data_6Q6Q
# 
_entry.id   6Q6Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6Q6Q         
WWPDB D_1200013134 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4UHX unspecified 
PDB . 4UHW unspecified 
PDB . 5EPG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q6Q 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mota, C.'         1 ? 
'Coelho, C.'       2 ? 
'Santos-Silva, T.' 3 ? 
'Romao, M.J.'      4 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? NE ? ? primary 'Febs Open Bio'    ? ? 2211-5463 ? ? 9  ? 925 934 
;Human aldehyde oxidase (hAOX1): structure determination of the Moco-free form of the natural variant G1269R and biophysical studies of single nucleotide polymorphisms.
;
2019 ? 10.1002/2211-5463.12617 30985987 ? 
? ? ? ? ? ? ? NE ? ? 1       'Febs Open Bio'    ? ? 2211-5463 ? ? ?  ? ?   ?   
;Human aldehyde oxidase (hAOX1): structure determination of the Moco‐free form of the natural variant G1269R and biophysical studies of single nucleotide polymorphisms
;
2019 ? 10.1002/2211-5463       ?        ? 
? ? ? ? ? ? ? US ? ? 2       'Nat. Chem. Biol.' ? ? 1552-4469 ? ? 11 ? 779 783 
'Structural insights into xenobiotic and inhibitor binding to human aldehyde oxidase' 2015 ? 10.1038/nchembio.1895   26322824 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mota, C.'         1  0000-0002-8999-0420 
primary 'Esmaeeli, M.'     2  ?                   
primary 'Coelho, C.'       3  ?                   
primary 'Santos-Silva, T.' 4  ?                   
primary 'Wolff, M.'        5  ?                   
primary 'Foti, A.'         6  ?                   
primary 'Leimkuhler, S.'   7  ?                   
primary 'Romao, M.J.'      8  ?                   
1       'Mota, C.'         9  ?                   
1       'Esmaeeli, M.'     10 ?                   
1       'Coelho, C.'       11 ?                   
1       'Santos-Silva, T.' 12 ?                   
1       'Wolff, M.'        13 ?                   
1       'Foti, A.'         14 ?                   
1       'Leimkuhler, S.'   15 ?                   
1       'Romao, M.J.'      16 ?                   
2       'Coelho, C.'       17 ?                   
2       'Foti, A.'         18 ?                   
2       'Hartmann, T.'     19 ?                   
2       'Santos-Silva, T.' 20 ?                   
2       'Leimkuhler, S.'   21 ?                   
2       'Romao, M.J.'      22 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q6Q 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     148.197 
_cell.length_a_esd                 ? 
_cell.length_b                     148.197 
_cell.length_b_esd                 ? 
_cell.length_c                     132.204 
_cell.length_c_esd                 ? 
_cell.volume                       2903510.626 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q6Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            'P 4n 2n' 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aldehyde oxidase'            148196.641 1  1.2.3.1,1.17.3.- ? ? ? 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'  175.820    2  ?                ? ? ? 
3 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE' 785.550    1  ?                ? ? ? 
4 non-polymer syn 'MALONATE ION'                102.046    4  ?                ? ? ? 
5 water       nat water                         18.015     16 ?                ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Aldehyde oxidase 1,Azaheterocycle hydroxylase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLRESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLRESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ASP n 
1 3    ARG n 
1 4    ALA n 
1 5    SER n 
1 6    GLU n 
1 7    LEU n 
1 8    LEU n 
1 9    PHE n 
1 10   TYR n 
1 11   VAL n 
1 12   ASN n 
1 13   GLY n 
1 14   ARG n 
1 15   LYS n 
1 16   VAL n 
1 17   ILE n 
1 18   GLU n 
1 19   LYS n 
1 20   ASN n 
1 21   VAL n 
1 22   ASP n 
1 23   PRO n 
1 24   GLU n 
1 25   THR n 
1 26   MET n 
1 27   LEU n 
1 28   LEU n 
1 29   PRO n 
1 30   TYR n 
1 31   LEU n 
1 32   ARG n 
1 33   LYS n 
1 34   LYS n 
1 35   LEU n 
1 36   ARG n 
1 37   LEU n 
1 38   THR n 
1 39   GLY n 
1 40   THR n 
1 41   LYS n 
1 42   TYR n 
1 43   GLY n 
1 44   CYS n 
1 45   GLY n 
1 46   GLY n 
1 47   GLY n 
1 48   GLY n 
1 49   CYS n 
1 50   GLY n 
1 51   ALA n 
1 52   CYS n 
1 53   THR n 
1 54   VAL n 
1 55   MET n 
1 56   ILE n 
1 57   SER n 
1 58   ARG n 
1 59   TYR n 
1 60   ASN n 
1 61   PRO n 
1 62   ILE n 
1 63   THR n 
1 64   LYS n 
1 65   ARG n 
1 66   ILE n 
1 67   ARG n 
1 68   HIS n 
1 69   HIS n 
1 70   PRO n 
1 71   ALA n 
1 72   ASN n 
1 73   ALA n 
1 74   CYS n 
1 75   LEU n 
1 76   ILE n 
1 77   PRO n 
1 78   ILE n 
1 79   CYS n 
1 80   SER n 
1 81   LEU n 
1 82   TYR n 
1 83   GLY n 
1 84   ALA n 
1 85   ALA n 
1 86   VAL n 
1 87   THR n 
1 88   THR n 
1 89   VAL n 
1 90   GLU n 
1 91   GLY n 
1 92   ILE n 
1 93   GLY n 
1 94   SER n 
1 95   THR n 
1 96   HIS n 
1 97   THR n 
1 98   ARG n 
1 99   ILE n 
1 100  HIS n 
1 101  PRO n 
1 102  VAL n 
1 103  GLN n 
1 104  GLU n 
1 105  ARG n 
1 106  ILE n 
1 107  ALA n 
1 108  LYS n 
1 109  CYS n 
1 110  HIS n 
1 111  GLY n 
1 112  THR n 
1 113  GLN n 
1 114  CYS n 
1 115  GLY n 
1 116  PHE n 
1 117  CYS n 
1 118  THR n 
1 119  PRO n 
1 120  GLY n 
1 121  MET n 
1 122  VAL n 
1 123  MET n 
1 124  SER n 
1 125  ILE n 
1 126  TYR n 
1 127  THR n 
1 128  LEU n 
1 129  LEU n 
1 130  ARG n 
1 131  ASN n 
1 132  HIS n 
1 133  PRO n 
1 134  GLU n 
1 135  PRO n 
1 136  THR n 
1 137  LEU n 
1 138  ASP n 
1 139  GLN n 
1 140  LEU n 
1 141  THR n 
1 142  ASP n 
1 143  ALA n 
1 144  LEU n 
1 145  GLY n 
1 146  GLY n 
1 147  ASN n 
1 148  LEU n 
1 149  CYS n 
1 150  ARG n 
1 151  CYS n 
1 152  THR n 
1 153  GLY n 
1 154  TYR n 
1 155  ARG n 
1 156  PRO n 
1 157  ILE n 
1 158  ILE n 
1 159  ASP n 
1 160  ALA n 
1 161  CYS n 
1 162  LYS n 
1 163  THR n 
1 164  PHE n 
1 165  CYS n 
1 166  LYS n 
1 167  THR n 
1 168  SER n 
1 169  GLY n 
1 170  CYS n 
1 171  CYS n 
1 172  GLN n 
1 173  SER n 
1 174  LYS n 
1 175  GLU n 
1 176  ASN n 
1 177  GLY n 
1 178  VAL n 
1 179  CYS n 
1 180  CYS n 
1 181  LEU n 
1 182  ASP n 
1 183  GLN n 
1 184  GLY n 
1 185  ILE n 
1 186  ASN n 
1 187  GLY n 
1 188  LEU n 
1 189  PRO n 
1 190  GLU n 
1 191  PHE n 
1 192  GLU n 
1 193  GLU n 
1 194  GLY n 
1 195  SER n 
1 196  LYS n 
1 197  THR n 
1 198  SER n 
1 199  PRO n 
1 200  LYS n 
1 201  LEU n 
1 202  PHE n 
1 203  ALA n 
1 204  GLU n 
1 205  GLU n 
1 206  GLU n 
1 207  PHE n 
1 208  LEU n 
1 209  PRO n 
1 210  LEU n 
1 211  ASP n 
1 212  PRO n 
1 213  THR n 
1 214  GLN n 
1 215  GLU n 
1 216  LEU n 
1 217  ILE n 
1 218  PHE n 
1 219  PRO n 
1 220  PRO n 
1 221  GLU n 
1 222  LEU n 
1 223  MET n 
1 224  ILE n 
1 225  MET n 
1 226  ALA n 
1 227  GLU n 
1 228  LYS n 
1 229  GLN n 
1 230  SER n 
1 231  GLN n 
1 232  ARG n 
1 233  THR n 
1 234  ARG n 
1 235  VAL n 
1 236  PHE n 
1 237  GLY n 
1 238  SER n 
1 239  GLU n 
1 240  ARG n 
1 241  MET n 
1 242  MET n 
1 243  TRP n 
1 244  PHE n 
1 245  SER n 
1 246  PRO n 
1 247  VAL n 
1 248  THR n 
1 249  LEU n 
1 250  LYS n 
1 251  GLU n 
1 252  LEU n 
1 253  LEU n 
1 254  GLU n 
1 255  PHE n 
1 256  LYS n 
1 257  PHE n 
1 258  LYS n 
1 259  TYR n 
1 260  PRO n 
1 261  GLN n 
1 262  ALA n 
1 263  PRO n 
1 264  VAL n 
1 265  ILE n 
1 266  MET n 
1 267  GLY n 
1 268  ASN n 
1 269  THR n 
1 270  SER n 
1 271  VAL n 
1 272  GLY n 
1 273  PRO n 
1 274  GLU n 
1 275  VAL n 
1 276  LYS n 
1 277  PHE n 
1 278  LYS n 
1 279  GLY n 
1 280  VAL n 
1 281  PHE n 
1 282  HIS n 
1 283  PRO n 
1 284  VAL n 
1 285  ILE n 
1 286  ILE n 
1 287  SER n 
1 288  PRO n 
1 289  ASP n 
1 290  ARG n 
1 291  ILE n 
1 292  GLU n 
1 293  GLU n 
1 294  LEU n 
1 295  SER n 
1 296  VAL n 
1 297  VAL n 
1 298  ASN n 
1 299  HIS n 
1 300  ALA n 
1 301  TYR n 
1 302  ASN n 
1 303  GLY n 
1 304  LEU n 
1 305  THR n 
1 306  LEU n 
1 307  GLY n 
1 308  ALA n 
1 309  GLY n 
1 310  LEU n 
1 311  SER n 
1 312  LEU n 
1 313  ALA n 
1 314  GLN n 
1 315  VAL n 
1 316  LYS n 
1 317  ASP n 
1 318  ILE n 
1 319  LEU n 
1 320  ALA n 
1 321  ASP n 
1 322  VAL n 
1 323  VAL n 
1 324  GLN n 
1 325  LYS n 
1 326  LEU n 
1 327  PRO n 
1 328  GLU n 
1 329  GLU n 
1 330  LYS n 
1 331  THR n 
1 332  GLN n 
1 333  MET n 
1 334  TYR n 
1 335  HIS n 
1 336  ALA n 
1 337  LEU n 
1 338  LEU n 
1 339  LYS n 
1 340  HIS n 
1 341  LEU n 
1 342  GLY n 
1 343  THR n 
1 344  LEU n 
1 345  ALA n 
1 346  GLY n 
1 347  SER n 
1 348  GLN n 
1 349  ILE n 
1 350  ARG n 
1 351  ASN n 
1 352  MET n 
1 353  ALA n 
1 354  SER n 
1 355  LEU n 
1 356  GLY n 
1 357  GLY n 
1 358  HIS n 
1 359  ILE n 
1 360  ILE n 
1 361  SER n 
1 362  ARG n 
1 363  HIS n 
1 364  PRO n 
1 365  ASP n 
1 366  SER n 
1 367  ASP n 
1 368  LEU n 
1 369  ASN n 
1 370  PRO n 
1 371  ILE n 
1 372  LEU n 
1 373  ALA n 
1 374  VAL n 
1 375  GLY n 
1 376  ASN n 
1 377  CYS n 
1 378  THR n 
1 379  LEU n 
1 380  ASN n 
1 381  LEU n 
1 382  LEU n 
1 383  SER n 
1 384  LYS n 
1 385  GLU n 
1 386  GLY n 
1 387  LYS n 
1 388  ARG n 
1 389  GLN n 
1 390  ILE n 
1 391  PRO n 
1 392  LEU n 
1 393  ASN n 
1 394  GLU n 
1 395  GLN n 
1 396  PHE n 
1 397  LEU n 
1 398  SER n 
1 399  LYS n 
1 400  CYS n 
1 401  PRO n 
1 402  ASN n 
1 403  ALA n 
1 404  ASP n 
1 405  LEU n 
1 406  LYS n 
1 407  PRO n 
1 408  GLN n 
1 409  GLU n 
1 410  ILE n 
1 411  LEU n 
1 412  VAL n 
1 413  SER n 
1 414  VAL n 
1 415  ASN n 
1 416  ILE n 
1 417  PRO n 
1 418  TYR n 
1 419  SER n 
1 420  ARG n 
1 421  LYS n 
1 422  TRP n 
1 423  GLU n 
1 424  PHE n 
1 425  VAL n 
1 426  SER n 
1 427  ALA n 
1 428  PHE n 
1 429  ARG n 
1 430  GLN n 
1 431  ALA n 
1 432  GLN n 
1 433  ARG n 
1 434  GLN n 
1 435  GLU n 
1 436  ASN n 
1 437  ALA n 
1 438  LEU n 
1 439  ALA n 
1 440  ILE n 
1 441  VAL n 
1 442  ASN n 
1 443  SER n 
1 444  GLY n 
1 445  MET n 
1 446  ARG n 
1 447  VAL n 
1 448  PHE n 
1 449  PHE n 
1 450  GLY n 
1 451  GLU n 
1 452  GLY n 
1 453  ASP n 
1 454  GLY n 
1 455  ILE n 
1 456  ILE n 
1 457  ARG n 
1 458  GLU n 
1 459  LEU n 
1 460  CYS n 
1 461  ILE n 
1 462  SER n 
1 463  TYR n 
1 464  GLY n 
1 465  GLY n 
1 466  VAL n 
1 467  GLY n 
1 468  PRO n 
1 469  ALA n 
1 470  THR n 
1 471  ILE n 
1 472  CYS n 
1 473  ALA n 
1 474  LYS n 
1 475  ASN n 
1 476  SER n 
1 477  CYS n 
1 478  GLN n 
1 479  LYS n 
1 480  LEU n 
1 481  ILE n 
1 482  GLY n 
1 483  ARG n 
1 484  HIS n 
1 485  TRP n 
1 486  ASN n 
1 487  GLU n 
1 488  GLN n 
1 489  MET n 
1 490  LEU n 
1 491  ASP n 
1 492  ILE n 
1 493  ALA n 
1 494  CYS n 
1 495  ARG n 
1 496  LEU n 
1 497  ILE n 
1 498  LEU n 
1 499  ASN n 
1 500  GLU n 
1 501  VAL n 
1 502  SER n 
1 503  LEU n 
1 504  LEU n 
1 505  GLY n 
1 506  SER n 
1 507  ALA n 
1 508  PRO n 
1 509  GLY n 
1 510  GLY n 
1 511  LYS n 
1 512  VAL n 
1 513  GLU n 
1 514  PHE n 
1 515  LYS n 
1 516  ARG n 
1 517  THR n 
1 518  LEU n 
1 519  ILE n 
1 520  ILE n 
1 521  SER n 
1 522  PHE n 
1 523  LEU n 
1 524  PHE n 
1 525  LYS n 
1 526  PHE n 
1 527  TYR n 
1 528  LEU n 
1 529  GLU n 
1 530  VAL n 
1 531  SER n 
1 532  GLN n 
1 533  ILE n 
1 534  LEU n 
1 535  LYS n 
1 536  LYS n 
1 537  MET n 
1 538  ASP n 
1 539  PRO n 
1 540  VAL n 
1 541  HIS n 
1 542  TYR n 
1 543  PRO n 
1 544  SER n 
1 545  LEU n 
1 546  ALA n 
1 547  ASP n 
1 548  LYS n 
1 549  TYR n 
1 550  GLU n 
1 551  SER n 
1 552  ALA n 
1 553  LEU n 
1 554  GLU n 
1 555  ASP n 
1 556  LEU n 
1 557  HIS n 
1 558  SER n 
1 559  LYS n 
1 560  HIS n 
1 561  HIS n 
1 562  CYS n 
1 563  SER n 
1 564  THR n 
1 565  LEU n 
1 566  LYS n 
1 567  TYR n 
1 568  GLN n 
1 569  ASN n 
1 570  ILE n 
1 571  GLY n 
1 572  PRO n 
1 573  LYS n 
1 574  GLN n 
1 575  HIS n 
1 576  PRO n 
1 577  GLU n 
1 578  ASP n 
1 579  PRO n 
1 580  ILE n 
1 581  GLY n 
1 582  HIS n 
1 583  PRO n 
1 584  ILE n 
1 585  MET n 
1 586  HIS n 
1 587  LEU n 
1 588  SER n 
1 589  GLY n 
1 590  VAL n 
1 591  LYS n 
1 592  HIS n 
1 593  ALA n 
1 594  THR n 
1 595  GLY n 
1 596  GLU n 
1 597  ALA n 
1 598  ILE n 
1 599  TYR n 
1 600  CYS n 
1 601  ASP n 
1 602  ASP n 
1 603  MET n 
1 604  PRO n 
1 605  LEU n 
1 606  VAL n 
1 607  ASP n 
1 608  GLN n 
1 609  GLU n 
1 610  LEU n 
1 611  PHE n 
1 612  LEU n 
1 613  THR n 
1 614  PHE n 
1 615  VAL n 
1 616  THR n 
1 617  SER n 
1 618  SER n 
1 619  ARG n 
1 620  ALA n 
1 621  HIS n 
1 622  ALA n 
1 623  LYS n 
1 624  ILE n 
1 625  VAL n 
1 626  SER n 
1 627  ILE n 
1 628  ASP n 
1 629  LEU n 
1 630  SER n 
1 631  GLU n 
1 632  ALA n 
1 633  LEU n 
1 634  SER n 
1 635  MET n 
1 636  PRO n 
1 637  GLY n 
1 638  VAL n 
1 639  VAL n 
1 640  ASP n 
1 641  ILE n 
1 642  MET n 
1 643  THR n 
1 644  ALA n 
1 645  GLU n 
1 646  HIS n 
1 647  LEU n 
1 648  SER n 
1 649  ASP n 
1 650  VAL n 
1 651  ASN n 
1 652  SER n 
1 653  PHE n 
1 654  CYS n 
1 655  PHE n 
1 656  PHE n 
1 657  THR n 
1 658  GLU n 
1 659  ALA n 
1 660  GLU n 
1 661  LYS n 
1 662  PHE n 
1 663  LEU n 
1 664  ALA n 
1 665  THR n 
1 666  ASP n 
1 667  LYS n 
1 668  VAL n 
1 669  PHE n 
1 670  CYS n 
1 671  VAL n 
1 672  GLY n 
1 673  GLN n 
1 674  LEU n 
1 675  VAL n 
1 676  CYS n 
1 677  ALA n 
1 678  VAL n 
1 679  LEU n 
1 680  ALA n 
1 681  ASP n 
1 682  SER n 
1 683  GLU n 
1 684  VAL n 
1 685  GLN n 
1 686  ALA n 
1 687  LYS n 
1 688  ARG n 
1 689  ALA n 
1 690  ALA n 
1 691  LYS n 
1 692  ARG n 
1 693  VAL n 
1 694  LYS n 
1 695  ILE n 
1 696  VAL n 
1 697  TYR n 
1 698  GLN n 
1 699  ASP n 
1 700  LEU n 
1 701  GLU n 
1 702  PRO n 
1 703  LEU n 
1 704  ILE n 
1 705  LEU n 
1 706  THR n 
1 707  ILE n 
1 708  GLU n 
1 709  GLU n 
1 710  SER n 
1 711  ILE n 
1 712  GLN n 
1 713  HIS n 
1 714  ASN n 
1 715  SER n 
1 716  SER n 
1 717  PHE n 
1 718  LYS n 
1 719  PRO n 
1 720  GLU n 
1 721  ARG n 
1 722  LYS n 
1 723  LEU n 
1 724  GLU n 
1 725  TYR n 
1 726  GLY n 
1 727  ASN n 
1 728  VAL n 
1 729  ASP n 
1 730  GLU n 
1 731  ALA n 
1 732  PHE n 
1 733  LYS n 
1 734  VAL n 
1 735  VAL n 
1 736  ASP n 
1 737  GLN n 
1 738  ILE n 
1 739  LEU n 
1 740  GLU n 
1 741  GLY n 
1 742  GLU n 
1 743  ILE n 
1 744  HIS n 
1 745  MET n 
1 746  GLY n 
1 747  GLY n 
1 748  GLN n 
1 749  GLU n 
1 750  HIS n 
1 751  PHE n 
1 752  TYR n 
1 753  MET n 
1 754  GLU n 
1 755  THR n 
1 756  GLN n 
1 757  SER n 
1 758  MET n 
1 759  LEU n 
1 760  VAL n 
1 761  VAL n 
1 762  PRO n 
1 763  LYS n 
1 764  GLY n 
1 765  GLU n 
1 766  ASP n 
1 767  GLN n 
1 768  GLU n 
1 769  MET n 
1 770  ASP n 
1 771  VAL n 
1 772  TYR n 
1 773  VAL n 
1 774  SER n 
1 775  THR n 
1 776  GLN n 
1 777  PHE n 
1 778  PRO n 
1 779  LYS n 
1 780  TYR n 
1 781  ILE n 
1 782  GLN n 
1 783  ASP n 
1 784  ILE n 
1 785  VAL n 
1 786  ALA n 
1 787  SER n 
1 788  THR n 
1 789  LEU n 
1 790  LYS n 
1 791  LEU n 
1 792  PRO n 
1 793  ALA n 
1 794  ASN n 
1 795  LYS n 
1 796  VAL n 
1 797  MET n 
1 798  CYS n 
1 799  HIS n 
1 800  VAL n 
1 801  ARG n 
1 802  ARG n 
1 803  VAL n 
1 804  GLY n 
1 805  GLY n 
1 806  ALA n 
1 807  PHE n 
1 808  GLY n 
1 809  GLY n 
1 810  LYS n 
1 811  VAL n 
1 812  LEU n 
1 813  LYS n 
1 814  THR n 
1 815  GLY n 
1 816  ILE n 
1 817  ILE n 
1 818  ALA n 
1 819  ALA n 
1 820  VAL n 
1 821  THR n 
1 822  ALA n 
1 823  PHE n 
1 824  ALA n 
1 825  ALA n 
1 826  ASN n 
1 827  LYS n 
1 828  HIS n 
1 829  GLY n 
1 830  ARG n 
1 831  ALA n 
1 832  VAL n 
1 833  ARG n 
1 834  CYS n 
1 835  VAL n 
1 836  LEU n 
1 837  GLU n 
1 838  ARG n 
1 839  GLY n 
1 840  GLU n 
1 841  ASP n 
1 842  MET n 
1 843  LEU n 
1 844  ILE n 
1 845  THR n 
1 846  GLY n 
1 847  GLY n 
1 848  ARG n 
1 849  HIS n 
1 850  PRO n 
1 851  TYR n 
1 852  LEU n 
1 853  GLY n 
1 854  LYS n 
1 855  TYR n 
1 856  LYS n 
1 857  ALA n 
1 858  GLY n 
1 859  PHE n 
1 860  MET n 
1 861  ASN n 
1 862  ASP n 
1 863  GLY n 
1 864  ARG n 
1 865  ILE n 
1 866  LEU n 
1 867  ALA n 
1 868  LEU n 
1 869  ASP n 
1 870  MET n 
1 871  GLU n 
1 872  HIS n 
1 873  TYR n 
1 874  SER n 
1 875  ASN n 
1 876  ALA n 
1 877  GLY n 
1 878  ALA n 
1 879  SER n 
1 880  LEU n 
1 881  ASP n 
1 882  GLU n 
1 883  SER n 
1 884  LEU n 
1 885  PHE n 
1 886  VAL n 
1 887  ILE n 
1 888  GLU n 
1 889  MET n 
1 890  GLY n 
1 891  LEU n 
1 892  LEU n 
1 893  LYS n 
1 894  MET n 
1 895  ASP n 
1 896  ASN n 
1 897  ALA n 
1 898  TYR n 
1 899  LYS n 
1 900  PHE n 
1 901  PRO n 
1 902  ASN n 
1 903  LEU n 
1 904  ARG n 
1 905  CYS n 
1 906  ARG n 
1 907  GLY n 
1 908  TRP n 
1 909  ALA n 
1 910  CYS n 
1 911  ARG n 
1 912  THR n 
1 913  ASN n 
1 914  LEU n 
1 915  PRO n 
1 916  SER n 
1 917  ASN n 
1 918  THR n 
1 919  ALA n 
1 920  PHE n 
1 921  ARG n 
1 922  GLY n 
1 923  PHE n 
1 924  GLY n 
1 925  PHE n 
1 926  PRO n 
1 927  GLN n 
1 928  ALA n 
1 929  ALA n 
1 930  LEU n 
1 931  ILE n 
1 932  THR n 
1 933  GLU n 
1 934  SER n 
1 935  CYS n 
1 936  ILE n 
1 937  THR n 
1 938  GLU n 
1 939  VAL n 
1 940  ALA n 
1 941  ALA n 
1 942  LYS n 
1 943  CYS n 
1 944  GLY n 
1 945  LEU n 
1 946  SER n 
1 947  PRO n 
1 948  GLU n 
1 949  LYS n 
1 950  VAL n 
1 951  ARG n 
1 952  ILE n 
1 953  ILE n 
1 954  ASN n 
1 955  MET n 
1 956  TYR n 
1 957  LYS n 
1 958  GLU n 
1 959  ILE n 
1 960  ASP n 
1 961  GLN n 
1 962  THR n 
1 963  PRO n 
1 964  TYR n 
1 965  LYS n 
1 966  GLN n 
1 967  GLU n 
1 968  ILE n 
1 969  ASN n 
1 970  ALA n 
1 971  LYS n 
1 972  ASN n 
1 973  LEU n 
1 974  ILE n 
1 975  GLN n 
1 976  CYS n 
1 977  TRP n 
1 978  ARG n 
1 979  GLU n 
1 980  CYS n 
1 981  MET n 
1 982  ALA n 
1 983  MET n 
1 984  SER n 
1 985  SER n 
1 986  TYR n 
1 987  SER n 
1 988  LEU n 
1 989  ARG n 
1 990  LYS n 
1 991  VAL n 
1 992  ALA n 
1 993  VAL n 
1 994  GLU n 
1 995  LYS n 
1 996  PHE n 
1 997  ASN n 
1 998  ALA n 
1 999  GLU n 
1 1000 ASN n 
1 1001 TYR n 
1 1002 TRP n 
1 1003 LYS n 
1 1004 LYS n 
1 1005 LYS n 
1 1006 GLY n 
1 1007 LEU n 
1 1008 ALA n 
1 1009 MET n 
1 1010 VAL n 
1 1011 PRO n 
1 1012 LEU n 
1 1013 LYS n 
1 1014 PHE n 
1 1015 PRO n 
1 1016 VAL n 
1 1017 GLY n 
1 1018 LEU n 
1 1019 GLY n 
1 1020 SER n 
1 1021 ARG n 
1 1022 ALA n 
1 1023 ALA n 
1 1024 GLY n 
1 1025 GLN n 
1 1026 ALA n 
1 1027 ALA n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 VAL n 
1 1031 HIS n 
1 1032 ILE n 
1 1033 TYR n 
1 1034 LEU n 
1 1035 ASP n 
1 1036 GLY n 
1 1037 SER n 
1 1038 VAL n 
1 1039 LEU n 
1 1040 VAL n 
1 1041 THR n 
1 1042 HIS n 
1 1043 GLY n 
1 1044 GLY n 
1 1045 ILE n 
1 1046 GLU n 
1 1047 MET n 
1 1048 GLY n 
1 1049 GLN n 
1 1050 GLY n 
1 1051 VAL n 
1 1052 HIS n 
1 1053 THR n 
1 1054 LYS n 
1 1055 MET n 
1 1056 ILE n 
1 1057 GLN n 
1 1058 VAL n 
1 1059 VAL n 
1 1060 SER n 
1 1061 ARG n 
1 1062 GLU n 
1 1063 LEU n 
1 1064 ARG n 
1 1065 MET n 
1 1066 PRO n 
1 1067 MET n 
1 1068 SER n 
1 1069 ASN n 
1 1070 VAL n 
1 1071 HIS n 
1 1072 LEU n 
1 1073 ARG n 
1 1074 GLY n 
1 1075 THR n 
1 1076 SER n 
1 1077 THR n 
1 1078 GLU n 
1 1079 THR n 
1 1080 VAL n 
1 1081 PRO n 
1 1082 ASN n 
1 1083 ALA n 
1 1084 ASN n 
1 1085 ILE n 
1 1086 SER n 
1 1087 GLY n 
1 1088 GLY n 
1 1089 SER n 
1 1090 VAL n 
1 1091 VAL n 
1 1092 ALA n 
1 1093 ASP n 
1 1094 LEU n 
1 1095 ASN n 
1 1096 GLY n 
1 1097 LEU n 
1 1098 ALA n 
1 1099 VAL n 
1 1100 LYS n 
1 1101 ASP n 
1 1102 ALA n 
1 1103 CYS n 
1 1104 GLN n 
1 1105 THR n 
1 1106 LEU n 
1 1107 LEU n 
1 1108 LYS n 
1 1109 ARG n 
1 1110 LEU n 
1 1111 GLU n 
1 1112 PRO n 
1 1113 ILE n 
1 1114 ILE n 
1 1115 SER n 
1 1116 LYS n 
1 1117 ASN n 
1 1118 PRO n 
1 1119 LYS n 
1 1120 GLY n 
1 1121 THR n 
1 1122 TRP n 
1 1123 LYS n 
1 1124 ASP n 
1 1125 TRP n 
1 1126 ALA n 
1 1127 GLN n 
1 1128 THR n 
1 1129 ALA n 
1 1130 PHE n 
1 1131 ASP n 
1 1132 GLU n 
1 1133 SER n 
1 1134 ILE n 
1 1135 ASN n 
1 1136 LEU n 
1 1137 SER n 
1 1138 ALA n 
1 1139 VAL n 
1 1140 GLY n 
1 1141 TYR n 
1 1142 PHE n 
1 1143 ARG n 
1 1144 GLY n 
1 1145 TYR n 
1 1146 GLU n 
1 1147 SER n 
1 1148 ASP n 
1 1149 MET n 
1 1150 ASN n 
1 1151 TRP n 
1 1152 GLU n 
1 1153 LYS n 
1 1154 GLY n 
1 1155 GLU n 
1 1156 GLY n 
1 1157 GLN n 
1 1158 PRO n 
1 1159 PHE n 
1 1160 GLU n 
1 1161 TYR n 
1 1162 PHE n 
1 1163 VAL n 
1 1164 TYR n 
1 1165 GLY n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 CYS n 
1 1169 SER n 
1 1170 GLU n 
1 1171 VAL n 
1 1172 GLU n 
1 1173 ILE n 
1 1174 ASP n 
1 1175 CYS n 
1 1176 LEU n 
1 1177 THR n 
1 1178 GLY n 
1 1179 ASP n 
1 1180 HIS n 
1 1181 LYS n 
1 1182 ASN n 
1 1183 ILE n 
1 1184 ARG n 
1 1185 THR n 
1 1186 ASP n 
1 1187 ILE n 
1 1188 VAL n 
1 1189 MET n 
1 1190 ASP n 
1 1191 VAL n 
1 1192 GLY n 
1 1193 CYS n 
1 1194 SER n 
1 1195 ILE n 
1 1196 ASN n 
1 1197 PRO n 
1 1198 ALA n 
1 1199 ILE n 
1 1200 ASP n 
1 1201 ILE n 
1 1202 GLY n 
1 1203 GLN n 
1 1204 ILE n 
1 1205 GLU n 
1 1206 GLY n 
1 1207 ALA n 
1 1208 PHE n 
1 1209 ILE n 
1 1210 GLN n 
1 1211 GLY n 
1 1212 MET n 
1 1213 GLY n 
1 1214 LEU n 
1 1215 TYR n 
1 1216 THR n 
1 1217 ILE n 
1 1218 GLU n 
1 1219 GLU n 
1 1220 LEU n 
1 1221 ASN n 
1 1222 TYR n 
1 1223 SER n 
1 1224 PRO n 
1 1225 GLN n 
1 1226 GLY n 
1 1227 ILE n 
1 1228 LEU n 
1 1229 HIS n 
1 1230 THR n 
1 1231 ARG n 
1 1232 GLY n 
1 1233 PRO n 
1 1234 ASP n 
1 1235 GLN n 
1 1236 TYR n 
1 1237 LYS n 
1 1238 ILE n 
1 1239 PRO n 
1 1240 ALA n 
1 1241 ILE n 
1 1242 CYS n 
1 1243 ASP n 
1 1244 MET n 
1 1245 PRO n 
1 1246 THR n 
1 1247 GLU n 
1 1248 LEU n 
1 1249 HIS n 
1 1250 ILE n 
1 1251 ALA n 
1 1252 LEU n 
1 1253 LEU n 
1 1254 PRO n 
1 1255 PRO n 
1 1256 SER n 
1 1257 GLN n 
1 1258 ASN n 
1 1259 SER n 
1 1260 ASN n 
1 1261 THR n 
1 1262 LEU n 
1 1263 TYR n 
1 1264 SER n 
1 1265 SER n 
1 1266 LYS n 
1 1267 GLY n 
1 1268 LEU n 
1 1269 ARG n 
1 1270 GLU n 
1 1271 SER n 
1 1272 GLY n 
1 1273 VAL n 
1 1274 PHE n 
1 1275 LEU n 
1 1276 GLY n 
1 1277 CYS n 
1 1278 SER n 
1 1279 VAL n 
1 1280 PHE n 
1 1281 PHE n 
1 1282 ALA n 
1 1283 ILE n 
1 1284 HIS n 
1 1285 ASP n 
1 1286 ALA n 
1 1287 VAL n 
1 1288 SER n 
1 1289 ALA n 
1 1290 ALA n 
1 1291 ARG n 
1 1292 GLN n 
1 1293 GLU n 
1 1294 ARG n 
1 1295 GLY n 
1 1296 LEU n 
1 1297 HIS n 
1 1298 GLY n 
1 1299 PRO n 
1 1300 LEU n 
1 1301 THR n 
1 1302 LEU n 
1 1303 ASN n 
1 1304 SER n 
1 1305 PRO n 
1 1306 LEU n 
1 1307 THR n 
1 1308 PRO n 
1 1309 GLU n 
1 1310 LYS n 
1 1311 ILE n 
1 1312 ARG n 
1 1313 MET n 
1 1314 ALA n 
1 1315 CYS n 
1 1316 GLU n 
1 1317 ASP n 
1 1318 LYS n 
1 1319 PHE n 
1 1320 THR n 
1 1321 LYS n 
1 1322 MET n 
1 1323 ILE n 
1 1324 PRO n 
1 1325 ARG n 
1 1326 ASP n 
1 1327 GLU n 
1 1328 PRO n 
1 1329 GLY n 
1 1330 SER n 
1 1331 TYR n 
1 1332 VAL n 
1 1333 PRO n 
1 1334 TRP n 
1 1335 ASN n 
1 1336 VAL n 
1 1337 PRO n 
1 1338 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1338 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AOX1, AO' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOXA_HUMAN 
_struct_ref.pdbx_db_accession          Q06278 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6Q6Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1338 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q06278 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1338 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1338 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             6Q6Q 
_struct_ref_seq_dif.mon_id                       ARG 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1269 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q06278 
_struct_ref_seq_dif.db_mon_id                    GLY 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          1269 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1269 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ? 'C27 H33 N9 O15 P2' 785.550 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER'  ? 'Fe2 S2'            175.820 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'     149.211 
MLI non-polymer         . 'MALONATE ION'                ? 'C3 H2 O4 -2'       102.046 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q6Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.43 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG3350, Sodium malonate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-07-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID30B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.976 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID30B 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            84.2337235282 
_reflns.entry_id                         6Q6Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.10 
_reflns.d_resolution_low                 49.40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50950 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.4 
_reflns.pdbx_Rmerge_I_obs                0.110 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.110 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.117 
_reflns.pdbx_Rpim_I_all                  0.040 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.10 
_reflns_shell.d_res_low                   3.29 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.921 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             0.921 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.981 
_reflns_shell.pdbx_Rpim_I_all             0.331 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               79.6965461748 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Q6Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.10003770671 
_refine.ls_d_res_low                             46.8640062404 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     50950 
_refine.ls_number_reflns_R_free                  2433 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8295354351 
_refine.ls_percent_reflns_R_free                 4.77526987242 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19367591884 
_refine.ls_R_factor_R_free                       0.235662739667 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.191587822435 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.204487145437 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4UHX 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.729061676 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.384293005148 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10034 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             16 
_refine_hist.number_atoms_total               10139 
_refine_hist.d_res_high                       3.10003770671 
_refine_hist.d_res_low                        46.8640062404 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00738251802051 ? 10345 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.495980938659   ? 13976 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0420233353746  ? 1556  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00307245594287 ? 1794  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 4.84018791054    ? 6246  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1    3.1633  . . 142 2849 100.0         . . . 0.400421382549 . 0.335246426087 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1633 3.2321  . . 146 2857 100.0         . . . 0.290143792138 . 0.293508183452 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2321 3.3072  . . 144 2888 100.0         . . . 0.328647937837 . 0.272483179338 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3072 3.3899  . . 154 2827 100.0         . . . 0.309649496654 . 0.257052268887 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3899 3.4815  . . 153 2854 100.0         . . . 0.304497270406 . 0.247954892649 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4815 3.584   . . 159 2823 99.9664767013 . . . 0.228311634678 . 0.233087157477 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.584  3.6996  . . 129 2894 100.0         . . . 0.258038908744 . 0.22176532847  . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6996 3.8318  . . 119 2856 99.8657267539 . . . 0.291585617511 . 0.201972699979 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8318 3.9851  . . 155 2854 100.0         . . . 0.248170836403 . 0.199866724098 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9851 4.1664  . . 164 2828 99.9331997328 . . . 0.224079669458 . 0.197430633334 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1664 4.3859  . . 134 2868 100.0         . . . 0.260413928093 . 0.187197437469 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3859 4.6604  . . 151 2861 99.9668104879 . . . 0.209622656608 . 0.17228113257  . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6604 5.0199  . . 154 2826 99.765651155  . . . 0.202047134904 . 0.160195157685 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0199 5.5243  . . 130 2887 99.7025776603 . . . 0.182866583204 . 0.167090918065 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5243 6.3221  . . 141 2853 99.7667444185 . . . 0.218107196274 . 0.186344707773 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3221 7.9588  . . 106 2867 99.3981945838 . . . 0.231208433426 . 0.177956533446 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.9588 46.8693 . . 152 2825 98.7723954877 . . . 0.202692538695 . 0.142788775071 . . . . . . . . . . 
# 
_struct.entry_id                     6Q6Q 
_struct.title                        'Human aldehyde oxidase SNP G1269R' 
_struct.pdbx_descriptor              'Aldehyde oxidase (E.C.1.2.3.1,1.17.3.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q6Q 
_struct_keywords.text            'Single-nucleotide Polymorphism, Moco-free form, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 26   ? LYS A 34   ? MET A 26   LYS A 34   1 ? 9  
HELX_P HELX_P2  AA2 CYS A 74   ? ILE A 76   ? CYS A 74   ILE A 76   5 ? 3  
HELX_P HELX_P3  AA3 PRO A 77   ? TYR A 82   ? PRO A 77   TYR A 82   5 ? 6  
HELX_P HELX_P4  AA4 THR A 88   ? GLY A 93   ? THR A 88   GLY A 93   1 ? 6  
HELX_P HELX_P5  AA5 HIS A 100  ? CYS A 109  ? HIS A 100  CYS A 109  1 ? 10 
HELX_P HELX_P6  AA6 CYS A 117  ? HIS A 132  ? CYS A 117  HIS A 132  1 ? 16 
HELX_P HELX_P7  AA7 THR A 136  ? LEU A 144  ? THR A 136  LEU A 144  1 ? 9  
HELX_P HELX_P8  AA8 GLY A 145  ? ASN A 147  ? GLY A 145  ASN A 147  5 ? 3  
HELX_P HELX_P9  AA9 TYR A 154  ? THR A 163  ? TYR A 154  THR A 163  1 ? 10 
HELX_P HELX_P10 AB1 ALA A 203  ? PHE A 207  ? ALA A 203  PHE A 207  5 ? 5  
HELX_P HELX_P11 AB2 PRO A 219  ? LYS A 228  ? PRO A 219  LYS A 228  1 ? 10 
HELX_P HELX_P12 AB3 THR A 248  ? TYR A 259  ? THR A 248  TYR A 259  1 ? 12 
HELX_P HELX_P13 AB4 SER A 270  ? LYS A 278  ? SER A 270  LYS A 278  1 ? 9  
HELX_P HELX_P14 AB5 ILE A 291  ? SER A 295  ? ILE A 291  SER A 295  5 ? 5  
HELX_P HELX_P15 AB6 SER A 311  ? VAL A 323  ? SER A 311  VAL A 323  1 ? 13 
HELX_P HELX_P16 AB7 THR A 331  ? THR A 343  ? THR A 331  THR A 343  1 ? 13 
HELX_P HELX_P17 AB8 GLY A 346  ? ALA A 353  ? GLY A 346  ALA A 353  1 ? 8  
HELX_P HELX_P18 AB9 SER A 354  ? ARG A 362  ? SER A 354  ARG A 362  1 ? 9  
HELX_P HELX_P19 AC1 LEU A 368  ? VAL A 374  ? LEU A 368  VAL A 374  1 ? 7  
HELX_P HELX_P20 AC2 ASN A 393  ? SER A 398  ? ASN A 393  SER A 398  1 ? 6  
HELX_P HELX_P21 AC3 ALA A 473  ? LYS A 479  ? ALA A 473  LYS A 479  1 ? 7  
HELX_P HELX_P22 AC4 ASN A 486  ? VAL A 501  ? ASN A 486  VAL A 501  1 ? 16 
HELX_P HELX_P23 AC5 LYS A 511  ? ASP A 538  ? LYS A 511  ASP A 538  1 ? 28 
HELX_P HELX_P24 AC6 ALA A 546  ? GLU A 554  ? ALA A 546  GLU A 554  5 ? 9  
HELX_P HELX_P25 AC7 SER A 588  ? GLY A 595  ? SER A 588  GLY A 595  1 ? 8  
HELX_P HELX_P26 AC8 LEU A 629  ? SER A 634  ? LEU A 629  SER A 634  1 ? 6  
HELX_P HELX_P27 AC9 THR A 643  ? VAL A 650  ? THR A 643  VAL A 650  5 ? 8  
HELX_P HELX_P28 AD1 SER A 682  ? LYS A 691  ? SER A 682  LYS A 691  1 ? 10 
HELX_P HELX_P29 AD2 THR A 706  ? GLN A 712  ? THR A 706  GLN A 712  1 ? 7  
HELX_P HELX_P30 AD3 GLU A 730  ? VAL A 734  ? GLU A 730  VAL A 734  5 ? 5  
HELX_P HELX_P31 AD4 PHE A 777  ? LEU A 789  ? PHE A 777  LEU A 789  1 ? 13 
HELX_P HELX_P32 AD5 PRO A 792  ? ASN A 794  ? PRO A 792  ASN A 794  5 ? 3  
HELX_P HELX_P33 AD6 VAL A 811  ? GLY A 829  ? VAL A 811  GLY A 829  1 ? 19 
HELX_P HELX_P34 AD7 GLU A 837  ? THR A 845  ? GLU A 837  THR A 845  1 ? 9  
HELX_P HELX_P35 AD8 LEU A 884  ? MET A 894  ? LEU A 884  MET A 894  1 ? 11 
HELX_P HELX_P36 AD9 GLY A 924  ? GLY A 944  ? GLY A 924  GLY A 944  1 ? 21 
HELX_P HELX_P37 AE1 SER A 946  ? ASN A 954  ? SER A 946  ASN A 954  1 ? 9  
HELX_P HELX_P38 AE2 ALA A 970  ? SER A 985  ? ALA A 970  SER A 985  1 ? 16 
HELX_P HELX_P39 AE3 SER A 985  ? ASN A 1000 ? SER A 985  ASN A 1000 1 ? 16 
HELX_P HELX_P40 AE4 ARG A 1021 ? GLN A 1025 ? ARG A 1021 GLN A 1025 5 ? 5  
HELX_P HELX_P41 AE5 GLY A 1050 ? ARG A 1064 ? GLY A 1050 ARG A 1064 1 ? 15 
HELX_P HELX_P42 AE6 PRO A 1066 ? SER A 1068 ? PRO A 1066 SER A 1068 5 ? 3  
HELX_P HELX_P43 AE7 VAL A 1090 ? LEU A 1110 ? VAL A 1090 LEU A 1110 1 ? 21 
HELX_P HELX_P44 AE8 LEU A 1110 ? ASN A 1117 ? LEU A 1110 ASN A 1117 1 ? 8  
HELX_P HELX_P45 AE9 THR A 1121 ? GLU A 1132 ? THR A 1121 GLU A 1132 1 ? 12 
HELX_P HELX_P46 AF1 ASN A 1196 ? THR A 1216 ? ASN A 1196 THR A 1216 1 ? 21 
HELX_P HELX_P47 AF2 ARG A 1231 ? GLN A 1235 ? ARG A 1231 GLN A 1235 5 ? 5  
HELX_P HELX_P48 AF3 THR A 1261 ? SER A 1265 ? THR A 1261 SER A 1265 5 ? 5  
HELX_P HELX_P49 AF4 SER A 1271 ? GLY A 1276 ? SER A 1271 GLY A 1276 1 ? 6  
HELX_P HELX_P50 AF5 CYS A 1277 ? ARG A 1294 ? CYS A 1277 ARG A 1294 1 ? 18 
HELX_P HELX_P51 AF6 THR A 1307 ? CYS A 1315 ? THR A 1307 CYS A 1315 1 ? 9  
HELX_P HELX_P52 AF7 ASP A 1317 ? ILE A 1323 ? ASP A 1317 ILE A 1323 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 44  N  ? ? ? 1_555 C FES . FE1 ? ? A CYS 44  A FES 3002 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc2 metalc ? ? A CYS 44  SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 44  A FES 3002 1_555 ? ? ? ? ? ? ? 2.676 ? 
metalc3 metalc ? ? A CYS 49  SG ? ? ? 1_555 C FES . FE1 ? ? A CYS 49  A FES 3002 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc4 metalc ? ? A CYS 52  SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 52  A FES 3002 1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc5 metalc ? ? A CYS 74  SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 74  A FES 3002 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc6 metalc ? ? A CYS 114 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 114 A FES 3001 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc7 metalc ? ? A CYS 117 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 117 A FES 3001 1_555 ? ? ? ? ? ? ? 2.226 ? 
metalc8 metalc ? ? A CYS 149 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 149 A FES 3001 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc9 metalc ? ? A CYS 151 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 151 A FES 3001 1_555 ? ? ? ? ? ? ? 2.577 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 701  A . ? GLU 701  A PRO 702  A ? PRO 702  A 1 1.19  
2 SER 1304 A . ? SER 1304 A PRO 1305 A ? PRO 1305 A 1 -0.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 8 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA6 6 7 ? parallel      
AA6 7 8 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 14   ? LYS A 19   ? ARG A 14   LYS A 19   
AA1 2 GLU A 6    ? VAL A 11   ? GLU A 6    VAL A 11   
AA1 3 ALA A 85   ? THR A 87   ? ALA A 85   THR A 87   
AA1 4 THR A 53   ? ASN A 60   ? THR A 53   ASN A 60   
AA1 5 ARG A 65   ? ASN A 72   ? ARG A 65   ASN A 72   
AA2 1 ARG A 234  ? GLY A 237  ? ARG A 234  GLY A 237  
AA2 2 MET A 242  ? SER A 245  ? MET A 242  SER A 245  
AA2 3 VAL A 284  ? ILE A 286  ? VAL A 284  ILE A 286  
AA3 1 VAL A 297  ? HIS A 299  ? VAL A 297  HIS A 299  
AA3 2 GLY A 303  ? GLY A 307  ? GLY A 303  GLY A 307  
AA3 3 ILE A 410  ? PRO A 417  ? ILE A 410  PRO A 417  
AA3 4 CYS A 377  ? LEU A 382  ? CYS A 377  LEU A 382  
AA3 5 LYS A 387  ? LEU A 392  ? LYS A 387  LEU A 392  
AA4 1 GLU A 423  ? PHE A 428  ? GLU A 423  PHE A 428  
AA4 2 ASN A 442  ? PHE A 448  ? ASN A 442  PHE A 448  
AA4 3 GLU A 458  ? GLY A 464  ? GLU A 458  GLY A 464  
AA4 4 ILE A 471  ? CYS A 472  ? ILE A 471  CYS A 472  
AA5 1 CYS A 562  ? LYS A 566  ? CYS A 562  LYS A 566  
AA5 2 GLU A 1247 ? LEU A 1252 ? GLU A 1247 LEU A 1252 
AA5 3 HIS A 1180 ? ASP A 1190 ? HIS A 1180 ASP A 1190 
AA5 4 TYR A 1161 ? ASP A 1174 ? TYR A 1161 ASP A 1174 
AA5 5 LYS A 1003 ? VAL A 1016 ? LYS A 1003 VAL A 1016 
AA6 1 VAL A 638  ? MET A 642  ? VAL A 638  MET A 642  
AA6 2 LEU A 674  ? ALA A 680  ? LEU A 674  ALA A 680  
AA6 3 LEU A 610  ? THR A 616  ? LEU A 610  THR A 616  
AA6 4 VAL A 832  ? VAL A 835  ? VAL A 832  VAL A 835  
AA6 5 SER A 757  ? PRO A 762  ? SER A 757  PRO A 762  
AA6 6 MET A 769  ? VAL A 773  ? MET A 769  VAL A 773  
AA6 7 VAL A 796  ? VAL A 800  ? VAL A 796  VAL A 800  
AA6 8 THR A 1075 ? SER A 1076 ? THR A 1075 SER A 1076 
AA7 1 LYS A 667  ? VAL A 668  ? LYS A 667  VAL A 668  
AA7 2 ALA A 622  ? ASP A 628  ? ALA A 622  ASP A 628  
AA7 3 LYS A 694  ? ASP A 699  ? LYS A 694  ASP A 699  
AA8 1 SER A 652  ? CYS A 654  ? SER A 652  CYS A 654  
AA8 2 ALA A 659  ? LYS A 661  ? ALA A 659  LYS A 661  
AA9 1 ARG A 721  ? TYR A 725  ? ARG A 721  TYR A 725  
AA9 2 ASN A 902  ? ARG A 911  ? ASN A 902  ARG A 911  
AA9 3 ILE A 865  ? GLY A 877  ? ILE A 865  GLY A 877  
AA9 4 TYR A 851  ? PHE A 859  ? TYR A 851  PHE A 859  
AA9 5 GLN A 737  ? MET A 745  ? GLN A 737  MET A 745  
AB1 1 ILE A 959  ? GLN A 961  ? ILE A 959  GLN A 961  
AB1 2 GLU A 967  ? ASN A 969  ? GLU A 967  ASN A 969  
AB2 1 VAL A 1070 ? HIS A 1071 ? VAL A 1070 HIS A 1071 
AB2 2 VAL A 1038 ? HIS A 1042 ? VAL A 1038 HIS A 1042 
AB2 3 ALA A 1026 ? ILE A 1032 ? ALA A 1026 ILE A 1032 
AB2 4 SER A 1137 ? PHE A 1142 ? SER A 1137 PHE A 1142 
AB3 1 ASP A 1148 ? ASN A 1150 ? ASP A 1148 ASN A 1150 
AB3 2 GLU A 1155 ? GLN A 1157 ? GLU A 1155 GLN A 1157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 18   ? O GLU A 18   N LEU A 7    ? N LEU A 7    
AA1 2 3 N TYR A 10   ? N TYR A 10   O VAL A 86   ? O VAL A 86   
AA1 3 4 O THR A 87   ? O THR A 87   N MET A 55   ? N MET A 55   
AA1 4 5 N VAL A 54   ? N VAL A 54   O ALA A 71   ? O ALA A 71   
AA2 1 2 N PHE A 236  ? N PHE A 236  O TRP A 243  ? O TRP A 243  
AA2 2 3 N PHE A 244  ? N PHE A 244  O ILE A 285  ? O ILE A 285  
AA3 1 2 N ASN A 298  ? N ASN A 298  O THR A 305  ? O THR A 305  
AA3 2 3 N LEU A 304  ? N LEU A 304  O ILE A 416  ? O ILE A 416  
AA3 3 4 O SER A 413  ? O SER A 413  N ASN A 380  ? N ASN A 380  
AA3 4 5 N CYS A 377  ? N CYS A 377  O LEU A 392  ? O LEU A 392  
AA4 1 2 N PHE A 424  ? N PHE A 424  O VAL A 447  ? O VAL A 447  
AA4 2 3 N ARG A 446  ? N ARG A 446  O CYS A 460  ? O CYS A 460  
AA4 3 4 N TYR A 463  ? N TYR A 463  O ILE A 471  ? O ILE A 471  
AA5 1 2 N LYS A 566  ? N LYS A 566  O ILE A 1250 ? O ILE A 1250 
AA5 2 3 O HIS A 1249 ? O HIS A 1249 N ILE A 1187 ? N ILE A 1187 
AA5 3 4 O ASP A 1190 ? O ASP A 1190 N TYR A 1164 ? N TYR A 1164 
AA5 4 5 O ILE A 1173 ? O ILE A 1173 N LYS A 1004 ? N LYS A 1004 
AA6 1 2 N VAL A 639  ? N VAL A 639  O LEU A 679  ? O LEU A 679  
AA6 2 3 O VAL A 678  ? O VAL A 678  N THR A 613  ? N THR A 613  
AA6 3 4 N LEU A 610  ? N LEU A 610  O ARG A 833  ? O ARG A 833  
AA6 4 5 O VAL A 832  ? O VAL A 832  N VAL A 760  ? N VAL A 760  
AA6 5 6 N LEU A 759  ? N LEU A 759  O TYR A 772  ? O TYR A 772  
AA6 6 7 N VAL A 771  ? N VAL A 771  O HIS A 799  ? O HIS A 799  
AA6 7 8 N VAL A 800  ? N VAL A 800  O THR A 1075 ? O THR A 1075 
AA7 1 2 O VAL A 668  ? O VAL A 668  N ALA A 622  ? N ALA A 622  
AA7 2 3 N ASP A 628  ? N ASP A 628  O LYS A 694  ? O LYS A 694  
AA8 1 2 N PHE A 653  ? N PHE A 653  O GLU A 660  ? O GLU A 660  
AA9 1 2 N TYR A 725  ? N TYR A 725  O LEU A 903  ? O LEU A 903  
AA9 2 3 O ARG A 904  ? O ARG A 904  N MET A 870  ? N MET A 870  
AA9 3 4 O ALA A 867  ? O ALA A 867  N GLY A 858  ? N GLY A 858  
AA9 4 5 O ALA A 857  ? O ALA A 857  N LEU A 739  ? N LEU A 739  
AB1 1 2 N ASP A 960  ? N ASP A 960  O ILE A 968  ? O ILE A 968  
AB2 1 2 O HIS A 1071 ? O HIS A 1071 N VAL A 1040 ? N VAL A 1040 
AB2 2 3 O LEU A 1039 ? O LEU A 1039 N HIS A 1031 ? N HIS A 1031 
AB2 3 4 N ALA A 1026 ? N ALA A 1026 O PHE A 1142 ? O PHE A 1142 
AB3 1 2 N ASN A 1150 ? N ASN A 1150 O GLU A 1155 ? O GLU A 1155 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FES 3001 ? 8  'binding site for residue FES A 3001' 
AC2 Software A FES 3002 ? 9  'binding site for residue FES A 3002' 
AC3 Software A FAD 3003 ? 25 'binding site for residue FAD A 3003' 
AC4 Software A MLI 3004 ? 5  'binding site for residue MLI A 3004' 
AC5 Software A MLI 3005 ? 7  'binding site for residue MLI A 3005' 
AC6 Software A MLI 3006 ? 3  'binding site for residue MLI A 3006' 
AC7 Software A MLI 3007 ? 6  'binding site for residue MLI A 3007' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLN A 113  ? GLN A 113  . ? 1_555 ? 
