  1.00 82.35  ? 12  LEU D CD1 1 
ATOM   8258  C CD2 . LEU D 1 11  ? 19.753  -4.511   -7.474  1.00 81.48  ? 12  LEU D CD2 1 
ATOM   8259  N N   . LEU D 1 12  ? 22.499  -5.038   -2.718  1.00 78.85  ? 13  LEU D N   1 
ATOM   8260  C CA  . LEU D 1 12  ? 23.315  -6.052   -2.059  1.00 77.99  ? 13  LEU D CA  1 
ATOM   8261  C C   . LEU D 1 12  ? 22.948  -6.230   -0.583  1.00 80.58  ? 13  LEU D C   1 
ATOM   8262  O O   . LEU D 1 12  ? 23.185  -7.290   0.002   1.00 81.30  ? 13  LEU D O   1 
ATOM   8263  C CB  . LEU D 1 12  ? 24.796  -5.691   -2.198  1.00 75.19  ? 13  LEU D CB  1 
ATOM   8264  C CG  . LEU D 1 12  ? 25.836  -6.639   -1.596  1.00 74.52  ? 13  LEU D CG  1 
ATOM   8265  C CD1 . LEU D 1 12  ? 25.585  -8.075   -2.031  1.00 73.83  ? 13  LEU D CD1 1 
ATOM   8266  C CD2 . LEU D 1 12  ? 27.234  -6.193   -1.990  1.00 73.04  ? 13  LEU D CD2 1 
ATOM   8267  N N   . ALA D 1 13  ? 22.364  -5.191   0.008   1.00 81.92  ? 14  ALA D N   1 
ATOM   8268  C CA  . ALA D 1 13  ? 21.951  -5.230   1.407   1.00 84.63  ? 14  ALA D CA  1 
ATOM   8269  C C   . ALA D 1 13  ? 20.988  -6.385   1.675   1.00 86.54  ? 14  ALA D C   1 
ATOM   8270  O O   . ALA D 1 13  ? 21.175  -7.153   2.619   1.00 88.39  ? 14  ALA D O   1 
ATOM   8271  C CB  . ALA D 1 13  ? 21.313  -3.906   1.805   1.00 85.24  ? 14  ALA D CB  1 
ATOM   8272  N N   . GLU D 1 14  ? 19.965  -6.507   0.833   1.00 85.93  ? 15  GLU D N   1 
ATOM   8273  C CA  . GLU D 1 14  ? 18.974  -7.569   0.971   1.00 86.89  ? 15  GLU D CA  1 
ATOM   8274  C C   . GLU D 1 14  ? 19.557  -8.923   0.576   1.00 85.54  ? 15  GLU D C   1 
ATOM   8275  O O   . GLU D 1 14  ? 20.033  -9.677   1.427   1.00 85.62  ? 15  GLU D O   1 
ATOM   8276  C CB  . GLU D 1 14  ? 17.740  -7.263   0.122   1.00 87.03  ? 15  GLU D CB  1 
ATOM   8277  N N   . GLU D 1 26  ? 23.929  -14.583  8.502   1.00 92.58  ? 27  GLU D N   1 
ATOM   8278  C CA  . GLU D 1 26  ? 24.330  -13.927  7.264   1.00 90.48  ? 27  GLU D CA  1 
ATOM   8279  C C   . GLU D 1 26  ? 24.799  -14.928  6.210   1.00 86.90  ? 27  GLU D C   1 
ATOM   8280  O O   . GLU D 1 26  ? 25.293  -16.005  6.544   1.00 87.91  ? 27  GLU D O   1 
ATOM   8281  C CB  . GLU D 1 26  ? 25.435  -12.902  7.532   1.00 91.67  ? 27  GLU D CB  1 
ATOM   8282  C CG  . GLU D 1 26  ? 25.161  -11.973  8.697   1.00 95.36  ? 27  GLU D CG  1 
ATOM   8283  C CD  . GLU D 1 26  ? 26.182  -10.856  8.788   1.00 96.07  ? 27  GLU D CD  1 
ATOM   8284  O OE1 . GLU D 1 26  ? 27.314  -11.118  9.249   1.00 96.99  ? 27  GLU D OE1 1 
ATOM   8285  O OE2 . GLU D 1 26  ? 25.855  -9.716   8.394   1.00 95.71  ? 27  GLU D OE2 1 
ATOM   8286  N N   . PRO D 1 27  ? 24.634  -14.574  4.927   1.00 82.80  ? 28  PRO D N   1 
ATOM   8287  C CA  . PRO D 1 27  ? 25.090  -15.415  3.818   1.00 78.46  ? 28  PRO D CA  1 
ATOM   8288  C C   . PRO D 1 27  ? 26.594  -15.299  3.593   1.00 73.67  ? 28  PRO D C   1 
ATOM   8289  O O   . PRO D 1 27  ? 27.197  -14.290  3.959   1.00 72.71  ? 28  PRO D O   1 
ATOM   8290  C CB  . PRO D 1 27  ? 24.319  -14.856  2.626   1.00 78.52  ? 28  PRO D CB  1 
ATOM   8291  C CG  . PRO D 1 27  ? 24.164  -13.412  2.964   1.00 79.30  ? 28  PRO D CG  1 
ATOM   8292  C CD  . PRO D 1 27  ? 23.917  -13.380  4.444   1.00 81.96  ? 28  PRO D CD  1 
ATOM   8293  N N   . GLU D 1 28  ? 27.186  -16.324  2.990   1.00 70.79  ? 29  GLU D N   1 
ATOM   8294  C CA  . GLU D 1 28  ? 28.618  -16.331  2.727   1.00 68.37  ? 29  GLU D CA  1 
ATOM   8295  C C   . GLU D 1 28  ? 28.939  -15.918  1.292   1.00 65.94  ? 29  GLU D C   1 
ATOM   8296  O O   . GLU D 1 28  ? 30.086  -15.591  0.983   1.00 65.30  ? 29  GLU D O   1 
ATOM   8297  C CB  . GLU D 1 28  ? 29.199  -17.716  3.005   1.00 69.56  ? 29  GLU D CB  1 
ATOM   8298  N N   . LEU D 1 29  ? 27.924  -15.939  0.428   1.00 64.08  ? 30  LEU D N   1 
ATOM   8299  C CA  . LEU D 1 29  ? 28.105  -15.739  -1.016  1.00 63.51  ? 30  LEU D CA  1 
ATOM   8300  C C   . LEU D 1 29  ? 27.222  -14.634  -1.589  1.00 60.78  ? 30  LEU D C   1 
ATOM   8301  O O   . LEU D 1 29  ? 26.096  -14.431  -1.140  1.00 61.38  ? 30  LEU D O   1 
ATOM   8302  C CB  . LEU D 1 29  ? 27.804  -17.037  -1.771  1.00 65.66  ? 30  LEU D CB  1 
ATOM   8303  C CG  . LEU D 1 29  ? 28.908  -18.047  -2.088  1.00 67.35  ? 30  LEU D CG  1 
ATOM   8304  C CD1 . LEU D 1 29  ? 29.764  -18.334  -0.879  1.00 69.65  ? 30  LEU D CD1 1 
ATOM   8305  C CD2 . LEU D 1 29  ? 28.277  -19.333  -2.598  1.00 68.82  ? 30  LEU D CD2 1 
ATOM   8306  N N   . ALA D 1 30  ? 27.728  -13.939  -2.602  1.00 59.62  ? 31  ALA D N   1 
ATOM   8307  C CA  . ALA D 1 30  ? 26.920  -12.965  -3.332  1.00 58.96  ? 31  ALA D CA  1 
ATOM   8308  C C   . ALA D 1 30  ? 27.290  -12.953  -4.815  1.00 56.66  ? 31  ALA D C   1 
ATOM   8309  O O   . ALA D 1 30  ? 28.456  -12.803  -5.168  1.00 53.08  ? 31  ALA D O   1 
ATOM   8310  C CB  . ALA D 1 30  ? 27.084  -11.576  -2.728  1.00 58.67  ? 31  ALA D CB  1 
ATOM   8311  N N   . VAL D 1 31  ? 26.296  -13.129  -5.680  1.00 54.22  ? 32  VAL D N   1 
ATOM   8312  C CA  . VAL D 1 31  ? 26.521  -13.056  -7.123  1.00 52.30  ? 32  VAL D CA  1 
ATOM   8313  C C   . VAL D 1 31  ? 25.520  -12.124  -7.783  1.00 52.63  ? 32  VAL D C   1 
ATOM   8314  O O   . VAL D 1 31  ? 24.530  -11.717  -7.171  1.00 54.13  ? 32  VAL D O   1 
ATOM   8315  C CB  . VAL D 1 31  ? 26.411  -14.433  -7.803  1.00 52.33  ? 32  VAL D CB  1 
ATOM   8316  C CG1 . VAL D 1 31  ? 27.430  -15.404  -7.232  1.00 52.64  ? 32  VAL D CG1 1 
ATOM   8317  C CG2 . VAL D 1 31  ? 24.997  -14.978  -7.661  1.00 54.10  ? 32  VAL D CG2 1 
ATOM   8318  N N   . SER D 1 32  ? 25.774  -11.801  -9.043  1.00 50.57  ? 33  SER D N   1 
ATOM   8319  C CA  . SER D 1 32  ? 24.847  -10.986  -9.807  1.00 49.53  ? 33  SER D CA  1 
ATOM   8320  C C   . SER D 1 32  ? 24.987  -11.253  -11.296 1.00 51.42  ? 33  SER D C   1 
ATOM   8321  O O   . SER D 1 32  ? 26.025  -11.722  -11.759 1.00 46.79  ? 33  SER D O   1 
ATOM   8322  C CB  . SER D 1 32  ? 25.068  -9.500   -9.517  1.00 55.56  ? 33  SER D CB  1 
ATOM   8323  O OG  . SER D 1 32  ? 26.371  -9.097   -9.899  1.00 54.59  ? 33  SER D OG  1 
ATOM   8324  N N   . ALA D 1 33  ? 23.917  -10.968  -12.031 1.00 51.09  ? 34  ALA D N   1 
ATOM   8325  C CA  . ALA D 1 33  ? 23.941  -10.983  -13.485 1.00 49.30  ? 34  ALA D CA  1 
ATOM   8326  C C   . ALA D 1 33  ? 23.035  -9.863   -13.973 1.00 48.46  ? 34  ALA D C   1 
ATOM   8327  O O   . ALA D 1 33  ? 21.957  -9.646   -13.415 1.00 48.50  ? 34  ALA D O   1 
ATOM   8328  C CB  . ALA D 1 33  ? 23.492  -12.326  -14.026 1.00 50.48  ? 34  ALA D CB  1 
ATOM   8329  N N   . PRO D 1 34  ? 23.473  -9.138   -15.011 1.00 46.63  ? 35  PRO D N   1 
ATOM   8330  C CA  . PRO D 1 34  ? 22.760  -7.944   -15.468 1.00 45.67  ? 35  PRO D CA  1 
ATOM   8331  C C   . PRO D 1 34  ? 21.580  -8.243   -16.382 1.00 46.22  ? 35  PRO D C   1 
ATOM   8332  O O   . PRO D 1 34  ? 21.457  -9.347   -16.913 1.00 46.40  ? 35  PRO D O   1 
ATOM   8333  C CB  . PRO D 1 34  ? 23.837  -7.185   -16.239 1.00 43.17  ? 35  PRO D CB  1 
ATOM   8334  C CG  . PRO D 1 34  ? 24.663  -8.272   -16.827 1.00 42.81  ? 35  PRO D CG  1 
ATOM   8335  C CD  . PRO D 1 34  ? 24.691  -9.382   -15.806 1.00 44.54  ? 35  PRO D CD  1 
ATOM   8336  N N   . GLY D 1 35  ? 20.719  -7.247   -16.556 1.00 46.38  ? 36  GLY D N   1 
ATOM   8337  C CA  . GLY D 1 35  ? 19.759  -7.257   -17.643 1.00 46.47  ? 36  GLY D CA  1 
ATOM   8338  C C   . GLY D 1 35  ? 20.500  -6.898   -18.917 1.00 43.71  ? 36  GLY D C   1 
ATOM   8339  O O   . GLY D 1 35  ? 21.694  -6.579   -18.873 1.00 40.58  ? 36  GLY D O   1 
ATOM   8340  N N   . ARG D 1 36  ? 19.796  -6.948   -20.043 1.00 44.07  ? 37  ARG D N   1 
ATOM   8341  C CA  . ARG D 1 36  ? 20.375  -6.665   -21.355 1.00 42.93  ? 37  ARG D CA  1 
ATOM   8342  C C   . ARG D 1 36  ? 19.542  -5.629   -22.106 1.00 42.48  ? 37  ARG D C   1 
ATOM   8343  O O   . ARG D 1 36  ? 18.325  -5.589   -21.954 1.00 40.57  ? 37  ARG D O   1 
ATOM   8344  C CB  . ARG D 1 36  ? 20.466  -7.953   -22.190 1.00 44.70  ? 37  ARG D CB  1 
ATOM   8345  C CG  . ARG D 1 36  ? 20.540  -7.694   -23.697 1.00 47.73  ? 37  ARG D CG  1 
ATOM   8346  C CD  . ARG D 1 36  ? 20.135  -8.880   -24.578 1.00 49.20  ? 37  ARG D CD  1 
ATOM   8347  N NE  . ARG D 1 36  ? 18.794  -9.424   -24.342 1.00 51.17  ? 37  ARG D NE  1 
ATOM   8348  C CZ  . ARG D 1 36  ? 17.655  -8.745   -24.437 1.00 52.56  ? 37  ARG D CZ  1 
ATOM   8349  N NH1 . ARG D 1 36  ? 17.665  -7.463   -24.760 1.00 53.91  ? 37  ARG D NH1 1 
ATOM   8350  N NH2 . ARG D 1 36  ? 16.497  -9.351   -24.220 1.00 53.50  ? 37  ARG D NH2 1 
ATOM   8351  N N   . VAL D 1 37  ? 20.193  -4.779   -22.897 1.00 37.33  ? 38  VAL D N   1 
ATOM   8352  C CA  . VAL D 1 37  ? 19.484  -4.057   -23.949 1.00 45.38  ? 38  VAL D CA  1 
ATOM   8353  C C   . VAL D 1 37  ? 20.195  -4.318   -25.276 1.00 42.04  ? 38  VAL D C   1 
ATOM   8354  O O   . VAL D 1 37  ? 21.424  -4.346   -25.337 1.00 39.80  ? 38  VAL D O   1 
ATOM   8355  C CB  . VAL D 1 37  ? 19.378  -2.533   -23.665 1.00 40.00  ? 38  VAL D CB  1 
ATOM   8356  C CG1 . VAL D 1 37  ? 20.707  -1.827   -23.882 1.00 37.43  ? 38  VAL D CG1 1 
ATOM   8357  C CG2 . VAL D 1 37  ? 18.310  -1.915   -24.545 1.00 41.79  ? 38  VAL D CG2 1 
ATOM   8358  N N   . ASN D 1 38  ? 19.422  -4.566   -26.328 1.00 41.40  ? 39  ASN D N   1 
ATOM   8359  C CA  . ASN D 1 38  ? 19.998  -4.728   -27.657 1.00 39.15  ? 39  ASN D CA  1 
ATOM   8360  C C   . ASN D 1 38  ? 20.061  -3.391   -28.377 1.00 35.61  ? 39  ASN D C   1 
ATOM   8361  O O   . ASN D 1 38  ? 19.045  -2.713   -28.531 1.00 35.19  ? 39  ASN D O   1 
ATOM   8362  C CB  . ASN D 1 38  ? 19.198  -5.728   -28.493 1.00 42.79  ? 39  ASN D CB  1 
ATOM   8363  C CG  . ASN D 1 38  ? 19.369  -7.164   -28.021 1.00 46.65  ? 39  ASN D CG  1 
ATOM   8364  O OD1 . ASN D 1 38  ? 20.431  -7.767   -28.188 1.00 46.73  ? 39  ASN D OD1 1 
ATOM   8365  N ND2 . ASN D 1 38  ? 18.309  -7.729   -27.458 1.00 48.97  ? 39  ASN D ND2 1 
ATOM   8366  N N   . LEU D 1 39  ? 21.258  -3.011   -28.806 1.00 33.02  ? 40  LEU D N   1 
ATOM   8367  C CA  . LEU D 1 39  ? 21.456  -1.737   -29.478 1.00 33.41  ? 40  LEU D CA  1 
ATOM   8368  C C   . LEU D 1 39  ? 20.946  -1.802   -30.910 1.00 33.17  ? 40  LEU D C   1 
ATOM   8369  O O   . LEU D 1 39  ? 20.376  -0.835   -31.411 1.00 33.34  ? 40  LEU D O   1 
ATOM   8370  C CB  . LEU D 1 39  ? 22.934  -1.342   -29.460 1.00 34.20  ? 40  LEU D CB  1 
ATOM   8371  C CG  . LEU D 1 39  ? 23.528  -1.125   -28.065 1.00 37.25  ? 40  LEU D CG  1 
ATOM   8372  C CD1 . LEU D 1 39  ? 24.997  -0.739   -28.170 1.00 37.60  ? 40  LEU D CD1 1 
ATOM   8373  C CD2 . LEU D 1 39  ? 22.746  -0.063   -27.326 1.00 38.02  ? 40  LEU D CD2 1 
ATOM   8374  N N   . ILE D 1 40  ? 21.153  -2.952   -31.551 1.00 31.99  ? 41  ILE D N   1 
ATOM   8375  C CA  . ILE D 1 40  ? 20.739  -3.174   -32.932 1.00 32.76  ? 41  ILE D CA  1 
ATOM   8376  C C   . ILE D 1 40  ? 20.946  -4.640   -33.314 1.00 34.23  ? 41  ILE D C   1 
ATOM   8377  O O   . ILE D 1 40  ? 21.786  -5.328   -32.729 1.00 34.92  ? 41  ILE D O   1 
ATOM   8378  C CB  . ILE D 1 40  ? 21.529  -2.263   -33.911 1.00 29.08  ? 41  ILE D CB  1 
ATOM   8379  C CG1 . ILE D 1 40  ? 20.871  -2.222   -35.294 1.00 31.28  ? 41  ILE D CG1 1 
ATOM   8380  C CG2 . ILE D 1 40  ? 22.979  -2.710   -34.023 1.00 26.38  ? 41  ILE D CG2 1 
ATOM   8381  C CD1 . ILE D 1 40  ? 21.550  -1.259   -36.247 1.00 30.93  ? 41  ILE D CD1 1 
ATOM   8382  N N   . GLY D 1 41  ? 20.156  -5.123   -34.269 1.00 36.41  ? 42  GLY D N   1 
ATOM   8383  C CA  . GLY D 1 41  ? 20.426  -6.391   -34.922 1.00 37.39  ? 42  GLY D CA  1 
ATOM   8384  C C   . GLY D 1 41  ? 19.800  -7.619   -34.293 1.00 42.13  ? 42  GLY D C   1 
ATOM   8385  O O   . GLY D 1 41  ? 19.997  -8.733   -34.770 1.00 42.93  ? 42  GLY D O   1 
ATOM   8386  N N   . GLU D 1 42  ? 19.021  -7.428   -33.241 1.00 45.61  ? 43  GLU D N   1 
ATOM   8387  C CA  . GLU D 1 42  ? 18.652  -8.542   -32.375 1.00 51.36  ? 43  GLU D CA  1 
ATOM   8388  C C   . GLU D 1 42  ? 17.836  -9.678   -33.010 1.00 51.90  ? 43  GLU D C   1 
ATOM   8389  O O   . GLU D 1 42  ? 17.913  -10.835  -32.547 1.00 52.87  ? 43  GLU D O   1 
ATOM   8390  C CB  . GLU D 1 42  ? 17.874  -8.023   -31.176 1.00 56.79  ? 43  GLU D CB  1 
ATOM   8391  C CG  . GLU D 1 42  ? 17.339  -6.622   -31.353 1.00 59.53  ? 43  GLU D CG  1 
ATOM   8392  C CD  . GLU D 1 42  ? 16.376  -6.219   -30.268 1.00 64.53  ? 43  GLU D CD  1 
ATOM   8393  O OE1 . GLU D 1 42  ? 16.266  -6.958   -29.265 1.00 70.50  ? 43  GLU D OE1 1 
ATOM   8394  O OE2 . GLU D 1 42  ? 15.707  -5.177   -30.439 1.00 64.11  ? 43  GLU D OE2 1 
ATOM   8395  N N   . HIS D 1 43  ? 17.043  -9.381   -34.041 1.00 50.40  ? 44  HIS D N   1 
ATOM   8396  C CA  . HIS D 1 43  ? 16.004  -10.357  -34.364 1.00 52.33  ? 44  HIS D CA  1 
ATOM   8397  C C   . HIS D 1 43  ? 16.360  -10.726  -35.787 1.00 50.59  ? 44  HIS D C   1 
ATOM   8398  O O   . HIS D 1 43  ? 15.529  -10.804  -36.694 1.00 53.17  ? 44  HIS D O   1 
ATOM   8399  C CB  . HIS D 1 43  ? 14.542  -9.853   -34.136 1.00 82.50  ? 44  HIS D CB  1 
ATOM   8400  C CG  . HIS D 1 43  ? 14.361  -8.392   -33.851 1.00 80.89  ? 44  HIS D CG  1 
ATOM   8401  N ND1 . HIS D 1 43  ? 15.368  -7.573   -33.350 1.00 79.30  ? 44  HIS D ND1 1 
ATOM   8402  C CD2 . HIS D 1 43  ? 13.213  -7.665   -33.675 1.00 81.17  ? 44  HIS D CD2 1 
ATOM   8403  C CE1 . HIS D 1 43  ? 14.906  -6.350   -33.183 1.00 78.19  ? 44  HIS D CE1 1 
ATOM   8404  N NE2 . HIS D 1 43  ? 13.564  -6.406   -33.302 1.00 79.65  ? 44  HIS D NE2 1 
ATOM   8405  N N   . THR D 1 44  ? 17.679  -10.855  -35.911 1.00 46.87  ? 45  THR D N   1 
ATOM   8406  C CA  . THR D 1 44  ? 18.378  -11.508  -36.983 1.00 45.84  ? 45  THR D CA  1 
ATOM   8407  C C   . THR D 1 44  ? 19.099  -12.727  -36.418 1.00 47.45  ? 45  THR D C   1 
ATOM   8408  O O   . THR D 1 44  ? 19.677  -13.507  -37.174 1.00 47.51  ? 45  THR D O   1 
ATOM   8409  C CB  . THR D 1 44  ? 19.428  -10.588  -37.636 1.00 42.30  ? 45  THR D CB  1 
ATOM   8410  O OG1 . THR D 1 44  ? 20.616  -10.553  -36.832 1.00 41.16  ? 45  THR D OG1 1 
ATOM   8411  C CG2 . THR D 1 44  ? 18.909  -9.187   -37.850 1.00 40.40  ? 45  THR D CG2 1 
ATOM   8412  N N   . ASP D 1 45  ? 19.099  -12.864  -35.090 1.00 48.62  ? 46  ASP D N   1 
ATOM   8413  C CA  . ASP D 1 45  ? 19.866  -13.918  -34.424 1.00 49.44  ? 46  ASP D CA  1 
ATOM   8414  C C   . ASP D 1 45  ? 19.437  -15.331  -34.822 1.00 52.93  ? 46  ASP D C   1 
ATOM   8415  O O   . ASP D 1 45  ? 20.249  -16.255  -34.793 1.00 53.43  ? 46  ASP D O   1 
ATOM   8416  C CB  . ASP D 1 45  ? 19.778  -13.764  -32.902 1.00 48.93  ? 46  ASP D CB  1 
ATOM   8417  C CG  . ASP D 1 45  ? 18.370  -13.950  -32.375 1.00 50.25  ? 46  ASP D CG  1 
ATOM   8418  O OD1 . ASP D 1 45  ? 17.414  -13.776  -33.156 1.00 51.95  ? 46  ASP D OD1 1 
ATOM   8419  O OD2 . ASP D 1 45  ? 18.217  -14.262  -31.176 1.00 51.15  ? 46  ASP D OD2 1 
ATOM   8420  N N   . TYR D 1 46  ? 18.169  -15.505  -35.183 1.00 56.15  ? 47  TYR D N   1 
ATOM   8421  C CA  . TYR D 1 46  ? 17.709  -16.807  -35.653 1.00 60.43  ? 47  TYR D CA  1 
ATOM   8422  C C   . TYR D 1 46  ? 17.709  -16.848  -37.180 1.00 58.36  ? 47  TYR D C   1 
ATOM   8423  O O   . TYR D 1 46  ? 17.081  -17.712  -37.791 1.00 58.98  ? 47  TYR D O   1 
ATOM   8424  C CB  . TYR D 1 46  ? 16.323  -17.145  -35.082 1.00 67.02  ? 47  TYR D CB  1 
ATOM   8425  C CG  . TYR D 1 46  ? 15.192  -16.202  -35.449 1.00 71.55  ? 47  TYR D CG  1 
ATOM   8426  C CD1 . TYR D 1 46  ? 14.423  -16.414  -36.587 1.00 74.37  ? 47  TYR D CD1 1 
ATOM   8427  C CD2 . TYR D 1 46  ? 14.868  -15.120  -34.636 1.00 73.01  ? 47  TYR D CD2 1 
ATOM   8428  C CE1 . TYR D 1 46  ? 13.379  -15.563  -36.915 1.00 75.82  ? 47  TYR D CE1 1 
ATOM   8429  C CE2 . TYR D 1 46  ? 13.825  -14.265  -34.957 1.00 74.29  ? 47  TYR D CE2 1 
ATOM   8430  C CZ  . TYR D 1 46  ? 13.085  -14.492  -36.094 1.00 75.95  ? 47  TYR D CZ  1 
ATOM   8431  O OH  . TYR D 1 46  ? 12.050  -13.641  -36.411 1.00 77.66  ? 47  TYR D OH  1 
ATOM   8432  N N   . ASN D 1 47  ? 18.433  -15.904  -37.778 1.00 55.45  ? 48  ASN D N   1 
ATOM   8433  C CA  . ASN D 1 47  ? 18.703  -15.897  -39.212 1.00 53.49  ? 48  ASN D CA  1 
ATOM   8434  C C   . ASN D 1 47  ? 20.204  -15.873  -39.489 1.00 50.31  ? 48  ASN D C   1 
ATOM   8435  O O   . ASN D 1 47  ? 20.636  -15.368  -40.525 1.00 49.02  ? 48  ASN D O   1 
ATOM   8436  C CB  . ASN D 1 47  ? 18.045  -14.693  -39.893 1.00 54.04  ? 48  ASN D CB  1 
ATOM   8437  C CG  . ASN D 1 47  ? 16.528  -14.771  -39.901 1.00 58.13  ? 48  ASN D CG  1 
ATOM   8438  O OD1 . ASN D 1 47  ? 15.857  -14.161  -39.067 1.00 59.85  ? 48  ASN D OD1 1 
ATOM   8439  N ND2 . ASN D 1 47  ? 15.979  -15.515  -40.854 1.00 60.06  ? 48  ASN D ND2 1 
ATOM   8440  N N   . GLN D 1 48  ? 20.984  -16.401  -38.548 1.00 49.75  ? 49  GLN D N   1 
ATOM   8441  C CA  . GLN D 1 48  ? 22.450  -16.403  -38.615 1.00 49.29  ? 49  GLN D CA  1 
ATOM   8442  C C   . GLN D 1 48  ? 23.044  -14.995  -38.739 1.00 48.63  ? 49  GLN D C   1 
ATOM   8443  O O   . GLN D 1 48  ? 24.114  -14.809  -39.324 1.00 48.46  ? 49  GLN D O   1 
ATOM   8444  C CB  . GLN D 1 48  ? 22.935  -17.275  -39.778 1.00 50.21  ? 49  GLN D CB  1 
ATOM   8445  N N   . GLY D 1 49  ? 22.362  -14.012  -38.160 1.00 48.15  ? 50  GLY D N   1 
ATOM   8446  C CA  . GLY D 1 49  ? 22.769  -12.625  -38.295 1.00 45.24  ? 50  GLY D CA  1 
ATOM   8447  C C   . GLY D 1 49  ? 23.772  -12.120  -37.274 1.00 42.49  ? 50  GLY D C   1 
ATOM   8448  O O   . GLY D 1 49  ? 24.574  -12.876  -36.728 1.00 42.37  ? 50  GLY D O   1 
ATOM   8449  N N   . LEU D 1 50  ? 23.723  -10.814  -37.038 1.00 39.98  ? 51  LEU D N   1 
ATOM   8450  C CA  . LEU D 1 50  ? 24.617  -10.139  -36.111 1.00 36.71  ? 51  LEU D CA  1 
ATOM   8451  C C   . LEU D 1 50  ? 23.785  -9.407   -35.069 1.00 36.08  ? 51  LEU D C   1 
ATOM   8452  O O   . LEU D 1 50  ? 22.753  -8.825   -35.399 1.00 34.89  ? 51  LEU D O   1 
ATOM   8453  C CB  . LEU D 1 50  ? 25.524  -9.148   -36.847 1.00 34.08  ? 51  LEU D CB  1 
ATOM   8454  C CG  . LEU D 1 50  ? 26.359  -9.649   -38.028 1.00 34.09  ? 51  LEU D CG  1 
ATOM   8455  C CD1 . LEU D 1 50  ? 26.941  -8.469   -38.785 1.00 33.11  ? 51  LEU D CD1 1 
ATOM   8456  C CD2 . LEU D 1 50  ? 27.465  -10.579  -37.560 1.00 34.41  ? 51  LEU D CD2 1 
ATOM   8457  N N   . VAL D 1 51  ? 24.216  -9.450   -33.811 1.00 35.45  ? 52  VAL D N   1 
ATOM   8458  C CA  . VAL D 1 51  ? 23.531  -8.704   -32.763 1.00 35.95  ? 52  VAL D CA  1 
ATOM   8459  C C   . VAL D 1 51  ? 24.540  -7.901   -31.959 1.00 34.36  ? 52  VAL D C   1 
ATOM   8460  O O   . VAL D 1 51  ? 25.695  -8.297   -31.815 1.00 35.95  ? 52  VAL D O   1 
ATOM   8461  C CB  . VAL D 1 51  ? 22.723  -9.623   -31.814 1.00 39.28  ? 52  VAL D CB  1 
ATOM   8462  C CG1 . VAL D 1 51  ? 21.705  -10.440  -32.595 1.00 40.43  ? 52  VAL D CG1 1 
ATOM   8463  C CG2 . VAL D 1 51  ? 23.639  -10.529  -31.037 1.00 39.99  ? 52  VAL D CG2 1 
ATOM   8464  N N   . LEU D 1 52  ? 24.102  -6.758   -31.449 1.00 33.93  ? 53  LEU D N   1 
ATOM   8465  C CA  . LEU D 1 52  ? 24.987  -5.874   -30.709 1.00 34.65  ? 53  LEU D CA  1 
ATOM   8466  C C   . LEU D 1 52  ? 24.333  -5.444   -29.403 1.00 34.87  ? 53  LEU D C   1 
ATOM   8467  O O   . LEU D 1 52  ? 23.837  -4.324   -29.292 1.00 34.22  ? 53  LEU D O   1 
ATOM   8468  C CB  . LEU D 1 52  ? 25.355  -4.657   -31.561 1.00 37.67  ? 53  LEU D CB  1 
ATOM   8469  C CG  . LEU D 1 52  ? 26.436  -3.696   -31.056 1.00 40.72  ? 53  LEU D CG  1 
ATOM   8470  C CD1 . LEU D 1 52  ? 27.669  -4.455   -30.610 1.00 42.02  ? 53  LEU D CD1 1 
ATOM   8471  C CD2 . LEU D 1 52  ? 26.795  -2.710   -32.161 1.00 39.69  ? 53  LEU D CD2 1 
ATOM   8472  N N   . PRO D 1 53  ? 24.302  -6.353   -28.416 1.00 34.58  ? 54  PRO D N   1 
ATOM   8473  C CA  . PRO D 1 53  ? 23.718  -6.015   -27.122 1.00 35.49  ? 54  PRO D CA  1 
ATOM   8474  C C   . PRO D 1 53  ? 24.732  -5.411   -26.159 1.00 33.56  ? 54  PRO D C   1 
ATOM   8475  O O   . PRO D 1 53  ? 25.943  -5.440   -26.395 1.00 31.68  ? 54  PRO D O   1 
ATOM   8476  C CB  . PRO D 1 53  ? 23.237  -7.366   -26.601 1.00 38.25  ? 54  PRO D CB  1 
ATOM   8477  C CG  . PRO D 1 53  ? 24.243  -8.312   -27.133 1.00 38.12  ? 54  PRO D CG  1 
ATOM   8478  C CD  . PRO D 1 53  ? 24.558  -7.800   -28.524 1.00 35.28  ? 54  PRO D CD  1 
ATOM   8479  N N   . MET D 1 54  ? 24.209  -4.869   -25.072 1.00 34.50  ? 55  MET D N   1 
ATOM   8480  C CA  . MET D 1 54  ? 25.027  -4.310   -24.001 1.00 36.09  ? 55  MET D CA  1 
ATOM   8481  C C   . MET D 1 54  ? 24.360  -4.603   -22.670 1.00 37.03  ? 55  MET D C   1 
ATOM   8482  O O   . MET D 1 54  ? 23.141  -4.500   -22.552 1.00 37.85  ? 55  MET D O   1 
ATOM   8483  C CB  . MET D 1 54  ? 25.219  -2.809   -24.224 1.00 37.51  ? 55  MET D CB  1 
ATOM   8484  C CG  . MET D 1 54  ? 24.755  -1.907   -23.102 1.00 40.09  ? 55  MET D CG  1 
ATOM   8485  S SD  . MET D 1 54  ? 25.209  -0.183   -23.376 1.00 42.17  ? 55  MET D SD  1 
ATOM   8486  C CE  . MET D 1 54  ? 24.162  0.602    -22.156 1.00 39.46  ? 55  MET D CE  1 
ATOM   8487  N N   . ALA D 1 55  ? 25.153  -5.009   -21.681 1.00 37.80  ? 56  ALA D N   1 
ATOM   8488  C CA  . ALA D 1 55  ? 24.616  -5.301   -20.360 1.00 39.80  ? 56  ALA D CA  1 
ATOM   8489  C C   . ALA D 1 55  ? 24.168  -4.012   -19.698 1.00 40.92  ? 56  ALA D C   1 
ATOM   8490  O O   . ALA D 1 55  ? 24.764  -2.956   -19.913 1.00 41.00  ? 56  ALA D O   1 
ATOM   8491  C CB  . ALA D 1 55  ? 25.647  -6.014   -19.501 1.00 39.41  ? 56  ALA D CB  1 
ATOM   8492  N N   . LEU D 1 56  ? 23.115  -4.109   -18.895 1.00 41.60  ? 57  LEU D N   1 
ATOM   8493  C CA  . LEU D 1 56  ? 22.560  -2.953   -18.207 1.00 43.32  ? 57  LEU D CA  1 
ATOM   8494  C C   . LEU D 1 56  ? 22.992  -2.905   -16.750 1.00 43.78  ? 57  LEU D C   1 
ATOM   8495  O O   . LEU D 1 56  ? 23.359  -3.927   -16.173 1.00 45.02  ? 57  LEU D O   1 
ATOM   8496  C CB  . LEU D 1 56  ? 21.037  -2.972   -18.274 1.00 44.64  ? 57  LEU D CB  1 
ATOM   8497  C CG  . LEU D 1 56  ? 20.446  -2.842   -19.670 1.00 44.19  ? 57  LEU D CG  1 
ATOM   8498  C CD1 . LEU D 1 56  ? 18.935  -2.915   -19.592 1.00 45.16  ? 57  LEU D CD1 1 
ATOM   8499  C CD2 . LEU D 1 56  ? 20.920  -1.540   -20.288 1.00 43.13  ? 57  LEU D CD2 1 
ATOM   8500  N N   . GLU D 1 57  ? 22.918  -1.718   -16.153 1.00 45.21  ? 58  GLU D N   1 
ATOM   8501  C CA  . GLU D 1 57  ? 23.205  -1.555   -14.726 1.00 49.50  ? 58  GLU D CA  1 
ATOM   8502  C C   . GLU D 1 57  ? 22.018  -2.013   -13.880 1.00 52.54  ? 58  GLU D C   1 
ATOM   8503  O O   . GLU D 1 57  ? 21.958  -1.760   -12.679 1.00 55.76  ? 58  GLU D O   1 
ATOM   8504  C CB  . GLU D 1 57  ? 23.559  -0.102   -14.407 1.00 50.89  ? 58  GLU D CB  1 
ATOM   8505  C CG  . GLU D 1 57  ? 24.847  0.381    -15.062 1.00 51.16  ? 58  GLU D CG  1 
ATOM   8506  C CD  . GLU D 1 57  ? 25.162  1.826    -14.728 1.00 53.45  ? 58  GLU D CD  1 
ATOM   8507  O OE1 . GLU D 1 57  ? 25.099  2.680    -15.636 1.00 52.18  ? 58  GLU D OE1 1 
ATOM   8508  O OE2 . GLU D 1 57  ? 25.474  2.110    -13.552 1.00 57.74  ? 58  GLU D OE2 1 
ATOM   8509  N N   . LEU D 1 58  ? 21.067  -2.675   -14.530 1.00 50.77  ? 59  LEU D N   1 
ATOM   8510  C CA  . LEU D 1 58  ? 19.988  -3.369   -13.847 1.00 51.47  ? 59  LEU D CA  1 
ATOM   8511  C C   . LEU D 1 58  ? 20.381  -4.835   -13.741 1.00 51.82  ? 59  LEU D C   1 
ATOM   8512  O O   . LEU D 1 58  ? 20.829  -5.426   -14.722 1.00 51.10  ? 59  LEU D O   1 
ATOM   8513  C CB  . LEU D 1 58  ? 18.669  -3.211   -14.608 1.00 50.74  ? 59  LEU D CB  1 
ATOM   8514  C CG  . LEU D 1 58  ? 18.226  -1.769   -14.860 1.00 49.24  ? 59  LEU D CG  1 
ATOM   8515  C CD1 . LEU D 1 58  ? 17.015  -1.725   -15.782 1.00 49.32  ? 59  LEU D CD1 1 
ATOM   8516  C CD2 . LEU D 1 58  ? 17.932  -1.062   -13.540 1.00 49.66  ? 59  LEU D CD2 1 
ATOM   8517  N N   . MET D 1 59  ? 20.229  -5.426   -12.561 1.00 52.58  ? 60  MET D N   1 
ATOM   8518  C CA  . MET D 1 59  ? 20.728  -6.782   -12.361 1.00 52.74  ? 60  MET D CA  1 
ATOM   8519  C C   . MET D 1 59  ? 19.886  -7.613   -11.403 1.00 54.58  ? 60  MET D C   1 
ATOM   8520  O O   . MET D 1 59  ? 19.026  -7.093   -10.695 1.00 56.78  ? 60  MET D O   1 
ATOM   8521  C CB  . MET D 1 59  ? 22.165  -6.737   -11.846 1.00 51.65  ? 60  MET D CB  1 
ATOM   8522  C CG  . MET D 1 59  ? 22.262  -6.486   -10.352 1.00 52.97  ? 60  MET D CG  1 
ATOM   8523  S SD  . MET D 1 59  ? 23.918  -6.006   -9.840  1.00 73.30  ? 60  MET D SD  1 
ATOM   8524  C CE  . MET D 1 59  ? 23.671  -4.251   -9.591  1.00 77.70  ? 60  MET D CE  1 
ATOM   8525  N N   . THR D 1 60  ? 20.149  -8.916   -11.401 1.00 54.13  ? 61  THR D N   1 
ATOM   8526  C CA  . THR D 1 60  ? 19.562  -9.833   -10.436 1.00 55.94  ? 61  THR D CA  1 
ATOM   8527  C C   . THR D 1 60  ? 20.668  -10.309  -9.501  1.00 56.41  ? 61  THR D C   1 
ATOM   8528  O O   . THR D 1 60  ? 21.789  -10.560  -9.942  1.00 53.68  ? 61  THR D O   1 
ATOM   8529  C CB  . THR D 1 60  ? 18.889  -11.032  -11.125 1.00 55.67  ? 61  THR D CB  1 
ATOM   8530  O OG1 . THR D 1 60  ? 17.890  -10.556  -12.030 1.00 54.37  ? 61  THR D OG1 1 
ATOM   8531  C CG2 . THR D 1 60  ? 18.233  -11.951  -10.100 1.00 58.89  ? 61  THR D CG2 1 
ATOM   8532  N N   . VAL D 1 61  ? 20.357  -10.416  -8.214  1.00 59.91  ? 62  VAL D N   1 
ATOM   8533  C CA  . VAL D 1 61  ? 21.360  -10.761  -7.211  1.00 61.56  ? 62  VAL D CA  1 
ATOM   8534  C C   . VAL D 1 61  ? 20.927  -11.934  -6.340  1.00 64.67  ? 62  VAL D C   1 
ATOM   8535  O O   . VAL D 1 61  ? 19.879  -11.886  -5.692  1.00 67.43  ? 62  VAL D O   1 
ATOM   8536  C CB  . VAL D 1 61  ? 21.673  -9.557   -6.295  1.00 61.60  ? 62  VAL D CB  1 
ATOM   8537  C CG1 . VAL D 1 61  ? 22.527  -9.988   -5.108  1.00 62.07  ? 62  VAL D CG1 1 
ATOM   8538  C CG2 . VAL D 1 61  ? 22.355  -8.450   -7.086  1.00 59.39  ? 62  VAL D CG2 1 
ATOM   8539  N N   . LEU D 1 62  ? 21.731  -12.992  -6.336  1.00 64.37  ? 63  LEU D N   1 
ATOM   8540  C CA  . LEU D 1 62  ? 21.531  -14.083  -5.397  1.00 67.11  ? 63  LEU D CA  1 
ATOM   8541  C C   . LEU D 1 62  ? 22.445  -13.902  -4.197  1.00 68.81  ? 63  LEU D C   1 
ATOM   8542  O O   . LEU D 1 62  ? 23.454  -13.198  -4.260  1.00 67.22  ? 63  LEU D O   1 
ATOM   8543  C CB  . LEU D 1 62  ? 21.783  -15.445  -6.047  1.00 66.87  ? 63  LEU D CB  1 
ATOM   8544  C CG  . LEU D 1 62  ? 20.550  -16.180  -6.575  1.00 67.81  ? 63  LEU D CG  1 
ATOM   8545  C CD1 . LEU D 1 62  ? 20.061  -15.545  -7.866  1.00 67.08  ? 63  LEU D CD1 1 
ATOM   8546  C CD2 . LEU D 1 62  ? 20.835  -17.665  -6.767  1.00 67.40  ? 63  LEU D CD2 1 
ATOM   8547  N N   . VAL D 1 63  ? 22.077  -14.552  -3.105  1.00 71.34  ? 64  VAL D N   1 
ATOM   8548  C CA  . VAL D 1 63  ? 22.808  -14.446  -1.857  1.00 73.43  ? 64  VAL D CA  1 
ATOM   8549  C C   . VAL D 1 63  ? 22.424  -15.657  -1.013  1.00 75.25  ? 64  VAL D C   1 
ATOM   8550  O O   . VAL D 1 63  ? 21.242  -15.990  -0.896  1.00 76.09  ? 64  VAL D O   1 
ATOM   8551  C CB  . VAL D 1 63  ? 22.502  -13.101  -1.141  1.00 72.65  ? 64  VAL D CB  1 
ATOM   8552  C CG1 . VAL D 1 63  ? 21.998  -13.313  0.265   1.00 74.96  ? 64  VAL D CG1 1 
ATOM   8553  C CG2 . VAL D 1 63  ? 23.727  -12.195  -1.154  1.00 70.75  ? 64  VAL D CG2 1 
ATOM   8554  N N   . GLY D 1 64  ? 23.423  -16.348  -0.474  1.00 76.21  ? 65  GLY D N   1 
ATOM   8555  C CA  . GLY D 1 64  ? 23.162  -17.567  0.268   1.00 79.07  ? 65  GLY D CA  1 
ATOM   8556  C C   . GLY D 1 64  ? 24.392  -18.353  0.674   1.00 79.28  ? 65  GLY D C   1 
ATOM   8557  O O   . GLY D 1 64  ? 25.513  -17.846  0.631   1.00 77.48  ? 65  GLY D O   1 
ATOM   8558  N N   . SER D 1 65  ? 24.172  -19.606  1.065   1.00 81.70  ? 66  SER D N   1 
ATOM   8559  C CA  . SER D 1 65  ? 25.221  -20.430  1.658   1.00 82.45  ? 66  SER D CA  1 
ATOM   8560  C C   . SER D 1 65  ? 25.040  -21.908  1.304   1.00 82.71  ? 66  SER D C   1 
ATOM   8561  O O   . SER D 1 65  ? 23.918  -22.350  1.061   1.00 82.73  ? 66  SER D O   1 
ATOM   8562  C CB  . SER D 1 65  ? 25.230  -20.234  3.175   1.00 85.19  ? 66  SER D CB  1 
ATOM   8563  O OG  . SER D 1 65  ? 25.069  -18.865  3.506   1.00 88.16  ? 66  SER D OG  1 
ATOM   8564  N N   . PRO D 1 66  ? 26.146  -22.676  1.272   1.00 83.32  ? 67  PRO D N   1 
ATOM   8565  C CA  . PRO D 1 66  ? 26.108  -24.084  0.852   1.00 84.39  ? 67  PRO D CA  1 
ATOM   8566  C C   . PRO D 1 66  ? 25.158  -24.944  1.684   1.00 87.45  ? 67  PRO D C   1 
ATOM   8567  O O   . PRO D 1 66  ? 25.064  -24.742  2.893   1.00 89.12  ? 67  PRO D O   1 
ATOM   8568  C CB  . PRO D 1 66  ? 27.560  -24.548  1.041   1.00 84.53  ? 67  PRO D CB  1 
ATOM   8569  C CG  . PRO D 1 66  ? 28.167  -23.558  1.981   1.00 84.93  ? 67  PRO D CG  1 
ATOM   8570  C CD  . PRO D 1 66  ? 27.509  -22.261  1.646   1.00 83.57  ? 67  PRO D CD  1 
ATOM   8571  N N   . GLY D 1 70  ? 19.093  -29.766  4.286   1.00 98.32  ? 71  GLY D N   1 
ATOM   8572  C CA  . GLY D 1 70  ? 19.950  -30.446  3.332   1.00 97.48  ? 71  GLY D CA  1 
ATOM   8573  C C   . GLY D 1 70  ? 19.395  -30.425  1.919   1.00 96.82  ? 71  GLY D C   1 
ATOM   8574  O O   . GLY D 1 70  ? 19.816  -31.206  1.064   1.00 96.70  ? 71  GLY D O   1 
ATOM   8575  N N   . LEU D 1 71  ? 18.448  -29.525  1.670   1.00 96.09  ? 72  LEU D N   1 
ATOM   8576  C CA  . LEU D 1 71  ? 17.819  -29.415  0.359   1.00 93.90  ? 72  LEU D CA  1 
ATOM   8577  C C   . LEU D 1 71  ? 18.023  -28.026  -0.237  1.00 91.86  ? 72  LEU D C   1 
ATOM   8578  O O   . LEU D 1 71  ? 18.997  -27.345  0.080   1.00 90.92  ? 72  LEU D O   1 
ATOM   8579  C CB  . LEU D 1 71  ? 16.326  -29.731  0.458   1.00 95.94  ? 72  LEU D CB  1 
ATOM   8580  N N   . VAL D 1 72  ? 17.102  -27.612  -1.104  1.00 90.57  ? 73  VAL D N   1 
ATOM   8581  C CA  . VAL D 1 72  ? 17.152  -26.279  -1.697  1.00 87.85  ? 73  VAL D CA  1 
ATOM   8582  C C   . VAL D 1 72  ? 15.998  -25.414  -1.197  1.00 88.61  ? 73  VAL D C   1 
ATOM   8583  O O   . VAL D 1 72  ? 14.832  -25.705  -1.461  1.00 89.08  ? 73  VAL D O   1 
ATOM   8584  C CB  . VAL D 1 72  ? 17.111  -26.338  -3.240  1.00 86.07  ? 73  VAL D CB  1 
ATOM   8585  N N   . SER D 1 73  ? 16.331  -24.353  -0.469  1.00 89.01  ? 74  SER D N   1 
ATOM   8586  C CA  . SER D 1 73  ? 15.334  -23.413  0.032   1.00 90.83  ? 74  SER D CA  1 
ATOM   8587  C C   . SER D 1 73  ? 15.626  -22.018  -0.503  1.00 89.84  ? 74  SER D C   1 
ATOM   8588  O O   . SER D 1 73  ? 16.783  -21.607  -0.572  1.00 88.16  ? 74  SER D O   1 
ATOM   8589  C CB  . SER D 1 73  ? 15.313  -23.404  1.562   1.00 92.48  ? 74  SER D CB  1 
ATOM   8590  N N   . LEU D 1 74  ? 14.579  -21.290  -0.879  1.00 91.33  ? 75  LEU D N   1 
ATOM   8591  C CA  . LEU D 1 74  ? 14.762  -19.991  -1.519  1.00 90.30  ? 75  LEU D CA  1 
ATOM   8592  C C   . LEU D 1 74  ? 13.716  -18.958  -1.104  1.00 92.10  ? 75  LEU D C   1 
ATOM   8593  O O   . LEU D 1 74  ? 12.599  -19.303  -0.717  1.00 94.35  ? 75  LEU D O   1 
ATOM   8594  C CB  . LEU D 1 74  ? 14.748  -20.151  -3.042  1.00 88.83  ? 75  LEU D CB  1 
ATOM   8595  N N   . LEU D 1 75  ? 14.098  -17.688  -1.193  1.00 91.20  ? 76  LEU D N   1 
ATOM   8596  C CA  . LEU D 1 75  ? 13.202  -16.572  -0.911  1.00 93.27  ? 76  LEU D CA  1 
ATOM   8597  C C   . LEU D 1 75  ? 13.445  -15.442  -1.906  1.00 92.57  ? 76  LEU D C   1 
ATOM   8598  O O   . LEU D 1 75  ? 14.514  -14.832  -1.913  1.00 90.69  ? 76  LEU D O   1 
ATOM   8599  C CB  . LEU D 1 75  ? 13.395  -16.070  0.523   1.00 94.84  ? 76  LEU D CB  1 
ATOM   8600  C CG  . LEU D 1 75  ? 12.898  -14.656  0.847   1.00 95.61  ? 76  LEU D CG  1 
ATOM   8601  C CD1 . LEU D 1 75  ? 11.384  -14.569  0.778   1.00 97.69  ? 76  LEU D CD1 1 
ATOM   8602  C CD2 . LEU D 1 75  ? 13.394  -14.210  2.213   1.00 96.88  ? 76  LEU D CD2 1 
ATOM   8603  N N   . THR D 1 76  ? 12.455  -15.172  -2.752  1.00 94.42  ? 77  THR D N   1 
ATOM   8604  C CA  . THR D 1 76  ? 12.568  -14.107  -3.745  1.00 94.01  ? 77  THR D CA  1 
ATOM   8605  C C   . THR D 1 76  ? 12.057  -12.784  -3.180  1.00 96.12  ? 77  THR D C   1 
ATOM   8606  O O   . THR D 1 76  ? 11.724  -12.695  -1.997  1.00 98.31  ? 77  THR D O   1 
ATOM   8607  C CB  . THR D 1 76  ? 11.785  -14.441  -5.033  1.00 93.63  ? 77  THR D CB  1 
ATOM   8608  O OG1 . THR D 1 76  ? 10.405  -14.096  -4.863  1.00 95.65  ? 77  THR D OG1 1 
ATOM   8609  C CG2 . THR D 1 76  ? 11.903  -15.920  -5.366  1.00 93.85  ? 77  THR D CG2 1 
ATOM   8610  N N   . THR D 1 77  ? 12.008  -11.760  -4.029  1.00 95.44  ? 78  THR D N   1 
ATOM   8611  C CA  . THR D 1 77  ? 11.446  -10.463  -3.654  1.00 96.73  ? 78  THR D CA  1 
ATOM   8612  C C   . THR D 1 77  ? 11.156  -9.618   -4.893  1.00 96.02  ? 78  THR D C   1 
ATOM   8613  O O   . THR D 1 77  ? 10.001  -9.461   -5.296  1.00 97.44  ? 78  THR D O   1 
ATOM   8614  C CB  . THR D 1 77  ? 12.383  -9.672   -2.718  1.00 96.18  ? 78  THR D CB  1 
ATOM   8615  O OG1 . THR D 1 77  ? 12.532  -10.373  -1.477  1.00 97.69  ? 78  THR D OG1 1 
ATOM   8616  C CG2 . THR D 1 77  ? 11.813  -8.288   -2.442  1.00 96.54  ? 78  THR D CG2 1 
ATOM   8617  N N   . GLN D 1 85  ? 6.959   -17.697  -3.139  1.00 106.40 ? 86  GLN D N   1 
ATOM   8618  C CA  . GLN D 1 85  ? 7.844   -16.655  -2.631  1.00 105.50 ? 86  GLN D CA  1 
ATOM   8619  C C   . GLN D 1 85  ? 8.700   -17.166  -1.474  1.00 106.54 ? 86  GLN D C   1 
ATOM   8620  O O   . GLN D 1 85  ? 9.446   -16.404  -0.862  1.00 105.83 ? 86  GLN D O   1 
ATOM   8621  C CB  . GLN D 1 85  ? 7.033   -15.435  -2.188  1.00 106.41 ? 86  GLN D CB  1 
ATOM   8622  N N   . ARG D 1 86  ? 8.583   -18.459  -1.185  1.00 108.33 ? 87  ARG D N   1 
ATOM   8623  C CA  . ARG D 1 86  ? 9.368   -19.101  -0.137  1.00 109.26 ? 87  ARG D CA  1 
ATOM   8624  C C   . ARG D 1 86  ? 9.268   -20.616  -0.267  1.00 111.39 ? 87  ARG D C   1 
ATOM   8625  O O   . ARG D 1 86  ? 8.900   -21.307  0.682   1.00 114.38 ? 87  ARG D O   1 
ATOM   8626  C CB  . ARG D 1 86  ? 8.895   -18.656  1.248   1.00 111.27 ? 87  ARG D CB  1 
ATOM   8627  N N   . LEU D 1 87  ? 9.600   -21.127  -1.448  1.00 110.41 ? 88  LEU D N   1 
ATOM   8628  C CA  . LEU D 1 87  ? 9.392   -22.537  -1.761  1.00 111.72 ? 88  LEU D CA  1 
ATOM   8629  C C   . LEU D 1 87  ? 10.668  -23.371  -1.664  1.00 110.73 ? 88  LEU D C   1 
ATOM   8630  O O   . LEU D 1 87  ? 11.543  -23.289  -2.527  1.00 109.31 ? 88  LEU D O   1 
ATOM   8631  C CB  . LEU D 1 87  ? 8.795   -22.677  -3.165  1.00 111.23 ? 88  LEU D CB  1 
ATOM   8632  N N   . GLN D 1 88  ? 10.762  -24.179  -0.613  1.00 111.38 ? 89  GLN D N   1 
ATOM   8633  C CA  . GLN D 1 88  ? 11.865  -25.121  -0.467  1.00 110.36 ? 89  GLN D CA  1 
ATOM   8634  C C   . GLN D 1 88  ? 11.620  -26.353  -1.334  1.00 110.87 ? 89  GLN D C   1 
ATOM   8635  O O   . GLN D 1 88  ? 10.489  -26.610  -1.742  1.00 113.45 ? 89  GLN D O   1 
ATOM   8636  C CB  . GLN D 1 88  ? 12.040  -25.525  0.997   1.00 113.48 ? 89  GLN D CB  1 
ATOM   8637  N N   . PHE D 1 89  ? 12.678  -27.110  -1.613  1.00 108.81 ? 90  PHE D N   1 
ATOM   8638  C CA  . PHE D 1 89  ? 12.567  -28.292  -2.467  1.00 107.70 ? 90  PHE D CA  1 
ATOM   8639  C C   . PHE D 1 89  ? 13.789  -29.202  -2.368  1.00 106.54 ? 90  PHE D C   1 
ATOM   8640  O O   . PHE D 1 89  ? 14.921  -28.724  -2.318  1.00 104.38 ? 90  PHE D O   1 
ATOM   8641  C CB  . PHE D 1 89  ? 12.359  -27.876  -3.926  1.00 105.52 ? 90  PHE D CB  1 
ATOM   8642  N N   . PRO D 1 90  ? 13.557  -30.525  -2.341  1.00 108.00 ? 91  PRO D N   1 
ATOM   8643  C CA  . PRO D 1 90  ? 14.641  -31.515  -2.381  1.00 107.09 ? 91  PRO D CA  1 
ATOM   8644  C C   . PRO D 1 90  ? 15.407  -31.480  -3.704  1.00 104.39 ? 91  PRO D C   1 
ATOM   8645  O O   . PRO D 1 90  ? 14.964  -30.837  -4.657  1.00 103.74 ? 91  PRO D O   1 
ATOM   8646  C CB  . PRO D 1 90  ? 13.907  -32.852  -2.208  1.00 109.32 ? 91  PRO D CB  1 
ATOM   8647  C CG  . PRO D 1 90  ? 12.491  -32.570  -2.586  1.00 110.79 ? 91  PRO D CG  1 
ATOM   8648  C CD  . PRO D 1 90  ? 12.239  -31.157  -2.170  1.00 110.54 ? 91  PRO D CD  1 
ATOM   8649  N N   . LEU D 1 91  ? 16.543  -32.169  -3.757  1.00 103.01 ? 92  LEU D N   1 
ATOM   8650  C CA  . LEU D 1 91  ? 17.395  -32.163  -4.943  1.00 100.53 ? 92  LEU D CA  1 
ATOM   8651  C C   . LEU D 1 91  ? 17.100  -33.344  -5.867  1.00 101.72 ? 92  LEU D C   1 
ATOM   8652  O O   . LEU D 1 91  ? 16.816  -34.447  -5.400  1.00 103.02 ? 92  LEU D O   1 
ATOM   8653  C CB  . LEU D 1 91  ? 18.870  -32.175  -4.536  1.00 98.59  ? 92  LEU D CB  1 
ATOM   8654  N N   . PRO D 1 92  ? 17.173  -33.112  -7.188  1.00 101.84 ? 93  PRO D N   1 
ATOM   8655  C CA  . PRO D 1 92  ? 16.890  -34.148  -8.189  1.00 103.35 ? 93  PRO D CA  1 
ATOM   8656  C C   . PRO D 1 92  ? 17.902  -35.293  -8.187  1.00 104.38 ? 93  PRO D C   1 
ATOM   8657  O O   . PRO D 1 92  ? 19.103  -35.068  -8.020  1.00 103.00 ? 93  PRO D O   1 
ATOM   8658  C CB  . PRO D 1 92  ? 16.957  -33.380  -9.515  1.00 101.00 ? 93  PRO D CB  1 
ATOM   8659  C CG  . PRO D 1 92  ? 17.822  -32.202  -9.227  1.00 98.90  ? 93  PRO D CG  1 
ATOM   8660  C CD  . PRO D 1 92  ? 17.501  -31.820  -7.814  1.00 100.00 ? 93  PRO D CD  1 
ATOM   8661  N N   . THR D 1 93  ? 17.404  -36.511  -8.369  1.00 106.95 ? 94  THR D N   1 
ATOM   8662  C CA  . THR D 1 93  ? 18.259  -37.674  -8.565  1.00 108.05 ? 94  THR D CA  1 
ATOM   8663  C C   . THR D 1 93  ? 18.150  -38.129  -10.015 1.00 109.31 ? 94  THR D C   1 
ATOM   8664  O O   . THR D 1 93  ? 17.249  -37.699  -10.735 1.00 109.33 ? 94  THR D O   1 
ATOM   8665  C CB  . THR D 1 93  ? 17.878  -38.834  -7.626  1.00 110.12 ? 94  THR D CB  1 
ATOM   8666  N N   . ALA D 1 94  ? 19.065  -38.993  -10.442 1.00 111.44 ? 95  ALA D N   1 
ATOM   8667  C CA  . ALA D 1 94  ? 19.039  -39.515  -11.803 1.00 113.18 ? 95  ALA D CA  1 
ATOM   8668  C C   . ALA D 1 94  ? 17.804  -40.383  -12.028 1.00 116.87 ? 95  ALA D C   1 
ATOM   8669  O O   . ALA D 1 94  ? 17.336  -40.535  -13.157 1.00 116.89 ? 95  ALA D O   1 
ATOM   8670  C CB  . ALA D 1 94  ? 20.305  -40.305  -12.094 1.00 113.40 ? 95  ALA D CB  1 
ATOM   8671  N N   . GLN D 1 95  ? 17.279  -40.944  -10.943 1.00 120.17 ? 96  GLN D N   1 
ATOM   8672  C CA  . GLN D 1 95  ? 16.095  -41.790  -11.009 1.00 123.48 ? 96  GLN D CA  1 
ATOM   8673  C C   . GLN D 1 95  ? 14.833  -41.023  -10.622 1.00 125.87 ? 96  GLN D C   1 
ATOM   8674  O O   . GLN D 1 95  ? 13.753  -41.606  -10.521 1.00 127.60 ? 96  GLN D O   1 
ATOM   8675  C CB  . GLN D 1 95  ? 16.261  -43.013  -10.103 1.00 125.69 ? 96  GLN D CB  1 
ATOM   8676  N N   . ARG D 1 96  ? 14.970  -39.717  -10.410 1.00 126.25 ? 97  ARG D N   1 
ATOM   8677  C CA  . ARG D 1 96  ? 13.843  -38.894  -9.980  1.00 128.95 ? 97  ARG D CA  1 
ATOM   8678  C C   . ARG D 1 96  ? 13.609  -37.688  -10.892 1.00 128.77 ? 97  ARG D C   1 
ATOM   8679  O O   . ARG D 1 96  ? 12.536  -37.556  -11.485 1.00 130.47 ? 97  ARG D O   1 
ATOM   8680  C CB  . ARG D 1 96  ? 14.055  -38.418  -8.541  1.00 129.21 ? 97  ARG D CB  1 
ATOM   8681  N N   . SER D 1 97  ? 14.614  -36.816  -10.979 1.00 126.73 ? 98  SER D N   1 
ATOM   8682  C CA  . SER D 1 97  ? 14.556  -35.570  -11.754 1.00 124.60 ? 98  SER D CA  1 
ATOM   8683  C C   . SER D 1 97  ? 13.541  -34.572  -11.188 1.00 126.62 ? 98  SER D C   1 
ATOM   8684  O O   . SER D 1 97  ? 12.614  -34.946  -10.469 1.00 129.09 ? 98  SER D O   1 
ATOM   8685  C CB  . SER D 1 97  ? 14.244  -35.856  -13.228 1.00 124.22 ? 98  SER D CB  1 
ATOM   8686  N N   . LEU D 1 98  ? 13.728  -33.297  -11.518 1.00 125.42 ? 99  LEU D N   1 
ATOM   8687  C CA  . LEU D 1 98  ? 12.886  -32.230  -10.982 1.00 125.93 ? 99  LEU D CA  1 
ATOM   8688  C C   . LEU D 1 98  ? 11.708  -31.907  -11.899 1.00 125.83 ? 99  LEU D C   1 
ATOM   8689  O O   . LEU D 1 98  ? 11.676  -32.326  -13.056 1.00 125.42 ? 99  LEU D O   1 
ATOM   8690  C CB  . LEU D 1 98  ? 13.718  -30.969  -10.741 1.00 124.03 ? 99  LEU D CB  1 
ATOM   8691  N N   . GLU D 1 99  ? 10.748  -31.151  -11.373 1.00 125.99 ? 100 GLU D N   1 
ATOM   8692  C CA  . GLU D 1 99  ? 9.543   -30.797  -12.119 1.00 126.04 ? 100 GLU D CA  1 
ATOM   8693  C C   . GLU D 1 99  ? 9.242   -29.299  -12.013 1.00 124.70 ? 100 GLU D C   1 
ATOM   8694  O O   . GLU D 1 99  ? 9.425   -28.707  -10.949 1.00 124.67 ? 100 GLU D O   1 
ATOM   8695  C CB  . GLU D 1 99  ? 8.349   -31.613  -11.615 1.00 128.65 ? 100 GLU D CB  1 
ATOM   8696  N N   . PRO D 1 100 ? 8.779   -28.689  -13.123 1.00 123.61 ? 101 PRO D N   1 
ATOM   8697  C CA  . PRO D 1 100 ? 8.470   -27.257  -13.262 1.00 121.83 ? 101 PRO D CA  1 
ATOM   8698  C C   . PRO D 1 100 ? 7.731   -26.643  -12.072 1.00 121.76 ? 101 PRO D C   1 
ATOM   8699  O O   . PRO D 1 100 ? 8.138   -25.590  -11.585 1.00 120.16 ? 101 PRO D O   1 
ATOM   8700  C CB  . PRO D 1 100 ? 7.596   -27.222  -14.514 1.00 122.97 ? 101 PRO D CB  1 
ATOM   8701  C CG  . PRO D 1 100 ? 8.140   -28.324  -15.351 1.00 123.00 ? 101 PRO D CG  1 
ATOM   8702  C CD  . PRO D 1 100 ? 8.557   -29.413  -14.389 1.00 124.14 ? 101 PRO D CD  1 
ATOM   8703  N N   . GLY D 1 101 ? 6.656   -27.280  -11.620 1.00 123.64 ? 102 GLY D N   1 
ATOM   8704  C CA  . GLY D 1 101 ? 5.993   -26.860  -10.396 1.00 124.75 ? 102 GLY D CA  1 
ATOM   8705  C C   . GLY D 1 101 ? 5.136   -25.607  -10.488 1.00 124.00 ? 102 GLY D C   1 
ATOM   8706  O O   . GLY D 1 101 ? 4.789   -25.161  -11.578 1.00 123.02 ? 102 GLY D O   1 
ATOM   8707  N N   . THR D 1 102 ? 4.817   -25.032  -9.329  1.00 123.92 ? 103 THR D N   1 
ATOM   8708  C CA  . THR D 1 102 ? 3.815   -23.972  -9.230  1.00 122.24 ? 103 THR D CA  1 
ATOM   8709  C C   . THR D 1 102 ? 4.350   -22.529  -9.136  1.00 119.83 ? 103 THR D C   1 
ATOM   8710  O O   . THR D 1 102 ? 3.868   -21.658  -9.869  1.00 119.73 ? 103 THR D O   1 
ATOM   8711  C CB  . THR D 1 102 ? 2.886   -24.218  -8.018  1.00 124.67 ? 103 THR D CB  1 
ATOM   8712  N N   . PRO D 1 103 ? 5.316   -22.252  -8.231  1.00 117.15 ? 104 PRO D N   1 
ATOM   8713  C CA  . PRO D 1 103 ? 5.728   -20.843  -8.196  1.00 113.99 ? 104 PRO D CA  1 
ATOM   8714  C C   . PRO D 1 103 ? 6.544   -20.444  -9.429  1.00 109.30 ? 104 PRO D C   1 
ATOM   8715  O O   . PRO D 1 103 ? 7.674   -20.903  -9.601  1.00 107.71 ? 104 PRO D O   1 
ATOM   8716  C CB  . PRO D 1 103 ? 6.567   -20.758  -6.920  1.00 114.00 ? 104 PRO D CB  1 
ATOM   8717  C CG  . PRO D 1 103 ? 7.107   -22.130  -6.726  1.00 114.64 ? 104 PRO D CG  1 
ATOM   8718  C CD  . PRO D 1 103 ? 6.044   -23.063  -7.230  1.00 117.06 ? 104 PRO D CD  1 
ATOM   8719  N N   . ARG D 1 104 ? 5.975   -19.558  -10.244 1.00 106.60 ? 105 ARG D N   1 
ATOM   8720  C CA  . ARG D 1 104 ? 6.513   -19.233  -11.565 1.00 101.80 ? 105 ARG D CA  1 
ATOM   8721  C C   . ARG D 1 104 ? 7.956   -18.742  -11.537 1.00 98.27  ? 105 ARG D C   1 
ATOM   8722  O O   . ARG D 1 104 ? 8.745   -19.065  -12.423 1.00 96.75  ? 105 ARG D O   1 
ATOM   8723  C CB  . ARG D 1 104 ? 5.628   -18.183  -12.247 1.00 101.48 ? 105 ARG D CB  1 
ATOM   8724  N N   . TRP D 1 105 ? 8.300   -17.960  -10.522 1.00 96.11  ? 106 TRP D N   1 
ATOM   8725  C CA  . TRP D 1 105 ? 9.646   -17.411  -10.421 1.00 91.31  ? 106 TRP D CA  1 
ATOM   8726  C C   . TRP D 1 105 ? 10.679  -18.515  -10.204 1.00 87.70  ? 106 TRP D C   1 
ATOM   8727  O O   . TRP D 1 105 ? 11.752  -18.500  -10.807 1.00 84.75  ? 106 TRP D O   1 
ATOM   8728  C CB  . TRP D 1 105 ? 9.723   -16.384  -9.290  1.00 92.05  ? 106 TRP D CB  1 
ATOM   8729  N N   . ALA D 1 106 ? 10.337  -19.481  -9.357  1.00 87.36  ? 107 ALA D N   1 
ATOM   8730  C CA  . ALA D 1 106 ? 11.240  -20.578  -9.020  1.00 84.83  ? 107 ALA D CA  1 
ATOM   8731  C C   . ALA D 1 106 ? 11.513  -21.505  -10.203 1.00 82.20  ? 107 ALA D C   1 
ATOM   8732  O O   . ALA D 1 106 ? 12.471  -22.278  -10.181 1.00 80.82  ? 107 ALA D O   1 
ATOM   8733  C CB  . ALA D 1 106 ? 10.674  -21.377  -7.852  1.00 87.24  ? 107 ALA D CB  1 
ATOM   8734  N N   . ASN D 1 107 ? 10.669  -21.429  -11.228 1.00 83.37  ? 108 ASN D N   1 
ATOM   8735  C CA  . ASN D 1 107 ? 10.789  -22.305  -12.390 1.00 82.87  ? 108 ASN D CA  1 
ATOM   8736  C C   . ASN D 1 107 ? 12.146  -22.190  -13.084 1.00 79.39  ? 108 ASN D C   1 
ATOM   8737  O O   . ASN D 1 107 ? 12.709  -23.188  -13.535 1.00 79.90  ? 108 ASN D O   1 
ATOM   8738  C CB  . ASN D 1 107 ? 9.671   -22.011  -13.392 1.00 83.92  ? 108 ASN D CB  1 
ATOM   8739  N N   . TYR D 1 108 ? 12.669  -20.971  -13.161 1.00 75.64  ? 109 TYR D N   1 
ATOM   8740  C CA  . TYR D 1 108 ? 13.946  -20.732  -13.822 1.00 72.03  ? 109 TYR D CA  1 
ATOM   8741  C C   . TYR D 1 108 ? 15.112  -21.311  -13.024 1.00 69.81  ? 109 TYR D C   1 
ATOM   8742  O O   . TYR D 1 108 ? 16.029  -21.904  -13.593 1.00 68.15  ? 109 TYR D O   1 
ATOM   8743  C CB  . TYR D 1 108 ? 14.154  -19.234  -14.051 1.00 70.33  ? 109 TYR D CB  1 
ATOM   8744  C CG  . TYR D 1 108 ? 13.137  -18.615  -14.985 1.00 71.06  ? 109 TYR D CG  1 
ATOM   8745  C CD1 . TYR D 1 108 ? 13.240  -18.778  -16.360 1.00 70.27  ? 109 TYR D CD1 1 
ATOM   8746  C CD2 . TYR D 1 108 ? 12.073  -17.869  -14.492 1.00 72.52  ? 109 TYR D CD2 1 
ATOM   8747  C CE1 . TYR D 1 108 ? 12.316  -18.215  -17.219 1.00 70.51  ? 109 TYR D CE1 1 
ATOM   8748  C CE2 . TYR D 1 108 ? 11.142  -17.303  -15.344 1.00 72.60  ? 109 TYR D CE2 1 
ATOM   8749  C CZ  . TYR D 1 108 ? 11.268  -17.478  -16.706 1.00 71.62  ? 109 TYR D CZ  1 
ATOM   8750  O OH  . TYR D 1 108 ? 10.346  -16.916  -17.561 1.00 71.78  ? 109 TYR D OH  1 
ATOM   8751  N N   . VAL D 1 109 ? 15.071  -21.139  -11.706 1.00 69.52  ? 110 VAL D N   1 
ATOM   8752  C CA  . VAL D 1 109 ? 16.128  -21.640  -10.830 1.00 68.61  ? 110 VAL D CA  1 
ATOM   8753  C C   . VAL D 1 109 ? 16.181  -23.165  -10.844 1.00 69.31  ? 110 VAL D C   1 
ATOM   8754  O O   . VAL D 1 109 ? 17.260  -23.760  -10.885 1.00 67.98  ? 110 VAL D O   1 
ATOM   8755  C CB  . VAL D 1 109 ? 15.937  -21.156  -9.380  1.00 69.06  ? 110 VAL D CB  1 
ATOM   8756  C CG1 . VAL D 1 109 ? 17.092  -21.620  -8.503  1.00 69.15  ? 110 VAL D CG1 1 
ATOM   8757  C CG2 . VAL D 1 109 ? 15.810  -19.642  -9.338  1.00 67.46  ? 110 VAL D CG2 1 
ATOM   8758  N N   . LYS D 1 110 ? 15.004  -23.786  -10.814 1.00 71.83  ? 111 LYS D N   1 
ATOM   8759  C CA  . LYS D 1 110 ? 14.892  -25.239  -10.805 1.00 74.42  ? 111 LYS D CA  1 
ATOM   8760  C C   . LYS D 1 110 ? 15.471  -25.842  -12.079 1.00 74.45  ? 111 LYS D C   1 
ATOM   8761  O O   . LYS D 1 110 ? 16.143  -26.874  -12.039 1.00 75.50  ? 111 LYS D O   1 
ATOM   8762  C CB  . LYS D 1 110 ? 13.431  -25.664  -10.638 1.00 76.69  ? 111 LYS D CB  1 
ATOM   8763  N N   . GLY D 1 111 ? 15.204  -25.188  -13.206 1.00 73.41  ? 112 GLY D N   1 
ATOM   8764  C CA  . GLY D 1 111 ? 15.724  -25.627  -14.487 1.00 71.98  ? 112 GLY D CA  1 
ATOM   8765  C C   . GLY D 1 111 ? 17.240  -25.664  -14.512 1.00 69.70  ? 112 GLY D C   1 
ATOM   8766  O O   . GLY D 1 111 ? 17.836  -26.627  -14.993 1.00 69.95  ? 112 GLY D O   1 
ATOM   8767  N N   . VAL D 1 112 ? 17.866  -24.615  -13.987 1.00 67.96  ? 113 VAL D N   1 
ATOM   8768  C CA  . VAL D 1 112 ? 19.324  -24.524  -13.962 1.00 67.20  ? 113 VAL D CA  1 
ATOM   8769  C C   . VAL D 1 112 ? 19.931  -25.638  -13.100 1.00 69.39  ? 113 VAL D C   1 
ATOM   8770  O O   . VAL D 1 112 ? 21.021  -26.133  -13.387 1.00 68.87  ? 113 VAL D O   1 
ATOM   8771  C CB  . VAL D 1 112 ? 19.790  -23.144  -13.444 1.00 65.57  ? 113 VAL D CB  1 
ATOM   8772  C CG1 . VAL D 1 112 ? 21.303  -23.019  -13.527 1.00 63.91  ? 113 VAL D CG1 1 
ATOM   8773  C CG2 . VAL D 1 112 ? 19.135  -22.033  -14.247 1.00 64.90  ? 113 VAL D CG2 1 
ATOM   8774  N N   . ILE D 1 113 ? 19.216  -26.045  -12.058 1.00 72.41  ? 114 ILE D N   1 
ATOM   8775  C CA  . ILE D 1 113 ? 19.668  -27.149  -11.215 1.00 75.55  ? 114 ILE D CA  1 
ATOM   8776  C C   . ILE D 1 113 ? 19.649  -28.478  -11.969 1.00 79.03  ? 114 ILE D C   1 
ATOM   8777  O O   . ILE D 1 113 ? 20.647  -29.199  -11.997 1.00 79.22  ? 114 ILE D O   1 
ATOM   8778  C CB  . ILE D 1 113 ? 18.805  -27.286  -9.949  1.00 76.58  ? 114 ILE D CB  1 
ATOM   8779  C CG1 . ILE D 1 113 ? 18.943  -26.039  -9.074  1.00 75.41  ? 114 ILE D CG1 1 
ATOM   8780  C CG2 . ILE D 1 113 ? 19.192  -28.537  -9.167  1.00 77.59  ? 114 ILE D CG2 1 
ATOM   8781  C CD1 . ILE D 1 113 ? 18.144  -26.107  -7.792  1.00 77.07  ? 114 ILE D CD1 1 
ATOM   8782  N N   . GLN D 1 114 ? 18.511  -28.788  -12.586 1.00 81.82  ? 115 GLN D N   1 
ATOM   8783  C CA  . GLN D 1 114 ? 18.318  -30.070  -13.261 1.00 85.50  ? 115 GLN D CA  1 
ATOM   8784  C C   . GLN D 1 114 ? 19.291  -30.288  -14.418 1.00 86.11  ? 115 GLN D C   1 
ATOM   8785  O O   . GLN D 1 114 ? 19.623  -31.426  -14.752 1.00 87.49  ? 115 GLN D O   1 
ATOM   8786  C CB  . GLN D 1 114 ? 16.879  -30.186  -13.772 1.00 86.99  ? 115 GLN D CB  1 
ATOM   8787  N N   . TYR D 1 115 ? 19.747  -29.200  -15.029 1.00 85.50  ? 116 TYR D N   1 
ATOM   8788  C CA  . TYR D 1 115 ? 20.649  -29.306  -16.168 1.00 86.16  ? 116 TYR D CA  1 
ATOM   8789  C C   . TYR D 1 115 ? 22.053  -28.814  -15.835 1.00 85.64  ? 116 TYR D C   1 
ATOM   8790  O O   . TYR D 1 115 ? 22.860  -28.573  -16.732 1.00 84.14  ? 116 TYR D O   1 
ATOM   8791  C CB  . TYR D 1 115 ? 20.091  -28.531  -17.363 1.00 86.11  ? 116 TYR D CB  1 
ATOM   8792  C CG  . TYR D 1 115 ? 18.747  -29.032  -17.843 1.00 88.63  ? 116 TYR D CG  1 
ATOM   8793  C CD1 . TYR D 1 115 ? 18.642  -30.213  -18.566 1.00 90.91  ? 116 TYR D CD1 1 
ATOM   8794  C CD2 . TYR D 1 115 ? 17.584  -28.321  -17.578 1.00 89.23  ? 116 TYR D CD2 1 
ATOM   8795  C CE1 . TYR D 1 115 ? 17.415  -30.675  -19.008 1.00 93.21  ? 116 TYR D CE1 1 
ATOM   8796  C CE2 . TYR D 1 115 ? 16.353  -28.774  -18.016 1.00 91.67  ? 116 TYR D CE2 1 
ATOM   8797  C CZ  . TYR D 1 115 ? 16.274  -29.951  -18.730 1.00 93.65  ? 116 TYR D CZ  1 
ATOM   8798  O OH  . TYR D 1 115 ? 15.049  -30.405  -19.168 1.00 95.93  ? 116 TYR D OH  1 
ATOM   8799  N N   . TYR D 1 116 ? 22.343  -28.670  -14.546 1.00 87.53  ? 117 TYR D N   1 
ATOM   8800  C CA  . TYR D 1 116 ? 23.681  -28.281  -14.113 1.00 88.54  ? 117 TYR D CA  1 
ATOM   8801  C C   . TYR D 1 116 ? 24.637  -29.459  -14.277 1.00 95.12  ? 117 TYR D C   1 
ATOM   8802  O O   . TYR D 1 116 ? 24.440  -30.513  -13.672 1.00 97.25  ? 117 TYR D O   1 
ATOM   8803  C CB  . TYR D 1 116 ? 23.667  -27.790  -12.664 1.00 85.47  ? 117 TYR D CB  1 
ATOM   8804  C CG  . TYR D 1 116 ? 24.952  -27.111  -12.254 1.00 81.92  ? 117 TYR D CG  1 
ATOM   8805  C CD1 . TYR D 1 116 ? 25.360  -25.933  -12.865 1.00 78.89  ? 117 TYR D CD1 1 
ATOM   8806  C CD2 . TYR D 1 116 ? 25.755  -27.644  -11.256 1.00 82.13  ? 117 TYR D CD2 1 
ATOM   8807  C CE1 . TYR D 1 116 ? 26.534  -25.307  -12.500 1.00 77.21  ? 117 TYR D CE1 1 
ATOM   8808  C CE2 . TYR D 1 116 ? 26.928  -27.022  -10.880 1.00 80.58  ? 117 TYR D CE2 1 
ATOM   8809  C CZ  . TYR D 1 116 ? 27.315  -25.856  -11.507 1.00 78.02  ? 117 TYR D CZ  1 
ATOM   8810  O OH  . TYR D 1 116 ? 28.486  -25.236  -11.138 1.00 76.49  ? 117 TYR D OH  1 
ATOM   8811  N N   . PRO D 1 117 ? 25.682  -29.276  -15.099 1.00 99.38  ? 118 PRO D N   1 
ATOM   8812  C CA  . PRO D 1 117 ? 26.563  -30.357  -15.559 1.00 105.51 ? 118 PRO D CA  1 
ATOM   8813  C C   . PRO D 1 117 ? 27.536  -30.900  -14.512 1.00 112.98 ? 118 PRO D C   1 
ATOM   8814  O O   . PRO D 1 117 ? 28.122  -31.958  -14.738 1.00 115.20 ? 118 PRO D O   1 
ATOM   8815  C CB  . PRO D 1 117 ? 27.334  -29.699  -16.706 1.00 102.38 ? 118 PRO D CB  1 
ATOM   8816  C CG  . PRO D 1 117 ? 27.386  -28.264  -16.332 1.00 98.82  ? 118 PRO D CG  1 
ATOM   8817  C CD  . PRO D 1 117 ? 26.073  -27.972  -15.662 1.00 97.95  ? 118 PRO D CD  1 
ATOM   8818  N N   . ALA D 1 118 ? 27.712  -30.201  -13.396 1.00 118.10 ? 119 ALA D N   1 
ATOM   8819  C CA  . ALA D 1 118 ? 28.664  -30.642  -12.379 1.00 125.93 ? 119 ALA D CA  1 
ATOM   8820  C C   . ALA D 1 118 ? 28.018  -31.624  -11.407 1.00 133.70 ? 119 ALA D C   1 
ATOM   8821  O O   . ALA D 1 118 ? 26.949  -31.357  -10.858 1.00 134.56 ? 119 ALA D O   1 
ATOM   8822  C CB  . ALA D 1 118 ? 29.232  -29.452  -11.634 1.00 128.43 ? 119 ALA D CB  1 
ATOM   8823  N N   . ALA D 1 119 ? 28.683  -32.755  -11.190 1.00 138.24 ? 120 ALA D N   1 
ATOM   8824  C CA  . ALA D 1 119 ? 28.093  -33.868  -10.446 1.00 141.80 ? 120 ALA D CA  1 
ATOM   8825  C C   . ALA D 1 119 ? 28.034  -33.668  -8.921  1.00 143.06 ? 120 ALA D C   1 
ATOM   8826  O O   . ALA D 1 119 ? 26.966  -33.834  -8.331  1.00 144.99 ? 120 ALA D O   1 
ATOM   8827  C CB  . ALA D 1 119 ? 28.834  -35.168  -10.781 1.00 143.76 ? 120 ALA D CB  1 
ATOM   8828  N N   . PRO D 1 120 ? 29.161  -33.316  -8.268  1.00 138.26 ? 121 PRO D N   1 
ATOM   8829  C CA  . PRO D 1 120 ? 29.051  -33.220  -6.805  1.00 134.46 ? 121 PRO D CA  1 
ATOM   8830  C C   . PRO D 1 120 ? 28.348  -31.948  -6.328  1.00 128.24 ? 121 PRO D C   1 
ATOM   8831  O O   . PRO D 1 120 ? 28.901  -31.226  -5.500  1.00 128.96 ? 121 PRO D O   1 
ATOM   8832  C CB  . PRO D 1 120 ? 30.516  -33.225  -6.337  1.00 137.54 ? 121 PRO D CB  1 
ATOM   8833  C CG  . PRO D 1 120 ? 31.333  -33.597  -7.547  1.00 139.40 ? 121 PRO D CG  1 
ATOM   8834  C CD  . PRO D 1 120 ? 30.549  -33.104  -8.712  1.00 140.34 ? 121 PRO D CD  1 
ATOM   8835  N N   . LEU D 1 121 ? 27.147  -31.687  -6.836  1.00 121.59 ? 122 LEU D N   1 
ATOM   8836  C CA  . LEU D 1 121 ? 26.414  -30.473  -6.494  1.00 113.78 ? 122 LEU D CA  1 
ATOM   8837  C C   . LEU D 1 121 ? 25.539  -30.669  -5.261  1.00 108.53 ? 122 LEU D C   1 
ATOM   8838  O O   . LEU D 1 121 ? 24.602  -31.468  -5.278  1.00 109.78 ? 122 LEU D O   1 
ATOM   8839  C CB  . LEU D 1 121 ? 25.557  -30.014  -7.677  1.00 112.49 ? 122 LEU D CB  1 
ATOM   8840  N N   . PRO D 1 122 ? 25.847  -29.935  -4.181  1.00 102.06 ? 123 PRO D N   1 
ATOM   8841  C CA  . PRO D 1 122 ? 25.116  -30.011  -2.914  1.00 99.50  ? 123 PRO D CA  1 
ATOM   8842  C C   . PRO D 1 122 ? 23.892  -29.101  -2.877  1.00 94.76  ? 123 PRO D C   1 
ATOM   8843  O O   . PRO D 1 122 ? 23.665  -28.337  -3.813  1.00 93.06  ? 123 PRO D O   1 
ATOM   8844  C CB  . PRO D 1 122 ? 26.157  -29.548  -1.897  1.00 99.79  ? 123 PRO D CB  1 
ATOM   8845  C CG  . PRO D 1 122 ? 26.955  -28.543  -2.655  1.00 98.29  ? 123 PRO D CG  1 
ATOM   8846  C CD  . PRO D 1 122 ? 27.016  -29.041  -4.082  1.00 98.75  ? 123 PRO D CD  1 
ATOM   8847  N N   . GLY D 1 123 ? 23.118  -29.186  -1.799  1.00 92.66  ? 124 GLY D N   1 
ATOM   8848  C CA  . GLY D 1 123 ? 21.976  -28.311  -1.602  1.00 88.81  ? 124 GLY D CA  1 
ATOM   8849  C C   . GLY D 1 123 ? 22.413  -26.958  -1.076  1.00 84.14  ? 124 GLY D C   1 
ATOM   8850  O O   . GLY D 1 123 ? 23.594  -26.758  -0.786  1.00 83.29  ? 124 GLY D O   1 
ATOM   8851  N N   . PHE D 1 124 ? 21.467  -26.031  -0.945  1.00 81.16  ? 125 PHE D N   1 
ATOM   8852  C CA  . PHE D 1 124 ? 21.789  -24.670  -0.520  1.00 77.95  ? 125 PHE D CA  1 
ATOM   8853  C C   . PHE D 1 124 ? 20.562  -23.852  -0.128  1.00 77.10  ? 125 PHE D C   1 
ATOM   8854  O O   . PHE D 1 124 ? 19.436  -24.180  -0.498  1.00 76.34  ? 125 PHE D O   1 
ATOM   8855  C CB  . PHE D 1 124 ? 22.539  -23.934  -1.634  1.00 74.57  ? 125 PHE D CB  1 
ATOM   8856  C CG  . PHE D 1 124 ? 21.705  -23.675  -2.857  1.00 73.04  ? 125 PHE D CG  1 
ATOM   8857  C CD1 . PHE D 1 124 ? 21.598  -24.631  -3.855  1.00 72.31  ? 125 PHE D CD1 1 
ATOM   8858  C CD2 . PHE D 1 124 ? 21.027  -22.476  -3.011  1.00 72.02  ? 125 PHE D CD2 1 
ATOM   8859  C CE1 . PHE D 1 124 ? 20.832  -24.396  -4.981  1.00 71.55  ? 125 PHE D CE1 1 
ATOM   8860  C CE2 . PHE D 1 124 ? 20.259  -22.235  -4.136  1.00 71.22  ? 125 PHE D CE2 1 
ATOM   8861  C CZ  . PHE D 1 124 ? 20.161  -23.197  -5.121  1.00 70.77  ? 125 PHE D CZ  1 
ATOM   8862  N N   . SER D 1 125 ? 20.801  -22.772  0.611   1.00 77.42  ? 126 SER D N   1 
ATOM   8863  C CA  . SER D 1 125 ? 19.766  -21.791  0.918   1.00 78.61  ? 126 SER D CA  1 
ATOM   8864  C C   . SER D 1 125 ? 20.116  -20.483  0.216   1.00 77.51  ? 126 SER D C   1 
ATOM   8865  O O   . SER D 1 125 ? 21.279  -20.080  0.206   1.00 76.97  ? 126 SER D O   1 
ATOM   8866  C CB  . SER D 1 125 ? 19.644  -21.581  2.429   1.00 80.69  ? 126 SER D CB  1 
ATOM   8867  O OG  . SER D 1 125 ? 19.522  -22.818  3.114   1.00 82.09  ? 126 SER D OG  1 
ATOM   8868  N N   . ALA D 1 126 ? 19.125  -19.817  -0.373  1.00 76.45  ? 127 ALA D N   1 
ATOM   8869  C CA  . ALA D 1 126 ? 19.410  -18.628  -1.173  1.00 73.99  ? 127 ALA D CA  1 
ATOM   8870  C C   . ALA D 1 126 ? 18.300  -17.574  -1.163  1.00 73.18  ? 127 ALA D C   1 
ATOM   8871  O O   . ALA D 1 126 ? 17.119  -17.890  -1.039  1.00 74.22  ? 127 ALA D O   1 
ATOM   8872  C CB  . ALA D 1 126 ? 19.714  -19.038  -2.611  1.00 73.23  ? 127 ALA D CB  1 
ATOM   8873  N N   . VAL D 1 127 ? 18.705  -16.314  -1.302  1.00 71.61  ? 128 VAL D N   1 
ATOM   8874  C CA  . VAL D 1 127 ? 17.778  -15.196  -1.457  1.00 71.15  ? 128 VAL D CA  1 
ATOM   8875  C C   . VAL D 1 127 ? 17.977  -14.543  -2.827  1.00 67.87  ? 128 VAL D C   1 
ATOM   8876  O O   . VAL D 1 127 ? 19.103  -14.226  -3.207  1.00 64.33  ? 128 VAL D O   1 
ATOM   8877  C CB  . VAL D 1 127 ? 17.975  -14.142  -0.354  1.00 69.10  ? 128 VAL D CB  1 
ATOM   8878  C CG1 . VAL D 1 127 ? 17.130  -12.909  -0.631  1.00 68.94  ? 128 VAL D CG1 1 
ATOM   8879  C CG2 . VAL D 1 127 ? 17.648  -14.734  1.010   1.00 71.74  ? 128 VAL D CG2 1 
ATOM   8880  N N   . VAL D 1 128 ? 16.885  -14.339  -3.561  1.00 67.52  ? 129 VAL D N   1 
ATOM   8881  C CA  . VAL D 1 128 ? 16.962  -13.795  -4.915  1.00 65.85  ? 129 VAL D CA  1 
ATOM   8882  C C   . VAL D 1 128 ? 16.257  -12.443  -5.053  1.00 66.40  ? 129 VAL D C   1 
ATOM   8883  O O   . VAL D 1 128 ? 15.039  -12.352  -4.906  1.00 68.33  ? 129 VAL D O   1 
ATOM   8884  C CB  . VAL D 1 128 ? 16.356  -14.773  -5.940  1.00 65.89  ? 129 VAL D CB  1 
ATOM   8885  N N   . VAL D 1 129 ? 17.030  -11.399  -5.342  1.00 64.89  ? 130 VAL D N   1 
ATOM   8886  C CA  . VAL D 1 129 ? 16.477  -10.065  -5.576  1.00 65.08  ? 130 VAL D CA  1 
ATOM   8887  C C   . VAL D 1 129 ? 16.902  -9.522   -6.943  1.00 62.39  ? 130 VAL D C   1 
ATOM   8888  O O   . VAL D 1 129 ? 17.893  -9.975   -7.515  1.00 59.89  ? 130 VAL D O   1 
ATOM   8889  C CB  . VAL D 1 129 ? 16.915  -9.071   -4.491  1.00 65.98  ? 130 VAL D CB  1 
ATOM   8890  N N   . SER D 1 130 ? 16.159  -8.544   -7.458  1.00 62.56  ? 131 SER D N   1 
ATOM   8891  C CA  . SER D 1 130 ? 16.453  -7.990   -8.778  1.00 62.19  ? 131 SER D CA  1 
ATOM   8892  C C   . SER D 1 130 ? 15.990  -6.543   -8.952  1.00 63.30  ? 131 SER D C   1 
ATOM   8893  O O   . SER D 1 130 ? 15.080  -6.080   -8.265  1.00 65.56  ? 131 SER D O   1 
ATOM   8894  C CB  . SER D 1 130 ? 15.816  -8.858   -9.867  1.00 61.58  ? 131 SER D CB  1 
ATOM   8895  O OG  . SER D 1 130 ? 16.115  -8.345   -11.154 1.00 59.04  ? 131 SER D OG  1 
ATOM   8896  N N   . SER D 1 131 ? 16.629  -5.841   -9.883  1.00 61.95  ? 132 SER D N   1 
ATOM   8897  C CA  . SER D 1 131 ? 16.240  -4.482   -10.247 1.00 62.05  ? 132 SER D CA  1 
ATOM   8898  C C   . SER D 1 131 ? 15.844  -4.418   -11.719 1.00 60.79  ? 132 SER D C   1 
ATOM   8899  O O   . SER D 1 131 ? 15.570  -3.345   -12.261 1.00 60.65  ? 132 SER D O   1 
ATOM   8900  C CB  . SER D 1 131 ? 17.375  -3.498   -9.964  1.00 61.42  ? 132 SER D CB  1 
ATOM   8901  O OG  . SER D 1 131 ? 18.573  -3.896   -10.614 1.00 60.32  ? 132 SER D OG  1 
ATOM   8902  N N   . VAL D 1 132 ? 15.829  -5.577   -12.367 1.00 59.86  ? 133 VAL D N   1 
ATOM   8903  C CA  . VAL D 1 132 ? 15.379  -5.669   -13.748 1.00 57.63  ? 133 VAL D CA  1 
ATOM   8904  C C   . VAL D 1 132 ? 13.863  -5.826   -13.772 1.00 59.56  ? 133 VAL D C   1 
ATOM   8905  O O   . VAL D 1 132 ? 13.324  -6.773   -13.195 1.00 60.92  ? 133 VAL D O   1 