2  AC1 8  CYS A 114  ? CYS A 114  . ? 1_555 ? 
3  AC1 8  GLY A 115  ? GLY A 115  . ? 1_555 ? 
4  AC1 8  CYS A 117  ? CYS A 117  . ? 1_555 ? 
5  AC1 8  CYS A 149  ? CYS A 149  . ? 1_555 ? 
6  AC1 8  ARG A 150  ? ARG A 150  . ? 1_555 ? 
7  AC1 8  CYS A 151  ? CYS A 151  . ? 1_555 ? 
8  AC1 8  MET A 753  ? MET A 753  . ? 1_555 ? 
9  AC2 9  GLY A 43   ? GLY A 43   . ? 1_555 ? 
10 AC2 9  CYS A 44   ? CYS A 44   . ? 1_555 ? 
11 AC2 9  GLY A 45   ? GLY A 45   . ? 1_555 ? 
12 AC2 9  GLY A 47   ? GLY A 47   . ? 1_555 ? 
13 AC2 9  GLY A 48   ? GLY A 48   . ? 1_555 ? 
14 AC2 9  CYS A 49   ? CYS A 49   . ? 1_555 ? 
15 AC2 9  GLY A 50   ? GLY A 50   . ? 1_555 ? 
16 AC2 9  CYS A 52   ? CYS A 52   . ? 1_555 ? 
17 AC2 9  CYS A 74   ? CYS A 74   . ? 1_555 ? 
18 AC3 25 GLY A 46   ? GLY A 46   . ? 1_555 ? 
19 AC3 25 GLY A 47   ? GLY A 47   . ? 1_555 ? 
20 AC3 25 PRO A 263  ? PRO A 263  . ? 1_555 ? 
21 AC3 25 VAL A 264  ? VAL A 264  . ? 1_555 ? 
22 AC3 25 ILE A 265  ? ILE A 265  . ? 1_555 ? 
23 AC3 25 MET A 266  ? MET A 266  . ? 1_555 ? 
24 AC3 25 GLY A 267  ? GLY A 267  . ? 1_555 ? 
25 AC3 25 ASN A 268  ? ASN A 268  . ? 1_555 ? 
26 AC3 25 THR A 269  ? THR A 269  . ? 1_555 ? 
27 AC3 25 SER A 270  ? SER A 270  . ? 1_555 ? 
28 AC3 25 VAL A 271  ? VAL A 271  . ? 1_555 ? 
29 AC3 25 LEU A 344  ? LEU A 344  . ? 1_555 ? 
30 AC3 25 ALA A 345  ? ALA A 345  . ? 1_555 ? 
31 AC3 25 ALA A 353  ? ALA A 353  . ? 1_555 ? 
32 AC3 25 SER A 354  ? SER A 354  . ? 1_555 ? 
33 AC3 25 GLY A 357  ? GLY A 357  . ? 1_555 ? 
34 AC3 25 HIS A 358  ? HIS A 358  . ? 1_555 ? 
35 AC3 25 ILE A 360  ? ILE A 360  . ? 1_555 ? 
36 AC3 25 SER A 361  ? SER A 361  . ? 1_555 ? 
37 AC3 25 HIS A 363  ? HIS A 363  . ? 1_555 ? 
38 AC3 25 ASP A 365  ? ASP A 365  . ? 1_555 ? 
39 AC3 25 SER A 366  ? SER A 366  . ? 1_555 ? 
40 AC3 25 ASP A 367  ? ASP A 367  . ? 1_555 ? 
41 AC3 25 LEU A 411  ? LEU A 411  . ? 1_555 ? 
42 AC3 25 LEU A 438  ? LEU A 438  . ? 1_555 ? 
43 AC4 5  CYS A 44   ? CYS A 44   . ? 1_555 ? 
44 AC4 5  LEU A 148  ? LEU A 148  . ? 1_555 ? 
45 AC4 5  ARG A 433  ? ARG A 433  . ? 1_555 ? 
46 AC4 5  TYR A 1236 ? TYR A 1236 . ? 1_555 ? 
47 AC4 5  LYS A 1237 ? LYS A 1237 . ? 1_555 ? 
48 AC5 7  ARG A 32   ? ARG A 32   . ? 1_555 ? 
49 AC5 7  LYS A 33   ? LYS A 33   . ? 1_555 ? 
50 AC5 7  THR A 38   ? THR A 38   . ? 1_555 ? 
51 AC5 7  ASP A 601  ? ASP A 601  . ? 1_555 ? 
52 AC5 7  MET A 603  ? MET A 603  . ? 1_555 ? 
53 AC5 7  LEU A 605  ? LEU A 605  . ? 1_555 ? 
54 AC5 7  HOH I .    ? HOH A 3103 . ? 1_555 ? 
55 AC6 3  THR A 616  ? THR A 616  . ? 1_555 ? 
56 AC6 3  ALA A 690  ? ALA A 690  . ? 1_555 ? 
57 AC6 3  LYS A 691  ? LYS A 691  . ? 1_555 ? 
58 AC7 6  PHE A 807  ? PHE A 807  . ? 1_555 ? 
59 AC7 6  GLY A 808  ? GLY A 808  . ? 1_555 ? 
60 AC7 6  ALA A 919  ? ALA A 919  . ? 1_555 ? 
61 AC7 6  PHE A 920  ? PHE A 920  . ? 1_555 ? 
62 AC7 6  GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
63 AC7 6  GLU A 1270 ? GLU A 1270 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6Q6Q 
_atom_sites.fract_transf_matrix[1][1]   0.006748 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006748 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007564 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
FE ? ? 20.90327 4.99816 2.55100  38.46870 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 6.96715  ?       11.43723 ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527  ?       9.05267  ?        0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135  5.44231 1.42069  35.72801 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A 1 4    ? -64.92000 -52.74800 -59.03100 1.000 80.32891  ? 4    ALA A N     1 
ATOM   2     C  CA    . ALA A 1 4    ? -65.73200 -52.84700 -60.23800 1.000 93.29963  ? 4    ALA A CA    1 
ATOM   3     C  C     . ALA A 1 4    ? -66.17500 -51.46900 -60.71900 1.000 93.60536  ? 4    ALA A C     1 
ATOM   4     O  O     . ALA A 1 4    ? -66.54700 -51.29600 -61.87900 1.000 97.55700  ? 4    ALA A O     1 
ATOM   5     C  CB    . ALA A 1 4    ? -66.94300 -53.73700 -59.99100 1.000 74.06596  ? 4    ALA A CB    1 
ATOM   6     N  N     . SER A 1 5    ? -66.13000 -50.49000 -59.82200 1.000 85.44691  ? 5    SER A N     1 
ATOM   7     C  CA    . SER A 1 5    ? -66.57700 -49.14200 -60.13300 1.000 85.76164  ? 5    SER A CA    1 
ATOM   8     C  C     . SER A 1 5    ? -65.41500 -48.28000 -60.61500 1.000 86.69010  ? 5    SER A C     1 
ATOM   9     O  O     . SER A 1 5    ? -64.24000 -48.61500 -60.44200 1.000 91.57743  ? 5    SER A O     1 
ATOM   10    C  CB    . SER A 1 5    ? -67.23300 -48.49500 -58.91200 1.000 82.00737  ? 5    SER A CB    1 
ATOM   11    O  OG    . SER A 1 5    ? -68.31300 -49.27900 -58.43600 1.000 83.70682  ? 5    SER A OG    1 
ATOM   12    N  N     . GLU A 1 6    ? -65.76400 -47.15400 -61.22900 1.000 87.32489  ? 6    GLU A N     1 
ATOM   13    C  CA    . GLU A 1 6    ? -64.80400 -46.16700 -61.69500 1.000 89.18013  ? 6    GLU A CA    1 
ATOM   14    C  C     . GLU A 1 6    ? -64.92300 -44.89500 -60.86600 1.000 82.62838  ? 6    GLU A C     1 
ATOM   15    O  O     . GLU A 1 6    ? -65.94600 -44.63400 -60.22900 1.000 90.28379  ? 6    GLU A O     1 
ATOM   16    C  CB    . GLU A 1 6    ? -65.02000 -45.84500 -63.17800 1.000 87.89333  ? 6    GLU A CB    1 
ATOM   17    C  CG    . GLU A 1 6    ? -64.80800 -47.02400 -64.11300 1.000 98.06687  ? 6    GLU A CG    1 
ATOM   18    C  CD    . GLU A 1 6    ? -65.06800 -46.66900 -65.56400 1.000 108.75412 ? 6    GLU A CD    1 
ATOM   19    O  OE1   . GLU A 1 6    ? -65.22100 -45.46600 -65.86500 1.000 102.75027 ? 6    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A 1 6    ? -65.11800 -47.59200 -66.40400 1.000 111.80766 ? 6    GLU A OE2   1 
ATOM   21    N  N     . LEU A 1 7    ? -63.85700 -44.10100 -60.88300 1.000 77.39839  ? 7    LEU A N     1 
ATOM   22    C  CA    . LEU A 1 7    ? -63.81000 -42.83000 -60.17500 1.000 72.71427  ? 7    LEU A CA    1 
ATOM   23    C  C     . LEU A 1 7    ? -63.83000 -41.70300 -61.19700 1.000 75.06394  ? 7    LEU A C     1 
ATOM   24    O  O     . LEU A 1 7    ? -63.02600 -41.69600 -62.13600 1.000 78.56119  ? 7    LEU A O     1 
ATOM   25    C  CB    . LEU A 1 7    ? -62.56100 -42.73700 -59.29500 1.000 70.09189  ? 7    LEU A CB    1 
ATOM   26    C  CG    . LEU A 1 7    ? -62.70400 -42.00500 -57.95600 1.000 70.89469  ? 7    LEU A CG    1 
ATOM   27    C  CD1   . LEU A 1 7    ? -61.46600 -42.21300 -57.09800 1.000 72.02602  ? 7    LEU A CD1   1 
ATOM   28    C  CD2   . LEU A 1 7    ? -62.98700 -40.52600 -58.14100 1.000 67.84824  ? 7    LEU A CD2   1 
ATOM   29    N  N     . LEU A 1 8    ? -64.74600 -40.75300 -61.01400 1.000 69.04189  ? 8    LEU A N     1 
ATOM   30    C  CA    . LEU A 1 8    ? -64.94200 -39.67100 -61.97300 1.000 63.64322  ? 8    LEU A CA    1 
ATOM   31    C  C     . LEU A 1 8    ? -65.09700 -38.35800 -61.22300 1.000 71.12398  ? 8    LEU A C     1 
ATOM   32    O  O     . LEU A 1 8    ? -65.97600 -38.23100 -60.36500 1.000 73.71578  ? 8    LEU A O     1 
ATOM   33    C  CB    . LEU A 1 8    ? -66.16700 -39.93700 -62.85400 1.000 59.97310  ? 8    LEU A CB    1 
ATOM   34    C  CG    . LEU A 1 8    ? -66.55800 -38.85100 -63.85800 1.000 72.90021  ? 8    LEU A CG    1 
ATOM   35    C  CD1   . LEU A 1 8    ? -65.39300 -38.53000 -64.77800 1.000 82.14634  ? 8    LEU A CD1   1 
ATOM   36    C  CD2   . LEU A 1 8    ? -67.77000 -39.29000 -64.66300 1.000 75.69286  ? 8    LEU A CD2   1 
ATOM   37    N  N     . PHE A 1 9    ? -64.24500 -37.38900 -61.54700 1.000 68.18674  ? 9    PHE A N     1 
ATOM   38    C  CA    . PHE A 1 9    ? -64.33800 -36.04100 -60.99900 1.000 60.91720  ? 9    PHE A CA    1 
ATOM   39    C  C     . PHE A 1 9    ? -63.58900 -35.09900 -61.93300 1.000 58.22550  ? 9    PHE A C     1 
ATOM   40    O  O     . PHE A 1 9    ? -63.02400 -35.52000 -62.94600 1.000 61.53189  ? 9    PHE A O     1 
ATOM   41    C  CB    . PHE A 1 9    ? -63.80400 -35.97800 -59.56300 1.000 58.92286  ? 9    PHE A CB    1 
ATOM   42    C  CG    . PHE A 1 9    ? -62.33600 -36.27700 -59.43700 1.000 58.80021  ? 9    PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1 9    ? -61.87100 -37.57900 -59.50600 1.000 54.35656  ? 9    PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1 9    ? -61.42300 -35.25800 -59.22200 1.000 58.72729  ? 9    PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1 9    ? -60.52500 -37.85900 -59.38000 1.000 57.19390  ? 9    PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1 9    ? -60.07400 -35.53300 -59.09300 1.000 53.55382  ? 9    PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1 9    ? -59.62500 -36.83400 -59.17400 1.000 57.67674  ? 9    PHE A CZ    1 
ATOM   48    N  N     . TYR A 1 10   ? -63.59400 -33.81400 -61.58800 1.000 56.12008  ? 10   TYR A N     1 
ATOM   49    C  CA    . TYR A 1 10   ? -63.01000 -32.77500 -62.42400 1.000 63.58292  ? 10   TYR A CA    1 
ATOM   50    C  C     . TYR A 1 10   ? -61.94500 -32.00700 -61.65600 1.000 63.50601  ? 10   TYR A C     1 
ATOM   51    O  O     . TYR A 1 10   ? -62.08800 -31.75700 -60.45400 1.000 61.88624  ? 10   TYR A O     1 
ATOM   52    C  CB    . TYR A 1 10   ? -64.08400 -31.80400 -62.92700 1.000 67.14550  ? 10   TYR A CB    1 
ATOM   53    C  CG    . TYR A 1 10   ? -64.71800 -32.21400 -64.23600 1.000 72.89834  ? 10   TYR A CG    1 
ATOM   54    C  CD1   . TYR A 1 10   ? -65.56200 -33.31500 -64.30700 1.000 66.02179  ? 10   TYR A CD1   1 
ATOM   55    C  CD2   . TYR A 1 10   ? -64.47000 -31.50100 -65.40100 1.000 70.63967  ? 10   TYR A CD2   1 
ATOM   56    C  CE1   . TYR A 1 10   ? -66.14300 -33.69300 -65.50300 1.000 68.66592  ? 10   TYR A CE1   1 
ATOM   57    C  CE2   . TYR A 1 10   ? -65.04500 -31.87200 -66.60100 1.000 75.56275  ? 10   TYR A CE2   1 
ATOM   58    C  CZ    . TYR A 1 10   ? -65.88100 -32.96800 -66.64600 1.000 79.99699  ? 10   TYR A CZ    1 
ATOM   59    O  OH    . TYR A 1 10   ? -66.45600 -33.34000 -67.83900 1.000 84.35409  ? 10   TYR A OH    1 
ATOM   60    N  N     . VAL A 1 11   ? -60.87700 -31.63700 -62.35900 1.000 60.21473  ? 11   VAL A N     1 
ATOM   61    C  CA    . VAL A 1 11   ? -59.80800 -30.80600 -61.81600 1.000 51.27526  ? 11   VAL A CA    1 
ATOM   62    C  C     . VAL A 1 11   ? -59.48500 -29.73100 -62.84300 1.000 57.82595  ? 11   VAL A C     1 
ATOM   63    O  O     . VAL A 1 11   ? -59.02700 -30.04400 -63.94900 1.000 59.93862  ? 11   VAL A O     1 
ATOM   64    C  CB    . VAL A 1 11   ? -58.54900 -31.61900 -61.47600 1.000 49.13440  ? 11   VAL A CB    1 
ATOM   65    C  CG1   . VAL A 1 11   ? -57.41100 -30.68800 -61.10400 1.000 55.32402  ? 11   VAL A CG1   1 
ATOM   66    C  CG2   . VAL A 1 11   ? -58.82800 -32.57900 -60.33800 1.000 55.77549  ? 11   VAL A CG2   1 
ATOM   67    N  N     . ASN A 1 12   ? -59.72600 -28.47000 -62.47900 1.000 57.98581  ? 12   ASN A N     1 
ATOM   68    C  CA    . ASN A 1 12   ? -59.43600 -27.32200 -63.34100 1.000 57.35321  ? 12   ASN A CA    1 
ATOM   69    C  C     . ASN A 1 12   ? -60.16000 -27.43500 -64.68100 1.000 64.53466  ? 12   ASN A C     1 
ATOM   70    O  O     . ASN A 1 12   ? -59.59600 -27.14800 -65.73900 1.000 71.78367  ? 12   ASN A O     1 
ATOM   71    C  CB    . ASN A 1 12   ? -57.92800 -27.15400 -63.55000 1.000 57.74339  ? 12   ASN A CB    1 
ATOM   72    C  CG    . ASN A 1 12   ? -57.17500 -26.97600 -62.24600 1.000 58.61960  ? 12   ASN A CG    1 
ATOM   73    O  OD1   . ASN A 1 12   ? -57.75400 -26.59100 -61.23000 1.000 59.63196  ? 12   ASN A OD1   1 
ATOM   74    N  ND2   . ASN A 1 12   ? -55.87600 -27.25000 -62.26900 1.000 68.26273  ? 12   ASN A ND2   1 
ATOM   75    N  N     . GLY A 1 13   ? -61.42300 -27.86100 -64.63600 1.000 64.47804  ? 13   GLY A N     1 
ATOM   76    C  CA    . GLY A 1 13   ? -62.23600 -27.99200 -65.82500 1.000 62.48388  ? 13   GLY A CA    1 
ATOM   77    C  C     . GLY A 1 13   ? -61.99000 -29.23400 -66.65100 1.000 67.33179  ? 13   GLY A C     1 
ATOM   78    O  O     . GLY A 1 13   ? -62.86700 -29.62300 -67.43200 1.000 72.84422  ? 13   GLY A O     1 
ATOM   79    N  N     . ARG A 1 14   ? -60.83200 -29.87200 -66.51100 1.000 70.95981  ? 14   ARG A N     1 
ATOM   80    C  CA    . ARG A 1 14   ? -60.51600 -31.07400 -67.26900 1.000 71.90264  ? 14   ARG A CA    1 
ATOM   81    C  C     . ARG A 1 14   ? -61.06500 -32.30400 -66.55900 1.000 67.78109  ? 14   ARG A C     1 
ATOM   82    O  O     . ARG A 1 14   ? -60.98300 -32.41900 -65.33300 1.000 62.01948  ? 14   ARG A O     1 
ATOM   83    C  CB    . ARG A 1 14   ? -59.00400 -31.21100 -67.45900 1.000 64.67317  ? 14   ARG A CB    1 
ATOM   84    C  CG    . ARG A 1 14   ? -58.30400 -29.91100 -67.82000 1.000 75.92795  ? 14   ARG A CG    1 
ATOM   85    C  CD    . ARG A 1 14   ? -57.33500 -30.10600 -68.97500 1.000 84.67868  ? 14   ARG A CD    1 
ATOM   86    N  NE    . ARG A 1 14   ? -58.02900 -30.33000 -70.24100 1.000 102.49890 ? 14   ARG A NE    1 
ATOM   87    C  CZ    . ARG A 1 14   ? -58.36500 -29.36400 -71.08900 1.000 99.80641  ? 14   ARG A CZ    1 
ATOM   88    N  NH1   . ARG A 1 14   ? -58.99400 -29.65800 -72.21900 1.000 88.96651  ? 14   ARG A NH1   1 
ATOM   89    N  NH2   . ARG A 1 14   ? -58.07100 -28.10100 -70.80900 1.000 92.86883  ? 14   ARG A NH2   1 
ATOM   90    N  N     . LYS A 1 15   ? -61.62900 -33.22200 -67.34000 1.000 68.04850  ? 15   LYS A N     1 
ATOM   91    C  CA    . LYS A 1 15   ? -62.17400 -34.44800 -66.77500 1.000 68.91234  ? 15   LYS A CA    1 
ATOM   92    C  C     . LYS A 1 15   ? -61.05100 -35.36800 -66.31500 1.000 71.21273  ? 15   LYS A C     1 
ATOM   93    O  O     . LYS A 1 15   ? -60.00500 -35.47400 -66.96300 1.000 75.08424  ? 15   LYS A O     1 
ATOM   94    C  CB    . LYS A 1 15   ? -63.05000 -35.16500 -67.80300 1.000 75.30020  ? 15   LYS A CB    1 
ATOM   95    C  CG    . LYS A 1 15   ? -63.66200 -36.46100 -67.29400 1.000 75.85440  ? 15   LYS A CG    1 
ATOM   96    C  CD    . LYS A 1 15   ? -64.26100 -37.28200 -68.42100 1.000 77.34412  ? 15   LYS A CD    1 
ATOM   97    C  CE    . LYS A 1 15   ? -65.43700 -36.57600 -69.06400 1.000 79.57524  ? 15   LYS A CE    1 
ATOM   98    N  NZ    . LYS A 1 15   ? -66.05200 -37.40500 -70.13800 1.000 88.17680  ? 15   LYS A NZ    1 
ATOM   99    N  N     . VAL A 1 16   ? -61.27200 -36.03700 -65.18600 1.000 66.88837  ? 16   VAL A N     1 
ATOM   100   C  CA    . VAL A 1 16   ? -60.32100 -36.99000 -64.62500 1.000 63.58784  ? 16   VAL A CA    1 
ATOM   101   C  C     . VAL A 1 16   ? -61.06200 -38.30000 -64.39900 1.000 70.80558  ? 16   VAL A C     1 
ATOM   102   O  O     . VAL A 1 16   ? -61.95500 -38.37300 -63.54600 1.000 72.67692  ? 16   VAL A O     1 
ATOM   103   C  CB    . VAL A 1 16   ? -59.69300 -36.48600 -63.31900 1.000 55.75294  ? 16   VAL A CB    1 
ATOM   104   C  CG1   . VAL A 1 16   ? -58.86200 -37.58200 -62.67900 1.000 49.75294  ? 16   VAL A CG1   1 
ATOM   105   C  CG2   . VAL A 1 16   ? -58.84300 -35.25100 -63.58000 1.000 64.16213  ? 16   VAL A CG2   1 
ATOM   106   N  N     . ILE A 1 17   ? -60.70100 -39.32900 -65.16200 1.000 74.89713  ? 17   ILE A N     1 
ATOM   107   C  CA    . ILE A 1 17   ? -61.25400 -40.66900 -65.00400 1.000 72.67272  ? 17   ILE A CA    1 
ATOM   108   C  C     . ILE A 1 17   ? -60.16200 -41.57400 -64.45800 1.000 68.97385  ? 17   ILE A C     1 
ATOM   109   O  O     . ILE A 1 17   ? -59.00600 -41.50100 -64.89100 1.000 74.71205  ? 17   ILE A O     1 
ATOM   110   C  CB    . ILE A 1 17   ? -61.81200 -41.22400 -66.32900 1.000 71.88144  ? 17   ILE A CB    1 
ATOM   111   C  CG1   . ILE A 1 17   ? -62.87000 -40.28300 -66.90400 1.000 78.46911  ? 17   ILE A CG1   1 
ATOM   112   C  CG2   . ILE A 1 17   ? -62.40300 -42.61100 -66.12500 1.000 66.44809  ? 17   ILE A CG2   1 
ATOM   113   C  CD1   . ILE A 1 17   ? -63.53200 -40.81200 -68.15700 1.000 85.13277  ? 17   ILE A CD1   1 
ATOM   114   N  N     . GLU A 1 18   ? -60.52900 -42.42700 -63.50600 1.000 70.55988  ? 18   GLU A N     1 
ATOM   115   C  CA    . GLU A 1 18   ? -59.58800 -43.34900 -62.88200 1.000 72.21379  ? 18   GLU A CA    1 
ATOM   116   C  C     . GLU A 1 18   ? -60.27600 -44.68800 -62.67700 1.000 74.03255  ? 18   GLU A C     1 
ATOM   117   O  O     . GLU A 1 18   ? -61.29900 -44.76400 -61.99000 1.000 77.71094  ? 18   GLU A O     1 
ATOM   118   C  CB    . GLU A 1 18   ? -59.07600 -42.79000 -61.55300 1.000 69.25673  ? 18   GLU A CB    1 
ATOM   119   C  CG    . GLU A 1 18   ? -57.88100 -41.86400 -61.67700 1.000 71.71386  ? 18   GLU A CG    1 
ATOM   120   C  CD    . GLU A 1 18   ? -56.62700 -42.57500 -62.14900 1.000 78.09956  ? 18   GLU A CD    1 
ATOM   121   O  OE1   . GLU A 1 18   ? -56.56500 -43.81900 -62.05000 1.000 82.24683  ? 18   GLU A OE1   1 
ATOM   122   O  OE2   . GLU A 1 18   ? -55.70000 -41.88600 -62.62300 1.000 80.44031  ? 18   GLU A OE2   1 
ATOM   123   N  N     . LYS A 1 19   ? -59.71300 -45.73700 -63.26900 1.000 82.34234  ? 19   LYS A N     1 
ATOM   124   C  CA    . LYS A 1 19   ? -60.28000 -47.07800 -63.20800 1.000 84.18125  ? 19   LYS A CA    1 
ATOM   125   C  C     . LYS A 1 19   ? -59.55100 -47.89600 -62.15100 1.000 80.66768  ? 19   LYS A C     1 
ATOM   126   O  O     . LYS A 1 19   ? -58.31600 -47.95000 -62.14600 1.000 82.44602  ? 19   LYS A O     1 
ATOM   127   C  CB    . LYS A 1 19   ? -60.18200 -47.77100 -64.56700 1.000 84.45542  ? 19   LYS A CB    1 
ATOM   128   C  CG    . LYS A 1 19   ? -60.61700 -46.90500 -65.73800 1.000 89.00179  ? 19   LYS A CG    1 
ATOM   129   C  CD    . LYS A 1 19   ? -61.07900 -47.75300 -66.91300 1.000 98.24061  ? 19   LYS A CD    1 
ATOM   130   C  CE    . LYS A 1 19   ? -60.10300 -48.88500 -67.20200 1.000 100.98260 ? 19   LYS A CE    1 
ATOM   131   N  NZ    . LYS A 1 19   ? -58.76100 -48.37700 -67.60100 1.000 102.06955 ? 19   LYS A NZ    1 
ATOM   132   N  N     . ASN A 1 20   ? -60.31900 -48.53100 -61.26700 1.000 84.40878  ? 20   ASN A N     1 
ATOM   133   C  CA    . ASN A 1 20   ? -59.79000 -49.38100 -60.20000 1.000 87.99985  ? 20   ASN A CA    1 
ATOM   134   C  C     . ASN A 1 20   ? -58.73200 -48.63400 -59.38300 1.000 80.22105  ? 20   ASN A C     1 
ATOM   135   O  O     . ASN A 1 20   ? -57.52900 -48.87700 -59.48100 1.000 71.64034  ? 20   ASN A O     1 
ATOM   136   C  CB    . ASN A 1 20   ? -59.23200 -50.68600 -60.77600 1.000 80.53776  ? 20   ASN A CB    1 
ATOM   137   C  CG    . ASN A 1 20   ? -60.16800 -51.86100 -60.56600 1.000 94.93370  ? 20   ASN A CG    1 
ATOM   138   O  OD1   . ASN A 1 20   ? -60.14100 -52.51400 -59.52200 1.000 98.45837  ? 20   ASN A OD1   1 
ATOM   139   N  ND2   . ASN A 1 20   ? -61.00600 -52.13500 -61.56100 1.000 94.35896  ? 20   ASN A ND2   1 
ATOM   140   N  N     . VAL A 1 21   ? -59.22600 -47.71100 -58.56700 1.000 76.47022  ? 21   VAL A N     1 
ATOM   141   C  CA    . VAL A 1 21   ? -58.36000 -46.84400 -57.77800 1.000 71.68564  ? 21   VAL A CA    1 
ATOM   142   C  C     . VAL A 1 21   ? -57.96200 -47.53300 -56.48200 1.000 72.49560  ? 21   VAL A C     1 
ATOM   143   O  O     . VAL A 1 21   ? -58.68800 -48.37700 -55.94400 1.000 77.60133  ? 21   VAL A O     1 
ATOM   144   C  CB    . VAL A 1 21   ? -59.05000 -45.49800 -57.48900 1.000 69.48760  ? 21   VAL A CB    1 
ATOM   145   C  CG1   . VAL A 1 21   ? -58.92300 -44.58300 -58.67400 1.000 73.22933  ? 21   VAL A CG1   1 
ATOM   146   C  CG2   . VAL A 1 21   ? -60.50900 -45.72200 -57.14100 1.000 75.11383  ? 21   VAL A CG2   1 
ATOM   147   N  N     . ASP A 1 22   ? -56.79000 -47.16300 -55.98000 1.000 68.74661  ? 22   ASP A N     1 
ATOM   148   C  CA    . ASP A 1 22   ? -56.38700 -47.49600 -54.62400 1.000 68.71920  ? 22   ASP A CA    1 
ATOM   149   C  C     . ASP A 1 22   ? -57.11900 -46.54300 -53.68600 1.000 73.08215  ? 22   ASP A C     1 
ATOM   150   O  O     . ASP A 1 22   ? -56.85200 -45.33500 -53.70300 1.000 69.53833  ? 22   ASP A O     1 
ATOM   151   C  CB    . ASP A 1 22   ? -54.86900 -47.37900 -54.46600 1.000 59.90945  ? 22   ASP A CB    1 
ATOM   152   C  CG    . ASP A 1 22   ? -54.37000 -47.94200 -53.15000 1.000 73.23710  ? 22   ASP A CG    1 
ATOM   153   O  OD1   . ASP A 1 22   ? -55.19400 -48.45800 -52.36500 1.000 74.40104  ? 22   ASP A OD1   1 
ATOM   154   O  OD2   . ASP A 1 22   ? -53.14800 -47.86800 -52.90000 1.000 80.35533  ? 22   ASP A OD2   1 
ATOM   155   N  N     . PRO A 1 23   ? -58.05500 -47.03800 -52.87200 1.000 73.83781  ? 23   PRO A N     1 
ATOM   156   C  CA    . PRO A 1 23   ? -58.85900 -46.12600 -52.03900 1.000 71.04147  ? 23   PRO A CA    1 
ATOM   157   C  C     . PRO A 1 23   ? -58.04100 -45.31400 -51.05100 1.000 66.98673  ? 23   PRO A C     1 
ATOM   158   O  O     . PRO A 1 23   ? -58.53200 -44.29000 -50.55900 1.000 64.30972  ? 23   PRO A O     1 
ATOM   159   C  CB    . PRO A 1 23   ? -59.83200 -47.07200 -51.31800 1.000 74.91549  ? 23   PRO A CB    1 
ATOM   160   C  CG    . PRO A 1 23   ? -59.82900 -48.33100 -52.13500 1.000 70.26017  ? 23   PRO A CG    1 
ATOM   161   C  CD    . PRO A 1 23   ? -58.44400 -48.44500 -52.68500 1.000 66.23411  ? 23   PRO A CD    1 
ATOM   162   N  N     . GLU A 1 24   ? -56.81200 -45.72900 -50.75000 1.000 63.35354  ? 24   GLU A N     1 
ATOM   163   C  CA    . GLU A 1 24   ? -55.94200 -44.99500 -49.84200 1.000 63.18269  ? 24   GLU A CA    1 
ATOM   164   C  C     . GLU A 1 24   ? -55.29600 -43.77600 -50.48900 1.000 58.17993  ? 24   GLU A C     1 
ATOM   165   O  O     . GLU A 1 24   ? -54.55100 -43.05900 -49.81200 1.000 59.90771  ? 24   GLU A O     1 
ATOM   166   C  CB    . GLU A 1 24   ? -54.85300 -45.92600 -49.30100 1.000 57.06245  ? 24   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 24   ? -55.31000 -46.83500 -48.17500 1.000 59.63281  ? 24   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 24   ? -54.34900 -47.98000 -47.92800 1.000 67.23723  ? 24   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 24   ? -54.02200 -48.70100 -48.89600 1.000 68.09252  ? 24   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 24   ? -53.91600 -48.15800 -46.76900 1.000 55.12057  ? 24   GLU A OE2   1 
ATOM   171   N  N     . THR A 1 25   ? -55.55800 -43.52400 -51.76900 1.000 54.65948  ? 25   THR A N     1 
ATOM   172   C  CA    . THR A 1 25   ? -54.93200 -42.40300 -52.45800 1.000 59.01963  ? 25   THR A CA    1 
ATOM   173   C  C     . THR A 1 25   ? -55.53200 -41.08500 -51.98600 1.000 56.73052  ? 25   THR A C     1 
ATOM   174   O  O     . THR A 1 25   ? -56.75300 -40.90000 -52.01400 1.000 64.35552  ? 25   THR A O     1 
ATOM   175   C  CB    . THR A 1 25   ? -55.10000 -42.54500 -53.97000 1.000 63.01274  ? 25   THR A CB    1 
ATOM   176   O  OG1   . THR A 1 25   ? -54.49000 -43.76500 -54.40900 1.000 64.14400  ? 25   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1 25   ? -54.45000 -41.37200 -54.69100 1.000 54.44250  ? 25   THR A CG2   1 
ATOM   178   N  N     . MET A 1 26   ? -54.67100 -40.16900 -51.55600 1.000 58.36200  ? 26   MET A N     1 
ATOM   179   C  CA    . MET A 1 26   ? -55.10700 -38.85700 -51.10800 1.000 58.61529  ? 26   MET A CA    1 
ATOM   180   C  C     . MET A 1 26   ? -55.02300 -37.85200 -52.25300 1.000 52.14717  ? 26   MET A C     1 
ATOM   181   O  O     . MET A 1 26   ? -54.32700 -38.06200 -53.24900 1.000 52.57763  ? 26   MET A O     1 
ATOM   182   C  CB    . MET A 1 26   ? -54.26500 -38.38300 -49.92400 1.000 59.11313  ? 26   MET A CB    1 
ATOM   183   C  CG    . MET A 1 26   ? -54.18800 -39.38900 -48.78800 1.000 73.57569  ? 26   MET A CG    1 
ATOM   184   S  SD    . MET A 1 26   ? -55.81300 -39.91400 -48.20800 1.000 82.15128  ? 26   MET A SD    1 
ATOM   185   C  CE    . MET A 1 26   ? -56.39500 -38.41100 -47.43400 1.000 61.98833  ? 26   MET A CE    1 
ATOM   186   N  N     . LEU A 1 27   ? -55.74500 -36.74100 -52.09300 1.000 52.32842  ? 27   LEU A N     1 
ATOM   187   C  CA    . LEU A 1 27   ? -55.87000 -35.78200 -53.18500 1.000 47.08177  ? 27   LEU A CA    1 
ATOM   188   C  C     . LEU A 1 27   ? -54.56600 -35.02800 -53.41700 1.000 57.61329  ? 27   LEU A C     1 
ATOM   189   O  O     . LEU A 1 27   ? -54.16400 -34.81000 -54.56600 1.000 56.62364  ? 27   LEU A O     1 
ATOM   190   C  CB    . LEU A 1 27   ? -57.00400 -34.80100 -52.89500 1.000 42.95062  ? 27   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1 27   ? -57.32500 -33.83600 -54.03600 1.000 51.19070  ? 27   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1 27   ? -57.86600 -34.63200 -55.21300 1.000 57.51242  ? 27   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1 27   ? -58.29600 -32.74500 -53.60600 1.000 51.42755  ? 27   LEU A CD2   1 
ATOM   194   N  N     . LEU A 1 28   ? -53.89500 -34.61800 -52.33800 1.000 53.26572  ? 28   LEU A N     1 
ATOM   195   C  CA    . LEU A 1 28   ? -52.67100 -33.83000 -52.48000 1.000 49.05715  ? 28   LEU A CA    1 
ATOM   196   C  C     . LEU A 1 28   ? -51.57300 -34.57600 -53.22800 1.000 49.86509  ? 28   LEU A C     1 
ATOM   197   O  O     . LEU A 1 28   ? -50.99800 -33.99600 -54.16500 1.000 53.46936  ? 28   LEU A O     1 
ATOM   198   C  CB    . LEU A 1 28   ? -52.19400 -33.35500 -51.10300 1.000 50.41983  ? 28   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1 28   ? -50.85200 -32.61900 -51.09900 1.000 49.83777  ? 28   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1 28   ? -50.92000 -31.37400 -51.96600 1.000 50.36751  ? 28   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1 28   ? -50.42300 -32.26400 -49.68300 1.000 52.49994  ? 28   LEU A CD2   1 
ATOM   202   N  N     . PRO A 1 29   ? -51.22400 -35.82500 -52.89300 1.000 47.78862  ? 29   PRO A N     1 
ATOM   203   C  CA    . PRO A 1 29   ? -50.24200 -36.53900 -53.72400 1.000 51.15781  ? 29   PRO A CA    1 
ATOM   204   C  C     . PRO A 1 29   ? -50.76300 -36.88700 -55.10700 1.000 56.49674  ? 29   PRO A C     1 
ATOM   205   O  O     . PRO A 1 29   ? -49.95400 -37.08200 -56.02200 1.000 58.85008  ? 29   PRO A O     1 
ATOM   206   C  CB    . PRO A 1 29   ? -49.93600 -37.80000 -52.90600 1.000 48.66157  ? 29   PRO A CB    1 
ATOM   207   C  CG    . PRO A 1 29   ? -51.15600 -38.01300 -52.09600 1.000 53.87494  ? 29   PRO A CG    1 
ATOM   208   C  CD    . PRO A 1 29   ? -51.63500 -36.64000 -51.73400 1.000 49.93788  ? 29   PRO A CD    1 
ATOM   209   N  N     . TYR A 1 30   ? -52.08400 -36.96700 -55.29100 1.000 52.11253  ? 30   TYR A N     1 
ATOM   210   C  CA    . TYR A 1 30   ? -52.62800 -37.22700 -56.62000 1.000 54.95167  ? 30   TYR A CA    1 
ATOM   211   C  C     . TYR A 1 30   ? -52.48200 -36.00800 -57.52600 1.000 56.26094  ? 30   TYR A C     1 
ATOM   212   O  O     . TYR A 1 30   ? -52.15600 -36.14400 -58.71000 1.000 62.94174  ? 30   TYR A O     1 
ATOM   213   C  CB    . TYR A 1 30   ? -54.09500 -37.64800 -56.51700 1.000 53.48569  ? 30   TYR A CB    1 
ATOM   214   C  CG    . TYR A 1 30   ? -54.70300 -38.04900 -57.84100 1.000 50.20729  ? 30   TYR A CG    1 
ATOM   215   C  CD1   . TYR A 1 30   ? -55.30700 -37.10700 -58.66500 1.000 52.97602  ? 30   TYR A CD1   1 
ATOM   216   C  CD2   . TYR A 1 30   ? -54.66800 -39.36900 -58.27100 1.000 49.52068  ? 30   TYR A CD2   1 
ATOM   217   C  CE1   . TYR A 1 30   ? -55.85700 -37.46700 -59.87800 1.000 54.35644  ? 30   TYR A CE1   1 
ATOM   218   C  CE2   . TYR A 1 30   ? -55.21900 -39.73900 -59.48200 1.000 57.77658  ? 30   TYR A CE2   1 
ATOM   219   C  CZ    . TYR A 1 30   ? -55.81100 -38.78400 -60.28100 1.000 59.03101  ? 30   TYR A CZ    1 
ATOM   220   O  OH    . TYR A 1 30   ? -56.35900 -39.14400 -61.48800 1.000 59.95191  ? 30   TYR A OH    1 
ATOM   221   N  N     . LEU A 1 31   ? -52.73300 -34.81200 -56.98800 1.000 49.82712  ? 31   LEU A N     1 
ATOM   222   C  CA    . LEU A 1 31   ? -52.57500 -33.58800 -57.77000 1.000 49.25857  ? 31   LEU A CA    1 
ATOM   223   C  C     . LEU A 1 31   ? -51.13300 -33.38300 -58.21100 1.000 54.80635  ? 31   LEU A C     1 
ATOM   224   O  O     . LEU A 1 31   ? -50.87800 -32.88500 -59.31400 1.000 57.09861  ? 31   LEU A O     1 
ATOM   225   C  CB    . LEU A 1 31   ? -53.05500 -32.38900 -56.95400 1.000 47.97791  ? 31   LEU A CB    1 
ATOM   226   C  CG    . LEU A 1 31   ? -54.47100 -31.88400 -57.21100 1.000 45.38673  ? 31   LEU A CG    1 
ATOM   227   C  CD1   . LEU A 1 31   ? -55.44300 -33.03000 -57.21800 1.000 56.37834  ? 31   LEU A CD1   1 
ATOM   228   C  CD2   . LEU A 1 31   ? -54.84000 -30.92300 -56.10300 1.000 58.43027  ? 31   LEU A CD2   1 
ATOM   229   N  N     . ARG A 1 32   ? -50.17600 -33.75700 -57.36500 1.000 50.07158  ? 32   ARG A N     1 
ATOM   230   C  CA    . ARG A 1 32   ? -48.77400 -33.46300 -57.62700 1.000 51.19241  ? 32   ARG A CA    1 
ATOM   231   C  C     . ARG A 1 32   ? -48.08400 -34.55200 -58.43800 1.000 56.61281  ? 32   ARG A C     1 
ATOM   232   O  O     . ARG A 1 32   ? -47.33400 -34.24500 -59.37100 1.000 54.61910  ? 32   ARG A O     1 
ATOM   233   C  CB    . ARG A 1 32   ? -48.03500 -33.25400 -56.30400 1.000 52.37198  ? 32   ARG A CB    1 
ATOM   234   C  CG    . ARG A 1 32   ? -48.62700 -32.16100 -55.43200 1.000 51.06756  ? 32   ARG A CG    1 
ATOM   235   C  CD    . ARG A 1 32   ? -47.90600 -32.08500 -54.10000 1.000 45.66372  ? 32   ARG A CD    1 
ATOM   236   N  NE    . ARG A 1 32   ? -46.46200 -31.97500 -54.28000 1.000 43.28108  ? 32   ARG A NE    1 
ATOM   237   C  CZ    . ARG A 1 32   ? -45.82400 -30.83200 -54.50600 1.000 52.25717  ? 32   ARG A CZ    1 
ATOM   238   N  NH1   . ARG A 1 32   ? -46.50200 -29.69500 -54.58300 1.000 54.91520  ? 32   ARG A NH1   1 
ATOM   239   N  NH2   . ARG A 1 32   ? -44.50800 -30.82500 -54.65900 1.000 61.42980  ? 32   ARG A NH2   1 
ATOM   240   N  N     . LYS A 1 33   ? -48.32600 -35.82000 -58.10800 1.000 57.31982  ? 33   LYS A N     1 
ATOM   241   C  CA    . LYS A 1 33   ? -47.60100 -36.92400 -58.72300 1.000 53.27099  ? 33   LYS A CA    1 
ATOM   242   C  C     . LYS A 1 33   ? -48.31900 -37.54500 -59.91400 1.000 54.22811  ? 33   LYS A C     1 
ATOM   243   O  O     . LYS A 1 33   ? -47.65800 -38.15600 -60.76000 1.000 70.42441  ? 33   LYS A O     1 
ATOM   244   C  CB    . LYS A 1 33   ? -47.32000 -38.01300 -57.68100 1.000 58.32026  ? 33   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1 33   ? -46.37300 -37.56800 -56.57600 1.000 60.71035  ? 33   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1 33   ? -46.27200 -38.60200 -55.46900 1.000 70.47132  ? 33   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1 33   ? -45.24400 -38.18800 -54.42800 1.000 89.47335  ? 33   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1 33   ? -45.19500 -39.14000 -53.28500 1.000 85.32622  ? 33   LYS A NZ    1 
ATOM   249   N  N     . LYS A 1 34   ? -49.64000 -37.40700 -60.00500 1.000 51.14294  ? 34   LYS A N     1 
ATOM   250   C  CA    . LYS A 1 34   ? -50.41300 -37.99000 -61.09600 1.000 50.70678  ? 34   LYS A CA    1 
ATOM   251   C  C     . LYS A 1 34   ? -50.93000 -36.96300 -62.09100 1.000 52.96041  ? 34   LYS A C     1 
ATOM   252   O  O     . LYS A 1 34   ? -50.91800 -37.22200 -63.29600 1.000 59.45428  ? 34   LYS A O     1 
ATOM   253   C  CB    . LYS A 1 34   ? -51.59500 -38.79200 -60.53800 1.000 53.53974  ? 34   LYS A CB    1 
ATOM   254   C  CG    . LYS A 1 34   ? -52.42300 -39.49700 -61.60000 1.000 67.75303  ? 34   LYS A CG    1 
ATOM   255   C  CD    . LYS A 1 34   ? -51.75300 -40.77700 -62.07300 1.000 74.76494  ? 34   LYS A CD    1 
ATOM   256   C  CE    . LYS A 1 34   ? -52.56900 -41.44900 -63.16600 1.000 78.44562  ? 34   LYS A CE    1 
ATOM   257   N  NZ    . LYS A 1 34   ? -52.13600 -42.85200 -63.41400 1.000 83.96225  ? 34   LYS A NZ    1 
ATOM   258   N  N     . LEU A 1 35   ? -51.38900 -35.80300 -61.62300 1.000 56.42814  ? 35   LEU A N     1 
ATOM   259   C  CA    . LEU A 1 35   ? -51.86300 -34.74400 -62.50300 1.000 58.01777  ? 35   LEU A CA    1 
ATOM   260   C  C     . LEU A 1 35   ? -50.79600 -33.70100 -62.80700 1.000 55.92792  ? 35   LEU A C     1 
ATOM   261   O  O     . LEU A 1 35   ? -51.05900 -32.77700 -63.58400 1.000 59.31687  ? 35   LEU A O     1 
ATOM   262   C  CB    . LEU A 1 35   ? -53.09400 -34.06000 -61.89800 1.000 58.30526  ? 35   LEU A CB    1 
ATOM   263   C  CG    . LEU A 1 35   ? -54.41100 -34.83700 -61.97100 1.000 61.01264  ? 35   LEU A CG    1 
ATOM   264   C  CD1   . LEU A 1 35   ? -55.52300 -34.07300 -61.27100 1.000 56.16614  ? 35   LEU A CD1   1 
ATOM   265   C  CD2   . LEU A 1 35   ? -54.78400 -35.13000 -63.41700 1.000 57.17742  ? 35   LEU A CD2   1 
ATOM   266   N  N     . ARG A 1 36   ? -49.60700 -33.82500 -62.21300 1.000 57.45953  ? 36   ARG A N     1 
ATOM   267   C  CA    . ARG A 1 36   ? -48.48300 -32.92100 -62.47700 1.000 57.25538  ? 36   ARG A CA    1 
ATOM   268   C  C     . ARG A 1 36   ? -48.85900 -31.46600 -62.20200 1.000 58.35733  ? 36   ARG A C     1 
ATOM   269   O  O     . ARG A 1 36   ? -48.41900 -30.54900 -62.89900 1.000 67.06860  ? 36   ARG A O     1 
ATOM   270   C  CB    . ARG A 1 36   ? -47.95600 -33.08700 -63.90500 1.000 58.28833  ? 36   ARG A CB    1 
ATOM   271   C  CG    . ARG A 1 36   ? -47.03100 -34.28400 -64.11300 1.000 60.79293  ? 36   ARG A CG    1 
ATOM   272   C  CD    . ARG A 1 36   ? -47.77400 -35.61100 -64.05600 1.000 54.31089  ? 36   ARG A CD    1 
ATOM   273   N  NE    . ARG A 1 36   ? -46.96800 -36.71200 -64.57600 1.000 60.38070  ? 36   ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1 36   ? -47.35800 -37.98200 -64.58700 1.000 59.78013  ? 36   ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1 36   ? -48.54700 -38.31600 -64.10400 1.000 62.04888  ? 36   ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1 36   ? -46.56000 -38.91900 -65.07900 1.000 58.77438  ? 36   ARG A NH2   1 
ATOM   277   N  N     . LEU A 1 37   ? -49.67900 -31.25500 -61.17700 1.000 51.22002  ? 37   LEU A N     1 
ATOM   278   C  CA    . LEU A 1 37   ? -50.11000 -29.92500 -60.75400 1.000 55.93407  ? 37   LEU A CA    1 
ATOM   279   C  C     . LEU A 1 37   ? -49.41900 -29.62000 -59.42700 1.000 60.92050  ? 37   LEU A C     1 
ATOM   280   O  O     . LEU A 1 37   ? -49.98500 -29.80100 -58.34800 1.000 63.22146  ? 37   LEU A O     1 
ATOM   281   C  CB    . LEU A 1 37   ? -51.63300 -29.85900 -60.63600 1.000 53.08001  ? 37   LEU A CB    1 
ATOM   282   C  CG    . LEU A 1 37   ? -52.41700 -30.03900 -61.93700 1.000 42.19475  ? 37   LEU A CG    1 
ATOM   283   C  CD1   . LEU A 1 37   ? -53.86300 -30.37800 -61.63900 1.000 41.64645  ? 37   LEU A CD1   1 
ATOM   284   C  CD2   . LEU A 1 37   ? -52.32600 -28.78800 -62.79600 1.000 48.40136  ? 37   LEU A CD2   1 
ATOM   285   N  N     . THR A 1 38   ? -48.17800 -29.15000 -59.51800 1.000 63.13600  ? 38   THR A N     1 
ATOM   286   C  CA    . THR A 1 38   ? -47.33700 -28.92800 -58.34900 1.000 60.47968  ? 38   THR A CA    1 
ATOM   287   C  C     . THR A 1 38   ? -47.63800 -27.61900 -57.62800 1.000 58.36189  ? 38   THR A C     1 
ATOM   288   O  O     . THR A 1 38   ? -46.91400 -27.26900 -56.69000 1.000 58.27815  ? 38   THR A O     1 
ATOM   289   C  CB    . THR A 1 38   ? -45.86100 -28.96100 -58.75200 1.000 62.68178  ? 38   THR A CB    1 
ATOM   290   O  OG1   . THR A 1 38   ? -45.57500 -27.85200 -59.61400 1.000 70.88981  ? 38   THR A OG1   1 
ATOM   291   C  CG2   . THR A 1 38   ? -45.54000 -30.25300 -59.48000 1.000 55.66260  ? 38   THR A CG2   1 
ATOM   292   N  N     . GLY A 1 39   ? -48.67700 -26.88900 -58.03900 1.000 62.17430  ? 39   GLY A N     1 
ATOM   293   C  CA    . GLY A 1 39   ? -49.01100 -25.65200 -57.35200 1.000 63.02536  ? 39   GLY A CA    1 
ATOM   294   C  C     . GLY A 1 39   ? -49.48500 -25.88400 -55.93000 1.000 53.93006  ? 39   GLY A C     1 
ATOM   295   O  O     . GLY A 1 39   ? -49.11300 -25.14600 -55.01400 1.000 51.59351  ? 39   GLY A O     1 
ATOM   296   N  N     . THR A 1 40   ? -50.31100 -26.90700 -55.72600 1.000 53.02278  ? 40   THR A N     1 
ATOM   297   C  CA    . THR A 1 40   ? -50.75600 -27.26900 -54.38700 1.000 49.37621  ? 40   THR A CA    1 
ATOM   298   C  C     . THR A 1 40   ? -49.58300 -27.85300 -53.60700 1.000 53.36498  ? 40   THR A C     1 
ATOM   299   O  O     . THR A 1 40   ? -49.02600 -28.88600 -53.99100 1.000 61.51394  ? 40   THR A O     1 
ATOM   300   C  CB    . THR A 1 40   ? -51.90600 -28.27100 -54.46900 1.000 48.49071  ? 40   THR A CB    1 
ATOM   301   O  OG1   . THR A 1 40   ? -52.85400 -27.83200 -55.45000 1.000 50.91771  ? 40   THR A OG1   1 
ATOM   302   C  CG2   . THR A 1 40   ? -52.60700 -28.38700 -53.13100 1.000 54.85930  ? 40   THR A CG2   1 
ATOM   303   N  N     . LYS A 1 41   ? -49.20800 -27.19400 -52.51600 1.000 55.53960  ? 41   LYS A N     1 
ATOM   304   C  CA    . LYS A 1 41   ? -47.99900 -27.52400 -51.77700 1.000 56.08453  ? 41   LYS A CA    1 
ATOM   305   C  C     . LYS A 1 41   ? -48.31800 -28.35200 -50.53700 1.000 54.94353  ? 41   LYS A C     1 
ATOM   306   O  O     . LYS A 1 41   ? -49.45300 -28.39400 -50.05800 1.000 58.77340  ? 41   LYS A O     1 
ATOM   307   C  CB    . LYS A 1 41   ? -47.25400 -26.24900 -51.37200 1.000 51.08209  ? 41   LYS A CB    1 
ATOM   308   C  CG    . LYS A 1 41   ? -46.97800 -25.30300 -52.52700 1.000 45.75331  ? 41   LYS A CG    1 
ATOM   309   C  CD    . LYS A 1 41   ? -46.13100 -25.96900 -53.59500 1.000 49.59215  ? 41   LYS A CD    1 
ATOM   310   C  CE    . LYS A 1 41   ? -45.45200 -24.93600 -54.47400 1.000 57.01561  ? 41   LYS A CE    1 
ATOM   311   N  NZ    . LYS A 1 41   ? -46.34600 -24.43700 -55.55600 1.000 63.12601  ? 41   LYS A NZ    1 
ATOM   312   N  N     . TYR A 1 42   ? -47.28600 -29.01600 -50.02100 1.000 51.76464  ? 42   TYR A N     1 
ATOM   313   C  CA    . TYR A 1 42   ? -47.37200 -29.78100 -48.78400 1.000 49.00724  ? 42   TYR A CA    1 
ATOM   314   C  C     . TYR A 1 42   ? -46.75800 -28.97300 -47.64900 1.000 58.41929  ? 42   TYR A C     1 
ATOM   315   O  O     . TYR A 1 42   ? -45.62600 -28.49300 -47.76400 1.000 55.24304  ? 42   TYR A O     1 
ATOM   316   C  CB    . TYR A 1 42   ? -46.66300 -31.13100 -48.92300 1.000 46.19533  ? 42   TYR A CB    1 
ATOM   317   C  CG    . TYR A 1 42   ? -46.45200 -31.85600 -47.60900 1.000 50.95461  ? 42   TYR A CG    1 
ATOM   318   C  CD1   . TYR A 1 42   ? -47.42500 -32.70800 -47.10400 1.000 55.25331  ? 42   TYR A CD1   1 
ATOM   319   C  CD2   . TYR A 1 42   ? -45.29100 -31.67400 -46.86600 1.000 55.25782  ? 42   TYR A CD2   1 
ATOM   320   C  CE1   . TYR A 1 42   ? -47.24400 -33.36600 -45.90200 1.000 55.26043  ? 42   TYR A CE1   1 
ATOM   321   C  CE2   . TYR A 1 42   ? -45.10200 -32.32800 -45.66300 1.000 63.05455  ? 42   TYR A CE2   1 
ATOM   322   C  CZ    . TYR A 1 42   ? -46.08100 -33.17300 -45.18600 1.000 61.68555  ? 42   TYR A CZ    1 
ATOM   323   O  OH    . TYR A 1 42   ? -45.89800 -33.82600 -43.98900 1.000 64.95956  ? 42   TYR A OH    1 
ATOM   324   N  N     . GLY A 1 43   ? -47.49900 -28.83800 -46.55200 1.000 64.18698  ? 43   GLY A N     1 
ATOM   325   C  CA    . GLY A 1 43   ? -47.04400 -28.02900 -45.43800 1.000 61.06208  ? 43   GLY A CA    1 
ATOM   326   C  C     . GLY A 1 43   ? -46.82600 -28.79700 -44.15100 1.000 60.17938  ? 43   GLY A C     1 
ATOM   327   O  O     . GLY A 1 43   ? -45.70000 -28.87000 -43.65200 1.000 63.54200  ? 43   GLY A O     1 
ATOM   328   N  N     . CYS A 1 44   ? -47.89500 -29.36900 -43.59600 1.000 60.34819  ? 44   CYS A N     1 
ATOM   329   C  CA    . CYS A 1 44   ? -47.80300 -30.09500 -42.33500 1.000 67.56843  ? 44   CYS A CA    1 
ATOM   330   C  C     . CYS A 1 44   ? -48.46500 -31.46500 -42.34400 1.000 71.96058  ? 44   CYS A C     1 
ATOM   331   O  O     . CYS A 1 44   ? -48.17700 -32.26600 -41.44700 1.000 76.79019  ? 44   CYS A O     1 
ATOM   332   C  CB    . CYS A 1 44   ? -48.40600 -29.26500 -41.19100 1.000 68.27383  ? 44   CYS A CB    1 
ATOM   333   S  SG    . CYS A 1 44   ? -50.19400 -29.03700 -41.29500 1.000 72.72725  ? 44   CYS A SG    1 
ATOM   334   N  N     . GLY A 1 45   ? -49.33100 -31.76600 -43.30900 1.000 70.64202  ? 45   GLY A N     1 
ATOM   335   C  CA    . GLY A 1 45   ? -49.96500 -33.06800 -43.35900 1.000 71.66112  ? 45   GLY A CA    1 
ATOM   336   C  C     . GLY A 1 45   ? -51.00200 -33.32700 -42.29100 1.000 83.45514  ? 45   GLY A C     1 
ATOM   337   O  O     . GLY A 1 45   ? -51.49400 -34.45500 -42.18900 1.000 86.74752  ? 45   GLY A O     1 
ATOM   338   N  N     . GLY A 1 46   ? -51.34900 -32.32400 -41.49000 1.000 85.88800  ? 46   GLY A N     1 
ATOM   339   C  CA    . GLY A 1 46   ? -52.35600 -32.48800 -40.46200 1.000 80.68941  ? 46   GLY A CA    1 
ATOM   340   C  C     . GLY A 1 46   ? -53.57700 -31.62700 -40.70700 1.000 77.73728  ? 46   GLY A C     1 
ATOM   341   O  O     . GLY A 1 46   ? -54.58800 -31.75400 -40.01000 1.000 79.41838  ? 46   GLY A O     1 
ATOM   342   N  N     . GLY A 1 47   ? -53.49200 -30.74600 -41.69900 1.000 72.42603  ? 47   GLY A N     1 
ATOM   343   C  CA    . GLY A 1 47   ? -54.59600 -29.87100 -42.03500 1.000 68.61623  ? 47   GLY A CA    1 
ATOM   344   C  C     . GLY A 1 47   ? -54.62900 -28.55700 -41.29100 1.000 70.32653  ? 47   GLY A C     1 
ATOM   345   O  O     . GLY A 1 47   ? -55.67300 -27.89400 -41.28700 1.000 65.86739  ? 47   GLY A O     1 
ATOM   346   N  N     . GLY A 1 48   ? -53.52600 -28.15100 -40.66600 1.000 70.51492  ? 48   GLY A N     1 
ATOM   347   C  CA    . GLY A 1 48   ? -53.52300 -26.95200 -39.85200 1.000 68.94946  ? 48   GLY A CA    1 
ATOM   348   C  C     . GLY A 1 48   ? -52.71400 -25.80000 -40.41300 1.000 64.48552  ? 48   GLY A C     1 
ATOM   349   O  O     . GLY A 1 48   ? -52.65400 -24.72800 -39.80400 1.000 71.11742  ? 48   GLY A O     1 
ATOM   350   N  N     . CYS A 1 49   ? -52.10000 -26.01500 -41.57200 1.000 60.09344  ? 49   CYS A N     1 
ATOM   351   C  CA    . CYS A 1 49   ? -51.28100 -24.98700 -42.20500 1.000 60.11000  ? 49   CYS A CA    1 