ATOM   8906  C CB  . VAL D 1 132 ? 16.040  -6.847   -14.483 1.00 55.81  ? 133 VAL D CB  1 
ATOM   8907  C CG1 . VAL D 1 132 ? 15.734  -6.781   -15.972 1.00 54.19  ? 133 VAL D CG1 1 
ATOM   8908  C CG2 . VAL D 1 132 ? 17.545  -6.846   -14.243 1.00 50.46  ? 133 VAL D CG2 1 
ATOM   8909  N N   . PRO D 1 133 ? 13.165  -4.889   -14.432 1.00 59.81  ? 134 PRO D N   1 
ATOM   8910  C CA  . PRO D 1 133 ? 11.700  -4.934   -14.458 1.00 62.71  ? 134 PRO D CA  1 
ATOM   8911  C C   . PRO D 1 133 ? 11.190  -6.150   -15.222 1.00 64.09  ? 134 PRO D C   1 
ATOM   8912  O O   . PRO D 1 133 ? 11.703  -6.452   -16.297 1.00 62.43  ? 134 PRO D O   1 
ATOM   8913  C CB  . PRO D 1 133 ? 11.320  -3.633   -15.172 1.00 62.11  ? 134 PRO D CB  1 
ATOM   8914  C CG  . PRO D 1 133 ? 12.504  -3.315   -16.021 1.00 59.30  ? 134 PRO D CG  1 
ATOM   8915  C CD  . PRO D 1 133 ? 13.699  -3.775   -15.234 1.00 57.75  ? 134 PRO D CD  1 
ATOM   8916  N N   . LEU D 1 134 ? 10.209  -6.848   -14.660 1.00 68.10  ? 135 LEU D N   1 
ATOM   8917  C CA  . LEU D 1 134 ? 9.612   -7.997   -15.329 1.00 70.61  ? 135 LEU D CA  1 
ATOM   8918  C C   . LEU D 1 134 ? 8.635   -7.536   -16.405 1.00 72.52  ? 135 LEU D C   1 
ATOM   8919  O O   . LEU D 1 134 ? 7.702   -6.787   -16.124 1.00 74.69  ? 135 LEU D O   1 
ATOM   8920  C CB  . LEU D 1 134 ? 8.905   -8.903   -14.317 1.00 72.71  ? 135 LEU D CB  1 
ATOM   8921  N N   . GLY D 1 135 ? 8.861   -7.975   -17.639 1.00 71.66  ? 136 GLY D N   1 
ATOM   8922  C CA  . GLY D 1 135 ? 7.972   -7.643   -18.738 1.00 71.99  ? 136 GLY D CA  1 
ATOM   8923  C C   . GLY D 1 135 ? 8.456   -6.478   -19.582 1.00 70.21  ? 136 GLY D C   1 
ATOM   8924  O O   . GLY D 1 135 ? 7.804   -6.098   -20.556 1.00 72.14  ? 136 GLY D O   1 
ATOM   8925  N N   . GLY D 1 136 ? 9.601   -5.910   -19.216 1.00 66.69  ? 137 GLY D N   1 
ATOM   8926  C CA  . GLY D 1 136 ? 10.150  -4.782   -19.946 1.00 63.27  ? 137 GLY D CA  1 
ATOM   8927  C C   . GLY D 1 136 ? 10.945  -5.238   -21.151 1.00 60.93  ? 137 GLY D C   1 
ATOM   8928  O O   . GLY D 1 136 ? 11.387  -4.429   -21.969 1.00 59.77  ? 137 GLY D O   1 
ATOM   8929  N N   . GLY D 1 137 ? 11.129  -6.548   -21.263 1.00 60.39  ? 138 GLY D N   1 
ATOM   8930  C CA  . GLY D 1 137 ? 11.960  -7.104   -22.312 1.00 57.81  ? 138 GLY D CA  1 
ATOM   8931  C C   . GLY D 1 137 ? 13.420  -6.788   -22.061 1.00 54.49  ? 138 GLY D C   1 
ATOM   8932  O O   . GLY D 1 137 ? 14.247  -6.818   -22.971 1.00 52.27  ? 138 GLY D O   1 
ATOM   8933  N N   . LEU D 1 138 ? 13.740  -6.476   -20.812 1.00 54.58  ? 139 LEU D N   1 
ATOM   8934  C CA  . LEU D 1 138 ? 15.115  -6.185   -20.445 1.00 53.01  ? 139 LEU D CA  1 
ATOM   8935  C C   . LEU D 1 138 ? 15.816  -7.432   -19.918 1.00 52.50  ? 139 LEU D C   1 
ATOM   8936  O O   . LEU D 1 138 ? 16.818  -7.340   -19.206 1.00 50.43  ? 139 LEU D O   1 
ATOM   8937  C CB  . LEU D 1 138 ? 15.173  -5.048   -19.424 1.00 52.92  ? 139 LEU D CB  1 
ATOM   8938  C CG  . LEU D 1 138 ? 14.802  -3.696   -20.038 1.00 52.70  ? 139 LEU D CG  1 
ATOM   8939  C CD1 . LEU D 1 138 ? 15.134  -2.537   -19.107 1.00 52.75  ? 139 LEU D CD1 1 
ATOM   8940  C CD2 . LEU D 1 138 ? 15.501  -3.535   -21.383 1.00 50.82  ? 139 LEU D CD2 1 
ATOM   8941  N N   . SER D 1 139 ? 15.263  -8.586   -20.289 1.00 53.41  ? 140 SER D N   1 
ATOM   8942  C CA  . SER D 1 139 ? 15.870  -9.896   -20.078 1.00 53.25  ? 140 SER D CA  1 
ATOM   8943  C C   . SER D 1 139 ? 15.979  -10.246  -18.598 1.00 54.45  ? 140 SER D C   1 
ATOM   8944  O O   . SER D 1 139 ? 17.025  -10.693  -18.121 1.00 52.86  ? 140 SER D O   1 
ATOM   8945  C CB  . SER D 1 139 ? 17.243  -9.952   -20.750 1.00 52.19  ? 140 SER D CB  1 
ATOM   8946  O OG  . SER D 1 139 ? 17.684  -11.286  -20.894 1.00 53.24  ? 140 SER D OG  1 
ATOM   8947  N N   . SER D 1 140 ? 14.879  -10.042  -17.880 1.00 56.45  ? 141 SER D N   1 
ATOM   8948  C CA  . SER D 1 140 ? 14.803  -10.366  -16.465 1.00 59.12  ? 141 SER D CA  1 
ATOM   8949  C C   . SER D 1 140 ? 15.023  -11.858  -16.245 1.00 60.85  ? 141 SER D C   1 
ATOM   8950  O O   . SER D 1 140 ? 15.632  -12.271  -15.258 1.00 60.45  ? 141 SER D O   1 
ATOM   8951  C CB  . SER D 1 140 ? 13.450  -9.938   -15.891 1.00 61.28  ? 141 SER D CB  1 
ATOM   8952  N N   . SER D 1 141 ? 14.529  -12.655  -17.186 1.00 62.57  ? 142 SER D N   1 
ATOM   8953  C CA  . SER D 1 141 ? 14.637  -14.105  -17.117 1.00 64.68  ? 142 SER D CA  1 
ATOM   8954  C C   . SER D 1 141 ? 16.091  -14.572  -17.186 1.00 61.65  ? 142 SER D C   1 
ATOM   8955  O O   . SER D 1 141 ? 16.553  -15.332  -16.329 1.00 62.64  ? 142 SER D O   1 
ATOM   8956  C CB  . SER D 1 141 ? 13.819  -14.742  -18.243 1.00 68.53  ? 142 SER D CB  1 
ATOM   8957  O OG  . SER D 1 141 ? 14.221  -16.078  -18.478 1.00 70.98  ? 142 SER D OG  1 
ATOM   8958  N N   . ALA D 1 142 ? 16.815  -14.106  -18.198 1.00 57.54  ? 143 ALA D N   1 
ATOM   8959  C CA  . ALA D 1 142 ? 18.199  -14.522  -18.390 1.00 54.51  ? 143 ALA D CA  1 
ATOM   8960  C C   . ALA D 1 142 ? 19.106  -14.092  -17.239 1.00 52.79  ? 143 ALA D C   1 
ATOM   8961  O O   . ALA D 1 142 ? 20.014  -14.831  -16.867 1.00 51.85  ? 143 ALA D O   1 
ATOM   8962  C CB  . ALA D 1 142 ? 18.735  -13.984  -19.699 1.00 52.54  ? 143 ALA D CB  1 
ATOM   8963  N N   . SER D 1 143 ? 18.871  -12.907  -16.681 1.00 52.49  ? 144 SER D N   1 
ATOM   8964  C CA  . SER D 1 143 ? 19.693  -12.435  -15.567 1.00 54.47  ? 144 SER D CA  1 
ATOM   8965  C C   . SER D 1 143 ? 19.540  -13.368  -14.369 1.00 54.83  ? 144 SER D C   1 
ATOM   8966  O O   . SER D 1 143 ? 20.521  -13.719  -13.721 1.00 55.15  ? 144 SER D O   1 
ATOM   8967  C CB  . SER D 1 143 ? 19.331  -10.998  -15.174 1.00 56.43  ? 144 SER D CB  1 
ATOM   8968  O OG  . SER D 1 143 ? 18.020  -10.917  -14.645 1.00 60.18  ? 144 SER D OG  1 
ATOM   8969  N N   . LEU D 1 144 ? 18.304  -13.779  -14.099 1.00 56.23  ? 145 LEU D N   1 
ATOM   8970  C CA  . LEU D 1 144 ? 18.015  -14.713  -13.017 1.00 57.30  ? 145 LEU D CA  1 
ATOM   8971  C C   . LEU D 1 144 ? 18.687  -16.064  -13.250 1.00 57.73  ? 145 LEU D C   1 
ATOM   8972  O O   . LEU D 1 144 ? 19.305  -16.620  -12.344 1.00 59.16  ? 145 LEU D O   1 
ATOM   8973  C CB  . LEU D 1 144 ? 16.503  -14.901  -12.863 1.00 59.28  ? 145 LEU D CB  1 
ATOM   8974  N N   . GLU D 1 145 ? 18.563  -16.582  -14.469 1.00 57.39  ? 146 GLU D N   1 
ATOM   8975  C CA  . GLU D 1 145 ? 19.160  -17.864  -14.833 1.00 57.50  ? 146 GLU D CA  1 
ATOM   8976  C C   . GLU D 1 145 ? 20.674  -17.844  -14.676 1.00 55.87  ? 146 GLU D C   1 
ATOM   8977  O O   . GLU D 1 145 ? 21.260  -18.754  -14.087 1.00 56.62  ? 146 GLU D O   1 
ATOM   8978  C CB  . GLU D 1 145 ? 18.800  -18.233  -16.273 1.00 58.44  ? 146 GLU D CB  1 
ATOM   8979  C CG  . GLU D 1 145 ? 17.338  -18.539  -16.494 1.00 60.42  ? 146 GLU D CG  1 
ATOM   8980  C CD  . GLU D 1 145 ? 16.917  -18.338  -17.935 1.00 60.85  ? 146 GLU D CD  1 
ATOM   8981  O OE1 . GLU D 1 145 ? 17.765  -18.495  -18.842 1.00 56.23  ? 146 GLU D OE1 1 
ATOM   8982  O OE2 . GLU D 1 145 ? 15.730  -18.026  -18.157 1.00 61.58  ? 146 GLU D OE2 1 
ATOM   8983  N N   . VAL D 1 146 ? 21.301  -16.800  -15.205 1.00 53.91  ? 147 VAL D N   1 
ATOM   8984  C CA  . VAL D 1 146 ? 22.752  -16.678  -15.162 1.00 51.97  ? 147 VAL D CA  1 
ATOM   8985  C C   . VAL D 1 146 ? 23.246  -16.461  -13.735 1.00 55.35  ? 147 VAL D C   1 
ATOM   8986  O O   . VAL D 1 146 ? 24.256  -17.041  -13.330 1.00 52.59  ? 147 VAL D O   1 
ATOM   8987  C CB  . VAL D 1 146 ? 23.242  -15.527  -16.057 1.00 50.02  ? 147 VAL D CB  1 
ATOM   8988  C CG1 . VAL D 1 146 ? 24.738  -15.310  -15.882 1.00 49.01  ? 147 VAL D CG1 1 
ATOM   8989  C CG2 . VAL D 1 146 ? 22.914  -15.822  -17.514 1.00 49.67  ? 147 VAL D CG2 1 
ATOM   8990  N N   . ALA D 1 147 ? 22.536  -15.630  -12.976 1.00 52.74  ? 148 ALA D N   1 
ATOM   8991  C CA  . ALA D 1 147 ? 22.887  -15.392  -11.578 1.00 58.39  ? 148 ALA D CA  1 
ATOM   8992  C C   . ALA D 1 147 ? 22.755  -16.682  -10.782 1.00 59.90  ? 148 ALA D C   1 
ATOM   8993  O O   . ALA D 1 147 ? 23.554  -16.956  -9.882  1.00 60.75  ? 148 ALA D O   1 
ATOM   8994  C CB  . ALA D 1 147 ? 22.011  -14.304  -10.977 1.00 53.70  ? 148 ALA D CB  1 
ATOM   8995  N N   . THR D 1 148 ? 21.738  -17.467  -11.122 1.00 60.37  ? 149 THR D N   1 
ATOM   8996  C CA  . THR D 1 148 ? 21.522  -18.766  -10.497 1.00 61.01  ? 149 THR D CA  1 
ATOM   8997  C C   . THR D 1 148 ? 22.668  -19.713  -10.827 1.00 59.95  ? 149 THR D C   1 
ATOM   8998  O O   . THR D 1 148 ? 23.225  -20.359  -9.936  1.00 61.14  ? 149 THR D O   1 
ATOM   8999  C CB  . THR D 1 148 ? 20.194  -19.402  -10.948 1.00 62.65  ? 149 THR D CB  1 
ATOM   9000  O OG1 . THR D 1 148 ? 19.096  -18.644  -10.426 1.00 60.25  ? 149 THR D OG1 1 
ATOM   9001  C CG2 . THR D 1 148 ? 20.091  -20.835  -10.453 1.00 64.64  ? 149 THR D CG2 1 
ATOM   9002  N N   . TYR D 1 149 ? 23.019  -19.782  -12.111 1.00 57.44  ? 150 TYR D N   1 
ATOM   9003  C CA  . TYR D 1 149 ? 24.105  -20.643  -12.564 1.00 56.87  ? 150 TYR D CA  1 
ATOM   9004  C C   . TYR D 1 149 ? 25.419  -20.232  -11.911 1.00 57.89  ? 150 TYR D C   1 
ATOM   9005  O O   . TYR D 1 149 ? 26.209  -21.080  -11.497 1.00 57.78  ? 150 TYR D O   1 
ATOM   9006  C CB  . TYR D 1 149 ? 24.243  -20.599  -14.090 1.00 56.40  ? 150 TYR D CB  1 
ATOM   9007  C CG  . TYR D 1 149 ? 25.144  -21.683  -14.646 1.00 57.96  ? 150 TYR D CG  1 
ATOM   9008  C CD1 . TYR D 1 149 ? 26.524  -21.516  -14.697 1.00 57.68  ? 150 TYR D CD1 1 
ATOM   9009  C CD2 . TYR D 1 149 ? 24.612  -22.879  -15.109 1.00 60.11  ? 150 TYR D CD2 1 
ATOM   9010  C CE1 . TYR D 1 149 ? 27.347  -22.512  -15.196 1.00 58.89  ? 150 TYR D CE1 1 
ATOM   9011  C CE2 . TYR D 1 149 ? 25.424  -23.877  -15.611 1.00 61.00  ? 150 TYR D CE2 1 
ATOM   9012  C CZ  . TYR D 1 149 ? 26.789  -23.691  -15.652 1.00 60.33  ? 150 TYR D CZ  1 
ATOM   9013  O OH  . TYR D 1 149 ? 27.594  -24.691  -16.154 1.00 60.66  ? 150 TYR D OH  1 
ATOM   9014  N N   . THR D 1 150 ? 25.641  -18.923  -11.827 1.00 54.77  ? 151 THR D N   1 
ATOM   9015  C CA  . THR D 1 150 ? 26.863  -18.374  -11.253 1.00 54.19  ? 151 THR D CA  1 
ATOM   9016  C C   . THR D 1 150 ? 26.962  -18.721  -9.765  1.00 55.75  ? 151 THR D C   1 
ATOM   9017  O O   . THR D 1 150 ? 28.052  -18.954  -9.241  1.00 56.10  ? 151 THR D O   1 
ATOM   9018  C CB  . THR D 1 150 ? 26.928  -16.841  -11.457 1.00 52.59  ? 151 THR D CB  1 
ATOM   9019  O OG1 . THR D 1 150 ? 26.967  -16.545  -12.862 1.00 51.19  ? 151 THR D OG1 1 
ATOM   9020  C CG2 . THR D 1 150 ? 28.162  -16.255  -10.797 1.00 52.24  ? 151 THR D CG2 1 
ATOM   9021  N N   . PHE D 1 151 ? 25.814  -18.769  -9.097  1.00 58.71  ? 152 PHE D N   1 
ATOM   9022  C CA  . PHE D 1 151 ? 25.753  -19.176  -7.698  1.00 60.47  ? 152 PHE D CA  1 
ATOM   9023  C C   . PHE D 1 151 ? 26.111  -20.650  -7.558  1.00 61.88  ? 152 PHE D C   1 
ATOM   9024  O O   . PHE D 1 151 ? 26.898  -21.024  -6.688  1.00 62.74  ? 152 PHE D O   1 
ATOM   9025  C CB  . PHE D 1 151 ? 24.362  -18.911  -7.114  1.00 62.30  ? 152 PHE D CB  1 
ATOM   9026  C CG  . PHE D 1 151 ? 24.279  -19.117  -5.623  1.00 65.81  ? 152 PHE D CG  1 
ATOM   9027  C CD1 . PHE D 1 151 ? 24.607  -18.091  -4.749  1.00 66.43  ? 152 PHE D CD1 1 
ATOM   9028  C CD2 . PHE D 1 151 ? 23.876  -20.334  -5.097  1.00 68.08  ? 152 PHE D CD2 1 
ATOM   9029  C CE1 . PHE D 1 151 ? 24.535  -18.276  -3.378  1.00 68.73  ? 152 PHE D CE1 1 
ATOM   9030  C CE2 . PHE D 1 151 ? 23.802  -20.523  -3.728  1.00 70.55  ? 152 PHE D CE2 1 
ATOM   9031  C CZ  . PHE D 1 151 ? 24.132  -19.492  -2.868  1.00 70.65  ? 152 PHE D CZ  1 
ATOM   9032  N N   . LEU D 1 152 ? 25.536  -21.483  -8.421  1.00 62.31  ? 153 LEU D N   1 
ATOM   9033  C CA  . LEU D 1 152 ? 25.819  -22.916  -8.406  1.00 64.66  ? 153 LEU D CA  1 
ATOM   9034  C C   . LEU D 1 152 ? 27.312  -23.215  -8.574  1.00 65.24  ? 153 LEU D C   1 
ATOM   9035  O O   . LEU D 1 152 ? 27.827  -24.171  -7.986  1.00 66.64  ? 153 LEU D O   1 
ATOM   9036  C CB  . LEU D 1 152 ? 25.023  -23.634  -9.501  1.00 64.59  ? 153 LEU D CB  1 
ATOM   9037  C CG  . LEU D 1 152 ? 23.494  -23.605  -9.408  1.00 65.65  ? 153 LEU D CG  1 
ATOM   9038  C CD1 . LEU D 1 152 ? 22.861  -24.528  -10.443 1.00 66.46  ? 153 LEU D CD1 1 
ATOM   9039  C CD2 . LEU D 1 152 ? 23.030  -23.974  -8.011  1.00 67.90  ? 153 LEU D CD2 1 
ATOM   9040  N N   . GLN D 1 153 ? 27.999  -22.386  -9.362  1.00 59.46  ? 154 GLN D N   1 
ATOM   9041  C CA  . GLN D 1 153 ? 29.414  -22.583  -9.671  1.00 60.90  ? 154 GLN D CA  1 
ATOM   9042  C C   . GLN D 1 153 ? 30.258  -22.500  -8.427  1.00 62.10  ? 154 GLN D C   1 
ATOM   9043  O O   . GLN D 1 153 ? 31.395  -22.954  -8.404  1.00 60.48  ? 154 GLN D O   1 
ATOM   9044  C CB  . GLN D 1 153 ? 29.909  -21.541  -10.675 1.00 57.09  ? 154 GLN D CB  1 
ATOM   9045  C CG  . GLN D 1 153 ? 29.679  -21.973  -12.091 1.00 57.08  ? 154 GLN D CG  1 
ATOM   9046  C CD  . GLN D 1 153 ? 30.067  -20.937  -13.108 1.00 54.58  ? 154 GLN D CD  1 
ATOM   9047  O OE1 . GLN D 1 153 ? 29.380  -19.932  -13.288 1.00 53.49  ? 154 GLN D OE1 1 
ATOM   9048  N NE2 . GLN D 1 153 ? 31.172  -21.182  -13.794 1.00 54.43  ? 154 GLN D NE2 1 
ATOM   9049  N N   . GLN D 1 154 ? 29.688  -21.899  -7.397  1.00 63.62  ? 155 GLN D N   1 
ATOM   9050  C CA  . GLN D 1 154 ? 30.451  -21.455  -6.253  1.00 65.35  ? 155 GLN D CA  1 
ATOM   9051  C C   . GLN D 1 154 ? 30.165  -22.413  -5.133  1.00 65.74  ? 155 GLN D C   1 
ATOM   9052  O O   . GLN D 1 154 ? 30.937  -22.487  -4.182  1.00 66.25  ? 155 GLN D O   1 
ATOM   9053  C CB  . GLN D 1 154 ? 30.100  -19.996  -5.977  1.00 69.15  ? 155 GLN D CB  1 
ATOM   9054  C CG  . GLN D 1 154 ? 30.787  -19.166  -7.035  1.00 74.56  ? 155 GLN D CG  1 
ATOM   9055  C CD  . GLN D 1 154 ? 32.102  -18.592  -6.576  1.00 81.52  ? 155 GLN D CD  1 
ATOM   9056  O OE1 . GLN D 1 154 ? 32.145  -17.438  -6.161  1.00 83.55  ? 155 GLN D OE1 1 
ATOM   9057  N NE2 . GLN D 1 154 ? 33.083  -19.454  -6.385  1.00 84.89  ? 155 GLN D NE2 1 
ATOM   9058  N N   . LEU D 1 155 ? 29.136  -23.238  -5.359  1.00 66.21  ? 156 LEU D N   1 
ATOM   9059  C CA  . LEU D 1 155 ? 28.848  -24.456  -4.596  1.00 70.09  ? 156 LEU D CA  1 
ATOM   9060  C C   . LEU D 1 155 ? 29.607  -25.654  -5.180  1.00 71.68  ? 156 LEU D C   1 
ATOM   9061  O O   . LEU D 1 155 ? 30.357  -26.332  -4.476  1.00 72.83  ? 156 LEU D O   1 
ATOM   9062  C CB  . LEU D 1 155 ? 27.347  -24.741  -4.600  1.00 71.66  ? 156 LEU D CB  1 
ATOM   9063  C CG  . LEU D 1 155 ? 26.506  -23.564  -4.121  1.00 71.74  ? 156 LEU D CG  1 
ATOM   9064  C CD1 . LEU D 1 155 ? 25.041  -23.871  -4.328  1.00 72.58  ? 156 LEU D CD1 1 
ATOM   9065  C CD2 . LEU D 1 155 ? 26.811  -23.272  -2.658  1.00 72.71  ? 156 LEU D CD2 1 
ATOM   9066  N N   . CYS D 1 156 ? 29.413  -25.900  -6.473  1.00 71.24  ? 157 CYS D N   1 
ATOM   9067  C CA  . CYS D 1 156 ? 30.102  -26.990  -7.164  1.00 72.36  ? 157 CYS D CA  1 
ATOM   9068  C C   . CYS D 1 156 ? 30.554  -26.554  -8.554  1.00 71.40  ? 157 CYS D C   1 
ATOM   9069  O O   . CYS D 1 156 ? 29.753  -26.509  -9.486  1.00 70.65  ? 157 CYS D O   1 
ATOM   9070  C CB  . CYS D 1 156 ? 29.203  -28.224  -7.270  1.00 73.33  ? 157 CYS D CB  1 
ATOM   9071  S SG  . CYS D 1 156 ? 29.943  -29.601  -8.189  1.00 93.59  ? 157 CYS D SG  1 
ATOM   9072  N N   . PRO D 1 157 ? 31.848  -26.239  -8.696  1.00 71.56  ? 158 PRO D N   1 
ATOM   9073  C CA  . PRO D 1 157 ? 32.397  -25.691  -9.940  1.00 71.16  ? 158 PRO D CA  1 
ATOM   9074  C C   . PRO D 1 157 ? 32.360  -26.672  -11.108 1.00 72.99  ? 158 PRO D C   1 
ATOM   9075  O O   . PRO D 1 157 ? 32.672  -27.850  -10.937 1.00 73.92  ? 158 PRO D O   1 
ATOM   9076  C CB  . PRO D 1 157 ? 33.849  -25.357  -9.568  1.00 70.46  ? 158 PRO D CB  1 
ATOM   9077  C CG  . PRO D 1 157 ? 33.871  -25.303  -8.074  1.00 71.05  ? 158 PRO D CG  1 
ATOM   9078  C CD  . PRO D 1 157 ? 32.861  -26.310  -7.631  1.00 72.70  ? 158 PRO D CD  1 
ATOM   9079  N N   . ASP D 1 158 ? 31.977  -26.182  -12.283 1.00 73.31  ? 159 ASP D N   1 
ATOM   9080  C CA  . ASP D 1 158 ? 32.083  -26.972  -13.501 1.00 75.29  ? 159 ASP D CA  1 
ATOM   9081  C C   . ASP D 1 158 ? 33.427  -26.686  -14.149 1.00 75.05  ? 159 ASP D C   1 
ATOM   9082  O O   . ASP D 1 158 ? 34.132  -25.762  -13.747 1.00 74.91  ? 159 ASP D O   1 
ATOM   9083  C CB  . ASP D 1 158 ? 30.936  -26.660  -14.466 1.00 76.28  ? 159 ASP D CB  1 
ATOM   9084  C CG  . ASP D 1 158 ? 30.967  -25.227  -14.976 1.00 76.56  ? 159 ASP D CG  1 
ATOM   9085  O OD1 . ASP D 1 158 ? 31.835  -24.905  -15.817 1.00 75.72  ? 159 ASP D OD1 1 
ATOM   9086  O OD2 . ASP D 1 158 ? 30.114  -24.424  -14.544 1.00 77.27  ? 159 ASP D OD2 1 
ATOM   9087  N N   . SER D 1 159 ? 33.788  -27.482  -15.147 1.00 75.63  ? 160 SER D N   1 
ATOM   9088  C CA  . SER D 1 159 ? 34.999  -27.222  -15.912 1.00 75.25  ? 160 SER D CA  1 
ATOM   9089  C C   . SER D 1 159 ? 34.609  -26.907  -17.348 1.00 74.19  ? 160 SER D C   1 
ATOM   9090  O O   . SER D 1 159 ? 35.421  -27.001  -18.272 1.00 74.36  ? 160 SER D O   1 
ATOM   9091  C CB  . SER D 1 159 ? 35.950  -28.416  -15.853 1.00 77.50  ? 160 SER D CB  1 
ATOM   9092  N N   . GLY D 1 160 ? 33.351  -26.513  -17.516 1.00 73.51  ? 161 GLY D N   1 
ATOM   9093  C CA  . GLY D 1 160 ? 32.775  -26.293  -18.828 1.00 73.13  ? 161 GLY D CA  1 
ATOM   9094  C C   . GLY D 1 160 ? 33.194  -24.990  -19.475 1.00 71.96  ? 161 GLY D C   1 
ATOM   9095  O O   . GLY D 1 160 ? 34.191  -24.371  -19.093 1.00 72.65  ? 161 GLY D O   1 
ATOM   9096  N N   . THR D 1 161 ? 32.422  -24.580  -20.475 1.00 70.28  ? 162 THR D N   1 
ATOM   9097  C CA  . THR D 1 161 ? 32.727  -23.393  -21.252 1.00 67.46  ? 162 THR D CA  1 
ATOM   9098  C C   . THR D 1 161 ? 31.575  -22.401  -21.191 1.00 63.99  ? 162 THR D C   1 
ATOM   9099  O O   . THR D 1 161 ? 30.539  -22.675  -20.580 1.00 63.76  ? 162 THR D O   1 
ATOM   9100  C CB  . THR D 1 161 ? 33.025  -23.753  -22.723 1.00 69.02  ? 162 THR D CB  1 
ATOM   9101  O OG1 . THR D 1 161 ? 31.829  -24.216  -23.367 1.00 70.18  ? 162 THR D OG1 1 
ATOM   9102  C CG2 . THR D 1 161 ? 34.075  -24.849  -22.797 1.00 70.83  ? 162 THR D CG2 1 
ATOM   9103  N N   . ILE D 1 162 ? 31.760  -21.250  -21.830 1.00 60.84  ? 163 ILE D N   1 
ATOM   9104  C CA  . ILE D 1 162 ? 30.754  -20.197  -21.803 1.00 59.02  ? 163 ILE D CA  1 
ATOM   9105  C C   . ILE D 1 162 ? 29.486  -20.602  -22.559 1.00 59.69  ? 163 ILE D C   1 
ATOM   9106  O O   . ILE D 1 162 ? 28.381  -20.446  -22.039 1.00 60.88  ? 163 ILE D O   1 
ATOM   9107  C CB  . ILE D 1 162 ? 31.300  -18.879  -22.388 1.00 56.78  ? 163 ILE D CB  1 
ATOM   9108  N N   . ALA D 1 163 ? 29.635  -21.122  -23.775 1.00 58.79  ? 164 ALA D N   1 
ATOM   9109  C CA  . ALA D 1 163 ? 28.466  -21.495  -24.572 1.00 58.06  ? 164 ALA D CA  1 
ATOM   9110  C C   . ALA D 1 163 ? 27.671  -22.617  -23.908 1.00 59.33  ? 164 ALA D C   1 
ATOM   9111  O O   . ALA D 1 163 ? 26.442  -22.564  -23.854 1.00 59.26  ? 164 ALA D O   1 
ATOM   9112  C CB  . ALA D 1 163 ? 28.878  -21.902  -25.976 1.00 57.80  ? 164 ALA D CB  1 
ATOM   9113  N N   . ALA D 1 164 ? 28.372  -23.625  -23.395 1.00 60.31  ? 165 ALA D N   1 
ATOM   9114  C CA  . ALA D 1 164 ? 27.715  -24.736  -22.717 1.00 61.53  ? 165 ALA D CA  1 
ATOM   9115  C C   . ALA D 1 164 ? 26.929  -24.243  -21.507 1.00 61.20  ? 165 ALA D C   1 
ATOM   9116  O O   . ALA D 1 164 ? 25.874  -24.786  -21.179 1.00 62.73  ? 165 ALA D O   1 
ATOM   9117  C CB  . ALA D 1 164 ? 28.733  -25.784  -22.298 1.00 62.91  ? 165 ALA D CB  1 
ATOM   9118  N N   . ARG D 1 165 ? 27.445  -23.210  -20.849 1.00 59.44  ? 166 ARG D N   1 
ATOM   9119  C CA  . ARG D 1 165 ? 26.755  -22.622  -19.709 1.00 59.17  ? 166 ARG D CA  1 
ATOM   9120  C C   . ARG D 1 165 ? 25.483  -21.926  -20.175 1.00 58.14  ? 166 ARG D C   1 
ATOM   9121  O O   . ARG D 1 165 ? 24.427  -22.053  -19.552 1.00 58.51  ? 166 ARG D O   1 
ATOM   9122  C CB  . ARG D 1 165 ? 27.663  -21.639  -18.973 1.00 58.27  ? 166 ARG D CB  1 
ATOM   9123  N N   . ALA D 1 166 ? 25.595  -21.187  -21.275 1.00 56.87  ? 167 ALA D N   1 
ATOM   9124  C CA  . ALA D 1 166 ? 24.439  -20.548  -21.887 1.00 56.65  ? 167 ALA D CA  1 
ATOM   9125  C C   . ALA D 1 166 ? 23.451  -21.609  -22.358 1.00 58.64  ? 167 ALA D C   1 
ATOM   9126  O O   . ALA D 1 166 ? 22.238  -21.444  -22.226 1.00 58.63  ? 167 ALA D O   1 
ATOM   9127  C CB  . ALA D 1 166 ? 24.869  -19.660  -23.048 1.00 55.14  ? 167 ALA D CB  1 
ATOM   9128  N N   . GLN D 1 167 ? 23.985  -22.702  -22.898 1.00 60.41  ? 168 GLN D N   1 
ATOM   9129  C CA  . GLN D 1 167 ? 23.163  -23.805  -23.382 1.00 63.83  ? 168 GLN D CA  1 
ATOM   9130  C C   . GLN D 1 167 ? 22.335  -24.408  -22.255 1.00 66.05  ? 168 GLN D C   1 
ATOM   9131  O O   . GLN D 1 167 ? 21.172  -24.763  -22.451 1.00 67.67  ? 168 GLN D O   1 
ATOM   9132  C CB  . GLN D 1 167 ? 24.036  -24.883  -24.028 1.00 65.48  ? 168 GLN D CB  1 
ATOM   9133  N N   . VAL D 1 168 ? 22.940  -24.519  -21.075 1.00 65.82  ? 169 VAL D N   1 
ATOM   9134  C CA  . VAL D 1 168 ? 22.242  -25.041  -19.905 1.00 67.38  ? 169 VAL D CA  1 
ATOM   9135  C C   . VAL D 1 168 ? 21.152  -24.072  -19.461 1.00 68.10  ? 169 VAL D C   1 
ATOM   9136  O O   . VAL D 1 168 ? 20.070  -24.486  -19.041 1.00 69.63  ? 169 VAL D O   1 
ATOM   9137  C CB  . VAL D 1 168 ? 23.208  -25.301  -18.728 1.00 66.19  ? 169 VAL D CB  1 
ATOM   9138  N N   . CYS D 1 169 ? 21.444  -22.779  -19.558 1.00 67.06  ? 170 CYS D N   1 
ATOM   9139  C CA  . CYS D 1 169 ? 20.468  -21.755  -19.214 1.00 68.03  ? 170 CYS D CA  1 
ATOM   9140  C C   . CYS D 1 169 ? 19.350  -21.711  -20.248 1.00 69.10  ? 170 CYS D C   1 
ATOM   9141  O O   . CYS D 1 169 ? 18.195  -21.450  -19.914 1.00 69.63  ? 170 CYS D O   1 
ATOM   9142  C CB  . CYS D 1 169 ? 21.137  -20.385  -19.097 1.00 66.38  ? 170 CYS D CB  1 
ATOM   9143  S SG  . CYS D 1 169 ? 22.171  -20.190  -17.630 1.00 58.68  ? 170 CYS D SG  1 
ATOM   9144  N N   . GLN D 1 170 ? 19.702  -21.974  -21.503 1.00 70.08  ? 171 GLN D N   1 
ATOM   9145  C CA  . GLN D 1 170 ? 18.728  -21.978  -22.589 1.00 72.28  ? 171 GLN D CA  1 
ATOM   9146  C C   . GLN D 1 170 ? 17.794  -23.176  -22.473 1.00 76.22  ? 171 GLN D C   1 
ATOM   9147  O O   . GLN D 1 170 ? 16.582  -23.045  -22.638 1.00 77.71  ? 171 GLN D O   1 
ATOM   9148  C CB  . GLN D 1 170 ? 19.431  -21.986  -23.948 1.00 71.43  ? 171 GLN D CB  1 
ATOM   9149  N N   . GLN D 1 171 ? 18.364  -24.343  -22.189 1.00 78.49  ? 172 GLN D N   1 
ATOM   9150  C CA  . GLN D 1 171 ? 17.574  -25.553  -21.998 1.00 82.77  ? 172 GLN D CA  1 
ATOM   9151  C C   . GLN D 1 171 ? 16.651  -25.400  -20.793 1.00 85.40  ? 172 GLN D C   1 
ATOM   9152  O O   . GLN D 1 171 ? 15.543  -25.937  -20.775 1.00 87.30  ? 172 GLN D O   1 
ATOM   9153  C CB  . GLN D 1 171 ? 18.482  -26.771  -21.821 1.00 83.70  ? 172 GLN D CB  1 
ATOM   9154  N N   . ALA D 1 172 ? 17.117  -24.662  -19.791 1.00 85.55  ? 173 ALA D N   1 
ATOM   9155  C CA  . ALA D 1 172 ? 16.315  -24.380  -18.608 1.00 88.02  ? 173 ALA D CA  1 
ATOM   9156  C C   . ALA D 1 172 ? 15.131  -23.486  -18.962 1.00 90.05  ? 173 ALA D C   1 
ATOM   9157  O O   . ALA D 1 172 ? 13.998  -23.769  -18.575 1.00 92.28  ? 173 ALA D O   1 
ATOM   9158  C CB  . ALA D 1 172 ? 17.167  -23.733  -17.526 1.00 86.43  ? 173 ALA D CB  1 
ATOM   9159  N N   . GLU D 1 173 ? 15.392  -22.406  -19.694 1.00 89.73  ? 174 GLU D N   1 
ATOM   9160  C CA  . GLU D 1 173 ? 14.314  -21.540  -20.157 1.00 91.68  ? 174 GLU D CA  1 
ATOM   9161  C C   . GLU D 1 173 ? 13.705  -22.130  -21.425 1.00 93.93  ? 174 GLU D C   1 
ATOM   9162  O O   . GLU D 1 173 ? 13.974  -21.673  -22.539 1.00 93.55  ? 174 GLU D O   1 
ATOM   9163  C CB  . GLU D 1 173 ? 14.807  -20.113  -20.408 1.00 89.92  ? 174 GLU D CB  1 
ATOM   9164  C CG  . GLU D 1 173 ? 13.707  -19.167  -20.882 1.00 90.79  ? 174 GLU D CG  1 
ATOM   9165  C CD  . GLU D 1 173 ? 14.161  -17.729  -20.981 1.00 89.30  ? 174 GLU D CD  1 
ATOM   9166  O OE1 . GLU D 1 173 ? 15.384  -17.482  -20.933 1.00 87.54  ? 174 GLU D OE1 1 
ATOM   9167  O OE2 . GLU D 1 173 ? 13.290  -16.843  -21.116 1.00 90.10  ? 174 GLU D OE2 1 
ATOM   9168  N N   . HIS D 1 174 ? 12.889  -23.159  -21.219 1.00 96.19  ? 175 HIS D N   1 
ATOM   9169  C CA  . HIS D 1 174 ? 12.207  -23.909  -22.267 1.00 98.14  ? 175 HIS D CA  1 
ATOM   9170  C C   . HIS D 1 174 ? 11.601  -25.124  -21.600 1.00 99.81  ? 175 HIS D C   1 
ATOM   9171  O O   . HIS D 1 174 ? 10.459  -25.100  -21.138 1.00 101.81 ? 175 HIS D O   1 
ATOM   9172  C CB  . HIS D 1 174 ? 13.154  -24.347  -23.389 1.00 98.31  ? 175 HIS D CB  1 
ATOM   9173  C CG  . HIS D 1 174 ? 12.477  -25.106  -24.487 1.00 101.61 ? 175 HIS D CG  1 
ATOM   9174  N ND1 . HIS D 1 174 ? 11.495  -24.551  -25.281 1.00 103.07 ? 175 HIS D ND1 1 
ATOM   9175  C CD2 . HIS D 1 174 ? 12.628  -26.382  -24.914 1.00 103.68 ? 175 HIS D CD2 1 
ATOM   9176  C CE1 . HIS D 1 174 ? 11.078  -25.450  -26.154 1.00 105.28 ? 175 HIS D CE1 1 
ATOM   9177  N NE2 . HIS D 1 174 ? 11.749  -26.570  -25.952 1.00 105.68 ? 175 HIS D NE2 1 
ATOM   9178  N N   . SER D 1 175 ? 12.396  -26.186  -21.538 1.00 99.13  ? 176 SER D N   1 
ATOM   9179  C CA  . SER D 1 175 ? 12.041  -27.375  -20.786 1.00 100.69 ? 176 SER D CA  1 
ATOM   9180  C C   . SER D 1 175 ? 12.180  -27.080  -19.300 1.00 99.36  ? 176 SER D C   1 
ATOM   9181  O O   . SER D 1 175 ? 13.114  -27.572  -18.673 1.00 99.19  ? 176 SER D O   1 
ATOM   9182  C CB  . SER D 1 175 ? 12.935  -28.551  -21.180 1.00 101.28 ? 176 SER D CB  1 
ATOM   9183  O OG  . SER D 1 175 ? 13.271  -28.495  -22.556 1.00 100.92 ? 176 SER D OG  1 
ATOM   9184  N N   . PHE D 1 176 ? 11.251  -26.259  -18.794 1.00 98.19  ? 177 PHE D N   1 
ATOM   9185  C CA  . PHE D 1 176 ? 11.104  -25.779  -17.403 1.00 96.57  ? 177 PHE D CA  1 
ATOM   9186  C C   . PHE D 1 176 ? 10.654  -24.319  -17.435 1.00 94.85  ? 177 PHE D C   1 
ATOM   9187  O O   . PHE D 1 176 ? 9.534   -23.989  -17.042 1.00 96.10  ? 177 PHE D O   1 
ATOM   9188  C CB  . PHE D 1 176 ? 12.384  -25.899  -16.563 1.00 94.01  ? 177 PHE D CB  1 
ATOM   9189  C CG  . PHE D 1 176 ? 12.357  -27.034  -15.568 1.00 95.17  ? 177 PHE D CG  1 
ATOM   9190  C CD1 . PHE D 1 176 ? 11.981  -26.810  -14.255 1.00 95.63  ? 177 PHE D CD1 1 
ATOM   9191  C CD2 . PHE D 1 176 ? 12.699  -28.323  -15.947 1.00 96.19  ? 177 PHE D CD2 1 
ATOM   9192  C CE1 . PHE D 1 176 ? 11.952  -27.848  -13.342 1.00 97.56  ? 177 PHE D CE1 1 
ATOM   9193  C CE2 . PHE D 1 176 ? 12.672  -29.364  -15.040 1.00 97.93  ? 177 PHE D CE2 1 
ATOM   9194  C CZ  . PHE D 1 176 ? 12.299  -29.126  -13.736 1.00 98.67  ? 177 PHE D CZ  1 
ATOM   9195  N N   . MET D 1 184 ? 21.349  -16.363  -26.044 1.00 57.55  ? 185 MET D N   1 
ATOM   9196  C CA  . MET D 1 184 ? 21.687  -15.050  -26.580 1.00 55.44  ? 185 MET D CA  1 
ATOM   9197  C C   . MET D 1 184 ? 21.615  -13.983  -25.499 1.00 53.04  ? 185 MET D C   1 
ATOM   9198  O O   . MET D 1 184 ? 22.600  -13.298  -25.219 1.00 50.86  ? 185 MET D O   1 
ATOM   9199  C CB  . MET D 1 184 ? 20.756  -14.686  -27.731 1.00 56.24  ? 185 MET D CB  1 
ATOM   9200  C CG  . MET D 1 184 ? 21.013  -13.309  -28.292 1.00 55.65  ? 185 MET D CG  1 
ATOM   9201  S SD  . MET D 1 184 ? 22.738  -13.137  -28.766 1.00 122.19 ? 185 MET D SD  1 
ATOM   9202  C CE  . MET D 1 184 ? 22.843  -14.377  -30.052 1.00 63.13  ? 185 MET D CE  1 
ATOM   9203  N N   . ASP D 1 185 ? 20.434  -13.843  -24.905 1.00 52.88  ? 186 ASP D N   1 
ATOM   9204  C CA  . ASP D 1 185 ? 20.264  -12.996  -23.733 1.00 53.05  ? 186 ASP D CA  1 
ATOM   9205  C C   . ASP D 1 185 ? 21.092  -13.559  -22.583 1.00 52.21  ? 186 ASP D C   1 
ATOM   9206  O O   . ASP D 1 185 ? 21.508  -12.834  -21.677 1.00 50.65  ? 186 ASP D O   1 
ATOM   9207  C CB  . ASP D 1 185 ? 18.790  -12.901  -23.335 1.00 56.16  ? 186 ASP D CB  1 
ATOM   9208  C CG  . ASP D 1 185 ? 17.925  -12.335  -24.439 1.00 58.15  ? 186 ASP D CG  1 
ATOM   9209  O OD1 . ASP D 1 185 ? 18.470  -11.629  -25.315 1.00 57.59  ? 186 ASP D OD1 1 
ATOM   9210  O OD2 . ASP D 1 185 ? 16.702  -12.579  -24.424 1.00 60.33  ? 186 ASP D OD2 1 
ATOM   9211  N N   . GLN D 1 186 ? 21.317  -14.868  -22.629 1.00 52.86  ? 187 GLN D N   1 
ATOM   9212  C CA  . GLN D 1 186 ? 22.163  -15.533  -21.653 1.00 53.15  ? 187 GLN D CA  1 
ATOM   9213  C C   . GLN D 1 186 ? 23.631  -15.220  -21.924 1.00 50.86  ? 187 GLN D C   1 
ATOM   9214  O O   . GLN D 1 186 ? 24.419  -15.056  -20.996 1.00 50.35  ? 187 GLN D O   1 
ATOM   9215  C CB  . GLN D 1 186 ? 21.924  -17.044  -21.677 1.00 55.46  ? 187 GLN D CB  1 
ATOM   9216  N N   . PHE D 1 187 ? 23.987  -15.123  -23.202 1.00 49.62  ? 188 PHE D N   1 
ATOM   9217  C CA  . PHE D 1 187 ? 25.365  -14.855  -23.597 1.00 47.09  ? 188 PHE D CA  1 
ATOM   9218  C C   . PHE D 1 187 ? 25.840  -13.495  -23.095 1.00 47.05  ? 188 PHE D C   1 
ATOM   9219  O O   . PHE D 1 187 ? 26.916  -13.387  -22.511 1.00 44.08  ? 188 PHE D O   1 
ATOM   9220  C CB  . PHE D 1 187 ? 25.514  -14.934  -25.118 1.00 46.70  ? 188 PHE D CB  1 
ATOM   9221  N N   . ILE D 1 188 ? 25.034  -12.461  -23.316 1.00 42.71  ? 189 ILE D N   1 
ATOM   9222  C CA  . ILE D 1 188 ? 25.414  -11.111  -22.916 1.00 41.46  ? 189 ILE D CA  1 
ATOM   9223  C C   . ILE D 1 188 ? 25.456  -11.004  -21.389 1.00 41.96  ? 189 ILE D C   1 
ATOM   9224  O O   . ILE D 1 188 ? 26.355  -10.380  -20.825 1.00 41.26  ? 189 ILE D O   1 
ATOM   9225  C CB  . ILE D 1 188 ? 24.450  -10.051  -23.507 1.00 48.13  ? 189 ILE D CB  1 
ATOM   9226  C CG1 . ILE D 1 188 ? 24.760  -8.655   -22.957 1.00 47.73  ? 189 ILE D CG1 1 
ATOM   9227  C CG2 . ILE D 1 188 ? 23.005  -10.424  -23.245 1.00 42.36  ? 189 ILE D CG2 1 
ATOM   9228  C CD1 . ILE D 1 188 ? 26.144  -8.149   -23.303 1.00 46.43  ? 189 ILE D CD1 1 
ATOM   9229  N N   . SER D 1 189 ? 24.495  -11.637  -20.728 1.00 43.35  ? 190 SER D N   1 
ATOM   9230  C CA  . SER D 1 189 ? 24.458  -11.658  -19.271 1.00 49.52  ? 190 SER D CA  1 
ATOM   9231  C C   . SER D 1 189 ? 25.704  -12.370  -18.745 1.00 49.05  ? 190 SER D C   1 
ATOM   9232  O O   . SER D 1 189 ? 26.286  -11.962  -17.742 1.00 49.14  ? 190 SER D O   1 
ATOM   9233  C CB  . SER D 1 189 ? 23.182  -12.339  -18.776 1.00 52.90  ? 190 SER D CB  1 
ATOM   9234  O OG  . SER D 1 189 ? 22.849  -11.905  -17.467 1.00 56.66  ? 190 SER D OG  1 
ATOM   9235  N N   . LEU D 1 190 ? 26.126  -13.414  -19.455 1.00 48.21  ? 191 LEU D N   1 
ATOM   9236  C CA  . LEU D 1 190 ? 27.321  -14.174  -19.093 1.00 46.42  ? 191 LEU D CA  1 
ATOM   9237  C C   . LEU D 1 190 ? 28.623  -13.485  -19.500 1.00 44.16  ? 191 LEU D C   1 
ATOM   9238  O O   . LEU D 1 190 ? 29.643  -13.660  -18.839 1.00 44.15  ? 191 LEU D O   1 
ATOM   9239  C CB  . LEU D 1 190 ? 27.278  -15.572  -19.725 1.00 47.97  ? 191 LEU D CB  1 
ATOM   9240  C CG  . LEU D 1 190 ? 26.490  -16.675  -19.020 1.00 51.17  ? 191 LEU D CG  1 
ATOM   9241  C CD1 . LEU D 1 190 ? 26.087  -17.766  -20.002 1.00 52.61  ? 191 LEU D CD1 1 
ATOM   9242  C CD2 . LEU D 1 190 ? 27.331  -17.257  -17.892 1.00 52.27  ? 191 LEU D CD2 1 
ATOM   9243  N N   . MET D 1 191 ? 28.604  -12.706  -20.579 1.00 42.41  ? 192 MET D N   1 
ATOM   9244  C CA  . MET D 1 191 ? 29.849  -12.179  -21.145 1.00 42.94  ? 192 MET D CA  1 
ATOM   9245  C C   . MET D 1 191 ? 29.971  -10.653  -21.106 1.00 40.04  ? 192 MET D C   1 
ATOM   9246  O O   . MET D 1 191 ? 30.986  -10.098  -21.525 1.00 39.20  ? 192 MET D O   1 
ATOM   9247  C CB  . MET D 1 191 ? 30.013  -12.664  -22.592 1.00 44.20  ? 192 MET D CB  1 
ATOM   9248  C CG  . MET D 1 191 ? 30.488  -14.113  -22.722 1.00 47.15  ? 192 MET D CG  1 
ATOM   9249  S SD  . MET D 1 191 ? 30.730  -14.635  -24.439 1.00 76.76  ? 192 MET D SD  1 
ATOM   9250  C CE  . MET D 1 191 ? 29.118  -15.316  -24.809 1.00 45.31  ? 192 MET D CE  1 
ATOM   9251  N N   . GLY D 1 192 ? 28.946  -9.980   -20.601 1.00 40.02  ? 193 GLY D N   1 
ATOM   9252  C CA  . GLY D 1 192 ? 28.949  -8.529   -20.542 1.00 41.04  ? 193 GLY D CA  1 
ATOM   9253  C C   . GLY D 1 192 ? 30.124  -7.931   -19.785 1.00 41.32  ? 193 GLY D C   1 
ATOM   9254  O O   . GLY D 1 192 ? 30.673  -8.541   -18.863 1.00 40.85  ? 193 GLY D O   1 
ATOM   9255  N N   . GLN D 1 193 ? 30.513  -6.720   -20.163 1.00 41.27  ? 194 GLN D N   1 
ATOM   9256  C CA  . GLN D 1 193 ? 31.602  -6.056   -19.465 1.00 44.38  ? 194 GLN D CA  1 
ATOM   9257  C C   . GLN D 1 193 ? 31.487  -4.531   -19.505 1.00 42.39  ? 194 GLN D C   1 
ATOM   9258  O O   . GLN D 1 193 ? 31.116  -3.952   -20.529 1.00 40.10  ? 194 GLN D O   1 
ATOM   9259  C CB  . GLN D 1 193 ? 32.935  -6.531   -20.048 1.00 48.52  ? 194 GLN D CB  1 
ATOM   9260  C CG  . GLN D 1 193 ? 34.064  -5.548   -19.947 1.00 53.60  ? 194 GLN D CG  1 
ATOM   9261  C CD  . GLN D 1 193 ? 35.364  -6.124   -20.462 1.00 59.31  ? 194 GLN D CD  1 
ATOM   9262  O OE1 . GLN D 1 193 ? 35.384  -7.181   -21.099 1.00 62.03  ? 194 GLN D OE1 1 
ATOM   9263  N NE2 . GLN D 1 193 ? 36.461  -5.430   -20.191 1.00 60.72  ? 194 GLN D NE2 1 
ATOM   9264  N N   . LYS D 1 194 ? 31.808  -3.898   -18.374 1.00 42.18  ? 195 LYS D N   1 
ATOM   9265  C CA  . LYS D 1 194 ? 31.667  -2.454   -18.216 1.00 42.10  ? 195 LYS D CA  1 
ATOM   9266  C C   . LYS D 1 194 ? 32.385  -1.671   -19.304 1.00 41.27  ? 195 LYS D C   1 
ATOM   9267  O O   . LYS D 1 194 ? 33.541  -1.952   -19.625 1.00 34.86  ? 195 LYS D O   1 
ATOM   9268  C CB  . LYS D 1 194 ? 32.186  -2.000   -16.846 1.00 44.68  ? 195 LYS D CB  1 
ATOM   9269  C CG  . LYS D 1 194 ? 32.274  -0.485   -16.725 1.00 45.36  ? 195 LYS D CG  1 
ATOM   9270  C CD  . LYS D 1 194 ? 32.394  -0.014   -15.287 1.00 48.41  ? 195 LYS D CD  1 
ATOM   9271  C CE  . LYS D 1 194 ? 32.476  1.507    -15.232 1.00 48.91  ? 195 LYS D CE  1 
ATOM   9272  N NZ  . LYS D 1 194 ? 32.300  2.023    -13.845 1.00 52.06  ? 195 LYS D NZ  1 
ATOM   9273  N N   . GLY D 1 195 ? 31.682  -0.697   -19.877 1.00 34.24  ? 196 GLY D N   1 
ATOM   9274  C CA  . GLY D 1 195 ? 32.250  0.152    -20.911 1.00 39.02  ? 196 GLY D CA  1 
ATOM   9275  C C   . GLY D 1 195 ? 32.407  -0.525   -22.264 1.00 37.07  ? 196 GLY D C   1 
ATOM   9276  O O   . GLY D 1 195 ? 33.160  -0.052   -23.115 1.00 34.53  ? 196 GLY D O   1 
ATOM   9277  N N   . HIS D 1 196 ? 31.710  -1.640   -22.462 1.00 37.22  ? 197 HIS D N   1 
ATOM   9278  C CA  . HIS D 1 196 ? 31.825  -2.399   -23.706 1.00 36.77  ? 197 HIS D CA  1 
ATOM   9279  C C   . HIS D 1 196 ? 30.469  -2.882   -24.204 1.00 37.91  ? 197 HIS D C   1 
ATOM   9280  O O   . HIS D 1 196 ? 29.575  -3.189   -23.413 1.00 33.85  ? 197 HIS D O   1 
ATOM   9281  C CB  . HIS D 1 196 ? 32.746  -3.612   -23.535 1.00 37.06  ? 197 HIS D CB  1 
ATOM   9282  C CG  . HIS D 1 196 ? 34.165  -3.264   -23.217 1.00 37.46  ? 197 HIS D CG  1 
ATOM   9283  N ND1 . HIS D 1 196 ? 34.563  -2.811   -21.974 1.00 38.36  ? 197 HIS D ND1 1 
ATOM   9284  C CD2 . HIS D 1 196 ? 35.288  -3.304   -23.974 1.00 37.46  ? 197 HIS D CD2 1 
ATOM   9285  C CE1 . HIS D 1 196 ? 35.862  -2.589   -21.983 1.00 39.23  ? 197 HIS D CE1 1 
ATOM   9286  N NE2 . HIS D 1 196 ? 36.329  -2.881   -23.187 1.00 38.66  ? 197 HIS D NE2 1 
ATOM   9287  N N   . ALA D 1 197 ? 30.334  -2.948   -25.525 1.00 38.20  ? 198 ALA D N   1 
ATOM   9288  C CA  . ALA D 1 197 ? 29.210  -3.625   -26.157 1.00 37.91  ? 198 ALA D CA  1 
ATOM   9289  C C   . ALA D 1 197 ? 29.707  -4.958   -26.702 1.00 36.71  ? 198 ALA D C   1 
ATOM   9290  O O   . ALA D 1 197 ? 30.903  -5.130   -26.944 1.00 35.92  ? 198 ALA D O   1 
ATOM   9291  C CB  . ALA D 1 197 ? 28.607  -2.764   -27.274 1.00 37.59  ? 198 ALA D CB  1 
ATOM   9292  N N   . LEU D 1 198 ? 28.797  -5.903   -26.900 1.00 36.75  ? 199 LEU D N   1 
ATOM   9293  C CA  . LEU D 1 198 ? 29.188  -7.228   -27.364 1.00 38.49  ? 199 LEU D CA  1 
ATOM   9294  C C   . LEU D 1 198 ? 28.676  -7.498   -28.781 1.00 37.91  ? 199 LEU D C   1 
ATOM   9295  O O   . LEU D 1 198 ? 27.483  -7.681   -28.986 1.00 38.02  ? 199 LEU D O   1 
ATOM   9296  C CB  . LEU D 1 198 ? 28.666  -8.293   -26.393 1.00 42.84  ? 199 LEU D CB  1 
ATOM   9297  C CG  . LEU D 1 198 ? 29.085  -9.757   -26.555 1.00 46.72  ? 199 LEU D CG  1 
ATOM   9298  C CD1 . LEU D 1 198 ? 30.600  -9.921   -26.485 1.00 47.73  ? 199 LEU D CD1 1 
ATOM   9299  C CD2 . LEU D 1 198 ? 28.412  -10.608  -25.492 1.00 48.33  ? 199 LEU D CD2 1 
ATOM   9300  N N   . LEU D 1 199 ? 29.571  -7.509   -29.764 1.00 35.47  ? 200 LEU D N   1 
ATOM   9301  C CA  . LEU D 1 199 ? 29.164  -7.915   -31.105 1.00 36.51  ? 200 LEU D CA  1 
ATOM   9302  C C   . LEU D 1 199 ? 29.145  -9.432   -31.191 1.00 39.12  ? 200 LEU D C   1 
ATOM   9303  O O   . LEU D 1 199 ? 30.174  -10.085  -31.023 1.00 38.58  ? 200 LEU D O   1 
ATOM   9304  C CB  . LEU D 1 199 ? 30.091  -7.341   -32.175 1.00 36.47  ? 200 LEU D CB  1 
ATOM   9305  C CG  . LEU D 1 199 ? 29.765  -7.812   -33.599 1.00 39.08  ? 200 LEU D CG  1 
ATOM   9306  C CD1 . LEU D 1 199 ? 28.432  -7.246   -34.079 1.00 35.11  ? 200 LEU D CD1 1 
ATOM   9307  C CD2 . LEU D 1 199 ? 30.885  -7.456   -34.560 1.00 38.29  ? 200 LEU D CD2 1 
ATOM   9308  N N   . ILE D 1 200 ? 27.970  -9.997   -31.433 1.00 37.68  ? 201 ILE D N   1 
ATOM   9309  C CA  . ILE D 1 200 ? 27.859  -11.440  -31.567 1.00 42.45  ? 201 ILE D CA  1 
ATOM   9310  C C   . ILE D 1 200 ? 27.506  -11.852  -32.987 1.00 42.75  ? 201 ILE D C   1 
ATOM   9311  O O   . ILE D 1 200 ? 26.418  -11.555  -33.478 1.00 40.11  ? 201 ILE D O   1 
ATOM   9312  C CB  . ILE D 1 200 ? 26.802  -12.015  -30.620 1.00 41.30  ? 201 ILE D CB  1 
ATOM   9313  C CG1 . ILE D 1 200 ? 27.117  -11.625  -29.172 1.00 39.68  ? 201 ILE D CG1 1 
ATOM   9314  C CG2 . ILE D 1 200 ? 26.705  -13.526  -30.794 1.00 41.78  ? 201 ILE D CG2 1 
ATOM   9315  C CD1 . ILE D 1 200 ? 25.961  -11.827  -28.230 1.00 40.53  ? 201 ILE D CD1 1 
ATOM   9316  N N   . ASP D 1 201 ? 28.436  -12.535  -33.643 1.00 42.13  ? 202 ASP D N   1 
ATOM   9317  C CA  . ASP D 1 201 ? 28.159  -13.140  -34.938 1.00 44.71  ? 202 ASP D CA  1 
ATOM   9318  C C   . ASP D 1 201 ? 27.474  -14.478  -34.712 1.00 47.65  ? 202 ASP D C   1 
ATOM   9319  O O   . ASP D 1 201 ? 28.093  -15.423  -34.238 1.00 49.32  ? 202 ASP D O   1 
ATOM   9320  C CB  . ASP D 1 201 ? 29.449  -13.315  -35.747 1.00 45.58  ? 202 ASP D CB  1 
ATOM   9321  C CG  . ASP D 1 201 ? 29.195  -13.768  -37.180 1.00 48.48  ? 202 ASP D CG  1 
ATOM   9322  O OD1 . ASP D 1 201 ? 28.196  -14.474  -37.434 1.00 49.49  ? 202 ASP D OD1 1 
ATOM   9323  O OD2 . ASP D 1 201 ? 29.999  -13.404  -38.064 1.00 49.39  ? 202 ASP D OD2 1 
ATOM   9324  N N   . CYS D 1 202 ? 26.196  -14.557  -35.059 1.00 49.87  ? 203 CYS D N   1 
ATOM   9325  C CA  . CYS D 1 202 ? 25.440  -15.785  -34.866 1.00 53.39  ? 203 CYS D CA  1 
ATOM   9326  C C   . CYS D 1 202 ? 25.743  -16.833  -35.938 1.00 57.02  ? 203 CYS D C   1 
ATOM   9327  O O   . CYS D 1 202 ? 25.058  -17.851  -36.018 1.00 59.24  ? 203 CYS D O   1 
ATOM   9328  C CB  . CYS D 1 202 ? 23.942  -15.486  -34.842 1.00 54.03  ? 203 CYS D CB  1 
ATOM   9329  S SG  . CYS D 1 202 ? 23.460  -14.319  -33.561 1.00 51.24  ? 203 CYS D SG  1 
ATOM   9330  N N   . ARG D 1 203 ? 26.759  -16.591  -36.763 1.00 56.97  ? 204 ARG D N   1 
ATOM   9331  C CA  . ARG D 1 203 ? 27.201  -17.608  -37.713 1.00 59.04  ? 204 ARG D CA  1 
ATOM   9332  C C   . ARG D 1 203 ? 28.502  -18.260  -37.245 1.00 59.98  ? 204 ARG D C   1 
ATOM   9333  O O   . ARG D 1 203 ? 28.528  -19.453  -36.952 1.00 61.04  ? 204 ARG D O   1 
ATOM   9334  C CB  . ARG D 1 203 ? 27.373  -17.017  -39.116 1.00 58.63  ? 204 ARG D CB  1 
ATOM   9335  C CG  . ARG D 1 203 ? 27.865  -18.032  -40.141 1.00 60.87  ? 204 ARG D CG  1 
ATOM   9336  C CD  . ARG D 1 203 ? 27.742  -17.506  -41.557 1.00 61.10  ? 204 ARG D CD  1 
ATOM   9337  N NE  . ARG D 1 203 ? 28.673  -16.414  -41.815 1.00 60.31  ? 204 ARG D NE  1 
ATOM   9338  C CZ  . ARG D 1 203 ? 28.751  -15.754  -42.967 1.00 60.70  ? 204 ARG D CZ  1 
ATOM   9339  N NH1 . ARG D 1 203 ? 27.954  -16.077  -43.977 1.00 62.82  ? 204 ARG D NH1 1 
ATOM   9340  N NH2 . ARG D 1 203 ? 29.628  -14.770  -43.109 1.00 59.11  ? 204 ARG D NH2 1 
ATOM   9341  N N   . SER D 1 204 ? 29.574  -17.474  -37.161 1.00 60.54  ? 205 SER D N   1 
ATOM   9342  C CA  . SER D 1 204 ? 30.874  -17.997  -36.742 1.00 62.76  ? 205 SER D CA  1 
ATOM   9343  C C   . SER D 1 204 ? 30.952  -18.143  -35.227 1.00 64.32  ? 205 SER D C   1 
ATOM   9344  O O   . SER D 1 204 ? 31.920  -18.695  -34.702 1.00 66.26  ? 205 SER D O   1 
ATOM   9345  C CB  . SER D 1 204 ? 32.015  -17.095  -37.233 1.00 61.99  ? 205 SER D CB  1 
ATOM   9346  O OG  . SER D 1 204 ? 31.916  -15.783  -36.706 1.00 60.83  ? 205 SER D OG  1 
ATOM   9347  N N   . LEU D 1 205 ? 29.937  -17.629  -34.535 1.00 63.60  ? 206 LEU D N   1 
ATOM   9348  C CA  . LEU D 1 205 ? 29.861  -17.673  -33.074 1.00 62.98  ? 206 LEU D CA  1 
ATOM   9349  C C   . LEU D 1 205 ? 31.046  -16.967  -32.416 1.00 62.32  ? 206 LEU D C   1 
ATOM   9350  O O   . LEU D 1 205 ? 31.377  -17.230  -31.258 1.00 63.14  ? 206 LEU D O   1 
ATOM   9351  C CB  . LEU D 1 205 ? 29.758  -19.119  -32.590 1.00 64.23  ? 206 LEU D CB  1 
ATOM   9352  C CG  . LEU D 1 205 ? 28.558  -19.853  -33.188 1.00 65.12  ? 206 LEU D CG  1 
ATOM   9353  C CD1 . LEU D 1 205 ? 28.548  -21.314  -32.764 1.00 67.17  ? 206 LEU D CD1 1 
ATOM   9354  C CD2 . LEU D 1 205 ? 27.264  -19.158  -32.791 1.00 64.06  ? 206 LEU D CD2 1 
ATOM   9355  N N   . GLU D 1 206 ? 31.681  -16.073  -33.169 1.00 61.17  ? 207 GLU D N   1 
ATOM   9356  C CA  . GLU D 1 206 ? 32.711  -15.196  -32.631 1.00 59.93  ? 207 GLU D CA  1 
ATOM   9357  C C   . GLU D 1 206 ? 32.069  -14.017  -31.923 1.00 55.25  ? 207 GLU D C   1 
ATOM   9358  O O   . GLU D 1 206 ? 31.068  -13.473  -32.383 1.00 53.74  ? 207 GLU D O   1 
ATOM   9359  C CB  . GLU D 1 206 ? 33.638  -14.687  -33.738 1.00 63.07  ? 207 GLU D CB  1 
ATOM   9360  C CG  . GLU D 1 206 ? 34.773  -13.810  -33.226 1.00 65.44  ? 207 GLU D CG  1 
ATOM   9361  C CD  . GLU D 1 206 ? 35.528  -13.095  -34.344 1.00 68.19  ? 207 GLU D CD  1 
ATOM   9362  O OE1 . GLU D 1 206 ? 34.971  -12.984  -35.456 1.00 69.54  ? 207 GLU D OE1 1 
ATOM   9363  O OE2 . GLU D 1 206 ? 36.673  -12.653  -34.105 1.00 68.58  ? 207 GLU D OE2 1 
ATOM   9364  N N   . THR D 1 207 ? 32.649  -13.628  -30.798 1.00 53.14  ? 208 THR D N   1 
ATOM   9365  C CA  . THR D 1 207 ? 32.186  -12.456  -30.086 1.00 50.76  ? 208 THR D CA  1 
ATOM   9366  C C   . THR D 1 207 ? 33.322  -11.455  -29.952 1.00 48.64  ? 208 THR D C   1 
ATOM   9367  O O   . THR D 1 207 ? 34.482  -11.832  -29.767 1.00 51.49  ? 208 THR D O   1 
ATOM   9368  C CB  . THR D 1 207 ? 31.643  -12.825  -28.704 1.00 51.82  ? 208 THR D CB  1 
ATOM   9369  O OG1 . THR D 1 207 ? 32.643  -13.554  -27.984 1.00 54.01  ? 208 THR D OG1 1 
ATOM   9370  C CG2 . THR D 1 207 ? 30.411  -13.698  -28.848 1.00 52.35  ? 208 THR D CG2 1 
ATOM   9371  N N   . SER D 1 208 ? 32.988  -10.178  -30.069 1.00 43.70  ? 209 SER D N   1 
ATOM   9372  C CA  . SER D 1 208 ? 33.956  -9.122   -29.834 1.00 40.68  ? 209 SER D CA  1 
ATOM   9373  C C   . SER D 1 208 ? 33.456  -8.202   -28.737 1.00 37.63  ? 209 SER D C   1 
ATOM   9374  O O   . SER D 1 208 ? 32.270  -7.896   -28.660 1.00 35.96  ? 209 SER D O   1 
ATOM   9375  C CB  . SER D 1 208 ? 34.223  -8.322   -31.109 1.00 40.33  ? 209 SER D CB  1 
ATOM   9376  O OG  . SER D 1 208 ? 34.725  -9.159   -32.131 1.00 42.38  ? 209 SER D OG  1 
ATOM   9377  N N   . LEU D 1 209 ? 34.369  -7.782   -27.874 1.00 37.04  ? 210 LEU D N   1 
ATOM   9378  C CA  . LEU D 1 209 ? 34.059  -6.753   -26.904 1.00 36.59  ? 210 LEU D CA  1 
ATOM   9379  C C   . LEU D 1 209 ? 34.513  -5.417   -27.460 1.00 36.98  ? 210 LEU D C   1 
ATOM   9380  O O   . LEU D 1 209 ? 35.713  -5.158   -27.603 1.00 37.72  ? 210 LEU D O   1 
ATOM   9381  C CB  . LEU D 1 209 ? 34.721  -7.054   -25.564 1.00 36.82  ? 210 LEU D CB  1 
ATOM   9382  C CG  . LEU D 1 209 ? 34.001  -8.173   -24.820 1.00 37.82  ? 210 LEU D CG  1 
ATOM   9383  C CD1 . LEU D 1 209 ? 34.903  -8.781   -23.775 1.00 39.36  ? 210 LEU D CD1 1 
ATOM   9384  C CD2 . LEU D 1 209 ? 32.728  -7.626   -24.188 1.00 38.27  ? 210 LEU D CD2 1 
ATOM   9385  N N   . VAL D 1 210 ? 33.540  -4.582   -27.795 1.00 36.96  ? 211 VAL D N   1 
ATOM   9386  C CA  . VAL D 1 210 ? 33.824  -3.300   -28.409 1.00 38.24  ? 211 VAL D CA  1 
ATOM   9387  C C   . VAL D 1 210 ? 33.708  -2.188   -27.386 1.00 40.01  ? 211 VAL D C   1 
ATOM   9388  O O   . VAL D 1 210 ? 32.632  -1.960   -26.840 1.00 39.23  ? 211 VAL D O   1 
ATOM   9389  C CB  . VAL D 1 210 ? 32.876  -3.018   -29.583 1.00 36.40  ? 211 VAL D CB  1 
ATOM   9390  C CG1 . VAL D 1 210 ? 33.195  -1.669   -30.189 1.00 35.02  ? 211 VAL D CG1 1 
ATOM   9391  C CG2 . VAL D 1 210 ? 32.987  -4.133   -30.619 1.00 35.49  ? 211 VAL D CG2 1 
ATOM   9392  N N   . PRO D 1 211 ? 34.823  -1.492   -27.126 1.00 44.44  ? 212 PRO D N   1 
ATOM   9393  C CA  . PRO D 1 211 ? 34.856  -0.431   -26.114 1.00 47.97  ? 212 PRO D CA  1 
ATOM   9394  C C   . PRO D 1 211 ? 33.876  0.700    -26.418 1.00 51.39  ? 212 PRO D C   1 
ATOM   9395  O O   . PRO D 1 211 ? 33.718  1.101    -27.572 1.00 48.52  ? 212 PRO D O   1 
ATOM   9396  C CB  . PRO D 1 211 ? 36.305  0.074    -26.178 1.00 47.03  ? 212 PRO D CB  1 
ATOM   9397  C CG  . PRO D 1 211 ? 37.081  -1.057   -26.786 1.00 47.21  ? 212 PRO D CG  1 
ATOM   9398  C CD  . PRO D 1 211 ? 36.136  -1.684   -27.768 1.00 45.67  ? 212 PRO D CD  1 
ATOM   9399  N N   . LEU D 1 212 ? 33.210  1.185    -25.375 1.00 57.79  ? 213 LEU D N   1 
ATOM   9400  C CA  . LEU D 1 212 ? 32.387  2.382    -25.459 1.00 61.17  ? 213 LEU D CA  1 
ATOM   9401  C C   . LEU D 1 212 ? 33.071  3.485    -24.664 1.00 67.18  ? 213 LEU D C   1 
ATOM   9402  O O   . LEU D 1 212 ? 33.894  4.233    -25.195 1.00 68.15  ? 213 LEU D O   1 
ATOM   9403  C CB  . LEU D 1 212 ? 30.982  2.121    -24.917 1.00 60.49  ? 213 LEU D CB  1 
ATOM   9404  C CG  . LEU D 1 212 ? 30.123  1.097    -25.658 1.00 59.18  ? 213 LEU D CG  1 
ATOM   9405  C CD1 . LEU D 1 212 ? 28.852  0.799    -24.881 1.00 58.27  ? 213 LEU D CD1 1 
ATOM   9406  C CD2 . LEU D 1 212 ? 29.784  1.611    -27.037 1.00 58.53  ? 213 LEU D CD2 1 
ATOM   9407  N N   . SER D 1 213 ? 32.700  3.576    -23.389 1.00 73.19  ? 214 SER D N   1 
ATOM   9408  C CA  . SER D 1 213 ? 33.411  4.367    -22.383 1.00 74.98  ? 214 SER D CA  1 
ATOM   9409  C C   . SER D 1 213 ? 33.425  5.881    -22.595 1.00 74.67  ? 214 SER D C   1 
ATOM   9410  O O   . SER D 1 213 ? 33.885  6.607    -21.714 1.00 77.04  ? 214 SER D O   1 
ATOM   9411  C CB  . SER D 1 213 ? 34.858  3.876    -22.266 1.00 77.32  ? 214 SER D CB  1 
ATOM   9412  N N   . ASP D 1 214 ? 32.943  6.359    -23.741 1.00 69.04  ? 215 ASP D N   1 
ATOM   9413  C CA  . ASP D 1 214 ? 32.871  7.800    -23.985 1.00 67.48  ? 215 ASP D CA  1 
ATOM   9414  C C   . ASP D 1 214 ? 31.980  8.428    -22.921 1.00 65.33  ? 215 ASP D C   1 
ATOM   9415  O O   . ASP D 1 214 ? 30.759  8.267    -22.953 1.00 65.76  ? 215 ASP D O   1 
ATOM   9416  C CB  . ASP D 1 214 ? 32.342  8.103    -25.389 1.00 67.13  ? 215 ASP D CB  1 
ATOM   9417  C CG  . ASP D 1 214 ? 32.524  9.562    -25.787 1.00 67.58  ? 215 ASP D CG  1 
ATOM   9418  O OD1 . ASP D 1 214 ? 32.272  10.459   -24.955 1.00 67.03  ? 215 ASP D OD1 1 
ATOM   9419  O OD2 . ASP D 1 214 ? 32.923  9.815    -26.943 1.00 68.73  ? 215 ASP D OD2 1 
ATOM   9420  N N   . PRO D 1 215 ? 32.599  9.154    -21.976 1.00 62.22  ? 216 PRO D N   1 
ATOM   9421  C CA  . PRO D 1 215 ? 31.960  9.611    -20.739 1.00 59.72  ? 216 PRO D CA  1 
ATOM   9422  C C   . PRO D 1 215 ? 30.759  10.508   -20.989 1.00 56.05  ? 216 PRO D C   1 
ATOM   9423  O O   . PRO D 1 215 ? 29.815  10.504   -20.201 1.00 55.34  ? 216 PRO D O   1 
ATOM   9424  C CB  . PRO D 1 215 ? 33.076  10.395   -20.033 1.00 61.36  ? 216 PRO D CB  1 
ATOM   9425  C CG  . PRO D 1 215 ? 34.342  9.962    -20.693 1.00 62.66  ? 216 PRO D CG  1 
ATOM   9426  C CD  . PRO D 1 215 ? 33.966  9.684    -22.108 1.00 62.32  ? 216 PRO D CD  1 
ATOM   9427  N N   . LYS D 1 216 ? 30.802  11.269   -22.075 1.00 54.16  ? 217 LYS D N   1 
ATOM   9428  C CA  . LYS D 1 216 ? 29.745  12.223   -22.374 1.00 53.00  ? 217 LYS D CA  1 
ATOM   9429  C C   . LYS D 1 216 ? 28.452  11.527   -22.798 1.00 50.30  ? 217 LYS D C   1 
ATOM   9430  O O   . LYS D 1 216 ? 27.360  12.033   -22.544 1.00 50.41  ? 217 LYS D O   1 
ATOM   9431  C CB  . LYS D 1 216 ? 30.201  13.194   -23.465 1.00 53.97  ? 217 LYS D CB  1 
ATOM   9432  N N   . LEU D 1 217 ? 28.581  10.363   -23.429 1.00 48.06  ? 218 LEU D N   1 
ATOM   9433  C CA  . LEU D 1 217 ? 27.428  9.658    -23.989 1.00 46.70  ? 218 LEU D CA  1 
ATOM   9434  C C   . LEU D 1 217 ? 26.786  8.690    -22.997 1.00 46.95  ? 218 LEU D C   1 
ATOM   9435  O O   . LEU D 1 217 ? 27.453  8.148    -22.117 1.00 47.86  ? 218 LEU D O   1 
ATOM   9436  C CB  . LEU D 1 217 ? 27.833  8.899    -25.257 1.00 44.76  ? 218 LEU D CB  1 
ATOM   9437  N N   . ALA D 1 218 ? 25.484  8.476    -23.156 1.00 45.31  ? 219 ALA D N   1 
ATOM   9438  C CA  . ALA D 1 218 ? 24.750  7.538    -22.318 1.00 43.25  ? 219 ALA D CA  1 
ATOM   9439  C C   . ALA D 1 218 ? 23.688  6.805    -23.133 1.00 41.38  ? 219 ALA D C   1 
ATOM   9440  O O   . ALA D 1 218 ? 23.422  7.154    -24.282 1.00 40.36  ? 219 ALA D O   1 
ATOM   9441  C CB  . ALA D 1 218 ? 24.110  8.259    -21.147 1.00 42.16  ? 219 ALA D CB  1 
ATOM   9442  N N   . VAL D 1 219 ? 23.082  5.794    -22.522 1.00 40.71  ? 220 VAL D N   1 
ATOM   9443  C CA  . VAL D 1 219 ? 22.000  5.053    -23.148 1.00 40.71  ? 220 VAL D CA  1 
ATOM   9444  C C   . VAL D 1 219 ? 20.709  5.204    -22.353 1.00 41.06  ? 220 VAL D C   1 
ATOM   9445  O O   . VAL D 1 219 ? 20.627  4.772    -21.207 1.00 41.61  ? 220 VAL D O   1 
ATOM   9446  C CB  . VAL D 1 219 ? 22.353  3.561    -23.277 1.00 41.01  ? 220 VAL D CB  1 
ATOM   9447  C CG1 . VAL D 1 219 ? 21.150  2.768    -23.747 1.00 40.94  ? 220 VAL D CG1 1 
ATOM   9448  C CG2 . VAL D 1 219 ? 23.528  3.383    -24.228 1.00 40.36  ? 220 VAL D CG2 1 
ATOM   9449  N N   . LEU D 1 220 ? 19.701  5.821    -22.965 1.00 40.58  ? 221 LEU D N   1 
ATOM   9450  C CA  . LEU D 1 220 ? 18.415  6.009    -22.304 1.00 40.99  ? 221 LEU D CA  1 
ATOM   9451  C C   . LEU D 1 220 ? 17.419  4.930    -22.705 1.00 42.36  ? 221 LEU D C   1 
ATOM   9452  O O   . LEU D 1 220 ? 17.108  4.753    -23.886 1.00 42.69  ? 221 LEU D O   1 
ATOM   9453  C CB  . LEU D 1 220 ? 17.833  7.386    -22.622 1.00 41.79  ? 221 LEU D CB  1 
ATOM   9454  C CG  . LEU D 1 220 ? 16.442  7.651    -22.037 1.00 43.58  ? 221 LEU D CG  1 
ATOM   9455  C CD1 . LEU D 1 220 ? 16.485  7.661    -20.510 1.00 44.31  ? 221 LEU D CD1 1 
ATOM   9456  C CD2 . LEU D 1 220 ? 15.852  8.952    -22.569 1.00 44.08  ? 221 LEU D CD2 1 
ATOM   9457  N N   . ILE D 1 221 ? 16.916  4.213    -21.710 1.00 41.23  ? 222 ILE D N   1 
ATOM   9458  C CA  . ILE D 1 221 ? 15.910  3.193    -21.942 1.00 39.87  ? 222 ILE D CA  1 
ATOM   9459  C C   . ILE D 1 221 ? 14.544  3.697    -21.526 1.00 40.61  ? 222 ILE D C   1 
ATOM   9460  O O   . ILE D 1 221 ? 14.343  4.095    -20.380 1.00 42.23  ? 222 ILE D O   1 
ATOM   9461  C CB  . ILE D 1 221 ? 16.237  1.915    -21.182 1.00 38.96  ? 222 ILE D CB  1 
ATOM   9462  C CG1 . ILE D 1 221 ? 17.546  1.338    -21.706 1.00 39.02  ? 222 ILE D CG1 1 
ATOM   9463  C CG2 . ILE D 1 221 ? 15.112  0.900    -21.322 1.00 39.14  ? 222 ILE D CG2 1 
ATOM   9464  C CD1 . ILE D 1 221 ? 17.940  0.097    -21.019 1.00 40.64  ? 222 ILE D CD1 1 
ATOM   9465  N N   . THR D 1 222 ? 13.607  3.691    -22.467 1.00 38.61  ? 223 THR D N   1 
ATOM   9466  C CA  . THR D 1 222 ? 12.265  4.175    -22.197 1.00 39.85  ? 223 THR D CA  1 
ATOM   9467  C C   . THR D 1 222 ? 11.259  3.040    -22.290 1.00 41.27  ? 223 THR D C   1 
ATOM   9468  O O   . THR D 1 222 ? 11.130  2.394    -23.328 1.00 40.17  ? 223 THR D O   1 
ATOM   9469  C CB  . THR D 1 222 ? 11.863  5.296    -23.169 1.00 40.10  ? 223 THR D CB  1 
ATOM   9470  O OG1 . THR D 1 222 ? 12.814  6.363    -23.076 1.00 41.19  ? 223 THR D OG1 1 
ATOM   9471  C CG2 . THR D 1 222 ? 10.480  5.824    -22.829 1.00 39.97  ? 223 THR D CG2 1 
ATOM   9472  N N   . ASN D 1 223 ? 10.559  2.794    -21.191 1.00 42.41  ? 224 ASN D N   1 
ATOM   9473  C CA  . ASN D 1 223 ? 9.546   1.753    -21.154 1.00 44.18  ? 224 ASN D CA  1 
ATOM   9474  C C   . ASN D 1 223 ? 8.193   2.337    -21.527 1.00 45.13  ? 224 ASN D C   1 
ATOM   9475  O O   . ASN D 1 223 ? 7.688   3.231    -20.844 1.00 46.05  ? 224 ASN D O   1 
ATOM   9476  C CB  . ASN D 1 223 ? 9.486   1.105    -19.766 1.00 45.41  ? 224 ASN D CB  1 
ATOM   9477  C CG  . ASN D 1 223 ? 8.762   -0.236   -19.770 1.00 47.95  ? 224 ASN D CG  1 
ATOM   9478  O OD1 . ASN D 1 223 ? 7.963   -0.531   -20.662 1.00 48.57  ? 224 ASN D OD1 1 
ATOM   9479  N ND2 . ASN D 1 223 ? 9.049   -1.060   -18.769 1.00 48.54  ? 224 ASN D ND2 1 
ATOM   9480  N N   . SER D 1 224 ? 7.619   1.843    -22.620 1.00 43.56  ? 225 SER D N   1 
ATOM   9481  C CA  . SER D 1 224 ? 6.275   2.235    -23.017 1.00 43.88  ? 225 SER D CA  1 
ATOM   9482  C C   . SER D 1 224 ? 5.264   1.726    -22.001 1.00 45.66  ? 225 SER D C   1 
ATOM   9483  O O   . SER D 1 224 ? 4.181   2.294    -21.872 1.00 46.65  ? 225 SER D O   1 
ATOM   9484  C CB  . SER D 1 224 ? 5.937   1.692    -24.406 1.00 42.74  ? 225 SER D CB  1 
ATOM   9485  O OG  . SER D 1 224 ? 5.805   0.289    -24.336 1.00 42.68  ? 225 SER D OG  1 
ATOM   9486  N N   . ASN D 1 225 ? 5.626   0.652    -21.301 1.00 46.00  ? 226 ASN D N   1 
ATOM   9487  C CA  . ASN D 1 225 ? 4.719   -0.021   -20.382 1.00 48.89  ? 226 ASN D CA  1 
ATOM   9488  C C   . ASN D 1 225 ? 3.394   -0.374   -21.022 1.00 49.66  ? 226 ASN D C   1 
ATOM   9489  O O   . ASN D 1 225 ? 2.351   -0.292   -20.387 1.00 52.11  ? 226 ASN D O   1 
ATOM   9490  C CB  . ASN D 1 225 ? 4.499   0.832    -19.129 1.00 51.36  ? 226 ASN D CB  1 
ATOM   9491  C CG  . ASN D 1 225 ? 5.667   0.762    -18.178 1.00 52.22  ? 226 ASN D CG  1 
ATOM   9492  O OD1 . ASN D 1 225 ? 6.066   1.759    -17.569 1.00 53.15  ? 226 ASN D OD1 1 
ATOM   9493  N ND2 . ASN D 1 225 ? 6.157   -0.446   -17.965 1.00 55.25  ? 226 ASN D ND2 1 
ATOM   9494  N N   . VAL D 1 226 ? 3.451   -0.779   -22.283 1.00 47.22  ? 227 VAL D N   1 
ATOM   9495  C CA  . VAL D 1 226 ? 2.338   -1.474   -22.907 1.00 47.54  ? 227 VAL D CA  1 
ATOM   9496  C C   . VAL D 1 226 ? 2.876   -2.784   -23.459 1.00 46.69  ? 227 VAL D C   1 
ATOM   9497  O O   . VAL D 1 226 ? 4.078   -2.917   -23.696 1.00 43.21  ? 227 VAL D O   1 
ATOM   9498  C CB  . VAL D 1 226 ? 1.663   -0.651   -24.026 1.00 48.12  ? 227 VAL D CB  1 
ATOM   9499  C CG1 . VAL D 1 226 ? 1.125   0.660    -23.472 1.00 47.61  ? 227 VAL D CG1 1 
ATOM   9500  C CG2 . VAL D 1 226 ? 2.642   -0.388   -25.151 1.00 45.83  ? 227 VAL D CG2 1 
ATOM   9501  N N   . ARG D 1 227 ? 1.987   -3.757   -23.612 1.00 50.67  ? 228 ARG D N   1 
ATOM   9502  C CA  . ARG D 1 227 ? 2.310   -5.034   -24.236 1.00 54.98  ? 228 ARG D CA  1 
ATOM   9503  C C   . ARG D 1 227 ? 1.095   -5.507   -25.024 1.00 57.23  ? 228 ARG D C   1 
ATOM   9504  O O   . ARG D 1 227 ? 0.092   -5.900   -24.433 1.00 59.25  ? 228 ARG D O   1 
ATOM   9505  C CB  . ARG D 1 227 ? 2.708   -6.070   -23.185 1.00 59.78  ? 228 ARG D CB  1 
ATOM   9506  C CG  . ARG D 1 227 ? 4.179   -6.053   -22.800 1.00 61.52  ? 228 ARG D CG  1 
ATOM   9507  C CD  . ARG D 1 227 ? 4.962   -7.101   -23.580 1.00 64.71  ? 228 ARG D CD  1 
ATOM   9508  N NE  . ARG D 1 227 ? 6.403   -6.881   -23.498 1.00 64.81  ? 228 ARG D NE  1 
ATOM   9509  C CZ  . ARG D 1 227 ? 7.146   -6.430   -24.504 1.00 64.42  ? 228 ARG D CZ  1 
ATOM   9510  N NH1 . ARG D 1 227 ? 6.585   -6.160   -25.674 1.00 64.81  ? 228 ARG D NH1 1 
ATOM   9511  N NH2 . ARG D 1 227 ? 8.451   -6.255   -24.340 1.00 63.54  ? 228 ARG D NH2 1 
ATOM   9512  N N   . HIS D 1 228 ? 1.180   -5.470   -26.351 1.00 57.05  ? 229 HIS D N   1 
ATOM   9513  C CA  . HIS D 1 228 ? -0.005  -5.684   -27.185 1.00 61.56  ? 229 HIS D CA  1 
ATOM   9514  C C   . HIS D 1 228 ? -0.098  -7.055   -27.855 1.00 67.60  ? 229 HIS D C   1 
ATOM   9515  O O   . HIS D 1 228 ? -1.193  -7.489   -28.210 1.00 72.21  ? 229 HIS D O   1 
ATOM   9516  C CB  . HIS D 1 228 ? -0.085  -4.600   -28.266 1.00 58.37  ? 229 HIS D CB  1 
ATOM   9517  C CG  . HIS D 1 228 ? -0.375  -3.232   -27.733 1.00 56.06  ? 229 HIS D CG  1 
ATOM   9518  N ND1 . HIS D 1 228 ? -1.426  -2.972   -26.877 1.00 57.37  ? 229 HIS D ND1 1 
ATOM   9519  C CD2 . HIS D 1 228 ? 0.244   -2.045   -27.935 1.00 53.08  ? 229 HIS D CD2 1 
ATOM   9520  C CE1 . HIS D 1 228 ? -1.437  -1.688   -26.573 1.00 55.91  ? 229 HIS D CE1 1 
ATOM   9521  N NE2 . HIS D 1 228 ? -0.433  -1.102   -27.202 1.00 53.55  ? 229 HIS D NE2 1 
ATOM   9522  N N   . SER D 1 229 ? 1.028   -7.736   -28.041 1.00 70.02  ? 230 SER D N   1 
ATOM   9523  C CA  . SER D 1 229 ? 1.008   -8.998   -28.780 1.00 78.48  ? 230 SER D CA  1 
ATOM   9524  C C   . SER D 1 229 ? 1.211   -10.215  -27.886 1.00 82.83  ? 230 SER D C   1 
ATOM   9525  O O   . SER D 1 229 ? 1.717   -10.108  -26.773 1.00 82.57  ? 230 SER D O   1 
ATOM   9526  C CB  . SER D 1 229 ? 2.068   -8.992   -29.881 1.00 77.84  ? 230 SER D CB  1 
ATOM   9527  N N   . LEU D 1 230 ? 0.821   -11.376  -28.404 1.00 89.25  ? 231 LEU D N   1 
ATOM   9528  C CA  . LEU D 1 230 ? 0.862   -12.626  -27.652 1.00 94.72  ? 231 LEU D CA  1 
ATOM   9529  C C   . LEU D 1 230 ? 2.284   -13.109  -27.357 1.00 95.44  ? 231 LEU D C   1 
ATOM   9530  O O   . LEU D 1 230 ? 2.481   -13.931  -26.451 1.00 97.43  ? 231 LEU D O   1 
ATOM   9531  C CB  . LEU D 1 230 ? 0.104   -13.716  -28.408 1.00 98.21  ? 231 LEU D CB  1 
ATOM   9532  N N   . ALA D 1 231 ? 3.247   -12.580  -28.121 1.00 93.83  ? 232 ALA D N   1 
ATOM   9533  C CA  . ALA D 1 231 ? 4.683   -12.902  -28.055 1.00 92.46  ? 232 ALA D CA  1 
ATOM   9534  C C   . ALA D 1 231 ? 5.017   -14.223  -28.733 1.00 94.59  ? 232 ALA D C   1 
ATOM   9535  O O   . ALA D 1 231 ? 6.173   -14.491  -29.018 1.00 94.40  ? 232 ALA D O   1 
ATOM   9536  C CB  . ALA D 1 231 ? 5.191   -12.911  -26.605 1.00 91.86  ? 232 ALA D CB  1 
ATOM   9537  N N   . SER D 1 232 ? 4.013   -15.055  -28.972 1.00 96.22  ? 233 SER D N   1 
ATOM   9538  C CA  . SER D 1 232 ? 4.228   -16.310  -29.672 1.00 95.66  ? 233 SER D CA  1 
ATOM   9539  C C   . SER D 1 232 ? 3.379   -16.378  -30.933 1.00 95.50  ? 233 SER D C   1 
ATOM   9540  O O   . SER D 1 232 ? 3.400   -17.362  -31.667 1.00 97.52  ? 233 SER D O   1 
ATOM   9541  C CB  . SER D 1 232 ? 3.926   -17.506  -28.761 1.00 98.02  ? 233 SER D CB  1 
ATOM   9542  N N   . SER D 1 233 ? 2.616   -15.326  -31.176 1.00 92.78  ? 234 SER D N   1 
ATOM   9543  C CA  . SER D 1 233 ? 1.736   -15.289  -32.333 1.00 92.04  ? 234 SER D CA  1 
ATOM   9544  C C   . SER D 1 233 ? 2.223   -14.283  -33.370 1.00 87.28  ? 234 SER D C   1 
ATOM   9545  O O   . SER D 1 233 ? 1.453   -13.837  -34.219 1.00 88.04  ? 234 SER D O   1 
ATOM   9546  C CB  . SER D 1 233 ? 0.305   -14.946  -31.905 1.00 94.03  ? 234 SER D CB  1 
ATOM   9547  N N   . GLU D 1 234 ? 3.504   -13.936  -33.306 1.00 82.30  ? 235 GLU D N   1 
ATOM   9548  C CA  . GLU D 1 234 ? 4.066   -12.939  -34.210 1.00 78.23  ? 235 GLU D CA  1 
ATOM   9549  C C   . GLU D 1 234 ? 5.383   -13.389  -34.850 1.00 74.62  ? 235 GLU D C   1 
ATOM   9550  O O   . GLU D 1 234 ? 5.626   -13.126  -36.029 1.00 74.03  ? 235 GLU D O   1 
ATOM   9551  C CB  . GLU D 1 234 ? 4.276   -11.615  -33.467 1.00 75.98  ? 235 GLU D CB  1 
ATOM   9552  N N   . TYR D 1 235 ? 6.223   -14.074  -34.079 1.00 71.57  ? 236 TYR D N   1 
ATOM   9553  C CA  . TYR D 1 235 ? 7.569   -14.431  -34.535 1.00 68.18  ? 236 TYR D CA  1 
ATOM   9554  C C   . TYR D 1 235 ? 7.726   -15.810  -35.193 1.00 67.64  ? 236 TYR D C   1 