ATOM   352   C  C     . CYS A 1 49   ? -51.99300 -24.29300 -43.36400 1.000 58.41730  ? 49   CYS A C     1 
ATOM   353   O  O     . CYS A 1 49   ? -51.83400 -23.08800 -43.56300 1.000 58.11483  ? 49   CYS A O     1 
ATOM   354   C  CB    . CYS A 1 49   ? -49.95700 -25.58400 -42.68800 1.000 60.86535  ? 49   CYS A CB    1 
ATOM   355   S  SG    . CYS A 1 49   ? -50.04100 -26.36800 -44.31500 1.000 65.47403  ? 49   CYS A SG    1 
ATOM   356   N  N     . GLY A 1 50   ? -52.77600 -25.05000 -44.12600 1.000 55.55373  ? 50   GLY A N     1 
ATOM   357   C  CA    . GLY A 1 50   ? -53.48400 -24.48800 -45.25600 1.000 49.77780  ? 50   GLY A CA    1 
ATOM   358   C  C     . GLY A 1 50   ? -52.67600 -24.33200 -46.52400 1.000 49.43610  ? 50   GLY A C     1 
ATOM   359   O  O     . GLY A 1 50   ? -53.15300 -23.68500 -47.46300 1.000 54.96812  ? 50   GLY A O     1 
ATOM   360   N  N     . ALA A 1 51   ? -51.47000 -24.90000 -46.58700 1.000 53.97056  ? 51   ALA A N     1 
ATOM   361   C  CA    . ALA A 1 51   ? -50.66900 -24.80400 -47.80200 1.000 55.71488  ? 51   ALA A CA    1 
ATOM   362   C  C     . ALA A 1 51   ? -51.27100 -25.59200 -48.95700 1.000 56.65308  ? 51   ALA A C     1 
ATOM   363   O  O     . ALA A 1 51   ? -50.93300 -25.32600 -50.11500 1.000 61.33363  ? 51   ALA A O     1 
ATOM   364   C  CB    . ALA A 1 51   ? -49.24200 -25.28500 -47.53300 1.000 54.58022  ? 51   ALA A CB    1 
ATOM   365   N  N     . CYS A 1 52   ? -52.15400 -26.54800 -48.66900 1.000 53.08047  ? 52   CYS A N     1 
ATOM   366   C  CA    . CYS A 1 52   ? -52.79400 -27.37400 -49.68400 1.000 45.46272  ? 52   CYS A CA    1 
ATOM   367   C  C     . CYS A 1 52   ? -54.26300 -27.00800 -49.87800 1.000 54.61684  ? 52   CYS A C     1 
ATOM   368   O  O     . CYS A 1 52   ? -55.09000 -27.87100 -50.18100 1.000 60.20172  ? 52   CYS A O     1 
ATOM   369   C  CB    . CYS A 1 52   ? -52.65500 -28.85300 -49.32800 1.000 53.88215  ? 52   CYS A CB    1 
ATOM   370   S  SG    . CYS A 1 52   ? -53.53900 -29.34500 -47.82900 1.000 53.46052  ? 52   CYS A SG    1 
ATOM   371   N  N     . THR A 1 53   ? -54.59800 -25.73100 -49.71400 1.000 54.48859  ? 53   THR A N     1 
ATOM   372   C  CA    . THR A 1 53   ? -55.98400 -25.29900 -49.82900 1.000 53.13494  ? 53   THR A CA    1 
ATOM   373   C  C     . THR A 1 53   ? -56.45100 -25.37400 -51.27900 1.000 50.30450  ? 53   THR A C     1 
ATOM   374   O  O     . THR A 1 53   ? -55.81600 -24.81600 -52.17900 1.000 55.31387  ? 53   THR A O     1 
ATOM   375   C  CB    . THR A 1 53   ? -56.14400 -23.87500 -49.29600 1.000 55.90944  ? 53   THR A CB    1 
ATOM   376   O  OG1   . THR A 1 53   ? -55.99300 -23.87700 -47.87100 1.000 56.72815  ? 53   THR A OG1   1 
ATOM   377   C  CG2   . THR A 1 53   ? -57.51500 -23.32000 -49.65300 1.000 52.80867  ? 53   THR A CG2   1 
ATOM   378   N  N     . VAL A 1 54   ? -57.56000 -26.08000 -51.50200 1.000 49.40266  ? 54   VAL A N     1 
ATOM   379   C  CA    . VAL A 1 54   ? -58.20600 -26.17200 -52.80400 1.000 51.75678  ? 54   VAL A CA    1 
ATOM   380   C  C     . VAL A 1 54   ? -59.69600 -25.91600 -52.61600 1.000 55.59720  ? 54   VAL A C     1 
ATOM   381   O  O     . VAL A 1 54   ? -60.19500 -25.81100 -51.49500 1.000 57.41638  ? 54   VAL A O     1 
ATOM   382   C  CB    . VAL A 1 54   ? -57.97000 -27.53700 -53.48500 1.000 52.07443  ? 54   VAL A CB    1 
ATOM   383   C  CG1   . VAL A 1 54   ? -56.48500 -27.76500 -53.72800 1.000 50.50910  ? 54   VAL A CG1   1 
ATOM   384   C  CG2   . VAL A 1 54   ? -58.55600 -28.65900 -52.64300 1.000 56.47835  ? 54   VAL A CG2   1 
ATOM   385   N  N     . MET A 1 55   ? -60.40900 -25.81600 -53.73400 1.000 57.76784  ? 55   MET A N     1 
ATOM   386   C  CA    . MET A 1 55   ? -61.84400 -25.55900 -53.72800 1.000 52.43536  ? 55   MET A CA    1 
ATOM   387   C  C     . MET A 1 55   ? -62.57600 -26.77100 -54.28800 1.000 57.14704  ? 55   MET A C     1 
ATOM   388   O  O     . MET A 1 55   ? -62.31500 -27.19100 -55.42000 1.000 63.98998  ? 55   MET A O     1 
ATOM   389   C  CB    . MET A 1 55   ? -62.18700 -24.30900 -54.53900 1.000 53.59491  ? 55   MET A CB    1 
ATOM   390   C  CG    . MET A 1 55   ? -63.68300 -24.03700 -54.63000 1.000 61.40354  ? 55   MET A CG    1 
ATOM   391   S  SD    . MET A 1 55   ? -64.10300 -22.49000 -55.45900 1.000 58.71132  ? 55   MET A SD    1 
ATOM   392   C  CE    . MET A 1 55   ? -63.78500 -22.91500 -57.16800 1.000 67.31067  ? 55   MET A CE    1 
ATOM   393   N  N     . ILE A 1 56   ? -63.48800 -27.32700 -53.49400 1.000 54.78495  ? 56   ILE A N     1 
ATOM   394   C  CA    . ILE A 1 56   ? -64.36000 -28.41300 -53.92400 1.000 58.86365  ? 56   ILE A CA    1 
ATOM   395   C  C     . ILE A 1 56   ? -65.70900 -27.82300 -54.30500 1.000 57.59726  ? 56   ILE A C     1 
ATOM   396   O  O     . ILE A 1 56   ? -66.25600 -26.97900 -53.58400 1.000 64.92783  ? 56   ILE A O     1 
ATOM   397   C  CB    . ILE A 1 56   ? -64.51200 -29.48100 -52.82400 1.000 64.25126  ? 56   ILE A CB    1 
ATOM   398   C  CG1   . ILE A 1 56   ? -63.14100 -29.90500 -52.29000 1.000 64.50951  ? 56   ILE A CG1   1 
ATOM   399   C  CG2   . ILE A 1 56   ? -65.27500 -30.68700 -53.35100 1.000 58.30677  ? 56   ILE A CG2   1 
ATOM   400   C  CD1   . ILE A 1 56   ? -62.20900 -30.44600 -53.35500 1.000 58.63166  ? 56   ILE A CD1   1 
ATOM   401   N  N     . SER A 1 57   ? -66.24800 -28.26000 -55.44100 1.000 58.04255  ? 57   SER A N     1 
ATOM   402   C  CA    . SER A 1 57   ? -67.50700 -27.73900 -55.96000 1.000 58.09502  ? 57   SER A CA    1 
ATOM   403   C  C     . SER A 1 57   ? -68.45000 -28.89800 -56.23900 1.000 67.22274  ? 57   SER A C     1 
ATOM   404   O  O     . SER A 1 57   ? -68.12600 -29.78900 -57.03200 1.000 69.50032  ? 57   SER A O     1 
ATOM   405   C  CB    . SER A 1 57   ? -67.28000 -26.91400 -57.23000 1.000 62.44167  ? 57   SER A CB    1 
ATOM   406   O  OG    . SER A 1 57   ? -66.35800 -25.86400 -56.99500 1.000 70.69969  ? 57   SER A OG    1 
ATOM   407   N  N     . ARG A 1 58   ? -69.61100 -28.88400 -55.58900 1.000 65.64782  ? 58   ARG A N     1 
ATOM   408   C  CA    . ARG A 1 58   ? -70.65500 -29.87100 -55.80500 1.000 60.64865  ? 58   ARG A CA    1 
ATOM   409   C  C     . ARG A 1 58   ? -71.91000 -29.17900 -56.31800 1.000 66.55299  ? 58   ARG A C     1 
ATOM   410   O  O     . ARG A 1 58   ? -72.10100 -27.97400 -56.13000 1.000 64.86781  ? 58   ARG A O     1 
ATOM   411   C  CB    . ARG A 1 58   ? -70.97500 -30.64000 -54.51500 1.000 63.69680  ? 58   ARG A CB    1 
ATOM   412   C  CG    . ARG A 1 58   ? -69.75500 -31.10400 -53.73800 1.000 61.15770  ? 58   ARG A CG    1 
ATOM   413   C  CD    . ARG A 1 58   ? -69.56700 -32.60900 -53.83700 1.000 54.40432  ? 58   ARG A CD    1 
ATOM   414   N  NE    . ARG A 1 58   ? -68.47800 -33.07000 -52.97900 1.000 75.68865  ? 58   ARG A NE    1 
ATOM   415   C  CZ    . ARG A 1 58   ? -68.08200 -34.33500 -52.88400 1.000 75.95613  ? 58   ARG A CZ    1 
ATOM   416   N  NH1   . ARG A 1 58   ? -68.68300 -35.27700 -53.59800 1.000 72.64137  ? 58   ARG A NH1   1 
ATOM   417   N  NH2   . ARG A 1 58   ? -67.08200 -34.65800 -52.07500 1.000 70.12281  ? 58   ARG A NH2   1 
ATOM   418   N  N     . TYR A 1 59   ? -72.76800 -29.95600 -56.97200 1.000 79.47742  ? 59   TYR A N     1 
ATOM   419   C  CA    . TYR A 1 59   ? -74.04500 -29.46700 -57.48000 1.000 77.92043  ? 59   TYR A CA    1 
ATOM   420   C  C     . TYR A 1 59   ? -75.16700 -30.25600 -56.82300 1.000 82.75162  ? 59   TYR A C     1 
ATOM   421   O  O     . TYR A 1 59   ? -75.26700 -31.47300 -57.01200 1.000 89.82337  ? 59   TYR A O     1 
ATOM   422   C  CB    . TYR A 1 59   ? -74.12200 -29.59100 -59.00300 1.000 80.81190  ? 59   TYR A CB    1 
ATOM   423   C  CG    . TYR A 1 59   ? -75.42000 -29.08000 -59.58900 1.000 88.90189  ? 59   TYR A CG    1 
ATOM   424   C  CD1   . TYR A 1 59   ? -75.61800 -27.72400 -59.81200 1.000 92.26555  ? 59   TYR A CD1   1 
ATOM   425   C  CD2   . TYR A 1 59   ? -76.44800 -29.95500 -59.92000 1.000 93.59940  ? 59   TYR A CD2   1 
ATOM   426   C  CE1   . TYR A 1 59   ? -76.80400 -27.25100 -60.34600 1.000 95.33495  ? 59   TYR A CE1   1 
ATOM   427   C  CE2   . TYR A 1 59   ? -77.63700 -29.49200 -60.45500 1.000 96.82894  ? 59   TYR A CE2   1 
ATOM   428   C  CZ    . TYR A 1 59   ? -77.80900 -28.14000 -60.66600 1.000 102.06257 ? 59   TYR A CZ    1 
ATOM   429   O  OH    . TYR A 1 59   ? -78.99000 -27.67500 -61.19900 1.000 107.97534 ? 59   TYR A OH    1 
ATOM   430   N  N     . ASN A 1 60   ? -76.00400 -29.56400 -56.05000 1.000 88.67802  ? 60   ASN A N     1 
ATOM   431   C  CA    . ASN A 1 60   ? -77.17000 -30.18700 -55.44100 1.000 94.80730  ? 60   ASN A CA    1 
ATOM   432   C  C     . ASN A 1 60   ? -78.31900 -30.13500 -56.43700 1.000 92.51910  ? 60   ASN A C     1 
ATOM   433   O  O     . ASN A 1 60   ? -78.82700 -29.03900 -56.72200 1.000 90.66720  ? 60   ASN A O     1 
ATOM   434   C  CB    . ASN A 1 60   ? -77.54900 -29.48100 -54.14800 1.000 96.99325  ? 60   ASN A CB    1 
ATOM   435   C  CG    . ASN A 1 60   ? -78.79300 -30.06400 -53.50800 1.000 98.75290  ? 60   ASN A CG    1 
ATOM   436   O  OD1   . ASN A 1 60   ? -79.64800 -29.33600 -53.00700 1.000 103.50508 ? 60   ASN A OD1   1 
ATOM   437   N  ND2   . ASN A 1 60   ? -78.90100 -31.38800 -53.52500 1.000 102.01236 ? 60   ASN A ND2   1 
ATOM   438   N  N     . PRO A 1 61   ? -78.75900 -31.26800 -56.99200 1.000 92.27371  ? 61   PRO A N     1 
ATOM   439   C  CA    . PRO A 1 61   ? -79.81700 -31.22000 -58.01300 1.000 96.23133  ? 61   PRO A CA    1 
ATOM   440   C  C     . PRO A 1 61   ? -81.18000 -30.84000 -57.46300 1.000 104.15286 ? 61   PRO A C     1 
ATOM   441   O  O     . PRO A 1 61   ? -82.05000 -30.43400 -58.24300 1.000 98.30093  ? 61   PRO A O     1 
ATOM   442   C  CB    . PRO A 1 61   ? -79.82200 -32.64700 -58.57300 1.000 90.16288  ? 61   PRO A CB    1 
ATOM   443   C  CG    . PRO A 1 61   ? -79.35600 -33.48400 -57.42600 1.000 93.54812  ? 61   PRO A CG    1 
ATOM   444   C  CD    . PRO A 1 61   ? -78.34500 -32.64800 -56.68500 1.000 89.11995  ? 61   PRO A CD    1 
ATOM   445   N  N     . ILE A 1 62   ? -81.39500 -30.95600 -56.15200 1.000 106.84586 ? 62   ILE A N     1 
ATOM   446   C  CA    . ILE A 1 62   ? -82.69200 -30.61300 -55.57900 1.000 101.60687 ? 62   ILE A CA    1 
ATOM   447   C  C     . ILE A 1 62   ? -82.85800 -29.10200 -55.48400 1.000 97.52303  ? 62   ILE A C     1 
ATOM   448   O  O     . ILE A 1 62   ? -83.93400 -28.56600 -55.77200 1.000 90.03826  ? 62   ILE A O     1 
ATOM   449   C  CB    . ILE A 1 62   ? -82.86100 -31.29200 -54.20800 1.000 101.07479 ? 62   ILE A CB    1 
ATOM   450   C  CG1   . ILE A 1 62   ? -82.36300 -32.73800 -54.26200 1.000 97.74965  ? 62   ILE A CG1   1 
ATOM   451   C  CG2   . ILE A 1 62   ? -84.31400 -31.24200 -53.76600 1.000 98.26972  ? 62   ILE A CG2   1 
ATOM   452   C  CD1   . ILE A 1 62   ? -83.12500 -33.61600 -55.23400 1.000 93.74056  ? 62   ILE A CD1   1 
ATOM   453   N  N     . THR A 1 63   ? -81.80500 -28.39300 -55.08200 1.000 100.83097 ? 63   THR A N     1 
ATOM   454   C  CA    . THR A 1 63   ? -81.84000 -26.94000 -54.99200 1.000 96.51762  ? 63   THR A CA    1 
ATOM   455   C  C     . THR A 1 63   ? -81.45700 -26.25900 -56.30100 1.000 94.71567  ? 63   THR A C     1 
ATOM   456   O  O     . THR A 1 63   ? -81.68700 -25.05300 -56.44300 1.000 90.95675  ? 63   THR A O     1 
ATOM   457   C  CB    . THR A 1 63   ? -80.90600 -26.45800 -53.87400 1.000 99.88339  ? 63   THR A CB    1 
ATOM   458   O  OG1   . THR A 1 63   ? -81.04700 -27.31300 -52.73300 1.000 103.30146 ? 63   THR A OG1   1 
ATOM   459   C  CG2   . THR A 1 63   ? -81.25600 -25.03700 -53.46000 1.000 102.31386 ? 63   THR A CG2   1 
ATOM   460   N  N     . LYS A 1 64   ? -80.89300 -27.00500 -57.25400 1.000 103.84097 ? 64   LYS A N     1 
ATOM   461   C  CA    . LYS A 1 64   ? -80.45800 -26.46100 -58.54300 1.000 103.04937 ? 64   LYS A CA    1 
ATOM   462   C  C     . LYS A 1 64   ? -79.46900 -25.31200 -58.35700 1.000 98.40466  ? 64   LYS A C     1 
ATOM   463   O  O     . LYS A 1 64   ? -79.53400 -24.29300 -59.04600 1.000 99.47528  ? 64   LYS A O     1 
ATOM   464   C  CB    . LYS A 1 64   ? -81.65100 -26.02000 -59.39600 1.000 105.98207 ? 64   LYS A CB    1 
ATOM   465   C  CG    . LYS A 1 64   ? -82.30000 -27.14700 -60.18300 1.000 106.89014 ? 64   LYS A CG    1 
ATOM   466   C  CD    . LYS A 1 64   ? -83.52900 -26.66600 -60.94000 1.000 111.18147 ? 64   LYS A CD    1 
ATOM   467   C  CE    . LYS A 1 64   ? -83.19200 -25.50000 -61.85800 1.000 111.83932 ? 64   LYS A CE    1 
ATOM   468   N  NZ    . LYS A 1 64   ? -84.38100 -25.03500 -62.62500 1.000 103.78187 ? 64   LYS A NZ    1 
ATOM   469   N  N     . ARG A 1 65   ? -78.54200 -25.47900 -57.41500 1.000 94.17086  ? 65   ARG A N     1 
ATOM   470   C  CA    . ARG A 1 65   ? -77.51900 -24.47900 -57.15300 1.000 94.11926  ? 65   ARG A CA    1 
ATOM   471   C  C     . ARG A 1 65   ? -76.20100 -25.17200 -56.84000 1.000 86.53424  ? 65   ARG A C     1 
ATOM   472   O  O     . ARG A 1 65   ? -76.17500 -26.31600 -56.38000 1.000 83.16946  ? 65   ARG A O     1 
ATOM   473   C  CB    . ARG A 1 65   ? -77.91500 -23.55000 -55.99900 1.000 98.54509  ? 65   ARG A CB    1 
ATOM   474   C  CG    . ARG A 1 65   ? -77.32800 -22.14900 -56.10800 1.000 99.92549  ? 65   ARG A CG    1 
ATOM   475   C  CD    . ARG A 1 65   ? -77.67700 -21.28300 -54.90400 1.000 106.19609 ? 65   ARG A CD    1 
ATOM   476   N  NE    . ARG A 1 65   ? -79.11700 -21.21000 -54.66900 1.000 124.16512 ? 65   ARG A NE    1 
ATOM   477   C  CZ    . ARG A 1 65   ? -79.76100 -21.90500 -53.73600 1.000 118.99349 ? 65   ARG A CZ    1 
ATOM   478   N  NH1   . ARG A 1 65   ? -79.09200 -22.73000 -52.94200 1.000 107.83426 ? 65   ARG A NH1   1 
ATOM   479   N  NH2   . ARG A 1 65   ? -81.07300 -21.77400 -53.59700 1.000 115.69801 ? 65   ARG A NH2   1 
ATOM   480   N  N     . ILE A 1 66   ? -75.10700 -24.46000 -57.09300 1.000 73.51496  ? 66   ILE A N     1 
ATOM   481   C  CA    . ILE A 1 66   ? -73.75600 -24.98400 -56.92900 1.000 71.81934  ? 66   ILE A CA    1 
ATOM   482   C  C     . ILE A 1 66   ? -73.17700 -24.46000 -55.62400 1.000 67.90574  ? 66   ILE A C     1 
ATOM   483   O  O     . ILE A 1 66   ? -73.33200 -23.27800 -55.29200 1.000 72.34221  ? 66   ILE A O     1 
ATOM   484   C  CB    . ILE A 1 66   ? -72.87100 -24.59300 -58.12700 1.000 76.99406  ? 66   ILE A CB    1 
ATOM   485   C  CG1   . ILE A 1 66   ? -73.64900 -24.77100 -59.43300 1.000 72.84322  ? 66   ILE A CG1   1 
ATOM   486   C  CG2   . ILE A 1 66   ? -71.59900 -25.42300 -58.14300 1.000 73.93146  ? 66   ILE A CG2   1 
ATOM   487   C  CD1   . ILE A 1 66   ? -73.03500 -24.06400 -60.61500 1.000 60.00262  ? 66   ILE A CD1   1 
ATOM   488   N  N     . ARG A 1 67   ? -72.50300 -25.33700 -54.88400 1.000 68.98859  ? 67   ARG A N     1 
ATOM   489   C  CA    . ARG A 1 67   ? -71.94500 -25.01000 -53.57700 1.000 70.34473  ? 67   ARG A CA    1 
ATOM   490   C  C     . ARG A 1 67   ? -70.42600 -25.10100 -53.64300 1.000 72.66053  ? 67   ARG A C     1 
ATOM   491   O  O     . ARG A 1 67   ? -69.87600 -26.17900 -53.88900 1.000 68.24009  ? 67   ARG A O     1 
ATOM   492   C  CB    . ARG A 1 67   ? -72.49600 -25.94700 -52.50000 1.000 69.42676  ? 67   ARG A CB    1 
ATOM   493   C  CG    . ARG A 1 67   ? -71.83000 -25.80900 -51.14100 1.000 78.09175  ? 67   ARG A CG    1 
ATOM   494   C  CD    . ARG A 1 67   ? -72.56200 -26.62800 -50.08700 1.000 87.48728  ? 67   ARG A CD    1 
ATOM   495   N  NE    . ARG A 1 67   ? -71.77500 -27.76900 -49.62800 1.000 84.58649  ? 67   ARG A NE    1 
ATOM   496   C  CZ    . ARG A 1 67   ? -70.93900 -27.73500 -48.59500 1.000 84.88981  ? 67   ARG A CZ    1 
ATOM   497   N  NH1   . ARG A 1 67   ? -70.77700 -26.61400 -47.90600 1.000 80.97719  ? 67   ARG A NH1   1 
ATOM   498   N  NH2   . ARG A 1 67   ? -70.26500 -28.82400 -48.24900 1.000 91.76036  ? 67   ARG A NH2   1 
ATOM   499   N  N     . HIS A 1 68   ? -69.75700 -23.97200 -53.42200 1.000 73.18844  ? 68   HIS A N     1 
ATOM   500   C  CA    . HIS A 1 68   ? -68.30200 -23.91100 -53.38300 1.000 64.93597  ? 68   HIS A CA    1 
ATOM   501   C  C     . HIS A 1 68   ? -67.83000 -23.83900 -51.93700 1.000 63.74475  ? 68   HIS A C     1 
ATOM   502   O  O     . HIS A 1 68   ? -68.40500 -23.11100 -51.12200 1.000 73.94399  ? 68   HIS A O     1 
ATOM   503   C  CB    . HIS A 1 68   ? -67.78200 -22.69800 -54.15500 1.000 61.43310  ? 68   HIS A CB    1 
ATOM   504   C  CG    . HIS A 1 68   ? -68.27000 -22.62000 -55.56800 1.000 62.05888  ? 68   HIS A CG    1 
ATOM   505   N  ND1   . HIS A 1 68   ? -68.07400 -23.63300 -56.48200 1.000 69.38059  ? 68   HIS A ND1   1 
ATOM   506   C  CD2   . HIS A 1 68   ? -68.94000 -21.64500 -56.22600 1.000 60.75574  ? 68   HIS A CD2   1 
ATOM   507   C  CE1   . HIS A 1 68   ? -68.60500 -23.28700 -57.64100 1.000 63.08644  ? 68   HIS A CE1   1 
ATOM   508   N  NE2   . HIS A 1 68   ? -69.13700 -22.08400 -57.51300 1.000 63.36016  ? 68   HIS A NE2   1 
ATOM   509   N  N     . HIS A 1 69   ? -66.77700 -24.59600 -51.62000 1.000 60.60642  ? 69   HIS A N     1 
ATOM   510   C  CA    . HIS A 1 69   ? -66.23400 -24.59000 -50.27100 1.000 68.98347  ? 69   HIS A CA    1 
ATOM   511   C  C     . HIS A 1 69   ? -64.76500 -24.98900 -50.29500 1.000 67.14158  ? 69   HIS A C     1 
ATOM   512   O  O     . HIS A 1 69   ? -64.38700 -25.89300 -51.05500 1.000 68.73485  ? 69   HIS A O     1 
ATOM   513   C  CB    . HIS A 1 69   ? -67.02900 -25.52200 -49.34300 1.000 69.63961  ? 69   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1 69   ? -66.59300 -26.95500 -49.38700 1.000 73.18885  ? 69   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1 69   ? -65.51100 -27.42900 -48.67600 1.000 71.41910  ? 69   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1 69   ? -67.10300 -28.02000 -50.05000 1.000 74.01502  ? 69   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1 69   ? -65.37000 -28.72300 -48.90400 1.000 70.22441  ? 69   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1 69   ? -66.32300 -29.10600 -49.73400 1.000 76.43465  ? 69   HIS A NE2   1 
ATOM   519   N  N     . PRO A 1 70   ? -63.92300 -24.33600 -49.49900 1.000 60.20825  ? 70   PRO A N     1 
ATOM   520   C  CA    . PRO A 1 70   ? -62.50100 -24.68500 -49.47300 1.000 66.53822  ? 70   PRO A CA    1 
ATOM   521   C  C     . PRO A 1 70   ? -62.25200 -25.94900 -48.66500 1.000 64.08107  ? 70   PRO A C     1 
ATOM   522   O  O     . PRO A 1 70   ? -63.09100 -26.39900 -47.88200 1.000 64.72687  ? 70   PRO A O     1 
ATOM   523   C  CB    . PRO A 1 70   ? -61.85400 -23.46800 -48.80400 1.000 64.07163  ? 70   PRO A CB    1 
ATOM   524   C  CG    . PRO A 1 70   ? -62.92300 -22.94700 -47.90500 1.000 66.08185  ? 70   PRO A CG    1 
ATOM   525   C  CD    . PRO A 1 70   ? -64.23200 -23.20300 -48.60900 1.000 61.04524  ? 70   PRO A CD    1 
ATOM   526   N  N     . ALA A 1 71   ? -61.06500 -26.51800 -48.86500 1.000 60.02701  ? 71   ALA A N     1 
ATOM   527   C  CA    . ALA A 1 71   ? -60.70100 -27.75200 -48.18300 1.000 63.11543  ? 71   ALA A CA    1 
ATOM   528   C  C     . ALA A 1 71   ? -59.19800 -27.96500 -48.28100 1.000 57.85355  ? 71   ALA A C     1 
ATOM   529   O  O     . ALA A 1 71   ? -58.54900 -27.48800 -49.21600 1.000 59.35178  ? 71   ALA A O     1 
ATOM   530   C  CB    . ALA A 1 71   ? -61.44600 -28.95600 -48.77100 1.000 61.21827  ? 71   ALA A CB    1 
ATOM   531   N  N     . ASN A 1 72   ? -58.65800 -28.68700 -47.30200 1.000 53.99665  ? 72   ASN A N     1 
ATOM   532   C  CA    . ASN A 1 72   ? -57.25400 -29.07600 -47.29800 1.000 57.94797  ? 72   ASN A CA    1 
ATOM   533   C  C     . ASN A 1 72   ? -57.10200 -30.38200 -48.07000 1.000 61.14592  ? 72   ASN A C     1 
ATOM   534   O  O     . ASN A 1 72   ? -57.63300 -31.41900 -47.65500 1.000 61.74539  ? 72   ASN A O     1 
ATOM   535   C  CB    . ASN A 1 72   ? -56.73700 -29.23200 -45.86800 1.000 62.91598  ? 72   ASN A CB    1 
ATOM   536   C  CG    . ASN A 1 72   ? -56.94100 -27.98200 -45.03300 1.000 70.76785  ? 72   ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1 72   ? -57.66200 -28.00000 -44.03500 1.000 75.14037  ? 72   ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1 72   ? -56.30400 -26.88900 -45.43600 1.000 67.95006  ? 72   ASN A ND2   1 
ATOM   539   N  N     . ALA A 1 73   ? -56.37200 -30.33100 -49.18700 1.000 57.66632  ? 73   ALA A N     1 
ATOM   540   C  CA    . ALA A 1 73   ? -56.26300 -31.48800 -50.06800 1.000 53.57229  ? 73   ALA A CA    1 
ATOM   541   C  C     . ALA A 1 73   ? -55.51000 -32.64900 -49.43200 1.000 56.26152  ? 73   ALA A C     1 
ATOM   542   O  O     . ALA A 1 73   ? -55.68300 -33.79300 -49.86600 1.000 55.41576  ? 73   ALA A O     1 
ATOM   543   C  CB    . ALA A 1 73   ? -55.58300 -31.08700 -51.37800 1.000 53.22065  ? 73   ALA A CB    1 
ATOM   544   N  N     . CYS A 1 74   ? -54.68500 -32.38900 -48.41500 1.000 54.54980  ? 74   CYS A N     1 
ATOM   545   C  CA    . CYS A 1 74   ? -53.88900 -33.44500 -47.80000 1.000 52.91921  ? 74   CYS A CA    1 
ATOM   546   C  C     . CYS A 1 74   ? -54.71800 -34.40700 -46.95900 1.000 55.59850  ? 74   CYS A C     1 
ATOM   547   O  O     . CYS A 1 74   ? -54.17600 -35.41500 -46.49400 1.000 54.18254  ? 74   CYS A O     1 
ATOM   548   C  CB    . CYS A 1 74   ? -52.77900 -32.83200 -46.94400 1.000 54.25116  ? 74   CYS A CB    1 
ATOM   549   S  SG    . CYS A 1 74   ? -53.35400 -31.82700 -45.56100 1.000 52.64465  ? 74   CYS A SG    1 
ATOM   550   N  N     . LEU A 1 75   ? -56.00600 -34.13000 -46.75500 1.000 64.79513  ? 75   LEU A N     1 
ATOM   551   C  CA    . LEU A 1 75   ? -56.87100 -34.99800 -45.96800 1.000 62.80772  ? 75   LEU A CA    1 
ATOM   552   C  C     . LEU A 1 75   ? -58.05900 -35.54100 -46.75000 1.000 55.86773  ? 75   LEU A C     1 
ATOM   553   O  O     . LEU A 1 75   ? -58.89900 -36.23300 -46.16300 1.000 55.20454  ? 75   LEU A O     1 
ATOM   554   C  CB    . LEU A 1 75   ? -57.38300 -34.25700 -44.72500 1.000 60.55987  ? 75   LEU A CB    1 
ATOM   555   C  CG    . LEU A 1 75   ? -56.40100 -34.07600 -43.56700 1.000 58.74239  ? 75   LEU A CG    1 
ATOM   556   C  CD1   . LEU A 1 75   ? -57.01000 -33.19100 -42.49100 1.000 50.69302  ? 75   LEU A CD1   1 
ATOM   557   C  CD2   . LEU A 1 75   ? -55.99600 -35.42500 -42.99100 1.000 55.11919  ? 75   LEU A CD2   1 
ATOM   558   N  N     . ILE A 1 76   ? -58.15400 -35.26200 -48.04300 1.000 57.28256  ? 76   ILE A N     1 
ATOM   559   C  CA    . ILE A 1 76   ? -59.28600 -35.68200 -48.86400 1.000 55.96067  ? 76   ILE A CA    1 
ATOM   560   C  C     . ILE A 1 76   ? -58.89600 -36.95600 -49.60500 1.000 56.67058  ? 76   ILE A C     1 
ATOM   561   O  O     . ILE A 1 76   ? -57.97200 -36.91700 -50.43200 1.000 61.72874  ? 76   ILE A O     1 
ATOM   562   C  CB    . ILE A 1 76   ? -59.70500 -34.58700 -49.85600 1.000 52.98833  ? 76   ILE A CB    1 
ATOM   563   C  CG1   . ILE A 1 76   ? -60.02100 -33.28400 -49.12300 1.000 58.22791  ? 76   ILE A CG1   1 
ATOM   564   C  CG2   . ILE A 1 76   ? -60.90100 -35.04400 -50.67800 1.000 55.29409  ? 76   ILE A CG2   1 
ATOM   565   C  CD1   . ILE A 1 76   ? -60.22200 -32.10900 -50.05100 1.000 60.84348  ? 76   ILE A CD1   1 
ATOM   566   N  N     . PRO A 1 77   ? -59.54800 -38.08600 -49.34400 1.000 59.51816  ? 77   PRO A N     1 
ATOM   567   C  CA    . PRO A 1 77   ? -59.39700 -39.23800 -50.23900 1.000 64.83178  ? 77   PRO A CA    1 
ATOM   568   C  C     . PRO A 1 77   ? -60.14600 -38.99300 -51.54000 1.000 64.92200  ? 77   PRO A C     1 
ATOM   569   O  O     . PRO A 1 77   ? -61.25300 -38.45100 -51.54600 1.000 67.15547  ? 77   PRO A O     1 
ATOM   570   C  CB    . PRO A 1 77   ? -60.01200 -40.39300 -49.44200 1.000 70.29895  ? 77   PRO A CB    1 
ATOM   571   C  CG    . PRO A 1 77   ? -60.98000 -39.73100 -48.51700 1.000 63.00441  ? 77   PRO A CG    1 
ATOM   572   C  CD    . PRO A 1 77   ? -60.39300 -38.39200 -48.17600 1.000 62.84421  ? 77   PRO A CD    1 
ATOM   573   N  N     . ILE A 1 78   ? -59.52600 -39.39400 -52.65300 1.000 60.40049  ? 78   ILE A N     1 
ATOM   574   C  CA    . ILE A 1 78   ? -60.09000 -39.07600 -53.96000 1.000 59.31462  ? 78   ILE A CA    1 
ATOM   575   C  C     . ILE A 1 78   ? -61.38200 -39.83500 -54.22900 1.000 68.59341  ? 78   ILE A C     1 
ATOM   576   O  O     . ILE A 1 78   ? -62.17000 -39.41900 -55.08700 1.000 69.56764  ? 78   ILE A O     1 
ATOM   577   C  CB    . ILE A 1 78   ? -59.06600 -39.34700 -55.07900 1.000 59.17639  ? 78   ILE A CB    1 
ATOM   578   C  CG1   . ILE A 1 78   ? -58.68700 -40.82800 -55.11700 1.000 67.48017  ? 78   ILE A CG1   1 
ATOM   579   C  CG2   . ILE A 1 78   ? -57.83300 -38.47800 -54.89100 1.000 58.74828  ? 78   ILE A CG2   1 
ATOM   580   C  CD1   . ILE A 1 78   ? -57.77900 -41.19000 -56.27200 1.000 59.72146  ? 78   ILE A CD1   1 
ATOM   581   N  N     . CYS A 1 79   ? -61.62900 -40.93900 -53.52000 1.000 71.31999  ? 79   CYS A N     1 
ATOM   582   C  CA    . CYS A 1 79   ? -62.87400 -41.67400 -53.70900 1.000 70.89459  ? 79   CYS A CA    1 
ATOM   583   C  C     . CYS A 1 79   ? -64.08200 -40.90900 -53.18500 1.000 72.43202  ? 79   CYS A C     1 
ATOM   584   O  O     . CYS A 1 79   ? -65.21100 -41.20200 -53.59400 1.000 69.34698  ? 79   CYS A O     1 
ATOM   585   C  CB    . CYS A 1 79   ? -62.78700 -43.04300 -53.03300 1.000 60.24305  ? 79   CYS A CB    1 
ATOM   586   S  SG    . CYS A 1 79   ? -61.51100 -44.13200 -53.70500 1.000 75.06364  ? 79   CYS A SG    1 
ATOM   587   N  N     . SER A 1 80   ? -63.87300 -39.93900 -52.29700 1.000 71.13095  ? 80   SER A N     1 
ATOM   588   C  CA    . SER A 1 80   ? -64.94500 -39.10200 -51.77700 1.000 68.13319  ? 80   SER A CA    1 
ATOM   589   C  C     . SER A 1 80   ? -65.24200 -37.90500 -52.67000 1.000 59.68130  ? 80   SER A C     1 
ATOM   590   O  O     . SER A 1 80   ? -66.05300 -37.05200 -52.29400 1.000 66.51607  ? 80   SER A O     1 
ATOM   591   C  CB    . SER A 1 80   ? -64.59900 -38.62000 -50.36600 1.000 70.38165  ? 80   SER A CB    1 
ATOM   592   O  OG    . SER A 1 80   ? -63.64400 -37.57300 -50.40600 1.000 75.05066  ? 80   SER A OG    1 
ATOM   593   N  N     . LEU A 1 81   ? -64.60900 -37.82200 -53.84000 1.000 56.26765  ? 81   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 81   ? -64.78000 -36.69400 -54.74500 1.000 64.02576  ? 81   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 81   ? -65.57100 -37.05200 -55.99600 1.000 63.35957  ? 81   LEU A C     1 
ATOM   596   O  O     . LEU A 1 81   ? -65.56100 -36.28100 -56.96100 1.000 66.43765  ? 81   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 81   ? -63.41600 -36.12400 -55.14100 1.000 60.84551  ? 81   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 81   ? -62.63500 -35.41600 -54.03500 1.000 67.81804  ? 81   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 81   ? -61.32800 -34.88400 -54.57800 1.000 53.57885  ? 81   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 81   ? -63.46100 -34.29300 -53.43100 1.000 69.15666  ? 81   LEU A CD2   1 
ATOM   601   N  N     . TYR A 1 82   ? -66.25400 -38.19500 -56.00400 1.000 59.72018  ? 82   TYR A N     1 
ATOM   602   C  CA    . TYR A 1 82   ? -67.02600 -38.59800 -57.17300 1.000 63.88504  ? 82   TYR A CA    1 
ATOM   603   C  C     . TYR A 1 82   ? -68.10800 -37.56800 -57.47000 1.000 64.80015  ? 82   TYR A C     1 
ATOM   604   O  O     . TYR A 1 82   ? -68.93900 -37.25900 -56.61000 1.000 71.80141  ? 82   TYR A O     1 
ATOM   605   C  CB    . TYR A 1 82   ? -67.64700 -39.97600 -56.94700 1.000 72.22190  ? 82   TYR A CB    1 
ATOM   606   C  CG    . TYR A 1 82   ? -68.33600 -40.54600 -58.17000 1.000 75.24120  ? 82   TYR A CG    1 
ATOM   607   C  CD1   . TYR A 1 82   ? -69.65300 -40.21500 -58.47000 1.000 79.87951  ? 82   TYR A CD1   1 
ATOM   608   C  CD2   . TYR A 1 82   ? -67.66900 -41.41400 -59.02400 1.000 71.98389  ? 82   TYR A CD2   1 
ATOM   609   C  CE1   . TYR A 1 82   ? -70.28400 -40.73100 -59.58600 1.000 75.77270  ? 82   TYR A CE1   1 
ATOM   610   C  CE2   . TYR A 1 82   ? -68.29400 -41.93600 -60.14200 1.000 76.03523  ? 82   TYR A CE2   1 
ATOM   611   C  CZ    . TYR A 1 82   ? -69.60100 -41.59000 -60.41700 1.000 79.40948  ? 82   TYR A CZ    1 
ATOM   612   O  OH    . TYR A 1 82   ? -70.22700 -42.10700 -61.52900 1.000 92.04478  ? 82   TYR A OH    1 
ATOM   613   N  N     . GLY A 1 83   ? -68.09400 -37.03700 -58.69000 1.000 58.50458  ? 83   GLY A N     1 
ATOM   614   C  CA    . GLY A 1 83   ? -69.05500 -36.03800 -59.10000 1.000 63.64538  ? 83   GLY A CA    1 
ATOM   615   C  C     . GLY A 1 83   ? -68.73700 -34.62300 -58.67400 1.000 66.34057  ? 83   GLY A C     1 
ATOM   616   O  O     . GLY A 1 83   ? -69.54600 -33.72200 -58.93400 1.000 68.47352  ? 83   GLY A O     1 
ATOM   617   N  N     . ALA A 1 84   ? -67.59700 -34.39200 -58.03300 1.000 64.04683  ? 84   ALA A N     1 
ATOM   618   C  CA    . ALA A 1 84   ? -67.20000 -33.06700 -57.58400 1.000 59.70365  ? 84   ALA A CA    1 
ATOM   619   C  C     . ALA A 1 84   ? -66.16900 -32.46700 -58.53500 1.000 64.68930  ? 84   ALA A C     1 
ATOM   620   O  O     . ALA A 1 84   ? -65.57100 -33.15500 -59.36500 1.000 68.37441  ? 84   ALA A O     1 
ATOM   621   C  CB    . ALA A 1 84   ? -66.64700 -33.12600 -56.15800 1.000 62.12452  ? 84   ALA A CB    1 
ATOM   622   N  N     . ALA A 1 85   ? -65.96300 -31.15800 -58.39900 1.000 58.99624  ? 85   ALA A N     1 
ATOM   623   C  CA    . ALA A 1 85   ? -65.05600 -30.40300 -59.25900 1.000 58.48701  ? 85   ALA A CA    1 
ATOM   624   C  C     . ALA A 1 85   ? -64.01000 -29.72100 -58.38900 1.000 58.31789  ? 85   ALA A C     1 
ATOM   625   O  O     . ALA A 1 85   ? -64.32900 -28.78900 -57.64300 1.000 64.42159  ? 85   ALA A O     1 
ATOM   626   C  CB    . ALA A 1 85   ? -65.82200 -29.38200 -60.09800 1.000 62.09160  ? 85   ALA A CB    1 
ATOM   627   N  N     . VAL A 1 86   ? -62.76700 -30.17900 -58.48900 1.000 60.57900  ? 86   VAL A N     1 
ATOM   628   C  CA    . VAL A 1 86   ? -61.65700 -29.61300 -57.73100 1.000 52.53541  ? 86   VAL A CA    1 
ATOM   629   C  C     . VAL A 1 86   ? -61.06000 -28.45600 -58.51500 1.000 52.80959  ? 86   VAL A C     1 
ATOM   630   O  O     . VAL A 1 86   ? -60.89500 -28.53200 -59.73800 1.000 57.87631  ? 86   VAL A O     1 
ATOM   631   C  CB    . VAL A 1 86   ? -60.59500 -30.68800 -57.42800 1.000 50.81639  ? 86   VAL A CB    1 
ATOM   632   C  CG1   . VAL A 1 86   ? -59.44900 -30.09800 -56.61800 1.000 45.69072  ? 86   VAL A CG1   1 
ATOM   633   C  CG2   . VAL A 1 86   ? -61.22400 -31.86000 -56.69400 1.000 56.45495  ? 86   VAL A CG2   1 
ATOM   634   N  N     . THR A 1 87   ? -60.74200 -27.37300 -57.81100 1.000 56.29629  ? 87   THR A N     1 
ATOM   635   C  CA    . THR A 1 87   ? -60.09000 -26.21200 -58.40000 1.000 56.48668  ? 87   THR A CA    1 
ATOM   636   C  C     . THR A 1 87   ? -58.83000 -25.90800 -57.60700 1.000 58.07285  ? 87   THR A C     1 
ATOM   637   O  O     . THR A 1 87   ? -58.87100 -25.84300 -56.37400 1.000 57.11599  ? 87   THR A O     1 
ATOM   638   C  CB    . THR A 1 87   ? -61.01600 -24.99200 -58.41100 1.000 58.52507  ? 87   THR A CB    1 
ATOM   639   O  OG1   . THR A 1 87   ? -62.28300 -25.35600 -58.97200 1.000 69.88704  ? 87   THR A OG1   1 
ATOM   640   C  CG2   . THR A 1 87   ? -60.40700 -23.86800 -59.23300 1.000 55.80651  ? 87   THR A CG2   1 
ATOM   641   N  N     . THR A 1 88   ? -57.71900 -25.73000 -58.31000 1.000 57.36695  ? 88   THR A N     1 
ATOM   642   C  CA    . THR A 1 88   ? -56.43600 -25.44200 -57.68500 1.000 56.17458  ? 88   THR A CA    1 
ATOM   643   C  C     . THR A 1 88   ? -55.92600 -24.08600 -58.16900 1.000 60.09573  ? 88   THR A C     1 
ATOM   644   O  O     . THR A 1 88   ? -56.63500 -23.33300 -58.84300 1.000 68.34564  ? 88   THR A O     1 
ATOM   645   C  CB    . THR A 1 88   ? -55.43000 -26.55600 -57.97800 1.000 57.61984  ? 88   THR A CB    1 
ATOM   646   O  OG1   . THR A 1 88   ? -55.18400 -26.62400 -59.38800 1.000 60.65710  ? 88   THR A OG1   1 
ATOM   647   C  CG2   . THR A 1 88   ? -55.98000 -27.88700 -57.51000 1.000 56.33554  ? 88   THR A CG2   1 
ATOM   648   N  N     . VAL A 1 89   ? -54.67700 -23.78400 -57.81600 1.000 53.06698  ? 89   VAL A N     1 
ATOM   649   C  CA    . VAL A 1 89   ? -54.08500 -22.50200 -58.18000 1.000 51.62998  ? 89   VAL A CA    1 
ATOM   650   C  C     . VAL A 1 89   ? -53.93200 -22.38900 -59.69000 1.000 62.79959  ? 89   VAL A C     1 
ATOM   651   O  O     . VAL A 1 89   ? -54.22500 -21.34300 -60.28200 1.000 64.53580  ? 89   VAL A O     1 
ATOM   652   C  CB    . VAL A 1 89   ? -52.73900 -22.32400 -57.45900 1.000 49.01340  ? 89   VAL A CB    1 
ATOM   653   C  CG1   . VAL A 1 89   ? -52.34600 -20.86000 -57.42200 1.000 50.39219  ? 89   VAL A CG1   1 
ATOM   654   C  CG2   . VAL A 1 89   ? -52.82200 -22.90600 -56.06200 1.000 59.59022  ? 89   VAL A CG2   1 
ATOM   655   N  N     . GLU A 1 90   ? -53.47300 -23.46300 -60.33900 1.000 61.03609  ? 90   GLU A N     1 
ATOM   656   C  CA    . GLU A 1 90   ? -53.30700 -23.44500 -61.78700 1.000 62.97230  ? 90   GLU A CA    1 
ATOM   657   C  C     . GLU A 1 90   ? -54.63300 -23.28200 -62.51700 1.000 63.21575  ? 90   GLU A C     1 
ATOM   658   O  O     . GLU A 1 90   ? -54.64500 -22.80600 -63.65800 1.000 68.36647  ? 90   GLU A O     1 
ATOM   659   C  CB    . GLU A 1 90   ? -52.61500 -24.72800 -62.25500 1.000 65.31431  ? 90   GLU A CB    1 
ATOM   660   C  CG    . GLU A 1 90   ? -51.31600 -25.05300 -61.52900 1.000 67.90227  ? 90   GLU A CG    1 
ATOM   661   C  CD    . GLU A 1 90   ? -51.52500 -25.92200 -60.30000 1.000 66.76683  ? 90   GLU A CD    1 
ATOM   662   O  OE1   . GLU A 1 90   ? -52.60200 -25.82400 -59.67400 1.000 66.21164  ? 90   GLU A OE1   1 
ATOM   663   O  OE2   . GLU A 1 90   ? -50.61200 -26.70500 -59.96100 1.000 59.00929  ? 90   GLU A OE2   1 
ATOM   664   N  N     . GLY A 1 91   ? -55.74600 -23.65600 -61.88500 1.000 60.52035  ? 91   GLY A N     1 
ATOM   665   C  CA    . GLY A 1 91   ? -57.02700 -23.59700 -62.56900 1.000 65.53425  ? 91   GLY A CA    1 
ATOM   666   C  C     . GLY A 1 91   ? -57.56600 -22.18600 -62.70800 1.000 59.90006  ? 91   GLY A C     1 
ATOM   667   O  O     . GLY A 1 91   ? -58.17700 -21.84400 -63.72500 1.000 63.90019  ? 91   GLY A O     1 
ATOM   668   N  N     . ILE A 1 92   ? -57.35100 -21.34500 -61.69200 1.000 58.98128  ? 92   ILE A N     1 
ATOM   669   C  CA    . ILE A 1 92   ? -57.91500 -19.99600 -61.71600 1.000 59.11206  ? 92   ILE A CA    1 
ATOM   670   C  C     . ILE A 1 92   ? -57.10200 -19.02600 -62.55500 1.000 63.73138  ? 92   ILE A C     1 
ATOM   671   O  O     . ILE A 1 92   ? -57.55600 -17.89800 -62.79000 1.000 60.93698  ? 92   ILE A O     1 
ATOM   672   C  CB    . ILE A 1 92   ? -58.06200 -19.43000 -60.29200 1.000 53.96397  ? 92   ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 92   ? -56.71000 -18.96400 -59.75400 1.000 58.44922  ? 92   ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 92   ? -58.66900 -20.47100 -59.36700 1.000 52.43301  ? 92   ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 92   ? -56.80000 -18.28800 -58.40800 1.000 57.28419  ? 92   ILE A CD1   1 
ATOM   676   N  N     . GLY A 1 93   ? -55.92600 -19.42000 -63.01600 1.000 64.50445  ? 93   GLY A N     1 
ATOM   677   C  CA    . GLY A 1 93   ? -55.13400 -18.55700 -63.86800 1.000 70.73536  ? 93   GLY A CA    1 
ATOM   678   C  C     . GLY A 1 93   ? -53.67600 -18.94700 -63.86600 1.000 68.07284  ? 93   GLY A C     1 
ATOM   679   O  O     . GLY A 1 93   ? -53.19200 -19.67900 -63.00000 1.000 66.27294  ? 93   GLY A O     1 
ATOM   680   N  N     . SER A 1 94   ? -52.96300 -18.43700 -64.86700 1.000 60.16150  ? 94   SER A N     1 
ATOM   681   C  CA    . SER A 1 94   ? -51.53500 -18.68200 -65.02000 1.000 57.51713  ? 94   SER A CA    1 
ATOM   682   C  C     . SER A 1 94   ? -50.94200 -17.54000 -65.83700 1.000 67.59036  ? 94   SER A C     1 
ATOM   683   O  O     . SER A 1 94   ? -51.64400 -16.60900 -66.24000 1.000 71.94247  ? 94   SER A O     1 
ATOM   684   C  CB    . SER A 1 94   ? -51.27200 -20.04100 -65.67500 1.000 62.51801  ? 94   SER A CB    1 
ATOM   685   O  OG    . SER A 1 94   ? -51.80000 -20.08500 -66.98900 1.000 76.60627  ? 94   SER A OG    1 
ATOM   686   N  N     . THR A 1 95   ? -49.63200 -17.62100 -66.08200 1.000 69.00002  ? 95   THR A N     1 
ATOM   687   C  CA    . THR A 1 95   ? -48.95200 -16.57100 -66.83300 1.000 61.57202  ? 95   THR A CA    1 
ATOM   688   C  C     . THR A 1 95   ? -49.21000 -16.67300 -68.33000 1.000 73.87194  ? 95   THR A C     1 
ATOM   689   O  O     . THR A 1 95   ? -49.26600 -15.64300 -69.01300 1.000 80.15611  ? 95   THR A O     1 
ATOM   690   C  CB    . THR A 1 95   ? -47.44600 -16.61400 -66.56500 1.000 63.99934  ? 95   THR A CB    1 
ATOM   691   O  OG1   . THR A 1 95   ? -46.97700 -17.96400 -66.66400 1.000 65.89604  ? 95   THR A OG1   1 
ATOM   692   C  CG2   . THR A 1 95   ? -47.13200 -16.06700 -65.18000 1.000 50.55339  ? 95   THR A CG2   1 
ATOM   693   N  N     . HIS A 1 96   ? -49.36500 -17.88800 -68.86100 1.000 72.70688  ? 96   HIS A N     1 
ATOM   694   C  CA    . HIS A 1 96   ? -49.58900 -18.03700 -70.29500 1.000 78.18067  ? 96   HIS A CA    1 
ATOM   695   C  C     . HIS A 1 96   ? -51.01900 -17.69400 -70.69200 1.000 83.08464  ? 96   HIS A C     1 
ATOM   696   O  O     . HIS A 1 96   ? -51.26200 -17.31700 -71.84400 1.000 95.95766  ? 96   HIS A O     1 
ATOM   697   C  CB    . HIS A 1 96   ? -49.23900 -19.45700 -70.75000 1.000 70.18461  ? 96   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1 96   ? -49.53700 -20.51600 -69.73500 1.000 77.72392  ? 96   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1 96   ? -48.71400 -20.77000 -68.65900 1.000 79.09925  ? 96   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1 96   ? -50.56200 -21.39600 -69.64000 1.000 85.11662  ? 96   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1 96   ? -49.22200 -21.75600 -67.94100 1.000 79.27731  ? 96   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1 96   ? -50.34400 -22.15300 -68.51500 1.000 81.31965  ? 96   HIS A NE2   1 
ATOM   703   N  N     . THR A 1 97   ? -51.97200 -17.81500 -69.76900 1.000 77.61255  ? 97   THR A N     1 
ATOM   704   C  CA    . THR A 1 97   ? -53.34700 -17.42300 -70.05400 1.000 78.66274  ? 97   THR A CA    1 
ATOM   705   C  C     . THR A 1 97   ? -53.65500 -16.07100 -69.42200 1.000 80.33126  ? 97   THR A C     1 
ATOM   706   O  O     . THR A 1 97   ? -53.08100 -15.05100 -69.81500 1.000 86.30779  ? 97   THR A O     1 
ATOM   707   C  CB    . THR A 1 97   ? -54.33300 -18.48400 -69.55500 1.000 76.55997  ? 97   THR A CB    1 
ATOM   708   O  OG1   . THR A 1 97   ? -53.89400 -18.99500 -68.29100 1.000 78.31722  ? 97   THR A OG1   1 
ATOM   709   C  CG2   . THR A 1 97   ? -54.43700 -19.62700 -70.55400 1.000 75.15617  ? 97   THR A CG2   1 
ATOM   710   N  N     . ARG A 1 98   ? -54.55200 -16.05300 -68.43900 1.000 76.10442  ? 98   ARG A N     1 
ATOM   711   C  CA    . ARG A 1 98   ? -54.96700 -14.82800 -67.77000 1.000 79.80720  ? 98   ARG A CA    1 
ATOM   712   C  C     . ARG A 1 98   ? -54.63500 -14.92100 -66.28900 1.000 75.59406  ? 98   ARG A C     1 
ATOM   713   O  O     . ARG A 1 98   ? -54.90500 -15.94400 -65.65200 1.000 72.62258  ? 98   ARG A O     1 
ATOM   714   C  CB    . ARG A 1 98   ? -56.46600 -14.57900 -67.96000 1.000 84.94930  ? 98   ARG A CB    1 
ATOM   715   C  CG    . ARG A 1 98   ? -56.82100 -13.14600 -68.31700 1.000 101.33198 ? 98   ARG A CG    1 
ATOM   716   C  CD    . ARG A 1 98   ? -58.32200 -12.98400 -68.49100 1.000 109.16310 ? 98   ARG A CD    1 
ATOM   717   N  NE    . ARG A 1 98   ? -58.75000 -13.29100 -69.85300 1.000 118.41831 ? 98   ARG A NE    1 
ATOM   718   C  CZ    . ARG A 1 98   ? -59.98100 -13.67000 -70.18200 1.000 123.12263 ? 98   ARG A CZ    1 
ATOM   719   N  NH1   . ARG A 1 98   ? -60.91200 -13.78900 -69.24500 1.000 116.63907 ? 98   ARG A NH1   1 
ATOM   720   N  NH2   . ARG A 1 98   ? -60.28100 -13.93000 -71.44700 1.000 124.56704 ? 98   ARG A NH2   1 
ATOM   721   N  N     . ILE A 1 99   ? -54.05400 -13.85700 -65.74500 1.000 74.05053  ? 99   ILE A N     1 
ATOM   722   C  CA    . ILE A 1 99   ? -53.75000 -13.79300 -64.32000 1.000 70.20179  ? 99   ILE A CA    1 
ATOM   723   C  C     . ILE A 1 99   ? -55.01200 -13.37500 -63.57600 1.000 65.03179  ? 99   ILE A C     1 
ATOM   724   O  O     . ILE A 1 99   ? -55.57600 -12.30800 -63.84200 1.000 65.17155  ? 99   ILE A O     1 
ATOM   725   C  CB    . ILE A 1 99   ? -52.59700 -12.81900 -64.04000 1.000 67.94281  ? 99   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1 99   ? -51.29000 -13.34100 -64.64500 1.000 60.37887  ? 99   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1 99   ? -52.45100 -12.58100 -62.54200 1.000 64.48452  ? 99   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1 99   ? -50.54000 -14.31000 -63.75700 1.000 69.28510  ? 99   ILE A CD1   1 
ATOM   729   N  N     . HIS A 1 100  ? -55.46000 -14.21400 -62.64900 1.000 63.09765  ? 100  HIS A N     1 
ATOM   730   C  CA    . HIS A 1 100  ? -56.63200 -13.87200 -61.85800 1.000 69.13561  ? 100  HIS A CA    1 
ATOM   731   C  C     . HIS A 1 100  ? -56.29900 -12.71500 -60.91900 1.000 67.81574  ? 100  HIS A C     1 
ATOM   732   O  O     . HIS A 1 100  ? -55.17200 -12.62700 -60.42100 1.000 71.67538  ? 100  HIS A O     1 
ATOM   733   C  CB    . HIS A 1 100  ? -57.11600 -15.08000 -61.05600 1.000 70.30467  ? 100  HIS A CB    1 
ATOM   734   C  CG    . HIS A 1 100  ? -58.49000 -14.91400 -60.48500 1.000 61.79186  ? 100  HIS A CG    1 
ATOM   735   N  ND1   . HIS A 1 100  ? -58.73100 -14.24600 -59.30400 1.000 62.44063  ? 100  HIS A ND1   1 
ATOM   736   C  CD2   . HIS A 1 100  ? -59.69900 -15.31900 -60.94200 1.000 59.78663  ? 100  HIS A CD2   1 
ATOM   737   C  CE1   . HIS A 1 100  ? -60.02900 -14.25200 -59.05500 1.000 66.43819  ? 100  HIS A CE1   1 
ATOM   738   N  NE2   . HIS A 1 100  ? -60.63800 -14.89700 -60.03300 1.000 64.39063  ? 100  HIS A NE2   1 
ATOM   739   N  N     . PRO A 1 101  ? -57.24500 -11.80300 -60.67700 1.000 65.43382  ? 101  PRO A N     1 
ATOM   740   C  CA    . PRO A 1 101  ? -56.95400 -10.66300 -59.79100 1.000 67.41634  ? 101  PRO A CA    1 
ATOM   741   C  C     . PRO A 1 101  ? -56.46800 -11.06200 -58.40800 1.000 63.22338  ? 101  PRO A C     1 
ATOM   742   O  O     . PRO A 1 101  ? -55.65100 -10.34000 -57.82300 1.000 58.87215  ? 101  PRO A O     1 
ATOM   743   C  CB    . PRO A 1 101  ? -58.29900 -9.92700  -59.72800 1.000 68.44374  ? 101  PRO A CB    1 
ATOM   744   C  CG    . PRO A 1 101  ? -58.94400 -10.24400 -61.03300 1.000 64.31791  ? 101  PRO A CG    1 
ATOM   745   C  CD    . PRO A 1 101  ? -58.54900 -11.66000 -61.34900 1.000 56.34100  ? 101  PRO A CD    1 
ATOM   746   N  N     . VAL A 1 102  ? -56.94300 -12.18500 -57.86200 1.000 66.02671  ? 102  VAL A N     1 
ATOM   747   C  CA    . VAL A 1 102  ? -56.43700 -12.65000 -56.57300 1.000 57.43590  ? 102  VAL A CA    1 
ATOM   748   C  C     . VAL A 1 102  ? -54.94500 -12.93800 -56.66300 1.000 65.87636  ? 102  VAL A C     1 
ATOM   749   O  O     . VAL A 1 102  ? -54.17600 -12.60800 -55.75200 1.000 61.30526  ? 102  VAL A O     1 
ATOM   750   C  CB    . VAL A 1 102  ? -57.22400 -13.88600 -56.10100 1.000 54.93074  ? 102  VAL A CB    1 
ATOM   751   C  CG1   . VAL A 1 102  ? -56.67600 -14.39300 -54.77500 1.000 56.56651  ? 102  VAL A CG1   1 
ATOM   752   C  CG2   . VAL A 1 102  ? -58.69700 -13.55900 -55.97800 1.000 64.26860  ? 102  VAL A CG2   1 
ATOM   753   N  N     . GLN A 1 103  ? -54.51100 -13.54800 -57.76800 1.000 71.63495  ? 103  GLN A N     1 
ATOM   754   C  CA    . GLN A 1 103  ? -53.09000 -13.81600 -57.95900 1.000 61.13522  ? 103  GLN A CA    1 
ATOM   755   C  C     . GLN A 1 103  ? -52.31300 -12.52800 -58.20100 1.000 66.19685  ? 103  GLN A C     1 
ATOM   756   O  O     . GLN A 1 103  ? -51.18400 -12.37600 -57.71900 1.000 59.47632  ? 103  GLN A O     1 
ATOM   757   C  CB    . GLN A 1 103  ? -52.89500 -14.78400 -59.12500 1.000 59.05691  ? 103  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1 103  ? -53.58400 -16.12600 -58.94100 1.000 62.63804  ? 103  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1 103  ? -53.54100 -16.97600 -60.19500 1.000 61.11787  ? 103  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1 103  ? -53.63200 -16.46100 -61.31000 1.000 62.85349  ? 103  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1 103  ? -53.39800 -18.28500 -60.02100 1.000 55.14809  ? 103  GLN A NE2   1 
ATOM   762   N  N     . GLU A 1 104  ? -52.90400 -11.58600 -58.93900 1.000 71.17093  ? 104  GLU A N     1 
ATOM   763   C  CA    . GLU A 1 104  ? -52.20100 -10.34800 -59.26300 1.000 68.27862  ? 104  GLU A CA    1 
ATOM   764   C  C     . GLU A 1 104  ? -52.02600 -9.46700  -58.03300 1.000 65.98387  ? 104  GLU A C     1 
ATOM   765   O  O     . GLU A 1 104  ? -50.97200 -8.84500  -57.85400 1.000 66.79513  ? 104  GLU A O     1 
ATOM   766   C  CB    . GLU A 1 104  ? -52.95300 -9.59400  -60.36100 1.000 68.05433  ? 104  GLU A CB    1 
ATOM   767   C  CG    . GLU A 1 104  ? -52.54800 -8.13600  -60.50600 1.000 71.14388  ? 104  GLU A CG    1 
ATOM   768   C  CD    . GLU A 1 104  ? -53.30100 -7.42700  -61.61500 1.000 82.34906  ? 104  GLU A CD    1 
ATOM   769   O  OE1   . GLU A 1 104  ? -52.76700 -7.34700  -62.74100 1.000 77.47139  ? 104  GLU A OE1   1 
ATOM   770   O  OE2   . GLU A 1 104  ? -54.42800 -6.95100  -61.35900 1.000 86.79985  ? 104  GLU A OE2   1 
ATOM   771   N  N     . ARG A 1 105  ? -53.03800 -9.41000  -57.16600 1.000 62.25790  ? 105  ARG A N     1 
ATOM   772   C  CA    . ARG A 1 105  ? -52.99400 -8.47100  -56.05000 1.000 63.10641  ? 105  ARG A CA    1 
ATOM   773   C  C     . ARG A 1 105  ? -52.15600 -8.99700  -54.89100 1.000 58.84993  ? 105  ARG A C     1 
ATOM   774   O  O     . ARG A 1 105  ? -51.38700 -8.23900  -54.29100 1.000 59.78074  ? 105  ARG A O     1 
ATOM   775   C  CB    . ARG A 1 105  ? -54.41300 -8.14200  -55.59000 1.000 64.16211  ? 105  ARG A CB    1 
ATOM   776   C  CG    . ARG A 1 105  ? -55.22700 -7.42400  -56.65300 1.000 70.09982  ? 105  ARG A CG    1 
ATOM   777   C  CD    . ARG A 1 105  ? -56.65800 -7.18700  -56.21600 1.000 73.48162  ? 105  ARG A CD    1 
ATOM   778   N  NE    . ARG A 1 105  ? -57.44600 -6.57700  -57.28300 1.000 74.10497  ? 105  ARG A NE    1 
ATOM   779   C  CZ    . ARG A 1 105  ? -58.72500 -6.24000  -57.16800 1.000 75.80241  ? 105  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A 1 105  ? -59.36700 -6.44700  -56.02700 1.000 77.41103  ? 105  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A 1 105  ? -59.36200 -5.69100  -58.19300 1.000 82.74368  ? 105  ARG A NH2   1 
ATOM   782   N  N     . ILE A 1 106  ? -52.28100 -10.28500 -54.55800 1.000 59.14939  ? 106  ILE A N     1 
ATOM   783   C  CA    . ILE A 1 106  ? -51.47500 -10.83700 -53.47500 1.000 59.36930  ? 106  ILE A CA    1 
ATOM   784   C  C     . ILE A 1 106  ? -49.99500 -10.85300 -53.83600 1.000 64.34056  ? 106  ILE A C     1 
ATOM   785   O  O     . ILE A 1 106  ? -49.14100 -10.90300 -52.94300 1.000 62.07767  ? 106  ILE A O     1 
ATOM   786   C  CB    . ILE A 1 106  ? -51.95900 -12.24900 -53.09300 1.000 50.89999  ? 106  ILE A CB    1 
ATOM   787   C  CG1   . ILE A 1 106  ? -51.48100 -12.61100 -51.68600 1.000 55.65288  ? 106  ILE A CG1   1 
ATOM   788   C  CG2   . ILE A 1 106  ? -51.46300 -13.28000 -54.09300 1.000 56.16369  ? 106  ILE A CG2   1 
ATOM   789   C  CD1   . ILE A 1 106  ? -52.14800 -13.83700 -51.11000 1.000 56.00059  ? 106  ILE A CD1   1 
ATOM   790   N  N     . ALA A 1 107  ? -49.66500 -10.79900 -55.12600 1.000 63.81646  ? 107  ALA A N     1 
ATOM   791   C  CA    . ALA A 1 107  ? -48.27600 -10.75200 -55.56000 1.000 61.49694  ? 107  ALA A CA    1 
ATOM   792   C  C     . ALA A 1 107  ? -47.75400 -9.32500  -55.66500 1.000 61.54706  ? 107  ALA A C     1 
ATOM   793   O  O     . ALA A 1 107  ? -46.60700 -9.05800  -55.29000 1.000 67.43158  ? 107  ALA A O     1 
ATOM   794   C  CB    . ALA A 1 107  ? -48.11900 -11.46300 -56.90700 1.000 69.55458  ? 107  ALA A CB    1 
ATOM   795   N  N     . LYS A 1 108  ? -48.57600 -8.39900  -56.16400 1.000 58.06568  ? 108  LYS A N     1 
ATOM   796   C  CA    . LYS A 1 108  ? -48.13900 -7.01800  -56.32800 1.000 60.72536  ? 108  LYS A CA    1 
ATOM   797   C  C     . LYS A 1 108  ? -48.21400 -6.21700  -55.03500 1.000 62.87357  ? 108  LYS A C     1 
ATOM   798   O  O     . LYS A 1 108  ? -47.55900 -5.17500  -54.93200 1.000 65.85786  ? 108  LYS A O     1 
ATOM   799   C  CB    . LYS A 1 108  ? -48.96300 -6.33200  -57.41900 1.000 59.91428  ? 108  LYS A CB    1 
ATOM   800   C  CG    . LYS A 1 108  ? -48.60700 -6.79300  -58.82300 1.000 55.82126  ? 108  LYS A CG    1 
ATOM   801   C  CD    . LYS A 1 108  ? -49.47400 -6.12300  -59.87200 1.000 56.75918  ? 108  LYS A CD    1 
ATOM   802   C  CE    . LYS A 1 108  ? -49.00700 -6.47500  -61.27300 1.000 60.16665  ? 108  LYS A CE    1 
ATOM   803   N  NZ    . LYS A 1 108  ? -49.83800 -5.81400  -62.31700 1.000 72.18281  ? 108  LYS A NZ    1 
ATOM   804   N  N     . CYS A 1 109  ? -48.99100 -6.67200  -54.05400 1.000 62.17520  ? 109  CYS A N     1 
ATOM   805   C  CA    . CYS A 1 109  ? -48.96700 -6.08100  -52.72200 1.000 61.60019  ? 109  CYS A CA    1 
ATOM   806   C  C     . CYS A 1 109  ? -47.79000 -6.57300  -51.89100 1.000 62.23796  ? 109  CYS A C     1 
ATOM   807   O  O     . CYS A 1 109  ? -47.74200 -6.29300  -50.68800 1.000 63.11991  ? 109  CYS A O     1 
ATOM   808   C  CB    . CYS A 1 109  ? -50.27700 -6.36900  -51.98400 1.000 55.68251  ? 109  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1 109  ? -51.71800 -5.49200  -52.63400 1.000 70.23169  ? 109  CYS A SG    1 
ATOM   810   N  N     . HIS A 1 110  ? -46.85700 -7.30000  -52.51000 1.000 59.81986  ? 110  HIS A N     1 
ATOM   811   C  CA    . HIS A 1 110  ? -45.67700 -7.83600  -51.83100 1.000 58.93568  ? 110  HIS A CA    1 
ATOM   812   C  C     . HIS A 1 110  ? -46.07600 -8.78300  -50.70200 1.000 55.51298  ? 110  HIS A C     1 
ATOM   813   O  O     . HIS A 1 110  ? -45.47700 -8.78700  -49.62500 1.000 56.65322  ? 110  HIS A O     1 
ATOM   814   C  CB    . HIS A 1 110  ? -44.77500 -6.71000  -51.32200 1.000 51.58334  ? 110  HIS A CB    1 
ATOM   815   C  CG    . HIS A 1 110  ? -44.54100 -5.62800  -52.33000 1.000 57.55169  ? 110  HIS A CG    1 
ATOM   816   N  ND1   . HIS A 1 110  ? -43.72300 -5.79600  -53.42600 1.000 62.40108  ? 110  HIS A ND1   1 
ATOM   817   C  CD2   . HIS A 1 110  ? -45.03100 -4.36900  -52.41600 1.000 64.89853  ? 110  HIS A CD2   1 
ATOM   818   C  CE1   . HIS A 1 110  ? -43.71200 -4.68500  -54.14000 1.000 69.55495  ? 110  HIS A CE1   1 
ATOM   819   N  NE2   . HIS A 1 110  ? -44.49700 -3.80200  -53.54900 1.000 76.69021  ? 110  HIS A NE2   1 
ATOM   820   N  N     . GLY A 1 111  ? -47.10100 -9.59400  -50.95500 1.000 60.37747  ? 111  GLY A N     1 
ATOM   821   C  CA    . GLY A 1 111  ? -47.56100 -10.57400 -49.99200 1.000 61.96507  ? 111  GLY A CA    1 
ATOM   822   C  C     . GLY A 1 111  ? -46.92200 -11.93200 -50.19000 1.000 59.58066  ? 111  GLY A C     1 
ATOM   823   O  O     . GLY A 1 111  ? -47.41700 -12.94200 -49.68300 1.000 61.14425  ? 111  GLY A O     1 
ATOM   824   N  N     . THR A 1 112  ? -45.82000 -11.96600 -50.93700 1.000 61.18312  ? 112  THR A N     1 
ATOM   825   C  CA    . THR A 1 112  ? -45.08400 -13.19400 -51.20600 1.000 62.22156  ? 112  THR A CA    1 
ATOM   826   C  C     . THR A 1 112  ? -43.60900 -12.95700 -50.92800 1.000 59.09092  ? 112  THR A C     1 
ATOM   827   O  O     . THR A 1 112  ? -43.03400 -11.97600 -51.40800 1.000 57.50005  ? 112  THR A O     1 
ATOM   828   C  CB    . THR A 1 112  ? -45.26800 -13.65700 -52.65700 1.000 57.88324  ? 112  THR A CB    1 
ATOM   829   O  OG1   . THR A 1 112  ? -44.71500 -12.67800 -53.54600 1.000 61.91170  ? 112  THR A OG1   1 
ATOM   830   C  CG2   . THR A 1 112  ? -46.74000 -13.84800 -52.98100 1.000 56.81446  ? 112  THR A CG2   1 
ATOM   831   N  N     . GLN A 1 113  ? -43.00300 -13.85100 -50.14900 1.000 54.88169  ? 113  GLN A N     1 
ATOM   832   C  CA    . GLN A 1 113  ? -41.56100 -13.81200 -49.94500 1.000 59.73638  ? 113  GLN A CA    1 
ATOM   833   C  C     . GLN A 1 113  ? -40.94500 -15.11800 -50.43100 1.000 62.46135  ? 113  GLN A C     1 
ATOM   834   O  O     . GLN A 1 113  ? -40.45100 -15.18900 -51.56200 1.000 64.58127  ? 113  GLN A O     1 
ATOM   835   C  CB    . GLN A 1 113  ? -41.22800 -13.54700 -48.47600 1.000 57.58756  ? 113  GLN A CB    1 
ATOM   836   C  CG    . GLN A 1 113  ? -41.66100 -12.16600 -48.00300 1.000 54.85602  ? 113  GLN A CG    1 
ATOM   837   C  CD    . GLN A 1 113  ? -41.10200 -11.80400 -46.64100 1.000 58.90299  ? 113  GLN A CD    1 
ATOM   838   O  OE1   . GLN A 1 113  ? -40.16600 -12.43500 -46.15100 1.000 71.17027  ? 113  GLN A OE1   1 
ATOM   839   N  NE2   . GLN A 1 113  ? -41.67100 -10.77500 -46.02400 1.000 55.97963  ? 113  GLN A NE2   1 
ATOM   840   N  N     . CYS A 1 114  ? -40.96900 -16.15800 -49.59500 1.000 53.99370  ? 114  CYS A N     1 
ATOM   841   C  CA    . CYS A 1 114  ? -40.57800 -17.47500 -50.08500 1.000 49.43045  ? 114  CYS A CA    1 
ATOM   842   C  C     . CYS A 1 114  ? -41.60800 -18.01700 -51.06700 1.000 54.92754  ? 114  CYS A C     1 
ATOM   843   O  O     . CYS A 1 114  ? -41.24800 -18.72200 -52.01700 1.000 56.06674  ? 114  CYS A O     1 
ATOM   844   C  CB    . CYS A 1 114  ? -40.38400 -18.44600 -48.92000 1.000 53.44620  ? 114  CYS A CB    1 
ATOM   845   S  SG    . CYS A 1 114  ? -41.89000 -19.28300 -48.37400 1.000 63.16859  ? 114  CYS A SG    1 
ATOM   846   N  N     . GLY A 1 115  ? -42.88400 -17.69100 -50.86100 1.000 59.92506  ? 115  GLY A N     1 
ATOM   847   C  CA    . GLY A 1 115  ? -43.93700 -18.03000 -51.79400 1.000 57.09406  ? 115  GLY A CA    1 
ATOM   848   C  C     . GLY A 1 115  ? -44.52500 -19.41500 -51.64500 1.000 51.12675  ? 115  GLY A C     1 
ATOM   849   O  O     . GLY A 1 115  ? -45.38400 -19.79100 -52.45300 1.000 57.38078  ? 115  GLY A O     1 
ATOM   850   N  N     . PHE A 1 116  ? -44.09800 -20.18600 -50.64400 1.000 50.20662  ? 116  PHE A N     1 
ATOM   851   C  CA    . PHE A 1 116  ? -44.59200 -21.55200 -50.51200 1.000 48.02858  ? 116  PHE A CA    1 
ATOM   852   C  C     . PHE A 1 116  ? -46.03400 -21.57600 -50.01900 1.000 54.65686  ? 116  PHE A C     1 
ATOM   853   O  O     . PHE A 1 116  ? -46.84500 -22.37800 -50.49600 1.000 59.51640  ? 116  PHE A O     1 
ATOM   854   C  CB    . PHE A 1 116  ? -43.68700 -22.34800 -49.57300 1.000 49.58989  ? 116  PHE A CB    1 
ATOM   855   C  CG    . PHE A 1 116  ? -43.73100 -23.83000 -49.80400 1.000 50.12783  ? 116  PHE A CG    1 
ATOM   856   C  CD1   . PHE A 1 116  ? -43.14900 -24.38400 -50.93200 1.000 54.59419  ? 116  PHE A CD1   1 
ATOM   857   C  CD2   . PHE A 1 116  ? -44.35700 -24.66800 -48.89900 1.000 47.47513  ? 116  PHE A CD2   1 
ATOM   858   C  CE1   . PHE A 1 116  ? -43.18800 -25.74700 -51.15100 1.000 53.92615  ? 116  PHE A CE1   1 
ATOM   859   C  CE2   . PHE A 1 116  ? -44.39900 -26.03100 -49.11300 1.000 54.17815  ? 116  PHE A CE2   1 
ATOM   860   C  CZ    . PHE A 1 116  ? -43.81300 -26.57100 -50.24000 1.000 51.82865  ? 116  PHE A CZ    1 
ATOM   861   N  N     . CYS A 1 117  ? -46.37200 -20.70600 -49.06700 1.000 57.28385  ? 117  CYS A N     1 
ATOM   862   C  CA    . CYS A 1 117  ? -47.73200 -20.62900 -48.55000 1.000 58.15171  ? 117  CYS A CA    1 
ATOM   863   C  C     . CYS A 1 117  ? -48.67400 -19.86400 -49.46900 1.000 58.27780  ? 117  CYS A C     1 
ATOM   864   O  O     . CYS A 1 117  ? -49.88800 -19.88800 -49.23900 1.000 54.03101  ? 117  CYS A O     1 
ATOM   865   C  CB    . CYS A 1 117  ? -47.73400 -19.96800 -47.17000 1.000 60.14236  ? 117  CYS A CB    1 
ATOM   866   S  SG    . CYS A 1 117  ? -47.30300 -18.21300 -47.19700 1.000 51.31348  ? 117  CYS A SG    1 
ATOM   867   N  N     . THR A 1 118  ? -48.14600 -19.19100 -50.49400 1.000 61.00229  ? 118  THR A N     1 
ATOM   868   C  CA    . THR A 1 118  ? -48.98100 -18.35900 -51.35800 1.000 56.46039  ? 118  THR A CA    1 
ATOM   869   C  C     . THR A 1 118  ? -50.08800 -19.13900 -52.05800 1.000 54.43290  ? 118  THR A C     1 
ATOM   870   O  O     . THR A 1 118  ? -51.23300 -18.65400 -52.07200 1.000 52.13546  ? 118  THR A O     1 
ATOM   871   C  CB    . THR A 1 118  ? -48.09800 -17.62100 -52.37000 1.000 52.69311  ? 118  THR A CB    1 
ATOM   872   O  OG1   . THR A 1 118  ? -47.14800 -16.80800 -51.67100 1.000 65.14510  ? 118  THR A OG1   1 
ATOM   873   C  CG2   . THR A 1 118  ? -48.94700 -16.73700 -53.26600 1.000 53.15081  ? 118  THR A CG2   1 
ATOM   874   N  N     . PRO A 1 119  ? -49.84200 -20.31600 -52.65600 1.000 61.06343  ? 119  PRO A N     1 
ATOM   875   C  CA    . PRO A 1 119  ? -50.95900 -21.04800 -53.28300 1.000 57.10210  ? 119  PRO A CA    1 
ATOM   876   C  C     . PRO A 1 119  ? -52.11400 -21.32500 -52.33500 1.000 65.15987  ? 119  PRO A C     1 
ATOM   877   O  O     . PRO A 1 119  ? -53.27600 -21.30500 -52.76000 1.000 64.53840  ? 119  PRO A O     1 
ATOM   878   C  CB    . PRO A 1 119  ? -50.29100 -22.34300 -53.76300 1.000 57.35348  ? 119  PRO A CB    1 
ATOM   879   C  CG    . PRO A 1 119  ? -48.88300 -21.96800 -53.99100 1.000 59.79059  ? 119  PRO A CG    1 
ATOM   880   C  CD    . PRO A 1 119  ? -48.55700 -21.00000 -52.89500 1.000 61.48258  ? 119  PRO A CD    1 
ATOM   881   N  N     . GLY A 1 120  ? -51.82800 -21.58100 -51.05800 1.000 71.53046  ? 120  GLY A N     1 
ATOM   882   C  CA    . GLY A 1 120  ? -52.90200 -21.76300 -50.09600 1.000 65.72910  ? 120  GLY A CA    1 
ATOM   883   C  C     . GLY A 1 120  ? -53.64100 -20.47200 -49.79800 1.000 62.19038  ? 120  GLY A C     1 
ATOM   884   O  O     . GLY A 1 120  ? -54.86200 -20.47200 -49.62200 1.000 66.29870  ? 120  GLY A O     1 
ATOM   885   N  N     . MET A 1 121  ? -52.91100 -19.35500 -49.73500 1.000 63.56158  ? 121  MET A N     1 
ATOM   886   C  CA    . MET A 1 121  ? -53.55200 -18.06100 -49.52700 1.000 55.89145  ? 121  MET A CA    1 
ATOM   887   C  C     . MET A 1 121  ? -54.44700 -17.69200 -50.70200 1.000 61.20988  ? 121  MET A C     1 
ATOM   888   O  O     . MET A 1 121  ? -55.56600 -17.20400 -50.51100 1.000 61.60892  ? 121  MET A O     1 
ATOM   889   C  CB    . MET A 1 121  ? -52.49400 -16.97900 -49.30800 1.000 47.41682  ? 121  MET A CB    1 
ATOM   890   C  CG    . MET A 1 121  ? -51.55200 -17.23600 -48.14800 1.000 51.33185  ? 121  MET A CG    1 
ATOM   891   S  SD    . MET A 1 121  ? -52.34700 -16.97000 -46.55500 1.000 56.47048  ? 121  MET A SD    1 
ATOM   892   C  CE    . MET A 1 121  ? -50.97300 -17.25400 -45.44200 1.000 57.20755  ? 121  MET A CE    1 
ATOM   893   N  N     . VAL A 1 122  ? -53.96900 -17.92300 -51.92800 1.000 66.00811  ? 122  VAL A N     1 
ATOM   894   C  CA    . VAL A 1 122  ? -54.72000 -17.52200 -53.11500 1.000 58.38150  ? 122  VAL A CA    1 
ATOM   895   C  C     . VAL A 1 122  ? -56.04400 -18.27200 -53.19400 1.000 59.11303  ? 122  VAL A C     1 
ATOM   896   O  O     . VAL A 1 122  ? -57.08800 -17.68700 -53.51000 1.000 64.65924  ? 122  VAL A O     1 
ATOM   897   C  CB    . VAL A 1 122  ? -53.86800 -17.74100 -54.37900 1.000 51.37213  ? 122  VAL A CB    1 
ATOM   898   C  CG1   . VAL A 1 122  ? -54.69100 -17.48700 -55.62700 1.000 59.90094  ? 122  VAL A CG1   1 
ATOM   899   C  CG2   . VAL A 1 122  ? -52.64500 -16.83900 -54.35600 1.000 53.56491  ? 122  VAL A CG2   1 
ATOM   900   N  N     . MET A 1 123  ? -56.02900 -19.57300 -52.89700 1.000 57.11600  ? 123  MET A N     1 
ATOM   901   C  CA    . MET A 1 123  ? -57.24400 -20.36900 -53.03500 1.000 59.67739  ? 123  MET A CA    1 
ATOM   902   C  C     . MET A 1 123  ? -58.27200 -20.01600 -51.96700 1.000 61.72928  ? 123  MET A C     1 
ATOM   903   O  O     . MET A 1 123  ? -59.47700 -20.00500 -52.24200 1.000 64.07966  ? 123  MET A O     1 
ATOM   904   C  CB    . MET A 1 123  ? -56.90600 -21.85800 -52.98900 1.000 60.32037  ? 123  MET A CB    1 
ATOM   905   C  CG    . MET A 1 123  ? -56.26200 -22.37600 -54.26000 1.000 55.28754  ? 123  MET A CG    1 
ATOM   906   S  SD    . MET A 1 123  ? -57.24300 -21.98300 -55.72200 1.000 65.49463  ? 123  MET A SD    1 
ATOM   907   C  CE    . MET A 1 123  ? -58.79700 -22.77600 -55.31700 1.000 53.68795  ? 123  MET A CE    1 
ATOM   908   N  N     . SER A 1 124  ? -57.82000 -19.72800 -50.74400 1.000 62.12214  ? 124  SER A N     1 
ATOM   909   C  CA    . SER A 1 124  ? -58.75100 -19.31800 -49.69700 1.000 60.43254  ? 124  SER A CA    1 
ATOM   910   C  C     . SER A 1 124  ? -59.42900 -18.00100 -50.05100 1.000 63.54991  ? 124  SER A C     1 
ATOM   911   O  O     . SER A 1 124  ? -60.63800 -17.84200 -49.84700 1.000 69.58110  ? 124  SER A O     1 
ATOM   912   C  CB    . SER A 1 124  ? -58.02300 -19.20100 -48.35900 1.000 58.27754  ? 124  SER A CB    1 
ATOM   913   O  OG    . SER A 1 124  ? -57.51400 -20.45500 -47.93800 1.000 63.03109  ? 124  SER A OG    1 
ATOM   914   N  N     . ILE A 1 125  ? -58.66600 -17.04700 -50.58700 1.000 58.01573  ? 125  ILE A N     1 
ATOM   915   C  CA    . ILE A 1 125  ? -59.24400 -15.76700 -50.98300 1.000 59.60983  ? 125  ILE A CA    1 
ATOM   916   C  C     . ILE A 1 125  ? -60.15200 -15.94200 -52.19400 1.000 67.67107  ? 125  ILE A C     1 
ATOM   917   O  O     . ILE A 1 125  ? -61.22100 -15.32600 -52.28000 1.000 73.76481  ? 125  ILE A O     1 
ATOM   918   C  CB    . ILE A 1 125  ? -58.12900 -14.74000 -51.25000 1.000 58.84120  ? 125  ILE A CB    1 
ATOM   919   C  CG1   . ILE A 1 125  ? -57.26000 -14.56200 -50.00300 1.000 59.29300  ? 125  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A 1 125  ? -58.71700 -13.40600 -51.68300 1.000 57.48977  ? 125  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A 1 125  ? -56.01800 -13.73000 -50.23700 1.000 55.02675  ? 125  ILE A CD1   1 
ATOM   922   N  N     . TYR A 1 126  ? -59.74700 -16.78700 -53.14700 1.000 62.53956  ? 126  TYR A N     1 
ATOM   923   C  CA    . TYR A 1 126  ? -60.56300 -17.00400 -54.33700 1.000 67.17235  ? 126  TYR A CA    1 
ATOM   924   C  C     . TYR A 1 126  ? -61.88600 -17.67500 -53.99000 1.000 66.52123  ? 126  TYR A C     1 
ATOM   925   O  O     . TYR A 1 126  ? -62.93700 -17.29900 -54.52300 1.000 66.50218  ? 126  TYR A O     1 
ATOM   926   C  CB    . TYR A 1 126  ? -59.79200 -17.84000 -55.36000 1.000 64.44650  ? 126  TYR A CB    1 
ATOM   927   C  CG    . TYR A 1 126  ? -60.60700 -18.22900 -56.57500 1.000 59.91334  ? 126  TYR A CG    1 
ATOM   928   C  CD1   . TYR A 1 126  ? -60.78400 -17.34200 -57.62800 1.000 66.86780  ? 126  TYR A CD1   1 
ATOM   929   C  CD2   . TYR A 1 126  ? -61.19300 -19.48600 -56.67100 1.000 57.02720  ? 126  TYR A CD2   1 
ATOM   930   C  CE1   . TYR A 1 126  ? -61.52700 -17.69200 -58.74100 1.000 71.01081  ? 126  TYR A CE1   1 
ATOM   931   C  CE2   . TYR A 1 126  ? -61.93800 -19.84500 -57.78000 1.000 60.51540  ? 126  TYR A CE2   1 
ATOM   932   C  CZ    . TYR A 1 126  ? -62.10100 -18.94400 -58.81200 1.000 68.79333  ? 126  TYR A CZ    1 
ATOM   933   O  OH    . TYR A 1 126  ? -62.83900 -19.29700 -59.91800 1.000 66.19254  ? 126  TYR A OH    1 
ATOM   934   N  N     . THR A 1 127  ? -61.85600 -18.66700 -53.09800 1.000 63.69085  ? 127  THR A N     1 
ATOM   935   C  CA    . THR A 1 127  ? -63.07900 -19.38400 -52.75400 1.000 67.32822  ? 127  THR A CA    1 
ATOM   936   C  C     . THR A 1 127  ? -64.06700 -18.48000 -52.02800 1.000 71.93845  ? 127  THR A C     1 
ATOM   937   O  O     . THR A 1 127  ? -65.27700 -18.54900 -52.27700 1.000 70.96373  ? 127  THR A O     1 
ATOM   938   C  CB    . THR A 1 127  ? -62.75200 -20.61100 -51.90300 1.000 66.23064  ? 127  THR A CB    1 
ATOM   939   O  OG1   . THR A 1 127  ? -61.72200 -21.37700 -52.54100 1.000 63.30869  ? 127  THR A OG1   1 
ATOM   940   C  CG2   . THR A 1 127  ? -63.98500 -21.48100 -51.73900 1.000 65.49157  ? 127  THR A CG2   1 
ATOM   941   N  N     . LEU A 1 128  ? -63.57500 -17.62400 -51.12900 1.000 71.78615  ? 128  LEU A N     1 
ATOM   942   C  CA    . LEU A 1 128  ? -64.46800 -16.70100 -50.43500 1.000 71.91372  ? 128  LEU A CA    1 
ATOM   943   C  C     . LEU A 1 128  ? -65.07100 -15.68900 -51.39900 1.000 70.10420  ? 128  LEU A C     1 
ATOM   944   O  O     . LEU A 1 128  ? -66.25200 -15.33900 -51.28200 1.000 73.94393  ? 128  LEU A O     1 
ATOM   945   C  CB    . LEU A 1 128  ? -63.72600 -15.98400 -49.30800 1.000 59.27918  ? 128  LEU A CB    1 
ATOM   946   C  CG    . LEU A 1 128  ? -64.65100 -15.25500 -48.33100 1.000 59.05983  ? 128  LEU A CG    1 
ATOM   947   C  CD1   . LEU A 1 128  ? -65.03500 -16.16000 -47.16900 1.000 68.23304  ? 128  LEU A CD1   1 
ATOM   948   C  CD2   . LEU A 1 128  ? -64.02300 -13.96800 -47.83200 1.000 69.07498  ? 128  LEU A CD2   1 
ATOM   949   N  N     . LEU A 1 129  ? -64.27900 -15.20500 -52.35900 1.000 61.37257  ? 129  LEU A N     1 
ATOM   950   C  CA    . LEU A 1 129  ? -64.79900 -14.26900 -53.34600 1.000 64.25940  ? 129  LEU A CA    1 
ATOM   951   C  C     . LEU A 1 129  ? -65.79400 -14.92400 -54.29400 1.000 68.29812  ? 129  LEU A C     1 
ATOM   952   O  O     . LEU A 1 129  ? -66.57300 -14.21600 -54.94100 1.000 69.46124  ? 129  LEU A O     1 
ATOM   953   C  CB    . LEU A 1 129  ? -63.64900 -13.64300 -54.13400 1.000 64.76207  ? 129  LEU A CB    1 
ATOM   954   C  CG    . LEU A 1 129  ? -62.79200 -12.65900 -53.33700 1.000 65.71957  ? 129  LEU A CG    1 
ATOM   955   C  CD1   . LEU A 1 129  ? -61.47100 -12.40300 -54.03500 1.000 68.90366  ? 129  LEU A CD1   1 
ATOM   956   C  CD2   . LEU A 1 129  ? -63.54200 -11.35600 -53.11300 1.000 67.52853  ? 129  LEU A CD2   1 
ATOM   957   N  N     . ARG A 1 130  ? -65.78400 -16.25400 -54.39400 1.000 65.42192  ? 130  ARG A N     1 
ATOM   958   C  CA    . ARG A 1 130  ? -66.80700 -16.95500 -55.15700 1.000 70.55573  ? 130  ARG A CA    1 
ATOM   959   C  C     . ARG A 1 130  ? -68.10200 -17.11700 -54.37500 1.000 68.91113  ? 130  ARG A C     1 
ATOM   960   O  O     . ARG A 1 130  ? -69.15200 -17.35800 -54.98100 1.000 65.49681  ? 130  ARG A O     1 
ATOM   961   C  CB    . ARG A 1 130  ? -66.29300 -18.32800 -55.59900 1.000 67.79035  ? 130  ARG A CB    1 
ATOM   962   C  CG    . ARG A 1 130  ? -65.26200 -18.27300 -56.71600 1.000 63.89089  ? 130  ARG A CG    1 
ATOM   963   C  CD    . ARG A 1 130  ? -65.86100 -17.69300 -57.98800 1.000 67.92839  ? 130  ARG A CD    1 
ATOM   964   N  NE    . ARG A 1 130  ? -67.03500 -18.43900 -58.43400 1.000 75.57445  ? 130  ARG A NE    1 
ATOM   965   C  CZ    . ARG A 1 130  ? -66.99600 -19.45200 -59.29200 1.000 68.47576  ? 130  ARG A CZ    1 
ATOM   966   N  NH1   . ARG A 1 130  ? -65.84000 -19.84700 -59.80500 1.000 69.51876  ? 130  ARG A NH1   1 
ATOM   967   N  NH2   . ARG A 1 130  ? -68.11600 -20.07100 -59.64000 1.000 65.21633  ? 130  ARG A NH2   1 
ATOM   968   N  N     . ASN A 1 131  ? -68.05100 -16.99400 -53.04700 1.000 70.78021  ? 131  ASN A N     1 
ATOM   969   C  CA    . ASN A 1 131  ? -69.24800 -17.01300 -52.21700 1.000 64.60208  ? 131  ASN A CA    1 
ATOM   970   C  C     . ASN A 1 131  ? -69.70400 -15.62200 -51.79900 1.000 66.00183  ? 131  ASN A C     1 
ATOM   971   O  O     . ASN A 1 131  ? -70.86900 -15.45700 -51.42100 1.000 71.71763  ? 131  ASN A O     1 
ATOM   972   C  CB    . ASN A 1 131  ? -69.01400 -17.86100 -50.96100 1.000 54.51078  ? 131  ASN A CB    1 
ATOM   973   C  CG    . ASN A 1 131  ? -68.78100 -19.32400 -51.27900 1.000 59.11423  ? 131  ASN A CG    1 
ATOM   974   O  OD1   . ASN A 1 131  ? -69.30700 -19.85000 -52.26000 1.000 63.38258  ? 131  ASN A OD1   1 
ATOM   975   N  ND2   . ASN A 1 131  ? -67.99000 -19.99200 -50.44700 1.000 65.46539  ? 131  ASN A ND2   1 
ATOM   976   N  N     . HIS A 1 132  ? -68.81900 -14.62900 -51.85400 1.000 64.98131  ? 132  HIS A N     1 
ATOM   977   C  CA    . HIS A 1 132  ? -69.16400 -13.25100 -51.50100 1.000 68.63654  ? 132  HIS A CA    1 
ATOM   978   C  C     . HIS A 1 132  ? -68.37300 -12.31300 -52.39700 1.000 71.16776  ? 132  HIS A C     1 
ATOM   979   O  O     . HIS A 1 132  ? -67.28900 -11.84100 -52.03500 1.000 71.54151  ? 132  HIS A O     1 
ATOM   980   C  CB    . HIS A 1 132  ? -68.87900 -12.96700 -50.02500 1.000 64.41007  ? 132  HIS A CB    1 
ATOM   981   C  CG    . HIS A 1 132  ? -69.58700 -13.89100 -49.08300 1.000 67.46550  ? 132  HIS A CG    1 
ATOM   982   N  ND1   . HIS A 1 132  ? -70.92400 -13.76100 -48.77600 1.000 72.15889  ? 132  HIS A ND1   1 
ATOM   983   C  CD2   . HIS A 1 132  ? -69.14400 -14.96300 -48.38400 1.000 66.43887  ? 132  HIS A CD2   1 
ATOM   984   C  CE1   . HIS A 1 132  ? -71.27400 -14.71100 -47.92700 1.000 66.03079  ? 132  HIS A CE1   1 
ATOM   985   N  NE2   . HIS A 1 132  ? -70.21200 -15.45400 -47.67300 1.000 55.02596  ? 132  HIS A NE2   1 
ATOM   986   N  N     . PRO A 1 133  ? -68.88900 -12.02200 -53.59500 1.000 68.87116  ? 133  PRO A N     1 
ATOM   987   C  CA    . PRO A 1 133  ? -68.14200 -11.15600 -54.52500 1.000 70.00860  ? 133  PRO A CA    1 
ATOM   988   C  C     . PRO A 1 133  ? -67.88200 -9.76100  -53.98200 1.000 84.58318  ? 133  PRO A C     1 
ATOM   989   O  O     . PRO A 1 133  ? -66.90000 -9.12400  -54.38500 1.000 83.21978  ? 133  PRO A O     1 
ATOM   990   C  CB    . PRO A 1 133  ? -69.04300 -11.11900 -55.76800 1.000 75.67998  ? 133  PRO A CB    1 
ATOM   991   C  CG    . PRO A 1 133  ? -69.89400 -12.34500 -55.66300 1.000 73.60525  ? 133  PRO A CG    1 
ATOM   992   C  CD    . PRO A 1 133  ? -70.12500 -12.54800 -54.19700 1.000 68.18369  ? 133  PRO A CD    1 
ATOM   993   N  N     . GLU A 1 134  ? -68.73300 -9.26500  -53.08100 1.000 87.56187  ? 134  GLU A N     1 
ATOM   994   C  CA    . GLU A 1 134  ? -68.54100 -7.98000  -52.41100 1.000 87.24827  ? 134  GLU A CA    1 
ATOM   995   C  C     . GLU A 1 134  ? -68.40600 -8.25700  -50.91800 1.000 86.83162  ? 134  GLU A C     1 
ATOM   996   O  O     . GLU A 1 134  ? -69.37800 -8.12200  -50.15900 1.000 89.93197  ? 134  GLU A O     1 
ATOM   997   C  CB    . GLU A 1 134  ? -69.69300 -7.01900  -52.70100 1.000 96.53736  ? 134  GLU A CB    1 
ATOM   998   C  CG    . GLU A 1 134  ? -69.73200 -6.51100  -54.13300 1.000 98.81740  ? 134  GLU A CG    1 
ATOM   999   C  CD    . GLU A 1 134  ? -68.60600 -5.54200  -54.43700 1.000 107.77637 ? 134  GLU A CD    1 
ATOM   1000  O  OE1   . GLU A 1 134  ? -68.23000 -4.76400  -53.53400 1.000 103.79615 ? 134  GLU A OE1   1 
ATOM   1001  O  OE2   . GLU A 1 134  ? -68.09700 -5.55600  -55.57800 1.000 103.21589 ? 134  GLU A OE2   1 
ATOM   1002  N  N     . PRO A 1 135  ? -67.22200 -8.64800  -50.46200 1.000 85.88579  ? 135  PRO A N     1 
ATOM   1003  C  CA    . PRO A 1 135  ? -67.05500 -9.07200  -49.07300 1.000 80.10030  ? 135  PRO A CA    1 
ATOM   1004  C  C     . PRO A 1 135  ? -66.61500 -7.93000  -48.16300 1.000 80.10527  ? 135  PRO A C     1 
ATOM   1005  O  O     . PRO A 1 135  ? -66.26000 -6.83700  -48.60800 1.000 83.71181  ? 135  PRO A O     1 
ATOM   1006  C  CB    . PRO A 1 135  ? -65.95100 -10.12700 -49.18400 1.000 77.93831  ? 135  PRO A CB    1 
ATOM   1007  C  CG    . PRO A 1 135  ? -65.07300 -9.58200  -50.27400 1.000 79.30367  ? 135  PRO A CG    1 
ATOM   1008  C  CD    . PRO A 1 135  ? -65.98600 -8.84400  -51.24100 1.000 77.31158  ? 135  PRO A CD    1 
ATOM   1009  N  N     . THR A 1 136  ? -66.65100 -8.21300  -46.86600 1.000 78.88842  ? 136  THR A N     1 
ATOM   1010  C  CA    . THR A 1 136  ? -66.06000 -7.35500  -45.85200 1.000 77.75807  ? 136  THR A CA    1 
ATOM   1011  C  C     . THR A 1 136  ? -64.75400 -7.97400  -45.37200 1.000 78.06946  ? 136  THR A C     1 
ATOM   1012  O  O     . THR A 1 136  ? -64.55500 -9.18800  -45.46200 1.000 77.53051  ? 136  THR A O     1 
ATOM   1013  C  CB    . THR A 1 136  ? -67.01200 -7.15300  -44.67000 1.000 77.39316  ? 136  THR A CB    1 
ATOM   1014  O  OG1   . THR A 1 136  ? -67.33600 -8.42400  -44.09100 1.000 78.05748  ? 136  THR A OG1   1 
ATOM   1015  C  CG2   . THR A 1 136  ? -68.29200 -6.46800  -45.12500 1.000 75.54180  ? 136  THR A CG2   1 
ATOM   1016  N  N     . LEU A 1 137  ? -63.85800 -7.12100  -44.86600 1.000 79.49697  ? 137  LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 137  ? -62.55400 -7.59800  -44.41200 1.000 77.14868  ? 137  LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 137  ? -62.68700 -8.67100  -43.33900 1.000 78.50550  ? 137  LEU A C     1 
ATOM   1019  O  O     . LEU A 1 137  ? -61.83200 -9.55900  -43.23900 1.000 77.33218  ? 137  LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 137  ? -61.71700 -6.42400  -43.89800 1.000 71.13358  ? 137  LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1 137  ? -60.42200 -6.75100  -43.15000 1.000 71.68689  ? 137  LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1 137  ? -59.28100 -5.89200  -43.65300 1.000 75.23845  ? 137  LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1 137  ? -60.60400 -6.56300  -41.64900 1.000 86.95590  ? 137  LEU A CD2   1 
ATOM   1024  N  N     . ASP A 1 138  ? -63.75400 -8.61400  -42.53800 1.000 81.23947  ? 138  ASP A N     1 
ATOM   1025  C  CA    . ASP A 1 138  ? -63.96200 -9.62000  -41.50200 1.000 82.86115  ? 138  ASP A CA    1 
ATOM   1026  C  C     . ASP A 1 138  ? -64.09000 -11.01400 -42.10300 1.000 77.70459  ? 138  ASP A C     1 
ATOM   1027  O  O     . ASP A 1 138  ? -63.58500 -11.99100 -41.53800 1.000 76.47134  ? 138  ASP A O     1 
ATOM   1028  C  CB    . ASP A 1 138  ? -65.20400 -9.27500  -40.68100 1.000 84.27759  ? 138  ASP A CB    1 
ATOM   1029  C  CG    . ASP A 1 138  ? -65.22800 -7.82500  -40.24000 1.000 96.03638  ? 138  ASP A CG    1 
ATOM   1030  O  OD1   . ASP A 1 138  ? -64.22300 -7.11700  -40.46200 1.000 91.87538  ? 138  ASP A OD1   1 
ATOM   1031  O  OD2   . ASP A 1 138  ? -66.25300 -7.39300  -39.67100 1.000 105.59457 ? 138  ASP A OD2   1 
ATOM   1032  N  N     . GLN A 1 139  ? -64.75800 -11.12500 -43.25400 1.000 79.21079  ? 139  GLN A N     1 
ATOM   1033  C  CA    . GLN A 1 139  ? -64.93700 -12.42900 -43.88200 1.000 78.85997  ? 139  GLN A CA    1 
ATOM   1034  C  C     . GLN A 1 139  ? -63.63700 -12.95400 -44.47800 1.000 75.70226  ? 139  GLN A C     1 
ATOM   1035  O  O     . GLN A 1 139  ? -63.40900 -14.16900 -44.48800 1.000 71.78550  ? 139  GLN A O     1 
ATOM   1036  C  CB    . GLN A 1 139  ? -66.01900 -12.34700 -44.95900 1.000 78.43907  ? 139  GLN A CB    1 
ATOM   1037  C  CG    . GLN A 1 139  ? -67.31500 -11.70900 -44.48700 1.000 73.51865  ? 139  GLN A CG    1 
ATOM   1038  C  CD    . GLN A 1 139  ? -68.37000 -11.65500 -45.57500 1.000 70.57897  ? 139  GLN A CD    1 
ATOM   1039  O  OE1   . GLN A 1 139  ? -68.28600 -10.84300 -46.49700 1.000 74.61444  ? 139  GLN A OE1   1 
ATOM   1040  N  NE2   . GLN A 1 139  ? -69.37400 -12.51900 -45.47000 1.000 60.26743  ? 139  GLN A NE2   1 
ATOM   1041  N  N     . LEU A 1 140  ? -62.77800 -12.06200 -44.97800 1.000 78.66297  ? 140  LEU A N     1 
ATOM   1042  C  CA    . LEU A 1 140  ? -61.52600 -12.50000 -45.58700 1.000 72.66336  ? 140  LEU A CA    1 
ATOM   1043  C  C     . LEU A 1 140  ? -60.52800 -12.96600 -44.53400 1.000 71.50116  ? 140  LEU A C     1 
ATOM   1044  O  O     . LEU A 1 140  ? -59.82400 -13.96200 -44.73900 1.000 73.57109  ? 140  LEU A O     1 
ATOM   1045  C  CB    . LEU A 1 140  ? -60.93600 -11.37300 -46.43300 1.000 67.92509  ? 140  LEU A CB    1 
ATOM   1046  C  CG    . LEU A 1 140  ? -61.51400 -11.23600 -47.84200 1.000 67.98418  ? 140  LEU A CG    1 
ATOM   1047  C  CD1   . LEU A 1 140  ? -61.22100 -9.86300  -48.41600 1.000 71.69240  ? 140  LEU A CD1   1 
ATOM   1048  C  CD2   . LEU A 1 140  ? -60.94400 -12.31700 -48.74600 1.000 67.30335  ? 140  LEU A CD2   1 
ATOM   1049  N  N     . THR A 1 141  ? -60.44900 -12.26100 -43.40300 1.000 64.62738  ? 141  THR A N     1 
ATOM   1050  C  CA    . THR A 1 141  ? -59.53700 -12.67300 -42.34200 1.000 62.17644  ? 141  THR A CA    1 
ATOM   1051  C  C     . THR A 1 141  ? -59.95800 -14.00000 -41.72300 1.000 65.97498  ? 141  THR A C     1 
ATOM   1052  O  O     . THR A 1 141  ? -59.10100 -14.78200 -41.29400 1.000 68.74445  ? 141  THR A O     1 
ATOM   1053  C  CB    . THR A 1 141  ? -59.45200 -11.59200 -41.26400 1.000 71.75108  ? 141  THR A CB    1 
ATOM   1054  O  OG1   . THR A 1 141  ? -60.77000 -11.13800 -40.93400 1.000 84.14099  ? 141  THR A OG1   1 
ATOM   1055  C  CG2   . THR A 1 141  ? -58.62300 -10.41400 -41.75600 1.000 72.49838  ? 141  THR A CG2   1 
ATOM   1056  N  N     . ASP A 1 142  ? -61.26300 -14.27400 -41.66900 1.000 73.85336  ? 142  ASP A N     1 
ATOM   1057  C  CA    . ASP A 1 142  ? -61.72500 -15.55100 -41.13700 1.000 74.03865  ? 142  ASP A CA    1 
ATOM   1058  C  C     . ASP A 1 142  ? -61.42200 -16.69700 -42.09100 1.000 70.82775  ? 142  ASP A C     1 
ATOM   1059  O  O     . ASP A 1 142  ? -61.20000 -17.82900 -41.64600 1.000 67.64439  ? 142  ASP A O     1 
ATOM   1060  C  CB    . ASP A 1 142  ? -63.22300 -15.48600 -40.83600 1.000 74.74475  ? 142  ASP A CB    1 
ATOM   1061  C  CG    . ASP A 1 142  ? -63.55900 -14.45800 -39.77400 1.000 85.47291  ? 142  ASP A CG    1 
ATOM   1062  O  OD1   . ASP A 1 142  ? -62.65300 -14.08600 -38.99700 1.000 79.50728  ? 142  ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A 1 142  ? -64.72700 -14.02100 -39.71400 1.000 90.33222  ? 142  ASP A OD2   1 
ATOM   1064  N  N     . ALA A 1 143  ? -61.41200 -16.43000 -43.39900 1.000 70.59268  ? 143  ALA A N     1 
ATOM   1065  C  CA    . ALA A 1 143  ? -61.02500 -17.46100 -44.35600 1.000 67.94869  ? 143  ALA A CA    1 
ATOM   1066  C  C     . ALA A 1 143  ? -59.53500 -17.76400 -44.26100 1.000 72.07504  ? 143  ALA A C     1 
ATOM   1067  O  O     . ALA A 1 143  ? -59.12200 -18.92300 -44.38100 1.000 76.40285  ? 143  ALA A O     1 
ATOM   1068  C  CB    . ALA A 1 143  ? -61.39500 -17.03000 -45.77500 1.000 60.44851  ? 143  ALA A CB    1 
ATOM   1069  N  N     . LEU A 1 144  ? -58.71700 -16.73600 -44.03800 1.000 66.75855  ? 144  LEU A N     1 
ATOM   1070  C  CA    . LEU A 1 144  ? -57.27800 -16.90300 -43.89200 1.000 62.91401  ? 144  LEU A CA    1 
ATOM   1071  C  C     . LEU A 1 144  ? -56.87300 -17.38900 -42.50700 1.000 69.33182  ? 144  LEU A C     1 
ATOM   1072  O  O     . LEU A 1 144  ? -55.67200 -17.50500 -42.23800 1.000 69.88843  ? 144  LEU A O     1 
ATOM   1073  C  CB    . LEU A 1 144  ? -56.56500 -15.58400 -44.19800 1.000 58.90376  ? 144  LEU A CB    1 
ATOM   1074  C  CG    . LEU A 1 144  ? -56.76500 -14.97500 -45.58700 1.000 61.80411  ? 144  LEU A CG    1 
ATOM   1075  C  CD1   . LEU A 1 144  ? -56.14100 -13.59000 -45.65300 1.000 57.05513  ? 144  LEU A CD1   1 
ATOM   1076  C  CD2   . LEU A 1 144  ? -56.18100 -15.87800 -46.66000 1.000 61.77784  ? 144  LEU A CD2   1 
ATOM   1077  N  N     . GLY A 1 145  ? -57.83500 -17.67300 -41.62600 1.000 71.18334  ? 145  GLY A N     1 
ATOM   1078  C  CA    . GLY A 1 145  ? -57.49500 -18.11700 -40.28600 1.000 70.19770  ? 145  GLY A CA    1 
ATOM   1079  C  C     . GLY A 1 145  ? -56.81300 -19.46900 -40.25600 1.000 72.05537  ? 145  GLY A C     1 
ATOM   1080  O  O     . GLY A 1 145  ? -56.06500 -19.76900 -39.32000 1.000 69.52540  ? 145  GLY A O     1 
ATOM   1081  N  N     . GLY A 1 146  ? -57.05600 -20.29900 -41.26600 1.000 71.66315  ? 146  GLY A N     1 
ATOM   1082  C  CA    . GLY A 1 146  ? -56.43700 -21.60100 -41.36600 1.000 72.77996  ? 146  GLY A CA    1 
ATOM   1083  C  C     . GLY A 1 146  ? -55.16300 -21.65300 -42.17400 1.000 69.65967  ? 146  GLY A C     1 
ATOM   1084  O  O     . GLY A 1 146  ? -54.61300 -22.74000 -42.37500 1.000 67.95424  ? 146  GLY A O     1 
ATOM   1085  N  N     . ASN A 1 147  ? -54.66800 -20.51100 -42.64400 1.000 64.27731  ? 147  ASN A N     1 
ATOM   1086  C  CA    . ASN A 1 147  ? -53.46400 -20.44800 -43.46000 1.000 62.40827  ? 147  ASN A CA    1 
ATOM   1087  C  C     . ASN A 1 147  ? -52.33500 -19.81200 -42.66100 1.000 62.38382  ? 147  ASN A C     1 
ATOM   1088  O  O     . ASN A 1 147  ? -52.49700 -18.71900 -42.10900 1.000 65.69514  ? 147  ASN A O     1 
ATOM   1089  C  CB    . ASN A 1 147  ? -53.71200 -19.65400 -44.74300 1.000 59.44962  ? 147  ASN A CB    1 
ATOM   1090  C  CG    . ASN A 1 147  ? -54.90600 -20.16300 -45.52100 1.000 64.85038  ? 147  ASN A CG    1 
ATOM   1091  O  OD1   . ASN A 1 147  ? -55.22500 -21.35200 -45.48600 1.000 70.37921  ? 147  ASN A OD1   1 
ATOM   1092  N  ND2   . ASN A 1 147  ? -55.57200 -19.26400 -46.23200 1.000 63.09437  ? 147  ASN A ND2   1 
ATOM   1093  N  N     . LEU A 1 148  ? -51.19700 -20.49400 -42.61000 1.000 60.85969  ? 148  LEU A N     1 
ATOM   1094  C  CA    . LEU A 1 148  ? -50.02400 -20.01700 -41.89600 1.000 56.91807  ? 148  LEU A CA    1 
ATOM   1095  C  C     . LEU A 1 148  ? -48.97700 -19.49900 -42.87400 1.000 58.46490  ? 148  LEU A C     1 
ATOM   1096  O  O     . LEU A 1 148  ? -48.89900 -19.93900 -44.02400 1.000 55.03389  ? 148  LEU A O     1 
ATOM   1097  C  CB    . LEU A 1 148  ? -49.41500 -21.13100 -41.04100 1.000 58.51269  ? 148  LEU A CB    1 
ATOM   1098  C  CG    . LEU A 1 148  ? -50.33800 -21.87800 -40.07900 1.000 60.48759  ? 148  LEU A CG    1 
ATOM   1099  C  CD1   . LEU A 1 148  ? -49.61000 -23.07700 -39.50400 1.000 69.01085  ? 148  LEU A CD1   1 
ATOM   1100  C  CD2   . LEU A 1 148  ? -50.81700 -20.95800 -38.97100 1.000 58.89225  ? 148  LEU A CD2   1 
ATOM   1101  N  N     . CYS A 1 149  ? -48.16700 -18.55500 -42.40000 1.000 56.01505  ? 149  CYS A N     1 
ATOM   1102  C  CA    . CYS A 1 149  ? -47.04000 -18.05100 -43.16900 1.000 45.16707  ? 149  CYS A CA    1 
ATOM   1103  C  C     . CYS A 1 149  ? -45.93300 -17.66200 -42.20200 1.000 50.83574  ? 149  CYS A C     1 
ATOM   1104  O  O     . CYS A 1 149  ? -46.19400 -17.06200 -41.15600 1.000 54.08007  ? 149  CYS A O     1 
ATOM   1105  C  CB    . CYS A 1 149  ? -47.43400 -16.85400 -44.04200 1.000 50.53357  ? 149  CYS A CB    1 
ATOM   1106  S  SG    . CYS A 1 149  ? -46.11500 -16.26900 -45.13800 1.000 47.75552  ? 149  CYS A SG    1 
ATOM   1107  N  N     . ARG A 1 150  ? -44.69900 -18.01300 -42.55800 1.000 49.32873  ? 150  ARG A N     1 
ATOM   1108  C  CA    . ARG A 1 150  ? -43.54100 -17.76900 -41.71200 1.000 46.83662  ? 150  ARG A CA    1 
ATOM   1109  C  C     . ARG A 1 150  ? -42.72800 -16.55500 -42.14900 1.000 52.59765  ? 150  ARG A C     1 
ATOM   1110  O  O     . ARG A 1 150  ? -41.86800 -16.09700 -41.39000 1.000 60.72131  ? 150  ARG A O     1 
ATOM   1111  C  CB    . ARG A 1 150  ? -42.64400 -19.01800 -41.69300 1.000 47.97698  ? 150  ARG A CB    1 
ATOM   1112  C  CG    . ARG A 1 150  ? -41.55700 -19.03400 -40.62500 1.000 48.87296  ? 150  ARG A CG    1 
ATOM   1113  C  CD    . ARG A 1 150  ? -42.13200 -18.90400 -39.22600 1.000 53.89268  ? 150  ARG A CD    1 
ATOM   1114  N  NE    . ARG A 1 150  ? -41.28800 -19.55900 -38.23100 1.000 53.32225  ? 150  ARG A NE    1 
ATOM   1115  C  CZ    . ARG A 1 150  ? -41.43800 -19.42500 -36.91600 1.000 58.86051  ? 150  ARG A CZ    1 
ATOM   1116  N  NH1   . ARG A 1 150  ? -42.40200 -18.65600 -36.43000 1.000 60.95566  ? 150  ARG A NH1   1 
ATOM   1117  N  NH2   . ARG A 1 150  ? -40.62100 -20.06100 -36.08700 1.000 62.58870  ? 150  ARG A NH2   1 
ATOM   1118  N  N     . CYS A 1 151  ? -42.99600 -16.00900 -43.33500 1.000 52.74553  ? 151  CYS A N     1 
ATOM   1119  C  CA    . CYS A 1 151  ? -42.17300 -14.95500 -43.91700 1.000 62.77635  ? 151  CYS A CA    1 
ATOM   1120  C  C     . CYS A 1 151  ? -42.81400 -13.57200 -43.85000 1.000 61.25559  ? 151  CYS A C     1 