ATOM   9555  O O   . TYR D 1 235 ? 8.585   -15.963  -36.059 1.00 65.90  ? 236 TYR D O   1 
ATOM   9556  C CB  . TYR D 1 235 ? 8.551   -14.308  -33.367 1.00 66.56  ? 236 TYR D CB  1 
ATOM   9557  C CG  . TYR D 1 235 ? 8.881   -12.868  -33.072 1.00 64.37  ? 236 TYR D CG  1 
ATOM   9558  C CD1 . TYR D 1 235 ? 8.305   -12.198  -31.996 1.00 63.42  ? 236 TYR D CD1 1 
ATOM   9559  C CD2 . TYR D 1 235 ? 9.742   -12.164  -33.897 1.00 62.69  ? 236 TYR D CD2 1 
ATOM   9560  C CE1 . TYR D 1 235 ? 8.596   -10.873  -31.747 1.00 61.85  ? 236 TYR D CE1 1 
ATOM   9561  C CE2 . TYR D 1 235 ? 10.040  -10.845  -33.656 1.00 60.99  ? 236 TYR D CE2 1 
ATOM   9562  C CZ  . TYR D 1 235 ? 9.467   -10.204  -32.585 1.00 61.20  ? 236 TYR D CZ  1 
ATOM   9563  O OH  . TYR D 1 235 ? 9.780   -8.885   -32.365 1.00 60.83  ? 236 TYR D OH  1 
ATOM   9564  N N   . PRO D 1 236 ? 6.931   -16.820  -34.784 1.00 68.45  ? 237 PRO D N   1 
ATOM   9565  C CA  . PRO D 1 236 ? 7.038   -18.065  -35.557 1.00 69.58  ? 237 PRO D CA  1 
ATOM   9566  C C   . PRO D 1 236 ? 6.690   -17.904  -37.036 1.00 68.87  ? 237 PRO D C   1 
ATOM   9567  O O   . PRO D 1 236 ? 7.399   -18.442  -37.887 1.00 70.02  ? 237 PRO D O   1 
ATOM   9568  C CB  . PRO D 1 236 ? 6.031   -18.988  -34.870 1.00 72.71  ? 237 PRO D CB  1 
ATOM   9569  C CG  . PRO D 1 236 ? 6.018   -18.522  -33.459 1.00 71.60  ? 237 PRO D CG  1 
ATOM   9570  C CD  . PRO D 1 236 ? 6.189   -17.026  -33.524 1.00 69.09  ? 237 PRO D CD  1 
ATOM   9571  N N   . VAL D 1 237 ? 5.619   -17.175  -37.334 1.00 67.45  ? 238 VAL D N   1 
ATOM   9572  C CA  . VAL D 1 237 ? 5.185   -16.988  -38.716 1.00 66.42  ? 238 VAL D CA  1 
ATOM   9573  C C   . VAL D 1 237 ? 6.206   -16.182  -39.519 1.00 62.24  ? 238 VAL D C   1 
ATOM   9574  O O   . VAL D 1 237 ? 6.456   -16.477  -40.689 1.00 64.11  ? 238 VAL D O   1 
ATOM   9575  C CB  . VAL D 1 237 ? 3.794   -16.296  -38.786 1.00 69.04  ? 238 VAL D CB  1 
ATOM   9576  C CG1 . VAL D 1 237 ? 3.819   -14.942  -38.091 1.00 67.61  ? 238 VAL D CG1 1 
ATOM   9577  C CG2 . VAL D 1 237 ? 3.339   -16.148  -40.231 1.00 69.51  ? 238 VAL D CG2 1 
ATOM   9578  N N   . ARG D 1 238 ? 6.806   -15.179  -38.885 1.00 56.89  ? 239 ARG D N   1 
ATOM   9579  C CA  . ARG D 1 238 ? 7.802   -14.343  -39.547 1.00 53.92  ? 239 ARG D CA  1 
ATOM   9580  C C   . ARG D 1 238 ? 9.097   -15.110  -39.782 1.00 54.76  ? 239 ARG D C   1 
ATOM   9581  O O   . ARG D 1 238 ? 9.803   -14.875  -40.765 1.00 53.32  ? 239 ARG D O   1 
ATOM   9582  C CB  . ARG D 1 238 ? 8.089   -13.086  -38.726 1.00 49.40  ? 239 ARG D CB  1 
ATOM   9583  C CG  . ARG D 1 238 ? 6.989   -12.032  -38.773 1.00 48.90  ? 239 ARG D CG  1 
ATOM   9584  C CD  . ARG D 1 238 ? 7.328   -10.870  -37.842 1.00 47.83  ? 239 ARG D CD  1 
ATOM   9585  N NE  . ARG D 1 238 ? 6.488   -9.693   -38.056 1.00 49.06  ? 239 ARG D NE  1 
ATOM   9586  C CZ  . ARG D 1 238 ? 5.262   -9.536   -37.565 1.00 51.72  ? 239 ARG D CZ  1 
ATOM   9587  N NH1 . ARG D 1 238 ? 4.702   -10.490  -36.834 1.00 53.30  ? 239 ARG D NH1 1 
ATOM   9588  N NH2 . ARG D 1 238 ? 4.587   -8.424   -37.818 1.00 52.87  ? 239 ARG D NH2 1 
ATOM   9589  N N   . ARG D 1 239 ? 9.419   -16.011  -38.860 1.00 56.74  ? 240 ARG D N   1 
ATOM   9590  C CA  . ARG D 1 239 ? 10.571  -16.885  -39.026 1.00 57.63  ? 240 ARG D CA  1 
ATOM   9591  C C   . ARG D 1 239 ? 10.363  -17.796  -40.232 1.00 60.47  ? 240 ARG D C   1 
ATOM   9592  O O   . ARG D 1 239 ? 11.309  -18.112  -40.957 1.00 60.85  ? 240 ARG D O   1 
ATOM   9593  C CB  . ARG D 1 239 ? 10.808  -17.718  -37.767 1.00 58.38  ? 240 ARG D CB  1 
ATOM   9594  N N   . ARG D 1 240 ? 9.118   -18.215  -40.438 1.00 61.95  ? 241 ARG D N   1 
ATOM   9595  C CA  . ARG D 1 240 ? 8.777   -19.067  -41.570 1.00 64.04  ? 241 ARG D CA  1 
ATOM   9596  C C   . ARG D 1 240 ? 8.839   -18.279  -42.876 1.00 63.44  ? 241 ARG D C   1 
ATOM   9597  O O   . ARG D 1 240 ? 9.364   -18.766  -43.878 1.00 64.38  ? 241 ARG D O   1 
ATOM   9598  C CB  . ARG D 1 240 ? 7.389   -19.683  -41.381 1.00 65.93  ? 241 ARG D CB  1 
ATOM   9599  N N   . GLN D 1 241 ? 8.304   -17.061  -42.860 1.00 61.55  ? 242 GLN D N   1 
ATOM   9600  C CA  . GLN D 1 241 ? 8.349   -16.191  -44.029 1.00 60.64  ? 242 GLN D CA  1 
ATOM   9601  C C   . GLN D 1 241 ? 9.789   -15.899  -44.439 1.00 57.80  ? 242 GLN D C   1 
ATOM   9602  O O   . GLN D 1 241 ? 10.094  -15.796  -45.623 1.00 56.96  ? 242 GLN D O   1 
ATOM   9603  C CB  . GLN D 1 241 ? 7.603   -14.883  -43.761 1.00 60.90  ? 242 GLN D CB  1 
ATOM   9604  C CG  . GLN D 1 241 ? 6.087   -14.995  -43.829 1.00 64.35  ? 242 GLN D CG  1 
ATOM   9605  C CD  . GLN D 1 241 ? 5.395   -13.773  -43.252 1.00 64.87  ? 242 GLN D CD  1 
ATOM   9606  O OE1 . GLN D 1 241 ? 5.845   -13.205  -42.256 1.00 63.82  ? 242 GLN D OE1 1 
ATOM   9607  N NE2 . GLN D 1 241 ? 4.299   -13.360  -43.878 1.00 66.24  ? 242 GLN D NE2 1 
ATOM   9608  N N   . CYS D 1 242 ? 10.676  -15.770  -43.457 1.00 56.52  ? 243 CYS D N   1 
ATOM   9609  C CA  . CYS D 1 242 ? 12.086  -15.539  -43.747 1.00 55.56  ? 243 CYS D CA  1 
ATOM   9610  C C   . CYS D 1 242 ? 12.749  -16.794  -44.310 1.00 57.07  ? 243 CYS D C   1 
ATOM   9611  O O   . CYS D 1 242 ? 13.593  -16.716  -45.202 1.00 56.73  ? 243 CYS D O   1 
ATOM   9612  C CB  . CYS D 1 242 ? 12.822  -15.071  -42.495 1.00 54.77  ? 243 CYS D CB  1 
ATOM   9613  S SG  . CYS D 1 242 ? 12.462  -13.359  -42.038 1.00 50.50  ? 243 CYS D SG  1 
ATOM   9614  N N   . GLU D 1 243 ? 12.364  -17.950  -43.782 1.00 58.04  ? 244 GLU D N   1 
ATOM   9615  C CA  . GLU D 1 243 ? 12.913  -19.218  -44.244 1.00 59.08  ? 244 GLU D CA  1 
ATOM   9616  C C   . GLU D 1 243 ? 12.515  -19.469  -45.692 1.00 59.76  ? 244 GLU D C   1 
ATOM   9617  O O   . GLU D 1 243 ? 13.325  -19.918  -46.502 1.00 59.29  ? 244 GLU D O   1 
ATOM   9618  C CB  . GLU D 1 243 ? 12.439  -20.367  -43.352 1.00 61.22  ? 244 GLU D CB  1 
ATOM   9619  N N   . GLU D 1 244 ? 11.262  -19.159  -46.010 1.00 60.43  ? 245 GLU D N   1 
ATOM   9620  C CA  . GLU D 1 244 ? 10.745  -19.342  -47.360 1.00 62.29  ? 245 GLU D CA  1 
ATOM   9621  C C   . GLU D 1 244 ? 11.458  -18.432  -48.352 1.00 60.66  ? 245 GLU D C   1 
ATOM   9622  O O   . GLU D 1 244 ? 11.780  -18.851  -49.463 1.00 61.58  ? 245 GLU D O   1 
ATOM   9623  C CB  . GLU D 1 244 ? 9.238   -19.082  -47.395 1.00 63.62  ? 245 GLU D CB  1 
ATOM   9624  N N   . VAL D 1 245 ? 11.706  -17.189  -47.951 1.00 57.81  ? 246 VAL D N   1 
ATOM   9625  C CA  . VAL D 1 245 ? 12.396  -16.244  -48.822 1.00 57.14  ? 246 VAL D CA  1 
ATOM   9626  C C   . VAL D 1 245 ? 13.813  -16.727  -49.114 1.00 57.50  ? 246 VAL D C   1 
ATOM   9627  O O   . VAL D 1 245 ? 14.279  -16.645  -50.247 1.00 58.73  ? 246 VAL D O   1 
ATOM   9628  C CB  . VAL D 1 245 ? 12.446  -14.831  -48.214 1.00 54.70  ? 246 VAL D CB  1 
ATOM   9629  C CG1 . VAL D 1 245 ? 13.415  -13.953  -48.993 1.00 52.50  ? 246 VAL D CG1 1 
ATOM   9630  C CG2 . VAL D 1 245 ? 11.056  -14.212  -48.207 1.00 56.00  ? 246 VAL D CG2 1 
ATOM   9631  N N   . ALA D 1 246 ? 14.489  -17.246  -48.095 1.00 57.06  ? 247 ALA D N   1 
ATOM   9632  C CA  . ALA D 1 246 ? 15.820  -17.805  -48.292 1.00 57.51  ? 247 ALA D CA  1 
ATOM   9633  C C   . ALA D 1 246 ? 15.779  -18.947  -49.309 1.00 60.04  ? 247 ALA D C   1 
ATOM   9634  O O   . ALA D 1 246 ? 16.618  -19.017  -50.206 1.00 59.48  ? 247 ALA D O   1 
ATOM   9635  C CB  . ALA D 1 246 ? 16.397  -18.287  -46.976 1.00 51.96  ? 247 ALA D CB  1 
ATOM   9636  N N   . ARG D 1 247 ? 14.791  -19.828  -49.169 1.00 61.90  ? 248 ARG D N   1 
ATOM   9637  C CA  . ARG D 1 247 ? 14.651  -20.981  -50.057 1.00 64.82  ? 248 ARG D CA  1 
ATOM   9638  C C   . ARG D 1 247 ? 14.314  -20.564  -51.487 1.00 65.06  ? 248 ARG D C   1 
ATOM   9639  O O   . ARG D 1 247 ? 14.952  -21.014  -52.440 1.00 65.67  ? 248 ARG D O   1 
ATOM   9640  C CB  . ARG D 1 247 ? 13.578  -21.933  -49.526 1.00 67.35  ? 248 ARG D CB  1 
ATOM   9641  N N   . ALA D 1 248 ? 13.311  -19.700  -51.626 1.00 64.87  ? 249 ALA D N   1 
ATOM   9642  C CA  . ALA D 1 248 ? 12.898  -19.188  -52.929 1.00 66.83  ? 249 ALA D CA  1 
ATOM   9643  C C   . ALA D 1 248 ? 14.052  -18.499  -53.646 1.00 67.71  ? 249 ALA D C   1 
ATOM   9644  O O   . ALA D 1 248 ? 14.088  -18.438  -54.879 1.00 69.85  ? 249 ALA D O   1 
ATOM   9645  C CB  . ALA D 1 248 ? 11.727  -18.230  -52.776 1.00 65.94  ? 249 ALA D CB  1 
ATOM   9646  N N   . LEU D 1 249 ? 14.995  -17.984  -52.864 1.00 67.23  ? 250 LEU D N   1 
ATOM   9647  C CA  . LEU D 1 249 ? 16.184  -17.344  -53.410 1.00 69.05  ? 250 LEU D CA  1 
ATOM   9648  C C   . LEU D 1 249 ? 17.375  -18.297  -53.365 1.00 71.26  ? 250 LEU D C   1 
ATOM   9649  O O   . LEU D 1 249 ? 18.513  -17.896  -53.610 1.00 71.50  ? 250 LEU D O   1 
ATOM   9650  C CB  . LEU D 1 249 ? 16.498  -16.052  -52.649 1.00 67.16  ? 250 LEU D CB  1 
ATOM   9651  C CG  . LEU D 1 249 ? 15.847  -14.772  -53.191 1.00 67.96  ? 250 LEU D CG  1 
ATOM   9652  C CD1 . LEU D 1 249 ? 14.325  -14.861  -53.163 1.00 69.68  ? 250 LEU D CD1 1 
ATOM   9653  C CD2 . LEU D 1 249 ? 16.329  -13.542  -52.424 1.00 65.33  ? 250 LEU D CD2 1 
ATOM   9654  N N   . GLY D 1 250 ? 17.101  -19.560  -53.048 1.00 73.09  ? 251 GLY D N   1 
ATOM   9655  C CA  . GLY D 1 250 ? 18.112  -20.603  -53.054 1.00 73.94  ? 251 GLY D CA  1 
ATOM   9656  C C   . GLY D 1 250 ? 19.281  -20.386  -52.109 1.00 71.36  ? 251 GLY D C   1 
ATOM   9657  O O   . GLY D 1 250 ? 20.434  -20.591  -52.484 1.00 72.02  ? 251 GLY D O   1 
ATOM   9658  N N   . ALA D 1 251 ? 18.990  -19.971  -50.881 1.00 69.31  ? 252 ALA D N   1 
ATOM   9659  C CA  . ALA D 1 251 ? 20.034  -19.765  -49.884 1.00 66.27  ? 252 ALA D CA  1 
ATOM   9660  C C   . ALA D 1 251 ? 19.681  -20.466  -48.577 1.00 65.96  ? 252 ALA D C   1 
ATOM   9661  O O   . ALA D 1 251 ? 18.506  -20.685  -48.280 1.00 66.49  ? 252 ALA D O   1 
ATOM   9662  C CB  . ALA D 1 251 ? 20.262  -18.282  -49.650 1.00 63.69  ? 252 ALA D CB  1 
ATOM   9663  N N   . ALA D 1 252 ? 20.704  -20.817  -47.802 1.00 64.94  ? 253 ALA D N   1 
ATOM   9664  C CA  . ALA D 1 252 ? 20.512  -21.543  -46.553 1.00 66.20  ? 253 ALA D CA  1 
ATOM   9665  C C   . ALA D 1 252 ? 19.803  -20.675  -45.513 1.00 65.48  ? 253 ALA D C   1 
ATOM   9666  O O   . ALA D 1 252 ? 18.888  -21.134  -44.829 1.00 67.14  ? 253 ALA D O   1 
ATOM   9667  C CB  . ALA D 1 252 ? 21.845  -22.031  -46.018 1.00 66.77  ? 253 ALA D CB  1 
ATOM   9668  N N   . SER D 1 253 ? 20.238  -19.424  -45.396 1.00 62.69  ? 254 SER D N   1 
ATOM   9669  C CA  . SER D 1 253 ? 19.567  -18.451  -44.541 1.00 60.99  ? 254 SER D CA  1 
ATOM   9670  C C   . SER D 1 253 ? 19.742  -17.047  -45.111 1.00 57.64  ? 254 SER D C   1 
ATOM   9671  O O   . SER D 1 253 ? 20.427  -16.858  -46.121 1.00 57.80  ? 254 SER D O   1 
ATOM   9672  C CB  . SER D 1 253 ? 20.100  -18.516  -43.110 1.00 61.17  ? 254 SER D CB  1 
ATOM   9673  O OG  . SER D 1 253 ? 21.475  -18.185  -43.060 1.00 61.66  ? 254 SER D OG  1 
ATOM   9674  N N   . LEU D 1 254 ? 19.124  -16.065  -44.463 1.00 53.75  ? 255 LEU D N   1 
ATOM   9675  C CA  . LEU D 1 254 ? 19.169  -14.693  -44.951 1.00 50.76  ? 255 LEU D CA  1 
ATOM   9676  C C   . LEU D 1 254 ? 20.530  -14.047  -44.714 1.00 50.68  ? 255 LEU D C   1 
ATOM   9677  O O   . LEU D 1 254 ? 20.803  -12.960  -45.220 1.00 51.00  ? 255 LEU D O   1 
ATOM   9678  C CB  . LEU D 1 254 ? 18.067  -13.858  -44.298 1.00 47.06  ? 255 LEU D CB  1 
ATOM   9679  C CG  . LEU D 1 254 ? 16.639  -14.261  -44.669 1.00 46.67  ? 255 LEU D CG  1 
ATOM   9680  C CD1 . LEU D 1 254 ? 15.642  -13.340  -44.001 1.00 44.76  ? 255 LEU D CD1 1 
ATOM   9681  C CD2 . LEU D 1 254 ? 16.447  -14.256  -46.185 1.00 48.31  ? 255 LEU D CD2 1 
ATOM   9682  N N   . ARG D 1 255 ? 21.383  -14.714  -43.945 1.00 50.69  ? 256 ARG D N   1 
ATOM   9683  C CA  . ARG D 1 255 ? 22.746  -14.236  -43.750 1.00 48.60  ? 256 ARG D CA  1 
ATOM   9684  C C   . ARG D 1 255 ? 23.530  -14.360  -45.055 1.00 49.49  ? 256 ARG D C   1 
ATOM   9685  O O   . ARG D 1 255 ? 24.477  -13.613  -45.300 1.00 48.27  ? 256 ARG D O   1 
ATOM   9686  C CB  . ARG D 1 255 ? 23.438  -15.011  -42.625 1.00 46.96  ? 256 ARG D CB  1 
ATOM   9687  C CG  . ARG D 1 255 ? 24.898  -14.636  -42.397 1.00 45.79  ? 256 ARG D CG  1 
ATOM   9688  C CD  . ARG D 1 255 ? 25.050  -13.170  -42.020 1.00 44.26  ? 256 ARG D CD  1 
ATOM   9689  N NE  . ARG D 1 255 ? 26.451  -12.793  -41.847 1.00 45.16  ? 256 ARG D NE  1 
ATOM   9690  C CZ  . ARG D 1 255 ? 27.130  -12.946  -40.714 1.00 46.36  ? 256 ARG D CZ  1 
ATOM   9691  N NH1 . ARG D 1 255 ? 26.538  -13.471  -39.646 1.00 45.48  ? 256 ARG D NH1 1 
ATOM   9692  N NH2 . ARG D 1 255 ? 28.403  -12.577  -40.647 1.00 47.60  ? 256 ARG D NH2 1 
ATOM   9693  N N   . GLU D 1 256 ? 23.118  -15.305  -45.896 1.00 52.47  ? 257 GLU D N   1 
ATOM   9694  C CA  . GLU D 1 256 ? 23.782  -15.535  -47.174 1.00 54.25  ? 257 GLU D CA  1 
ATOM   9695  C C   . GLU D 1 256 ? 23.104  -14.772  -48.305 1.00 53.25  ? 257 GLU D C   1 
ATOM   9696  O O   . GLU D 1 256 ? 23.472  -14.922  -49.470 1.00 54.95  ? 257 GLU D O   1 
ATOM   9697  C CB  . GLU D 1 256 ? 23.813  -17.031  -47.505 1.00 58.74  ? 257 GLU D CB  1 
ATOM   9698  C CG  . GLU D 1 256 ? 24.112  -17.927  -46.320 1.00 61.47  ? 257 GLU D CG  1 
ATOM   9699  C CD  . GLU D 1 256 ? 25.503  -17.701  -45.752 1.00 63.06  ? 257 GLU D CD  1 
ATOM   9700  O OE1 . GLU D 1 256 ? 26.430  -17.418  -46.543 1.00 64.46  ? 257 GLU D OE1 1 
ATOM   9701  O OE2 . GLU D 1 256 ? 25.664  -17.792  -44.513 1.00 62.06  ? 257 GLU D OE2 1 
ATOM   9702  N N   . VAL D 1 257 ? 22.110  -13.959  -47.963 1.00 50.72  ? 258 VAL D N   1 
ATOM   9703  C CA  . VAL D 1 257 ? 21.408  -13.166  -48.964 1.00 51.89  ? 258 VAL D CA  1 
ATOM   9704  C C   . VAL D 1 257 ? 21.859  -11.713  -48.927 1.00 50.81  ? 258 VAL D C   1 
ATOM   9705  O O   . VAL D 1 257 ? 21.833  -11.071  -47.875 1.00 50.09  ? 258 VAL D O   1 
ATOM   9706  C CB  . VAL D 1 257 ? 19.883  -13.226  -48.768 1.00 52.13  ? 258 VAL D CB  1 
ATOM   9707  C CG1 . VAL D 1 257 ? 19.185  -12.324  -49.777 1.00 52.85  ? 258 VAL D CG1 1 
ATOM   9708  C CG2 . VAL D 1 257 ? 19.391  -14.660  -48.899 1.00 53.94  ? 258 VAL D CG2 1 
ATOM   9709  N N   . GLN D 1 258 ? 22.286  -11.202  -50.078 1.00 50.05  ? 259 GLN D N   1 
ATOM   9710  C CA  . GLN D 1 258 ? 22.667  -9.799   -50.200 1.00 48.25  ? 259 GLN D CA  1 
ATOM   9711  C C   . GLN D 1 258 ? 21.425  -8.937   -50.414 1.00 47.67  ? 259 GLN D C   1 
ATOM   9712  O O   . GLN D 1 258 ? 20.483  -9.356   -51.090 1.00 51.04  ? 259 GLN D O   1 
ATOM   9713  C CB  . GLN D 1 258 ? 23.661  -9.607   -51.355 1.00 49.18  ? 259 GLN D CB  1 
ATOM   9714  N N   . LEU D 1 259 ? 21.433  -7.732   -49.850 1.00 47.25  ? 260 LEU D N   1 
ATOM   9715  C CA  . LEU D 1 259 ? 20.292  -6.823   -49.947 1.00 41.78  ? 260 LEU D CA  1 
ATOM   9716  C C   . LEU D 1 259 ? 19.901  -6.505   -51.396 1.00 44.12  ? 260 LEU D C   1 
ATOM   9717  O O   . LEU D 1 259 ? 18.718  -6.463   -51.732 1.00 44.49  ? 260 LEU D O   1 
ATOM   9718  C CB  . LEU D 1 259 ? 20.587  -5.518   -49.207 1.00 40.29  ? 260 LEU D CB  1 
ATOM   9719  C CG  . LEU D 1 259 ? 19.409  -4.542   -49.134 1.00 40.25  ? 260 LEU D CG  1 
ATOM   9720  C CD1 . LEU D 1 259 ? 18.252  -5.163   -48.375 1.00 39.96  ? 260 LEU D CD1 1 
ATOM   9721  C CD2 . LEU D 1 259 ? 19.816  -3.216   -48.511 1.00 39.08  ? 260 LEU D CD2 1 
ATOM   9722  N N   . GLU D 1 260 ? 20.898  -6.282   -52.244 1.00 44.44  ? 261 GLU D N   1 
ATOM   9723  C CA  . GLU D 1 260 ? 20.641  -5.877   -53.623 1.00 46.35  ? 261 GLU D CA  1 
ATOM   9724  C C   . GLU D 1 260 ? 19.988  -7.009   -54.402 1.00 56.56  ? 261 GLU D C   1 
ATOM   9725  O O   . GLU D 1 260 ? 19.065  -6.782   -55.181 1.00 57.02  ? 261 GLU D O   1 
ATOM   9726  C CB  . GLU D 1 260 ? 21.933  -5.427   -54.308 1.00 47.02  ? 261 GLU D CB  1 
ATOM   9727  C CG  . GLU D 1 260 ? 22.424  -4.050   -53.873 1.00 48.70  ? 261 GLU D CG  1 
ATOM   9728  C CD  . GLU D 1 260 ? 22.878  -4.009   -52.416 1.00 47.11  ? 261 GLU D CD  1 
ATOM   9729  O OE1 . GLU D 1 260 ? 23.524  -4.978   -51.967 1.00 43.42  ? 261 GLU D OE1 1 
ATOM   9730  O OE2 . GLU D 1 260 ? 22.586  -3.010   -51.725 1.00 42.83  ? 261 GLU D OE2 1 
ATOM   9731  N N   . GLU D 1 261 ? 20.465  -8.229   -54.180 1.00 48.06  ? 262 GLU D N   1 
ATOM   9732  C CA  . GLU D 1 261 ? 19.877  -9.401   -54.807 1.00 55.41  ? 262 GLU D CA  1 
ATOM   9733  C C   . GLU D 1 261 ? 18.432  -9.565   -54.350 1.00 55.11  ? 262 GLU D C   1 
ATOM   9734  O O   . GLU D 1 261 ? 17.559  -9.910   -55.139 1.00 51.49  ? 262 GLU D O   1 
ATOM   9735  C CB  . GLU D 1 261 ? 20.691  -10.657  -54.484 1.00 49.84  ? 262 GLU D CB  1 
ATOM   9736  N N   . LEU D 1 262 ? 18.179  -9.293   -53.075 1.00 51.08  ? 263 LEU D N   1 
ATOM   9737  C CA  . LEU D 1 262 ? 16.837  -9.445   -52.525 1.00 51.75  ? 263 LEU D CA  1 
ATOM   9738  C C   . LEU D 1 262 ? 15.855  -8.440   -53.133 1.00 51.67  ? 263 LEU D C   1 
ATOM   9739  O O   . LEU D 1 262 ? 14.718  -8.790   -53.447 1.00 53.02  ? 263 LEU D O   1 
ATOM   9740  C CB  . LEU D 1 262 ? 16.864  -9.309   -50.998 1.00 48.62  ? 263 LEU D CB  1 
ATOM   9741  C CG  . LEU D 1 262 ? 15.504  -9.351   -50.298 1.00 49.08  ? 263 LEU D CG  1 
ATOM   9742  C CD1 . LEU D 1 262 ? 14.711  -10.578  -50.714 1.00 47.81  ? 263 LEU D CD1 1 
ATOM   9743  C CD2 . LEU D 1 262 ? 15.679  -9.316   -48.782 1.00 43.95  ? 263 LEU D CD2 1 
ATOM   9744  N N   . GLU D 1 263 ? 16.300  -7.201   -53.313 1.00 51.62  ? 264 GLU D N   1 
ATOM   9745  C CA  . GLU D 1 263 ? 15.436  -6.156   -53.858 1.00 54.88  ? 264 GLU D CA  1 
ATOM   9746  C C   . GLU D 1 263 ? 15.002  -6.462   -55.292 1.00 57.20  ? 264 GLU D C   1 
ATOM   9747  O O   . GLU D 1 263 ? 13.931  -6.038   -55.724 1.00 59.33  ? 264 GLU D O   1 
ATOM   9748  C CB  . GLU D 1 263 ? 16.138  -4.798   -53.801 1.00 56.95  ? 264 GLU D CB  1 
ATOM   9749  C CG  . GLU D 1 263 ? 16.366  -4.278   -52.383 1.00 58.59  ? 264 GLU D CG  1 
ATOM   9750  C CD  . GLU D 1 263 ? 15.260  -3.350   -51.910 1.00 62.50  ? 264 GLU D CD  1 
ATOM   9751  O OE1 . GLU D 1 263 ? 15.401  -2.766   -50.817 1.00 62.71  ? 264 GLU D OE1 1 
ATOM   9752  O OE2 . GLU D 1 263 ? 14.255  -3.195   -52.635 1.00 66.20  ? 264 GLU D OE2 1 
ATOM   9753  N N   . ALA D 1 264 ? 15.826  -7.212   -56.016 1.00 56.23  ? 265 ALA D N   1 
ATOM   9754  C CA  . ALA D 1 264 ? 15.534  -7.546   -57.407 1.00 58.17  ? 265 ALA D CA  1 
ATOM   9755  C C   . ALA D 1 264 ? 14.841  -8.898   -57.524 1.00 58.86  ? 265 ALA D C   1 
ATOM   9756  O O   . ALA D 1 264 ? 14.739  -9.457   -58.613 1.00 59.95  ? 265 ALA D O   1 
ATOM   9757  C CB  . ALA D 1 264 ? 16.809  -7.538   -58.228 1.00 58.04  ? 265 ALA D CB  1 
ATOM   9758  N N   . ALA D 1 265 ? 14.366  -9.424   -56.400 1.00 57.21  ? 266 ALA D N   1 
ATOM   9759  C CA  . ALA D 1 265 ? 13.701  -10.719  -56.404 1.00 58.52  ? 266 ALA D CA  1 
ATOM   9760  C C   . ALA D 1 265 ? 12.273  -10.611  -55.885 1.00 59.21  ? 266 ALA D C   1 
ATOM   9761  O O   . ALA D 1 265 ? 11.708  -11.589  -55.394 1.00 57.62  ? 266 ALA D O   1 
ATOM   9762  C CB  . ALA D 1 265 ? 14.492  -11.721  -55.579 1.00 55.37  ? 266 ALA D CB  1 
ATOM   9763  N N   . ARG D 1 266 ? 11.687  -9.424   -56.010 1.00 57.31  ? 267 ARG D N   1 
ATOM   9764  C CA  . ARG D 1 266 ? 10.352  -9.176   -55.478 1.00 61.43  ? 267 ARG D CA  1 
ATOM   9765  C C   . ARG D 1 266 ? 9.277   -10.017  -56.175 1.00 60.76  ? 267 ARG D C   1 
ATOM   9766  O O   . ARG D 1 266 ? 8.190   -10.213  -55.632 1.00 61.50  ? 267 ARG D O   1 
ATOM   9767  C CB  . ARG D 1 266 ? 10.009  -7.686   -55.581 1.00 61.64  ? 267 ARG D CB  1 
ATOM   9768  N N   . ASP D 1 267 ? 9.583   -10.517  -57.371 1.00 64.11  ? 268 ASP D N   1 
ATOM   9769  C CA  . ASP D 1 267 ? 8.658   -11.386  -58.093 1.00 65.48  ? 268 ASP D CA  1 
ATOM   9770  C C   . ASP D 1 267 ? 8.730   -12.836  -57.603 1.00 65.54  ? 268 ASP D C   1 
ATOM   9771  O O   . ASP D 1 267 ? 7.856   -13.645  -57.911 1.00 67.88  ? 268 ASP D O   1 
ATOM   9772  C CB  . ASP D 1 267 ? 8.932   -11.332  -59.602 1.00 70.79  ? 268 ASP D CB  1 
ATOM   9773  C CG  . ASP D 1 267 ? 8.356   -10.091  -60.257 1.00 69.05  ? 268 ASP D CG  1 
ATOM   9774  O OD1 . ASP D 1 267 ? 7.130   -9.869   -60.144 1.00 70.57  ? 268 ASP D OD1 1 
ATOM   9775  O OD2 . ASP D 1 267 ? 9.130   -9.333   -60.880 1.00 72.07  ? 268 ASP D OD2 1 
ATOM   9776  N N   . LEU D 1 268 ? 9.764   -13.161  -56.833 1.00 63.23  ? 269 LEU D N   1 
ATOM   9777  C CA  . LEU D 1 268 ? 9.967   -14.536  -56.378 1.00 63.49  ? 269 LEU D CA  1 
ATOM   9778  C C   . LEU D 1 268 ? 9.225   -14.872  -55.087 1.00 62.89  ? 269 LEU D C   1 
ATOM   9779  O O   . LEU D 1 268 ? 9.068   -16.043  -54.750 1.00 63.88  ? 269 LEU D O   1 
ATOM   9780  C CB  . LEU D 1 268 ? 11.456  -14.817  -56.176 1.00 61.75  ? 269 LEU D CB  1 
ATOM   9781  C CG  . LEU D 1 268 ? 12.326  -15.140  -57.390 1.00 66.38  ? 269 LEU D CG  1 
ATOM   9782  C CD1 . LEU D 1 268 ? 12.693  -13.880  -58.165 1.00 62.63  ? 269 LEU D CD1 1 
ATOM   9783  C CD2 . LEU D 1 268 ? 13.575  -15.886  -56.936 1.00 65.68  ? 269 LEU D CD2 1 
ATOM   9784  N N   . VAL D 1 269 ? 8.779   -13.849  -54.364 1.00 65.23  ? 270 VAL D N   1 
ATOM   9785  C CA  . VAL D 1 269 ? 8.234   -14.043  -53.019 1.00 60.60  ? 270 VAL D CA  1 
ATOM   9786  C C   . VAL D 1 269 ? 6.997   -13.185  -52.760 1.00 61.23  ? 270 VAL D C   1 
ATOM   9787  O O   . VAL D 1 269 ? 6.690   -12.282  -53.535 1.00 68.43  ? 270 VAL D O   1 
ATOM   9788  C CB  . VAL D 1 269 ? 9.289   -13.721  -51.944 1.00 60.75  ? 270 VAL D CB  1 
ATOM   9789  C CG1 . VAL D 1 269 ? 10.390  -14.772  -51.934 1.00 57.27  ? 270 VAL D CG1 1 
ATOM   9790  C CG2 . VAL D 1 269 ? 9.869   -12.333  -52.172 1.00 58.85  ? 270 VAL D CG2 1 
ATOM   9791  N N   . SER D 1 270 ? 6.295   -13.457  -51.662 1.00 61.13  ? 271 SER D N   1 
ATOM   9792  C CA  . SER D 1 270 ? 5.078   -12.712  -51.342 1.00 62.00  ? 271 SER D CA  1 
ATOM   9793  C C   . SER D 1 270 ? 5.395   -11.256  -51.007 1.00 59.88  ? 271 SER D C   1 
ATOM   9794  O O   . SER D 1 270 ? 6.553   -10.899  -50.801 1.00 57.52  ? 271 SER D O   1 
ATOM   9795  C CB  . SER D 1 270 ? 4.330   -13.371  -50.182 1.00 66.04  ? 271 SER D CB  1 
ATOM   9796  O OG  . SER D 1 270 ? 5.008   -13.174  -48.952 1.00 63.11  ? 271 SER D OG  1 
ATOM   9797  N N   . LYS D 1 271 ? 4.366   -10.415  -50.970 1.00 66.58  ? 272 LYS D N   1 
ATOM   9798  C CA  . LYS D 1 271 ? 4.552   -9.006   -50.641 1.00 65.45  ? 272 LYS D CA  1 
ATOM   9799  C C   . LYS D 1 271 ? 5.049   -8.857   -49.206 1.00 64.12  ? 272 LYS D C   1 
ATOM   9800  O O   . LYS D 1 271 ? 5.973   -8.092   -48.932 1.00 61.06  ? 272 LYS D O   1 
ATOM   9801  C CB  . LYS D 1 271 ? 3.249   -8.225   -50.836 1.00 66.55  ? 272 LYS D CB  1 
ATOM   9802  N N   . GLU D 1 272 ? 4.440   -9.612   -48.298 1.00 55.74  ? 273 GLU D N   1 
ATOM   9803  C CA  . GLU D 1 272 ? 4.769   -9.520   -46.883 1.00 55.58  ? 273 GLU D CA  1 
ATOM   9804  C C   . GLU D 1 272 ? 6.073   -10.245  -46.561 1.00 54.22  ? 273 GLU D C   1 
ATOM   9805  O O   . GLU D 1 272 ? 6.874   -9.765   -45.760 1.00 52.34  ? 273 GLU D O   1 
ATOM   9806  C CB  . GLU D 1 272 ? 3.627   -10.087  -46.040 1.00 57.90  ? 273 GLU D CB  1 
ATOM   9807  C CG  . GLU D 1 272 ? 3.542   -9.510   -44.640 1.00 57.30  ? 273 GLU D CG  1 
ATOM   9808  C CD  . GLU D 1 272 ? 2.271   -9.923   -43.921 1.00 59.85  ? 273 GLU D CD  1 
ATOM   9809  O OE1 . GLU D 1 272 ? 1.286   -9.154   -43.970 1.00 62.04  ? 273 GLU D OE1 1 
ATOM   9810  O OE2 . GLU D 1 272 ? 2.257   -11.013  -43.307 1.00 59.33  ? 273 GLU D OE2 1 
ATOM   9811  N N   . GLY D 1 273 ? 6.279   -11.402  -47.184 1.00 55.89  ? 274 GLY D N   1 
ATOM   9812  C CA  . GLY D 1 273 ? 7.490   -12.177  -46.979 1.00 54.88  ? 274 GLY D CA  1 
ATOM   9813  C C   . GLY D 1 273 ? 8.726   -11.412  -47.414 1.00 54.62  ? 274 GLY D C   1 
ATOM   9814  O O   . GLY D 1 273 ? 9.754   -11.419  -46.726 1.00 54.47  ? 274 GLY D O   1 
ATOM   9815  N N   . PHE D 1 274 ? 8.620   -10.745  -48.560 1.00 54.63  ? 275 PHE D N   1 
ATOM   9816  C CA  . PHE D 1 274 ? 9.694   -9.893   -49.060 1.00 53.24  ? 275 PHE D CA  1 
ATOM   9817  C C   . PHE D 1 274 ? 10.119  -8.881   -48.006 1.00 51.42  ? 275 PHE D C   1 
ATOM   9818  O O   . PHE D 1 274 ? 11.307  -8.737   -47.706 1.00 47.92  ? 275 PHE D O   1 
ATOM   9819  C CB  . PHE D 1 274 ? 9.257   -9.164   -50.332 1.00 54.65  ? 275 PHE D CB  1 
ATOM   9820  C CG  . PHE D 1 274 ? 10.201  -8.075   -50.763 1.00 53.21  ? 275 PHE D CG  1 
ATOM   9821  C CD1 . PHE D 1 274 ? 11.395  -8.384   -51.395 1.00 53.21  ? 275 PHE D CD1 1 
ATOM   9822  C CD2 . PHE D 1 274 ? 9.889   -6.742   -50.546 1.00 52.19  ? 275 PHE D CD2 1 
ATOM   9823  C CE1 . PHE D 1 274 ? 12.265  -7.383   -51.798 1.00 52.31  ? 275 PHE D CE1 1 
ATOM   9824  C CE2 . PHE D 1 274 ? 10.754  -5.740   -50.944 1.00 52.16  ? 275 PHE D CE2 1 
ATOM   9825  C CZ  . PHE D 1 274 ? 11.944  -6.062   -51.572 1.00 51.72  ? 275 PHE D CZ  1 
ATOM   9826  N N   . ARG D 1 275 ? 9.139   -8.176   -47.454 1.00 52.80  ? 276 ARG D N   1 
ATOM   9827  C CA  . ARG D 1 275 ? 9.423   -7.171   -46.454 1.00 54.20  ? 276 ARG D CA  1 
ATOM   9828  C C   . ARG D 1 275 ? 10.068  -7.831   -45.248 1.00 51.02  ? 276 ARG D C   1 
ATOM   9829  O O   . ARG D 1 275 ? 11.019  -7.296   -44.682 1.00 49.23  ? 276 ARG D O   1 
ATOM   9830  C CB  . ARG D 1 275 ? 8.149   -6.414   -46.058 1.00 57.58  ? 276 ARG D CB  1 
ATOM   9831  C CG  . ARG D 1 275 ? 7.454   -5.736   -47.234 1.00 60.99  ? 276 ARG D CG  1 
ATOM   9832  C CD  . ARG D 1 275 ? 6.395   -4.744   -46.776 1.00 63.03  ? 276 ARG D CD  1 
ATOM   9833  N NE  . ARG D 1 275 ? 5.336   -5.393   -46.008 1.00 64.73  ? 276 ARG D NE  1 
ATOM   9834  C CZ  . ARG D 1 275 ? 4.037   -5.192   -46.207 1.00 67.28  ? 276 ARG D CZ  1 
ATOM   9835  N NH1 . ARG D 1 275 ? 3.629   -4.359   -47.157 1.00 70.59  ? 276 ARG D NH1 1 
ATOM   9836  N NH2 . ARG D 1 275 ? 3.144   -5.829   -45.460 1.00 66.50  ? 276 ARG D NH2 1 
ATOM   9837  N N   . ARG D 1 276 ? 9.552   -8.993   -44.854 1.00 50.75  ? 277 ARG D N   1 
ATOM   9838  C CA  . ARG D 1 276 ? 10.043  -9.681   -43.660 1.00 49.36  ? 277 ARG D CA  1 
ATOM   9839  C C   . ARG D 1 276 ? 11.531  -9.980   -43.777 1.00 45.68  ? 277 ARG D C   1 
ATOM   9840  O O   . ARG D 1 276 ? 12.296  -9.782   -42.824 1.00 44.10  ? 277 ARG D O   1 
ATOM   9841  C CB  . ARG D 1 276 ? 9.243   -10.957  -43.397 1.00 52.54  ? 277 ARG D CB  1 
ATOM   9842  C CG  . ARG D 1 276 ? 8.164   -10.834  -42.302 1.00 53.78  ? 277 ARG D CG  1 
ATOM   9843  C CD  . ARG D 1 276 ? 7.404   -9.508   -42.385 1.00 55.32  ? 277 ARG D CD  1 
ATOM   9844  N NE  . ARG D 1 276 ? 6.069   -9.527   -41.780 1.00 55.49  ? 277 ARG D NE  1 
ATOM   9845  C CZ  . ARG D 1 276 ? 5.255   -8.471   -41.754 1.00 54.85  ? 277 ARG D CZ  1 
ATOM   9846  N NH1 . ARG D 1 276 ? 5.647   -7.319   -42.288 1.00 55.12  ? 277 ARG D NH1 1 
ATOM   9847  N NH2 . ARG D 1 276 ? 4.053   -8.560   -41.201 1.00 53.53  ? 277 ARG D NH2 1 
ATOM   9848  N N   . ALA D 1 277 ? 11.934  -10.436  -44.954 1.00 43.60  ? 278 ALA D N   1 
ATOM   9849  C CA  . ALA D 1 277 ? 13.332  -10.716  -45.238 1.00 41.83  ? 278 ALA D CA  1 
ATOM   9850  C C   . ALA D 1 277 ? 14.141  -9.437   -45.426 1.00 40.36  ? 278 ALA D C   1 
ATOM   9851  O O   . ALA D 1 277 ? 15.330  -9.406   -45.115 1.00 40.11  ? 278 ALA D O   1 
ATOM   9852  C CB  . ALA D 1 277 ? 13.452  -11.594  -46.473 1.00 42.69  ? 278 ALA D CB  1 
ATOM   9853  N N   . ARG D 1 278 ? 13.507  -8.386   -45.941 1.00 39.29  ? 279 ARG D N   1 
ATOM   9854  C CA  . ARG D 1 278 ? 14.236  -7.148   -46.183 1.00 38.59  ? 279 ARG D CA  1 
ATOM   9855  C C   . ARG D 1 278 ? 14.698  -6.517   -44.866 1.00 36.01  ? 279 ARG D C   1 
ATOM   9856  O O   . ARG D 1 278 ? 15.780  -5.939   -44.805 1.00 35.43  ? 279 ARG D O   1 
ATOM   9857  C CB  . ARG D 1 278 ? 13.403  -6.144   -46.983 1.00 40.59  ? 279 ARG D CB  1 
ATOM   9858  C CG  . ARG D 1 278 ? 14.181  -4.871   -47.315 1.00 43.13  ? 279 ARG D CG  1 
ATOM   9859  C CD  . ARG D 1 278 ? 13.539  -4.061   -48.432 1.00 48.18  ? 279 ARG D CD  1 
ATOM   9860  N NE  . ARG D 1 278 ? 12.165  -3.700   -48.104 1.00 52.19  ? 279 ARG D NE  1 
ATOM   9861  C CZ  . ARG D 1 278 ? 11.413  -2.874   -48.823 1.00 54.22  ? 279 ARG D CZ  1 
ATOM   9862  N NH1 . ARG D 1 278 ? 11.905  -2.308   -49.919 1.00 56.31  ? 279 ARG D NH1 1 
ATOM   9863  N NH2 . ARG D 1 278 ? 10.171  -2.610   -48.440 1.00 54.29  ? 279 ARG D NH2 1 
ATOM   9864  N N   . HIS D 1 279 ? 13.900  -6.633   -43.810 1.00 35.53  ? 280 HIS D N   1 
ATOM   9865  C CA  . HIS D 1 279 ? 14.358  -6.119   -42.523 1.00 34.95  ? 280 HIS D CA  1 
ATOM   9866  C C   . HIS D 1 279 ? 15.603  -6.860   -42.068 1.00 32.98  ? 280 HIS D C   1 
ATOM   9867  O O   . HIS D 1 279 ? 16.595  -6.250   -41.698 1.00 32.22  ? 280 HIS D O   1 
ATOM   9868  C CB  . HIS D 1 279 ? 13.305  -6.237   -41.428 1.00 34.87  ? 280 HIS D CB  1 
ATOM   9869  C CG  . HIS D 1 279 ? 13.891  -6.114   -40.059 1.00 32.39  ? 280 HIS D CG  1 
ATOM   9870  N ND1 . HIS D 1 279 ? 14.511  -4.961   -39.622 1.00 31.06  ? 280 HIS D ND1 1 
ATOM   9871  C CD2 . HIS D 1 279 ? 14.023  -7.012   -39.056 1.00 32.02  ? 280 HIS D CD2 1 
ATOM   9872  C CE1 . HIS D 1 279 ? 14.977  -5.148   -38.402 1.00 30.49  ? 280 HIS D CE1 1 
ATOM   9873  N NE2 . HIS D 1 279 ? 14.690  -6.384   -38.031 1.00 31.34  ? 280 HIS D NE2 1 
ATOM   9874  N N   . VAL D 1 280 ? 15.539  -8.184   -42.112 1.00 33.41  ? 281 VAL D N   1 
ATOM   9875  C CA  . VAL D 1 280 ? 16.611  -9.024   -41.601 1.00 33.61  ? 281 VAL D CA  1 
ATOM   9876  C C   . VAL D 1 280 ? 17.919  -8.822   -42.359 1.00 33.84  ? 281 VAL D C   1 
ATOM   9877  O O   . VAL D 1 280 ? 18.970  -8.629   -41.750 1.00 32.56  ? 281 VAL D O   1 
ATOM   9878  C CB  . VAL D 1 280 ? 16.211  -10.506  -41.652 1.00 35.26  ? 281 VAL D CB  1 