ATOM   1121  O  O     . CYS A 1 151  ? -42.18600 -12.62600 -43.37100 1.000 60.26186  ? 151  CYS A O     1 
ATOM   1122  C  CB    . CYS A 1 151  ? -41.84700 -15.29500 -45.37700 1.000 56.18923  ? 151  CYS A CB    1 
ATOM   1123  S  SG    . CYS A 1 151  ? -40.61200 -16.59100 -45.60000 1.000 51.84679  ? 151  CYS A SG    1 
ATOM   1124  N  N     . THR A 1 152  ? -44.05200 -13.43000 -44.32600 1.000 62.06460  ? 152  THR A N     1 
ATOM   1125  C  CA    . THR A 1 152  ? -44.60300 -12.10600 -44.59200 1.000 59.71037  ? 152  THR A CA    1 
ATOM   1126  C  C     . THR A 1 152  ? -45.15300 -11.40800 -43.35400 1.000 62.49774  ? 152  THR A C     1 
ATOM   1127  O  O     . THR A 1 152  ? -45.26200 -10.17700 -43.35600 1.000 59.52939  ? 152  THR A O     1 
ATOM   1128  C  CB    . THR A 1 152  ? -45.71100 -12.19800 -45.64300 1.000 62.42768  ? 152  THR A CB    1 
ATOM   1129  O  OG1   . THR A 1 152  ? -46.81500 -12.94200 -45.11300 1.000 62.02861  ? 152  THR A OG1   1 
ATOM   1130  C  CG2   . THR A 1 152  ? -45.19700 -12.88600 -46.89800 1.000 65.51506  ? 152  THR A CG2   1 
ATOM   1131  N  N     . GLY A 1 153  ? -45.50300 -12.14800 -42.30600 1.000 70.87718  ? 153  GLY A N     1 
ATOM   1132  C  CA    . GLY A 1 153  ? -46.16800 -11.52100 -41.18100 1.000 69.23912  ? 153  GLY A CA    1 
ATOM   1133  C  C     . GLY A 1 153  ? -47.60800 -11.14200 -41.43500 1.000 69.27020  ? 153  GLY A C     1 
ATOM   1134  O  O     . GLY A 1 153  ? -48.18200 -10.38600 -40.64400 1.000 73.27224  ? 153  GLY A O     1 
ATOM   1135  N  N     . TYR A 1 154  ? -48.19200 -11.61800 -42.53800 1.000 58.62264  ? 154  TYR A N     1 
ATOM   1136  C  CA    . TYR A 1 154  ? -49.61500 -11.50600 -42.85000 1.000 57.26359  ? 154  TYR A CA    1 
ATOM   1137  C  C     . TYR A 1 154  ? -50.05400 -10.09100 -43.21300 1.000 64.77133  ? 154  TYR A C     1 
ATOM   1138  O  O     . TYR A 1 154  ? -51.15300 -9.91100  -43.74400 1.000 68.57103  ? 154  TYR A O     1 
ATOM   1139  C  CB    . TYR A 1 154  ? -50.46500 -12.02300 -41.68600 1.000 52.01421  ? 154  TYR A CB    1 
ATOM   1140  C  CG    . TYR A 1 154  ? -50.14100 -13.43900 -41.27100 1.000 54.60575  ? 154  TYR A CG    1 
ATOM   1141  C  CD1   . TYR A 1 154  ? -50.57300 -14.52100 -42.02500 1.000 54.36601  ? 154  TYR A CD1   1 
ATOM   1142  C  CD2   . TYR A 1 154  ? -49.41000 -13.69400 -40.11900 1.000 58.91134  ? 154  TYR A CD2   1 
ATOM   1143  C  CE1   . TYR A 1 154  ? -50.28100 -15.81700 -41.64600 1.000 58.72969  ? 154  TYR A CE1   1 
ATOM   1144  C  CE2   . TYR A 1 154  ? -49.11200 -14.98500 -39.73200 1.000 52.98050  ? 154  TYR A CE2   1 
ATOM   1145  C  CZ    . TYR A 1 154  ? -49.55000 -16.04300 -40.49800 1.000 54.03853  ? 154  TYR A CZ    1 
ATOM   1146  O  OH    . TYR A 1 154  ? -49.25700 -17.33100 -40.11500 1.000 53.96661  ? 154  TYR A OH    1 
ATOM   1147  N  N     . ARG A 1 155  ? -49.22000 -9.08500  -42.94500 1.000 66.50553  ? 155  ARG A N     1 
ATOM   1148  C  CA    . ARG A 1 155  ? -49.62300 -7.70700  -43.22800 1.000 64.92872  ? 155  ARG A CA    1 
ATOM   1149  C  C     . ARG A 1 155  ? -49.91400 -7.47100  -44.70700 1.000 64.93213  ? 155  ARG A C     1 
ATOM   1150  O  O     . ARG A 1 155  ? -51.00500 -6.96300  -45.02100 1.000 69.97529  ? 155  ARG A O     1 
ATOM   1151  C  CB    . ARG A 1 155  ? -48.56100 -6.73300  -42.69900 1.000 67.18678  ? 155  ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1 155  ? -48.96700 -5.25400  -42.73200 1.000 68.29604  ? 155  ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1 155  ? -48.65100 -4.58100  -44.06700 1.000 71.72064  ? 155  ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1 155  ? -47.24300 -4.70500  -44.42800 1.000 76.51558  ? 155  ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1 155  ? -46.74700 -4.40500  -45.62400 1.000 75.28056  ? 155  ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1 155  ? -47.54600 -3.95900  -46.58400 1.000 72.85135  ? 155  ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1 155  ? -45.45000 -4.55100  -45.86000 1.000 66.62620  ? 155  ARG A NH2   1 
ATOM   1158  N  N     . PRO A 1 156  ? -49.02100 -7.79200  -45.65300 1.000 63.96107  ? 156  PRO A N     1 
ATOM   1159  C  CA    . PRO A 1 156  ? -49.33000 -7.47900  -47.05700 1.000 64.03407  ? 156  PRO A CA    1 
ATOM   1160  C  C     . PRO A 1 156  ? -50.46600 -8.31000  -47.62800 1.000 67.04610  ? 156  PRO A C     1 
ATOM   1161  O  O     . PRO A 1 156  ? -51.12200 -7.86400  -48.57700 1.000 69.24380  ? 156  PRO A O     1 
ATOM   1162  C  CB    . PRO A 1 156  ? -48.00600 -7.75700  -47.77900 1.000 58.57028  ? 156  PRO A CB    1 
ATOM   1163  C  CG    . PRO A 1 156  ? -47.32500 -8.75900  -46.92700 1.000 63.39818  ? 156  PRO A CG    1 
ATOM   1164  C  CD    . PRO A 1 156  ? -47.69200 -8.41900  -45.51800 1.000 64.28680  ? 156  PRO A CD    1 
ATOM   1165  N  N     . ILE A 1 157  ? -50.71800 -9.50300  -47.08700 1.000 65.82710  ? 157  ILE A N     1 
ATOM   1166  C  CA    . ILE A 1 157  ? -51.85200 -10.29500 -47.55100 1.000 65.96319  ? 157  ILE A CA    1 
ATOM   1167  C  C     . ILE A 1 157  ? -53.16300 -9.62800  -47.15100 1.000 71.06784  ? 157  ILE A C     1 
ATOM   1168  O  O     . ILE A 1 157  ? -54.14900 -9.66500  -47.89800 1.000 68.20608  ? 157  ILE A O     1 
ATOM   1169  C  CB    . ILE A 1 157  ? -51.75500 -11.73600 -47.01700 1.000 65.97141  ? 157  ILE A CB    1 
ATOM   1170  C  CG1   . ILE A 1 157  ? -50.45100 -12.38700 -47.48100 1.000 66.81664  ? 157  ILE A CG1   1 
ATOM   1171  C  CG2   . ILE A 1 157  ? -52.94800 -12.56200 -47.47600 1.000 61.19881  ? 157  ILE A CG2   1 
ATOM   1172  C  CD1   . ILE A 1 157  ? -50.30400 -13.83300 -47.05600 1.000 55.84682  ? 157  ILE A CD1   1 
ATOM   1173  N  N     . ILE A 1 158  ? -53.19500 -8.99900  -45.97300 1.000 72.73076  ? 158  ILE A N     1 
ATOM   1174  C  CA    . ILE A 1 158  ? -54.38300 -8.25700  -45.56100 1.000 67.16239  ? 158  ILE A CA    1 
ATOM   1175  C  C     . ILE A 1 158  ? -54.59200 -7.04300  -46.45900 1.000 69.92662  ? 158  ILE A C     1 
ATOM   1176  O  O     . ILE A 1 158  ? -55.73100 -6.67900  -46.77800 1.000 74.10532  ? 158  ILE A O     1 
ATOM   1177  C  CB    . ILE A 1 158  ? -54.27900 -7.85600  -44.07800 1.000 60.22176  ? 158  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A 1 158  ? -54.08200 -9.09100  -43.19900 1.000 60.67392  ? 158  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A 1 158  ? -55.51800 -7.09100  -43.63800 1.000 75.83284  ? 158  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A 1 158  ? -55.17300 -10.12500 -43.34300 1.000 70.03150  ? 158  ILE A CD1   1 
ATOM   1181  N  N     . ASP A 1 159  ? -53.50100 -6.40100  -46.88400 1.000 67.26936  ? 159  ASP A N     1 
ATOM   1182  C  CA    . ASP A 1 159  ? -53.62000 -5.25400  -47.78000 1.000 74.69959  ? 159  ASP A CA    1 
ATOM   1183  C  C     . ASP A 1 159  ? -54.23600 -5.65700  -49.11300 1.000 71.66527  ? 159  ASP A C     1 
ATOM   1184  O  O     . ASP A 1 159  ? -55.08700 -4.94200  -49.65500 1.000 73.80558  ? 159  ASP A O     1 
ATOM   1185  C  CB    . ASP A 1 159  ? -52.25200 -4.60600  -47.99500 1.000 73.37319  ? 159  ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1 159  ? -51.74400 -3.89100  -46.75900 1.000 83.64148  ? 159  ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1 159  ? -52.57400 -3.52800  -45.89800 1.000 87.79079  ? 159  ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1 159  ? -50.51700 -3.68600  -46.65100 1.000 83.05144  ? 159  ASP A OD2   1 
ATOM   1189  N  N     . ALA A 1 160  ? -53.81700 -6.80100  -49.66000 1.000 70.32059  ? 160  ALA A N     1 
ATOM   1190  C  CA    . ALA A 1 160  ? -54.42000 -7.29100  -50.89400 1.000 67.27610  ? 160  ALA A CA    1 
ATOM   1191  C  C     . ALA A 1 160  ? -55.87600 -7.68200  -50.68500 1.000 71.19740  ? 160  ALA A C     1 
ATOM   1192  O  O     . ALA A 1 160  ? -56.68800 -7.56200  -51.61000 1.000 70.56094  ? 160  ALA A O     1 
ATOM   1193  C  CB    . ALA A 1 160  ? -53.62300 -8.47600  -51.43600 1.000 67.41852  ? 160  ALA A CB    1 
ATOM   1194  N  N     . CYS A 1 161  ? -56.22500 -8.14800  -49.48300 1.000 71.18778  ? 161  CYS A N     1 
ATOM   1195  C  CA    . CYS A 1 161  ? -57.61300 -8.49700  -49.19900 1.000 72.23237  ? 161  CYS A CA    1 
ATOM   1196  C  C     . CYS A 1 161  ? -58.49100 -7.25400  -49.12400 1.000 76.18255  ? 161  CYS A C     1 
ATOM   1197  O  O     . CYS A 1 161  ? -59.64900 -7.27900  -49.55700 1.000 82.14709  ? 161  CYS A O     1 
ATOM   1198  C  CB    . CYS A 1 161  ? -57.69600 -9.29700  -47.89900 1.000 69.89654  ? 161  CYS A CB    1 
ATOM   1199  S  SG    . CYS A 1 161  ? -57.16300 -11.01700 -48.04800 1.000 69.68470  ? 161  CYS A SG    1 
ATOM   1200  N  N     . LYS A 1 162  ? -57.95600 -6.15600  -48.58200 1.000 72.52098  ? 162  LYS A N     1 
ATOM   1201  C  CA    . LYS A 1 162  ? -58.70500 -4.90500  -48.52500 1.000 73.01313  ? 162  LYS A CA    1 
ATOM   1202  C  C     . LYS A 1 162  ? -59.08300 -4.39600  -49.90900 1.000 73.52269  ? 162  LYS A C     1 
ATOM   1203  O  O     . LYS A 1 162  ? -60.04600 -3.63200  -50.03500 1.000 79.95929  ? 162  LYS A O     1 
ATOM   1204  C  CB    . LYS A 1 162  ? -57.89200 -3.83400  -47.79500 1.000 80.17399  ? 162  LYS A CB    1 
ATOM   1205  C  CG    . LYS A 1 162  ? -57.78500 -4.03300  -46.29500 1.000 76.55682  ? 162  LYS A CG    1 
ATOM   1206  C  CD    . LYS A 1 162  ? -56.97000 -2.92100  -45.65200 1.000 80.85197  ? 162  LYS A CD    1 
ATOM   1207  C  CE    . LYS A 1 162  ? -56.96900 -3.03500  -44.13700 1.000 87.49291  ? 162  LYS A CE    1 
ATOM   1208  N  NZ    . LYS A 1 162  ? -56.11800 -1.99000  -43.50300 1.000 98.56309  ? 162  LYS A NZ    1 
ATOM   1209  N  N     . THR A 1 163  ? -58.34700 -4.80300  -50.94700 1.000 71.63889  ? 163  THR A N     1 
ATOM   1210  C  CA    . THR A 1 163  ? -58.62200 -4.32300  -52.29600 1.000 75.06305  ? 163  THR A CA    1 
ATOM   1211  C  C     . THR A 1 163  ? -59.97300 -4.81000  -52.80600 1.000 78.50792  ? 163  THR A C     1 
ATOM   1212  O  O     . THR A 1 163  ? -60.59300 -4.14700  -53.64600 1.000 75.47648  ? 163  THR A O     1 
ATOM   1213  C  CB    . THR A 1 163  ? -57.50400 -4.76800  -53.24100 1.000 76.98774  ? 163  THR A CB    1 
ATOM   1214  O  OG1   . THR A 1 163  ? -56.23300 -4.51400  -52.62900 1.000 73.00616  ? 163  THR A OG1   1 
ATOM   1215  C  CG2   . THR A 1 163  ? -57.57600 -4.00600  -54.55500 1.000 81.19692  ? 163  THR A CG2   1 
ATOM   1216  N  N     . PHE A 1 164  ? -60.45100 -5.94900  -52.30800 1.000 78.67885  ? 164  PHE A N     1 
ATOM   1217  C  CA    . PHE A 1 164  ? -61.72200 -6.50900  -52.74500 1.000 79.68234  ? 164  PHE A CA    1 
ATOM   1218  C  C     . PHE A 1 164  ? -62.91200 -5.99700  -51.94400 1.000 85.88452  ? 164  PHE A C     1 
ATOM   1219  O  O     . PHE A 1 164  ? -64.05300 -6.32600  -52.28400 1.000 94.04880  ? 164  PHE A O     1 
ATOM   1220  C  CB    . PHE A 1 164  ? -61.68100 -8.03900  -52.66200 1.000 79.20598  ? 164  PHE A CB    1 
ATOM   1221  C  CG    . PHE A 1 164  ? -60.66600 -8.67000  -53.57200 1.000 76.45608  ? 164  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A 1 164  ? -60.98800 -8.98300  -54.88200 1.000 75.42012  ? 164  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A 1 164  ? -59.38900 -8.95200  -53.11500 1.000 72.19613  ? 164  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A 1 164  ? -60.05500 -9.56500  -55.72000 1.000 72.48884  ? 164  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A 1 164  ? -58.45100 -9.53300  -53.94800 1.000 67.37949  ? 164  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A 1 164  ? -58.78500 -9.84000  -55.25200 1.000 69.80616  ? 164  PHE A CZ    1 
ATOM   1227  N  N     . CYS A 1 165  ? -62.67900 -5.20500  -50.90100 1.000 83.03165  ? 165  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1 165  ? -63.75200 -4.72400  -50.04400 1.000 90.70249  ? 165  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1 165  ? -64.21800 -3.34300  -50.48700 1.000 103.68987 ? 165  CYS A C     1 
ATOM   1230  O  O     . CYS A 1 165  ? -63.41200 -2.50200  -50.89600 1.000 97.86820  ? 165  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1 165  ? -63.29400 -4.67300  -48.58500 1.000 92.98764  ? 165  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1 165  ? -62.93900 -6.28600  -47.85400 1.000 75.53482  ? 165  CYS A SG    1 
ATOM   1233  N  N     . LYS A 1 166  ? -65.52500 -3.11700  -50.40100 1.000 111.41355 ? 166  LYS A N     1 
ATOM   1234  C  CA    . LYS A 1 166  ? -66.11500 -1.81000  -50.68900 1.000 114.37412 ? 166  LYS A CA    1 
ATOM   1235  C  C     . LYS A 1 166  ? -66.14600 -0.93100  -49.44200 1.000 122.46452 ? 166  LYS A C     1 
ATOM   1236  O  O     . LYS A 1 166  ? -67.17000 -0.34900  -49.08300 1.000 124.09456 ? 166  LYS A O     1 
ATOM   1237  C  CB    . LYS A 1 166  ? -67.51100 -1.98800  -51.27800 1.000 110.45746 ? 166  LYS A CB    1 
ATOM   1238  C  CG    . LYS A 1 166  ? -68.43000 -2.88700  -50.46300 1.000 112.96466 ? 166  LYS A CG    1 
ATOM   1239  C  CD    . LYS A 1 166  ? -69.84200 -2.88700  -51.02700 1.000 113.56532 ? 166  LYS A CD    1 
ATOM   1240  C  CE    . LYS A 1 166  ? -70.78800 -3.69600  -50.15400 1.000 101.71936 ? 166  LYS A CE    1 
ATOM   1241  N  NZ    . LYS A 1 166  ? -72.19000 -3.64100  -50.65300 1.000 93.48041  ? 166  LYS A NZ    1 
ATOM   1242  N  N     . THR A 1 167  ? -65.00200 -0.83400  -48.77200 1.000 124.09432 ? 167  THR A N     1 
ATOM   1243  C  CA    . THR A 1 167  ? -64.88200 -0.06400  -47.53800 1.000 125.18220 ? 167  THR A CA    1 
ATOM   1244  C  C     . THR A 1 167  ? -65.16100 1.41700   -47.76800 1.000 122.43882 ? 167  THR A C     1 
ATOM   1245  O  O     . THR A 1 167  ? -66.12800 1.96500   -47.24000 1.000 117.37138 ? 167  THR A O     1 
ATOM   1246  C  CB    . THR A 1 167  ? -63.48100 -0.21800  -46.91500 1.000 118.47922 ? 167  THR A CB    1 
ATOM   1247  O  OG1   . THR A 1 167  ? -62.48300 0.04600   -47.90900 1.000 112.13712 ? 167  THR A OG1   1 
ATOM   1248  C  CG2   . THR A 1 167  ? -63.29000 -1.62600  -46.37300 1.000 110.49135 ? 167  THR A CG2   1 
ATOM   1249  N  N     . PRO A 1 199  ? -46.89700 7.95300   -49.84300 1.000 99.60158  ? 199  PRO A N     1 
ATOM   1250  C  CA    . PRO A 1 199  ? -46.25500 6.96400   -50.71400 1.000 101.76848 ? 199  PRO A CA    1 
ATOM   1251  C  C     . PRO A 1 199  ? -46.56200 5.53000   -50.29300 1.000 102.70915 ? 199  PRO A C     1 
ATOM   1252  O  O     . PRO A 1 199  ? -46.44200 5.19500   -49.11400 1.000 106.41050 ? 199  PRO A O     1 
ATOM   1253  C  CB    . PRO A 1 199  ? -44.76500 7.27300   -50.55200 1.000 100.02344 ? 199  PRO A CB    1 
ATOM   1254  C  CG    . PRO A 1 199  ? -44.72600 8.72100   -50.21500 1.000 100.31566 ? 199  PRO A CG    1 
ATOM   1255  C  CD    . PRO A 1 199  ? -45.94600 8.97500   -49.37300 1.000 96.38788  ? 199  PRO A CD    1 
ATOM   1256  N  N     . LYS A 1 200  ? -46.95900 4.69800   -51.25200 1.000 99.71907  ? 200  LYS A N     1 
ATOM   1257  C  CA    . LYS A 1 200  ? -47.28700 3.30400   -51.00000 1.000 100.27133 ? 200  LYS A CA    1 
ATOM   1258  C  C     . LYS A 1 200  ? -46.35000 2.39900   -51.78900 1.000 94.11068  ? 200  LYS A C     1 
ATOM   1259  O  O     . LYS A 1 200  ? -45.66800 2.83300   -52.72200 1.000 91.11649  ? 200  LYS A O     1 
ATOM   1260  C  CB    . LYS A 1 200  ? -48.74700 3.00000   -51.36600 1.000 96.68868  ? 200  LYS A CB    1 
ATOM   1261  C  CG    . LYS A 1 200  ? -49.70900 4.15000   -51.10500 1.000 103.79215 ? 200  LYS A CG    1 
ATOM   1262  C  CD    . LYS A 1 200  ? -49.79700 4.47700   -49.62100 1.000 102.93989 ? 200  LYS A CD    1 
ATOM   1263  C  CE    . LYS A 1 200  ? -50.51200 5.79800   -49.38800 1.000 106.61427 ? 200  LYS A CE    1 
ATOM   1264  N  NZ    . LYS A 1 200  ? -51.87200 5.81000   -49.99400 1.000 93.01357  ? 200  LYS A NZ    1 
ATOM   1265  N  N     . LEU A 1 201  ? -46.32500 1.12400   -51.39900 1.000 83.05907  ? 201  LEU A N     1 
ATOM   1266  C  CA    . LEU A 1 201  ? -45.45600 0.13700   -52.02500 1.000 79.34515  ? 201  LEU A CA    1 
ATOM   1267  C  C     . LEU A 1 201  ? -46.05300 -0.47500  -53.28500 1.000 80.52924  ? 201  LEU A C     1 
ATOM   1268  O  O     . LEU A 1 201  ? -45.36300 -1.23800  -53.97000 1.000 76.01429  ? 201  LEU A O     1 
ATOM   1269  C  CB    . LEU A 1 201  ? -45.11900 -0.98300  -51.03400 1.000 74.19296  ? 201  LEU A CB    1 
ATOM   1270  C  CG    . LEU A 1 201  ? -44.19000 -0.65600  -49.86000 1.000 78.56074  ? 201  LEU A CG    1 
ATOM   1271  C  CD1   . LEU A 1 201  ? -43.00600 0.18600   -50.31800 1.000 82.00615  ? 201  LEU A CD1   1 
ATOM   1272  C  CD2   . LEU A 1 201  ? -44.93800 0.02700   -48.72200 1.000 88.43660  ? 201  LEU A CD2   1 
ATOM   1273  N  N     . PHE A 1 202  ? -47.30700 -0.16700  -53.60600 1.000 81.28750  ? 202  PHE A N     1 
ATOM   1274  C  CA    . PHE A 1 202  ? -47.95300 -0.72500  -54.78300 1.000 77.39353  ? 202  PHE A CA    1 
ATOM   1275  C  C     . PHE A 1 202  ? -49.03900 0.22800   -55.25700 1.000 80.13482  ? 202  PHE A C     1 
ATOM   1276  O  O     . PHE A 1 202  ? -49.60800 0.98700   -54.46800 1.000 86.03319  ? 202  PHE A O     1 
ATOM   1277  C  CB    . PHE A 1 202  ? -48.55100 -2.11000  -54.49800 1.000 76.62485  ? 202  PHE A CB    1 
ATOM   1278  C  CG    . PHE A 1 202  ? -49.45300 -2.14800  -53.29600 1.000 75.09497  ? 202  PHE A CG    1 
ATOM   1279  C  CD1   . PHE A 1 202  ? -50.81000 -1.89700  -53.42200 1.000 70.18011  ? 202  PHE A CD1   1 
ATOM   1280  C  CD2   . PHE A 1 202  ? -48.94500 -2.44100  -52.04000 1.000 73.42728  ? 202  PHE A CD2   1 
ATOM   1281  C  CE1   . PHE A 1 202  ? -51.64200 -1.93200  -52.31900 1.000 64.58830  ? 202  PHE A CE1   1 
ATOM   1282  C  CE2   . PHE A 1 202  ? -49.77200 -2.47800  -50.93300 1.000 69.95346  ? 202  PHE A CE2   1 
ATOM   1283  C  CZ    . PHE A 1 202  ? -51.12300 -2.22400  -51.07300 1.000 70.06562  ? 202  PHE A CZ    1 
ATOM   1284  N  N     . ALA A 1 203  ? -49.32100 0.17800   -56.55600 1.000 80.16392  ? 203  ALA A N     1 
ATOM   1285  C  CA    . ALA A 1 203  ? -50.36800 0.99900   -57.16000 1.000 82.28538  ? 203  ALA A CA    1 
ATOM   1286  C  C     . ALA A 1 203  ? -51.64900 0.17600   -57.19600 1.000 86.65778  ? 203  ALA A C     1 
ATOM   1287  O  O     . ALA A 1 203  ? -51.84200 -0.65600  -58.08700 1.000 89.18160  ? 203  ALA A O     1 
ATOM   1288  C  CB    . ALA A 1 203  ? -49.95700 1.46200   -58.55300 1.000 81.35906  ? 203  ALA A CB    1 
ATOM   1289  N  N     . GLU A 1 204  ? -52.52700 0.40200   -56.21500 1.000 84.10266  ? 204  GLU A N     1 
ATOM   1290  C  CA    . GLU A 1 204  ? -53.79800 -0.31500  -56.18800 1.000 80.87883  ? 204  GLU A CA    1 
ATOM   1291  C  C     . GLU A 1 204  ? -54.66600 0.04500   -57.38400 1.000 81.96554  ? 204  GLU A C     1 
ATOM   1292  O  O     . GLU A 1 204  ? -55.42300 -0.79900  -57.87900 1.000 85.00817  ? 204  GLU A O     1 
ATOM   1293  C  CB    . GLU A 1 204  ? -54.55200 -0.02100  -54.89100 1.000 80.60119  ? 204  GLU A CB    1 
ATOM   1294  C  CG    . GLU A 1 204  ? -55.88400 -0.75200  -54.78500 1.000 86.31712  ? 204  GLU A CG    1 
ATOM   1295  C  CD    . GLU A 1 204  ? -56.70300 -0.32500  -53.58200 1.000 99.38295  ? 204  GLU A CD    1 
ATOM   1296  O  OE1   . GLU A 1 204  ? -56.19100 0.46200   -52.75800 1.000 95.18929  ? 204  GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A 1 204  ? -57.86300 -0.77300  -53.46700 1.000 94.53226  ? 204  GLU A OE2   1 
ATOM   1298  N  N     . GLU A 1 205  ? -54.56800 1.28400   -57.86800 1.000 86.66904  ? 205  GLU A N     1 
ATOM   1299  C  CA    . GLU A 1 205  ? -55.42800 1.71500   -58.96100 1.000 85.32622  ? 205  GLU A CA    1 
ATOM   1300  C  C     . GLU A 1 205  ? -55.15000 0.97600   -60.26200 1.000 84.30828  ? 205  GLU A C     1 
ATOM   1301  O  O     . GLU A 1 205  ? -55.97500 1.05600   -61.17300 1.000 91.47309  ? 205  GLU A O     1 
ATOM   1302  C  CB    . GLU A 1 205  ? -55.29700 3.22500   -59.19100 1.000 78.94644  ? 205  GLU A CB    1 
ATOM   1303  C  CG    . GLU A 1 205  ? -54.06400 3.65700   -59.97300 1.000 82.85658  ? 205  GLU A CG    1 
ATOM   1304  C  CD    . GLU A 1 205  ? -52.81300 3.72300   -59.12000 1.000 89.30159  ? 205  GLU A CD    1 
ATOM   1305  O  OE1   . GLU A 1 205  ? -52.90800 3.48300   -57.89800 1.000 85.10850  ? 205  GLU A OE1   1 
ATOM   1306  O  OE2   . GLU A 1 205  ? -51.73400 4.02500   -59.67200 1.000 94.02684  ? 205  GLU A OE2   1 
ATOM   1307  N  N     . GLU A 1 206  ? -54.03400 0.25800   -60.37100 1.000 81.65941  ? 206  GLU A N     1 
ATOM   1308  C  CA    . GLU A 1 206  ? -53.69100 -0.46200  -61.59200 1.000 86.02428  ? 206  GLU A CA    1 
ATOM   1309  C  C     . GLU A 1 206  ? -54.15800 -1.91300  -61.59000 1.000 83.81095  ? 206  GLU A C     1 
ATOM   1310  O  O     . GLU A 1 206  ? -53.94700 -2.61600  -62.58300 1.000 82.82201  ? 206  GLU A O     1 
ATOM   1311  C  CB    . GLU A 1 206  ? -52.17700 -0.42100  -61.82500 1.000 92.63681  ? 206  GLU A CB    1 
ATOM   1312  C  CG    . GLU A 1 206  ? -51.59700 0.97900   -61.93300 1.000 97.33104  ? 206  GLU A CG    1 
ATOM   1313  C  CD    . GLU A 1 206  ? -50.09100 0.97300   -62.10800 1.000 102.05157 ? 206  GLU A CD    1 
ATOM   1314  O  OE1   . GLU A 1 206  ? -49.48200 -0.11400  -62.00900 1.000 102.86709 ? 206  GLU A OE1   1 
ATOM   1315  O  OE2   . GLU A 1 206  ? -49.51500 2.05500   -62.34600 1.000 98.33471  ? 206  GLU A OE2   1 
ATOM   1316  N  N     . PHE A 1 207  ? -54.78200 -2.37800  -60.51200 1.000 81.10437  ? 207  PHE A N     1 
ATOM   1317  C  CA    . PHE A 1 207  ? -55.21400 -3.76500  -60.43000 1.000 79.67247  ? 207  PHE A CA    1 
ATOM   1318  C  C     . PHE A 1 207  ? -56.46500 -4.00300  -61.26800 1.000 84.94855  ? 207  PHE A C     1 
ATOM   1319  O  O     . PHE A 1 207  ? -57.28700 -3.10400  -61.47000 1.000 87.11239  ? 207  PHE A O     1 
ATOM   1320  C  CB    . PHE A 1 207  ? -55.48700 -4.16200  -58.97800 1.000 79.36014  ? 207  PHE A CB    1 
ATOM   1321  C  CG    . PHE A 1 207  ? -54.27200 -4.11600  -58.09300 1.000 75.59417  ? 207  PHE A CG    1 
ATOM   1322  C  CD1   . PHE A 1 207  ? -52.99800 -4.17600  -58.63300 1.000 74.08368  ? 207  PHE A CD1   1 
ATOM   1323  C  CD2   . PHE A 1 207  ? -54.40700 -4.01600  -56.71900 1.000 72.98603  ? 207  PHE A CD2   1 
ATOM   1324  C  CE1   . PHE A 1 207  ? -51.88200 -4.13500  -57.81900 1.000 67.98017  ? 207  PHE A CE1   1 
ATOM   1325  C  CE2   . PHE A 1 207  ? -53.29600 -3.97600  -55.90000 1.000 70.84875  ? 207  PHE A CE2   1 
ATOM   1326  C  CZ    . PHE A 1 207  ? -52.03200 -4.03600  -56.45100 1.000 68.72887  ? 207  PHE A CZ    1 
ATOM   1327  N  N     . LEU A 1 208  ? -56.59900 -5.22900  -61.75700 1.000 89.98220  ? 208  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1 208  ? -57.80400 -5.61700  -62.47900 1.000 94.34135  ? 208  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1 208  ? -58.99200 -5.64500  -61.52500 1.000 93.94376  ? 208  LEU A C     1 
ATOM   1330  O  O     . LEU A 1 208  ? -58.88700 -6.20900  -60.43000 1.000 91.67784  ? 208  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1 208  ? -57.63700 -6.99100  -63.12400 1.000 102.19863 ? 208  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1 208  ? -56.97600 -7.13100  -64.49700 1.000 106.55325 ? 208  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1 208  ? -55.50200 -6.76300  -64.45500 1.000 99.05475  ? 208  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1 208  ? -57.16500 -8.55500  -64.99900 1.000 100.07647 ? 208  LEU A CD2   1 
ATOM   1335  N  N     . PRO A 1 209  ? -60.12700 -5.05600  -61.89300 1.000 97.30910  ? 209  PRO A N     1 
ATOM   1336  C  CA    . PRO A 1 209  ? -61.33300 -5.22900  -61.07700 1.000 94.23727  ? 209  PRO A CA    1 
ATOM   1337  C  C     . PRO A 1 209  ? -61.83800 -6.65800  -61.17900 1.000 90.46156  ? 209  PRO A C     1 
ATOM   1338  O  O     . PRO A 1 209  ? -61.87000 -7.24700  -62.26300 1.000 93.53195  ? 209  PRO A O     1 
ATOM   1339  C  CB    . PRO A 1 209  ? -62.32300 -4.23300  -61.68900 1.000 98.07150  ? 209  PRO A CB    1 
ATOM   1340  C  CG    . PRO A 1 209  ? -61.87300 -4.09000  -63.10500 1.000 104.42771 ? 209  PRO A CG    1 
ATOM   1341  C  CD    . PRO A 1 209  ? -60.37300 -4.21500  -63.07800 1.000 91.02151  ? 209  PRO A CD    1 
ATOM   1342  N  N     . LEU A 1 210  ? -62.21700 -7.22200  -60.03200 1.000 89.44007  ? 210  LEU A N     1 
ATOM   1343  C  CA    . LEU A 1 210  ? -62.69600 -8.59800  -60.00100 1.000 83.56126  ? 210  LEU A CA    1 
ATOM   1344  C  C     . LEU A 1 210  ? -63.93300 -8.75100  -60.87400 1.000 92.58865  ? 210  LEU A C     1 
ATOM   1345  O  O     . LEU A 1 210  ? -65.02800 -8.33200  -60.49000 1.000 97.06814  ? 210  LEU A O     1 
ATOM   1346  C  CB    . LEU A 1 210  ? -62.99900 -9.04100  -58.56800 1.000 79.33392  ? 210  LEU A CB    1 
ATOM   1347  C  CG    . LEU A 1 210  ? -63.51200 -10.47900 -58.44600 1.000 79.55152  ? 210  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A 1 210  ? -62.42900 -11.47200 -58.83900 1.000 80.45767  ? 210  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A 1 210  ? -64.01700 -10.76100 -57.03900 1.000 85.14400  ? 210  LEU A CD2   1 
ATOM   1350  N  N     . ASP A 1 211  ? -63.75500 -9.33900  -62.05600 1.000 96.26215  ? 211  ASP A N     1 
ATOM   1351  C  CA    . ASP A 1 211  ? -64.83100 -9.57200  -63.01000 1.000 97.77221  ? 211  ASP A CA    1 
ATOM   1352  C  C     . ASP A 1 211  ? -65.58800 -10.83500 -62.61800 1.000 106.03739 ? 211  ASP A C     1 
ATOM   1353  O  O     . ASP A 1 211  ? -65.08500 -11.94800 -62.82300 1.000 108.57280 ? 211  ASP A O     1 
ATOM   1354  C  CB    . ASP A 1 211  ? -64.26100 -9.68500  -64.42800 1.000 99.76117  ? 211  ASP A CB    1 
ATOM   1355  C  CG    . ASP A 1 211  ? -65.33600 -9.86100  -65.48900 1.000 108.12721 ? 211  ASP A CG    1 
ATOM   1356  O  OD1   . ASP A 1 211  ? -66.03700 -10.89500 -65.47800 1.000 107.00179 ? 211  ASP A OD1   1 
ATOM   1357  O  OD2   . ASP A 1 211  ? -65.47400 -8.96200  -66.34400 1.000 118.12447 ? 211  ASP A OD2   1 
ATOM   1358  N  N     . PRO A 1 212  ? -66.79500 -10.71300 -62.05500 1.000 108.81460 ? 212  PRO A N     1 
ATOM   1359  C  CA    . PRO A 1 212  ? -67.54300 -11.90900 -61.64800 1.000 105.88727 ? 212  PRO A CA    1 
ATOM   1360  C  C     . PRO A 1 212  ? -68.20200 -12.63800 -62.80400 1.000 110.77095 ? 212  PRO A C     1 
ATOM   1361  O  O     . PRO A 1 212  ? -68.68800 -13.76100 -62.60900 1.000 109.45727 ? 212  PRO A O     1 
ATOM   1362  C  CB    . PRO A 1 212  ? -68.60400 -11.34900 -60.68000 1.000 104.79728 ? 212  PRO A CB    1 
ATOM   1363  C  CG    . PRO A 1 212  ? -68.29400 -9.86500  -60.53200 1.000 104.26784 ? 212  PRO A CG    1 
ATOM   1364  C  CD    . PRO A 1 212  ? -67.55100 -9.48600  -61.76800 1.000 106.97861 ? 212  PRO A CD    1 
ATOM   1365  N  N     . THR A 1 213  ? -68.23400 -12.03700 -63.99400 1.000 111.88772 ? 213  THR A N     1 
ATOM   1366  C  CA    . THR A 1 213  ? -68.88700 -12.66600 -65.13600 1.000 111.21933 ? 213  THR A CA    1 
ATOM   1367  C  C     . THR A 1 213  ? -68.05400 -13.80700 -65.70700 1.000 107.41337 ? 213  THR A C     1 
ATOM   1368  O  O     . THR A 1 213  ? -68.60200 -14.84800 -66.08700 1.000 111.03198 ? 213  THR A O     1 
ATOM   1369  C  CB    . THR A 1 213  ? -69.16400 -11.62500 -66.22200 1.000 116.12104 ? 213  THR A CB    1 
ATOM   1370  O  OG1   . THR A 1 213  ? -69.66400 -10.42200 -65.62300 1.000 119.73456 ? 213  THR A OG1   1 
ATOM   1371  C  CG2   . THR A 1 213  ? -70.18500 -12.15200 -67.21800 1.000 118.83627 ? 213  THR A CG2   1 
ATOM   1372  N  N     . GLN A 1 214  ? -66.73500 -13.63500 -65.77400 1.000 107.05791 ? 214  GLN A N     1 
ATOM   1373  C  CA    . GLN A 1 214  ? -65.84300 -14.60300 -66.41100 1.000 105.69345 ? 214  GLN A CA    1 
ATOM   1374  C  C     . GLN A 1 214  ? -65.09800 -15.46200 -65.40000 1.000 90.16220  ? 214  GLN A C     1 
ATOM   1375  O  O     . GLN A 1 214  ? -63.92000 -15.77900 -65.59200 1.000 83.90477  ? 214  GLN A O     1 
ATOM   1376  C  CB    . GLN A 1 214  ? -64.86100 -13.89000 -67.33300 1.000 100.89246 ? 214  GLN A CB    1 
ATOM   1377  C  CG    . GLN A 1 214  ? -65.36800 -13.73500 -68.75300 1.000 106.92979 ? 214  GLN A CG    1 
ATOM   1378  C  CD    . GLN A 1 214  ? -66.66800 -12.96200 -68.82800 1.000 110.79779 ? 214  GLN A CD    1 
ATOM   1379  O  OE1   . GLN A 1 214  ? -66.73100 -11.79300 -68.44800 1.000 113.84133 ? 214  GLN A OE1   1 
ATOM   1380  N  NE2   . GLN A 1 214  ? -67.71800 -13.61400 -69.31400 1.000 107.78547 ? 214  GLN A NE2   1 
ATOM   1381  N  N     . GLU A 1 215  ? -65.75500 -15.85500 -64.31400 1.000 87.17039  ? 215  GLU A N     1 
ATOM   1382  C  CA    . GLU A 1 215  ? -65.17400 -16.84300 -63.42300 1.000 87.39957  ? 215  GLU A CA    1 
ATOM   1383  C  C     . GLU A 1 215  ? -65.30400 -18.23400 -64.04100 1.000 81.68749  ? 215  GLU A C     1 
ATOM   1384  O  O     . GLU A 1 215  ? -65.93800 -18.42500 -65.08200 1.000 75.88810  ? 215  GLU A O     1 
ATOM   1385  C  CB    . GLU A 1 215  ? -65.84200 -16.79200 -62.05000 1.000 89.08072  ? 215  GLU A CB    1 
ATOM   1386  C  CG    . GLU A 1 215  ? -65.82500 -15.42000 -61.37700 1.000 97.14604  ? 215  GLU A CG    1 
ATOM   1387  C  CD    . GLU A 1 215  ? -64.45100 -15.02200 -60.85600 1.000 89.64842  ? 215  GLU A CD    1 
ATOM   1388  O  OE1   . GLU A 1 215  ? -63.52500 -14.83000 -61.67200 1.000 90.25737  ? 215  GLU A OE1   1 
ATOM   1389  O  OE2   . GLU A 1 215  ? -64.29900 -14.90100 -59.62200 1.000 84.75972  ? 215  GLU A OE2   1 
ATOM   1390  N  N     . LEU A 1 216  ? -64.68600 -19.21500 -63.38800 1.000 79.58559  ? 216  LEU A N     1 
ATOM   1391  C  CA    . LEU A 1 216  ? -64.71500 -20.58400 -63.89000 1.000 71.13745  ? 216  LEU A CA    1 
ATOM   1392  C  C     . LEU A 1 216  ? -66.13600 -21.13200 -63.82900 1.000 73.78115  ? 216  LEU A C     1 
ATOM   1393  O  O     . LEU A 1 216  ? -66.75900 -21.14500 -62.76200 1.000 77.93189  ? 216  LEU A O     1 
ATOM   1394  C  CB    . LEU A 1 216  ? -63.76600 -21.46600 -63.08400 1.000 65.96110  ? 216  LEU A CB    1 
ATOM   1395  C  CG    . LEU A 1 216  ? -62.27700 -21.12300 -63.15400 1.000 65.22966  ? 216  LEU A CG    1 
ATOM   1396  C  CD1   . LEU A 1 216  ? -61.46700 -22.11800 -62.33900 1.000 63.54502  ? 216  LEU A CD1   1 
ATOM   1397  C  CD2   . LEU A 1 216  ? -61.79900 -21.09300 -64.59600 1.000 64.09555  ? 216  LEU A CD2   1 
ATOM   1398  N  N     . ILE A 1 217  ? -66.64900 -21.58000 -64.97000 1.000 67.90606  ? 217  ILE A N     1 
ATOM   1399  C  CA    . ILE A 1 217  ? -67.97900 -22.17100 -65.02300 1.000 70.48979  ? 217  ILE A CA    1 
ATOM   1400  C  C     . ILE A 1 217  ? -67.91600 -23.59000 -64.47700 1.000 65.83631  ? 217  ILE A C     1 
ATOM   1401  O  O     . ILE A 1 217  ? -66.92500 -24.30600 -64.66600 1.000 71.55502  ? 217  ILE A O     1 
ATOM   1402  C  CB    . ILE A 1 217  ? -68.53500 -22.13600 -66.46000 1.000 71.22470  ? 217  ILE A CB    1 
ATOM   1403  C  CG1   . ILE A 1 217  ? -67.71800 -23.03400 -67.39400 1.000 79.86101  ? 217  ILE A CG1   1 
ATOM   1404  C  CG2   . ILE A 1 217  ? -68.56100 -20.70900 -66.98700 1.000 70.91593  ? 217  ILE A CG2   1 
ATOM   1405  C  CD1   . ILE A 1 217  ? -68.41500 -24.32600 -67.77500 1.000 78.42415  ? 217  ILE A CD1   1 
ATOM   1406  N  N     . PHE A 1 218  ? -68.96900 -23.99300 -63.77500 1.000 64.20034  ? 218  PHE A N     1 
ATOM   1407  C  CA    . PHE A 1 218  ? -69.02800 -25.34300 -63.23900 1.000 64.40041  ? 218  PHE A CA    1 
ATOM   1408  C  C     . PHE A 1 218  ? -69.11200 -26.35000 -64.38400 1.000 72.09668  ? 218  PHE A C     1 
ATOM   1409  O  O     . PHE A 1 218  ? -69.80500 -26.10300 -65.37600 1.000 76.95154  ? 218  PHE A O     1 
ATOM   1410  C  CB    . PHE A 1 218  ? -70.23200 -25.49400 -62.31100 1.000 62.12886  ? 218  PHE A CB    1 
ATOM   1411  C  CG    . PHE A 1 218  ? -70.32300 -26.83400 -61.63800 1.000 61.65649  ? 218  PHE A CG    1 
ATOM   1412  C  CD1   . PHE A 1 218  ? -69.57500 -27.10800 -60.50600 1.000 67.26967  ? 218  PHE A CD1   1 
ATOM   1413  C  CD2   . PHE A 1 218  ? -71.16700 -27.81600 -62.13100 1.000 69.91516  ? 218  PHE A CD2   1 
ATOM   1414  C  CE1   . PHE A 1 218  ? -69.65900 -28.33900 -59.88100 1.000 64.07079  ? 218  PHE A CE1   1 
ATOM   1415  C  CE2   . PHE A 1 218  ? -71.25500 -29.05000 -61.51100 1.000 71.54250  ? 218  PHE A CE2   1 
ATOM   1416  C  CZ    . PHE A 1 218  ? -70.50100 -29.31100 -60.38500 1.000 62.02106  ? 218  PHE A CZ    1 
ATOM   1417  N  N     . PRO A 1 219  ? -68.40600 -27.47400 -64.28900 1.000 69.44694  ? 219  PRO A N     1 
ATOM   1418  C  CA    . PRO A 1 219  ? -68.44900 -28.47800 -65.35900 1.000 68.05796  ? 219  PRO A CA    1 
ATOM   1419  C  C     . PRO A 1 219  ? -69.86800 -28.95700 -65.60200 1.000 67.98031  ? 219  PRO A C     1 
ATOM   1420  O  O     . PRO A 1 219  ? -70.49800 -29.54200 -64.70900 1.000 72.21045  ? 219  PRO A O     1 
ATOM   1421  C  CB    . PRO A 1 219  ? -67.56200 -29.60900 -64.81700 1.000 69.72441  ? 219  PRO A CB    1 
ATOM   1422  C  CG    . PRO A 1 219  ? -66.64300 -28.93600 -63.85700 1.000 57.72145  ? 219  PRO A CG    1 
ATOM   1423  C  CD    . PRO A 1 219  ? -67.44100 -27.82800 -63.23300 1.000 63.52515  ? 219  PRO A CD    1 
ATOM   1424  N  N     . PRO A 1 220  ? -70.40900 -28.72100 -66.80200 1.000 77.06719  ? 220  PRO A N     1 
ATOM   1425  C  CA    . PRO A 1 220  ? -71.80700 -29.10000 -67.06500 1.000 80.85914  ? 220  PRO A CA    1 
ATOM   1426  C  C     . PRO A 1 220  ? -72.05200 -30.59700 -67.03600 1.000 74.84850  ? 220  PRO A C     1 
ATOM   1427  O  O     . PRO A 1 220  ? -73.19200 -31.01300 -66.79600 1.000 76.93143  ? 220  PRO A O     1 
ATOM   1428  C  CB    . PRO A 1 220  ? -72.07400 -28.52200 -68.46300 1.000 78.45269  ? 220  PRO A CB    1 
ATOM   1429  C  CG    . PRO A 1 220  ? -70.98500 -27.51000 -68.68600 1.000 76.31638  ? 220  PRO A CG    1 
ATOM   1430  C  CD    . PRO A 1 220  ? -69.79600 -28.04400 -67.95500 1.000 79.88434  ? 220  PRO A CD    1 
ATOM   1431  N  N     . GLU A 1 221  ? -71.02700 -31.41800 -67.27500 1.000 70.29088  ? 221  GLU A N     1 
ATOM   1432  C  CA    . GLU A 1 221  ? -71.22000 -32.86500 -67.25500 1.000 73.09273  ? 221  GLU A CA    1 
ATOM   1433  C  C     . GLU A 1 221  ? -71.61400 -33.34900 -65.86500 1.000 80.29991  ? 221  GLU A C     1 
ATOM   1434  O  O     . GLU A 1 221  ? -72.42900 -34.26800 -65.72700 1.000 82.12546  ? 221  GLU A O     1 
ATOM   1435  C  CB    . GLU A 1 221  ? -69.95000 -33.56900 -67.73400 1.000 78.76207  ? 221  GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1 221  ? -69.99200 -35.08300 -67.60900 1.000 89.91660  ? 221  GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1 221  ? -68.92200 -35.76400 -68.43700 1.000 99.14371  ? 221  GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1 221  ? -68.26100 -35.07000 -69.23800 1.000 103.30148 ? 221  GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1 221  ? -68.74100 -36.99100 -68.28500 1.000 97.40988  ? 221  GLU A OE2   1 
ATOM   1440  N  N     . LEU A 1 222  ? -71.04900 -32.73800 -64.82100 1.000 81.16191  ? 222  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1 222  ? -71.41800 -33.11200 -63.46100 1.000 79.78227  ? 222  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1 222  ? -72.82600 -32.64700 -63.11400 1.000 80.86794  ? 222  LEU A C     1 
ATOM   1443  O  O     . LEU A 1 222  ? -73.51000 -33.29300 -62.31200 1.000 77.64576  ? 222  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1 222  ? -70.41100 -32.54000 -62.46500 1.000 76.54891  ? 222  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1 222  ? -68.94900 -32.92500 -62.69200 1.000 71.19529  ? 222  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1 222  ? -68.02900 -32.04100 -61.86500 1.000 68.68489  ? 222  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1 222  ? -68.72600 -34.39400 -62.36900 1.000 72.76617  ? 222  LEU A CD2   1 
ATOM   1448  N  N     . MET A 1 223  ? -73.27300 -31.53300 -63.70000 1.000 75.47871  ? 223  MET A N     1 
ATOM   1449  C  CA    . MET A 1 223  ? -74.62900 -31.06100 -63.44600 1.000 81.67310  ? 223  MET A CA    1 
ATOM   1450  C  C     . MET A 1 223  ? -75.66200 -32.03600 -63.99500 1.000 87.79958  ? 223  MET A C     1 
ATOM   1451  O  O     . MET A 1 223  ? -76.71400 -32.24700 -63.38100 1.000 94.44862  ? 223  MET A O     1 
ATOM   1452  C  CB    . MET A 1 223  ? -74.82300 -29.67000 -64.05000 1.000 86.42852  ? 223  MET A CB    1 
ATOM   1453  C  CG    . MET A 1 223  ? -76.13500 -29.00500 -63.66900 1.000 92.92262  ? 223  MET A CG    1 
ATOM   1454  S  SD    . MET A 1 223  ? -76.25100 -27.30600 -64.26100 1.000 113.35768 ? 223  MET A SD    1 
ATOM   1455  C  CE    . MET A 1 223  ? -74.75900 -26.60300 -63.56300 1.000 94.15664  ? 223  MET A CE    1 
ATOM   1456  N  N     . ILE A 1 224  ? -75.37700 -32.64400 -65.14800 1.000 85.48686  ? 224  ILE A N     1 
ATOM   1457  C  CA    . ILE A 1 224  ? -76.27600 -33.65700 -65.69000 1.000 87.49953  ? 224  ILE A CA    1 
ATOM   1458  C  C     . ILE A 1 224  ? -76.18600 -34.94100 -64.87600 1.000 91.21744  ? 224  ILE A C     1 
ATOM   1459  O  O     . ILE A 1 224  ? -77.18700 -35.64700 -64.70200 1.000 95.86454  ? 224  ILE A O     1 
ATOM   1460  C  CB    . ILE A 1 224  ? -75.96500 -33.89800 -67.17900 1.000 75.95660  ? 224  ILE A CB    1 
ATOM   1461  C  CG1   . ILE A 1 224  ? -76.13800 -32.60200 -67.97300 1.000 82.59745  ? 224  ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A 1 224  ? -76.85900 -34.98900 -67.75100 1.000 84.68845  ? 224  ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A 1 224  ? -75.88800 -32.75300 -69.45700 1.000 75.36568  ? 224  ILE A CD1   1 
ATOM   1464  N  N     . MET A 1 225  ? -74.99900 -35.25900 -64.35100 1.000 87.81396  ? 225  MET A N     1 
ATOM   1465  C  CA    . MET A 1 225  ? -74.84300 -36.46300 -63.53900 1.000 87.07320  ? 225  MET A CA    1 
ATOM   1466  C  C     . MET A 1 225  ? -75.64500 -36.37100 -62.24700 1.000 87.42846  ? 225  MET A C     1 
ATOM   1467  O  O     . MET A 1 225  ? -76.26000 -37.35600 -61.82100 1.000 82.13264  ? 225  MET A O     1 
ATOM   1468  C  CB    . MET A 1 225  ? -73.36600 -36.70100 -63.23000 1.000 90.09702  ? 225  MET A CB    1 
ATOM   1469  C  CG    . MET A 1 225  ? -72.57000 -37.29800 -64.37400 1.000 95.49188  ? 225  MET A CG    1 
ATOM   1470  S  SD    . MET A 1 225  ? -70.83700 -37.52100 -63.93200 1.000 82.76378  ? 225  MET A SD    1 
ATOM   1471  C  CE    . MET A 1 225  ? -70.99800 -38.33800 -62.34600 1.000 73.29167  ? 225  MET A CE    1 
ATOM   1472  N  N     . ALA A 1 226  ? -75.64400 -35.20100 -61.60500 1.000 86.98932  ? 226  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1 226  ? -76.38500 -35.04500 -60.35800 1.000 91.61245  ? 226  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1 226  ? -77.89000 -35.06100 -60.59100 1.000 100.17083 ? 226  ALA A C     1 
ATOM   1475  O  O     . ALA A 1 226  ? -78.64000 -35.55700 -59.74300 1.000 95.57417  ? 226  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1 226  ? -75.97000 -33.75200 -59.65700 1.000 88.55733  ? 226  ALA A CB    1 
ATOM   1477  N  N     . GLU A 1 227  ? -78.34800 -34.52900 -61.72800 1.000 102.45241 ? 227  GLU A N     1 
ATOM   1478  C  CA    . GLU A 1 227  ? -79.77800 -34.51100 -62.01800 1.000 104.48042 ? 227  GLU A CA    1 
ATOM   1479  C  C     . GLU A 1 227  ? -80.34800 -35.92000 -62.12300 1.000 101.39444 ? 227  GLU A C     1 
ATOM   1480  O  O     . GLU A 1 227  ? -81.50600 -36.14900 -61.75400 1.000 103.95772 ? 227  GLU A O     1 
ATOM   1481  C  CB    . GLU A 1 227  ? -80.04200 -33.72600 -63.30300 1.000 98.73404  ? 227  GLU A CB    1 
ATOM   1482  C  CG    . GLU A 1 227  ? -79.88500 -32.22200 -63.14300 1.000 100.53240 ? 227  GLU A CG    1 
ATOM   1483  C  CD    . GLU A 1 227  ? -79.74100 -31.50200 -64.46900 1.000 104.39300 ? 227  GLU A CD    1 
ATOM   1484  O  OE1   . GLU A 1 227  ? -79.66700 -32.18400 -65.51300 1.000 102.77246 ? 227  GLU A OE1   1 
ATOM   1485  O  OE2   . GLU A 1 227  ? -79.69800 -30.25400 -64.46700 1.000 99.89353  ? 227  GLU A OE2   1 
ATOM   1486  N  N     . LYS A 1 228  ? -79.55900 -36.87100 -62.61900 1.000 95.68436  ? 228  LYS A N     1 
ATOM   1487  C  CA    . LYS A 1 228  ? -79.95300 -38.28000 -62.63300 1.000 97.77667  ? 228  LYS A CA    1 
ATOM   1488  C  C     . LYS A 1 228  ? -79.50200 -38.89300 -61.31500 1.000 102.22390 ? 228  LYS A C     1 
ATOM   1489  O  O     . LYS A 1 228  ? -78.36000 -39.33200 -61.16700 1.000 107.38537 ? 228  LYS A O     1 
ATOM   1490  C  CB    . LYS A 1 228  ? -79.34400 -39.00900 -63.82400 1.000 101.56103 ? 228  LYS A CB    1 
ATOM   1491  C  CG    . LYS A 1 228  ? -79.09900 -38.13800 -65.04300 1.000 106.62788 ? 228  LYS A CG    1 
ATOM   1492  C  CD    . LYS A 1 228  ? -78.12900 -38.80800 -66.00500 1.000 103.68506 ? 228  LYS A CD    1 
ATOM   1493  C  CE    . LYS A 1 228  ? -76.80800 -39.12700 -65.32000 1.000 99.57350  ? 228  LYS A CE    1 
ATOM   1494  N  NZ    . LYS A 1 228  ? -75.91400 -39.95200 -66.17900 1.000 97.38481  ? 228  LYS A NZ    1 
ATOM   1495  N  N     . GLN A 1 229  ? -80.40800 -38.91800 -60.33700 1.000 101.40786 ? 229  GLN A N     1 
ATOM   1496  C  CA    . GLN A 1 229  ? -80.10800 -39.49800 -59.02900 1.000 107.15338 ? 229  GLN A CA    1 
ATOM   1497  C  C     . GLN A 1 229  ? -79.94200 -41.00700 -59.19200 1.000 105.41877 ? 229  GLN A C     1 
ATOM   1498  O  O     . GLN A 1 229  ? -80.86700 -41.80000 -59.00400 1.000 106.53170 ? 229  GLN A O     1 
ATOM   1499  C  CB    . GLN A 1 229  ? -81.19100 -39.15300 -58.01100 1.000 104.30962 ? 229  GLN A CB    1 
ATOM   1500  C  CG    . GLN A 1 229  ? -81.02500 -39.83300 -56.64700 1.000 108.32311 ? 229  GLN A CG    1 
ATOM   1501  C  CD    . GLN A 1 229  ? -79.87400 -39.27100 -55.82900 1.000 114.63766 ? 229  GLN A CD    1 
ATOM   1502  O  OE1   . GLN A 1 229  ? -78.70400 -39.47400 -56.15600 1.000 113.76778 ? 229  GLN A OE1   1 