ATOM   9879  C CG1 . VAL D 1 280 ? 17.381  -11.389  -41.255 1.00 35.61  ? 281 VAL D CG1 1 
ATOM   9880  C CG2 . VAL D 1 280 ? 15.010  -10.754  -40.741 1.00 34.46  ? 281 VAL D CG2 1 
ATOM   9881  N N   . VAL D 1 281 ? 17.855  -8.861   -43.687 1.00 34.78  ? 282 VAL D N   1 
ATOM   9882  C CA  . VAL D 1 281 ? 19.052  -8.695   -44.500 1.00 34.19  ? 282 VAL D CA  1 
ATOM   9883  C C   . VAL D 1 281 ? 19.631  -7.289   -44.324 1.00 33.78  ? 282 VAL D C   1 
ATOM   9884  O O   . VAL D 1 281 ? 20.844  -7.122   -44.172 1.00 33.61  ? 282 VAL D O   1 
ATOM   9885  C CB  . VAL D 1 281 ? 18.759  -8.970   -45.985 1.00 34.23  ? 282 VAL D CB  1 
ATOM   9886  C CG1 . VAL D 1 281 ? 19.948  -8.568   -46.864 1.00 33.53  ? 282 VAL D CG1 1 
ATOM   9887  C CG2 . VAL D 1 281 ? 18.406  -10.440  -46.181 1.00 35.07  ? 282 VAL D CG2 1 
ATOM   9888  N N   . GLY D 1 282 ? 18.760  -6.284   -44.334 1.00 32.89  ? 283 GLY D N   1 
ATOM   9889  C CA  . GLY D 1 282 ? 19.181  -4.911   -44.132 1.00 31.17  ? 283 GLY D CA  1 
ATOM   9890  C C   . GLY D 1 282 ? 19.738  -4.692   -42.732 1.00 29.31  ? 283 GLY D C   1 
ATOM   9891  O O   . GLY D 1 282 ? 20.678  -3.924   -42.542 1.00 29.28  ? 283 GLY D O   1 
ATOM   9892  N N   . GLU D 1 283 ? 19.159  -5.379   -41.753 1.00 28.81  ? 284 GLU D N   1 
ATOM   9893  C CA  . GLU D 1 283 ? 19.582  -5.240   -40.352 1.00 27.95  ? 284 GLU D CA  1 
ATOM   9894  C C   . GLU D 1 283 ? 20.960  -5.853   -40.114 1.00 28.33  ? 284 GLU D C   1 
ATOM   9895  O O   . GLU D 1 283 ? 21.776  -5.294   -39.386 1.00 28.58  ? 284 GLU D O   1 
ATOM   9896  C CB  . GLU D 1 283 ? 18.556  -5.881   -39.414 1.00 26.77  ? 284 GLU D CB  1 
ATOM   9897  C CG  . GLU D 1 283 ? 18.806  -5.623   -37.920 1.00 27.89  ? 284 GLU D CG  1 
ATOM   9898  C CD  . GLU D 1 283 ? 18.382  -4.238   -37.475 1.00 28.66  ? 284 GLU D CD  1 
ATOM   9899  O OE1 . GLU D 1 283 ? 18.096  -3.385   -38.348 1.00 29.95  ? 284 GLU D OE1 1 
ATOM   9900  O OE2 . GLU D 1 283 ? 18.323  -4.006   -36.247 1.00 28.24  ? 284 GLU D OE2 1 
ATOM   9901  N N   . ILE D 1 284 ? 21.216  -7.002   -40.729 1.00 30.43  ? 285 ILE D N   1 
ATOM   9902  C CA  . ILE D 1 284 ? 22.536  -7.615   -40.672 1.00 31.75  ? 285 ILE D CA  1 
ATOM   9903  C C   . ILE D 1 284 ? 23.591  -6.622   -41.153 1.00 32.08  ? 285 ILE D C   1 
ATOM   9904  O O   . ILE D 1 284 ? 24.600  -6.406   -40.479 1.00 31.47  ? 285 ILE D O   1 
ATOM   9905  C CB  . ILE D 1 284 ? 22.600  -8.905   -41.517 1.00 33.94  ? 285 ILE D CB  1 
ATOM   9906  C CG1 . ILE D 1 284 ? 21.724  -9.992   -40.892 1.00 34.19  ? 285 ILE D CG1 1 
ATOM   9907  C CG2 . ILE D 1 284 ? 24.032  -9.399   -41.646 1.00 34.51  ? 285 ILE D CG2 1 
ATOM   9908  C CD1 . ILE D 1 284 ? 21.658  -11.285  -41.716 1.00 36.46  ? 285 ILE D CD1 1 
ATOM   9909  N N   . ARG D 1 285 ? 23.338  -5.998   -42.304 1.00 30.27  ? 286 ARG D N   1 
ATOM   9910  C CA  . ARG D 1 285 ? 24.246  -4.989   -42.845 1.00 29.43  ? 286 ARG D CA  1 
ATOM   9911  C C   . ARG D 1 285 ? 24.413  -3.786   -41.909 1.00 27.57  ? 286 ARG D C   1 
ATOM   9912  O O   . ARG D 1 285 ? 25.529  -3.312   -41.707 1.00 26.73  ? 286 ARG D O   1 
ATOM   9913  C CB  . ARG D 1 285 ? 23.762  -4.505   -44.224 1.00 30.08  ? 286 ARG D CB  1 
ATOM   9914  C CG  . ARG D 1 285 ? 24.632  -3.411   -44.835 1.00 32.15  ? 286 ARG D CG  1 
ATOM   9915  C CD  . ARG D 1 285 ? 24.164  -3.009   -46.247 1.00 34.79  ? 286 ARG D CD  1 
ATOM   9916  N NE  . ARG D 1 285 ? 24.323  -4.099   -47.211 1.00 36.64  ? 286 ARG D NE  1 
ATOM   9917  C CZ  . ARG D 1 285 ? 23.996  -4.018   -48.500 1.00 36.88  ? 286 ARG D CZ  1 
ATOM   9918  N NH1 . ARG D 1 285 ? 23.491  -2.898   -48.991 1.00 30.93  ? 286 ARG D NH1 1 
ATOM   9919  N NH2 . ARG D 1 285 ? 24.171  -5.064   -49.297 1.00 38.36  ? 286 ARG D NH2 1 
ATOM   9920  N N   . ARG D 1 286 ? 23.306  -3.284   -41.364 1.00 25.55  ? 287 ARG D N   1 
ATOM   9921  C CA  . ARG D 1 286 ? 23.342  -2.102   -40.503 1.00 26.75  ? 287 ARG D CA  1 
ATOM   9922  C C   . ARG D 1 286 ? 24.138  -2.379   -39.229 1.00 26.33  ? 287 ARG D C   1 
ATOM   9923  O O   . ARG D 1 286 ? 24.829  -1.505   -38.707 1.00 26.90  ? 287 ARG D O   1 
ATOM   9924  C CB  . ARG D 1 286 ? 21.924  -1.652   -40.136 1.00 28.16  ? 287 ARG D CB  1 
ATOM   9925  C CG  . ARG D 1 286 ? 21.225  -0.807   -41.193 1.00 29.30  ? 287 ARG D CG  1 
ATOM   9926  C CD  . ARG D 1 286 ? 19.890  -0.275   -40.678 1.00 29.08  ? 287 ARG D CD  1 
ATOM   9927  N NE  . ARG D 1 286 ? 18.947  -1.349   -40.377 1.00 28.78  ? 287 ARG D NE  1 
ATOM   9928  C CZ  . ARG D 1 286 ? 18.091  -1.854   -41.261 1.00 30.58  ? 287 ARG D CZ  1 
ATOM   9929  N NH1 . ARG D 1 286 ? 18.062  -1.377   -42.504 1.00 30.71  ? 287 ARG D NH1 1 
ATOM   9930  N NH2 . ARG D 1 286 ? 17.267  -2.834   -40.910 1.00 30.25  ? 287 ARG D NH2 1 
ATOM   9931  N N   . THR D 1 287 ? 24.023  -3.604   -38.739 1.00 26.08  ? 288 THR D N   1 
ATOM   9932  C CA  . THR D 1 287 ? 24.688  -4.007   -37.507 1.00 27.22  ? 288 THR D CA  1 
ATOM   9933  C C   . THR D 1 287 ? 26.198  -4.056   -37.720 1.00 28.68  ? 288 THR D C   1 
ATOM   9934  O O   . THR D 1 287 ? 26.964  -3.615   -36.866 1.00 27.30  ? 288 THR D O   1 
ATOM   9935  C CB  . THR D 1 287 ? 24.158  -5.354   -37.030 1.00 27.57  ? 288 THR D CB  1 
ATOM   9936  O OG1 . THR D 1 287 ? 22.746  -5.235   -36.802 1.00 26.70  ? 288 THR D OG1 1 
ATOM   9937  C CG2 . THR D 1 287 ? 24.853  -5.791   -35.733 1.00 27.94  ? 288 THR D CG2 1 
ATOM   9938  N N   . ALA D 1 288 ? 26.621  -4.565   -38.876 1.00 28.85  ? 289 ALA D N   1 
ATOM   9939  C CA  . ALA D 1 288 ? 28.036  -4.554   -39.226 1.00 29.00  ? 289 ALA D CA  1 
ATOM   9940  C C   . ALA D 1 288 ? 28.534  -3.117   -39.329 1.00 29.47  ? 289 ALA D C   1 
ATOM   9941  O O   . ALA D 1 288 ? 29.634  -2.794   -38.875 1.00 30.26  ? 289 ALA D O   1 
ATOM   9942  C CB  . ALA D 1 288 ? 28.278  -5.304   -40.536 1.00 30.32  ? 289 ALA D CB  1 
ATOM   9943  N N   . GLN D 1 289 ? 27.711  -2.249   -39.911 1.00 28.41  ? 290 GLN D N   1 
ATOM   9944  C CA  . GLN D 1 289 ? 28.075  -0.842   -40.061 1.00 28.55  ? 290 GLN D CA  1 
ATOM   9945  C C   . GLN D 1 289 ? 28.078  -0.116   -38.712 1.00 28.57  ? 290 GLN D C   1 
ATOM   9946  O O   . GLN D 1 289 ? 28.885  0.781    -38.488 1.00 27.91  ? 290 GLN D O   1 
ATOM   9947  C CB  . GLN D 1 289 ? 27.128  -0.148   -41.041 1.00 29.88  ? 290 GLN D CB  1 
ATOM   9948  C CG  . GLN D 1 289 ? 27.182  -0.723   -42.455 1.00 31.78  ? 290 GLN D CG  1 
ATOM   9949  C CD  . GLN D 1 289 ? 26.255  -0.003   -43.421 1.00 35.39  ? 290 GLN D CD  1 
ATOM   9950  O OE1 . GLN D 1 289 ? 25.473  0.856    -43.020 1.00 38.11  ? 290 GLN D OE1 1 
ATOM   9951  N NE2 . GLN D 1 289 ? 26.343  -0.349   -44.703 1.00 34.51  ? 290 GLN D NE2 1 
ATOM   9952  N N   . ALA D 1 290 ? 27.173  -0.514   -37.823 1.00 28.39  ? 291 ALA D N   1 
ATOM   9953  C CA  . ALA D 1 290 ? 27.077  0.080    -36.495 1.00 30.37  ? 291 ALA D CA  1 
ATOM   9954  C C   . ALA D 1 290 ? 28.317  -0.238   -35.661 1.00 31.37  ? 291 ALA D C   1 
ATOM   9955  O O   . ALA D 1 290 ? 28.872  0.642    -35.000 1.00 31.84  ? 291 ALA D O   1 
ATOM   9956  C CB  . ALA D 1 290 ? 25.808  -0.401   -35.786 1.00 28.15  ? 291 ALA D CB  1 
ATOM   9957  N N   . ALA D 1 291 ? 28.760  -1.491   -35.708 1.00 31.17  ? 292 ALA D N   1 
ATOM   9958  C CA  . ALA D 1 291 ? 29.968  -1.895   -34.996 1.00 32.19  ? 292 ALA D CA  1 
ATOM   9959  C C   . ALA D 1 291 ? 31.183  -1.148   -35.544 1.00 33.56  ? 292 ALA D C   1 
ATOM   9960  O O   . ALA D 1 291 ? 32.067  -0.745   -34.784 1.00 33.66  ? 292 ALA D O   1 
ATOM   9961  C CB  . ALA D 1 291 ? 30.173  -3.406   -35.091 1.00 30.99  ? 292 ALA D CB  1 
ATOM   9962  N N   . ALA D 1 292 ? 31.215  -0.954   -36.860 1.00 31.80  ? 293 ALA D N   1 
ATOM   9963  C CA  . ALA D 1 292 ? 32.294  -0.199   -37.490 1.00 32.26  ? 293 ALA D CA  1 
ATOM   9964  C C   . ALA D 1 292 ? 32.265  1.252    -37.014 1.00 31.56  ? 293 ALA D C   1 
ATOM   9965  O O   . ALA D 1 292 ? 33.306  1.837    -36.723 1.00 32.01  ? 293 ALA D O   1 
ATOM   9966  C CB  . ALA D 1 292 ? 32.188  -0.270   -39.021 1.00 33.66  ? 293 ALA D CB  1 
ATOM   9967  N N   . ALA D 1 293 ? 31.064  1.820    -36.935 1.00 29.96  ? 294 ALA D N   1 
ATOM   9968  C CA  . ALA D 1 293 ? 30.882  3.182    -36.438 1.00 29.96  ? 294 ALA D CA  1 
ATOM   9969  C C   . ALA D 1 293 ? 31.366  3.305    -34.995 1.00 32.22  ? 294 ALA D C   1 
ATOM   9970  O O   . ALA D 1 293 ? 31.946  4.318    -34.605 1.00 34.37  ? 294 ALA D O   1 
ATOM   9971  C CB  . ALA D 1 293 ? 29.421  3.599    -36.546 1.00 27.91  ? 294 ALA D CB  1 
ATOM   9972  N N   . LEU D 1 294 ? 31.128  2.266    -34.205 1.00 33.29  ? 295 LEU D N   1 
ATOM   9973  C CA  . LEU D 1 294 ? 31.619  2.241    -32.831 1.00 34.97  ? 295 LEU D CA  1 
ATOM   9974  C C   . LEU D 1 294 ? 33.140  2.311    -32.798 1.00 36.80  ? 295 LEU D C   1 
ATOM   9975  O O   . LEU D 1 294 ? 33.716  3.092    -32.039 1.00 37.28  ? 295 LEU D O   1 
ATOM   9976  C CB  . LEU D 1 294 ? 31.137  0.988    -32.103 1.00 34.68  ? 295 LEU D CB  1 
ATOM   9977  C CG  . LEU D 1 294 ? 29.791  1.153    -31.400 1.00 36.41  ? 295 LEU D CG  1 
ATOM   9978  C CD1 . LEU D 1 294 ? 29.438  -0.096   -30.601 1.00 36.52  ? 295 LEU D CD1 1 
ATOM   9979  C CD2 . LEU D 1 294 ? 29.801  2.398    -30.513 1.00 38.22  ? 295 LEU D CD2 1 
ATOM   9980  N N   . ARG D 1 295 ? 33.780  1.505    -33.639 1.00 36.23  ? 296 ARG D N   1 
ATOM   9981  C CA  . ARG D 1 295 ? 35.232  1.389    -33.643 1.00 38.55  ? 296 ARG D CA  1 
ATOM   9982  C C   . ARG D 1 295 ? 35.922  2.702    -33.996 1.00 39.82  ? 296 ARG D C   1 
ATOM   9983  O O   . ARG D 1 295 ? 37.042  2.956    -33.559 1.00 40.96  ? 296 ARG D O   1 
ATOM   9984  C CB  . ARG D 1 295 ? 35.675  0.290    -34.611 1.00 38.89  ? 296 ARG D CB  1 
ATOM   9985  C CG  . ARG D 1 295 ? 35.223  -1.096   -34.202 1.00 38.75  ? 296 ARG D CG  1 
ATOM   9986  C CD  . ARG D 1 295 ? 35.800  -2.183   -35.096 1.00 39.59  ? 296 ARG D CD  1 
ATOM   9987  N NE  . ARG D 1 295 ? 35.433  -3.508   -34.600 1.00 40.65  ? 296 ARG D NE  1 
ATOM   9988  C CZ  . ARG D 1 295 ? 34.462  -4.260   -35.110 1.00 41.21  ? 296 ARG D CZ  1 
ATOM   9989  N NH1 . ARG D 1 295 ? 33.766  -3.831   -36.155 1.00 42.55  ? 296 ARG D NH1 1 
ATOM   9990  N NH2 . ARG D 1 295 ? 34.198  -5.448   -34.583 1.00 40.83  ? 296 ARG D NH2 1 
ATOM   9991  N N   . ARG D 1 296 ? 35.263  3.540    -34.783 1.00 40.52  ? 297 ARG D N   1 
ATOM   9992  C CA  . ARG D 1 296 ? 35.855  4.826    -35.126 1.00 42.30  ? 297 ARG D CA  1 
ATOM   9993  C C   . ARG D 1 296 ? 35.254  5.939    -34.270 1.00 42.88  ? 297 ARG D C   1 
ATOM   9994  O O   . ARG D 1 296 ? 35.512  7.121    -34.495 1.00 43.31  ? 297 ARG D O   1 
ATOM   9995  C CB  . ARG D 1 296 ? 35.684  5.121    -36.620 1.00 42.62  ? 297 ARG D CB  1 
ATOM   9996  C CG  . ARG D 1 296 ? 34.259  5.076    -37.123 1.00 43.23  ? 297 ARG D CG  1 
ATOM   9997  C CD  . ARG D 1 296 ? 34.178  5.470    -38.598 1.00 44.04  ? 297 ARG D CD  1 
ATOM   9998  N NE  . ARG D 1 296 ? 32.829  5.907    -38.943 1.00 44.26  ? 297 ARG D NE  1 
ATOM   9999  C CZ  . ARG D 1 296 ? 31.904  5.130    -39.492 1.00 44.18  ? 297 ARG D CZ  1 
ATOM   10000 N NH1 . ARG D 1 296 ? 32.183  3.868    -39.794 1.00 43.04  ? 297 ARG D NH1 1 
ATOM   10001 N NH2 . ARG D 1 296 ? 30.700  5.622    -39.753 1.00 45.94  ? 297 ARG D NH2 1 
ATOM   10002 N N   . GLY D 1 297 ? 34.463  5.544    -33.276 1.00 43.70  ? 298 GLY D N   1 
ATOM   10003 C CA  . GLY D 1 297 ? 33.872  6.484    -32.340 1.00 45.17  ? 298 GLY D CA  1 
ATOM   10004 C C   . GLY D 1 297 ? 32.887  7.439    -32.985 1.00 46.62  ? 298 GLY D C   1 
ATOM   10005 O O   . GLY D 1 297 ? 32.680  8.550    -32.493 1.00 48.61  ? 298 GLY D O   1 
ATOM   10006 N N   . ASP D 1 298 ? 32.280  7.004    -34.087 1.00 44.53  ? 299 ASP D N   1 
ATOM   10007 C CA  . ASP D 1 298 ? 31.312  7.819    -34.810 1.00 44.50  ? 299 ASP D CA  1 
ATOM   10008 C C   . ASP D 1 298 ? 29.896  7.551    -34.306 1.00 45.40  ? 299 ASP D C   1 
ATOM   10009 O O   . ASP D 1 298 ? 29.112  6.857    -34.960 1.00 44.38  ? 299 ASP D O   1 
ATOM   10010 C CB  . ASP D 1 298 ? 31.401  7.541    -36.312 1.00 43.89  ? 299 ASP D CB  1 
ATOM   10011 C CG  . ASP D 1 298 ? 30.636  8.556    -37.147 1.00 44.97  ? 299 ASP D CG  1 
ATOM   10012 O OD1 . ASP D 1 298 ? 29.768  9.268    -36.599 1.00 44.91  ? 299 ASP D OD1 1 
ATOM   10013 O OD2 . ASP D 1 298 ? 30.903  8.637    -38.365 1.00 46.23  ? 299 ASP D OD2 1 
ATOM   10014 N N   . TYR D 1 299 ? 29.569  8.124    -33.153 1.00 46.23  ? 300 TYR D N   1 
ATOM   10015 C CA  . TYR D 1 299 ? 28.293  7.855    -32.496 1.00 46.06  ? 300 TYR D CA  1 
ATOM   10016 C C   . TYR D 1 299 ? 27.116  8.501    -33.218 1.00 44.48  ? 300 TYR D C   1 
ATOM   10017 O O   . TYR D 1 299 ? 25.968  8.095    -33.034 1.00 44.37  ? 300 TYR D O   1 
ATOM   10018 C CB  . TYR D 1 299 ? 28.353  8.320    -31.037 1.00 48.63  ? 300 TYR D CB  1 
ATOM   10019 C CG  . TYR D 1 299 ? 29.474  7.652    -30.279 1.00 50.06  ? 300 TYR D CG  1 
ATOM   10020 C CD1 . TYR D 1 299 ? 29.364  6.333    -29.861 1.00 49.88  ? 300 TYR D CD1 1 
ATOM   10021 C CD2 . TYR D 1 299 ? 30.655  8.330    -30.007 1.00 52.30  ? 300 TYR D CD2 1 
ATOM   10022 C CE1 . TYR D 1 299 ? 30.391  5.710    -29.183 1.00 51.16  ? 300 TYR D CE1 1 
ATOM   10023 C CE2 . TYR D 1 299 ? 31.689  7.717    -29.326 1.00 53.44  ? 300 TYR D CE2 1 
ATOM   10024 C CZ  . TYR D 1 299 ? 31.552  6.407    -28.917 1.00 53.65  ? 300 TYR D CZ  1 
ATOM   10025 O OH  . TYR D 1 299 ? 32.580  5.793    -28.240 1.00 56.18  ? 300 TYR D OH  1 
ATOM   10026 N N   . ARG D 1 300 ? 27.400  9.502    -34.044 1.00 44.16  ? 301 ARG D N   1 
ATOM   10027 C CA  . ARG D 1 300 ? 26.370  10.103   -34.883 1.00 43.25  ? 301 ARG D CA  1 
ATOM   10028 C C   . ARG D 1 300 ? 25.899  9.084    -35.912 1.00 41.09  ? 301 ARG D C   1 
ATOM   10029 O O   . ARG D 1 300 ? 24.702  8.869    -36.082 1.00 41.53  ? 301 ARG D O   1 
ATOM   10030 C CB  . ARG D 1 300 ? 26.892  11.362   -35.577 1.00 44.99  ? 301 ARG D CB  1 
ATOM   10031 N N   . ALA D 1 301 ? 26.855  8.454    -36.586 1.00 39.09  ? 302 ALA D N   1 
ATOM   10032 C CA  . ALA D 1 301 ? 26.550  7.408    -37.552 1.00 38.51  ? 302 ALA D CA  1 
ATOM   10033 C C   . ALA D 1 301 ? 25.829  6.239    -36.883 1.00 36.83  ? 302 ALA D C   1 
ATOM   10034 O O   . ALA D 1 301 ? 24.911  5.656    -37.462 1.00 36.34  ? 302 ALA D O   1 
ATOM   10035 C CB  . ALA D 1 301 ? 27.823  6.926    -38.241 1.00 38.19  ? 302 ALA D CB  1 
ATOM   10036 N N   . PHE D 1 302 ? 26.244  5.905    -35.664 1.00 35.37  ? 303 PHE D N   1 
ATOM   10037 C CA  . PHE D 1 302 ? 25.633  4.808    -34.922 1.00 34.26  ? 303 PHE D CA  1 
ATOM   10038 C C   . PHE D 1 302 ? 24.153  5.092    -34.682 1.00 35.50  ? 303 PHE D C   1 
ATOM   10039 O O   . PHE D 1 302 ? 23.300  4.238    -34.916 1.00 36.41  ? 303 PHE D O   1 
ATOM   10040 C CB  . PHE D 1 302 ? 26.355  4.584    -33.586 1.00 34.72  ? 303 PHE D CB  1 
ATOM   10041 C CG  . PHE D 1 302 ? 25.958  3.309    -32.890 1.00 33.64  ? 303 PHE D CG  1 
ATOM   10042 C CD1 . PHE D 1 302 ? 24.807  3.250    -32.115 1.00 33.64  ? 303 PHE D CD1 1 
ATOM   10043 C CD2 . PHE D 1 302 ? 26.727  2.164    -33.026 1.00 32.26  ? 303 PHE D CD2 1 
ATOM   10044 C CE1 . PHE D 1 302 ? 24.436  2.073    -31.490 1.00 33.02  ? 303 PHE D CE1 1 
ATOM   10045 C CE2 . PHE D 1 302 ? 26.363  0.987    -32.401 1.00 31.57  ? 303 PHE D CE2 1 
ATOM   10046 C CZ  . PHE D 1 302 ? 25.220  0.940    -31.632 1.00 32.01  ? 303 PHE D CZ  1 
ATOM   10047 N N   . GLY D 1 303 ? 23.858  6.302    -34.221 1.00 36.48  ? 304 GLY D N   1 
ATOM   10048 C CA  . GLY D 1 303 ? 22.490  6.708    -33.951 1.00 37.17  ? 304 GLY D CA  1 
ATOM   10049 C C   . GLY D 1 303 ? 21.608  6.734    -35.187 1.00 36.71  ? 304 GLY D C   1 
ATOM   10050 O O   . GLY D 1 303 ? 20.411  6.458    -35.110 1.00 38.08  ? 304 GLY D O   1 
ATOM   10051 N N   . ARG D 1 304 ? 22.193  7.063    -36.334 1.00 35.40  ? 305 ARG D N   1 
ATOM   10052 C CA  . ARG D 1 304 ? 21.435  7.074    -37.580 1.00 35.09  ? 305 ARG D CA  1 
ATOM   10053 C C   . ARG D 1 304 ? 21.056  5.653    -37.988 1.00 33.44  ? 305 ARG D C   1 
ATOM   10054 O O   . ARG D 1 304 ? 19.949  5.408    -38.471 1.00 33.95  ? 305 ARG D O   1 
ATOM   10055 C CB  . ARG D 1 304 ? 22.230  7.754    -38.695 1.00 35.99  ? 305 ARG D CB  1 
ATOM   10056 N N   . LEU D 1 305 ? 21.977  4.716    -37.787 1.00 31.50  ? 306 LEU D N   1 
ATOM   10057 C CA  . LEU D 1 305 ? 21.708  3.318    -38.098 1.00 32.27  ? 306 LEU D CA  1 
ATOM   10058 C C   . LEU D 1 305 ? 20.637  2.775    -37.168 1.00 32.43  ? 306 LEU D C   1 
ATOM   10059 O O   . LEU D 1 305 ? 19.826  1.937    -37.564 1.00 32.18  ? 306 LEU D O   1 
ATOM   10060 C CB  . LEU D 1 305 ? 22.985  2.488    -37.998 1.00 32.06  ? 306 LEU D CB  1 
ATOM   10061 C CG  . LEU D 1 305 ? 24.019  2.888    -39.050 1.00 31.73  ? 306 LEU D CG  1 
ATOM   10062 C CD1 . LEU D 1 305 ? 25.408  2.424    -38.635 1.00 30.58  ? 306 LEU D CD1 1 
ATOM   10063 C CD2 . LEU D 1 305 ? 23.638  2.326    -40.424 1.00 30.54  ? 306 LEU D CD2 1 
ATOM   10064 N N   . MET D 1 306 ? 20.635  3.271    -35.933 1.00 33.05  ? 307 MET D N   1 
ATOM   10065 C CA  . MET D 1 306 ? 19.598  2.929    -34.967 1.00 30.80  ? 307 MET D CA  1 
ATOM   10066 C C   . MET D 1 306 ? 18.227  3.330    -35.488 1.00 31.20  ? 307 MET D C   1 
ATOM   10067 O O   . MET D 1 306 ? 17.276  2.550    -35.419 1.00 32.04  ? 307 MET D O   1 
ATOM   10068 C CB  . MET D 1 306 ? 19.865  3.605    -33.619 1.00 29.03  ? 307 MET D CB  1 
ATOM   10069 C CG  . MET D 1 306 ? 21.073  3.046    -32.867 1.00 28.05  ? 307 MET D CG  1 
ATOM   10070 S SD  . MET D 1 306 ? 21.359  3.914    -31.308 1.00 34.92  ? 307 MET D SD  1 
ATOM   10071 C CE  . MET D 1 306 ? 19.873  3.491    -30.401 1.00 29.93  ? 307 MET D CE  1 
ATOM   10072 N N   . VAL D 1 307 ? 18.133  4.551    -36.008 1.00 32.51  ? 308 VAL D N   1 
ATOM   10073 C CA  . VAL D 1 307 ? 16.879  5.060    -36.562 1.00 32.81  ? 308 VAL D CA  1 
ATOM   10074 C C   . VAL D 1 307 ? 16.478  4.292    -37.820 1.00 33.36  ? 308 VAL D C   1 
ATOM   10075 O O   . VAL D 1 307 ? 15.301  3.979    -38.016 1.00 37.11  ? 308 VAL D O   1 
ATOM   10076 C CB  . VAL D 1 307 ? 16.974  6.569    -36.886 1.00 33.19  ? 308 VAL D CB  1 
ATOM   10077 C CG1 . VAL D 1 307 ? 15.667  7.074    -37.497 1.00 33.22  ? 308 VAL D CG1 1 
ATOM   10078 C CG2 . VAL D 1 307 ? 17.306  7.355    -35.634 1.00 35.25  ? 308 VAL D CG2 1 
ATOM   10079 N N   . GLU D 1 308 ? 17.449  3.988    -38.675 1.00 32.39  ? 309 GLU D N   1 
ATOM   10080 C CA  . GLU D 1 308 ? 17.173  3.173    -39.858 1.00 34.83  ? 309 GLU D CA  1 
ATOM   10081 C C   . GLU D 1 308 ? 16.660  1.799    -39.441 1.00 33.99  ? 309 GLU D C   1 
ATOM   10082 O O   . GLU D 1 308 ? 15.798  1.218    -40.108 1.00 32.86  ? 309 GLU D O   1 
ATOM   10083 C CB  . GLU D 1 308 ? 18.419  3.022    -40.729 1.00 38.12  ? 309 GLU D CB  1 
ATOM   10084 C CG  . GLU D 1 308 ? 18.897  4.306    -41.384 1.00 42.62  ? 309 GLU D CG  1 
ATOM   10085 C CD  . GLU D 1 308 ? 20.149  4.097    -42.218 1.00 46.48  ? 309 GLU D CD  1 
ATOM   10086 O OE1 . GLU D 1 308 ? 20.908  5.073    -42.403 1.00 48.41  ? 309 GLU D OE1 1 
ATOM   10087 O OE2 . GLU D 1 308 ? 20.374  2.957    -42.689 1.00 47.29  ? 309 GLU D OE2 1 
ATOM   10088 N N   . SER D 1 309 ? 17.193  1.284    -38.330 1.00 32.41  ? 310 SER D N   1 
ATOM   10089 C CA  . SER D 1 309 ? 16.739  0.010    -37.790 1.00 31.14  ? 310 SER D CA  1 
ATOM   10090 C C   . SER D 1 309 ? 15.279  0.091    -37.364 1.00 32.61  ? 310 SER D C   1 
ATOM   10091 O O   . SER D 1 309 ? 14.499  -0.822   -37.633 1.00 33.76  ? 310 SER D O   1 
ATOM   10092 C CB  . SER D 1 309 ? 17.607  -0.429   -36.602 1.00 30.77  ? 310 SER D CB  1 
ATOM   10093 O OG  . SER D 1 309 ? 17.036  -1.556   -35.958 1.00 30.04  ? 310 SER D OG  1 
ATOM   10094 N N   . HIS D 1 310 ? 14.902  1.183    -36.703 1.00 33.14  ? 311 HIS D N   1 
ATOM   10095 C CA  . HIS D 1 310 ? 13.532  1.306    -36.217 1.00 33.29  ? 311 HIS D CA  1 
ATOM   10096 C C   . HIS D 1 310 ? 12.532  1.392    -37.362 1.00 34.99  ? 311 HIS D C   1 
ATOM   10097 O O   . HIS D 1 310 ? 11.475  0.766    -37.310 1.00 36.33  ? 311 HIS D O   1 
ATOM   10098 C CB  . HIS D 1 310 ? 13.360  2.528    -35.313 1.00 32.73  ? 311 HIS D CB  1 
ATOM   10099 C CG  . HIS D 1 310 ? 11.962  2.689    -34.803 1.00 33.85  ? 311 HIS D CG  1 
ATOM   10100 N ND1 . HIS D 1 310 ? 11.460  1.940    -33.760 1.00 33.47  ? 311 HIS D ND1 1 
ATOM   10101 C CD2 . HIS D 1 310 ? 10.944  3.478    -35.222 1.00 35.73  ? 311 HIS D CD2 1 
ATOM   10102 C CE1 . HIS D 1 310 ? 10.201  2.277    -33.543 1.00 33.95  ? 311 HIS D CE1 1 
ATOM   10103 N NE2 . HIS D 1 310 ? 9.864   3.209    -34.416 1.00 35.28  ? 311 HIS D NE2 1 
ATOM   10104 N N   . ARG D 1 311 ? 12.863  2.179    -38.383 1.00 35.09  ? 312 ARG D N   1 
ATOM   10105 C CA  . ARG D 1 311 ? 11.996  2.318    -39.550 1.00 38.44  ? 312 ARG D CA  1 
ATOM   10106 C C   . ARG D 1 311 ? 11.798  0.967    -40.214 1.00 36.34  ? 312 ARG D C   1 
ATOM   10107 O O   . ARG D 1 311 ? 10.700  0.629    -40.649 1.00 37.18  ? 312 ARG D O   1 
ATOM   10108 C CB  . ARG D 1 311 ? 12.579  3.314    -40.557 1.00 42.06  ? 312 ARG D CB  1 
ATOM   10109 C CG  . ARG D 1 311 ? 12.578  4.755    -40.091 1.00 47.24  ? 312 ARG D CG  1 
ATOM   10110 C CD  . ARG D 1 311 ? 12.657  5.713    -41.274 1.00 52.94  ? 312 ARG D CD  1 
ATOM   10111 N NE  . ARG D 1 311 ? 13.837  6.569    -41.204 1.00 57.14  ? 312 ARG D NE  1 
ATOM   10112 C CZ  . ARG D 1 311 ? 14.962  6.353    -41.880 1.00 59.47  ? 312 ARG D CZ  1 
ATOM   10113 N NH1 . ARG D 1 311 ? 15.064  5.306    -42.688 1.00 59.78  ? 312 ARG D NH1 1 
ATOM   10114 N NH2 . ARG D 1 311 ? 15.986  7.188    -41.749 1.00 60.31  ? 312 ARG D NH2 1 
ATOM   10115 N N   . SER D 1 312 ? 12.875  0.194    -40.281 1.00 34.30  ? 313 SER D N   1 
ATOM   10116 C CA  . SER D 1 312 ? 12.813  -1.139   -40.859 1.00 34.14  ? 313 SER D CA  1 
ATOM   10117 C C   . SER D 1 312 ? 11.921  -2.042   -40.016 1.00 33.86  ? 313 SER D C   1 
ATOM   10118 O O   . SER D 1 312 ? 11.126  -2.816   -40.546 1.00 33.21  ? 313 SER D O   1 
ATOM   10119 C CB  . SER D 1 312 ? 14.214  -1.730   -40.984 1.00 33.88  ? 313 SER D CB  1 
ATOM   10120 O OG  . SER D 1 312 ? 14.179  -3.009   -41.581 1.00 36.72  ? 313 SER D OG  1 
ATOM   10121 N N   . LEU D 1 313 ? 12.047  -1.929   -38.698 1.00 32.69  ? 314 LEU D N   1 
ATOM   10122 C CA  . LEU D 1 313 ? 11.209  -2.702   -37.788 1.00 32.67  ? 314 LEU D CA  1 
ATOM   10123 C C   . LEU D 1 313 ? 9.747   -2.257   -37.854 1.00 34.57  ? 314 LEU D C   1 
ATOM   10124 O O   . LEU D 1 313 ? 8.831   -3.070   -37.750 1.00 34.75  ? 314 LEU D O   1 
ATOM   10125 C CB  . LEU D 1 313 ? 11.738  -2.581   -36.354 1.00 30.57  ? 314 LEU D CB  1 
ATOM   10126 C CG  . LEU D 1 313 ? 13.012  -3.365   -36.043 1.00 29.43  ? 314 LEU D CG  1 
ATOM   10127 C CD1 . LEU D 1 313 ? 13.665  -2.876   -34.738 1.00 24.43  ? 314 LEU D CD1 1 
ATOM   10128 C CD2 . LEU D 1 313 ? 12.672  -4.841   -35.952 1.00 30.00  ? 314 LEU D CD2 1 
ATOM   10129 N N   . ARG D 1 314 ? 9.538   -0.957   -38.028 1.00 36.83  ? 315 ARG D N   1 
ATOM   10130 C CA  . ARG D 1 314 ? 8.193   -0.390   -38.035 1.00 39.95  ? 315 ARG D CA  1 
ATOM   10131 C C   . ARG D 1 314 ? 7.423   -0.730   -39.305 1.00 41.30  ? 315 ARG D C   1 
ATOM   10132 O O   . ARG D 1 314 ? 6.292   -1.200   -39.241 1.00 41.89  ? 315 ARG D O   1 
ATOM   10133 C CB  . ARG D 1 314 ? 8.262   1.128    -37.874 1.00 42.28  ? 315 ARG D CB  1 
ATOM   10134 C CG  . ARG D 1 314 ? 6.911   1.820    -37.806 1.00 44.82  ? 315 ARG D CG  1 
ATOM   10135 C CD  . ARG D 1 314 ? 7.096   3.315    -37.971 1.00 47.19  ? 315 ARG D CD  1 
ATOM   10136 N NE  . ARG D 1 314 ? 7.722   3.627    -39.254 1.00 49.90  ? 315 ARG D NE  1 
ATOM   10137 C CZ  . ARG D 1 314 ? 8.407   4.738    -39.509 1.00 51.09  ? 315 ARG D CZ  1 
ATOM   10138 N NH1 . ARG D 1 314 ? 8.572   5.653    -38.565 1.00 51.51  ? 315 ARG D NH1 1 
ATOM   10139 N NH2 . ARG D 1 314 ? 8.936   4.931    -40.711 1.00 51.82  ? 315 ARG D NH2 1 
ATOM   10140 N N   . ASP D 1 315 ? 8.047   -0.489   -40.453 1.00 41.28  ? 316 ASP D N   1 
ATOM   10141 C CA  . ASP D 1 315 ? 7.374   -0.602   -41.742 1.00 44.30  ? 316 ASP D CA  1 
ATOM   10142 C C   . ASP D 1 315 ? 7.571   -1.969   -42.375 1.00 43.99  ? 316 ASP D C   1 
ATOM   10143 O O   . ASP D 1 315 ? 6.635   -2.546   -42.922 1.00 44.47  ? 316 ASP D O   1 
ATOM   10144 C CB  . ASP D 1 315 ? 7.877   0.481    -42.696 1.00 45.17  ? 316 ASP D CB  1 
ATOM   10145 C CG  . ASP D 1 315 ? 7.740   1.866    -42.121 1.00 47.88  ? 316 ASP D CG  1 
ATOM   10146 O OD1 . ASP D 1 315 ? 6.834   2.080    -41.294 1.00 50.12  ? 316 ASP D OD1 1 
ATOM   10147 O OD2 . ASP D 1 315 ? 8.540   2.744    -42.490 1.00 48.84  ? 316 ASP D OD2 1 
ATOM   10148 N N   . ASP D 1 316 ? 8.790   -2.491   -42.316 1.00 42.71  ? 317 ASP D N   1 
ATOM   10149 C CA  . ASP D 1 316 ? 9.014   -3.791   -42.918 1.00 42.62  ? 317 ASP D CA  1 
ATOM   10150 C C   . ASP D 1 316 ? 8.586   -4.917   -41.982 1.00 44.91  ? 317 ASP D C   1 
ATOM   10151 O O   . ASP D 1 316 ? 7.592   -5.581   -42.280 1.00 47.26  ? 317 ASP D O   1 
ATOM   10152 C CB  . ASP D 1 316 ? 10.477  -3.940   -43.393 1.00 40.70  ? 317 ASP D CB  1 
ATOM   10153 C CG  . ASP D 1 316 ? 10.686  -3.376   -44.803 1.00 44.72  ? 317 ASP D CG  1 
ATOM   10154 O OD1 . ASP D 1 316 ? 9.683   -2.988   -45.432 1.00 45.67  ? 317 ASP D OD1 1 
ATOM   10155 O OD2 . ASP D 1 316 ? 11.837  -3.306   -45.280 1.00 45.80  ? 317 ASP D OD2 1 
ATOM   10156 N N   . TYR D 1 317 ? 9.322   -5.183   -40.898 1.00 43.86  ? 318 TYR D N   1 
ATOM   10157 C CA  . TYR D 1 317 ? 9.027   -6.370   -40.073 1.00 44.12  ? 318 TYR D CA  1 
ATOM   10158 C C   . TYR D 1 317 ? 7.692   -6.175   -39.355 1.00 42.73  ? 318 TYR D C   1 
ATOM   10159 O O   . TYR D 1 317 ? 7.014   -7.144   -39.003 1.00 41.16  ? 318 TYR D O   1 
ATOM   10160 C CB  . TYR D 1 317 ? 10.157  -6.680   -39.079 1.00 45.70  ? 318 TYR D CB  1 
ATOM   10161 C CG  . TYR D 1 317 ? 10.445  -8.175   -38.919 1.00 49.92  ? 318 TYR D CG  1 
ATOM   10162 C CD1 . TYR D 1 317 ? 10.609  -8.990   -40.035 1.00 52.87  ? 318 TYR D CD1 1 
ATOM   10163 C CD2 . TYR D 1 317 ? 10.571  -8.761   -37.661 1.00 51.73  ? 318 TYR D CD2 1 
ATOM   10164 C CE1 . TYR D 1 317 ? 10.861  -10.342  -39.918 1.00 55.10  ? 318 TYR D CE1 1 
ATOM   10165 C CE2 . TYR D 1 317 ? 10.829  -10.125  -37.534 1.00 54.05  ? 318 TYR D CE2 1 
ATOM   10166 C CZ  . TYR D 1 317 ? 10.974  -10.906  -38.669 1.00 55.94  ? 318 TYR D CZ  1 
ATOM   10167 O OH  . TYR D 1 317 ? 11.226  -12.255  -38.559 1.00 58.28  ? 318 TYR D OH  1 
ATOM   10168 N N   . GLU D 1 318 ? 7.288   -4.914   -39.222 1.00 43.55  ? 319 GLU D N   1 
ATOM   10169 C CA  . GLU D 1 318 ? 5.996   -4.549   -38.647 1.00 44.54  ? 319 GLU D CA  1 
ATOM   10170 C C   . GLU D 1 318 ? 5.812   -5.156   -37.255 1.00 42.12  ? 319 GLU D C   1 
ATOM   10171 O O   . GLU D 1 318 ? 4.811   -5.823   -36.988 1.00 43.17  ? 319 GLU D O   1 
ATOM   10172 C CB  . GLU D 1 318 ? 4.861   -4.977   -39.583 1.00 48.15  ? 319 GLU D CB  1 
ATOM   10173 C CG  . GLU D 1 318 ? 4.744   -4.104   -40.835 1.00 51.03  ? 319 GLU D CG  1 
ATOM   10174 C CD  . GLU D 1 318 ? 3.587   -4.489   -41.751 1.00 54.63  ? 319 GLU D CD  1 
ATOM   10175 O OE1 . GLU D 1 318 ? 3.556   -5.638   -42.241 1.00 56.11  ? 319 GLU D OE1 1 
ATOM   10176 O OE2 . GLU D 1 318 ? 2.703   -3.634   -41.973 1.00 55.18  ? 319 GLU D OE2 1 
ATOM   10177 N N   . VAL D 1 319 ? 6.787   -4.927   -36.375 1.00 37.75  ? 320 VAL D N   1 
ATOM   10178 C CA  . VAL D 1 319 ? 6.670   -5.361   -34.979 1.00 36.13  ? 320 VAL D CA  1 
ATOM   10179 C C   . VAL D 1 319 ? 6.742   -4.183   -34.011 1.00 34.57  ? 320 VAL D C   1 
ATOM   10180 O O   . VAL D 1 319 ? 6.958   -4.368   -32.808 1.00 32.42  ? 320 VAL D O   1 
ATOM   10181 C CB  . VAL D 1 319 ? 7.762   -6.381   -34.588 1.00 34.45  ? 320 VAL D CB  1 
ATOM   10182 C CG1 . VAL D 1 319 ? 7.629   -7.656   -35.417 1.00 34.57  ? 320 VAL D CG1 1 
ATOM   10183 C CG2 . VAL D 1 319 ? 9.150   -5.767   -34.726 1.00 33.48  ? 320 VAL D CG2 1 
ATOM   10184 N N   . SER D 1 320 ? 6.556   -2.976   -34.534 1.00 34.80  ? 321 SER D N   1 
ATOM   10185 C CA  . SER D 1 320 ? 6.476   -1.793   -33.690 1.00 37.35  ? 321 SER D CA  1 
ATOM   10186 C C   . SER D 1 320 ? 5.019   -1.548   -33.318 1.00 39.56  ? 321 SER D C   1 
ATOM   10187 O O   . SER D 1 320 ? 4.184   -2.433   -33.469 1.00 40.47  ? 321 SER D O   1 
ATOM   10188 C CB  . SER D 1 320 ? 7.071   -0.572   -34.396 1.00 39.33  ? 321 SER D CB  1 
ATOM   10189 O OG  . SER D 1 320 ? 7.141   0.542    -33.522 1.00 40.74  ? 321 SER D OG  1 
ATOM   10190 N N   . CYS D 1 321 ? 4.724   -0.351   -32.826 1.00 41.13  ? 322 CYS D N   1 
ATOM   10191 C CA  . CYS D 1 321 ? 3.358   0.031    -32.477 1.00 43.50  ? 322 CYS D CA  1 
ATOM   10192 C C   . CYS D 1 321 ? 3.325   1.548    -32.293 1.00 45.70  ? 322 CYS D C   1 
ATOM   10193 O O   . CYS D 1 321 ? 4.382   2.167    -32.157 1.00 44.55  ? 322 CYS D O   1 
ATOM   10194 C CB  . CYS D 1 321 ? 2.876   -0.710   -31.213 1.00 42.92  ? 322 CYS D CB  1 
ATOM   10195 S SG  . CYS D 1 321 ? 3.744   -0.348   -29.659 1.00 48.75  ? 322 CYS D SG  1 
ATOM   10196 N N   . PRO D 1 322 ? 2.123   2.155    -32.329 1.00 49.20  ? 323 PRO D N   1 
ATOM   10197 C CA  . PRO D 1 322 ? 1.986   3.606    -32.148 1.00 51.51  ? 323 PRO D CA  1 
ATOM   10198 C C   . PRO D 1 322 ? 2.753   4.158    -30.946 1.00 51.60  ? 323 PRO D C   1 
ATOM   10199 O O   . PRO D 1 322 ? 3.409   5.192    -31.077 1.00 52.76  ? 323 PRO D O   1 
ATOM   10200 C CB  . PRO D 1 322 ? 0.481   3.784    -31.956 1.00 53.18  ? 323 PRO D CB  1 
ATOM   10201 C CG  . PRO D 1 322 ? -0.106  2.713    -32.801 1.00 53.15  ? 323 PRO D CG  1 
ATOM   10202 C CD  . PRO D 1 322 ? 0.836   1.537    -32.705 1.00 50.39  ? 323 PRO D CD  1 