ATOM   1503  N  NE2   . GLN A 1 229  ? -80.20400 -38.56800 -54.75100 1.000 103.27671 ? 229  GLN A NE2   1 
ATOM   1504  N  N     . SER A 1 230  ? -78.73300 -41.40400 -59.57900 1.000 98.79790  ? 230  SER A N     1 
ATOM   1505  C  CA    . SER A 1 230  ? -78.37300 -42.81300 -59.54700 1.000 94.31992  ? 230  SER A CA    1 
ATOM   1506  C  C     . SER A 1 230  ? -78.32800 -43.28500 -58.10100 1.000 96.56917  ? 230  SER A C     1 
ATOM   1507  O  O     . SER A 1 230  ? -77.77200 -42.60700 -57.23300 1.000 99.71360  ? 230  SER A O     1 
ATOM   1508  C  CB    . SER A 1 230  ? -77.02200 -43.03100 -60.22600 1.000 93.66274  ? 230  SER A CB    1 
ATOM   1509  O  OG    . SER A 1 230  ? -76.48000 -44.29300 -59.88200 1.000 95.08988  ? 230  SER A OG    1 
ATOM   1510  N  N     . GLN A 1 231  ? -78.93200 -44.44000 -57.83700 1.000 98.56040  ? 231  GLN A N     1 
ATOM   1511  C  CA    . GLN A 1 231  ? -79.02300 -44.95600 -56.48000 1.000 94.44714  ? 231  GLN A CA    1 
ATOM   1512  C  C     . GLN A 1 231  ? -78.03200 -46.07800 -56.20500 1.000 99.88379  ? 231  GLN A C     1 
ATOM   1513  O  O     . GLN A 1 231  ? -77.99000 -46.58600 -55.07900 1.000 102.62100 ? 231  GLN A O     1 
ATOM   1514  C  CB    . GLN A 1 231  ? -80.44600 -45.44300 -56.19100 1.000 101.33260 ? 231  GLN A CB    1 
ATOM   1515  C  CG    . GLN A 1 231  ? -81.53500 -44.48400 -56.65000 1.000 103.46785 ? 231  GLN A CG    1 
ATOM   1516  C  CD    . GLN A 1 231  ? -82.33200 -43.90300 -55.50100 1.000 106.03213 ? 231  GLN A CD    1 
ATOM   1517  O  OE1   . GLN A 1 231  ? -81.83000 -43.07700 -54.74000 1.000 111.11111 ? 231  GLN A OE1   1 
ATOM   1518  N  NE2   . GLN A 1 231  ? -83.57900 -44.33900 -55.36200 1.000 105.03138 ? 231  GLN A NE2   1 
ATOM   1519  N  N     . ARG A 1 232  ? -77.23000 -46.46800 -57.19400 1.000 101.91162 ? 232  ARG A N     1 
ATOM   1520  C  CA    . ARG A 1 232  ? -76.28300 -47.55900 -57.01200 1.000 101.31419 ? 232  ARG A CA    1 
ATOM   1521  C  C     . ARG A 1 232  ? -75.08900 -47.09400 -56.19000 1.000 83.23688  ? 232  ARG A C     1 
ATOM   1522  O  O     . ARG A 1 232  ? -74.53300 -46.01700 -56.43200 1.000 75.66341  ? 232  ARG A O     1 
ATOM   1523  C  CB    . ARG A 1 232  ? -75.81900 -48.10500 -58.36500 1.000 99.44133  ? 232  ARG A CB    1 
ATOM   1524  C  CG    . ARG A 1 232  ? -75.09600 -47.10400 -59.25600 1.000 101.43110 ? 232  ARG A CG    1 
ATOM   1525  C  CD    . ARG A 1 232  ? -74.69100 -47.74300 -60.57200 1.000 107.39032 ? 232  ARG A CD    1 
ATOM   1526  N  NE    . ARG A 1 232  ? -75.65100 -48.75800 -60.99000 1.000 116.76936 ? 232  ARG A NE    1 
ATOM   1527  C  CZ    . ARG A 1 232  ? -75.87400 -49.10300 -62.25300 1.000 119.23110 ? 232  ARG A CZ    1 
ATOM   1528  N  NH1   . ARG A 1 232  ? -75.19900 -48.51600 -63.23100 1.000 117.01067 ? 232  ARG A NH1   1 
ATOM   1529  N  NH2   . ARG A 1 232  ? -76.77100 -50.03700 -62.53900 1.000 108.35151 ? 232  ARG A NH2   1 
ATOM   1530  N  N     . THR A 1 233  ? -74.70600 -47.90400 -55.20900 1.000 73.18262  ? 233  THR A N     1 
ATOM   1531  C  CA    . THR A 1 233  ? -73.51400 -47.62800 -54.42500 1.000 77.82385  ? 233  THR A CA    1 
ATOM   1532  C  C     . THR A 1 233  ? -72.26900 -47.99200 -55.22100 1.000 76.72429  ? 233  THR A C     1 
ATOM   1533  O  O     . THR A 1 233  ? -72.27000 -48.92500 -56.02900 1.000 72.76351  ? 233  THR A O     1 
ATOM   1534  C  CB    . THR A 1 233  ? -73.53500 -48.40700 -53.11000 1.000 75.39843  ? 233  THR A CB    1 
ATOM   1535  O  OG1   . THR A 1 233  ? -73.04100 -49.73500 -53.32900 1.000 75.67834  ? 233  THR A OG1   1 
ATOM   1536  C  CG2   . THR A 1 233  ? -74.94600 -48.48800 -52.57300 1.000 79.46903  ? 233  THR A CG2   1 
ATOM   1537  N  N     . ARG A 1 234  ? -71.20100 -47.24100 -54.98700 1.000 67.12684  ? 234  ARG A N     1 
ATOM   1538  C  CA    . ARG A 1 234  ? -69.94400 -47.42900 -55.69200 1.000 63.58586  ? 234  ARG A CA    1 
ATOM   1539  C  C     . ARG A 1 234  ? -68.95900 -48.17200 -54.80200 1.000 72.06971  ? 234  ARG A C     1 
ATOM   1540  O  O     . ARG A 1 234  ? -68.84000 -47.88100 -53.60800 1.000 70.14876  ? 234  ARG A O     1 
ATOM   1541  C  CB    . ARG A 1 234  ? -69.36400 -46.08200 -56.12100 1.000 64.91695  ? 234  ARG A CB    1 
ATOM   1542  C  CG    . ARG A 1 234  ? -70.42200 -45.01200 -56.30900 1.000 68.31304  ? 234  ARG A CG    1 
ATOM   1543  C  CD    . ARG A 1 234  ? -69.86000 -43.77800 -56.98100 1.000 80.36414  ? 234  ARG A CD    1 
ATOM   1544  N  NE    . ARG A 1 234  ? -70.55700 -42.57200 -56.54700 1.000 77.96119  ? 234  ARG A NE    1 
ATOM   1545  C  CZ    . ARG A 1 234  ? -70.19000 -41.83400 -55.50500 1.000 84.03327  ? 234  ARG A CZ    1 
ATOM   1546  N  NH1   . ARG A 1 234  ? -69.13100 -42.18000 -54.78600 1.000 81.91691  ? 234  ARG A NH1   1 
ATOM   1547  N  NH2   . ARG A 1 234  ? -70.88300 -40.75100 -55.18100 1.000 82.54770  ? 234  ARG A NH2   1 
ATOM   1548  N  N     . VAL A 1 235  ? -68.25900 -49.13700 -55.39100 1.000 69.18857  ? 235  VAL A N     1 
ATOM   1549  C  CA    . VAL A 1 235  ? -67.31700 -49.98600 -54.67200 1.000 68.52926  ? 235  VAL A CA    1 
ATOM   1550  C  C     . VAL A 1 235  ? -65.92800 -49.74400 -55.24300 1.000 72.29123  ? 235  VAL A C     1 
ATOM   1551  O  O     . VAL A 1 235  ? -65.69400 -49.96700 -56.43800 1.000 75.62728  ? 235  VAL A O     1 
ATOM   1552  C  CB    . VAL A 1 235  ? -67.69700 -51.47100 -54.76800 1.000 60.32721  ? 235  VAL A CB    1 
ATOM   1553  C  CG1   . VAL A 1 235  ? -66.66000 -52.32900 -54.05800 1.000 58.63232  ? 235  VAL A CG1   1 
ATOM   1554  C  CG2   . VAL A 1 235  ? -69.08100 -51.70300 -54.18400 1.000 60.85945  ? 235  VAL A CG2   1 
ATOM   1555  N  N     . PHE A 1 236  ? -65.01400 -49.28500 -54.39400 1.000 69.11266  ? 236  PHE A N     1 
ATOM   1556  C  CA    . PHE A 1 236  ? -63.60800 -49.13800 -54.73900 1.000 64.23516  ? 236  PHE A CA    1 
ATOM   1557  C  C     . PHE A 1 236  ? -62.80000 -50.03900 -53.81900 1.000 67.85367  ? 236  PHE A C     1 
ATOM   1558  O  O     . PHE A 1 236  ? -63.03500 -50.06300 -52.60700 1.000 72.98208  ? 236  PHE A O     1 
ATOM   1559  C  CB    . PHE A 1 236  ? -63.15200 -47.68200 -54.60700 1.000 64.36121  ? 236  PHE A CB    1 
ATOM   1560  C  CG    . PHE A 1 236  ? -64.01900 -46.70600 -55.35100 1.000 59.49165  ? 236  PHE A CG    1 
ATOM   1561  C  CD1   . PHE A 1 236  ? -63.90400 -46.56400 -56.72300 1.000 63.65823  ? 236  PHE A CD1   1 
ATOM   1562  C  CD2   . PHE A 1 236  ? -64.94500 -45.92700 -54.67800 1.000 65.70803  ? 236  PHE A CD2   1 
ATOM   1563  C  CE1   . PHE A 1 236  ? -64.69900 -45.66500 -57.41100 1.000 71.49511  ? 236  PHE A CE1   1 
ATOM   1564  C  CE2   . PHE A 1 236  ? -65.74300 -45.02700 -55.36000 1.000 66.10445  ? 236  PHE A CE2   1 
ATOM   1565  C  CZ    . PHE A 1 236  ? -65.61900 -44.89600 -56.72800 1.000 65.53770  ? 236  PHE A CZ    1 
ATOM   1566  N  N     . GLY A 1 237  ? -61.86200 -50.78800 -54.39000 1.000 67.12013  ? 237  GLY A N     1 
ATOM   1567  C  CA    . GLY A 1 237  ? -61.12100 -51.75500 -53.60400 1.000 72.53624  ? 237  GLY A CA    1 
ATOM   1568  C  C     . GLY A 1 237  ? -59.69800 -51.92500 -54.08400 1.000 75.60854  ? 237  GLY A C     1 
ATOM   1569  O  O     . GLY A 1 237  ? -59.35400 -51.60500 -55.22700 1.000 76.71740  ? 237  GLY A O     1 
ATOM   1570  N  N     . SER A 1 238  ? -58.86800 -52.43400 -53.17800 1.000 70.52300  ? 238  SER A N     1 
ATOM   1571  C  CA    . SER A 1 238  ? -57.49500 -52.80300 -53.48200 1.000 64.04125  ? 238  SER A CA    1 
ATOM   1572  C  C     . SER A 1 238  ? -57.14000 -54.01400 -52.63000 1.000 77.30507  ? 238  SER A C     1 
ATOM   1573  O  O     . SER A 1 238  ? -57.98100 -54.55700 -51.90800 1.000 83.21647  ? 238  SER A O     1 
ATOM   1574  C  CB    . SER A 1 238  ? -56.53600 -51.63300 -53.23400 1.000 72.17620  ? 238  SER A CB    1 
ATOM   1575  O  OG    . SER A 1 238  ? -56.34300 -51.41500 -51.84700 1.000 73.65719  ? 238  SER A OG    1 
ATOM   1576  N  N     . GLU A 1 239  ? -55.87800 -54.43700 -52.71200 1.000 84.20574  ? 239  GLU A N     1 
ATOM   1577  C  CA    . GLU A 1 239  ? -55.42500 -55.57300 -51.91900 1.000 82.77242  ? 239  GLU A CA    1 
ATOM   1578  C  C     . GLU A 1 239  ? -55.34900 -55.26200 -50.43000 1.000 84.70371  ? 239  GLU A C     1 
ATOM   1579  O  O     . GLU A 1 239  ? -55.10800 -56.17900 -49.63700 1.000 92.80398  ? 239  GLU A O     1 
ATOM   1580  C  CB    . GLU A 1 239  ? -54.05800 -56.04800 -52.41700 1.000 83.29046  ? 239  GLU A CB    1 
ATOM   1581  C  CG    . GLU A 1 239  ? -54.01600 -56.36900 -53.90200 1.000 102.14464 ? 239  GLU A CG    1 
ATOM   1582  C  CD    . GLU A 1 239  ? -53.80400 -57.84600 -54.17400 1.000 121.26161 ? 239  GLU A CD    1 
ATOM   1583  O  OE1   . GLU A 1 239  ? -54.21100 -58.67200 -53.33000 1.000 119.10982 ? 239  GLU A OE1   1 
ATOM   1584  O  OE2   . GLU A 1 239  ? -53.22800 -58.18000 -55.23100 1.000 118.83969 ? 239  GLU A OE2   1 
ATOM   1585  N  N     . ARG A 1 240  ? -55.55300 -54.00800 -50.03300 1.000 75.94808  ? 240  ARG A N     1 
ATOM   1586  C  CA    . ARG A 1 240  ? -55.45900 -53.59700 -48.64000 1.000 74.00187  ? 240  ARG A CA    1 
ATOM   1587  C  C     . ARG A 1 240  ? -56.76600 -53.09000 -48.05100 1.000 76.44599  ? 240  ARG A C     1 
ATOM   1588  O  O     . ARG A 1 240  ? -57.00200 -53.29500 -46.85800 1.000 74.49071  ? 240  ARG A O     1 
ATOM   1589  C  CB    . ARG A 1 240  ? -54.39700 -52.49700 -48.48000 1.000 72.79015  ? 240  ARG A CB    1 
ATOM   1590  C  CG    . ARG A 1 240  ? -52.96400 -52.99900 -48.45000 1.000 70.06931  ? 240  ARG A CG    1 
ATOM   1591  C  CD    . ARG A 1 240  ? -51.98100 -51.83900 -48.39100 1.000 72.68168  ? 240  ARG A CD    1 
ATOM   1592  N  NE    . ARG A 1 240  ? -52.24500 -50.94300 -47.26800 1.000 66.31626  ? 240  ARG A NE    1 
ATOM   1593  C  CZ    . ARG A 1 240  ? -51.58300 -50.97200 -46.11700 1.000 65.79926  ? 240  ARG A CZ    1 
ATOM   1594  N  NH1   . ARG A 1 240  ? -50.61000 -51.85400 -45.93000 1.000 62.55313  ? 240  ARG A NH1   1 
ATOM   1595  N  NH2   . ARG A 1 240  ? -51.89100 -50.11700 -45.15200 1.000 66.88744  ? 240  ARG A NH2   1 
ATOM   1596  N  N     . MET A 1 241  ? -57.61900 -52.44100 -48.84200 1.000 73.16526  ? 241  MET A N     1 
ATOM   1597  C  CA    . MET A 1 241  ? -58.78200 -51.75800 -48.29500 1.000 72.12131  ? 241  MET A CA    1 
ATOM   1598  C  C     . MET A 1 241  ? -59.91100 -51.74600 -49.31600 1.000 77.08375  ? 241  MET A C     1 
ATOM   1599  O  O     . MET A 1 241  ? -59.67400 -51.56000 -50.51200 1.000 76.15795  ? 241  MET A O     1 
ATOM   1600  C  CB    . MET A 1 241  ? -58.42400 -50.32300 -47.88600 1.000 72.38292  ? 241  MET A CB    1 
ATOM   1601  C  CG    . MET A 1 241  ? -59.61700 -49.41500 -47.63200 1.000 75.42569  ? 241  MET A CG    1 
ATOM   1602  S  SD    . MET A 1 241  ? -59.13400 -47.69100 -47.42500 1.000 90.72488  ? 241  MET A SD    1 
ATOM   1603  C  CE    . MET A 1 241  ? -58.15700 -47.78600 -45.92800 1.000 76.76815  ? 241  MET A CE    1 
ATOM   1604  N  N     . MET A 1 242  ? -61.13500 -51.94700 -48.83200 1.000 78.96163  ? 242  MET A N     1 
ATOM   1605  C  CA    . MET A 1 242  ? -62.34100 -51.80800 -49.63400 1.000 72.22057  ? 242  MET A CA    1 
ATOM   1606  C  C     . MET A 1 242  ? -63.07200 -50.53000 -49.24100 1.000 67.56670  ? 242  MET A C     1 
ATOM   1607  O  O     . MET A 1 242  ? -63.02500 -50.09800 -48.08600 1.000 76.40529  ? 242  MET A O     1 
ATOM   1608  C  CB    . MET A 1 242  ? -63.26400 -53.01800 -49.46400 1.000 74.95075  ? 242  MET A CB    1 
ATOM   1609  C  CG    . MET A 1 242  ? -62.62300 -54.34300 -49.84800 1.000 87.92970  ? 242  MET A CG    1 
ATOM   1610  S  SD    . MET A 1 242  ? -63.65500 -55.32200 -50.95500 1.000 116.68609 ? 242  MET A SD    1 
ATOM   1611  C  CE    . MET A 1 242  ? -63.62400 -54.30700 -52.43100 1.000 84.08469  ? 242  MET A CE    1 
ATOM   1612  N  N     . TRP A 1 243  ? -63.75400 -49.92800 -50.21500 1.000 66.15562  ? 243  TRP A N     1 
ATOM   1613  C  CA    . TRP A 1 243  ? -64.36800 -48.61500 -50.05300 1.000 61.60292  ? 243  TRP A CA    1 
ATOM   1614  C  C     . TRP A 1 243  ? -65.77900 -48.66600 -50.61800 1.000 67.00072  ? 243  TRP A C     1 
ATOM   1615  O  O     . TRP A 1 243  ? -65.96100 -48.93600 -51.81000 1.000 68.31167  ? 243  TRP A O     1 
ATOM   1616  C  CB    . TRP A 1 243  ? -63.53400 -47.54100 -50.76100 1.000 64.03785  ? 243  TRP A CB    1 
ATOM   1617  C  CG    . TRP A 1 243  ? -64.05800 -46.14100 -50.64900 1.000 65.95064  ? 243  TRP A CG    1 
ATOM   1618  C  CD1   . TRP A 1 243  ? -65.17200 -45.62500 -51.24700 1.000 65.93038  ? 243  TRP A CD1   1 
ATOM   1619  C  CD2   . TRP A 1 243  ? -63.46100 -45.06300 -49.91800 1.000 63.41028  ? 243  TRP A CD2   1 
ATOM   1620  N  NE1   . TRP A 1 243  ? -65.31500 -44.29900 -50.91700 1.000 67.90968  ? 243  TRP A NE1   1 
ATOM   1621  C  CE2   . TRP A 1 243  ? -64.27700 -43.93000 -50.10300 1.000 65.74929  ? 243  TRP A CE2   1 
ATOM   1622  C  CE3   . TRP A 1 243  ? -62.31900 -44.94900 -49.12000 1.000 59.74883  ? 243  TRP A CE3   1 
ATOM   1623  C  CZ2   . TRP A 1 243  ? -63.98400 -42.69900 -49.52200 1.000 64.21683  ? 243  TRP A CZ2   1 
ATOM   1624  C  CZ3   . TRP A 1 243  ? -62.03500 -43.72800 -48.53900 1.000 61.91753  ? 243  TRP A CZ3   1 
ATOM   1625  C  CH2   . TRP A 1 243  ? -62.86500 -42.62000 -48.74200 1.000 64.12554  ? 243  TRP A CH2   1 
ATOM   1626  N  N     . PHE A 1 244  ? -66.77100 -48.40300 -49.77100 1.000 67.84092  ? 244  PHE A N     1 
ATOM   1627  C  CA    . PHE A 1 244  ? -68.17200 -48.41100 -50.16900 1.000 66.10094  ? 244  PHE A CA    1 
ATOM   1628  C  C     . PHE A 1 244  ? -68.75100 -47.01400 -50.00900 1.000 65.07134  ? 244  PHE A C     1 
ATOM   1629  O  O     . PHE A 1 244  ? -68.65600 -46.41800 -48.93100 1.000 64.10703  ? 244  PHE A O     1 
ATOM   1630  C  CB    . PHE A 1 244  ? -68.97600 -49.41700 -49.34100 1.000 63.35869  ? 244  PHE A CB    1 
ATOM   1631  C  CG    . PHE A 1 244  ? -68.44200 -50.81700 -49.40500 1.000 63.24052  ? 244  PHE A CG    1 
ATOM   1632  C  CD1   . PHE A 1 244  ? -68.61100 -51.58400 -50.54600 1.000 67.42752  ? 244  PHE A CD1   1 
ATOM   1633  C  CD2   . PHE A 1 244  ? -67.77400 -51.36800 -48.32500 1.000 63.43738  ? 244  PHE A CD2   1 
ATOM   1634  C  CE1   . PHE A 1 244  ? -68.12100 -52.87400 -50.61000 1.000 67.44972  ? 244  PHE A CE1   1 
ATOM   1635  C  CE2   . PHE A 1 244  ? -67.28100 -52.65800 -48.38200 1.000 64.58515  ? 244  PHE A CE2   1 
ATOM   1636  C  CZ    . PHE A 1 244  ? -67.45500 -53.41200 -49.52600 1.000 71.04260  ? 244  PHE A CZ    1 
ATOM   1637  N  N     . SER A 1 245  ? -69.35300 -46.49700 -51.08300 1.000 59.58664  ? 245  SER A N     1 
ATOM   1638  C  CA    . SER A 1 245  ? -69.97400 -45.17500 -51.09900 1.000 64.30059  ? 245  SER A CA    1 
ATOM   1639  C  C     . SER A 1 245  ? -71.46600 -45.33900 -51.36900 1.000 77.08892  ? 245  SER A C     1 
ATOM   1640  O  O     . SER A 1 245  ? -71.91900 -45.20900 -52.51700 1.000 83.85869  ? 245  SER A O     1 
ATOM   1641  C  CB    . SER A 1 245  ? -69.32500 -44.26400 -52.13900 1.000 73.63154  ? 245  SER A CB    1 
ATOM   1642  O  OG    . SER A 1 245  ? -67.99700 -43.93300 -51.77200 1.000 81.03187  ? 245  SER A OG    1 
ATOM   1643  N  N     . PRO A 1 246  ? -72.25900 -45.62800 -50.33900 1.000 72.53915  ? 246  PRO A N     1 
ATOM   1644  C  CA    . PRO A 1 246  ? -73.71000 -45.69600 -50.53400 1.000 68.25898  ? 246  PRO A CA    1 
ATOM   1645  C  C     . PRO A 1 246  ? -74.30200 -44.30600 -50.69500 1.000 74.42969  ? 246  PRO A C     1 
ATOM   1646  O  O     . PRO A 1 246  ? -73.93800 -43.36800 -49.98200 1.000 76.68997  ? 246  PRO A O     1 
ATOM   1647  C  CB    . PRO A 1 246  ? -74.20500 -46.37500 -49.25400 1.000 76.40310  ? 246  PRO A CB    1 
ATOM   1648  C  CG    . PRO A 1 246  ? -73.19500 -45.97900 -48.22800 1.000 73.55218  ? 246  PRO A CG    1 
ATOM   1649  C  CD    . PRO A 1 246  ? -71.87300 -45.92500 -48.94900 1.000 72.47193  ? 246  PRO A CD    1 
ATOM   1650  N  N     . VAL A 1 247  ? -75.21900 -44.17800 -51.65200 1.000 79.02990  ? 247  VAL A N     1 
ATOM   1651  C  CA    . VAL A 1 247  ? -75.85200 -42.89700 -51.94800 1.000 84.71800  ? 247  VAL A CA    1 
ATOM   1652  C  C     . VAL A 1 247  ? -77.27700 -42.80500 -51.42600 1.000 91.28327  ? 247  VAL A C     1 
ATOM   1653  O  O     . VAL A 1 247  ? -77.86900 -41.71400 -51.48100 1.000 92.88470  ? 247  VAL A O     1 
ATOM   1654  C  CB    . VAL A 1 247  ? -75.82500 -42.59100 -53.46000 1.000 74.13281  ? 247  VAL A CB    1 
ATOM   1655  C  CG1   . VAL A 1 247  ? -74.39100 -42.53900 -53.96200 1.000 80.11524  ? 247  VAL A CG1   1 
ATOM   1656  C  CG2   . VAL A 1 247  ? -76.61300 -43.63400 -54.21500 1.000 78.21265  ? 247  VAL A CG2   1 
ATOM   1657  N  N     . THR A 1 248  ? -77.84800 -43.89700 -50.92600 1.000 90.80053  ? 248  THR A N     1 
ATOM   1658  C  CA    . THR A 1 248  ? -79.17600 -43.88700 -50.33300 1.000 87.06860  ? 248  THR A CA    1 
ATOM   1659  C  C     . THR A 1 248  ? -79.08000 -44.30100 -48.87200 1.000 89.82885  ? 248  THR A C     1 
ATOM   1660  O  O     . THR A 1 248  ? -78.19200 -45.06800 -48.48500 1.000 81.45969  ? 248  THR A O     1 
ATOM   1661  C  CB    . THR A 1 248  ? -80.13600 -44.82900 -51.07100 1.000 83.92750  ? 248  THR A CB    1 
ATOM   1662  O  OG1   . THR A 1 248  ? -79.72200 -46.18400 -50.87600 1.000 78.52409  ? 248  THR A OG1   1 
ATOM   1663  C  CG2   . THR A 1 248  ? -80.13100 -44.52900 -52.55500 1.000 85.19836  ? 248  THR A CG2   1 
ATOM   1664  N  N     . LEU A 1 249  ? -80.00400 -43.78200 -48.06000 1.000 88.56842  ? 249  LEU A N     1 
ATOM   1665  C  CA    . LEU A 1 249  ? -80.00100 -44.10900 -46.63700 1.000 81.34659  ? 249  LEU A CA    1 
ATOM   1666  C  C     . LEU A 1 249  ? -80.23000 -45.59800 -46.41300 1.000 83.76963  ? 249  LEU A C     1 
ATOM   1667  O  O     . LEU A 1 249  ? -79.66700 -46.18800 -45.48300 1.000 85.24341  ? 249  LEU A O     1 
ATOM   1668  C  CB    . LEU A 1 249  ? -81.06000 -43.28300 -45.90700 1.000 83.94398  ? 249  LEU A CB    1 
ATOM   1669  C  CG    . LEU A 1 249  ? -81.30500 -43.62700 -44.43600 1.000 83.91719  ? 249  LEU A CG    1 
ATOM   1670  C  CD1   . LEU A 1 249  ? -80.02400 -43.48700 -43.62400 1.000 84.06678  ? 249  LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A 1 249  ? -82.40800 -42.75800 -43.85700 1.000 82.06359  ? 249  LEU A CD2   1 
ATOM   1672  N  N     . LYS A 1 250  ? -81.05200 -46.22500 -47.25900 1.000 85.86439  ? 250  LYS A N     1 
ATOM   1673  C  CA    . LYS A 1 250  ? -81.28000 -47.66300 -47.14200 1.000 83.49833  ? 250  LYS A CA    1 
ATOM   1674  C  C     . LYS A 1 250  ? -79.98500 -48.44000 -47.34300 1.000 84.12734  ? 250  LYS A C     1 
ATOM   1675  O  O     . LYS A 1 250  ? -79.66200 -49.34500 -46.56500 1.000 83.97992  ? 250  LYS A O     1 
ATOM   1676  C  CB    . LYS A 1 250  ? -82.33700 -48.11300 -48.15100 1.000 75.42471  ? 250  LYS A CB    1 
ATOM   1677  C  CG    . LYS A 1 250  ? -82.32000 -49.61000 -48.41900 1.000 73.92289  ? 250  LYS A CG    1 
ATOM   1678  C  CD    . LYS A 1 250  ? -83.53100 -50.06200 -49.21600 1.000 82.78789  ? 250  LYS A CD    1 
ATOM   1679  C  CE    . LYS A 1 250  ? -83.46700 -51.55500 -49.49800 1.000 92.46190  ? 250  LYS A CE    1 
ATOM   1680  N  NZ    . LYS A 1 250  ? -84.74700 -52.08200 -50.04600 1.000 85.01343  ? 250  LYS A NZ    1 
ATOM   1681  N  N     . GLU A 1 251  ? -79.22600 -48.09600 -48.38600 1.000 82.90872  ? 251  GLU A N     1 
ATOM   1682  C  CA    . GLU A 1 251  ? -77.98200 -48.80900 -48.65800 1.000 81.55223  ? 251  GLU A CA    1 
ATOM   1683  C  C     . GLU A 1 251  ? -76.94200 -48.54000 -47.57700 1.000 80.34001  ? 251  GLU A C     1 
ATOM   1684  O  O     . GLU A 1 251  ? -76.19600 -49.44800 -47.19000 1.000 80.50967  ? 251  GLU A O     1 
ATOM   1685  C  CB    . GLU A 1 251  ? -77.44100 -48.41800 -50.03200 1.000 86.98513  ? 251  GLU A CB    1 
ATOM   1686  C  CG    . GLU A 1 251  ? -78.26900 -48.92800 -51.20400 1.000 95.93581  ? 251  GLU A CG    1 
ATOM   1687  C  CD    . GLU A 1 251  ? -78.04400 -50.40000 -51.48700 1.000 105.23084 ? 251  GLU A CD    1 
ATOM   1688  O  OE1   . GLU A 1 251  ? -76.87200 -50.81600 -51.60000 1.000 93.90852  ? 251  GLU A OE1   1 
ATOM   1689  O  OE2   . GLU A 1 251  ? -79.04300 -51.14000 -51.60700 1.000 109.73399 ? 251  GLU A OE2   1 
ATOM   1690  N  N     . LEU A 1 252  ? -76.87700 -47.30200 -47.07800 1.000 75.24357  ? 252  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1 252  ? -75.91500 -46.97400 -46.02900 1.000 74.34245  ? 252  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1 252  ? -76.15300 -47.81200 -44.78000 1.000 78.87023  ? 252  LEU A C     1 
ATOM   1693  O  O     . LEU A 1 252  ? -75.20200 -48.31700 -44.17200 1.000 75.25055  ? 252  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1 252  ? -75.98800 -45.48300 -45.69900 1.000 74.57844  ? 252  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1 252  ? -75.27900 -45.00800 -44.42600 1.000 61.22186  ? 252  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1 252  ? -73.79500 -45.34800 -44.45800 1.000 66.58423  ? 252  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1 252  ? -75.48200 -43.51400 -44.22700 1.000 63.08948  ? 252  LEU A CD2   1 
ATOM   1698  N  N     . LEU A 1 253  ? -77.41800 -47.97400 -44.38500 1.000 78.61550  ? 253  LEU A N     1 
ATOM   1699  C  CA    . LEU A 1 253  ? -77.73000 -48.80600 -43.22800 1.000 80.98794  ? 253  LEU A CA    1 
ATOM   1700  C  C     . LEU A 1 253  ? -77.34000 -50.25800 -43.46400 1.000 79.21655  ? 253  LEU A C     1 
ATOM   1701  O  O     . LEU A 1 253  ? -77.00500 -50.97400 -42.51400 1.000 73.42767  ? 253  LEU A O     1 
ATOM   1702  C  CB    . LEU A 1 253  ? -79.21800 -48.70300 -42.89700 1.000 81.84304  ? 253  LEU A CB    1 
ATOM   1703  C  CG    . LEU A 1 253  ? -79.67500 -47.37500 -42.29200 1.000 78.75402  ? 253  LEU A CG    1 
ATOM   1704  C  CD1   . LEU A 1 253  ? -81.19200 -47.32800 -42.18700 1.000 88.01459  ? 253  LEU A CD1   1 
ATOM   1705  C  CD2   . LEU A 1 253  ? -79.02800 -47.15300 -40.93500 1.000 78.97069  ? 253  LEU A CD2   1 
ATOM   1706  N  N     . GLU A 1 254  ? -77.37400 -50.70800 -44.72000 1.000 82.47912  ? 254  GLU A N     1 
ATOM   1707  C  CA    . GLU A 1 254  ? -76.99300 -52.08300 -45.02400 1.000 84.59168  ? 254  GLU A CA    1 
ATOM   1708  C  C     . GLU A 1 254  ? -75.49000 -52.28400 -44.88100 1.000 83.27039  ? 254  GLU A C     1 
ATOM   1709  O  O     . GLU A 1 254  ? -75.04200 -53.32600 -44.38600 1.000 84.52584  ? 254  GLU A O     1 
ATOM   1710  C  CB    . GLU A 1 254  ? -77.45400 -52.45600 -46.43300 1.000 82.16173  ? 254  GLU A CB    1 
ATOM   1711  C  CG    . GLU A 1 254  ? -78.44600 -53.60500 -46.47700 1.000 91.17558  ? 254  GLU A CG    1 
ATOM   1712  C  CD    . GLU A 1 254  ? -77.85500 -54.90400 -45.96400 1.000 106.95011 ? 254  GLU A CD    1 
ATOM   1713  O  OE1   . GLU A 1 254  ? -78.60700 -55.70800 -45.37400 1.000 103.30605 ? 254  GLU A OE1   1 
ATOM   1714  O  OE2   . GLU A 1 254  ? -76.64000 -55.12400 -46.15400 1.000 109.29818 ? 254  GLU A OE2   1 
ATOM   1715  N  N     . PHE A 1 255  ? -74.69400 -51.30000 -45.30700 1.000 76.40039  ? 255  PHE A N     1 
ATOM   1716  C  CA    . PHE A 1 255  ? -73.24500 -51.43500 -45.20600 1.000 75.55746  ? 255  PHE A CA    1 
ATOM   1717  C  C     . PHE A 1 255  ? -72.77400 -51.29900 -43.76400 1.000 74.40949  ? 255  PHE A C     1 
ATOM   1718  O  O     . PHE A 1 255  ? -71.83100 -51.98100 -43.34800 1.000 74.11503  ? 255  PHE A O     1 
ATOM   1719  C  CB    . PHE A 1 255  ? -72.55400 -50.40600 -46.10000 1.000 72.04151  ? 255  PHE A CB    1 
ATOM   1720  C  CG    . PHE A 1 255  ? -72.58300 -50.75800 -47.55900 1.000 68.37172  ? 255  PHE A CG    1 
ATOM   1721  C  CD1   . PHE A 1 255  ? -71.74600 -51.73800 -48.06300 1.000 68.37755  ? 255  PHE A CD1   1 
ATOM   1722  C  CD2   . PHE A 1 255  ? -73.44400 -50.10900 -48.42700 1.000 69.36419  ? 255  PHE A CD2   1 
ATOM   1723  C  CE1   . PHE A 1 255  ? -71.77000 -52.06700 -49.40400 1.000 68.04736  ? 255  PHE A CE1   1 
ATOM   1724  C  CE2   . PHE A 1 255  ? -73.47200 -50.43300 -49.76900 1.000 76.04569  ? 255  PHE A CE2   1 
ATOM   1725  C  CZ    . PHE A 1 255  ? -72.63300 -51.41300 -50.25800 1.000 69.32990  ? 255  PHE A CZ    1 
ATOM   1726  N  N     . LYS A 1 256  ? -73.41600 -50.42400 -42.98600 1.000 74.56852  ? 256  LYS A N     1 
ATOM   1727  C  CA    . LYS A 1 256  ? -73.07500 -50.31100 -41.57300 1.000 76.49171  ? 256  LYS A CA    1 
ATOM   1728  C  C     . LYS A 1 256  ? -73.42100 -51.57700 -40.80100 1.000 79.87215  ? 256  LYS A C     1 
ATOM   1729  O  O     . LYS A 1 256  ? -72.83600 -51.82200 -39.74000 1.000 84.34940  ? 256  LYS A O     1 
ATOM   1730  C  CB    . LYS A 1 256  ? -73.78200 -49.10600 -40.95000 1.000 71.13180  ? 256  LYS A CB    1 
ATOM   1731  C  CG    . LYS A 1 256  ? -73.19100 -48.66500 -39.61800 1.000 76.43291  ? 256  LYS A CG    1 
ATOM   1732  C  CD    . LYS A 1 256  ? -71.75000 -48.20500 -39.78400 1.000 77.42313  ? 256  LYS A CD    1 
ATOM   1733  C  CE    . LYS A 1 256  ? -70.89400 -48.60700 -38.59300 1.000 70.09803  ? 256  LYS A CE    1 
ATOM   1734  N  NZ    . LYS A 1 256  ? -71.44400 -48.10200 -37.30600 1.000 67.90623  ? 256  LYS A NZ    1 
ATOM   1735  N  N     . PHE A 1 257  ? -74.35200 -52.38600 -41.31000 1.000 81.05855  ? 257  PHE A N     1 
ATOM   1736  C  CA    . PHE A 1 257  ? -74.67100 -53.65100 -40.65800 1.000 87.44410  ? 257  PHE A CA    1 
ATOM   1737  C  C     . PHE A 1 257  ? -73.70100 -54.75200 -41.07200 1.000 90.15803  ? 257  PHE A C     1 
ATOM   1738  O  O     . PHE A 1 257  ? -73.28000 -55.55600 -40.23300 1.000 89.66333  ? 257  PHE A O     1 
ATOM   1739  C  CB    . PHE A 1 257  ? -76.10900 -54.06200 -40.97800 1.000 91.84073  ? 257  PHE A CB    1 
ATOM   1740  C  CG    . PHE A 1 257  ? -76.56400 -55.29000 -40.24200 1.000 101.20650 ? 257  PHE A CG    1 
ATOM   1741  C  CD1   . PHE A 1 257  ? -77.13700 -55.18700 -38.98500 1.000 94.56680  ? 257  PHE A CD1   1 
ATOM   1742  C  CD2   . PHE A 1 257  ? -76.41300 -56.54800 -40.80300 1.000 103.85419 ? 257  PHE A CD2   1 
ATOM   1743  C  CE1   . PHE A 1 257  ? -77.55400 -56.31300 -38.30400 1.000 93.93751  ? 257  PHE A CE1   1 
ATOM   1744  C  CE2   . PHE A 1 257  ? -76.82500 -57.67800 -40.12600 1.000 103.95888 ? 257  PHE A CE2   1 
ATOM   1745  C  CZ    . PHE A 1 257  ? -77.39800 -57.56000 -38.87500 1.000 108.23414 ? 257  PHE A CZ    1 
ATOM   1746  N  N     . LYS A 1 258  ? -73.34700 -54.80700 -42.36000 1.000 86.70252  ? 258  LYS A N     1 
ATOM   1747  C  CA    . LYS A 1 258  ? -72.41500 -55.82500 -42.83700 1.000 82.44732  ? 258  LYS A CA    1 
ATOM   1748  C  C     . LYS A 1 258  ? -71.07800 -55.72800 -42.11300 1.000 83.58285  ? 258  LYS A C     1 
ATOM   1749  O  O     . LYS A 1 258  ? -70.57300 -56.72100 -41.57600 1.000 80.19298  ? 258  LYS A O     1 
ATOM   1750  C  CB    . LYS A 1 258  ? -72.21000 -55.68400 -44.34600 1.000 81.31654  ? 258  LYS A CB    1 
ATOM   1751  C  CG    . LYS A 1 258  ? -73.27700 -56.33100 -45.20800 1.000 85.29468  ? 258  LYS A CG    1 
ATOM   1752  C  CD    . LYS A 1 258  ? -72.90900 -56.20900 -46.67900 1.000 89.91120  ? 258  LYS A CD    1 
ATOM   1753  C  CE    . LYS A 1 258  ? -73.98400 -56.79200 -47.57900 1.000 97.92995  ? 258  LYS A CE    1 
ATOM   1754  N  NZ    . LYS A 1 258  ? -73.71300 -56.49900 -49.01500 1.000 102.12863 ? 258  LYS A NZ    1 
ATOM   1755  N  N     . TYR A 1 259  ? -70.48700 -54.53100 -42.09200 1.000 82.47432  ? 259  TYR A N     1 
ATOM   1756  C  CA    . TYR A 1 259  ? -69.19700 -54.27800 -41.45500 1.000 80.30270  ? 259  TYR A CA    1 
ATOM   1757  C  C     . TYR A 1 259  ? -69.40900 -53.23900 -40.36100 1.000 83.59831  ? 259  TYR A C     1 
ATOM   1758  O  O     . TYR A 1 259  ? -69.18700 -52.03800 -40.57700 1.000 84.94208  ? 259  TYR A O     1 
ATOM   1759  C  CB    . TYR A 1 259  ? -68.15100 -53.81400 -42.46900 1.000 76.88102  ? 259  TYR A CB    1 
ATOM   1760  C  CG    . TYR A 1 259  ? -68.25700 -54.49500 -43.81700 1.000 73.00553  ? 259  TYR A CG    1 
ATOM   1761  C  CD1   . TYR A 1 259  ? -69.12100 -54.01700 -44.79400 1.000 72.77541  ? 259  TYR A CD1   1 
ATOM   1762  C  CD2   . TYR A 1 259  ? -67.50500 -55.62600 -44.10500 1.000 68.11899  ? 259  TYR A CD2   1 
ATOM   1763  C  CE1   . TYR A 1 259  ? -69.22500 -54.63900 -46.02300 1.000 74.73112  ? 259  TYR A CE1   1 
ATOM   1764  C  CE2   . TYR A 1 259  ? -67.60300 -56.25600 -45.33100 1.000 62.24481  ? 259  TYR A CE2   1 
ATOM   1765  C  CZ    . TYR A 1 259  ? -68.46500 -55.75900 -46.28600 1.000 72.71000  ? 259  TYR A CZ    1 
ATOM   1766  O  OH    . TYR A 1 259  ? -68.56800 -56.38000 -47.50900 1.000 80.18432  ? 259  TYR A OH    1 
ATOM   1767  N  N     . PRO A 1 260  ? -69.84600 -53.66500 -39.17300 1.000 87.08961  ? 260  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 260  ? -70.06700 -52.69500 -38.08900 1.000 80.68902  ? 260  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 260  ? -68.80300 -51.97600 -37.65900 1.000 80.53053  ? 260  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 260  ? -68.87500 -50.81800 -37.22800 1.000 89.71193  ? 260  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 260  ? -70.63500 -53.56500 -36.95700 1.000 84.05233  ? 260  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 260  ? -70.19000 -54.95300 -37.27500 1.000 87.11345  ? 260  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 260  ? -70.18300 -55.03900 -38.76800 1.000 87.68356  ? 260  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 261  ? -67.64300 -52.62600 -37.76900 1.000 74.49564  ? 261  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 261  ? -66.39000 -52.01400 -37.34900 1.000 71.64360  ? 261  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 261  ? -65.89000 -50.96200 -38.32800 1.000 74.53560  ? 261  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 261  ? -65.07800 -50.11300 -37.94200 1.000 64.80096  ? 261  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 261  ? -65.31700 -53.08800 -37.16400 1.000 77.72332  ? 261  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 261  ? -65.38300 -53.83100 -35.83400 1.000 89.43187  ? 261  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 261  ? -65.83300 -52.95000 -34.68200 1.000 94.91777  ? 261  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 261  ? -67.02700 -52.83200 -34.40300 1.000 93.45816  ? 261  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 261  ? -64.87400 -52.32600 -34.00500 1.000 91.43503  ? 261  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1 262  ? -66.34800 -50.99800 -39.57300 1.000 75.40452  ? 262  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1 262  ? -65.89600 -50.03100 -40.56500 1.000 72.50905  ? 262  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1 262  ? -66.37800 -48.63400 -40.19100 1.000 71.89035  ? 262  ALA A C     1 
ATOM   1786  O  O     . ALA A 1 262  ? -67.57800 -48.43700 -39.96500 1.000 78.57147  ? 262  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1 262  ? -66.40800 -50.40900 -41.95300 1.000 71.19887  ? 262  ALA A CB    1 
ATOM   1788  N  N     . PRO A 1 263  ? -65.48900 -47.64800 -40.11300 1.000 70.85757  ? 263  PRO A N     1 
ATOM   1789  C  CA    . PRO A 1 263  ? -65.92500 -46.28800 -39.78400 1.000 72.43946  ? 263  PRO A CA    1 
ATOM   1790  C  C     . PRO A 1 263  ? -66.66100 -45.64400 -40.94800 1.000 72.10387  ? 263  PRO A C     1 
ATOM   1791  O  O     . PRO A 1 263  ? -66.56700 -46.07100 -42.10100 1.000 70.77217  ? 263  PRO A O     1 
ATOM   1792  C  CB    . PRO A 1 263  ? -64.61300 -45.55700 -39.48500 1.000 71.39025  ? 263  PRO A CB    1 
ATOM   1793  C  CG    . PRO A 1 263  ? -63.59900 -46.29100 -40.28900 1.000 77.98851  ? 263  PRO A CG    1 
ATOM   1794  C  CD    . PRO A 1 263  ? -64.02800 -47.73400 -40.28400 1.000 76.81496  ? 263  PRO A CD    1 
ATOM   1795  N  N     . VAL A 1 264  ? -67.40600 -44.59200 -40.62400 1.000 70.11772  ? 264  VAL A N     1 
ATOM   1796  C  CA    . VAL A 1 264  ? -68.18600 -43.84100 -41.59900 1.000 66.55569  ? 264  VAL A CA    1 
ATOM   1797  C  C     . VAL A 1 264  ? -67.43600 -42.53800 -41.85800 1.000 68.49412  ? 264  VAL A C     1 
ATOM   1798  O  O     . VAL A 1 264  ? -67.55100 -41.57600 -41.09500 1.000 76.23799  ? 264  VAL A O     1 
ATOM   1799  C  CB    . VAL A 1 264  ? -69.61500 -43.59200 -41.11200 1.000 66.95487  ? 264  VAL A CB    1 
ATOM   1800  C  CG1   . VAL A 1 264  ? -70.40500 -42.81800 -42.15300 1.000 63.17381  ? 264  VAL A CG1   1 
ATOM   1801  C  CG2   . VAL A 1 264  ? -70.30100 -44.91200 -40.79100 1.000 66.27497  ? 264  VAL A CG2   1 
ATOM   1802  N  N     . ILE A 1 265  ? -66.66600 -42.50300 -42.94100 1.000 64.66741  ? 265  ILE A N     1 
ATOM   1803  C  CA    . ILE A 1 265  ? -65.82900 -41.34800 -43.24400 1.000 62.80353  ? 265  ILE A CA    1 
ATOM   1804  C  C     . ILE A 1 265  ? -66.70500 -40.21800 -43.76600 1.000 65.50748  ? 265  ILE A C     1 
ATOM   1805  O  O     . ILE A 1 265  ? -67.51600 -40.41300 -44.67900 1.000 66.91590  ? 265  ILE A O     1 
ATOM   1806  C  CB    . ILE A 1 265  ? -64.73800 -41.71600 -44.26100 1.000 62.47251  ? 265  ILE A CB    1 
ATOM   1807  C  CG1   . ILE A 1 265  ? -63.99000 -42.97200 -43.81100 1.000 67.97556  ? 265  ILE A CG1   1 
ATOM   1808  C  CG2   . ILE A 1 265  ? -63.77000 -40.55700 -44.44700 1.000 61.85943  ? 265  ILE A CG2   1 
ATOM   1809  C  CD1   . ILE A 1 265  ? -63.38900 -42.87300 -42.43400 1.000 62.14072  ? 265  ILE A CD1   1 
ATOM   1810  N  N     . MET A 1 266  ? -66.54200 -39.03000 -43.18500 1.000 63.76838  ? 266  MET A N     1 
ATOM   1811  C  CA    . MET A 1 266  ? -67.27200 -37.85200 -43.63200 1.000 65.94790  ? 266  MET A CA    1 
ATOM   1812  C  C     . MET A 1 266  ? -66.30300 -36.79200 -44.14000 1.000 62.48922  ? 266  MET A C     1 
ATOM   1813  O  O     . MET A 1 266  ? -66.17400 -36.58700 -45.35100 1.000 70.04147  ? 266  MET A O     1 
ATOM   1814  C  CB    . MET A 1 266  ? -68.13200 -37.29100 -42.49900 1.000 69.75373  ? 266  MET A CB    1 
ATOM   1815  C  CG    . MET A 1 266  ? -69.29200 -38.18500 -42.10300 1.000 73.05799  ? 266  MET A CG    1 
ATOM   1816  S  SD    . MET A 1 266  ? -70.44500 -38.45300 -43.46200 1.000 76.45770  ? 266  MET A SD    1 
ATOM   1817  C  CE    . MET A 1 266  ? -71.98900 -38.59200 -42.56800 1.000 75.69494  ? 266  MET A CE    1 
ATOM   1818  N  N     . GLY A 1 267  ? -65.61800 -36.11900 -43.22000 1.000 62.25515  ? 267  GLY A N     1 
ATOM   1819  C  CA    . GLY A 1 267  ? -64.63900 -35.11700 -43.59100 1.000 64.13549  ? 267  GLY A CA    1 
ATOM   1820  C  C     . GLY A 1 267  ? -63.21500 -35.61700 -43.47300 1.000 65.31875  ? 267  GLY A C     1 
ATOM   1821  O  O     . GLY A 1 267  ? -62.28200 -34.97200 -43.96100 1.000 60.80126  ? 267  GLY A O     1 
ATOM   1822  N  N     . ASN A 1 268  ? -63.04300 -36.76600 -42.81700 1.000 59.09311  ? 268  ASN A N     1 
ATOM   1823  C  CA    . ASN A 1 268  ? -61.75200 -37.42400 -42.63400 1.000 61.25671  ? 268  ASN A CA    1 
ATOM   1824  C  C     . ASN A 1 268  ? -60.78700 -36.59500 -41.79100 1.000 65.29087  ? 268  ASN A C     1 
ATOM   1825  O  O     . ASN A 1 268  ? -59.57600 -36.83400 -41.81900 1.000 67.86720  ? 268  ASN A O     1 
ATOM   1826  C  CB    . ASN A 1 268  ? -61.11300 -37.76900 -43.98700 1.000 63.04542  ? 268  ASN A CB    1 
ATOM   1827  C  CG    . ASN A 1 268  ? -60.12100 -38.91300 -43.89500 1.000 66.80744  ? 268  ASN A CG    1 
ATOM   1828  O  OD1   . ASN A 1 268  ? -60.18100 -39.73100 -42.98000 1.000 69.70268  ? 268  ASN A OD1   1 
ATOM   1829  N  ND2   . ASN A 1 268  ? -59.20200 -38.97600 -44.85200 1.000 70.46102  ? 268  ASN A ND2   1 
ATOM   1830  N  N     . THR A 1 269  ? -61.29600 -35.62600 -41.02900 1.000 62.78826  ? 269  THR A N     1 
ATOM   1831  C  CA    . THR A 1 269  ? -60.45200 -34.76500 -40.21000 1.000 62.71483  ? 269  THR A CA    1 
ATOM   1832  C  C     . THR A 1 269  ? -60.16500 -35.34100 -38.83000 1.000 61.44805  ? 269  THR A C     1 
ATOM   1833  O  O     . THR A 1 269  ? -59.36700 -34.75700 -38.08800 1.000 64.49297  ? 269  THR A O     1 
ATOM   1834  C  CB    . THR A 1 269  ? -61.09300 -33.38100 -40.05500 1.000 61.98588  ? 269  THR A CB    1 
ATOM   1835  O  OG1   . THR A 1 269  ? -62.24600 -33.47700 -39.21000 1.000 63.73351  ? 269  THR A OG1   1 
ATOM   1836  C  CG2   . THR A 1 269  ? -61.50700 -32.83000 -41.41100 1.000 60.07175  ? 269  THR A CG2   1 
ATOM   1837  N  N     . SER A 1 270  ? -60.79200 -36.45500 -38.46500 1.000 61.32522  ? 270  SER A N     1 
ATOM   1838  C  CA    . SER A 1 270  ? -60.51500 -37.13900 -37.20700 1.000 66.22140  ? 270  SER A CA    1 
ATOM   1839  C  C     . SER A 1 270  ? -59.78200 -38.45700 -37.39500 1.000 72.37100  ? 270  SER A C     1 
ATOM   1840  O  O     . SER A 1 270  ? -58.82800 -38.73500 -36.66700 1.000 71.46867  ? 270  SER A O     1 
ATOM   1841  C  CB    . SER A 1 270  ? -61.81800 -37.39500 -36.44100 1.000 65.04535  ? 270  SER A CB    1 
ATOM   1842  O  OG    . SER A 1 270  ? -61.58400 -38.18500 -35.28800 1.000 60.74369  ? 270  SER A OG    1 
ATOM   1843  N  N     . VAL A 1 271  ? -60.20800 -39.27200 -38.35600 1.000 68.60147  ? 271  VAL A N     1 
ATOM   1844  C  CA    . VAL A 1 271  ? -59.54100 -40.53800 -38.63100 1.000 67.14394  ? 271  VAL A CA    1 
ATOM   1845  C  C     . VAL A 1 271  ? -58.35200 -40.35800 -39.57600 1.000 75.86139  ? 271  VAL A C     1 
ATOM   1846  O  O     . VAL A 1 271  ? -57.37400 -41.10900 -39.48700 1.000 89.73811  ? 271  VAL A O     1 
ATOM   1847  C  CB    . VAL A 1 271  ? -60.56800 -41.54200 -39.18700 1.000 61.82642  ? 271  VAL A CB    1 
ATOM   1848  C  CG1   . VAL A 1 271  ? -61.38300 -40.89700 -40.28900 1.000 67.24501  ? 271  VAL A CG1   1 
ATOM   1849  C  CG2   . VAL A 1 271  ? -59.89200 -42.81500 -39.68300 1.000 77.74178  ? 271  VAL A CG2   1 
ATOM   1850  N  N     . GLY A 1 272  ? -58.40600 -39.36500 -40.46100 1.000 69.25372  ? 272  GLY A N     1 
ATOM   1851  C  CA    . GLY A 1 272  ? -57.31300 -39.05900 -41.35400 1.000 68.99745  ? 272  GLY A CA    1 
ATOM   1852  C  C     . GLY A 1 272  ? -55.99400 -38.82500 -40.64100 1.000 79.38604  ? 272  GLY A C     1 
ATOM   1853  O  O     . GLY A 1 272  ? -54.99200 -39.49300 -40.92000 1.000 83.88238  ? 272  GLY A O     1 
ATOM   1854  N  N     . PRO A 1 273  ? -55.96000 -37.85900 -39.71700 1.000 76.55992  ? 273  PRO A N     1 
ATOM   1855  C  CA    . PRO A 1 273  ? -54.72900 -37.64600 -38.93700 1.000 76.12470  ? 273  PRO A CA    1 
ATOM   1856  C  C     . PRO A 1 273  ? -54.28600 -38.86800 -38.15000 1.000 85.92907  ? 273  PRO A C     1 
ATOM   1857  O  O     . PRO A 1 273  ? -53.07900 -39.05700 -37.95100 1.000 96.68743  ? 273  PRO A O     1 
ATOM   1858  C  CB    . PRO A 1 273  ? -55.10300 -36.48100 -38.01200 1.000 70.91266  ? 273  PRO A CB    1 
ATOM   1859  C  CG    . PRO A 1 273  ? -56.15600 -35.74300 -38.75800 1.000 64.60943  ? 273  PRO A CG    1 
ATOM   1860  C  CD    . PRO A 1 273  ? -56.94900 -36.79100 -39.48400 1.000 69.65815  ? 273  PRO A CD    1 
ATOM   1861  N  N     . GLU A 1 274  ? -55.22100 -39.70500 -37.69300 1.000 80.37667  ? 274  GLU A N     1 
ATOM   1862  C  CA    . GLU A 1 274  ? -54.83400 -40.91900 -36.98100 1.000 89.05225  ? 274  GLU A CA    1 
ATOM   1863  C  C     . GLU A 1 274  ? -54.21700 -41.94800 -37.91900 1.000 94.09608  ? 274  GLU A C     1 
ATOM   1864  O  O     . GLU A 1 274  ? -53.40500 -42.77200 -37.48400 1.000 95.01416  ? 274  GLU A O     1 
ATOM   1865  C  CB    . GLU A 1 274  ? -56.04000 -41.52100 -36.26000 1.000 90.66530  ? 274  GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1 274  ? -56.71900 -40.57500 -35.28700 1.000 95.72237  ? 274  GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1 274  ? -57.41300 -41.30400 -34.15300 1.000 106.11879 ? 274  GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1 274  ? -56.79500 -41.45800 -33.07800 1.000 105.20375 ? 274  GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1 274  ? -58.57600 -41.72100 -34.33600 1.000 102.55592 ? 274  GLU A OE2   1 
ATOM   1870  N  N     . VAL A 1 275  ? -54.59200 -41.92000 -39.19900 1.000 97.56224  ? 275  VAL A N     1 
ATOM   1871  C  CA    . VAL A 1 275  ? -54.01000 -42.84500 -40.16800 1.000 100.35372 ? 275  VAL A CA    1 
ATOM   1872  C  C     . VAL A 1 275  ? -52.52000 -42.57100 -40.33400 1.000 100.73301 ? 275  VAL A C     1 
ATOM   1873  O  O     . VAL A 1 275  ? -51.70900 -43.49900 -40.44500 1.000 94.92615  ? 275  VAL A O     1 
ATOM   1874  C  CB    . VAL A 1 275  ? -54.76100 -42.74600 -41.51100 1.000 96.74818  ? 275  VAL A CB    1 
ATOM   1875  C  CG1   . VAL A 1 275  ? -53.91900 -43.30600 -42.65000 1.000 93.05911  ? 275  VAL A CG1   1 
ATOM   1876  C  CG2   . VAL A 1 275  ? -56.10000 -43.46400 -41.42600 1.000 98.48269  ? 275  VAL A CG2   1 
ATOM   1877  N  N     . LYS A 1 276  ? -52.13500 -41.29500 -40.32600 1.000 97.93745  ? 276  LYS A N     1 
ATOM   1878  C  CA    . LYS A 1 276  ? -50.75400 -40.92000 -40.61300 1.000 99.42358  ? 276  LYS A CA    1 
ATOM   1879  C  C     . LYS A 1 276  ? -49.83900 -41.17300 -39.41800 1.000 102.39928 ? 276  LYS A C     1 
ATOM   1880  O  O     . LYS A 1 276  ? -48.89300 -41.96300 -39.50300 1.000 93.86926  ? 276  LYS A O     1 
ATOM   1881  C  CB    . LYS A 1 276  ? -50.69400 -39.44900 -41.03400 1.000 98.97836  ? 276  LYS A CB    1 
ATOM   1882  C  CG    . LYS A 1 276  ? -49.64200 -39.13600 -42.08700 1.000 105.98250 ? 276  LYS A CG    1 
ATOM   1883  C  CD    . LYS A 1 276  ? -50.17200 -39.39600 -43.48900 1.000 105.67555 ? 276  LYS A CD    1 
ATOM   1884  C  CE    . LYS A 1 276  ? -49.05100 -39.39300 -44.51600 1.000 85.37425  ? 276  LYS A CE    1 
ATOM   1885  N  NZ    . LYS A 1 276  ? -48.25000 -40.64600 -44.47400 1.000 96.17484  ? 276  LYS A NZ    1 
ATOM   1886  N  N     . PHE A 1 277  ? -50.10800 -40.51000 -38.29200 1.000 106.60596 ? 277  PHE A N     1 
ATOM   1887  C  CA    . PHE A 1 277  ? -49.17500 -40.48300 -37.17300 1.000 108.42517 ? 277  PHE A CA    1 
ATOM   1888  C  C     . PHE A 1 277  ? -49.54400 -41.42200 -36.03100 1.000 114.37482 ? 277  PHE A C     1 
ATOM   1889  O  O     . PHE A 1 277  ? -48.72400 -41.61100 -35.12600 1.000 123.88091 ? 277  PHE A O     1 
ATOM   1890  C  CB    . PHE A 1 277  ? -49.05400 -39.05700 -36.61700 1.000 107.49206 ? 277  PHE A CB    1 
ATOM   1891  C  CG    . PHE A 1 277  ? -49.13000 -37.98500 -37.66600 1.000 109.63455 ? 277  PHE A CG    1 
ATOM   1892  C  CD1   . PHE A 1 277  ? -48.07700 -37.77800 -38.54200 1.000 111.69799 ? 277  PHE A CD1   1 
ATOM   1893  C  CD2   . PHE A 1 277  ? -50.25200 -37.17900 -37.77100 1.000 102.23980 ? 277  PHE A CD2   1 
ATOM   1894  C  CE1   . PHE A 1 277  ? -48.14400 -36.78900 -39.50600 1.000 113.54396 ? 277  PHE A CE1   1 
ATOM   1895  C  CE2   . PHE A 1 277  ? -50.32500 -36.18900 -38.73300 1.000 99.23088  ? 277  PHE A CE2   1 
ATOM   1896  C  CZ    . PHE A 1 277  ? -49.27000 -35.99400 -39.60200 1.000 105.68161 ? 277  PHE A CZ    1 
ATOM   1897  N  N     . LYS A 1 278  ? -50.73800 -42.01100 -36.03700 1.000 106.80389 ? 278  LYS A N     1 
ATOM   1898  C  CA    . LYS A 1 278  ? -51.20400 -42.80200 -34.90400 1.000 105.28876 ? 278  LYS A CA    1 
ATOM   1899  C  C     . LYS A 1 278  ? -51.35300 -44.28500 -35.22600 1.000 104.89963 ? 278  LYS A C     1 
ATOM   1900  O  O     . LYS A 1 278  ? -51.86800 -45.04000 -34.39500 1.000 97.93009  ? 278  LYS A O     1 
ATOM   1901  C  CB    . LYS A 1 278  ? -52.52100 -42.23100 -34.37500 1.000 107.78864 ? 278  LYS A CB    1 
ATOM   1902  C  CG    . LYS A 1 278  ? -52.40200 -40.78500 -33.90600 1.000 111.52333 ? 278  LYS A CG    1 
ATOM   1903  C  CD    . LYS A 1 278  ? -53.72800 -40.23900 -33.40900 1.000 105.94178 ? 278  LYS A CD    1 
ATOM   1904  C  CE    . LYS A 1 278  ? -53.65200 -38.74100 -33.14900 1.000 104.15677 ? 278  LYS A CE    1 
ATOM   1905  N  NZ    . LYS A 1 278  ? -52.72000 -38.40700 -32.03800 1.000 109.06478 ? 278  LYS A NZ    1 
ATOM   1906  N  N     . GLY A 1 279  ? -50.91900 -44.71800 -36.40800 1.000 114.39652 ? 279  GLY A N     1 
ATOM   1907  C  CA    . GLY A 1 279  ? -50.81500 -46.13500 -36.70400 1.000 117.25398 ? 279  GLY A CA    1 
ATOM   1908  C  C     . GLY A 1 279  ? -52.11600 -46.90000 -36.78000 1.000 112.21369 ? 279  GLY A C     1 
ATOM   1909  O  O     . GLY A 1 279  ? -52.11200 -48.12000 -36.60000 1.000 112.19397 ? 279  GLY A O     1 
ATOM   1910  N  N     . VAL A 1 280  ? -53.22800 -46.23000 -37.04500 1.000 109.57582 ? 280  VAL A N     1 
ATOM   1911  C  CA    . VAL A 1 280  ? -54.51200 -46.90500 -37.19100 1.000 102.01439 ? 280  VAL A CA    1 
ATOM   1912  C  C     . VAL A 1 280  ? -54.66000 -47.36100 -38.63600 1.000 105.07555 ? 280  VAL A C     1 
ATOM   1913  O  O     . VAL A 1 280  ? -54.06300 -46.79100 -39.55700 1.000 102.24684 ? 280  VAL A O     1 
ATOM   1914  C  CB    . VAL A 1 280  ? -55.67600 -45.98800 -36.75800 1.000 102.19130 ? 280  VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1 280  ? -55.99100 -44.96600 -37.84100 1.000 104.62179 ? 280  VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1 280  ? -56.91000 -46.81200 -36.41200 1.000 99.21647  ? 280  VAL A CG2   1 
ATOM   1917  N  N     . PHE A 1 281  ? -55.45100 -48.41200 -38.84100 1.000 95.10600  ? 281  PHE A N     1 
ATOM   1918  C  CA    . PHE A 1 281  ? -55.70500 -48.92700 -40.18000 1.000 87.76500  ? 281  PHE A CA    1 
ATOM   1919  C  C     . PHE A 1 281  ? -57.06400 -49.60800 -40.20700 1.000 89.43271  ? 281  PHE A C     1 
ATOM   1920  O  O     . PHE A 1 281  ? -57.35200 -50.45600 -39.35800 1.000 94.60828  ? 281  PHE A O     1 
ATOM   1921  C  CB    . PHE A 1 281  ? -54.61400 -49.90800 -40.62000 1.000 76.18559  ? 281  PHE A CB    1 
ATOM   1922  C  CG    . PHE A 1 281  ? -54.87000 -50.53000 -41.96200 1.000 79.54156  ? 281  PHE A CG    1 
ATOM   1923  C  CD1   . PHE A 1 281  ? -54.80300 -49.76800 -43.11700 1.000 74.88571  ? 281  PHE A CD1   1 
ATOM   1924  C  CD2   . PHE A 1 281  ? -55.18300 -51.87600 -42.07000 1.000 84.54296  ? 281  PHE A CD2   1 
ATOM   1925  C  CE1   . PHE A 1 281  ? -55.04100 -50.33500 -44.35500 1.000 75.95872  ? 281  PHE A CE1   1 
ATOM   1926  C  CE2   . PHE A 1 281  ? -55.42100 -52.45000 -43.30600 1.000 84.03361  ? 281  PHE A CE2   1 
ATOM   1927  C  CZ    . PHE A 1 281  ? -55.35000 -51.67900 -44.44900 1.000 76.83582  ? 281  PHE A CZ    1 
ATOM   1928  N  N     . HIS A 1 282  ? -57.88600 -49.23900 -41.18600 1.000 81.23429  ? 282  HIS A N     1 
ATOM   1929  C  CA    . HIS A 1 282  ? -59.22400 -49.79300 -41.34400 1.000 75.17223  ? 282  HIS A CA    1 
ATOM   1930  C  C     . HIS A 1 282  ? -59.30200 -50.54600 -42.66500 1.000 75.65598  ? 282  HIS A C     1 
ATOM   1931  O  O     . HIS A 1 282  ? -59.14900 -49.92700 -43.73200 1.000 80.41707  ? 282  HIS A O     1 
ATOM   1932  C  CB    . HIS A 1 282  ? -60.27800 -48.68500 -41.29700 1.000 81.06435  ? 282  HIS A CB    1 
ATOM   1933  C  CG    . HIS A 1 282  ? -60.31600 -47.94300 -39.99700 1.000 83.33250  ? 282  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A 1 282  ? -60.37800 -46.56800 -39.92600 1.000 80.26988  ? 282  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A 1 282  ? -60.30400 -48.38500 -38.71700 1.000 86.69103  ? 282  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A 1 282  ? -60.40000 -46.19500 -38.65900 1.000 81.03595  ? 282  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A 1 282  ? -60.35700 -47.27900 -37.90500 1.000 89.81095  ? 282  HIS A NE2   1 
ATOM   1938  N  N     . PRO A 1 283  ? -59.53200 -51.86100 -42.65800 1.000 74.00884  ? 283  PRO A N     1 
ATOM   1939  C  CA    . PRO A 1 283  ? -59.63100 -52.58400 -43.93500 1.000 68.70250  ? 283  PRO A CA    1 
ATOM   1940  C  C     . PRO A 1 283  ? -60.89300 -52.25600 -44.71200 1.000 68.68583  ? 283  PRO A C     1 
ATOM   1941  O  O     . PRO A 1 283  ? -60.87100 -52.29000 -45.94800 1.000 69.95676  ? 283  PRO A O     1 
ATOM   1942  C  CB    . PRO A 1 283  ? -59.59600 -54.05600 -43.50600 1.000 66.30116  ? 283  PRO A CB    1 
ATOM   1943  C  CG    . PRO A 1 283  ? -60.14800 -54.04800 -42.12000 1.000 63.71970  ? 283  PRO A CG    1 
ATOM   1944  C  CD    . PRO A 1 283  ? -59.69000 -52.75600 -41.49800 1.000 74.72146  ? 283  PRO A CD    1 
ATOM   1945  N  N     . VAL A 1 284  ? -61.99000 -51.94100 -44.03100 1.000 69.31162  ? 284  VAL A N     1 
ATOM   1946  C  CA    . VAL A 1 284  ? -63.24900 -51.58600 -44.67300 1.000 68.90256  ? 284  VAL A CA    1 
ATOM   1947  C  C     . VAL A 1 284  ? -63.55600 -50.12900 -44.35700 1.000 68.72279  ? 284  VAL A C     1 
ATOM   1948  O  O     . VAL A 1 284  ? -63.32300 -49.66300 -43.23600 1.000 70.96412  ? 284  VAL A O     1 
ATOM   1949  C  CB    . VAL A 1 284  ? -64.39900 -52.50400 -44.21400 1.000 75.10900  ? 284  VAL A CB    1 
ATOM   1950  C  CG1   . VAL A 1 284  ? -65.60900 -52.33800 -45.12200 1.000 69.90453  ? 284  VAL A CG1   1 
ATOM   1951  C  CG2   . VAL A 1 284  ? -63.94000 -53.95400 -44.18500 1.000 66.22232  ? 284  VAL A CG2   1 
ATOM   1952  N  N     . ILE A 1 285  ? -64.07600 -49.41100 -45.35000 1.000 63.82845  ? 285  ILE A N     1 
ATOM   1953  C  CA    . ILE A 1 285  ? -64.37800 -47.99000 -45.22000 1.000 65.71789  ? 285  ILE A CA    1 
ATOM   1954  C  C     . ILE A 1 285  ? -65.73500 -47.72300 -45.85400 1.000 68.74645  ? 285  ILE A C     1 
ATOM   1955  O  O     . ILE A 1 285  ? -65.98100 -48.12000 -46.99800 1.000 67.46103  ? 285  ILE A O     1 
ATOM   1956  C  CB    . ILE A 1 285  ? -63.29600 -47.11000 -45.87600 1.000 65.46113  ? 285  ILE A CB    1 
ATOM   1957  C  CG1   . ILE A 1 285  ? -62.01700 -47.11000 -45.03700 1.000 71.63736  ? 285  ILE A CG1   1 
ATOM   1958  C  CG2   . ILE A 1 285  ? -63.80900 -45.69600 -46.07300 1.000 62.51960  ? 285  ILE A CG2   1 
ATOM   1959  C  CD1   . ILE A 1 285  ? -62.19000 -46.51000 -43.66100 1.000 76.30721  ? 285  ILE A CD1   1 
ATOM   1960  N  N     . ILE A 1 286  ? -66.61400 -47.05400 -45.11300 1.000 72.45654  ? 286  ILE A N     1 
ATOM   1961  C  CA    . ILE A 1 286  ? -67.90700 -46.60900 -45.61900 1.000 67.32373  ? 286  ILE A CA    1 
ATOM   1962  C  C     . ILE A 1 286  ? -67.87700 -45.08900 -45.68500 1.000 62.82779  ? 286  ILE A C     1 
ATOM   1963  O  O     . ILE A 1 286  ? -67.62700 -44.42100 -44.67500 1.000 62.89565  ? 286  ILE A O     1 
ATOM   1964  C  CB    . ILE A 1 286  ? -69.06600 -47.10100 -44.73800 1.000 61.24141  ? 286  ILE A CB    1 
ATOM   1965  C  CG1   . ILE A 1 286  ? -68.90500 -48.58800 -44.42300 1.000 66.69201  ? 286  ILE A CG1   1 
ATOM   1966  C  CG2   . ILE A 1 286  ? -70.40000 -46.84100 -45.42300 1.000 65.20349  ? 286  ILE A CG2   1 
ATOM   1967  C  CD1   . ILE A 1 286  ? -69.88900 -49.10200 -43.39700 1.000 67.06758  ? 286  ILE A CD1   1 
ATOM   1968  N  N     . SER A 1 287  ? -68.12300 -44.54200 -46.87300 1.000 58.95470  ? 287  SER A N     1 
ATOM   1969  C  CA    . SER A 1 287  ? -68.14400 -43.09600 -47.08700 1.000 66.13448  ? 287  SER A CA    1 
ATOM   1970  C  C     . SER A 1 287  ? -69.40800 -42.74400 -47.85700 1.000 67.70069  ? 287  SER A C     1 
ATOM   1971  O  O     . SER A 1 287  ? -69.42000 -42.76000 -49.09500 1.000 66.06975  ? 287  SER A O     1 
ATOM   1972  C  CB    . SER A 1 287  ? -66.89800 -42.62400 -47.82900 1.000 69.83857  ? 287  SER A CB    1 
ATOM   1973  O  OG    . SER A 1 287  ? -67.10300 -41.35000 -48.41500 1.000 70.34430  ? 287  SER A OG    1 
ATOM   1974  N  N     . PRO A 1 288  ? -70.48900 -42.41500 -47.15800 1.000 62.79261  ? 288  PRO A N     1 
ATOM   1975  C  CA    . PRO A 1 288  ? -71.74100 -42.09600 -47.84800 1.000 67.96843  ? 288  PRO A CA    1 
ATOM   1976  C  C     . PRO A 1 288  ? -71.62900 -40.80100 -48.63400 1.000 74.21879  ? 288  PRO A C     1 
ATOM   1977  O  O     . PRO A 1 288  ? -70.89600 -39.88000 -48.26500 1.000 74.55389  ? 288  PRO A O     1 
ATOM   1978  C  CB    . PRO A 1 288  ? -72.75000 -41.96500 -46.70200 1.000 70.97618  ? 288  PRO A CB    1 
ATOM   1979  C  CG    . PRO A 1 288  ? -71.91600 -41.53800 -45.53800 1.000 63.52343  ? 288  PRO A CG    1 
ATOM   1980  C  CD    . PRO A 1 288  ? -70.61400 -42.27600 -45.69700 1.000 65.16263  ? 288  PRO A CD    1 
ATOM   1981  N  N     . ASP A 1 289  ? -72.36900 -40.74300 -49.73900 1.000 79.09702  ? 289  ASP A N     1 
ATOM   1982  C  CA    . ASP A 1 289  ? -72.45100 -39.52200 -50.52900 1.000 83.99337  ? 289  ASP A CA    1 
ATOM   1983  C  C     . ASP A 1 289  ? -73.44200 -38.57200 -49.87000 1.000 93.02041  ? 289  ASP A C     1 
ATOM   1984  O  O     . ASP A 1 289  ? -73.78000 -38.75000 -48.69500 1.000 92.23796  ? 289  ASP A O     1 
ATOM   1985  C  CB    . ASP A 1 289  ? -72.86200 -39.83600 -51.96900 1.000 90.07267  ? 289  ASP A CB    1 
ATOM   1986  C  CG    . ASP A 1 289  ? -72.34600 -38.81200 -52.96000 1.000 101.21295 ? 289  ASP A CG    1 
ATOM   1987  O  OD1   . ASP A 1 289  ? -71.97400 -37.70000 -52.52900 1.000 98.83125  ? 289  ASP A OD1   1 
ATOM   1988  O  OD2   . ASP A 1 289  ? -72.31200 -39.12000 -54.17100 1.000 97.50603  ? 289  ASP A OD2   1 
ATOM   1989  N  N     . ARG A 1 290  ? -73.91800 -37.56600 -50.59900 1.000 95.10755  ? 290  ARG A N     1 
ATOM   1990  C  CA    . ARG A 1 290  ? -74.90900 -36.65800 -50.03400 1.000 97.62407  ? 290  ARG A CA    1 
ATOM   1991  C  C     . ARG A 1 290  ? -76.23800 -37.38900 -49.89200 1.000 99.39659  ? 290  ARG A C     1 
ATOM   1992  O  O     . ARG A 1 290  ? -76.89000 -37.71200 -50.89100 1.000 97.38816  ? 290  ARG A O     1 
ATOM   1993  C  CB    . ARG A 1 290  ? -75.07200 -35.41000 -50.89400 1.000 109.98695 ? 290  ARG A CB    1 
ATOM   1994  C  CG    . ARG A 1 290  ? -76.04300 -34.41900 -50.27000 1.000 112.27204 ? 290  ARG A CG    1 
ATOM   1995  C  CD    . ARG A 1 290  ? -76.82600 -33.62600 -51.30000 1.000 108.18063 ? 290  ARG A CD    1 
ATOM   1996  N  NE    . ARG A 1 290  ? -78.03500 -33.05100 -50.71400 1.000 114.02043 ? 290  ARG A NE    1 
ATOM   1997  C  CZ    . ARG A 1 290  ? -78.05300 -32.01400 -49.88200 1.000 117.88648 ? 290  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG A 1 290  ? -76.92200 -31.41900 -49.52700 1.000 112.82804 ? 290  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG A 1 290  ? -79.20700 -31.57100 -49.40100 1.000 107.55742 ? 290  ARG A NH2   1 
ATOM   2000  N  N     . ILE A 1 291  ? -76.63800 -37.65200 -48.65200 1.000 100.22903 ? 291  ILE A N     1 
ATOM   2001  C  CA    . ILE A 1 291  ? -77.91400 -38.28300 -48.34000 1.000 94.54063  ? 291  ILE A CA    1 
ATOM   2002  C  C     . ILE A 1 291  ? -78.83000 -37.21500 -47.76200 1.000 97.04645  ? 291  ILE A C     1 
ATOM   2003  O  O     . ILE A 1 291  ? -78.45500 -36.51500 -46.81300 1.000 99.27004  ? 291  ILE A O     1 
ATOM   2004  C  CB    . ILE A 1 291  ? -77.73800 -39.45600 -47.36100 1.000 87.55301  ? 291  ILE A CB    1 
ATOM   2005  C  CG1   . ILE A 1 291  ? -76.86900 -40.54600 -47.99600 1.000 83.16402  ? 291  ILE A CG1   1 
ATOM   2006  C  CG2   . ILE A 1 291  ? -79.09400 -40.01100 -46.94700 1.000 89.19834  ? 291  ILE A CG2   1 
ATOM   2007  C  CD1   . ILE A 1 291  ? -77.00200 -41.90700 -47.34500 1.000 83.79498  ? 291  ILE A CD1   1 
ATOM   2008  N  N     . GLU A 1 292  ? -80.02700 -37.08300 -48.34100 1.000 98.18417  ? 292  GLU A N     1 
ATOM   2009  C  CA    . GLU A 1 292  ? -80.93700 -36.02100 -47.92100 1.000 95.48655  ? 292  GLU A CA    1 
ATOM   2010  C  C     . GLU A 1 292  ? -81.35300 -36.17600 -46.46400 1.000 91.07558  ? 292  GLU A C     1 
ATOM   2011  O  O     . GLU A 1 292  ? -81.55000 -35.17400 -45.76600 1.000 90.10209  ? 292  GLU A O     1 
ATOM   2012  C  CB    . GLU A 1 292  ? -82.16900 -35.99700 -48.82700 1.000 96.10404  ? 292  GLU A CB    1 
ATOM   2013  C  CG    . GLU A 1 292  ? -82.69600 -34.60000 -49.12200 1.000 107.69448 ? 292  GLU A CG    1 
ATOM   2014  C  CD    . GLU A 1 292  ? -81.68000 -33.72700 -49.83800 1.000 115.13477 ? 292  GLU A CD    1 
ATOM   2015  O  OE1   . GLU A 1 292  ? -80.88400 -34.26600 -50.63600 1.000 111.08897 ? 292  GLU A OE1   1 
ATOM   2016  O  OE2   . GLU A 1 292  ? -81.67600 -32.50100 -49.59900 1.000 115.44784 ? 292  GLU A OE2   1 
ATOM   2017  N  N     . GLU A 1 293  ? -81.48800 -37.41500 -45.98400 1.000 89.85783  ? 293  GLU A N     1 
ATOM   2018  C  CA    . GLU A 1 293  ? -81.86500 -37.63400 -44.59300 1.000 87.29597  ? 293  GLU A CA    1 
ATOM   2019  C  C     . GLU A 1 293  ? -80.74900 -37.26900 -43.62300 1.000 87.66764  ? 293  GLU A C     1 
ATOM   2020  O  O     . GLU A 1 293  ? -81.02900 -37.00300 -42.45000 1.000 88.49487  ? 293  GLU A O     1 
ATOM   2021  C  CB    . GLU A 1 293  ? -82.27900 -39.09200 -44.37500 1.000 86.41224  ? 293  GLU A CB    1 
ATOM   2022  C  CG    . GLU A 1 293  ? -83.60700 -39.47800 -45.01200 1.000 90.29692  ? 293  GLU A CG    1 
ATOM   2023  C  CD    . GLU A 1 293  ? -83.48100 -39.79200 -46.49000 1.000 96.36928  ? 293  GLU A CD    1 
ATOM   2024  O  OE1   . GLU A 1 293  ? -84.35200 -39.35100 -47.27000 1.000 96.38949  ? 293  GLU A OE1   1 
ATOM   2025  O  OE2   . GLU A 1 293  ? -82.51200 -40.48100 -46.87200 1.000 98.73088  ? 293  GLU A OE2   1 
ATOM   2026  N  N     . LEU A 1 294  ? -79.49800 -37.24700 -44.08200 1.000 87.40207  ? 294  LEU A N     1 
ATOM   2027  C  CA    . LEU A 1 294  ? -78.36100 -36.95300 -43.21900 1.000 77.93078  ? 294  LEU A CA    1 
ATOM   2028  C  C     . LEU A 1 294  ? -78.01100 -35.47100 -43.16500 1.000 80.66195  ? 294  LEU A C     1 
ATOM   2029  O  O     . LEU A 1 294  ? -77.22100 -35.07000 -42.30400 1.000 76.56140  ? 294  LEU A O     1 
ATOM   2030  C  CB    . LEU A 1 294  ? -77.13200 -37.74600 -43.67700 1.000 69.44582  ? 294  LEU A CB    1 
ATOM   2031  C  CG    . LEU A 1 294  ? -76.71500 -38.92300 -42.79400 1.000 75.08947  ? 294  LEU A CG    1 
ATOM   2032  C  CD1   . LEU A 1 294  ? -77.83000 -39.95300 -42.70600 1.000 84.20379  ? 294  LEU A CD1   1 
ATOM   2033  C  CD2   . LEU A 1 294  ? -75.43900 -39.55700 -43.32100 1.000 72.49249  ? 294  LEU A CD2   1 
ATOM   2034  N  N     . SER A 1 295  ? -78.57000 -34.65400 -44.05600 1.000 84.87682  ? 295  SER A N     1 
ATOM   2035  C  CA    . SER A 1 295  ? -78.28200 -33.22500 -44.06300 1.000 81.90893  ? 295  SER A CA    1 
ATOM   2036  C  C     . SER A 1 295  ? -79.56500 -32.41900 -43.91000 1.000 85.58990  ? 295  SER A C     1 
ATOM   2037  O  O     . SER A 1 295  ? -79.86700 -31.55600 -44.74000 1.000 87.66626  ? 295  SER A O     1 
ATOM   2038  C  CB    . SER A 1 295  ? -77.55400 -32.83200 -45.35000 1.000 89.93755  ? 295  SER A CB    1 
ATOM   2039  O  OG    . SER A 1 295  ? -78.31600 -33.17800 -46.49400 1.000 105.63825 ? 295  SER A OG    1 
ATOM   2040  N  N     . VAL A 1 296  ? -80.32000 -32.69100 -42.85100 1.000 92.36785  ? 296  VAL A N     1 
ATOM   2041  C  CA    . VAL A 1 296  ? -81.61200 -32.05800 -42.61400 1.000 91.49922  ? 296  VAL A CA    1 
ATOM   2042  C  C     . VAL A 1 296  ? -81.44400 -30.94000 -41.59500 1.000 82.24772  ? 296  VAL A C     1 
ATOM   2043  O  O     . VAL A 1 296  ? -80.73400 -31.09300 -40.59300 1.000 86.50465  ? 296  VAL A O     1 
ATOM   2044  C  CB    . VAL A 1 296  ? -82.65500 -33.09300 -42.14300 1.000 93.56131  ? 296  VAL A CB    1 
ATOM   2045  C  CG1   . VAL A 1 296  ? -82.12200 -33.89600 -40.96400 1.000 80.09220  ? 296  VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A 1 296  ? -83.97100 -32.41400 -41.78700 1.000 102.96074 ? 296  VAL A CG2   1 
ATOM   2047  N  N     . VAL A 1 297  ? -82.08500 -29.80500 -41.86200 1.000 81.59770  ? 297  VAL A N     1 
ATOM   2048  C  CA    . VAL A 1 297  ? -82.13900 -28.67900 -40.93800 1.000 84.21818  ? 297  VAL A CA    1 
ATOM   2049  C  C     . VAL A 1 297  ? -83.59300 -28.22900 -40.84200 1.000 88.53564  ? 297  VAL A C     1 
ATOM   2050  O  O     . VAL A 1 297  ? -84.13800 -27.65300 -41.79200 1.000 86.31909  ? 297  VAL A O     1 
ATOM   2051  C  CB    . VAL A 1 297  ? -81.21200 -27.52600 -41.36200 1.000 77.35097  ? 297  VAL A CB    1 
ATOM   2052  C  CG1   . VAL A 1 297  ? -81.37400 -27.19100 -42.84200 1.000 73.89204  ? 297  VAL A CG1   1 
ATOM   2053  C  CG2   . VAL A 1 297  ? -81.47900 -26.29200 -40.51100 1.000 82.62366  ? 297  VAL A CG2   1 
ATOM   2054  N  N     . ASN A 1 298  ? -84.22800 -28.51100 -39.70700 1.000 92.31959  ? 298  ASN A N     1 
ATOM   2055  C  CA    . ASN A 1 298  ? -85.62300 -28.16600 -39.48800 1.000 101.64662 ? 298  ASN A CA    1 
ATOM   2056  C  C     . ASN A 1 298  ? -85.75100 -27.25900 -38.27100 1.000 103.81176 ? 298  ASN A C     1 
ATOM   2057  O  O     . ASN A 1 298  ? -85.00200 -27.38400 -37.29700 1.000 94.19947  ? 298  ASN A O     1 
ATOM   2058  C  CB    . ASN A 1 298  ? -86.49200 -29.42300 -39.30900 1.000 101.34097 ? 298  ASN A CB    1 
ATOM   2059  C  CG    . ASN A 1 298  ? -86.30900 -30.07500 -37.95200 1.000 104.96679 ? 298  ASN A CG    1 
ATOM   2060  O  OD1   . ASN A 1 298  ? -85.19900 -30.14400 -37.42800 1.000 106.18394 ? 298  ASN A OD1   1 
ATOM   2061  N  ND2   . ASN A 1 298  ? -87.40500 -30.55400 -37.37500 1.000 102.85734 ? 298  ASN A ND2   1 
ATOM   2062  N  N     . HIS A 1 299  ? -86.70400 -26.33400 -38.34400 1.000 107.33957 ? 299  HIS A N     1 
ATOM   2063  C  CA    . HIS A 1 299  ? -86.98100 -25.39600 -37.26000 1.000 105.71504 ? 299  HIS A CA    1 
ATOM   2064  C  C     . HIS A 1 299  ? -88.22700 -25.88800 -36.53300 1.000 108.84268 ? 299  HIS A C     1 
ATOM   2065  O  O     . HIS A 1 299  ? -89.35400 -25.60300 -36.94500 1.000 113.26133 ? 299  HIS A O     1 
ATOM   2066  C  CB    . HIS A 1 299  ? -87.15800 -23.98100 -37.80100 1.000 101.49251 ? 299  HIS A CB    1 
ATOM   2067  C  CG    . HIS A 1 299  ? -86.02100 -23.51700 -38.65700 1.000 105.80165 ? 299  HIS A CG    1 
ATOM   2068  N  ND1   . HIS A 1 299  ? -84.77100 -23.23600 -38.14700 1.000 102.91244 ? 299  HIS A ND1   1 
ATOM   2069  C  CD2   . HIS A 1 299  ? -85.94200 -23.28800 -39.98900 1.000 107.48281 ? 299  HIS A CD2   1 
ATOM   2070  C  CE1   . HIS A 1 299  ? -83.97300 -22.85200 -39.12700 1.000 98.26419  ? 299  HIS A CE1   1 
ATOM   2071  N  NE2   . HIS A 1 299  ? -84.66000 -22.87500 -40.25600 1.000 99.98239  ? 299  HIS A NE2   1 
ATOM   2072  N  N     . ALA A 1 300  ? -88.01900 -26.63300 -35.45100 1.000 105.39388 ? 300  ALA A N     1 
ATOM   2073  C  CA    . ALA A 1 300  ? -89.11300 -27.22400 -34.69900 1.000 104.70294 ? 300  ALA A CA    1 
ATOM   2074  C  C     . ALA A 1 300  ? -89.63800 -26.24100 -33.65400 1.000 108.86743 ? 300  ALA A C     1 
ATOM   2075  O  O     . ALA A 1 300  ? -89.17900 -25.10200 -33.54000 1.000 108.63892 ? 300  ALA A O     1 
ATOM   2076  C  CB    . ALA A 1 300  ? -88.66500 -28.53200 -34.04900 1.000 98.38440  ? 300  ALA A CB    1 
ATOM   2077  N  N     . TYR A 1 301  ? -90.62200 -26.69400 -32.87600 1.000 110.48560 ? 301  TYR A N     1 
ATOM   2078  C  CA    . TYR A 1 301  ? -91.21000 -25.85500 -31.83800 1.000 109.43963 ? 301  TYR A CA    1 
ATOM   2079  C  C     . TYR A 1 301  ? -90.39800 -25.90900 -30.54900 1.000 108.23979 ? 301  TYR A C     1 
ATOM   2080  O  O     . TYR A 1 301  ? -90.22300 -24.88400 -29.88000 1.000 108.27602 ? 301  TYR A O     1 
ATOM   2081  C  CB    . TYR A 1 301  ? -92.65500 -26.28700 -31.58200 1.000 106.62260 ? 301  TYR A CB    1 
ATOM   2082  C  CG    . TYR A 1 301  ? -93.49300 -25.27200 -30.83800 1.000 105.20057 ? 301  TYR A CG    1 
ATOM   2083  C  CD1   . TYR A 1 301  ? -93.52000 -25.24800 -29.44900 1.000 104.86081 ? 301  TYR A CD1   1 
ATOM   2084  C  CD2   . TYR A 1 301  ? -94.26400 -24.34200 -31.52400 1.000 97.86893  ? 301  TYR A CD2   1 
ATOM   2085  C  CE1   . TYR A 1 301  ? -94.28800 -24.32500 -28.76400 1.000 96.99979  ? 301  TYR A CE1   1 
ATOM   2086  C  CE2   . TYR A 1 301  ? -95.03500 -23.41500 -30.84800 1.000 102.94482 ? 301  TYR A CE2   1 
ATOM   2087  C  CZ    . TYR A 1 301  ? -95.04300 -23.41100 -29.46900 1.000 97.07104  ? 301  TYR A CZ    1 
ATOM   2088  O  OH    . TYR A 1 301  ? -95.80900 -22.49100 -28.79100 1.000 96.22456  ? 301  TYR A OH    1 
ATOM   2089  N  N     . ASN A 1 302  ? -89.89600 -27.09100 -30.18900 1.000 102.99141 ? 302  ASN A N     1 
ATOM   2090  C  CA    . ASN A 1 302  ? -89.10400 -27.24200 -28.97500 1.000 102.37192 ? 302  ASN A CA    1 
ATOM   2091  C  C     . ASN A 1 302  ? -87.64400 -26.85900 -29.18000 1.000 101.89681 ? 302  ASN A C     1 
ATOM   2092  O  O     . ASN A 1 302  ? -86.96400 -26.51200 -28.20800 1.000 100.68130 ? 302  ASN A O     1 
ATOM   2093  C  CB    . ASN A 1 302  ? -89.20000 -28.68400 -28.46900 1.000 105.23520 ? 302  ASN A CB    1 
ATOM   2094  C  CG    . ASN A 1 302  ? -88.48900 -28.88800 -27.14700 1.000 113.18486 ? 302  ASN A CG    1 
ATOM   2095  O  OD1   . ASN A 1 302  ? -87.64400 -29.77400 -27.01300 1.000 114.82414 ? 302  ASN A OD1   1 
ATOM   2096  N  ND2   . ASN A 1 302  ? -88.83000 -28.06900 -26.15800 1.000 104.84994 ? 302  ASN A ND2   1 
ATOM   2097  N  N     . GLY A 1 303  ? -87.15200 -26.90800 -30.41500 1.000 103.29561 ? 303  GLY A N     1 
ATOM   2098  C  CA    . GLY A 1 303  ? -85.77800 -26.55400 -30.71200 1.000 100.03712 ? 303  GLY A CA    1 
ATOM   2099  C  C     . GLY A 1 303  ? -85.46100 -26.70800 -32.18500 1.000 97.55539  ? 303  GLY A C     1 
ATOM   2100  O  O     . GLY A 1 303  ? -86.31500 -26.44800 -33.03700 1.000 99.07966  ? 303  GLY A O     1 
ATOM   2101  N  N     . LEU A 1 304  ? -84.23700 -27.12300 -32.50000 1.000 87.15009  ? 304  LEU A N     1 
ATOM   2102  C  CA    . LEU A 1 304  ? -83.85200 -27.43700 -33.86700 1.000 85.93643  ? 304  LEU A CA    1 
ATOM   2103  C  C     . LEU A 1 304  ? -83.09700 -28.75700 -33.88900 1.000 88.71898  ? 304  LEU A C     1 
ATOM   2104  O  O     . LEU A 1 304  ? -82.38300 -29.10100 -32.94200 1.000 83.36154  ? 304  LEU A O     1 
ATOM   2105  C  CB    . LEU A 1 304  ? -82.99600 -26.32100 -34.50100 1.000 81.92612  ? 304  LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1 304  ? -81.89300 -25.62400 -33.69800 1.000 83.10720  ? 304  LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1 304  ? -80.64900 -26.49100 -33.53900 1.000 87.60156  ? 304  LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1 304  ? -81.53500 -24.29200 -34.34100 1.000 75.72432  ? 304  LEU A CD2   1 
ATOM   2109  N  N     . THR A 1 305  ? -83.27300 -29.50100 -34.97700 1.000 90.87318  ? 305  THR A N     1 
ATOM   2110  C  CA    . THR A 1 305  ? -82.57900 -30.76400 -35.19400 1.000 87.19602  ? 305  THR A CA    1 
ATOM   2111  C  C     . THR A 1 305  ? -81.74800 -30.64000 -36.46200 1.000 85.59205  ? 305  THR A C     1 
ATOM   2112  O  O     . THR A 1 305  ? -82.28200 -30.31300 -37.52700 1.000 80.21867  ? 305  THR A O     1 
ATOM   2113  C  CB    . THR A 1 305  ? -83.56400 -31.93200 -35.30300 1.000 90.60704  ? 305  THR A CB    1 
ATOM   2114  O  OG1   . THR A 1 305  ? -84.14400 -31.95000 -36.61300 1.000 101.04662 ? 305  THR A OG1   1 
ATOM   2115  C  CG2   . THR A 1 305  ? -84.67300 -31.79300 -34.26900 1.000 88.66030  ? 305  THR A CG2   1 
ATOM   2116  N  N     . LEU A 1 306  ? -80.44700 -30.89100 -36.34400 1.000 86.57344  ? 306  LEU A N     1 
ATOM   2117  C  CA    . LEU A 1 306  ? -79.51200 -30.74500 -37.44900 1.000 76.69388  ? 306  LEU A CA    1 
ATOM   2118  C  C     . LEU A 1 306  ? -78.93900 -32.10200 -37.82500 1.000 77.59442  ? 306  LEU A C     1 
ATOM   2119  O  O     . LEU A 1 306  ? -78.58500 -32.90000 -36.95200 1.000 79.69621  ? 306  LEU A O     1 
ATOM   2120  C  CB    . LEU A 1 306  ? -78.37900 -29.78200 -37.08800 1.000 73.32622  ? 306  LEU A CB    1 
ATOM   2121  C  CG    . LEU A 1 306  ? -78.83800 -28.40100 -36.62400 1.000 69.84940  ? 306  LEU A CG    1 
ATOM   2122  C  CD1   . LEU A 1 306  ? -77.64700 -27.51600 -36.29000 1.000 65.91693  ? 306  LEU A CD1   1 
ATOM   2123  C  CD2   . LEU A 1 306  ? -79.72000 -27.76300 -37.68100 1.000 64.24102  ? 306  LEU A CD2   1 
ATOM   2124  N  N     . GLY A 1 307  ? -78.84300 -32.35300 -39.12800 1.000 77.52951  ? 307  GLY A N     1 
ATOM   2125  C  CA    . GLY A 1 307  ? -78.34500 -33.63200 -39.59400 1.000 79.29237  ? 307  GLY A CA    1 
ATOM   2126  C  C     . GLY A 1 307  ? -76.87400 -33.82800 -39.27600 1.000 77.23190  ? 307  GLY A C     1 
ATOM   2127  O  O     . GLY A 1 307  ? -76.09600 -32.87800 -39.17900 1.000 77.83415  ? 307  GLY A O     1 
ATOM   2128  N  N     . ALA A 1 308  ? -76.49300 -35.09600 -39.11400 1.000 72.48164  ? 308  ALA A N     1 
ATOM   2129  C  CA    . ALA A 1 308  ? -75.11200 -35.44100 -38.79900 1.000 71.00241  ? 308  ALA A CA    1 
ATOM   2130  C  C     . ALA A 1 308  ? -74.17300 -35.26900 -39.98500 1.000 75.32899  ? 308  ALA A C     1 
ATOM   2131  O  O     . ALA A 1 308  ? -72.95300 -35.34800 -39.80100 1.000 77.88919  ? 308  ALA A O     1 
ATOM   2132  C  CB    . ALA A 1 308  ? -75.03800 -36.88000 -38.28800 1.000 73.05162  ? 308  ALA A CB    1 
ATOM   2133  N  N     . GLY A 1 309  ? -74.70100 -35.04000 -41.18400 1.000 73.41144  ? 309  GLY A N     1 
ATOM   2134  C  CA    . GLY A 1 309  ? -73.89400 -34.84900 -42.36800 1.000 71.91927  ? 309  GLY A CA    1 
ATOM   2135  C  C     . GLY A 1 309  ? -73.53700 -33.41800 -42.68800 1.000 68.69421  ? 309  GLY A C     1 
ATOM   2136  O  O     . GLY A 1 309  ? -72.79500 -33.17400 -43.64500 1.000 73.31961  ? 309  GLY A O     1 
ATOM   2137  N  N     . LEU A 1 310  ? -74.04300 -32.45700 -41.92100 1.000 70.99067  ? 310  LEU A N     1 
ATOM   2138  C  CA    . LEU A 1 310  ? -73.72500 -31.05600 -42.15100 1.000 68.40183  ? 310  LEU A CA    1 
ATOM   2139  C  C     . LEU A 1 310  ? -72.32000 -30.74300 -41.65700 1.000 66.72405  ? 310  LEU A C     1 
ATOM   2140  O  O     . LEU A 1 310  ? -71.87100 -31.27400 -40.63700 1.000 69.26190  ? 310  LEU A O     1 
ATOM   2141  C  CB    . LEU A 1 310  ? -74.73600 -30.15300 -41.44300 1.000 73.14017  ? 310  LEU A CB    1 
ATOM   2142  C  CG    . LEU A 1 310  ? -76.19800 -30.28100 -41.87000 1.000 77.23423  ? 310  LEU A CG    1 
ATOM   2143  C  CD1   . LEU A 1 310  ? -77.10700 -29.57400 -40.87700 1.000 70.79073  ? 310  LEU A CD1   1 
ATOM   2144  C  CD2   . LEU A 1 310  ? -76.39700 -29.72700 -43.27200 1.000 76.97438  ? 310  LEU A CD2   1 
ATOM   2145  N  N     . SER A 1 311  ? -71.62700 -29.87500 -42.38600 1.000 65.09116  ? 311  SER A N     1 
ATOM   2146  C  CA    . SER A 1 311  ? -70.30700 -29.43700 -41.96500 1.000 61.27856  ? 311  SER A CA    1 
ATOM   2147  C  C     . SER A 1 311  ? -70.42600 -28.39700 -40.85800 1.000 66.20963  ? 311  SER A C     1 
ATOM   2148  O  O     . SER A 1 311  ? -71.42600 -27.68000 -40.75500 1.000 75.49651  ? 311  SER A O     1 
ATOM   2149  C  CB    . SER A 1 311  ? -69.52200 -28.86200 -43.14500 1.000 60.58416  ? 311  SER A CB    1 
ATOM   2150  O  OG    . SER A 1 311  ? -70.16000 -27.71600 -43.67800 1.000 60.80611  ? 311  SER A OG    1 
ATOM   2151  N  N     . LEU A 1 312  ? -69.38800 -28.32400 -40.02000 1.000 66.28888  ? 312  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1 312  ? -69.38900 -27.35900 -38.92400 1.000 64.07427  ? 312  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1 312  ? -69.51000 -25.93000 -39.43600 1.000 66.35480  ? 312  LEU A C     1 
ATOM   2154  O  O     . LEU A 1 312  ? -70.06000 -25.06700 -38.74200 1.000 68.31610  ? 312  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1 312  ? -68.12300 -27.51900 -38.08000 1.000 54.74387  ? 312  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1 312  ? -67.83500 -28.92600 -37.55300 1.000 52.46269  ? 312  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1 312  ? -66.58600 -28.93000 -36.68700 1.000 55.06365  ? 312  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1 312  ? -69.02600 -29.46000 -36.77600 1.000 61.57822  ? 312  LEU A CD2   1 
ATOM   2159  N  N     . ALA A 1 313  ? -69.00900 -25.66100 -40.64400 1.000 59.81914  ? 313  ALA A N     1 
ATOM   2160  C  CA    . ALA A 1 313  ? -69.18100 -24.33900 -41.23600 1.000 72.19517  ? 313  ALA A CA    1 
ATOM   2161  C  C     . ALA A 1 313  ? -70.63900 -24.08200 -41.59500 1.000 78.97122  ? 313  ALA A C     1 
ATOM   2162  O  O     . ALA A 1 313  ? -71.13800 -22.96400 -41.42500 1.000 80.90967  ? 313  ALA A O     1 
ATOM   2163  C  CB    . ALA A 1 313  ? -68.28800 -24.19500 -42.46800 1.000 73.19075  ? 313  ALA A CB    1 
ATOM   2164  N  N     . GLN A 1 314  ? -71.33900 -25.10500 -42.09500 1.000 73.78279  ? 314  GLN A N     1 
ATOM   2165  C  CA    . GLN A 1 314  ? -72.76200 -24.95300 -42.38300 1.000 73.78204  ? 314  GLN A CA    1 
ATOM   2166  C  C     . GLN A 1 314  ? -73.56900 -24.77100 -41.10400 1.000 76.43583  ? 314  GLN A C     1 
ATOM   2167  O  O     . GLN A 1 314  ? -74.53000 -23.99400 -41.07600 1.000 78.00136  ? 314  GLN A O     1 
ATOM   2168  C  CB    . GLN A 1 314  ? -73.27800 -26.16100 -43.16400 1.000 72.30076  ? 314  GLN A CB    1 
ATOM   2169  C  CG    . GLN A 1 314  ? -72.80700 -26.23600 -44.60400 1.000 77.03070  ? 314  GLN A CG    1 
ATOM   2170  C  CD    . GLN A 1 314  ? -73.26800 -27.50500 -45.29300 1.000 81.09553  ? 314  GLN A CD    1 
ATOM   2171  O  OE1   . GLN A 1 314  ? -72.94000 -28.61200 -44.86500 1.000 80.78105  ? 314  GLN A OE1   1 
ATOM   2172  N  NE2   . GLN A 1 314  ? -74.03800 -27.35100 -46.36400 1.000 90.72211  ? 314  GLN A NE2   1 
ATOM   2173  N  N     . VAL A 1 315  ? -73.19500 -25.48400 -40.03900 1.000 71.66531  ? 315  VAL A N     1 
ATOM   2174  C  CA    . VAL A 1 315  ? -73.92900 -25.39100 -38.78000 1.000 67.87243  ? 315  VAL A CA    1 
ATOM   2175  C  C     . VAL A 1 315  ? -73.87500 -23.97000 -38.23400 1.000 73.38201  ? 315  VAL A C     1 
ATOM   2176  O  O     . VAL A 1 315  ? -74.89000 -23.42200 -37.79000 1.000 79.41566  ? 315  VAL A O     1 
ATOM   2177  C  CB    . VAL A 1 315  ? -73.38100 -26.41100 -37.76400 1.000 71.18169  ? 315  VAL A CB    1 
ATOM   2178  C  CG1   . VAL A 1 315  ? -73.91700 -26.11900 -36.37100 1.000 65.26737  ? 315  VAL A CG1   1 
ATOM   2179  C  CG2   . VAL A 1 315  ? -73.74200 -27.82700 -38.18900 1.000 73.95110  ? 315  VAL A CG2   1 
ATOM   2180  N  N     . LYS A 1 316  ? -72.69600 -23.34500 -38.27000 1.000 72.74008  ? 316  LYS A N     1 
ATOM   2181  C  CA    . LYS A 1 316  ? -72.58700 -21.97200 -37.79200 1.000 74.07718  ? 316  LYS A CA    1 
ATOM   2182  C  C     . LYS A 1 316  ? -73.34000 -20.99100 -38.67900 1.000 76.98363  ? 316  LYS A C     1 
ATOM   2183  O  O     . LYS A 1 316  ? -73.70100 -19.90700 -38.21100 1.000 90.34549  ? 316  LYS A O     1 
ATOM   2184  C  CB    . LYS A 1 316  ? -71.11800 -21.55300 -37.68500 1.000 73.73199  ? 316  LYS A CB    1 
ATOM   2185  C  CG    . LYS A 1 316  ? -70.53400 -20.96500 -38.95900 1.000 85.15461  ? 316  LYS A CG    1 
ATOM   2186  C  CD    . LYS A 1 316  ? -69.51100 -19.88500 -38.64500 1.000 81.07859  ? 316  LYS A CD    1 
ATOM   2187  C  CE    . LYS A 1 316  ? -68.41600 -20.40700 -37.73200 1.000 72.23511  ? 316  LYS A CE    1 
ATOM   2188  N  NZ    . LYS A 1 316  ? -67.39900 -19.35900 -37.44600 1.000 78.70141  ? 316  LYS A NZ    1 
ATOM   2189  N  N     . ASP A 1 317  ? -73.59200 -21.34400 -39.94200 1.000 76.51312  ? 317  ASP A N     1 
ATOM   2190  C  CA    . ASP A 1 317  ? -74.33100 -20.44700 -40.82300 1.000 81.97972  ? 317  ASP A CA    1 
ATOM   2191  C  C     . ASP A 1 317  ? -75.82400 -20.47000 -40.52200 1.000 88.31764  ? 317  ASP A C     1 
ATOM   2192  O  O     . ASP A 1 317  ? -76.48000 -19.42300 -40.55100 1.000 94.23310  ? 317  ASP A O     1 
ATOM   2193  C  CB    . ASP A 1 317  ? -74.07200 -20.80900 -42.28500 1.000 81.60002  ? 317  ASP A CB    1 
ATOM   2194  C  CG    . ASP A 1 317  ? -72.78200 -20.21300 -42.81300 1.000 91.30616  ? 317  ASP A CG    1 
ATOM   2195  O  OD1   . ASP A 1 317  ? -72.01700 -19.64300 -42.00600 1.000 99.38441  ? 317  ASP A OD1   1 
ATOM   2196  O  OD2   . ASP A 1 317  ? -72.53500 -20.30900 -44.03400 1.000 91.41900  ? 317  ASP A OD2   1 
ATOM   2197  N  N     . ILE A 1 318  ? -76.38000 -21.64900 -40.23100 1.000 83.06111  ? 318  ILE A N     1 
ATOM   2198  C  CA    . ILE A 1 318  ? -77.79000 -21.71000 -39.86400 1.000 81.56901  ? 318  ILE A CA    1 
ATOM   2199  C  C     . ILE A 1 318  ? -77.99200 -21.19500 -38.44500 1.000 82.95717  ? 318  ILE A C     1 
ATOM   2200  O  O     . ILE A 1 318  ? -79.07800 -20.71500 -38.10000 1.000 93.37478  ? 318  ILE A O     1 
ATOM   2201  C  CB    . ILE A 1 318  ? -78.33700 -23.14100 -40.03800 1.000 74.82329  ? 318  ILE A CB    1 
ATOM   2202  C  CG1   . ILE A 1 318  ? -77.75800 -24.08800 -38.98300 1.000 78.48700  ? 318  ILE A CG1   1 
ATOM   2203  C  CG2   . ILE A 1 318  ? -78.03400 -23.65900 -41.43600 1.000 75.71553  ? 318  ILE A CG2   1 
ATOM   2204  C  CD1   . ILE A 1 318  ? -78.69000 -24.35400 -37.81400 1.000 76.88630  ? 318  ILE A CD1   1 
ATOM   2205  N  N     . LEU A 1 319  ? -76.95900 -21.27900 -37.60100 1.000 76.03391  ? 319  LEU A N     1 
ATOM   2206  C  CA    . LEU A 1 319  ? -77.07300 -20.77300 -36.23800 1.000 79.20802  ? 319  LEU A CA    1 
ATOM   2207  C  C     . LEU A 1 319  ? -76.89000 -19.26100 -36.18500 1.000 82.96924  ? 319  LEU A C     1 
ATOM   2208  O  O     . LEU A 1 319  ? -77.56900 -18.58000 -35.40900 1.000 88.01019  ? 319  LEU A O     1 
ATOM   2209  C  CB    . LEU A 1 319  ? -76.06200 -21.47100 -35.32800 1.000 75.05368  ? 319  LEU A CB    1 
ATOM   2210  C  CG    . LEU A 1 319  ? -76.36200 -22.93200 -34.98200 1.000 72.57101  ? 319  LEU A CG    1 
ATOM   2211  C  CD1   . LEU A 1 319  ? -75.32900 -23.48100 -34.00900 1.000 67.96060  ? 319  LEU A CD1   1 
ATOM   2212  C  CD2   . LEU A 1 319  ? -77.76700 -23.07200 -34.41700 1.000 73.14540  ? 319  LEU A CD2   1 
ATOM   2213  N  N     . ALA A 1 320  ? -75.98000 -18.71700 -36.99700 1.000 78.57856  ? 320  ALA A N     1 
ATOM   2214  C  CA    . ALA A 1 320  ? -75.85300 -17.26800 -37.09100 1.000 86.48412  ? 320  ALA A CA    1 
ATOM   2215  C  C     . ALA A 1 320  ? -77.08700 -16.62800 -37.70800 1.000 94.77334  ? 320  ALA A C     1 
ATOM   2216  O  O     . ALA A 1 320  ? -77.34400 -15.44300 -37.46700 1.000 94.03818  ? 320  ALA A O     1 
ATOM   2217  C  CB    . ALA A 1 320  ? -74.61200 -16.89100 -37.90300 1.000 83.40966  ? 320  ALA A CB    1 
ATOM   2218  N  N     . ASP A 1 321  ? -77.85200 -17.38400 -38.49600 1.000 98.63176  ? 321  ASP A N     1 
ATOM   2219  C  CA    . ASP A 1 321  ? -79.08500 -16.86100 -39.07100 1.000 100.25211 ? 321  ASP A CA    1 
ATOM   2220  C  C     . ASP A 1 321  ? -80.21200 -16.83300 -38.04600 1.000 96.71974  ? 321  ASP A C     1 
ATOM   2221  O  O     . ASP A 1 321  ? -80.99200 -15.87600 -38.00600 1.000 100.91957 ? 321  ASP A O     1 
ATOM   2222  C  CB    . ASP A 1 321  ? -79.49000 -17.69700 -40.28500 1.000 92.48110  ? 321  ASP A CB    1 
ATOM   2223  C  CG    . ASP A 1 321  ? -80.47200 -16.97900 -41.18800 1.000 104.34772 ? 321  ASP A CG    1 
ATOM   2224  O  OD1   . ASP A 1 321  ? -80.58900 -15.74000 -41.07800 1.000 114.25435 ? 321  ASP A OD1   1 
ATOM   2225  O  OD2   . ASP A 1 321  ? -81.12900 -17.65500 -42.00800 1.000 100.70255 ? 321  ASP A OD2   1 
ATOM   2226  N  N     . VAL A 1 322  ? -80.30600 -17.86400 -37.20400 1.000 84.85697  ? 322  VAL A N     1 
ATOM   2227  C  CA    . VAL A 1 322  ? -81.42400 -17.96600 -36.27200 1.000 88.38339  ? 322  VAL A CA    1 
ATOM   2228  C  C     . VAL A 1 322  ? -81.26900 -17.04300 -35.06700 1.000 95.55411  ? 322  VAL A C     1 
ATOM   2229  O  O     . VAL A 1 322  ? -82.27800 -16.65500 -34.46300 1.000 104.01072 ? 322  VAL A O     1 
ATOM   2230  C  CB    . VAL A 1 322  ? -81.60500 -19.42600 -35.81500 1.000 84.42429  ? 322  VAL A CB    1 
ATOM   2231  C  CG1   . VAL A 1 322  ? -80.51100 -19.83200 -34.83600 1.000 79.59938  ? 322  VAL A CG1   1 
ATOM   2232  C  CG2   . VAL A 1 322  ? -82.98600 -19.63900 -35.20900 1.000 91.61340  ? 322  VAL A CG2   1 
ATOM   2233  N  N     . VAL A 1 323  ? -80.04100 -16.66100 -34.70700 1.000 93.43880  ? 323  VAL A N     1 
ATOM   2234  C  CA    . VAL A 1 323  ? -79.84800 -15.83600 -33.51800 1.000 93.71479  ? 323  VAL A CA    1 
ATOM   2235  C  C     . VAL A 1 323  ? -80.24900 -14.38400 -33.74500 1.000 92.15377  ? 323  VAL A C     1 
ATOM   2236  O  O     . VAL A 1 323  ? -80.52000 -13.66800 -32.77200 1.000 96.32794  ? 323  VAL A O     1 
ATOM   2237  C  CB    . VAL A 1 323  ? -78.39300 -15.90500 -33.02500 1.000 87.64666  ? 323  VAL A CB    1 
ATOM   2238  C  CG1   . VAL A 1 323  ? -78.10000 -17.28200 -32.44700 1.000 80.57360  ? 323  VAL A CG1   1 
ATOM   2239  C  CG2   . VAL A 1 323  ? -77.42900 -15.57000 -34.15200 1.000 93.62057  ? 323  VAL A CG2   1 
ATOM   2240  N  N     . GLN A 1 324  ? -80.29200 -13.92400 -34.99300 1.000 92.59310  ? 324  GLN A N     1 
ATOM   2241  C  CA    . GLN A 1 324  ? -80.81000 -12.60100 -35.31300 1.000 104.60551 ? 324  GLN A CA    1 
ATOM   2242  C  C     . GLN A 1 324  ? -82.25000 -12.65000 -35.80800 1.000 106.00671 ? 324  GLN A C     1 
ATOM   2243  O  O     . GLN A 1 324  ? -82.76600 -11.63800 -36.29200 1.000 104.72921 ? 324  GLN A O     1 
ATOM   2244  C  CB    . GLN A 1 324  ? -79.91500 -11.91200 -36.34600 1.000 105.65798 ? 324  GLN A CB    1 
ATOM   2245  C  CG    . GLN A 1 324  ? -79.78300 -12.64800 -37.66700 1.000 109.76630 ? 324  GLN A CG    1 
ATOM   2246  C  CD    . GLN A 1 324  ? -78.69300 -12.06400 -38.54600 1.000 113.53273 ? 324  GLN A CD    1 
ATOM   2247  O  OE1   . GLN A 1 324  ? -78.72400 -10.88200 -38.89000 1.000 99.63964  ? 324  GLN A OE1   1 
ATOM   2248  N  NE2   . GLN A 1 324  ? -77.72000 -12.89000 -38.91200 1.000 113.11275 ? 324  GLN A NE2   1 
ATOM   2249  N  N     . LYS A 1 325  ? -82.90600 -13.80800 -35.69700 1.000 102.27212 ? 325  LYS A N     1 
ATOM   2250  C  CA    . LYS A 1 325  ? -84.30800 -13.95700 -36.05300 1.000 98.74807  ? 325  LYS A CA    1 
ATOM   2251  C  C     . LYS A 1 325  ? -85.19500 -14.35100 -34.88300 1.000 101.64336 ? 325  LYS A C     1 
ATOM   2252  O  O     . LYS A 1 325  ? -86.41800 -14.20900 -34.98700 1.000 112.13496 ? 325  LYS A O     1 
ATOM   2253  C  CB    . LYS A 1 325  ? -84.47500 -15.00900 -37.16200 1.000 101.33177 ? 325  LYS A CB    1 
ATOM   2254  C  CG    . LYS A 1 325  ? -83.83800 -14.64200 -38.49300 1.000 108.11466 ? 325  LYS A CG    1 
ATOM   2255  C  CD    . LYS A 1 325  ? -84.88200 -14.26900 -39.53100 1.000 107.32032 ? 325  LYS A CD    1 
ATOM   2256  C  CE    . LYS A 1 325  ? -84.23100 -13.94300 -40.86600 1.000 95.34564  ? 325  LYS A CE    1 
ATOM   2257  N  NZ    . LYS A 1 325  ? -83.27500 -12.80600 -40.76100 1.000 99.58600  ? 325  LYS A NZ    1 
ATOM   2258  N  N     . LEU A 1 326  ? -84.62500 -14.83700 -33.78600 1.000 94.88373  ? 326  LEU A N     1 
ATOM   2259  C  CA    . LEU A 1 326  ? -85.35700 -15.33300 -32.63400 1.000 92.95372  ? 326  LEU A CA    1 
ATOM   2260  C  C     . LEU A 1 326  ? -84.99200 -14.53300 -31.38800 1.000 97.69784  ? 326  LEU A C     1 
ATOM   2261  O  O     . LEU A 1 326  ? -83.93400 -13.89400 -31.34000 1.000 99.36180  ? 326  LEU A O     1 
ATOM   2262  C  CB    . LEU A 1 326  ? -85.05800 -16.82300 -32.40600 1.000 89.77564  ? 326  LEU A CB    1 
ATOM   2263  C  CG    . LEU A 1 326  ? -86.03800 -17.82500 -33.02300 1.000 84.22315  ? 326  LEU A CG    1 
ATOM   2264  C  CD1   . LEU A 1 326  ? -86.08000 -17.70400 -34.53800 1.000 82.57790  ? 326  LEU A CD1   1 
ATOM   2265  C  CD2   . LEU A 1 326  ? -85.67800 -19.24100 -32.60800 1.000 86.59288  ? 326  LEU A CD2   1 
ATOM   2266  N  N     . PRO A 1 327  ? -85.84900 -14.53800 -30.36400 1.000 103.09141 ? 327  PRO A N     1 
ATOM   2267  C  CA    . PRO A 1 327  ? -85.53600 -13.78300 -29.14400 1.000 102.62404 ? 327  PRO A CA    1 
ATOM   2268  C  C     . PRO A 1 327  ? -84.30400 -14.33100 -28.43800 1.000 97.87344  ? 327  PRO A C     1 
ATOM   2269  O  O     . PRO A 1 327  ? -83.97800 -15.51700 -28.53200 1.000 94.60210  ? 327  PRO A O     1 
ATOM   2270  C  CB    . PRO A 1 327  ? -86.79700 -13.95300 -28.28700 1.000 109.43505 ? 327  PRO A CB    1 