ATOM   10203 N N   . GLU D 1 323 ? 2.676   3.478    -29.805 1.00 50.35  ? 324 GLU D N   1 
ATOM   10204 C CA  . GLU D 1 323 ? 3.398   3.913    -28.614 1.00 49.44  ? 324 GLU D CA  1 
ATOM   10205 C C   . GLU D 1 323 ? 4.901   3.972    -28.859 1.00 47.80  ? 324 GLU D C   1 
ATOM   10206 O O   . GLU D 1 323 ? 5.550   4.962    -28.521 1.00 49.32  ? 324 GLU D O   1 
ATOM   10207 C CB  . GLU D 1 323 ? 3.105   2.991    -27.429 1.00 48.53  ? 324 GLU D CB  1 
ATOM   10208 C CG  . GLU D 1 323 ? 1.690   3.099    -26.880 1.00 50.80  ? 324 GLU D CG  1 
ATOM   10209 C CD  . GLU D 1 323 ? 0.736   2.109    -27.515 1.00 50.44  ? 324 GLU D CD  1 
ATOM   10210 O OE1 . GLU D 1 323 ? 1.063   1.569    -28.592 1.00 49.32  ? 324 GLU D OE1 1 
ATOM   10211 O OE2 . GLU D 1 323 ? -0.340  1.865    -26.931 1.00 51.39  ? 324 GLU D OE2 1 
ATOM   10212 N N   . LEU D 1 324 ? 5.453   2.913    -29.444 1.00 44.32  ? 325 LEU D N   1 
ATOM   10213 C CA  . LEU D 1 324 ? 6.892   2.849    -29.686 1.00 41.41  ? 325 LEU D CA  1 
ATOM   10214 C C   . LEU D 1 324 ? 7.323   3.916    -30.684 1.00 41.87  ? 325 LEU D C   1 
ATOM   10215 O O   . LEU D 1 324 ? 8.378   4.528    -30.540 1.00 42.27  ? 325 LEU D O   1 
ATOM   10216 C CB  . LEU D 1 324 ? 7.296   1.460    -30.192 1.00 38.17  ? 325 LEU D CB  1 
ATOM   10217 C CG  . LEU D 1 324 ? 7.298   0.316    -29.175 1.00 35.01  ? 325 LEU D CG  1 
ATOM   10218 C CD1 . LEU D 1 324 ? 7.461   -1.028   -29.884 1.00 33.13  ? 325 LEU D CD1 1 
ATOM   10219 C CD2 . LEU D 1 324 ? 8.394   0.521    -28.133 1.00 32.38  ? 325 LEU D CD2 1 
ATOM   10220 N N   . ASP D 1 325 ? 6.497   4.138    -31.697 1.00 41.96  ? 326 ASP D N   1 
ATOM   10221 C CA  . ASP D 1 325 ? 6.819   5.109    -32.729 1.00 43.28  ? 326 ASP D CA  1 
ATOM   10222 C C   . ASP D 1 325 ? 6.756   6.533    -32.181 1.00 45.11  ? 326 ASP D C   1 
ATOM   10223 O O   . ASP D 1 325 ? 7.518   7.402    -32.603 1.00 45.86  ? 326 ASP D O   1 
ATOM   10224 C CB  . ASP D 1 325 ? 5.876   4.936    -33.919 1.00 44.68  ? 326 ASP D CB  1 
ATOM   10225 C CG  . ASP D 1 325 ? 6.009   3.569    -34.558 1.00 44.03  ? 326 ASP D CG  1 
ATOM   10226 O OD1 . ASP D 1 325 ? 7.106   2.975    -34.464 1.00 42.14  ? 326 ASP D OD1 1 
ATOM   10227 O OD2 . ASP D 1 325 ? 5.022   3.082    -35.144 1.00 46.13  ? 326 ASP D OD2 1 
ATOM   10228 N N   . GLN D 1 326 ? 5.856   6.764    -31.232 1.00 46.22  ? 327 GLN D N   1 
ATOM   10229 C CA  . GLN D 1 326 ? 5.741   8.069    -30.596 1.00 49.01  ? 327 GLN D CA  1 
ATOM   10230 C C   . GLN D 1 326 ? 6.968   8.349    -29.736 1.00 49.47  ? 327 GLN D C   1 
ATOM   10231 O O   . GLN D 1 326 ? 7.521   9.450    -29.761 1.00 50.94  ? 327 GLN D O   1 
ATOM   10232 C CB  . GLN D 1 326 ? 4.468   8.148    -29.750 1.00 50.56  ? 327 GLN D CB  1 
ATOM   10233 N N   . LEU D 1 327 ? 7.396   7.341    -28.985 1.00 47.89  ? 328 LEU D N   1 
ATOM   10234 C CA  . LEU D 1 327 ? 8.556   7.473    -28.113 1.00 46.65  ? 328 LEU D CA  1 
ATOM   10235 C C   . LEU D 1 327 ? 9.826   7.756    -28.913 1.00 45.18  ? 328 LEU D C   1 
ATOM   10236 O O   . LEU D 1 327 ? 10.639  8.596    -28.526 1.00 47.16  ? 328 LEU D O   1 
ATOM   10237 C CB  . LEU D 1 327 ? 8.732   6.210    -27.269 1.00 45.38  ? 328 LEU D CB  1 
ATOM   10238 C CG  . LEU D 1 327 ? 7.634   5.915    -26.245 1.00 46.35  ? 328 LEU D CG  1 
ATOM   10239 C CD1 . LEU D 1 327 ? 7.874   4.570    -25.574 1.00 44.05  ? 328 LEU D CD1 1 
ATOM   10240 C CD2 . LEU D 1 327 ? 7.550   7.025    -25.208 1.00 48.44  ? 328 LEU D CD2 1 
ATOM   10241 N N   . VAL D 1 328 ? 9.995   7.054    -30.029 1.00 41.61  ? 329 VAL D N   1 
ATOM   10242 C CA  . VAL D 1 328 ? 11.145  7.281    -30.896 1.00 39.81  ? 329 VAL D CA  1 
ATOM   10243 C C   . VAL D 1 328 ? 11.126  8.698    -31.471 1.00 42.27  ? 329 VAL D C   1 
ATOM   10244 O O   . VAL D 1 328 ? 12.125  9.412    -31.406 1.00 42.53  ? 329 VAL D O   1 
ATOM   10245 C CB  . VAL D 1 328 ? 11.194  6.256    -32.052 1.00 37.71  ? 329 VAL D CB  1 
ATOM   10246 C CG1 . VAL D 1 328 ? 12.172  6.705    -33.132 1.00 36.41  ? 329 VAL D CG1 1 
ATOM   10247 C CG2 . VAL D 1 328 ? 11.558  4.872    -31.524 1.00 36.19  ? 329 VAL D CG2 1 
ATOM   10248 N N   . GLU D 1 329 ? 9.981   9.101    -32.017 1.00 43.54  ? 330 GLU D N   1 
ATOM   10249 C CA  . GLU D 1 329 ? 9.842   10.409   -32.658 1.00 45.81  ? 330 GLU D CA  1 
ATOM   10250 C C   . GLU D 1 329 ? 10.118  11.556   -31.688 1.00 46.77  ? 330 GLU D C   1 
ATOM   10251 O O   . GLU D 1 329 ? 10.750  12.550   -32.048 1.00 47.31  ? 330 GLU D O   1 
ATOM   10252 C CB  . GLU D 1 329 ? 8.442   10.565   -33.258 1.00 48.96  ? 330 GLU D CB  1 
ATOM   10253 C CG  . GLU D 1 329 ? 8.341   11.687   -34.279 1.00 52.54  ? 330 GLU D CG  1 
ATOM   10254 C CD  . GLU D 1 329 ? 6.969   11.781   -34.919 1.00 55.78  ? 330 GLU D CD  1 
ATOM   10255 O OE1 . GLU D 1 329 ? 5.960   11.865   -34.181 1.00 56.92  ? 330 GLU D OE1 1 
ATOM   10256 O OE2 . GLU D 1 329 ? 6.905   11.753   -36.166 1.00 56.77  ? 330 GLU D OE2 1 
ATOM   10257 N N   . ALA D 1 330 ? 9.636   11.407   -30.460 1.00 46.71  ? 331 ALA D N   1 
ATOM   10258 C CA  . ALA D 1 330 ? 9.854   12.401   -29.421 1.00 47.02  ? 331 ALA D CA  1 
ATOM   10259 C C   . ALA D 1 330 ? 11.330  12.487   -29.052 1.00 46.96  ? 331 ALA D C   1 
ATOM   10260 O O   . ALA D 1 330 ? 11.865  13.578   -28.860 1.00 49.10  ? 331 ALA D O   1 
ATOM   10261 C CB  . ALA D 1 330 ? 9.016   12.075   -28.195 1.00 46.41  ? 331 ALA D CB  1 
ATOM   10262 N N   . ALA D 1 331 ? 11.984  11.333   -28.961 1.00 44.71  ? 332 ALA D N   1 
ATOM   10263 C CA  . ALA D 1 331 ? 13.396  11.281   -28.599 1.00 44.27  ? 332 ALA D CA  1 
ATOM   10264 C C   . ALA D 1 331 ? 14.267  11.966   -29.647 1.00 45.49  ? 332 ALA D C   1 
ATOM   10265 O O   . ALA D 1 331 ? 15.204  12.687   -29.310 1.00 46.69  ? 332 ALA D O   1 
ATOM   10266 C CB  . ALA D 1 331 ? 13.841  9.836    -28.402 1.00 40.82  ? 332 ALA D CB  1 
ATOM   10267 N N   . LEU D 1 332 ? 13.945  11.753   -30.918 1.00 45.66  ? 333 LEU D N   1 
ATOM   10268 C CA  . LEU D 1 332 ? 14.743  12.303   -32.009 1.00 46.14  ? 333 LEU D CA  1 
ATOM   10269 C C   . LEU D 1 332 ? 14.554  13.813   -32.146 1.00 49.11  ? 333 LEU D C   1 
ATOM   10270 O O   . LEU D 1 332 ? 15.284  14.471   -32.888 1.00 49.54  ? 333 LEU D O   1 
ATOM   10271 C CB  . LEU D 1 332 ? 14.392  11.610   -33.330 1.00 44.73  ? 333 LEU D CB  1 
ATOM   10272 C CG  . LEU D 1 332 ? 14.590  10.093   -33.390 1.00 40.85  ? 333 LEU D CG  1 
ATOM   10273 C CD1 . LEU D 1 332 ? 14.189  9.558    -34.757 1.00 40.05  ? 333 LEU D CD1 1 
ATOM   10274 C CD2 . LEU D 1 332 ? 16.024  9.708    -33.058 1.00 38.78  ? 333 LEU D CD2 1 
ATOM   10275 N N   . ALA D 1 333 ? 13.574  14.355   -31.430 1.00 50.70  ? 334 ALA D N   1 
ATOM   10276 C CA  . ALA D 1 333 ? 13.297  15.787   -31.467 1.00 53.34  ? 334 ALA D CA  1 
ATOM   10277 C C   . ALA D 1 333 ? 14.191  16.552   -30.493 1.00 54.81  ? 334 ALA D C   1 
ATOM   10278 O O   . ALA D 1 333 ? 14.296  17.776   -30.563 1.00 56.92  ? 334 ALA D O   1 
ATOM   10279 C CB  . ALA D 1 333 ? 11.831  16.050   -31.157 1.00 54.34  ? 334 ALA D CB  1 
ATOM   10280 N N   . VAL D 1 334 ? 14.834  15.827   -29.585 1.00 53.19  ? 335 VAL D N   1 
ATOM   10281 C CA  . VAL D 1 334 ? 15.690  16.451   -28.583 1.00 53.68  ? 335 VAL D CA  1 
ATOM   10282 C C   . VAL D 1 334 ? 17.125  16.582   -29.084 1.00 54.00  ? 335 VAL D C   1 
ATOM   10283 O O   . VAL D 1 334 ? 17.714  15.608   -29.561 1.00 51.90  ? 335 VAL D O   1 
ATOM   10284 C CB  . VAL D 1 334 ? 15.685  15.653   -27.264 1.00 51.48  ? 335 VAL D CB  1 
ATOM   10285 C CG1 . VAL D 1 334 ? 16.584  16.316   -26.232 1.00 51.75  ? 335 VAL D CG1 1 
ATOM   10286 C CG2 . VAL D 1 334 ? 14.265  15.520   -26.732 1.00 52.62  ? 335 VAL D CG2 1 
ATOM   10287 N N   . PRO D 1 335 ? 17.687  17.799   -28.995 1.00 55.98  ? 336 PRO D N   1 
ATOM   10288 C CA  . PRO D 1 335 ? 19.097  18.032   -29.324 1.00 55.30  ? 336 PRO D CA  1 
ATOM   10289 C C   . PRO D 1 335 ? 20.021  17.278   -28.372 1.00 53.56  ? 336 PRO D C   1 
ATOM   10290 O O   . PRO D 1 335 ? 19.839  17.340   -27.155 1.00 53.81  ? 336 PRO D O   1 
ATOM   10291 C CB  . PRO D 1 335 ? 19.256  19.548   -29.159 1.00 57.87  ? 336 PRO D CB  1 
ATOM   10292 C CG  . PRO D 1 335 ? 17.870  20.096   -29.283 1.00 59.98  ? 336 PRO D CG  1 
ATOM   10293 C CD  . PRO D 1 335 ? 16.982  19.052   -28.678 1.00 59.24  ? 336 PRO D CD  1 
ATOM   10294 N N   . GLY D 1 336 ? 20.996  16.567   -28.923 1.00 51.93  ? 337 GLY D N   1 
ATOM   10295 C CA  . GLY D 1 336 ? 21.892  15.769   -28.110 1.00 51.69  ? 337 GLY D CA  1 
ATOM   10296 C C   . GLY D 1 336 ? 21.584  14.290   -28.225 1.00 50.23  ? 337 GLY D C   1 
ATOM   10297 O O   . GLY D 1 336 ? 22.371  13.449   -27.796 1.00 50.02  ? 337 GLY D O   1 
ATOM   10298 N N   . VAL D 1 337 ? 20.428  13.975   -28.801 1.00 49.89  ? 338 VAL D N   1 
ATOM   10299 C CA  . VAL D 1 337 ? 20.054  12.592   -29.064 1.00 47.89  ? 338 VAL D CA  1 
ATOM   10300 C C   . VAL D 1 337 ? 20.608  12.156   -30.416 1.00 48.07  ? 338 VAL D C   1 
ATOM   10301 O O   . VAL D 1 337 ? 20.344  12.796   -31.433 1.00 49.40  ? 338 VAL D O   1 
ATOM   10302 C CB  . VAL D 1 337 ? 18.523  12.403   -29.042 1.00 46.88  ? 338 VAL D CB  1 
ATOM   10303 C CG1 . VAL D 1 337 ? 18.138  11.046   -29.614 1.00 44.71  ? 338 VAL D CG1 1 
ATOM   10304 C CG2 . VAL D 1 337 ? 17.993  12.561   -27.628 1.00 47.10  ? 338 VAL D CG2 1 
ATOM   10305 N N   . TYR D 1 338 ? 21.382  11.073   -30.420 1.00 47.12  ? 339 TYR D N   1 
ATOM   10306 C CA  . TYR D 1 338 ? 22.009  10.577   -31.645 1.00 46.60  ? 339 TYR D CA  1 
ATOM   10307 C C   . TYR D 1 338 ? 21.085  9.656    -32.435 1.00 43.77  ? 339 TYR D C   1 
ATOM   10308 O O   . TYR D 1 338 ? 21.047  9.705    -33.666 1.00 43.20  ? 339 TYR D O   1 
ATOM   10309 C CB  . TYR D 1 338 ? 23.312  9.837    -31.324 1.00 47.98  ? 339 TYR D CB  1 
ATOM   10310 C CG  . TYR D 1 338 ? 24.409  10.728   -30.799 1.00 51.18  ? 339 TYR D CG  1 
ATOM   10311 C CD1 . TYR D 1 338 ? 24.965  11.717   -31.597 1.00 53.41  ? 339 TYR D CD1 1 
ATOM   10312 C CD2 . TYR D 1 338 ? 24.895  10.576   -29.510 1.00 53.02  ? 339 TYR D CD2 1 
ATOM   10313 C CE1 . TYR D 1 338 ? 25.970  12.537   -31.120 1.00 55.43  ? 339 TYR D CE1 1 
ATOM   10314 C CE2 . TYR D 1 338 ? 25.901  11.389   -29.024 1.00 54.71  ? 339 TYR D CE2 1 
ATOM   10315 C CZ  . TYR D 1 338 ? 26.435  12.368   -29.833 1.00 55.75  ? 339 TYR D CZ  1 
ATOM   10316 O OH  . TYR D 1 338 ? 27.436  13.183   -29.352 1.00 57.02  ? 339 TYR D OH  1 
ATOM   10317 N N   . GLY D 1 339 ? 20.350  8.810    -31.725 1.00 41.04  ? 340 GLY D N   1 
ATOM   10318 C CA  . GLY D 1 339 ? 19.427  7.895    -32.368 1.00 37.86  ? 340 GLY D CA  1 
ATOM   10319 C C   . GLY D 1 339 ? 18.518  7.223    -31.363 1.00 36.28  ? 340 GLY D C   1 
ATOM   10320 O O   . GLY D 1 339 ? 18.775  7.255    -30.157 1.00 36.66  ? 340 GLY D O   1 
ATOM   10321 N N   . SER D 1 340 ? 17.450  6.614    -31.861 1.00 34.13  ? 341 SER D N   1 
ATOM   10322 C CA  . SER D 1 340 ? 16.500  5.917    -31.005 1.00 34.19  ? 341 SER D CA  1 
ATOM   10323 C C   . SER D 1 340 ? 15.769  4.843    -31.806 1.00 34.06  ? 341 SER D C   1 
ATOM   10324 O O   . SER D 1 340 ? 15.521  5.010    -32.998 1.00 35.69  ? 341 SER D O   1 
ATOM   10325 C CB  . SER D 1 340 ? 15.508  6.909    -30.391 1.00 35.91  ? 341 SER D CB  1 
ATOM   10326 O OG  . SER D 1 340 ? 14.692  6.294    -29.408 1.00 36.11  ? 341 SER D OG  1 
ATOM   10327 N N   . ARG D 1 341 ? 15.432  3.737    -31.153 1.00 32.91  ? 342 ARG D N   1 
ATOM   10328 C CA  . ARG D 1 341 ? 14.715  2.650    -31.810 1.00 34.13  ? 342 ARG D CA  1 
ATOM   10329 C C   . ARG D 1 341 ? 14.004  1.786    -30.783 1.00 34.12  ? 342 ARG D C   1 
ATOM   10330 O O   . ARG D 1 341 ? 14.400  1.744    -29.620 1.00 32.14  ? 342 ARG D O   1 
ATOM   10331 C CB  . ARG D 1 341 ? 15.675  1.784    -32.634 1.00 34.81  ? 342 ARG D CB  1 
ATOM   10332 C CG  . ARG D 1 341 ? 16.744  1.094    -31.793 1.00 35.15  ? 342 ARG D CG  1 
ATOM   10333 C CD  . ARG D 1 341 ? 17.737  0.312    -32.645 1.00 34.88  ? 342 ARG D CD  1 
ATOM   10334 N NE  . ARG D 1 341 ? 17.184  -0.930   -33.186 1.00 34.43  ? 342 ARG D NE  1 
ATOM   10335 C CZ  . ARG D 1 341 ? 17.109  -2.080   -32.515 1.00 33.40  ? 342 ARG D CZ  1 
ATOM   10336 N NH1 . ARG D 1 341 ? 17.538  -2.162   -31.261 1.00 33.34  ? 342 ARG D NH1 1 
ATOM   10337 N NH2 . ARG D 1 341 ? 16.603  -3.156   -33.099 1.00 32.15  ? 342 ARG D NH2 1 
ATOM   10338 N N   . MET D 1 342 ? 12.957  1.090    -31.210 1.00 34.88  ? 343 MET D N   1 
ATOM   10339 C CA  . MET D 1 342 ? 12.375  0.054    -30.371 1.00 35.13  ? 343 MET D CA  1 
ATOM   10340 C C   . MET D 1 342 ? 13.412  -1.042   -30.163 1.00 34.70  ? 343 MET D C   1 
ATOM   10341 O O   . MET D 1 342 ? 14.297  -1.234   -30.995 1.00 35.42  ? 343 MET D O   1 
ATOM   10342 C CB  . MET D 1 342 ? 11.108  -0.524   -31.001 1.00 35.08  ? 343 MET D CB  1 
ATOM   10343 C CG  . MET D 1 342 ? 11.325  -1.100   -32.392 1.00 34.45  ? 343 MET D CG  1 
ATOM   10344 S SD  . MET D 1 342 ? 10.201  -2.464   -32.727 1.00 32.24  ? 343 MET D SD  1 
ATOM   10345 C CE  . MET D 1 342 ? 10.938  -3.747   -31.719 1.00 35.10  ? 343 MET D CE  1 
ATOM   10346 N N   . THR D 1 343 ? 13.309  -1.759   -29.053 1.00 35.04  ? 344 THR D N   1 
ATOM   10347 C CA  . THR D 1 343 ? 14.254  -2.829   -28.765 1.00 34.57  ? 344 THR D CA  1 
ATOM   10348 C C   . THR D 1 343 ? 13.525  -4.025   -28.161 1.00 34.15  ? 344 THR D C   1 
ATOM   10349 O O   . THR D 1 343 ? 12.516  -3.872   -27.474 1.00 34.31  ? 344 THR D O   1 
ATOM   10350 C CB  . THR D 1 343 ? 15.382  -2.352   -27.818 1.00 35.57  ? 344 THR D CB  1 
ATOM   10351 O OG1 . THR D 1 343 ? 16.408  -3.350   -27.746 1.00 36.01  ? 344 THR D OG1 1 
ATOM   10352 C CG2 . THR D 1 343 ? 14.844  -2.063   -26.419 1.00 35.62  ? 344 THR D CG2 1 
ATOM   10353 N N   . GLY D 1 344 ? 14.028  -5.221   -28.438 1.00 33.54  ? 345 GLY D N   1 
ATOM   10354 C CA  . GLY D 1 344 ? 13.354  -6.429   -28.014 1.00 33.40  ? 345 GLY D CA  1 
ATOM   10355 C C   . GLY D 1 344 ? 12.279  -6.882   -28.989 1.00 34.54  ? 345 GLY D C   1 
ATOM   10356 O O   . GLY D 1 344 ? 12.386  -6.675   -30.205 1.00 33.75  ? 345 GLY D O   1 
ATOM   10357 N N   . GLY D 1 345 ? 11.229  -7.486   -28.439 1.00 34.83  ? 346 GLY D N   1 
ATOM   10358 C CA  . GLY D 1 345 ? 10.204  -8.146   -29.227 1.00 35.27  ? 346 GLY D CA  1 
ATOM   10359 C C   . GLY D 1 345 ? 9.261   -7.229   -29.981 1.00 37.11  ? 346 GLY D C   1 
ATOM   10360 O O   . GLY D 1 345 ? 8.749   -7.595   -31.041 1.00 39.69  ? 346 GLY D O   1 
ATOM   10361 N N   . GLY D 1 346 ? 9.019   -6.041   -29.441 1.00 35.84  ? 347 GLY D N   1 
ATOM   10362 C CA  . GLY D 1 346 ? 8.124   -5.097   -30.080 1.00 36.58  ? 347 GLY D CA  1 
ATOM   10363 C C   . GLY D 1 346 ? 6.685   -5.246   -29.634 1.00 37.83  ? 347 GLY D C   1 
ATOM   10364 O O   . GLY D 1 346 ? 6.401   -5.965   -28.679 1.00 36.80  ? 347 GLY D O   1 
ATOM   10365 N N   . PHE D 1 347 ? 5.782   -4.566   -30.338 1.00 40.58  ? 348 PHE D N   1 
ATOM   10366 C CA  . PHE D 1 347 ? 4.372   -4.492   -29.961 1.00 42.92  ? 348 PHE D CA  1 
ATOM   10367 C C   . PHE D 1 347 ? 4.226   -3.918   -28.552 1.00 43.17  ? 348 PHE D C   1 
ATOM   10368 O O   . PHE D 1 347 ? 3.256   -4.198   -27.850 1.00 45.06  ? 348 PHE D O   1 
ATOM   10369 C CB  . PHE D 1 347 ? 3.709   -5.867   -30.047 1.00 43.79  ? 348 PHE D CB  1 
ATOM   10370 C CG  . PHE D 1 347 ? 3.845   -6.525   -31.390 1.00 45.12  ? 348 PHE D CG  1 
ATOM   10371 C CD1 . PHE D 1 347 ? 2.984   -6.198   -32.429 1.00 45.68  ? 348 PHE D CD1 1 
ATOM   10372 C CD2 . PHE D 1 347 ? 4.829   -7.475   -31.613 1.00 44.73  ? 348 PHE D CD2 1 
ATOM   10373 C CE1 . PHE D 1 347 ? 3.106   -6.803   -33.668 1.00 46.49  ? 348 PHE D CE1 1 
ATOM   10374 C CE2 . PHE D 1 347 ? 4.955   -8.085   -32.854 1.00 44.82  ? 348 PHE D CE2 1 
ATOM   10375 C CZ  . PHE D 1 347 ? 4.092   -7.747   -33.881 1.00 45.79  ? 348 PHE D CZ  1 
ATOM   10376 N N   . GLY D 1 348 ? 5.199   -3.104   -28.154 1.00 40.68  ? 349 GLY D N   1 
ATOM   10377 C CA  . GLY D 1 348 ? 5.252   -2.556   -26.812 1.00 38.03  ? 349 GLY D CA  1 
ATOM   10378 C C   . GLY D 1 348 ? 6.647   -2.724   -26.247 1.00 34.91  ? 349 GLY D C   1 
ATOM   10379 O O   . GLY D 1 348 ? 7.610   -2.888   -26.994 1.00 32.02  ? 349 GLY D O   1 
ATOM   10380 N N   . GLY D 1 349 ? 6.767   -2.699   -24.925 1.00 34.44  ? 350 GLY D N   1 
ATOM   10381 C CA  . GLY D 1 349 ? 8.072   -2.827   -24.304 1.00 32.27  ? 350 GLY D CA  1 
ATOM   10382 C C   . GLY D 1 349 ? 8.842   -1.525   -24.376 1.00 32.98  ? 350 GLY D C   1 
ATOM   10383 O O   . GLY D 1 349 ? 8.250   -0.447   -24.283 1.00 33.11  ? 350 GLY D O   1 
ATOM   10384 N N   . CYS D 1 350 ? 10.156  -1.622   -24.572 1.00 32.26  ? 351 CYS D N   1 
ATOM   10385 C CA  . CYS D 1 350 ? 11.036  -0.465   -24.455 1.00 33.51  ? 351 CYS D CA  1 
ATOM   10386 C C   . CYS D 1 350 ? 11.626  0.055    -25.770 1.00 33.46  ? 351 CYS D C   1 
ATOM   10387 O O   . CYS D 1 350 ? 11.698  -0.657   -26.773 1.00 32.54  ? 351 CYS D O   1 
ATOM   10388 C CB  . CYS D 1 350 ? 12.195  -0.788   -23.499 1.00 33.40  ? 351 CYS D CB  1 
ATOM   10389 S SG  . CYS D 1 350 ? 11.711  -1.189   -21.794 1.00 39.96  ? 351 CYS D SG  1 
ATOM   10390 N N   . THR D 1 351 ? 12.051  1.315    -25.735 1.00 34.04  ? 352 THR D N   1 
ATOM   10391 C CA  . THR D 1 351 ? 12.910  1.889    -26.762 1.00 33.14  ? 352 THR D CA  1 
ATOM   10392 C C   . THR D 1 351 ? 14.303  2.098    -26.180 1.00 34.79  ? 352 THR D C   1 
ATOM   10393 O O   . THR D 1 351 ? 14.464  2.203    -24.960 1.00 36.14  ? 352 THR D O   1 
ATOM   10394 C CB  . THR D 1 351 ? 12.378  3.239    -27.282 1.00 33.36  ? 352 THR D CB  1 
ATOM   10395 O OG1 . THR D 1 351 ? 12.536  4.240    -26.265 1.00 34.35  ? 352 THR D OG1 1 
ATOM   10396 C CG2 . THR D 1 351 ? 10.911  3.131    -27.662 1.00 32.86  ? 352 THR D CG2 1 
ATOM   10397 N N   . VAL D 1 352 ? 15.309  2.157    -27.045 1.00 34.15  ? 353 VAL D N   1 
ATOM   10398 C CA  . VAL D 1 352 ? 16.658  2.459    -26.596 1.00 33.40  ? 353 VAL D CA  1 
ATOM   10399 C C   . VAL D 1 352 ? 17.175  3.688    -27.345 1.00 35.54  ? 353 VAL D C   1 
ATOM   10400 O O   . VAL D 1 352 ? 17.026  3.809    -28.562 1.00 35.83  ? 353 VAL D O   1 
ATOM   10401 C CB  . VAL D 1 352 ? 17.614  1.250    -26.778 1.00 32.33  ? 353 VAL D CB  1 
ATOM   10402 C CG1 . VAL D 1 352 ? 17.739  0.850    -28.237 1.00 29.96  ? 353 VAL D CG1 1 
ATOM   10403 C CG2 . VAL D 1 352 ? 18.978  1.557    -26.186 1.00 33.21  ? 353 VAL D CG2 1 
ATOM   10404 N N   . THR D 1 353 ? 17.750  4.619    -26.595 1.00 36.28  ? 354 THR D N   1 
ATOM   10405 C CA  . THR D 1 353 ? 18.167  5.897    -27.147 1.00 36.22  ? 354 THR D CA  1 
ATOM   10406 C C   . THR D 1 353 ? 19.630  6.155    -26.823 1.00 35.55  ? 354 THR D C   1 
ATOM   10407 O O   . THR D 1 353 ? 20.035  6.063    -25.668 1.00 36.62  ? 354 THR D O   1 
ATOM   10408 C CB  . THR D 1 353 ? 17.305  7.055    -26.592 1.00 38.15  ? 354 THR D CB  1 
ATOM   10409 O OG1 . THR D 1 353 ? 15.932  6.865    -26.963 1.00 38.96  ? 354 THR D OG1 1 
ATOM   10410 C CG2 . THR D 1 353 ? 17.788  8.391    -27.126 1.00 38.76  ? 354 THR D CG2 1 
ATOM   10411 N N   . LEU D 1 354 ? 20.422  6.456    -27.847 1.00 34.73  ? 355 LEU D N   1 
ATOM   10412 C CA  . LEU D 1 354 ? 21.803  6.870    -27.651 1.00 36.21  ? 355 LEU D CA  1 
ATOM   10413 C C   . LEU D 1 354 ? 21.858  8.390    -27.636 1.00 39.29  ? 355 LEU D C   1 
ATOM   10414 O O   . LEU D 1 354 ? 21.406  9.037    -28.579 1.00 38.85  ? 355 LEU D O   1 
ATOM   10415 C CB  . LEU D 1 354 ? 22.710  6.313    -28.748 1.00 35.19  ? 355 LEU D CB  1 
ATOM   10416 C CG  . LEU D 1 354 ? 24.193  6.670    -28.600 1.00 35.48  ? 355 LEU D CG  1 
ATOM   10417 C CD1 . LEU D 1 354 ? 24.800  5.977    -27.389 1.00 35.85  ? 355 LEU D CD1 1 
ATOM   10418 C CD2 . LEU D 1 354 ? 24.971  6.322    -29.857 1.00 35.26  ? 355 LEU D CD2 1 
ATOM   10419 N N   . LEU D 1 355 ? 22.411  8.958    -26.567 1.00 41.61  ? 356 LEU D N   1 
ATOM   10420 C CA  . LEU D 1 355 ? 22.400  10.406   -26.399 1.00 44.43  ? 356 LEU D CA  1 
ATOM   10421 C C   . LEU D 1 355 ? 23.508  10.911   -25.480 1.00 45.79  ? 356 LEU D C   1 
ATOM   10422 O O   . LEU D 1 355 ? 24.043  10.167   -24.658 1.00 43.77  ? 356 LEU D O   1 
ATOM   10423 C CB  . LEU D 1 355 ? 21.046  10.867   -25.850 1.00 46.51  ? 356 LEU D CB  1 
ATOM   10424 C CG  . LEU D 1 355 ? 20.791  10.723   -24.343 1.00 48.44  ? 356 LEU D CG  1 
ATOM   10425 C CD1 . LEU D 1 355 ? 19.498  11.421   -23.958 1.00 49.85  ? 356 LEU D CD1 1 
ATOM   10426 C CD2 . LEU D 1 355 ? 20.749  9.265    -23.905 1.00 48.12  ? 356 LEU D CD2 1 
ATOM   10427 N N   . GLU D 1 356 ? 23.846  12.186   -25.635 1.00 48.44  ? 357 GLU D N   1 
ATOM   10428 C CA  . GLU D 1 356 ? 24.715  12.864   -24.689 1.00 51.72  ? 357 GLU D CA  1 
ATOM   10429 C C   . GLU D 1 356 ? 24.025  12.872   -23.333 1.00 51.66  ? 357 GLU D C   1 
ATOM   10430 O O   . GLU D 1 356 ? 22.863  13.262   -23.227 1.00 52.02  ? 357 GLU D O   1 
ATOM   10431 C CB  . GLU D 1 356 ? 25.024  14.286   -25.159 1.00 56.39  ? 357 GLU D CB  1 
ATOM   10432 C CG  . GLU D 1 356 ? 25.772  14.339   -26.483 1.00 58.95  ? 357 GLU D CG  1 
ATOM   10433 C CD  . GLU D 1 356 ? 25.811  15.731   -27.083 1.00 63.96  ? 357 GLU D CD  1 
ATOM   10434 O OE1 . GLU D 1 356 ? 25.132  16.633   -26.547 1.00 67.02  ? 357 GLU D OE1 1 
ATOM   10435 O OE2 . GLU D 1 356 ? 26.520  15.922   -28.095 1.00 64.78  ? 357 GLU D OE2 1 
ATOM   10436 N N   . ALA D 1 357 ? 24.740  12.424   -22.305 1.00 51.25  ? 358 ALA D N   1 
ATOM   10437 C CA  . ALA D 1 357 ? 24.179  12.298   -20.962 1.00 52.70  ? 358 ALA D CA  1 
ATOM   10438 C C   . ALA D 1 357 ? 23.604  13.616   -20.449 1.00 53.83  ? 358 ALA D C   1 
ATOM   10439 O O   . ALA D 1 357 ? 22.677  13.622   -19.639 1.00 54.15  ? 358 ALA D O   1 
ATOM   10440 C CB  . ALA D 1 357 ? 25.237  11.779   -19.997 1.00 53.70  ? 358 ALA D CB  1 
ATOM   10441 N N   . SER D 1 358 ? 24.155  14.727   -20.929 1.00 54.63  ? 359 SER D N   1 
ATOM   10442 C CA  . SER D 1 358 ? 23.705  16.052   -20.512 1.00 57.30  ? 359 SER D CA  1 
ATOM   10443 C C   . SER D 1 358 ? 22.369  16.424   -21.152 1.00 56.83  ? 359 SER D C   1 
ATOM   10444 O O   . SER D 1 358 ? 21.691  17.349   -20.702 1.00 58.95  ? 359 SER D O   1 
ATOM   10445 C CB  . SER D 1 358 ? 24.759  17.104   -20.859 1.00 58.57  ? 359 SER D CB  1 
ATOM   10446 O OG  . SER D 1 358 ? 25.032  17.103   -22.249 1.00 57.37  ? 359 SER D OG  1 
ATOM   10447 N N   . ALA D 1 359 ? 21.997  15.704   -22.205 1.00 53.42  ? 360 ALA D N   1 
ATOM   10448 C CA  . ALA D 1 359 ? 20.736  15.963   -22.890 1.00 53.74  ? 360 ALA D CA  1 
ATOM   10449 C C   . ALA D 1 359 ? 19.604  15.150   -22.270 1.00 53.56  ? 360 ALA D C   1 
ATOM   10450 O O   . ALA D 1 359 ? 18.436  15.325   -22.620 1.00 54.13  ? 360 ALA D O   1 
ATOM   10451 C CB  . ALA D 1 359 ? 20.865  15.651   -24.373 1.00 51.80  ? 360 ALA D CB  1 
ATOM   10452 N N   . ALA D 1 360 ? 19.961  14.272   -21.337 1.00 52.62  ? 361 ALA D N   1 
ATOM   10453 C CA  . ALA D 1 360 ? 19.021  13.304   -20.774 1.00 51.33  ? 361 ALA D CA  1 
ATOM   10454 C C   . ALA D 1 360 ? 17.842  13.911   -19.998 1.00 53.04  ? 361 ALA D C   1 
ATOM   10455 O O   . ALA D 1 360 ? 16.713  13.452   -20.170 1.00 53.18  ? 361 ALA D O   1 
ATOM   10456 C CB  . ALA D 1 360 ? 19.770  12.309   -19.888 1.00 50.35  ? 361 ALA D CB  1 
ATOM   10457 N N   . PRO D 1 361 ? 18.086  14.921   -19.133 1.00 54.43  ? 362 PRO D N   1 
ATOM   10458 C CA  . PRO D 1 361 ? 16.922  15.487   -18.437 1.00 55.56  ? 362 PRO D CA  1 
ATOM   10459 C C   . PRO D 1 361 ? 15.914  16.112   -19.395 1.00 55.93  ? 362 PRO D C   1 
ATOM   10460 O O   . PRO D 1 361 ? 14.707  15.996   -19.179 1.00 56.47  ? 362 PRO D O   1 
ATOM   10461 C CB  . PRO D 1 361 ? 17.540  16.556   -17.528 1.00 58.55  ? 362 PRO D CB  1 
ATOM   10462 C CG  . PRO D 1 361 ? 18.938  16.115   -17.327 1.00 57.60  ? 362 PRO D CG  1 
ATOM   10463 C CD  . PRO D 1 361 ? 19.347  15.496   -18.628 1.00 55.30  ? 362 PRO D CD  1 
ATOM   10464 N N   . HIS D 1 362 ? 16.409  16.767   -20.439 1.00 56.57  ? 363 HIS D N   1 
ATOM   10465 C CA  . HIS D 1 362 ? 15.540  17.315   -21.472 1.00 59.30  ? 363 HIS D CA  1 
ATOM   10466 C C   . HIS D 1 362 ? 14.860  16.184   -22.240 1.00 56.81  ? 363 HIS D C   1 
ATOM   10467 O O   . HIS D 1 362 ? 13.687  16.279   -22.601 1.00 58.18  ? 363 HIS D O   1 
ATOM   10468 C CB  . HIS D 1 362 ? 16.331  18.208   -22.431 1.00 61.96  ? 363 HIS D CB  1 
ATOM   10469 C CG  . HIS D 1 362 ? 15.484  18.896   -23.457 1.00 65.33  ? 363 HIS D CG  1 
ATOM   10470 N ND1 . HIS D 1 362 ? 15.998  19.393   -24.635 1.00 66.29  ? 363 HIS D ND1 1 
ATOM   10471 C CD2 . HIS D 1 362 ? 14.158  19.173   -23.479 1.00 67.30  ? 363 HIS D CD2 1 
ATOM   10472 C CE1 . HIS D 1 362 ? 15.025  19.945   -25.340 1.00 67.73  ? 363 HIS D CE1 1 
ATOM   10473 N NE2 . HIS D 1 362 ? 13.899  19.824   -24.661 1.00 68.48  ? 363 HIS D NE2 1 
ATOM   10474 N N   . ALA D 1 363 ? 15.611  15.114   -22.485 1.00 53.51  ? 364 ALA D N   1 
ATOM   10475 C CA  . ALA D 1 363 ? 15.084  13.950   -23.189 1.00 50.94  ? 364 ALA D CA  1 
ATOM   10476 C C   . ALA D 1 363 ? 13.964  13.309   -22.384 1.00 52.43  ? 364 ALA D C   1 
ATOM   10477 O O   . ALA D 1 363 ? 12.882  13.057   -22.900 1.00 52.63  ? 364 ALA D O   1 
ATOM   10478 C CB  . ALA D 1 363 ? 16.188  12.945   -23.458 1.00 46.90  ? 364 ALA D CB  1 
ATOM   10479 N N   . MET D 1 364 ? 14.228  13.063   -21.106 1.00 54.17  ? 365 MET D N   1 
ATOM   10480 C CA  . MET D 1 364 ? 13.241  12.446   -20.230 1.00 55.91  ? 365 MET D CA  1 
ATOM   10481 C C   . MET D 1 364 ? 12.064  13.362   -19.894 1.00 61.44  ? 365 MET D C   1 
ATOM   10482 O O   . MET D 1 364 ? 11.074  12.909   -19.305 1.00 64.61  ? 365 MET D O   1 
ATOM   10483 C CB  . MET D 1 364 ? 13.897  11.971   -18.937 1.00 54.92  ? 365 MET D CB  1 
ATOM   10484 C CG  . MET D 1 364 ? 14.688  10.672   -19.062 1.00 52.17  ? 365 MET D CG  1 
ATOM   10485 S SD  . MET D 1 364 ? 15.491  10.215   -17.511 1.00 64.39  ? 365 MET D SD  1 
ATOM   10486 C CE  . MET D 1 364 ? 14.118  10.401   -16.376 1.00 74.31  ? 365 MET D CE  1 
ATOM   10487 N N   . ARG D 1 365 ? 12.128  14.620   -20.322 1.00 62.12  ? 366 ARG D N   1 
ATOM   10488 C CA  . ARG D 1 365 ? 11.012  15.539   -20.140 1.00 63.12  ? 366 ARG D CA  1 
ATOM   10489 C C   . ARG D 1 365 ? 10.188  15.621   -21.411 1.00 61.85  ? 366 ARG D C   1 
ATOM   10490 O O   . ARG D 1 365 ? 8.962   15.589   -21.353 1.00 62.58  ? 366 ARG D O   1 
ATOM   10491 C CB  . ARG D 1 365 ? 11.504  16.929   -19.750 1.00 65.11  ? 366 ARG D CB  1 
ATOM   10492 N N   . HIS D 1 366 ? 10.853  15.661   -22.564 1.00 60.43  ? 367 HIS D N   1 
ATOM   10493 C CA  . HIS D 1 366 ? 10.145  15.874   -23.840 1.00 61.08  ? 367 HIS D CA  1 
ATOM   10494 C C   . HIS D 1 366 ? 9.419   14.625   -24.334 1.00 59.94  ? 367 HIS D C   1 
ATOM   10495 O O   . HIS D 1 366 ? 8.312   14.721   -24.905 1.00 60.67  ? 367 HIS D O   1 
ATOM   10496 C CB  . HIS D 1 366 ? 11.109  16.350   -24.927 1.00 60.71  ? 367 HIS D CB  1 
ATOM   10497 C CG  . HIS D 1 366 ? 10.432  16.860   -26.164 1.00 62.73  ? 367 HIS D CG  1 
ATOM   10498 N ND1 . HIS D 1 366 ? 10.062  16.032   -27.202 1.00 61.60  ? 367 HIS D ND1 1 
ATOM   10499 C CD2 . HIS D 1 366 ? 10.066  18.111   -26.535 1.00 65.49  ? 367 HIS D CD2 1 
ATOM   10500 C CE1 . HIS D 1 366 ? 9.491   16.748   -28.154 1.00 63.10  ? 367 HIS D CE1 1 
ATOM   10501 N NE2 . HIS D 1 366 ? 9.480   18.013   -27.774 1.00 65.56  ? 367 HIS D NE2 1 
ATOM   10502 N N   . ILE D 1 367 ? 10.040  13.460   -24.118 1.00 58.25  ? 368 ILE D N   1 
ATOM   10503 C CA  . ILE D 1 367 ? 9.415   12.164   -24.462 1.00 57.64  ? 368 ILE D CA  1 
ATOM   10504 C C   . ILE D 1 367 ? 8.102   11.945   -23.696 1.00 59.55  ? 368 ILE D C   1 
ATOM   10505 O O   . ILE D 1 367 ? 7.062   11.617   -24.273 1.00 58.93  ? 368 ILE D O   1 
ATOM   10506 C CB  . ILE D 1 367 ? 10.385  11.036   -24.173 1.00 55.16  ? 368 ILE D CB  1 
ATOM   10507 C CG1 . ILE D 1 367 ? 11.562  11.073   -25.196 1.00 44.88  ? 368 ILE D CG1 1 
ATOM   10508 C CG2 . ILE D 1 367 ? 9.677   9.708    -24.187 1.00 53.84  ? 368 ILE D CG2 1 
ATOM   10509 C CD1 . ILE D 1 367 ? 12.689  10.137   -24.783 1.00 42.53  ? 368 ILE D CD1 1 
ATOM   10510 N N   . GLN D 1 368 ? 8.178   12.186   -22.388 1.00 61.85  ? 369 GLN D N   1 
ATOM   10511 C CA  . GLN D 1 368 ? 7.089   11.947   -21.435 1.00 65.36  ? 369 GLN D CA  1 
ATOM   10512 C C   . GLN D 1 368 ? 5.893   12.860   -21.664 1.00 70.47  ? 369 GLN D C   1 
ATOM   10513 O O   . GLN D 1 368 ? 4.746   12.440   -21.555 1.00 71.36  ? 369 GLN D O   1 
ATOM   10514 C CB  . GLN D 1 368 ? 7.604   12.123   -19.988 1.00 66.42  ? 369 GLN D CB  1 
ATOM   10515 C CG  . GLN D 1 368 ? 6.588   11.839   -18.901 1.00 68.40  ? 369 GLN D CG  1 
ATOM   10516 C CD  . GLN D 1 368 ? 6.161   10.394   -18.895 1.00 67.41  ? 369 GLN D CD  1 
ATOM   10517 O OE1 . GLN D 1 368 ? 5.385   9.963    -19.743 1.00 67.38  ? 369 GLN D OE1 1 
ATOM   10518 N NE2 . GLN D 1 368 ? 6.682   9.628    -17.947 1.00 66.47  ? 369 GLN D NE2 1 
ATOM   10519 N N   . GLU D 1 369 ? 6.166   14.117   -21.982 1.00 74.42  ? 370 GLU D N   1 
ATOM   10520 C CA  . GLU D 1 369 ? 5.088   15.065   -22.222 1.00 79.90  ? 370 GLU D CA  1 
ATOM   10521 C C   . GLU D 1 369 ? 4.407   14.787   -23.557 1.00 81.30  ? 370 GLU D C   1 
ATOM   10522 O O   . GLU D 1 369 ? 3.249   15.150   -23.756 1.00 83.32  ? 370 GLU D O   1 
ATOM   10523 C CB  . GLU D 1 369 ? 5.603   16.504   -22.176 1.00 82.77  ? 370 GLU D CB  1 
ATOM   10524 C CG  . GLU D 1 369 ? 5.731   17.065   -20.766 1.00 85.57  ? 370 GLU D CG  1 
ATOM   10525 C CD  . GLU D 1 369 ? 6.707   18.228   -20.687 1.00 88.00  ? 370 GLU D CD  1 
ATOM   10526 O OE1 . GLU D 1 369 ? 7.157   18.703   -21.754 1.00 87.96  ? 370 GLU D OE1 1 
ATOM   10527 O OE2 . GLU D 1 369 ? 7.020   18.669   -19.559 1.00 89.86  ? 370 GLU D OE2 1 
ATOM   10528 N N   . HIS D 1 370 ? 5.122   14.129   -24.464 1.00 80.83  ? 371 HIS D N   1 
ATOM   10529 C CA  . HIS D 1 370 ? 4.562   13.789   -25.767 1.00 82.46  ? 371 HIS D CA  1 
ATOM   10530 C C   . HIS D 1 370 ? 4.154   12.323   -25.853 1.00 81.19  ? 371 HIS D C   1 
ATOM   10531 O O   . HIS D 1 370 ? 3.945   11.794   -26.944 1.00 80.43  ? 371 HIS D O   1 
ATOM   10532 C CB  . HIS D 1 370 ? 5.557   14.124   -26.877 1.00 82.13  ? 371 HIS D CB  1 
ATOM   10533 C CG  . HIS D 1 370 ? 5.593   15.577   -27.230 1.00 85.79  ? 371 HIS D CG  1 
ATOM   10534 N ND1 . HIS D 1 370 ? 5.153   16.058   -28.445 1.00 87.53  ? 371 HIS D ND1 1 
ATOM   10535 C CD2 . HIS D 1 370 ? 6.007   16.657   -26.526 1.00 87.73  ? 371 HIS D CD2 1 
ATOM   10536 C CE1 . HIS D 1 370 ? 5.297   17.371   -28.475 1.00 89.89  ? 371 HIS D CE1 1 
ATOM   10537 N NE2 . HIS D 1 370 ? 5.814   17.760   -27.323 1.00 90.12  ? 371 HIS D NE2 1 
ATOM   10538 N N   . TYR D 1 371 ? 4.037   11.674   -24.700 1.00 81.59  ? 372 TYR D N   1 
ATOM   10539 C CA  . TYR D 1 371 ? 3.581   10.291   -24.649 1.00 81.42  ? 372 TYR D CA  1 
ATOM   10540 C C   . TYR D 1 371 ? 2.198   10.210   -24.012 1.00 90.14  ? 372 TYR D C   1 
ATOM   10541 O O   . TYR D 1 371 ? 1.953   10.809   -22.966 1.00 95.68  ? 372 TYR D O   1 
ATOM   10542 C CB  . TYR D 1 371 ? 4.578   9.421    -23.880 1.00 74.70  ? 372 TYR D CB  1 
ATOM   10543 C CG  . TYR D 1 371 ? 4.296   7.937    -23.967 1.00 68.66  ? 372 TYR D CG  1 
ATOM   10544 C CD1 . TYR D 1 371 ? 4.059   7.325    -25.192 1.00 65.97  ? 372 TYR D CD1 1 
ATOM   10545 C CD2 . TYR D 1 371 ? 4.281   7.147    -22.825 1.00 66.22  ? 372 TYR D CD2 1 
ATOM   10546 C CE1 . TYR D 1 371 ? 3.807   5.968    -25.276 1.00 63.09  ? 372 TYR D CE1 1 
ATOM   10547 C CE2 . TYR D 1 371 ? 4.029   5.791    -22.898 1.00 63.42  ? 372 TYR D CE2 1 
ATOM   10548 C CZ  . TYR D 1 371 ? 3.793   5.207    -24.126 1.00 62.01  ? 372 TYR D CZ  1 
ATOM   10549 O OH  . TYR D 1 371 ? 3.543   3.859    -24.199 1.00 60.09  ? 372 TYR D OH  1 
ATOM   10550 N N   . GLY D 1 372 ? 1.298   9.472    -24.654 1.00 96.14  ? 373 GLY D N   1 
ATOM   10551 C CA  . GLY D 1 372 ? -0.069  9.341    -24.180 1.00 99.50  ? 373 GLY D CA  1 
ATOM   10552 C C   . GLY D 1 372 ? -0.174  8.538    -22.899 1.00 99.68  ? 373 GLY D C   1 
ATOM   10553 O O   . GLY D 1 372 ? -1.032  8.802    -22.056 1.00 102.72 ? 373 GLY D O   1 
ATOM   10554 N N   . GLY D 1 373 ? 0.700   7.548    -22.755 1.00 91.99  ? 374 GLY D N   1 
ATOM   10555 C CA  . GLY D 1 373 ? 0.743   6.745    -21.549 1.00 88.64  ? 374 GLY D CA  1 
ATOM   10556 C C   . GLY D 1 373 ? 1.766   7.311    -20.589 1.00 86.14  ? 374 GLY D C   1 
ATOM   10557 O O   . GLY D 1 373 ? 2.242   8.430    -20.772 1.00 87.25  ? 374 GLY D O   1 
ATOM   10558 N N   . THR D 1 374 ? 2.107   6.545    -19.561 1.00 82.00  ? 375 THR D N   1 
ATOM   10559 C CA  . THR D 1 374 ? 3.152   6.960    -18.638 1.00 78.26  ? 375 THR D CA  1 
ATOM   10560 C C   . THR D 1 374 ? 4.449   6.211    -18.945 1.00 71.05  ? 375 THR D C   1 
ATOM   10561 O O   . THR D 1 374 ? 4.540   5.000    -18.762 1.00 68.81  ? 375 THR D O   1 
ATOM   10562 C CB  . THR D 1 374 ? 2.727   6.742    -17.166 1.00 79.92  ? 375 THR D CB  1 
ATOM   10563 O OG1 . THR D 1 374 ? 3.869   6.863    -16.307 1.00 79.70  ? 375 THR D OG1 1 
ATOM   10564 C CG2 . THR D 1 374 ? 2.074   5.376    -16.973 1.00 79.05  ? 375 THR D CG2 1 
ATOM   10565 N N   . ALA D 1 375 ? 5.443   6.939    -19.443 1.00 67.30  ? 376 ALA D N   1 
ATOM   10566 C CA  . ALA D 1 375 ? 6.736   6.345    -19.763 1.00 62.59  ? 376 ALA D CA  1 
ATOM   10567 C C   . ALA D 1 375 ? 7.571   6.136    -18.501 1.00 61.59  ? 376 ALA D C   1 
ATOM   10568 O O   . ALA D 1 375 ? 7.440   6.878    -17.529 1.00 63.63  ? 376 ALA D O   1 
ATOM   10569 C CB  . ALA D 1 375 ? 7.486   7.215    -20.760 1.00 61.55  ? 376 ALA D CB  1 
ATOM   10570 N N   . THR D 1 376 ? 8.412   5.105    -18.517 1.00 58.88  ? 377 THR D N   1 
ATOM   10571 C CA  . THR D 1 376 ? 9.349   4.843    -17.425 1.00 57.63  ? 377 THR D CA  1 
ATOM   10572 C C   . THR D 1 376 ? 10.765  4.888    -17.990 1.00 54.25  ? 377 THR D C   1 
ATOM   10573 O O   . THR D 1 376 ? 11.007  4.398    -19.092 1.00 51.01  ? 377 THR D O   1 
ATOM   10574 C CB  . THR D 1 376 ? 9.093   3.475    -16.754 1.00 57.90  ? 377 THR D CB  1 
ATOM   10575 O OG1 . THR D 1 376 ? 7.769   3.442    -16.213 1.00 60.23  ? 377 THR D OG1 1 
ATOM   10576 C CG2 . THR D 1 376 ? 10.090  3.228    -15.628 1.00 58.23  ? 377 THR D CG2 1 
ATOM   10577 N N   . PHE D 1 377 ? 11.697  5.476    -17.245 1.00 54.32  ? 378 PHE D N   1 
ATOM   10578 C CA  . PHE D 1 377 ? 13.040  5.694    -17.769 1.00 52.74  ? 378 PHE D CA  1 
ATOM   10579 C C   . PHE D 1 377 ? 14.137  4.988    -16.983 1.00 52.33  ? 378 PHE D C   1 
ATOM   10580 O O   . PHE D 1 377 ? 14.065  4.867    -15.759 1.00 53.65  ? 378 PHE D O   1 
ATOM   10581 C CB  . PHE D 1 377 ? 13.345  7.192    -17.815 1.00 53.81  ? 378 PHE D CB  1 
ATOM   10582 C CG  . PHE D 1 377 ? 12.385  7.981    -18.656 1.00 53.49  ? 378 PHE D CG  1 
ATOM   10583 C CD1 . PHE D 1 377 ? 12.495  7.983    -20.037 1.00 51.05  ? 378 PHE D CD1 1 
ATOM   10584 C CD2 . PHE D 1 377 ? 11.375  8.724    -18.067 1.00 55.01  ? 378 PHE D CD2 1 
ATOM   10585 C CE1 . PHE D 1 377 ? 11.616  8.707    -20.814 1.00 51.89  ? 378 PHE D CE1 1 
ATOM   10586 C CE2 . PHE D 1 377 ? 10.493  9.451    -18.840 1.00 55.65  ? 378 PHE D CE2 1 
ATOM   10587 C CZ  . PHE D 1 377 ? 10.613  9.441    -20.217 1.00 54.12  ? 378 PHE D CZ  1 
ATOM   10588 N N   . TYR D 1 378 ? 15.151  4.525    -17.708 1.00 50.74  ? 379 TYR D N   1 
ATOM   10589 C CA  . TYR D 1 378 ? 16.385  4.035    -17.107 1.00 51.84  ? 379 TYR D CA  1 
ATOM   10590 C C   . TYR D 1 378 ? 17.581  4.589    -17.866 1.00 49.52  ? 379 TYR D C   1 
ATOM   10591 O O   . TYR D 1 378 ? 17.658  4.459    -19.087 1.00 47.81  ? 379 TYR D O   1 
ATOM   10592 C CB  . TYR D 1 378 ? 16.438  2.508    -17.107 1.00 53.85  ? 379 TYR D CB  1 
ATOM   10593 C CG  . TYR D 1 378 ? 15.251  1.844    -16.454 1.00 57.63  ? 379 TYR D CG  1 
ATOM   10594 C CD1 . TYR D 1 378 ? 15.166  1.741    -15.072 1.00 60.28  ? 379 TYR D CD1 1 
ATOM   10595 C CD2 . TYR D 1 378 ? 14.224  1.304    -17.218 1.00 58.26  ? 379 TYR D CD2 1 
ATOM   10596 C CE1 . TYR D 1 378 ? 14.085  1.130    -14.469 1.00 61.73  ? 379 TYR D CE1 1 
ATOM   10597 C CE2 . TYR D 1 378 ? 13.137  0.691    -16.623 1.00 59.39  ? 379 TYR D CE2 1 
ATOM   10598 C CZ  . TYR D 1 378 ? 13.076  0.606    -15.248 1.00 61.24  ? 379 TYR D CZ  1 
ATOM   10599 O OH  . TYR D 1 378 ? 12.003  -0.002   -14.641 1.00 62.85  ? 379 TYR D OH  1 
ATOM   10600 N N   . LEU D 1 379 ? 18.498  5.221    -17.143 1.00 48.94  ? 380 LEU D N   1 
ATOM   10601 C CA  . LEU D 1 379 ? 19.767  5.653    -17.713 1.00 48.84  ? 380 LEU D CA  1 
ATOM   10602 C C   . LEU D 1 379 ? 20.838  4.628    -17.371 1.00 48.85  ? 380 LEU D C   1 
ATOM   10603 O O   . LEU D 1 379 ? 20.978  4.238    -16.211 1.00 49.05  ? 380 LEU D O   1 
ATOM   10604 C CB  . LEU D 1 379 ? 20.169  7.030    -17.186 1.00 51.10  ? 380 LEU D CB  1 
ATOM   10605 C CG  . LEU D 1 379 ? 19.766  8.262    -17.994 1.00 52.21  ? 380 LEU D CG  1 
ATOM   10606 C CD1 . LEU D 1 379 ? 20.213  9.526    -17.269 1.00 54.61  ? 380 LEU D CD1 1 
ATOM   10607 C CD2 . LEU D 1 379 ? 20.368  8.204    -19.389 1.00 50.60  ? 380 LEU D CD2 1 
ATOM   10608 N N   . SER D 1 380 ? 21.593  4.190    -18.371 1.00 47.28  ? 381 SER D N   1 
ATOM   10609 C CA  . SER D 1 380 ? 22.580  3.147    -18.134 1.00 47.16  ? 381 SER D CA  1 
ATOM   10610 C C   . SER D 1 380 ? 23.828  3.287    -18.993 1.00 47.53  ? 381 SER D C   1 
ATOM   10611 O O   . SER D 1 380 ? 23.758  3.643    -20.168 1.00 47.82  ? 381 SER D O   1 
ATOM   10612 C CB  . SER D 1 380 ? 21.957  1.768    -18.372 1.00 45.24  ? 381 SER D CB  1 
ATOM   10613 O OG  . SER D 1 380 ? 22.888  0.736    -18.086 1.00 44.70  ? 381 SER D OG  1 
ATOM   10614 N N   . GLN D 1 381 ? 24.973  3.012    -18.383 1.00 48.09  ? 382 GLN D N   1 
ATOM   10615 C CA  . GLN D 1 381 ? 26.211  2.814    -19.114 1.00 47.89  ? 382 GLN D CA  1 
ATOM   10616 C C   . GLN D 1 381 ? 26.312  1.318    -19.372 1.00 44.25  ? 382 GLN D C   1 
ATOM   10617 O O   . GLN D 1 381 ? 25.551  0.546    -18.788 1.00 44.03  ? 382 GLN D O   1 
ATOM   10618 C CB  . GLN D 1 381 ? 27.417  3.332    -18.313 1.00 53.59  ? 382 GLN D CB  1 
ATOM   10619 C CG  . GLN D 1 381 ? 27.347  4.808    -17.928 1.00 58.38  ? 382 GLN D CG  1 
ATOM   10620 C CD  . GLN D 1 381 ? 27.494  5.735    -19.124 1.00 60.65  ? 382 GLN D CD  1 
ATOM   10621 O OE1 . GLN D 1 381 ? 27.925  5.316    -20.200 1.00 61.14  ? 382 GLN D OE1 1 
ATOM   10622 N NE2 . GLN D 1 381 ? 27.143  7.002    -18.939 1.00 61.86  ? 382 GLN D NE2 1 
ATOM   10623 N N   . ALA D 1 382 ? 27.234  0.901    -20.236 1.00 40.86  ? 383 ALA D N   1 
ATOM   10624 C CA  . ALA D 1 382 ? 27.498  -0.525   -20.421 1.00 36.32  ? 383 ALA D CA  1 
ATOM   10625 C C   . ALA D 1 382 ? 28.004  -1.128   -19.109 1.00 35.89  ? 383 ALA D C   1 
ATOM   10626 O O   . ALA D 1 382 ? 28.939  -0.604   -18.506 1.00 36.10  ? 383 ALA D O   1 
ATOM   10627 C CB  . ALA D 1 382 ? 28.506  -0.749   -21.530 1.00 34.30  ? 383 ALA D CB  1 
ATOM   10628 N N   . ALA D 1 383 ? 27.391  -2.226   -18.676 1.00 34.79  ? 384 ALA D N   1 
ATOM   10629 C CA  . ALA D 1 383 ? 27.705  -2.811   -17.379 1.00 36.27  ? 384 ALA D CA  1 
ATOM   10630 C C   . ALA D 1 383 ? 28.445  -4.135   -17.490 1.00 35.11  ? 384 ALA D C   1 
ATOM   10631 O O   . ALA D 1 383 ? 28.495  -4.755   -18.560 1.00 35.11  ? 384 ALA D O   1 
ATOM   10632 C CB  . ALA D 1 383 ? 26.430  -3.002   -16.572 1.00 37.08  ? 384 ALA D CB  1 
ATOM   10633 N N   . ASP D 1 384 ? 29.020  -4.557   -16.369 1.00 33.74  ? 385 ASP D N   1 
ATOM   10634 C CA  . ASP D 1 384 ? 29.617  -5.881   -16.251 1.00 35.27  ? 385 ASP D CA  1 
ATOM   10635 C C   . ASP D 1 384 ? 28.559  -6.958   -16.418 1.00 33.35  ? 385 ASP D C   1 
ATOM   10636 O O   . ASP D 1 384 ? 27.366  -6.707   -16.253 1.00 33.78  ? 385 ASP D O   1 
ATOM   10637 C CB  . ASP D 1 384 ? 30.309  -6.057   -14.894 1.00 40.38  ? 385 ASP D CB  1 
ATOM   10638 C CG  . ASP D 1 384 ? 31.644  -5.349   -14.821 1.00 44.03  ? 385 ASP D CG  1 
ATOM   10639 O OD1 . ASP D 1 384 ? 32.264  -5.126   -15.884 1.00 42.65  ? 385 ASP D OD1 1 
ATOM   10640 O OD2 . ASP D 1 384 ? 32.079  -5.027   -13.691 1.00 47.37  ? 385 ASP D OD2 1 
ATOM   10641 N N   . GLY D 1 385 ? 29.002  -8.160   -16.754 1.00 32.23  ? 386 GLY D N   1 
ATOM   10642 C CA  . GLY D 1 385 ? 28.120  -9.305   -16.752 1.00 33.06  ? 386 GLY D CA  1 
ATOM   10643 C C   . GLY D 1 385 ? 28.193  -9.997   -15.403 1.00 35.08  ? 386 GLY D C   1 
ATOM   10644 O O   . GLY D 1 385 ? 28.309  -9.347   -14.360 1.00 34.47  ? 386 GLY D O   1 
ATOM   10645 N N   . ALA D 1 386 ? 28.147  -11.323  -15.434 1.00 37.91  ? 387 ALA D N   1 
ATOM   10646 C CA  . ALA D 1 386 ? 28.067  -12.132  -14.222 1.00 42.00  ? 387 ALA D CA  1 
ATOM   10647 C C   . ALA D 1 386 ? 29.319  -12.003  -13.358 1.00 43.10  ? 387 ALA D C   1 
ATOM   10648 O O   . ALA D 1 386 ? 30.437  -12.155  -13.846 1.00 43.16  ? 387 ALA D O   1 
ATOM   10649 C CB  . ALA D 1 386 ? 27.832  -13.585  -14.592 1.00 41.70  ? 387 ALA D CB  1 
ATOM   10650 N N   . LYS D 1 387 ? 29.133  -11.720  -12.074 1.00 45.69  ? 388 LYS D N   1 
ATOM   10651 C CA  . LYS D 1 387 ? 30.275  -11.663  -11.171 1.00 49.32  ? 388 LYS D CA  1 
ATOM   10652 C C   . LYS D 1 387 ? 29.968  -12.181  -9.780  1.00 50.82  ? 388 LYS D C   1 
ATOM   10653 O O   . LYS D 1 387 ? 28.813  -12.431  -9.422  1.00 50.83  ? 388 LYS D O   1 
ATOM   10654 C CB  . LYS D 1 387 ? 30.816  -10.238  -11.074 1.00 52.00  ? 388 LYS D CB  1 
ATOM   10655 C CG  . LYS D 1 387 ? 29.770  -9.160   -10.872 1.00 52.62  ? 388 LYS D CG  1 
ATOM   10656 C CD  . LYS D 1 387 ? 30.451  -7.801   -10.782 1.00 54.38  ? 388 LYS D CD  1 
ATOM   10657 C CE  . LYS D 1 387 ? 29.600  -6.693   -11.380 1.00 51.63  ? 388 LYS D CE  1 
ATOM   10658 N NZ  . LYS D 1 387 ? 30.383  -5.432   -11.501 1.00 51.39  ? 388 LYS D NZ  1 
ATOM   10659 N N   . VAL D 1 388 ? 31.034  -12.333  -9.003  1.00 50.59  ? 389 VAL D N   1 
ATOM   10660 C CA  . VAL D 1 388 ? 30.946  -12.890  -7.673  1.00 50.82  ? 389 VAL D CA  1 
ATOM   10661 C C   . VAL D 1 388 ? 31.613  -12.029  -6.608  1.00 51.19  ? 389 VAL D C   1 
ATOM   10662 O O   . VAL D 1 388 ? 32.717  -11.530  -6.817  1.00 50.12  ? 389 VAL D O   1 
ATOM   10663 C CB  . VAL D 1 388 ? 31.612  -14.249  -7.593  1.00 52.78  ? 389 VAL D CB  1 
ATOM   10664 C CG1 . VAL D 1 388 ? 31.588  -14.681  -6.157  1.00 54.87  ? 389 VAL D CG1 1 
ATOM   10665 C CG2 . VAL D 1 388 ? 30.931  -15.269  -8.532  1.00 51.82  ? 389 VAL D CG2 1 
ATOM   10666 N N   . LEU D 1 389 ? 30.952  -11.882  -5.462  1.00 52.68  ? 390 LEU D N   1 
ATOM   10667 C CA  . LEU D 1 389 ? 31.581  -11.305  -4.284  1.00 55.22  ? 390 LEU D CA  1 
ATOM   10668 C C   . LEU D 1 389 ? 31.404  -12.221  -3.077  1.00 56.36  ? 390 LEU D C   1 
ATOM   10669 O O   . LEU D 1 389 ? 30.285  -12.444  -2.617  1.00 55.90  ? 390 LEU D O   1 
ATOM   10670 C CB  . LEU D 1 389 ? 31.001  -9.927   -3.980  1.00 55.95  ? 390 LEU D CB  1 
ATOM   10671 C CG  . LEU D 1 389 ? 31.531  -9.346   -2.668  1.00 60.52  ? 390 LEU D CG  1 
ATOM   10672 C CD1 . LEU D 1 389 ? 33.027  -9.082   -2.770  1.00 62.67  ? 390 LEU D CD1 1 
ATOM   10673 C CD2 . LEU D 1 389 ? 30.777  -8.085   -2.266  1.00 61.24  ? 390 LEU D CD2 1 
ATOM   10674 N N   . CYS D 1 390 ? 32.511  -12.754  -2.575  1.00 58.19  ? 391 CYS D N   1 
ATOM   10675 C CA  . CYS D 1 390 ? 32.471  -13.603  -1.390  1.00 60.55  ? 391 CYS D CA  1 
ATOM   10676 C C   . CYS D 1 390 ? 32.186  -12.768  -0.150  1.00 61.08  ? 391 CYS D C   1 
ATOM   10677 O O   . CYS D 1 390 ? 32.694  -11.656  -0.007  1.00 61.20  ? 391 CYS D O   1 
ATOM   10678 C CB  . CYS D 1 390 ? 33.783  -14.360  -1.223  1.00 61.95  ? 391 CYS D CB  1 
ATOM   10679 S SG  . CYS D 1 390 ? 34.401  -15.135  -2.732  1.00 60.04  ? 391 CYS D SG  1 
ATOM   10680 N N   . LEU D 1 391 ? 31.365  -13.311  0.741   1.00 61.41  ? 392 LEU D N   1 
ATOM   10681 C CA  . LEU D 1 391 ? 30.976  -12.600  1.949   1.00 65.84  ? 392 LEU D CA  1 
ATOM   10682 C C   . LEU D 1 391 ? 31.557  -13.268  3.188   1.00 66.80  ? 392 LEU D C   1 
ATOM   10683 O O   . LEU D 1 391 ? 32.038  -14.401  3.139   1.00 67.83  ? 392 LEU D O   1 
ATOM   10684 C CB  . LEU D 1 391 ? 29.452  -12.520  2.056   1.00 63.19  ? 392 LEU D CB  1 
ATOM   10685 C CG  . LEU D 1 391 ? 28.748  -11.908  0.842   1.00 59.40  ? 392 LEU D CG  1 
ATOM   10686 C CD1 . LEU D 1 391 ? 27.249  -11.832  1.079   1.00 56.59  ? 392 LEU D CD1 1 
ATOM   10687 C CD2 . LEU D 1 391 ? 29.322  -10.533  0.531   1.00 58.08  ? 392 LEU D CD2 1 
ATOM   10688 O OXT . LEU D 1 391 ? 31.555  -12.673  4.262   1.00 74.92  ? 392 LEU D OXT 1 
HETATM 10689 C C1  . GAL E 2 .   ? -16.568 -10.244  -23.073 1.00 32.57  ? 401 GAL A C1  1 
HETATM 10690 C C2  . GAL E 2 .   ? -17.235 -8.963   -22.545 1.00 29.47  ? 401 GAL A C2  1 
HETATM 10691 C C3  . GAL E 2 .   ? -18.484 -8.664   -23.398 1.00 28.53  ? 401 GAL A C3  1 
HETATM 10692 C C4  . GAL E 2 .   ? -18.129 -8.649   -24.919 1.00 25.84  ? 401 GAL A C4  1 
HETATM 10693 C C5  . GAL E 2 .   ? -17.223 -9.842   -25.271 1.00 25.49  ? 401 GAL A C5  1 
HETATM 10694 C C6  . GAL E 2 .   ? -16.646 -9.829   -26.683 1.00 23.84  ? 401 GAL A C6  1 
HETATM 10695 O O1  . GAL E 2 .   ? -15.503 -10.647  -22.306 1.00 40.36  ? 401 GAL A O1  1 
HETATM 10696 O O2  . GAL E 2 .   ? -17.657 -9.091   -21.202 1.00 27.91  ? 401 GAL A O2  1 
HETATM 10697 O O3  . GAL E 2 .   ? -19.054 -7.407   -23.065 1.00 28.04  ? 401 GAL A O3  1 
HETATM 10698 O O4  . GAL E 2 .   ? -17.496 -7.439   -25.287 1.00 26.10  ? 401 GAL A O4  1 
HETATM 10699 O O5  . GAL E 2 .   ? -16.107 -9.965   -24.364 1.00 29.48  ? 401 GAL A O5  1 
HETATM 10700 O O6  . GAL E 2 .   ? -17.677 -10.065  -27.628 1.00 24.45  ? 401 GAL A O6  1 
HETATM 10701 C C10 . HFK F 3 .   ? -12.043 -13.823  -8.380  1.00 40.70  ? 402 HFK A C10 1 
HETATM 10702 C C13 . HFK F 3 .   ? -11.474 -15.515  -10.750 1.00 41.14  ? 402 HFK A C13 1 
HETATM 10703 C C15 . HFK F 3 .   ? -14.406 -14.644  -11.938 1.00 38.86  ? 402 HFK A C15 1 
HETATM 10704 C C20 . HFK F 3 .   ? -17.969 -16.147  -9.513  1.00 35.94  ? 402 HFK A C20 1 
HETATM 10705 C C21 . HFK F 3 .   ? -16.843 -16.022  -8.694  1.00 37.12  ? 402 HFK A C21 1 
HETATM 10706 C C24 . HFK F 3 .   ? -18.024 -17.170  -6.892  1.00 35.37  ? 402 HFK A C24 1 
HETATM 10707 C C26 . HFK F 3 .   ? -19.138 -16.791  -9.028  1.00 35.82  ? 402 HFK A C26 1 
HETATM 10708 C C02 . HFK F 3 .   ? -10.422 -12.710  -12.165 1.00 54.72  ? 402 HFK A C02 1 
HETATM 10709 C C03 . HFK F 3 .   ? -10.127 -11.961  -13.514 1.00 47.19  ? 402 HFK A C03 1 
HETATM 10710 C C04 . HFK F 3 .   ? -10.687 -12.681  -14.731 1.00 46.89  ? 402 HFK A C04 1 
HETATM 10711 C C05 . HFK F 3 .   ? -12.228 -12.900  -14.579 1.00 38.99  ? 402 HFK A C05 1 
HETATM 10712 C C06 . HFK F 3 .   ? -12.548 -13.730  -13.325 1.00 40.09  ? 402 HFK A C06 1 
HETATM 10713 C C07 . HFK F 3 .   ? -11.893 -13.210  -12.033 1.00 40.58  ? 402 HFK A C07 1 
HETATM 10714 C C08 . HFK F 3 .   ? -12.166 -14.161  -10.893 1.00 40.14  ? 402 HFK A C08 1 
HETATM 10715 C C09 . HFK F 3 .   ? -11.825 -13.203  -9.749  1.00 39.97  ? 402 HFK A C09 1 
HETATM 10716 C C11 . HFK F 3 .   ? -11.336 -15.168  -8.240  1.00 41.24  ? 402 HFK A C11 1 
HETATM 10717 C C12 . HFK F 3 .   ? -11.691 -16.127  -9.378  1.00 41.30  ? 402 HFK A C12 1 
HETATM 10718 C C18 . HFK F 3 .   ? -16.394 -15.096  -10.667 1.00 36.56  ? 402 HFK A C18 1 
HETATM 10719 C C23 . HFK F 3 .   ? -16.869 -16.535  -7.368  1.00 36.30  ? 402 HFK A C23 1 
HETATM 10720 C C25 . HFK F 3 .   ? -19.154 -17.299  -7.721  1.00 35.69  ? 402 HFK A C25 1 
HETATM 10721 N N14 . HFK F 3 .   ? -13.631 -14.287  -10.671 1.00 38.91  ? 402 HFK A N14 1 
HETATM 10722 N N16 . HFK F 3 .   ? -13.997 -13.832  -13.152 1.00 39.61  ? 402 HFK A N16 1 
HETATM 10723 N N17 . HFK F 3 .   ? -15.706 -14.423  -11.735 1.00 37.15  ? 402 HFK A N17 1 
HETATM 10724 N N19 . HFK F 3 .   ? -17.649 -15.551  -10.744 1.00 35.08  ? 402 HFK A N19 1 
HETATM 10725 O O01 . HFK F 3 .   ? -9.504  -13.727  -12.030 1.00 54.58  ? 402 HFK A O01 1 
HETATM 10726 O O22 . HFK F 3 .   ? -15.883 -15.358  -9.460  1.00 37.96  ? 402 HFK A O22 1 
HETATM 10727 C C1  . GAL G 2 .   ? -15.875 -55.575  -48.551 1.00 42.77  ? 401 GAL B C1  1 
HETATM 10728 C C2  . GAL G 2 .   ? -15.978 -57.081  -48.264 1.00 41.74  ? 401 GAL B C2  1 
HETATM 10729 C C3  . GAL G 2 .   ? -14.755 -57.817  -48.837 1.00 39.70  ? 401 GAL B C3  1 
HETATM 10730 C C4  . GAL G 2 .   ? -14.614 -57.512  -50.356 1.00 33.81  ? 401 GAL B C4  1 
HETATM 10731 C C5  . GAL G 2 .   ? -14.663 -55.985  -50.581 1.00 36.41  ? 401 GAL B C5  1 
HETATM 10732 C C6  . GAL G 2 .   ? -14.708 -55.546  -52.050 1.00 35.27  ? 401 GAL B C6  1 
HETATM 10733 O O1  . GAL G 2 .   ? -16.982 -54.879  -48.049 1.00 45.50  ? 401 GAL B O1  1 
HETATM 10734 O O2  . GAL G 2 .   ? -16.037 -57.350  -46.869 1.00 43.28  ? 401 GAL B O2  1 
HETATM 10735 O O3  . GAL G 2 .   ? -14.871 -59.228  -48.683 1.00 37.40  ? 401 GAL B O3  1 
HETATM 10736 O O4  . GAL G 2 .   ? -15.647 -58.153  -51.094 1.00 32.15  ? 401 GAL B O4  1 
HETATM 10737 O O5  . GAL G 2 .   ? -15.812 -55.373  -49.953 1.00 39.81  ? 401 GAL B O5  1 
HETATM 10738 O O6  . GAL G 2 .   ? -13.418 -55.632  -52.632 1.00 35.57  ? 401 GAL B O6  1 
HETATM 10739 C C10 . HFK H 3 .   ? -21.903 -49.283  -35.495 1.00 54.84  ? 402 HFK B C10 1 
HETATM 10740 C C13 . HFK H 3 .   ? -22.890 -51.907  -36.427 1.00 54.75  ? 402 HFK B C13 1 
HETATM 10741 C C15 . HFK H 3 .   ? -19.384 -51.592  -37.535 1.00 53.51  ? 402 HFK B C15 1 
HETATM 10742 C C20 . HFK H 3 .   ? -16.578 -52.340  -33.983 1.00 50.70  ? 402 HFK B C20 1 
HETATM 10743 C C21 . HFK H 3 .   ? -17.863 -52.027  -33.540 1.00 50.68  ? 402 HFK B C21 1 
HETATM 10744 C C24 . HFK H 3 .   ? -17.034 -51.862  -31.241 1.00 49.67  ? 402 HFK B C24 1 
HETATM 10745 C C26 . HFK H 3 .   ? -15.502 -52.413  -33.053 1.00 50.18  ? 402 HFK B C26 1 
HETATM 10746 C C02 . HFK H 3 .   ? -23.504 -51.513  -39.160 1.00 80.71  ? 402 HFK B C02 1 
HETATM 10747 C C03 . HFK H 3 .   ? -23.642 -51.975  -40.653 1.00 58.52  ? 402 HFK B C03 1 
HETATM 10748 C C04 . HFK H 3 .   ? -22.527 -51.428  -41.535 1.00 58.07  ? 402 HFK B C04 1 
HETATM 10749 C C05 . HFK H 3 .   ? -21.125 -51.848  -40.975 1.00 54.41  ? 402 HFK B C05 1 
HETATM 10750 C C06 . HFK H 3 .   ? -20.916 -51.386  -39.520 1.00 54.16  ? 402 HFK B C06 1 
HETATM 10751 C C07 . HFK H 3 .   ? -22.079 -51.744  -38.578 1.00 54.70  ? 402 HFK B C07 1 
HETATM 10752 C C08 . HFK H 3 .   ? -21.829 -51.141  -37.217 1.00 54.79  ? 402 HFK B C08 1 
HETATM 10753 C C09 . HFK H 3 .   ? -21.871 -49.635  -36.968 1.00 54.66  ? 402 HFK B C09 1 
HETATM 10754 C C11 . HFK H 3 .   ? -22.999 -50.034  -34.745 1.00 54.58  ? 402 HFK B C11 1 
HETATM 10755 C C12 . HFK H 3 .   ? -22.893 -51.539  -34.957 1.00 54.55  ? 402 HFK B C12 1 
HETATM 10756 C C18 . HFK H 3 .   ? -17.934 -52.324  -35.751 1.00 50.79  ? 402 HFK B C18 1 
HETATM 10757 C C23 . HFK H 3 .   ? -18.096 -51.788  -32.155 1.00 49.89  ? 402 HFK B C23 1 
HETATM 10758 C C25 . HFK H 3 .   ? -15.736 -52.173  -31.690 1.00 49.70  ? 402 HFK B C25 1 
HETATM 10759 N N14 . HFK H 3 .   ? -20.607 -51.747  -36.631 1.00 54.56  ? 402 HFK B N14 1 
HETATM 10760 N N16 . HFK H 3 .   ? -19.643 -51.900  -39.003 1.00 53.41  ? 402 HFK B N16 1 
HETATM 10761 N N17 . HFK H 3 .   ? -18.428 -52.420  -37.102 1.00 52.37  ? 402 HFK B N17 1 
HETATM 10762 N N19 . HFK H 3 .   ? -16.661 -52.517  -35.382 1.00 50.41  ? 402 HFK B N19 1 
HETATM 10763 O O01 . HFK H 3 .   ? -23.884 -50.191  -39.086 1.00 80.89  ? 402 HFK B O01 1 
HETATM 10764 O O22 . HFK H 3 .   ? -18.674 -52.034  -34.679 1.00 50.18  ? 402 HFK B O22 1 
HETATM 10765 C C1  . GAL I 2 .   ? 20.450  -76.150  -40.929 1.00 39.36  ? 401 GAL C C1  1 
HETATM 10766 C C2  . GAL I 2 .   ? 20.749  -74.667  -40.739 1.00 36.61  ? 401 GAL C C2  1 
HETATM 10767 C C3  . GAL I 2 .   ? 19.961  -73.844  -41.779 1.00 34.00  ? 401 GAL C C3  1 
HETATM 10768 C C4  . GAL I 2 .   ? 20.238  -74.372  -43.209 1.00 35.78  ? 401 GAL C C4  1 
HETATM 10769 C C5  . GAL I 2 .   ? 20.122  -75.899  -43.258 1.00 37.84  ? 401 GAL C C5  1 
HETATM 10770 C C6  . GAL I 2 .   ? 20.608  -76.519  -44.566 1.00 39.65  ? 401 GAL C C6  1 
HETATM 10771 O O1  . GAL I 2 .   ? 21.106  -76.932  -39.999 1.00 41.99  ? 401 GAL C O1  1 
HETATM 10772 O O2  . GAL I 2 .   ? 20.381  -74.212  -39.432 1.00 37.19  ? 401 GAL C O2  1 
HETATM 10773 O O3  . GAL I 2 .   ? 20.349  -72.477  -41.769 1.00 31.79  ? 401 GAL C O3  1 
HETATM 10774 O O4  . GAL I 2 .   ? 21.531  -73.974  -43.638 1.00 37.02  ? 401 GAL C O4  1 
HETATM 10775 O O5  . GAL I 2 .   ? 20.879  -76.531  -42.227 1.00 39.75  ? 401 GAL C O5  1 
HETATM 10776 O O6  . GAL I 2 .   ? 19.676  -76.272  -45.599 1.00 39.46  ? 401 GAL C O6  1 
HETATM 10777 N N1  . HGE J 4 .   ? 26.295  -73.929  -26.967 1.00 87.22  ? 402 HGE C N1  1 
HETATM 10778 C C4  . HGE J 4 .   ? 30.460  -76.096  -30.877 1.00 88.78  ? 402 HGE C C4  1 
HETATM 10779 C C5  . HGE J 4 .   ? 29.550  -76.327  -29.674 1.00 88.57  ? 402 HGE C C5  1 
HETATM 10780 C C6  . HGE J 4 .   ? 29.981  -73.953  -29.268 1.00 88.48  ? 402 HGE C C6  1 
HETATM 10781 C C7  . HGE J 4 .   ? 31.446  -74.261  -29.502 1.00 88.68  ? 402 HGE C C7  1 
HETATM 10782 C C8  . HGE J 4 .   ? 27.854  -74.993  -28.397 1.00 87.74  ? 402 HGE C C8  1 
HETATM 10783 C C10 . HGE J 4 .   ? 25.327  -74.689  -27.498 1.00 87.32  ? 402 HGE C C10 1 
HETATM 10784 O O1  . HGE J 4 .   ? 31.404  -73.325  -32.124 1.00 102.37 ? 402 HGE C O1  1 
HETATM 10785 C C2  . HGE J 4 .   ? 31.952  -74.411  -31.930 1.00 102.46 ? 402 HGE C C2  1 
HETATM 10786 O O   . HGE J 4 .   ? 32.846  -74.920  -32.887 1.00 102.58 ? 402 HGE C O   1 
HETATM 10787 C C1  . HGE J 4 .   ? 33.307  -73.977  -33.785 1.00 102.46 ? 402 HGE C C1  1 
HETATM 10788 C C   . HGE J 4 .   ? 34.638  -74.479  -34.387 1.00 102.31 ? 402 HGE C C   1 
HETATM 10789 C C3  . HGE J 4 .   ? 31.651  -75.212  -30.631 1.00 88.82  ? 402 HGE C C3  1 
HETATM 10790 N N   . HGE J 4 .   ? 29.240  -75.147  -28.889 1.00 88.31  ? 402 HGE C N   1 
HETATM 10791 N N2  . HGE J 4 .   ? 26.900  -75.725  -28.907 1.00 87.57  ? 402 HGE C N2  1 
HETATM 10792 C C11 . HGE J 4 .   ? 25.622  -75.596  -28.469 1.00 87.37  ? 402 HGE C C11 1 
HETATM 10793 C C9  . HGE J 4 .   ? 27.544  -74.066  -27.400 1.00 87.35  ? 402 HGE C C9  1 
HETATM 10794 C C10 . HFK K 3 .   ? 21.972  -80.920  -26.144 1.00 49.06  ? 403 HFK C C10 1 
HETATM 10795 C C13 . HFK K 3 .   ? 23.356  -78.417  -26.892 1.00 49.12  ? 403 HFK C C13 1 
HETATM 10796 C C15 . HFK K 3 .   ? 20.481  -78.607  -29.133 1.00 48.86  ? 403 HFK C C15 1 
HETATM 10797 C C20 . HFK K 3 .   ? 16.775  -77.461  -26.659 1.00 50.72  ? 403 HFK C C20 1 
HETATM 10798 C C21 . HFK K 3 .   ? 17.856  -77.707  -25.813 1.00 49.76  ? 403 HFK C C21 1 
HETATM 10799 C C24 . HFK K 3 .   ? 16.370  -77.599  -23.872 1.00 50.42  ? 403 HFK C C24 1 
HETATM 10800 C C26 . HFK K 3 .   ? 15.473  -77.281  -26.118 1.00 51.04  ? 403 HFK C C26 1 
HETATM 10801 C C02 . HFK K 3 .   ? 24.828  -79.393  -29.404 1.00 68.11  ? 403 HFK C C02 1 
HETATM 10802 C C03 . HFK K 3 .   ? 24.983  -80.267  -30.703 1.00 61.81  ? 403 HFK C C03 1 
HETATM 10803 C C04 . HFK K 3 .   ? 24.500  -79.585  -31.980 1.00 61.72  ? 403 HFK C C04 1 
HETATM 10804 C C05 . HFK K 3 .   ? 23.308  -78.599  -31.728 1.00 47.12  ? 403 HFK C C05 1 
HETATM 10805 C C06 . HFK K 3 .   ? 22.533  -78.988  -30.457 1.00 48.65  ? 403 HFK C C06 1 
HETATM 10806 C C07 . HFK K 3 .   ? 23.388  -78.825  -29.186 1.00 48.73  ? 403 HFK C C07 1 
HETATM 10807 C C08 . HFK K 3 .   ? 22.621  -79.253  -27.949 1.00 49.16  ? 403 HFK C C08 1 
HETATM 10808 C C09 . HFK K 3 .   ? 22.472  -80.725  -27.564 1.00 49.28  ? 403 HFK C C09 1 
HETATM 10809 C C11 . HFK K 3 .   ? 22.780  -80.119  -25.124 1.00 48.54  ? 403 HFK C C11 1 
HETATM 10810 C C12 . HFK K 3 .   ? 22.829  -78.639  -25.487 1.00 48.77  ? 403 HFK C C12 1 
HETATM 10811 C C18 . HFK K 3 .   ? 18.597  -77.680  -27.917 1.00 49.26  ? 403 HFK C C18 1 
HETATM 10812 C C23 . HFK K 3 .   ? 17.656  -77.776  -24.405 1.00 50.08  ? 403 HFK C C23 1 
HETATM 10813 C C25 . HFK K 3 .   ? 15.281  -77.351  -24.730 1.00 50.92  ? 403 HFK C C25 1 
HETATM 10814 N N14 . HFK K 3 .   ? 21.316  -78.539  -27.857 1.00 49.32  ? 403 HFK C N14 1 
HETATM 10815 N N16 . HFK K 3 .   ? 21.274  -78.253  -30.372 1.00 48.79  ? 403 HFK C N16 1 
HETATM 10816 N N17 . HFK K 3 .   ? 19.468  -77.740  -29.062 1.00 48.62  ? 403 HFK C N17 1 
HETATM 10817 N N19 . HFK K 3 .   ? 17.279  -77.450  -27.979 1.00 50.10  ? 403 HFK C N19 1 
HETATM 10818 O O01 . HFK K 3 .   ? 25.306  -80.143  -28.349 1.00 68.24  ? 403 HFK C O01 1 
HETATM 10819 O O22 . HFK K 3 .   ? 18.972  -77.834  -26.643 1.00 49.27  ? 403 HFK C O22 1 
HETATM 10820 O O   . HOH L 5 .   ? -39.826 -18.656  1.426   1.00 67.31  ? 501 HOH A O   1 
HETATM 10821 O O   . HOH L 5 .   ? -29.006 -0.120   2.483   1.00 45.12  ? 502 HOH A O   1 
HETATM 10822 O O   . HOH L 5 .   ? -16.317 -9.060   -18.136 1.00 46.19  ? 503 HOH A O   1 
HETATM 10823 O O   . HOH L 5 .   ? -19.398 -15.144  -22.857 1.00 30.88  ? 504 HOH A O   1 
HETATM 10824 O O   . HOH L 5 .   ? -10.998 -4.442   -47.102 1.00 59.65  ? 505 HOH A O   1 
HETATM 10825 O O   . HOH L 5 .   ? -20.235 -16.483  8.412   1.00 40.75  ? 506 HOH A O   1 
HETATM 10826 O O   . HOH L 5 .   ? -14.506 -26.000  -17.727 1.00 45.74  ? 507 HOH A O   1 
HETATM 10827 O O   . HOH L 5 .   ? -18.547 -11.896  -16.648 1.00 40.43  ? 508 HOH A O   1 
HETATM 10828 O O   . HOH L 5 .   ? -13.212 3.204    -24.084 1.00 53.80  ? 509 HOH A O   1 
HETATM 10829 O O   . HOH L 5 .   ? -15.928 1.758    -26.151 1.00 39.93  ? 510 HOH A O   1 
HETATM 10830 O O   . HOH L 5 .   ? -17.996 -12.708  -43.586 1.00 43.27  ? 511 HOH A O   1 
HETATM 10831 O O   . HOH L 5 .   ? -25.828 -10.033  -46.344 1.00 38.20  ? 512 HOH A O   1 
HETATM 10832 O O   . HOH L 5 .   ? -19.684 -14.156  6.257   1.00 33.80  ? 513 HOH A O   1 
HETATM 10833 O O   . HOH L 5 .   ? -22.063 5.222    -0.982  1.00 53.68  ? 514 HOH A O   1 
HETATM 10834 O O   . HOH L 5 .   ? -27.963 -31.764  -10.566 1.00 63.58  ? 515 HOH A O   1 
HETATM 10835 O O   . HOH L 5 .   ? -5.969  3.047    -42.637 1.00 55.20  ? 516 HOH A O   1 
HETATM 10836 O O   . HOH L 5 .   ? -30.276 -4.544   7.672   1.00 39.91  ? 517 HOH A O   1 
HETATM 10837 O O   . HOH L 5 .   ? -35.905 -10.772  -7.683  1.00 43.91  ? 518 HOH A O   1 
HETATM 10838 O O   . HOH L 5 .   ? -33.591 -30.002  -38.096 1.00 61.54  ? 519 HOH A O   1 
HETATM 10839 O O   . HOH L 5 .   ? -14.028 -9.640   -14.054 1.00 43.03  ? 520 HOH A O   1 
HETATM 10840 O O   . HOH L 5 .   ? -13.330 -7.161   -2.341  1.00 46.30  ? 521 HOH A O   1 
HETATM 10841 O O   . HOH L 5 .   ? -24.988 -26.384  -13.618 1.00 37.51  ? 522 HOH A O   1 
HETATM 10842 O O   . HOH L 5 .   ? -12.391 -16.271  -25.031 1.00 48.40  ? 523 HOH A O   1 
HETATM 10843 O O   . HOH L 5 .   ? -26.512 -7.968   14.506  1.00 40.73  ? 524 HOH A O   1 
HETATM 10844 O O   . HOH L 5 .   ? -12.602 -9.174   -40.999 1.00 39.74  ? 525 HOH A O   1 
HETATM 10845 O O   . HOH L 5 .   ? -21.709 -1.490   -39.205 1.00 47.70  ? 526 HOH A O   1 
HETATM 10846 O O   . HOH L 5 .   ? -24.707 4.207    -33.115 1.00 50.57  ? 527 HOH A O   1 
HETATM 10847 O O   . HOH L 5 .   ? -16.404 -25.935  -28.992 1.00 33.08  ? 528 HOH A O   1 
HETATM 10848 O O   . HOH L 5 .   ? -14.638 -6.323   4.701   1.00 51.19  ? 529 HOH A O   1 
HETATM 10849 O O   . HOH L 5 .   ? -2.438  -5.304   -23.609 1.00 34.42  ? 530 HOH A O   1 
HETATM 10850 O O   . HOH L 5 .   ? -2.698  -19.580  -34.781 1.00 60.14  ? 531 HOH A O   1 
HETATM 10851 O O   . HOH L 5 .   ? -16.357 -14.859  -19.736 1.00 49.57  ? 532 HOH A O   1 
H