ATOM   2271  C  CG    . PRO A 1 327  ? -87.46500 -15.17800 -28.82600 1.000 96.50798  ? 327  PRO A CG    1 
ATOM   2272  C  CD    . PRO A 1 327  ? -87.18600 -15.15300 -30.29700 1.000 99.00069  ? 327  PRO A CD    1 
ATOM   2273  N  N     . GLU A 1 328  ? -83.62100 -13.44100 -27.71400 1.000 99.31383  ? 328  GLU A N     1 
ATOM   2274  C  CA    . GLU A 1 328  ? -82.36800 -13.78200 -27.05200 1.000 96.02349  ? 328  GLU A CA    1 
ATOM   2275  C  C     . GLU A 1 328  ? -82.54900 -14.76900 -25.90500 1.000 97.50546  ? 328  GLU A C     1 
ATOM   2276  O  O     . GLU A 1 328  ? -81.55700 -15.35000 -25.45200 1.000 98.78091  ? 328  GLU A O     1 
ATOM   2277  C  CB    . GLU A 1 328  ? -81.69000 -12.50500 -26.54400 1.000 97.05950  ? 328  GLU A CB    1 
ATOM   2278  C  CG    . GLU A 1 328  ? -80.19500 -12.64000 -26.28500 1.000 104.44749 ? 328  GLU A CG    1 
ATOM   2279  C  CD    . GLU A 1 328  ? -79.85500 -12.66900 -24.80700 1.000 114.09816 ? 328  GLU A CD    1 
ATOM   2280  O  OE1   . GLU A 1 328  ? -78.65300 -12.63000 -24.47100 1.000 107.64785 ? 328  GLU A OE1   1 
ATOM   2281  O  OE2   . GLU A 1 328  ? -80.79100 -12.73000 -23.98100 1.000 117.92804 ? 328  GLU A OE2   1 
ATOM   2282  N  N     . GLU A 1 329  ? -83.77700 -14.97600 -25.42700 1.000 99.89476  ? 329  GLU A N     1 
ATOM   2283  C  CA    . GLU A 1 329  ? -83.99300 -15.94600 -24.36000 1.000 98.78462  ? 329  GLU A CA    1 
ATOM   2284  C  C     . GLU A 1 329  ? -83.91200 -17.38000 -24.86800 1.000 96.16792  ? 329  GLU A C     1 
ATOM   2285  O  O     . GLU A 1 329  ? -83.55200 -18.28200 -24.10400 1.000 96.85456  ? 329  GLU A O     1 
ATOM   2286  C  CB    . GLU A 1 329  ? -85.34600 -15.71100 -23.68600 1.000 98.65675  ? 329  GLU A CB    1 
ATOM   2287  C  CG    . GLU A 1 329  ? -86.54600 -15.93600 -24.59300 1.000 103.55741 ? 329  GLU A CG    1 
ATOM   2288  C  CD    . GLU A 1 329  ? -87.78700 -16.34600 -23.82500 1.000 109.37124 ? 329  GLU A CD    1 
ATOM   2289  O  OE1   . GLU A 1 329  ? -87.64600 -17.04100 -22.79600 1.000 106.37043 ? 329  GLU A OE1   1 
ATOM   2290  O  OE2   . GLU A 1 329  ? -88.90200 -15.97700 -24.24900 1.000 108.34370 ? 329  GLU A OE2   1 
ATOM   2291  N  N     . LYS A 1 330  ? -84.24000 -17.60900 -26.14000 1.000 96.19612  ? 330  LYS A N     1 
ATOM   2292  C  CA    . LYS A 1 330  ? -84.21300 -18.94600 -26.71600 1.000 97.39490  ? 330  LYS A CA    1 
ATOM   2293  C  C     . LYS A 1 330  ? -82.91900 -19.25700 -27.45600 1.000 99.65361  ? 330  LYS A C     1 
ATOM   2294  O  O     . LYS A 1 330  ? -82.57600 -20.43500 -27.60100 1.000 100.81953 ? 330  LYS A O     1 
ATOM   2295  C  CB    . LYS A 1 330  ? -85.39800 -19.13900 -27.67000 1.000 100.08308 ? 330  LYS A CB    1 
ATOM   2296  C  CG    . LYS A 1 330  ? -86.74100 -18.76400 -27.06600 1.000 98.78681  ? 330  LYS A CG    1 
ATOM   2297  C  CD    . LYS A 1 330  ? -87.88800 -19.13100 -27.99200 1.000 96.47511  ? 330  LYS A CD    1 
ATOM   2298  C  CE    . LYS A 1 330  ? -89.22300 -18.68600 -27.41700 1.000 99.84608  ? 330  LYS A CE    1 
ATOM   2299  N  NZ    . LYS A 1 330  ? -90.37100 -19.17800 -28.22800 1.000 89.01137  ? 330  LYS A NZ    1 
ATOM   2300  N  N     . THR A 1 331  ? -82.19900 -18.23900 -27.92100 1.000 97.11452  ? 331  THR A N     1 
ATOM   2301  C  CA    . THR A 1 331  ? -80.91700 -18.42900 -28.60100 1.000 86.28967  ? 331  THR A CA    1 
ATOM   2302  C  C     . THR A 1 331  ? -79.74500 -18.42300 -27.63200 1.000 85.68731  ? 331  THR A C     1 
ATOM   2303  O  O     . THR A 1 331  ? -78.68400 -17.86800 -27.93200 1.000 85.76490  ? 331  THR A O     1 
ATOM   2304  C  CB    . THR A 1 331  ? -80.73600 -17.35900 -29.67300 1.000 91.37396  ? 331  THR A CB    1 
ATOM   2305  O  OG1   . THR A 1 331  ? -80.78500 -16.05900 -29.07000 1.000 84.73300  ? 331  THR A OG1   1 
ATOM   2306  C  CG2   . THR A 1 331  ? -81.82800 -17.47000 -30.72600 1.000 89.76404  ? 331  THR A CG2   1 
ATOM   2307  N  N     . GLN A 1 332  ? -79.91100 -19.02700 -26.45400 1.000 90.27844  ? 332  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1 332  ? -78.81500 -19.10400 -25.49500 1.000 94.13179  ? 332  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1 332  ? -77.85800 -20.23600 -25.84400 1.000 85.80810  ? 332  GLN A C     1 
ATOM   2310  O  O     . GLN A 1 332  ? -76.63600 -20.04900 -25.84500 1.000 80.44562  ? 332  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1 332  ? -79.36500 -19.28700 -24.08000 1.000 89.41575  ? 332  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1 332  ? -78.50600 -18.67900 -22.98700 1.000 88.13593  ? 332  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1 332  ? -78.73300 -17.19100 -22.82700 1.000 92.41246  ? 332  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1 332  ? -79.82500 -16.68600 -23.08900 1.000 97.24741  ? 332  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1 332  ? -77.70100 -16.47900 -22.39000 1.000 93.02572  ? 332  GLN A NE2   1 
ATOM   2316  N  N     . MET A 1 333  ? -78.40000 -21.42000 -26.13800 1.000 84.67508  ? 333  MET A N     1 
ATOM   2317  C  CA    . MET A 1 333  ? -77.55300 -22.55200 -26.49400 1.000 76.51193  ? 333  MET A CA    1 
ATOM   2318  C  C     . MET A 1 333  ? -76.81700 -22.31000 -27.80500 1.000 79.30755  ? 333  MET A C     1 
ATOM   2319  O  O     . MET A 1 333  ? -75.64100 -22.66900 -27.94000 1.000 77.79386  ? 333  MET A O     1 
ATOM   2320  C  CB    . MET A 1 333  ? -78.38700 -23.82500 -26.59300 1.000 73.33787  ? 333  MET A CB    1 
ATOM   2321  C  CG    . MET A 1 333  ? -77.54600 -25.04600 -26.87000 1.000 78.41637  ? 333  MET A CG    1 
ATOM   2322  S  SD    . MET A 1 333  ? -76.62700 -25.64700 -25.45400 1.000 92.67387  ? 333  MET A SD    1 
ATOM   2323  C  CE    . MET A 1 333  ? -77.24900 -27.32000 -25.40500 1.000 87.94303  ? 333  MET A CE    1 
ATOM   2324  N  N     . TYR A 1 334  ? -77.49500 -21.71200 -28.78700 1.000 79.06939  ? 334  TYR A N     1 
ATOM   2325  C  CA    . TYR A 1 334  ? -76.88200 -21.51400 -30.09500 1.000 72.16037  ? 334  TYR A CA    1 
ATOM   2326  C  C     . TYR A 1 334  ? -75.76800 -20.47700 -30.04200 1.000 78.00194  ? 334  TYR A C     1 
ATOM   2327  O  O     . TYR A 1 334  ? -74.80000 -20.57000 -30.80500 1.000 83.62499  ? 334  TYR A O     1 
ATOM   2328  C  CB    . TYR A 1 334  ? -77.94900 -21.11000 -31.11200 1.000 73.24058  ? 334  TYR A CB    1 
ATOM   2329  C  CG    . TYR A 1 334  ? -79.19500 -21.96900 -31.05500 1.000 80.53396  ? 334  TYR A CG    1 
ATOM   2330  C  CD1   . TYR A 1 334  ? -79.11000 -23.33900 -30.83900 1.000 84.94370  ? 334  TYR A CD1   1 
ATOM   2331  C  CD2   . TYR A 1 334  ? -80.45600 -21.40700 -31.20100 1.000 79.89908  ? 334  TYR A CD2   1 
ATOM   2332  C  CE1   . TYR A 1 334  ? -80.24300 -24.12400 -30.77900 1.000 83.37083  ? 334  TYR A CE1   1 
ATOM   2333  C  CE2   . TYR A 1 334  ? -81.59600 -22.18700 -31.14200 1.000 83.08018  ? 334  TYR A CE2   1 
ATOM   2334  C  CZ    . TYR A 1 334  ? -81.48200 -23.54400 -30.92900 1.000 84.66307  ? 334  TYR A CZ    1 
ATOM   2335  O  OH    . TYR A 1 334  ? -82.61000 -24.32900 -30.86800 1.000 86.09018  ? 334  TYR A OH    1 
ATOM   2336  N  N     . HIS A 1 335  ? -75.88200 -19.48900 -29.15000 1.000 80.55798  ? 335  HIS A N     1 
ATOM   2337  C  CA    . HIS A 1 335  ? -74.81900 -18.50100 -29.00100 1.000 75.22137  ? 335  HIS A CA    1 
ATOM   2338  C  C     . HIS A 1 335  ? -73.54100 -19.14100 -28.47100 1.000 72.40285  ? 335  HIS A C     1 
ATOM   2339  O  O     . HIS A 1 335  ? -72.43800 -18.78200 -28.89700 1.000 79.77959  ? 335  HIS A O     1 
ATOM   2340  C  CB    . HIS A 1 335  ? -75.27500 -17.37300 -28.07700 1.000 83.18785  ? 335  HIS A CB    1 
ATOM   2341  C  CG    . HIS A 1 335  ? -76.07100 -16.31000 -28.76700 1.000 82.76865  ? 335  HIS A CG    1 
ATOM   2342  N  ND1   . HIS A 1 335  ? -77.21400 -15.76500 -28.22500 1.000 92.69474  ? 335  HIS A ND1   1 
ATOM   2343  C  CD2   . HIS A 1 335  ? -75.88600 -15.69000 -29.95700 1.000 84.75123  ? 335  HIS A CD2   1 
ATOM   2344  C  CE1   . HIS A 1 335  ? -77.70000 -14.85500 -29.05000 1.000 98.86512  ? 335  HIS A CE1   1 
ATOM   2345  N  NE2   . HIS A 1 335  ? -76.91200 -14.79000 -30.10900 1.000 93.34324  ? 335  HIS A NE2   1 
ATOM   2346  N  N     . ALA A 1 336  ? -73.67100 -20.08900 -27.54000 1.000 73.16886  ? 336  ALA A N     1 
ATOM   2347  C  CA    . ALA A 1 336  ? -72.49400 -20.77400 -27.01600 1.000 72.21510  ? 336  ALA A CA    1 
ATOM   2348  C  C     . ALA A 1 336  ? -71.82800 -21.62500 -28.09000 1.000 80.52697  ? 336  ALA A C     1 
ATOM   2349  O  O     . ALA A 1 336  ? -70.59700 -21.73900 -28.12500 1.000 79.69826  ? 336  ALA A O     1 
ATOM   2350  C  CB    . ALA A 1 336  ? -72.87700 -21.63100 -25.81000 1.000 73.70076  ? 336  ALA A CB    1 
ATOM   2351  N  N     . LEU A 1 337  ? -72.62400 -22.22900 -28.97600 1.000 79.32284  ? 337  LEU A N     1 
ATOM   2352  C  CA    . LEU A 1 337  ? -72.05200 -22.99600 -30.07800 1.000 75.62085  ? 337  LEU A CA    1 
ATOM   2353  C  C     . LEU A 1 337  ? -71.38500 -22.08200 -31.09900 1.000 81.04284  ? 337  LEU A C     1 
ATOM   2354  O  O     . LEU A 1 337  ? -70.28700 -22.38100 -31.58300 1.000 84.48007  ? 337  LEU A O     1 
ATOM   2355  C  CB    . LEU A 1 337  ? -73.13300 -23.84600 -30.74600 1.000 73.67967  ? 337  LEU A CB    1 
ATOM   2356  C  CG    . LEU A 1 337  ? -73.68000 -25.02900 -29.94700 1.000 70.51270  ? 337  LEU A CG    1 
ATOM   2357  C  CD1   . LEU A 1 337  ? -74.86200 -25.65700 -30.66800 1.000 69.91605  ? 337  LEU A CD1   1 
ATOM   2358  C  CD2   . LEU A 1 337  ? -72.58900 -26.06000 -29.70400 1.000 63.63590  ? 337  LEU A CD2   1 
ATOM   2359  N  N     . LEU A 1 338  ? -72.03400 -20.96400 -31.43800 1.000 80.34279  ? 338  LEU A N     1 
ATOM   2360  C  CA    . LEU A 1 338  ? -71.45000 -20.02700 -32.39200 1.000 72.46672  ? 338  LEU A CA    1 
ATOM   2361  C  C     . LEU A 1 338  ? -70.16800 -19.40400 -31.85800 1.000 75.90261  ? 338  LEU A C     1 
ATOM   2362  O  O     . LEU A 1 338  ? -69.29600 -19.01100 -32.64200 1.000 77.59760  ? 338  LEU A O     1 
ATOM   2363  C  CB    . LEU A 1 338  ? -72.45700 -18.93200 -32.74100 1.000 70.43237  ? 338  LEU A CB    1 
ATOM   2364  C  CG    . LEU A 1 338  ? -73.55800 -19.29700 -33.73500 1.000 73.97901  ? 338  LEU A CG    1 
ATOM   2365  C  CD1   . LEU A 1 338  ? -74.84700 -18.57400 -33.38900 1.000 81.68701  ? 338  LEU A CD1   1 
ATOM   2366  C  CD2   . LEU A 1 338  ? -73.11800 -18.96400 -35.14800 1.000 75.89173  ? 338  LEU A CD2   1 
ATOM   2367  N  N     . LYS A 1 339  ? -70.03700 -19.30000 -30.53400 1.000 73.38515  ? 339  LYS A N     1 
ATOM   2368  C  CA    . LYS A 1 339  ? -68.83700 -18.71100 -29.95000 1.000 76.97343  ? 339  LYS A CA    1 
ATOM   2369  C  C     . LYS A 1 339  ? -67.61000 -19.56900 -30.23400 1.000 73.94979  ? 339  LYS A C     1 
ATOM   2370  O  O     . LYS A 1 339  ? -66.57600 -19.06200 -30.68600 1.000 72.43200  ? 339  LYS A O     1 
ATOM   2371  C  CB    . LYS A 1 339  ? -69.03000 -18.52200 -28.44500 1.000 71.91152  ? 339  LYS A CB    1 
ATOM   2372  C  CG    . LYS A 1 339  ? -67.83800 -17.90400 -27.73500 1.000 75.74484  ? 339  LYS A CG    1 
ATOM   2373  C  CD    . LYS A 1 339  ? -68.03200 -17.92200 -26.22700 1.000 81.12761  ? 339  LYS A CD    1 
ATOM   2374  C  CE    . LYS A 1 339  ? -66.88400 -17.23000 -25.51100 1.000 93.42015  ? 339  LYS A CE    1 
ATOM   2375  N  NZ    . LYS A 1 339  ? -67.05200 -17.27100 -24.03200 1.000 88.51819  ? 339  LYS A NZ    1 
ATOM   2376  N  N     . HIS A 1 340  ? -67.70800 -20.87500 -29.98200 1.000 72.39863  ? 340  HIS A N     1 
ATOM   2377  C  CA    . HIS A 1 340  ? -66.56900 -21.76200 -30.17400 1.000 75.30153  ? 340  HIS A CA    1 
ATOM   2378  C  C     . HIS A 1 340  ? -66.40500 -22.21400 -31.61900 1.000 73.16699  ? 340  HIS A C     1 
ATOM   2379  O  O     . HIS A 1 340  ? -65.29500 -22.59000 -32.01100 1.000 76.45538  ? 340  HIS A O     1 
ATOM   2380  C  CB    . HIS A 1 340  ? -66.69200 -22.97900 -29.25500 1.000 73.02784  ? 340  HIS A CB    1 
ATOM   2381  C  CG    . HIS A 1 340  ? -66.31900 -22.69600 -27.83300 1.000 68.84592  ? 340  HIS A CG    1 
ATOM   2382  N  ND1   . HIS A 1 340  ? -66.36200 -23.65700 -26.84600 1.000 64.90415  ? 340  HIS A ND1   1 
ATOM   2383  C  CD2   . HIS A 1 340  ? -65.89600 -21.55800 -27.23300 1.000 69.88046  ? 340  HIS A CD2   1 
ATOM   2384  C  CE1   . HIS A 1 340  ? -65.98100 -23.12300 -25.69900 1.000 71.57864  ? 340  HIS A CE1   1 
ATOM   2385  N  NE2   . HIS A 1 340  ? -65.69300 -21.85100 -25.90700 1.000 76.11723  ? 340  HIS A NE2   1 
ATOM   2386  N  N     . LEU A 1 341  ? -67.47500 -22.19000 -32.41700 1.000 74.85828  ? 341  LEU A N     1 
ATOM   2387  C  CA    . LEU A 1 341  ? -67.33700 -22.48700 -33.83800 1.000 69.24110  ? 341  LEU A CA    1 
ATOM   2388  C  C     . LEU A 1 341  ? -66.56900 -21.40000 -34.57800 1.000 70.50669  ? 341  LEU A C     1 
ATOM   2389  O  O     . LEU A 1 341  ? -66.03900 -21.66400 -35.66200 1.000 72.82103  ? 341  LEU A O     1 
ATOM   2390  C  CB    . LEU A 1 341  ? -68.71300 -22.68600 -34.47600 1.000 73.93009  ? 341  LEU A CB    1 
ATOM   2391  C  CG    . LEU A 1 341  ? -69.28000 -24.10700 -34.42100 1.000 74.01427  ? 341  LEU A CG    1 
ATOM   2392  C  CD1   . LEU A 1 341  ? -70.54900 -24.21400 -35.25000 1.000 70.31824  ? 341  LEU A CD1   1 
ATOM   2393  C  CD2   . LEU A 1 341  ? -68.24300 -25.11100 -34.90000 1.000 70.39843  ? 341  LEU A CD2   1 
ATOM   2394  N  N     . GLY A 1 342  ? -66.49700 -20.19000 -34.02000 1.000 75.68226  ? 342  GLY A N     1 
ATOM   2395  C  CA    . GLY A 1 342  ? -65.68800 -19.14900 -34.63000 1.000 70.44609  ? 342  GLY A CA    1 
ATOM   2396  C  C     . GLY A 1 342  ? -64.20300 -19.35700 -34.42200 1.000 70.31874  ? 342  GLY A C     1 
ATOM   2397  O  O     . GLY A 1 342  ? -63.39700 -19.01200 -35.29100 1.000 79.00833  ? 342  GLY A O     1 
ATOM   2398  N  N     . THR A 1 343  ? -63.81900 -19.91500 -33.27600 1.000 64.28933  ? 343  THR A N     1 
ATOM   2399  C  CA    . THR A 1 343  ? -62.43500 -20.26100 -32.98600 1.000 60.52714  ? 343  THR A CA    1 
ATOM   2400  C  C     . THR A 1 343  ? -62.12400 -21.71600 -33.31000 1.000 72.36986  ? 343  THR A C     1 
ATOM   2401  O  O     . THR A 1 343  ? -61.02600 -22.19200 -33.00300 1.000 82.66491  ? 343  THR A O     1 
ATOM   2402  C  CB    . THR A 1 343  ? -62.11700 -19.97600 -31.51800 1.000 67.46247  ? 343  THR A CB    1 
ATOM   2403  O  OG1   . THR A 1 343  ? -62.67400 -21.01100 -30.70000 1.000 72.95523  ? 343  THR A OG1   1 
ATOM   2404  C  CG2   . THR A 1 343  ? -62.70600 -18.63800 -31.09600 1.000 69.47530  ? 343  THR A CG2   1 
ATOM   2405  N  N     . LEU A 1 344  ? -63.06500 -22.42800 -33.92600 1.000 77.76814  ? 344  LEU A N     1 
ATOM   2406  C  CA    . LEU A 1 344  ? -62.92600 -23.85300 -34.21700 1.000 69.30361  ? 344  LEU A CA    1 
ATOM   2407  C  C     . LEU A 1 344  ? -62.02200 -24.00800 -35.43500 1.000 70.78207  ? 344  LEU A C     1 
ATOM   2408  O  O     . LEU A 1 344  ? -62.47500 -23.88400 -36.57400 1.000 69.98337  ? 344  LEU A O     1 
ATOM   2409  C  CB    . LEU A 1 344  ? -64.29800 -24.47400 -34.46100 1.000 67.75035  ? 344  LEU A CB    1 
ATOM   2410  C  CG    . LEU A 1 344  ? -64.51600 -25.99200 -34.44700 1.000 66.97847  ? 344  LEU A CG    1 
ATOM   2411  C  CD1   . LEU A 1 344  ? -63.89500 -26.70300 -35.64900 1.000 73.00180  ? 344  LEU A CD1   1 
ATOM   2412  C  CD2   . LEU A 1 344  ? -64.02300 -26.58600 -33.14500 1.000 72.02419  ? 344  LEU A CD2   1 
ATOM   2413  N  N     . ALA A 1 345  ? -60.73800 -24.27800 -35.19100 1.000 74.76250  ? 345  ALA A N     1 
ATOM   2414  C  CA    . ALA A 1 345  ? -59.76900 -24.54900 -36.24900 1.000 74.73627  ? 345  ALA A CA    1 
ATOM   2415  C  C     . ALA A 1 345  ? -59.75700 -23.45900 -37.31400 1.000 72.09509  ? 345  ALA A C     1 
ATOM   2416  O  O     . ALA A 1 345  ? -59.79200 -22.26700 -36.99600 1.000 68.93554  ? 345  ALA A O     1 
ATOM   2417  C  CB    . ALA A 1 345  ? -60.05400 -25.90700 -36.89700 1.000 68.30635  ? 345  ALA A CB    1 
ATOM   2418  N  N     . GLY A 1 346  ? -59.71200 -23.86500 -38.58300 1.000 65.16396  ? 346  GLY A N     1 
ATOM   2419  C  CA    . GLY A 1 346  ? -59.73000 -22.94900 -39.69900 1.000 63.18532  ? 346  GLY A CA    1 
ATOM   2420  C  C     . GLY A 1 346  ? -60.93000 -23.17400 -40.60300 1.000 68.20456  ? 346  GLY A C     1 
ATOM   2421  O  O     . GLY A 1 346  ? -61.72200 -24.10100 -40.41500 1.000 70.36375  ? 346  GLY A O     1 
ATOM   2422  N  N     . SER A 1 347  ? -61.04200 -22.29600 -41.60300 1.000 69.96720  ? 347  SER A N     1 
ATOM   2423  C  CA    . SER A 1 347  ? -62.18300 -22.34500 -42.51000 1.000 58.69368  ? 347  SER A CA    1 
ATOM   2424  C  C     . SER A 1 347  ? -62.21700 -23.63800 -43.31400 1.000 66.32233  ? 347  SER A C     1 
ATOM   2425  O  O     . SER A 1 347  ? -63.30100 -24.15100 -43.61800 1.000 67.04936  ? 347  SER A O     1 
ATOM   2426  C  CB    . SER A 1 347  ? -62.15700 -21.14100 -43.45100 1.000 64.72513  ? 347  SER A CB    1 
ATOM   2427  O  OG    . SER A 1 347  ? -63.09600 -21.29800 -44.49900 1.000 68.14513  ? 347  SER A OG    1 
ATOM   2428  N  N     . GLN A 1 348  ? -61.05000 -24.18000 -43.66600 1.000 69.22873  ? 348  GLN A N     1 
ATOM   2429  C  CA    . GLN A 1 348  ? -61.01300 -25.39200 -44.47700 1.000 64.29262  ? 348  GLN A CA    1 
ATOM   2430  C  C     . GLN A 1 348  ? -61.45700 -26.60700 -43.67200 1.000 70.43320  ? 348  GLN A C     1 
ATOM   2431  O  O     . GLN A 1 348  ? -62.25000 -27.42600 -44.15100 1.000 65.57039  ? 348  GLN A O     1 
ATOM   2432  C  CB    . GLN A 1 348  ? -59.60900 -25.60700 -45.04700 1.000 65.54539  ? 348  GLN A CB    1 
ATOM   2433  C  CG    . GLN A 1 348  ? -58.96100 -24.36500 -45.64300 1.000 69.13673  ? 348  GLN A CG    1 
ATOM   2434  C  CD    . GLN A 1 348  ? -58.27300 -23.50200 -44.60200 1.000 73.39709  ? 348  GLN A CD    1 
ATOM   2435  O  OE1   . GLN A 1 348  ? -57.85000 -23.99300 -43.55500 1.000 75.05797  ? 348  GLN A OE1   1 
ATOM   2436  N  NE2   . GLN A 1 348  ? -58.16400 -22.20900 -44.88300 1.000 72.31185  ? 348  GLN A NE2   1 
ATOM   2437  N  N     . ILE A 1 349  ? -60.95300 -26.74100 -42.44300 1.000 67.96172  ? 349  ILE A N     1 
ATOM   2438  C  CA    . ILE A 1 349  ? -61.31200 -27.88900 -41.61500 1.000 62.01257  ? 349  ILE A CA    1 
ATOM   2439  C  C     . ILE A 1 349  ? -62.78000 -27.81700 -41.20900 1.000 63.21124  ? 349  ILE A C     1 
ATOM   2440  O  O     . ILE A 1 349  ? -63.46500 -28.84400 -41.12200 1.000 61.63330  ? 349  ILE A O     1 
ATOM   2441  C  CB    . ILE A 1 349  ? -60.37600 -27.97300 -40.39400 1.000 62.99689  ? 349  ILE A CB    1 
ATOM   2442  C  CG1   . ILE A 1 349  ? -58.99000 -28.45800 -40.82600 1.000 67.24018  ? 349  ILE A CG1   1 
ATOM   2443  C  CG2   . ILE A 1 349  ? -60.94400 -28.89700 -39.32700 1.000 57.98155  ? 349  ILE A CG2   1 
ATOM   2444  C  CD1   . ILE A 1 349  ? -59.01100 -29.77700 -41.57400 1.000 62.56956  ? 349  ILE A CD1   1 
ATOM   2445  N  N     . ARG A 1 350  ? -63.29300 -26.60700 -40.97300 1.000 66.35942  ? 350  ARG A N     1 
ATOM   2446  C  CA    . ARG A 1 350  ? -64.70900 -26.46200 -40.65000 1.000 67.48870  ? 350  ARG A CA    1 
ATOM   2447  C  C     . ARG A 1 350  ? -65.58800 -26.89000 -41.81900 1.000 69.25724  ? 350  ARG A C     1 
ATOM   2448  O  O     . ARG A 1 350  ? -66.65700 -27.47900 -41.61800 1.000 70.47667  ? 350  ARG A O     1 
ATOM   2449  C  CB    . ARG A 1 350  ? -65.01900 -25.01900 -40.25000 1.000 62.33255  ? 350  ARG A CB    1 
ATOM   2450  C  CG    . ARG A 1 350  ? -64.54600 -24.64400 -38.85700 1.000 58.43852  ? 350  ARG A CG    1 
ATOM   2451  C  CD    . ARG A 1 350  ? -65.16600 -23.33300 -38.39000 1.000 62.80526  ? 350  ARG A CD    1 
ATOM   2452  N  NE    . ARG A 1 350  ? -64.76200 -22.19400 -39.21000 1.000 58.12228  ? 350  ARG A NE    1 
ATOM   2453  C  CZ    . ARG A 1 350  ? -63.71800 -21.41400 -38.94500 1.000 63.70159  ? 350  ARG A CZ    1 
ATOM   2454  N  NH1   . ARG A 1 350  ? -62.96700 -21.64700 -37.87700 1.000 60.22432  ? 350  ARG A NH1   1 
ATOM   2455  N  NH2   . ARG A 1 350  ? -63.42700 -20.39900 -39.74700 1.000 65.09325  ? 350  ARG A NH2   1 
ATOM   2456  N  N     . ASN A 1 351  ? -65.15200 -26.61000 -43.04800 1.000 64.49609  ? 351  ASN A N     1 
ATOM   2457  C  CA    . ASN A 1 351  ? -65.92500 -26.96500 -44.23100 1.000 59.48558  ? 351  ASN A CA    1 
ATOM   2458  C  C     . ASN A 1 351  ? -65.81000 -28.43800 -44.60100 1.000 59.92062  ? 351  ASN A C     1 
ATOM   2459  O  O     . ASN A 1 351  ? -66.53700 -28.89300 -45.49000 1.000 64.39741  ? 351  ASN A O     1 
ATOM   2460  C  CB    . ASN A 1 351  ? -65.49400 -26.10200 -45.41900 1.000 63.17252  ? 351  ASN A CB    1 
ATOM   2461  C  CG    . ASN A 1 351  ? -66.23300 -24.77900 -45.47500 1.000 65.09057  ? 351  ASN A CG    1 
ATOM   2462  O  OD1   . ASN A 1 351  ? -67.37300 -24.71100 -45.93300 1.000 70.19358  ? 351  ASN A OD1   1 
ATOM   2463  N  ND2   . ASN A 1 351  ? -65.58400 -23.71900 -45.00800 1.000 61.43293  ? 351  ASN A ND2   1 
ATOM   2464  N  N     . MET A 1 352  ? -64.91900 -29.18700 -43.95400 1.000 62.95239  ? 352  MET A N     1 
ATOM   2465  C  CA    . MET A 1 352  ? -64.79300 -30.62400 -44.16800 1.000 63.11104  ? 352  MET A CA    1 
ATOM   2466  C  C     . MET A 1 352  ? -65.40600 -31.43200 -43.03200 1.000 65.76875  ? 352  MET A C     1 
ATOM   2467  O  O     . MET A 1 352  ? -66.17700 -32.36400 -43.27700 1.000 67.08675  ? 352  MET A O     1 
ATOM   2468  C  CB    . MET A 1 352  ? -63.31700 -31.00800 -44.33300 1.000 63.02687  ? 352  MET A CB    1 
ATOM   2469  C  CG    . MET A 1 352  ? -62.62000 -30.35500 -45.51200 1.000 66.73880  ? 352  MET A CG    1 
ATOM   2470  S  SD    . MET A 1 352  ? -60.85000 -30.69400 -45.50500 1.000 69.46000  ? 352  MET A SD    1 
ATOM   2471  C  CE    . MET A 1 352  ? -60.84800 -32.47900 -45.64600 1.000 64.81621  ? 352  MET A CE    1 
ATOM   2472  N  N     . ALA A 1 353  ? -65.07800 -31.08000 -41.79100 1.000 69.74281  ? 353  ALA A N     1 
ATOM   2473  C  CA    . ALA A 1 353  ? -65.56800 -31.81700 -40.63500 1.000 65.82689  ? 353  ALA A CA    1 
ATOM   2474  C  C     . ALA A 1 353  ? -67.08600 -31.74600 -40.54800 1.000 64.95699  ? 353  ALA A C     1 
ATOM   2475  O  O     . ALA A 1 353  ? -67.69500 -30.71900 -40.85600 1.000 66.16371  ? 353  ALA A O     1 
ATOM   2476  C  CB    . ALA A 1 353  ? -64.94400 -31.25700 -39.36000 1.000 63.62720  ? 353  ALA A CB    1 
ATOM   2477  N  N     . SER A 1 354  ? -67.69600 -32.84600 -40.12100 1.000 65.58400  ? 354  SER A N     1 
ATOM   2478  C  CA    . SER A 1 354  ? -69.14300 -32.94700 -40.00600 1.000 67.66458  ? 354  SER A CA    1 
ATOM   2479  C  C     . SER A 1 354  ? -69.58000 -32.82300 -38.55100 1.000 67.54441  ? 354  SER A C     1 
ATOM   2480  O  O     . SER A 1 354  ? -68.81100 -33.06900 -37.61900 1.000 66.78672  ? 354  SER A O     1 
ATOM   2481  C  CB    . SER A 1 354  ? -69.64000 -34.27300 -40.59100 1.000 65.08532  ? 354  SER A CB    1 
ATOM   2482  O  OG    . SER A 1 354  ? -69.06800 -35.37600 -39.91000 1.000 62.48572  ? 354  SER A OG    1 
ATOM   2483  N  N     . LEU A 1 355  ? -70.84300 -32.42800 -38.37000 1.000 61.14136  ? 355  LEU A N     1 
ATOM   2484  C  CA    . LEU A 1 355  ? -71.39900 -32.31300 -37.02500 1.000 59.68865  ? 355  LEU A CA    1 
ATOM   2485  C  C     . LEU A 1 355  ? -71.47600 -33.67600 -36.35000 1.000 68.08111  ? 355  LEU A C     1 
ATOM   2486  O  O     . LEU A 1 355  ? -71.10700 -33.82500 -35.17900 1.000 68.12506  ? 355  LEU A O     1 
ATOM   2487  C  CB    . LEU A 1 355  ? -72.77800 -31.65600 -37.08700 1.000 67.27238  ? 355  LEU A CB    1 
ATOM   2488  C  CG    . LEU A 1 355  ? -73.58300 -31.57500 -35.78700 1.000 66.75316  ? 355  LEU A CG    1 
ATOM   2489  C  CD1   . LEU A 1 355  ? -72.80200 -30.84800 -34.70400 1.000 61.81863  ? 355  LEU A CD1   1 
ATOM   2490  C  CD2   . LEU A 1 355  ? -74.91800 -30.89300 -36.03800 1.000 72.40386  ? 355  LEU A CD2   1 
ATOM   2491  N  N     . GLY A 1 356  ? -71.95600 -34.68700 -37.07600 1.000 69.23449  ? 356  GLY A N     1 
ATOM   2492  C  CA    . GLY A 1 356  ? -71.99100 -36.02900 -36.52100 1.000 64.23260  ? 356  GLY A CA    1 
ATOM   2493  C  C     . GLY A 1 356  ? -70.60500 -36.60600 -36.31100 1.000 68.55844  ? 356  GLY A C     1 
ATOM   2494  O  O     . GLY A 1 356  ? -70.36000 -37.31400 -35.33000 1.000 60.02401  ? 356  GLY A O     1 
ATOM   2495  N  N     . GLY A 1 357  ? -69.68000 -36.31300 -37.22700 1.000 67.34815  ? 357  GLY A N     1 
ATOM   2496  C  CA    . GLY A 1 357  ? -68.30900 -36.76000 -37.04600 1.000 58.24683  ? 357  GLY A CA    1 
ATOM   2497  C  C     . GLY A 1 357  ? -67.66000 -36.15100 -35.81800 1.000 65.27817  ? 357  GLY A C     1 
ATOM   2498  O  O     . GLY A 1 357  ? -66.86000 -36.80000 -35.14100 1.000 63.96685  ? 357  GLY A O     1 
ATOM   2499  N  N     . HIS A 1 358  ? -67.99900 -34.89600 -35.51200 1.000 63.06475  ? 358  HIS A N     1 
ATOM   2500  C  CA    . HIS A 1 358  ? -67.46900 -34.25800 -34.31200 1.000 63.78863  ? 358  HIS A CA    1 
ATOM   2501  C  C     . HIS A 1 358  ? -67.99200 -34.93400 -33.05100 1.000 68.62015  ? 358  HIS A C     1 
ATOM   2502  O  O     . HIS A 1 358  ? -67.24700 -35.11400 -32.08000 1.000 72.26524  ? 358  HIS A O     1 
ATOM   2503  C  CB    . HIS A 1 358  ? -67.82300 -32.77100 -34.30600 1.000 59.14309  ? 358  HIS A CB    1 
ATOM   2504  C  CG    . HIS A 1 358  ? -67.18000 -32.00000 -33.19500 1.000 58.27381  ? 358  HIS A CG    1 
ATOM   2505  N  ND1   . HIS A 1 358  ? -66.10600 -31.16000 -33.39600 1.000 60.36766  ? 358  HIS A ND1   1 
ATOM   2506  C  CD2   . HIS A 1 358  ? -67.45900 -31.94400 -31.87100 1.000 59.72067  ? 358  HIS A CD2   1 
ATOM   2507  C  CE1   . HIS A 1 358  ? -65.75100 -30.61900 -32.24400 1.000 65.52398  ? 358  HIS A CE1   1 
ATOM   2508  N  NE2   . HIS A 1 358  ? -66.55600 -31.07800 -31.30300 1.000 63.96345  ? 358  HIS A NE2   1 
ATOM   2509  N  N     . ILE A 1 359  ? -69.27100 -35.31400 -33.04800 1.000 66.82915  ? 359  ILE A N     1 
ATOM   2510  C  CA    . ILE A 1 359  ? -69.86600 -35.92300 -31.86300 1.000 66.49589  ? 359  ILE A CA    1 
ATOM   2511  C  C     . ILE A 1 359  ? -69.29900 -37.32000 -31.63700 1.000 66.04878  ? 359  ILE A C     1 
ATOM   2512  O  O     . ILE A 1 359  ? -68.87800 -37.66500 -30.52700 1.000 70.98528  ? 359  ILE A O     1 
ATOM   2513  C  CB    . ILE A 1 359  ? -71.40000 -35.95100 -31.99000 1.000 66.60350  ? 359  ILE A CB    1 
ATOM   2514  C  CG1   . ILE A 1 359  ? -71.95300 -34.52800 -32.09600 1.000 62.88663  ? 359  ILE A CG1   1 
ATOM   2515  C  CG2   . ILE A 1 359  ? -72.02000 -36.68300 -30.81000 1.000 64.77463  ? 359  ILE A CG2   1 
ATOM   2516  C  CD1   . ILE A 1 359  ? -73.43100 -34.46600 -32.41500 1.000 67.60439  ? 359  ILE A CD1   1 
ATOM   2517  N  N     . ILE A 1 360  ? -69.27300 -38.14100 -32.69000 1.000 62.55945  ? 360  ILE A N     1 
ATOM   2518  C  CA    . ILE A 1 360  ? -68.82600 -39.52300 -32.54400 1.000 64.68145  ? 360  ILE A CA    1 
ATOM   2519  C  C     . ILE A 1 360  ? -67.33000 -39.58800 -32.25900 1.000 67.56252  ? 360  ILE A C     1 
ATOM   2520  O  O     . ILE A 1 360  ? -66.86700 -40.49500 -31.55500 1.000 61.22854  ? 360  ILE A O     1 
ATOM   2521  C  CB    . ILE A 1 360  ? -69.20200 -40.33500 -33.79800 1.000 66.99482  ? 360  ILE A CB    1 
ATOM   2522  C  CG1   . ILE A 1 360  ? -70.70900 -40.26500 -34.04400 1.000 66.81013  ? 360  ILE A CG1   1 
ATOM   2523  C  CG2   . ILE A 1 360  ? -68.76600 -41.78600 -33.65500 1.000 64.70971  ? 360  ILE A CG2   1 
ATOM   2524  C  CD1   . ILE A 1 360  ? -71.53600 -40.89200 -32.94500 1.000 70.39909  ? 360  ILE A CD1   1 
ATOM   2525  N  N     . SER A 1 361  ? -66.55200 -38.63800 -32.78900 1.000 69.24405  ? 361  SER A N     1 
ATOM   2526  C  CA    . SER A 1 361  ? -65.11200 -38.63700 -32.54500 1.000 60.35115  ? 361  SER A CA    1 
ATOM   2527  C  C     . SER A 1 361  ? -64.80600 -38.59000 -31.05400 1.000 70.29506  ? 361  SER A C     1 
ATOM   2528  O  O     . SER A 1 361  ? -63.90100 -39.28500 -30.57700 1.000 75.99918  ? 361  SER A O     1 
ATOM   2529  C  CB    . SER A 1 361  ? -64.45400 -37.45600 -33.25900 1.000 62.04630  ? 361  SER A CB    1 
ATOM   2530  O  OG    . SER A 1 361  ? -64.71700 -37.48900 -34.65100 1.000 70.76202  ? 361  SER A OG    1 
ATOM   2531  N  N     . ARG A 1 362  ? -65.55900 -37.78400 -30.30400 1.000 75.20431  ? 362  ARG A N     1 
ATOM   2532  C  CA    . ARG A 1 362  ? -65.41300 -37.67300 -28.85400 1.000 73.50806  ? 362  ARG A CA    1 
ATOM   2533  C  C     . ARG A 1 362  ? -63.97100 -37.35100 -28.47000 1.000 69.95923  ? 362  ARG A C     1 
ATOM   2534  O  O     . ARG A 1 362  ? -63.35000 -38.02400 -27.64500 1.000 67.90408  ? 362  ARG A O     1 
ATOM   2535  C  CB    . ARG A 1 362  ? -65.90500 -38.94400 -28.15800 1.000 71.52061  ? 362  ARG A CB    1 
ATOM   2536  C  CG    . ARG A 1 362  ? -67.36900 -38.88600 -27.75500 1.000 76.87611  ? 362  ARG A CG    1 
ATOM   2537  C  CD    . ARG A 1 362  ? -67.94400 -40.27100 -27.51100 1.000 87.90555  ? 362  ARG A CD    1 
ATOM   2538  N  NE    . ARG A 1 362  ? -68.22300 -40.97200 -28.76100 1.000 83.76779  ? 362  ARG A NE    1 
ATOM   2539  C  CZ    . ARG A 1 362  ? -69.03800 -42.01700 -28.86600 1.000 80.29950  ? 362  ARG A CZ    1 
ATOM   2540  N  NH1   . ARG A 1 362  ? -69.66200 -42.48200 -27.79300 1.000 80.23728  ? 362  ARG A NH1   1 
ATOM   2541  N  NH2   . ARG A 1 362  ? -69.23300 -42.59300 -30.04400 1.000 80.48024  ? 362  ARG A NH2   1 
ATOM   2542  N  N     . HIS A 1 363  ? -63.43500 -36.30900 -29.09700 1.000 65.84695  ? 363  HIS A N     1 
ATOM   2543  C  CA    . HIS A 1 363  ? -62.09800 -35.85400 -28.75700 1.000 69.99344  ? 363  HIS A CA    1 
ATOM   2544  C  C     . HIS A 1 363  ? -62.08600 -35.30000 -27.33400 1.000 74.02147  ? 363  HIS A C     1 
ATOM   2545  O  O     . HIS A 1 363  ? -63.01700 -34.59300 -26.93500 1.000 75.90470  ? 363  HIS A O     1 
ATOM   2546  C  CB    . HIS A 1 363  ? -61.62500 -34.78300 -29.73900 1.000 70.19672  ? 363  HIS A CB    1 
ATOM   2547  C  CG    . HIS A 1 363  ? -61.38400 -35.29400 -31.12500 1.000 68.03361  ? 363  HIS A CG    1 
ATOM   2548  N  ND1   . HIS A 1 363  ? -61.08900 -34.46300 -32.18400 1.000 67.04784  ? 363  HIS A ND1   1 
ATOM   2549  C  CD2   . HIS A 1 363  ? -61.39300 -36.55200 -31.62600 1.000 71.49926  ? 363  HIS A CD2   1 
ATOM   2550  C  CE1   . HIS A 1 363  ? -60.92800 -35.18600 -33.27800 1.000 61.72979  ? 363  HIS A CE1   1 
ATOM   2551  N  NE2   . HIS A 1 363  ? -61.10700 -36.45700 -32.96600 1.000 63.08763  ? 363  HIS A NE2   1 
ATOM   2552  N  N     . PRO A 1 364  ? -61.05700 -35.61100 -26.54400 1.000 67.87682  ? 364  PRO A N     1 
ATOM   2553  C  CA    . PRO A 1 364  ? -60.99900 -35.06500 -25.17900 1.000 71.64298  ? 364  PRO A CA    1 
ATOM   2554  C  C     . PRO A 1 364  ? -60.94200 -33.54900 -25.14500 1.000 74.06890  ? 364  PRO A C     1 
ATOM   2555  O  O     . PRO A 1 364  ? -61.45300 -32.93600 -24.19900 1.000 71.49487  ? 364  PRO A O     1 
ATOM   2556  C  CB    . PRO A 1 364  ? -59.72200 -35.69500 -24.60500 1.000 72.48735  ? 364  PRO A CB    1 
ATOM   2557  C  CG    . PRO A 1 364  ? -58.90800 -36.07600 -25.79900 1.000 72.95372  ? 364  PRO A CG    1 
ATOM   2558  C  CD    . PRO A 1 364  ? -59.89700 -36.46200 -26.85400 1.000 70.14442  ? 364  PRO A CD    1 
ATOM   2559  N  N     . ASP A 1 365  ? -60.34000 -32.92600 -26.15600 1.000 74.59919  ? 365  ASP A N     1 
ATOM   2560  C  CA    . ASP A 1 365  ? -60.25100 -31.47200 -26.26600 1.000 74.65563  ? 365  ASP A CA    1 
ATOM   2561  C  C     . ASP A 1 365  ? -61.29900 -30.91400 -27.21900 1.000 71.92521  ? 365  ASP A C     1 
ATOM   2562  O  O     . ASP A 1 365  ? -61.02700 -29.97900 -27.97800 1.000 74.41387  ? 365  ASP A O     1 
ATOM   2563  C  CB    . ASP A 1 365  ? -58.85100 -31.06700 -26.71100 1.000 81.23056  ? 365  ASP A CB    1 
ATOM   2564  C  CG    . ASP A 1 365  ? -58.39600 -31.81400 -27.95000 1.000 87.37257  ? 365  ASP A CG    1 
ATOM   2565  O  OD1   . ASP A 1 365  ? -58.81100 -32.97900 -28.12700 1.000 76.97535  ? 365  ASP A OD1   1 
ATOM   2566  O  OD2   . ASP A 1 365  ? -57.62800 -31.23700 -28.74700 1.000 97.03603  ? 365  ASP A OD2   1 
ATOM   2567  N  N     . SER A 1 366  ? -62.50600 -31.47400 -27.20100 1.000 73.91512  ? 366  SER A N     1 
ATOM   2568  C  CA    . SER A 1 366  ? -63.55100 -31.03000 -28.11400 1.000 72.32010  ? 366  SER A CA    1 
ATOM   2569  C  C     . SER A 1 366  ? -64.10000 -29.67600 -27.67900 1.000 72.88552  ? 366  SER A C     1 
ATOM   2570  O  O     . SER A 1 366  ? -64.38000 -29.45600 -26.49700 1.000 80.53474  ? 366  SER A O     1 
ATOM   2571  C  CB    . SER A 1 366  ? -64.67500 -32.06200 -28.17500 1.000 70.70962  ? 366  SER A CB    1 
ATOM   2572  O  OG    . SER A 1 366  ? -65.72300 -31.62300 -29.02200 1.000 64.26928  ? 366  SER A OG    1 
ATOM   2573  N  N     . ASP A 1 367  ? -64.25100 -28.76800 -28.64300 1.000 70.25823  ? 367  ASP A N     1 
ATOM   2574  C  CA    . ASP A 1 367  ? -64.79800 -27.44300 -28.38700 1.000 67.93508  ? 367  ASP A CA    1 
ATOM   2575  C  C     . ASP A 1 367  ? -66.32000 -27.40500 -28.42500 1.000 67.60028  ? 367  ASP A C     1 
ATOM   2576  O  O     . ASP A 1 367  ? -66.90400 -26.37200 -28.08000 1.000 67.45913  ? 367  ASP A O     1 
ATOM   2577  C  CB    . ASP A 1 367  ? -64.24500 -26.43700 -29.40300 1.000 70.92039  ? 367  ASP A CB    1 
ATOM   2578  C  CG    . ASP A 1 367  ? -62.94700 -25.79900 -28.94900 1.000 74.36324  ? 367  ASP A CG    1 
ATOM   2579  O  OD1   . ASP A 1 367  ? -62.45800 -26.15600 -27.85700 1.000 75.28128  ? 367  ASP A OD1   1 
ATOM   2580  O  OD2   . ASP A 1 367  ? -62.42000 -24.93600 -29.68300 1.000 75.15962  ? 367  ASP A OD2   1 
ATOM   2581  N  N     . LEU A 1 368  ? -66.97300 -28.49200 -28.83100 1.000 66.47357  ? 368  LEU A N     1 
ATOM   2582  C  CA    . LEU A 1 368  ? -68.42200 -28.51600 -28.97900 1.000 69.69988  ? 368  LEU A CA    1 
ATOM   2583  C  C     . LEU A 1 368  ? -69.12100 -29.53400 -28.09200 1.000 76.52361  ? 368  LEU A C     1 
ATOM   2584  O  O     . LEU A 1 368  ? -70.28200 -29.31900 -27.73800 1.000 81.57042  ? 368  LEU A O     1 
ATOM   2585  C  CB    . LEU A 1 368  ? -68.80700 -28.79500 -30.44000 1.000 62.74939  ? 368  LEU A CB    1 
ATOM   2586  C  CG    . LEU A 1 368  ? -68.23800 -27.84600 -31.49700 1.000 62.63694  ? 368  LEU A CG    1 
ATOM   2587  C  CD1   . LEU A 1 368  ? -68.82500 -28.16200 -32.86400 1.000 57.11168  ? 368  LEU A CD1   1 
ATOM   2588  C  CD2   . LEU A 1 368  ? -68.49200 -26.39500 -31.11900 1.000 64.07595  ? 368  LEU A CD2   1 
ATOM   2589  N  N     . ASN A 1 369  ? -68.45800 -30.63300 -27.73100 1.000 78.04811  ? 369  ASN A N     1 
ATOM   2590  C  CA    . ASN A 1 369  ? -69.09900 -31.63800 -26.88400 1.000 79.36287  ? 369  ASN A CA    1 
ATOM   2591  C  C     . ASN A 1 369  ? -69.47900 -31.11000 -25.50400 1.000 84.63709  ? 369  ASN A C     1 
ATOM   2592  O  O     . ASN A 1 369  ? -70.60200 -31.39500 -25.05300 1.000 89.91706  ? 369  ASN A O     1 
ATOM   2593  C  CB    . ASN A 1 369  ? -68.20300 -32.87800 -26.77800 1.000 78.65462  ? 369  ASN A CB    1 
ATOM   2594  C  CG    . ASN A 1 369  ? -68.05800 -33.60800 -28.09900 1.000 74.97205  ? 369  ASN A CG    1 
ATOM   2595  O  OD1   . ASN A 1 369  ? -68.90100 -33.48100 -28.98700 1.000 68.48112  ? 369  ASN A OD1   1 
ATOM   2596  N  ND2   . ASN A 1 369  ? -66.99100 -34.39000 -28.23000 1.000 70.84280  ? 369  ASN A ND2   1 
ATOM   2597  N  N     . PRO A 1 370  ? -68.62900 -30.36600 -24.78200 1.000 79.13240  ? 370  PRO A N     1 
ATOM   2598  C  CA    . PRO A 1 370  ? -69.06500 -29.85600 -23.47000 1.000 75.60628  ? 370  PRO A CA    1 
ATOM   2599  C  C     . PRO A 1 370  ? -70.25300 -28.91300 -23.54700 1.000 75.19808  ? 370  PRO A C     1 
ATOM   2600  O  O     . PRO A 1 370  ? -71.05000 -28.86300 -22.60100 1.000 83.93999  ? 370  PRO A O     1 
ATOM   2601  C  CB    . PRO A 1 370  ? -67.81300 -29.14500 -22.93400 1.000 78.10826  ? 370  PRO A CB    1 
ATOM   2602  C  CG    . PRO A 1 370  ? -66.97400 -28.88000 -24.13300 1.000 77.14499  ? 370  PRO A CG    1 
ATOM   2603  C  CD    . PRO A 1 370  ? -67.21600 -30.03800 -25.04000 1.000 77.32396  ? 370  PRO A CD    1 
ATOM   2604  N  N     . ILE A 1 371  ? -70.40100 -28.16400 -24.64100 1.000 65.63224  ? 371  ILE A N     1 
ATOM   2605  C  CA    . ILE A 1 371  ? -71.55300 -27.27900 -24.77800 1.000 69.42229  ? 371  ILE A CA    1 
ATOM   2606  C  C     . ILE A 1 371  ? -72.82700 -28.08900 -24.97900 1.000 84.08580  ? 371  ILE A C     1 
ATOM   2607  O  O     . ILE A 1 371  ? -73.87200 -27.78800 -24.38900 1.000 91.42622  ? 371  ILE A O     1 
ATOM   2608  C  CB    . ILE A 1 371  ? -71.33100 -26.28500 -25.93200 1.000 71.01340  ? 371  ILE A CB    1 
ATOM   2609  C  CG1   . ILE A 1 371  ? -70.01100 -25.53600 -25.75300 1.000 68.94286  ? 371  ILE A CG1   1 
ATOM   2610  C  CG2   . ILE A 1 371  ? -72.49400 -25.30800 -26.02300 1.000 73.89091  ? 371  ILE A CG2   1 
ATOM   2611  C  CD1   . ILE A 1 371  ? -69.65500 -24.65000 -26.92900 1.000 67.66443  ? 371  ILE A CD1   1 
ATOM   2612  N  N     . LEU A 1 372  ? -72.76300 -29.12900 -25.81400 1.000 88.07249  ? 372  LEU A N     1 
ATOM   2613  C  CA    . LEU A 1 372  ? -73.93800 -29.94800 -26.08700 1.000 85.79466  ? 372  LEU A CA    1 
ATOM   2614  C  C     . LEU A 1 372  ? -74.29600 -30.86300 -24.92400 1.000 89.25190  ? 372  LEU A C     1 
ATOM   2615  O  O     . LEU A 1 372  ? -75.46000 -31.26200 -24.80300 1.000 87.84372  ? 372  LEU A O     1 
ATOM   2616  C  CB    . LEU A 1 372  ? -73.71400 -30.78400 -27.34700 1.000 81.02366  ? 372  LEU A CB    1 
ATOM   2617  C  CG    . LEU A 1 372  ? -73.45200 -30.03500 -28.65400 1.000 85.21728  ? 372  LEU A CG    1 
ATOM   2618  C  CD1   . LEU A 1 372  ? -73.16900 -31.01800 -29.78000 1.000 74.21870  ? 372  LEU A CD1   1 
ATOM   2619  C  CD2   . LEU A 1 372  ? -74.62700 -29.13400 -29.00300 1.000 83.93408  ? 372  LEU A CD2   1 
ATOM   2620  N  N     . ALA A 1 373  ? -73.33000 -31.20100 -24.06700 1.000 79.91049  ? 373  ALA A N     1 
ATOM   2621  C  CA    . ALA A 1 373  ? -73.59200 -32.13700 -22.98000 1.000 86.37211  ? 373  ALA A CA    1 
ATOM   2622  C  C     . ALA A 1 373  ? -74.38700 -31.51300 -21.84200 1.000 90.03756  ? 373  ALA A C     1 
ATOM   2623  O  O     . ALA A 1 373  ? -74.98000 -32.24800 -21.04400 1.000 90.87492  ? 373  ALA A O     1 
ATOM   2624  C  CB    . ALA A 1 373  ? -72.27500 -32.69600 -22.43900 1.000 83.13890  ? 373  ALA A CB    1 
ATOM   2625  N  N     . VAL A 1 374  ? -74.42300 -30.18300 -21.74900 1.000 92.77601  ? 374  VAL A N     1 
ATOM   2626  C  CA    . VAL A 1 374  ? -75.01700 -29.50400 -20.60400 1.000 91.67321  ? 374  VAL A CA    1 
ATOM   2627  C  C     . VAL A 1 374  ? -76.39900 -28.94100 -20.91600 1.000 95.07267  ? 374  VAL A C     1 
ATOM   2628  O  O     . VAL A 1 374  ? -76.96700 -28.22000 -20.09000 1.000 98.11439  ? 374  VAL A O     1 
ATOM   2629  C  CB    . VAL A 1 374  ? -74.09100 -28.39600 -20.07900 1.000 76.74271  ? 374  VAL A CB    1 
ATOM   2630  C  CG1   . VAL A 1 374  ? -72.76800 -28.98500 -19.62900 1.000 86.07341  ? 374  VAL A CG1   1 
ATOM   2631  C  CG2   . VAL A 1 374  ? -73.87600 -27.33800 -21.14900 1.000 70.68655  ? 374  VAL A CG2   1 
ATOM   2632  N  N     . GLY A 1 375  ? -76.96000 -29.25600 -22.07900 1.000 94.06720  ? 375  GLY A N     1 
ATOM   2633  C  CA    . GLY A 1 375  ? -78.24700 -28.69400 -22.43600 1.000 95.53117  ? 375  GLY A CA    1 
ATOM   2634  C  C     . GLY A 1 375  ? -79.24500 -29.68700 -22.99200 1.000 97.88109  ? 375  GLY A C     1 
ATOM   2635  O  O     . GLY A 1 375  ? -80.08200 -29.32700 -23.82600 1.000 90.37030  ? 375  GLY A O     1 
ATOM   2636  N  N     . ASN A 1 376  ? -79.15900 -30.93700 -22.54200 1.000 99.80591  ? 376  ASN A N     1 
ATOM   2637  C  CA    . ASN A 1 376  ? -80.14200 -31.97600 -22.85000 1.000 98.48080  ? 376  ASN A CA    1 
ATOM   2638  C  C     . ASN A 1 376  ? -80.32100 -32.13800 -24.36300 1.000 98.61910  ? 376  ASN A C     1 
ATOM   2639  O  O     . ASN A 1 376  ? -81.36100 -31.82000 -24.94100 1.000 99.86452  ? 376  ASN A O     1 
ATOM   2640  C  CB    . ASN A 1 376  ? -81.47600 -31.66500 -22.16600 1.000 89.40467  ? 376  ASN A CB    1 
ATOM   2641  C  CG    . ASN A 1 376  ? -81.32400 -31.42400 -20.67800 1.000 91.97436  ? 376  ASN A CG    1 
ATOM   2642  O  OD1   . ASN A 1 376  ? -81.22300 -30.28200 -20.23000 1.000 91.79641  ? 376  ASN A OD1   1 
ATOM   2643  N  ND2   . ASN A 1 376  ? -81.29800 -32.50200 -19.90300 1.000 85.97436  ? 376  ASN A ND2   1 
ATOM   2644  N  N     . CYS A 1 377  ? -79.26600 -32.64700 -24.99000 1.000 93.45514  ? 377  CYS A N     1 
ATOM   2645  C  CA    . CYS A 1 377  ? -79.26800 -32.92400 -26.41800 1.000 93.92646  ? 377  CYS A CA    1 
ATOM   2646  C  C     . CYS A 1 377  ? -79.48000 -34.41300 -26.65400 1.000 90.98803  ? 377  CYS A C     1 
ATOM   2647  O  O     . CYS A 1 377  ? -78.94800 -35.25100 -25.92000 1.000 89.04108  ? 377  CYS A O     1 
ATOM   2648  C  CB    . CYS A 1 377  ? -77.96100 -32.46800 -27.06800 1.000 98.29288  ? 377  CYS A CB    1 
ATOM   2649  S  SG    . CYS A 1 377  ? -77.76000 -30.67300 -27.16100 1.000 101.40971 ? 377  CYS A SG    1 
ATOM   2650  N  N     . THR A 1 378  ? -80.26400 -34.73600 -27.67900 1.000 86.23591  ? 378  THR A N     1 
ATOM   2651  C  CA    . THR A 1 378  ? -80.57400 -36.11400 -28.02500 1.000 87.40609  ? 378  THR A CA    1 
ATOM   2652  C  C     . THR A 1 378  ? -80.01200 -36.44500 -29.40000 1.000 85.25764  ? 378  THR A C     1 
ATOM   2653  O  O     . THR A 1 378  ? -79.88300 -35.57300 -30.26500 1.000 80.41375  ? 378  THR A O     1 
ATOM   2654  C  CB    . THR A 1 378  ? -82.08600 -36.37300 -28.00700 1.000 89.24641  ? 378  THR A CB    1 
ATOM   2655  O  OG1   . THR A 1 378  ? -82.75000 -35.40100 -28.82500 1.000 89.10444  ? 378  THR A OG1   1 
ATOM   2656  C  CG2   . THR A 1 378  ? -82.62400 -36.28900 -26.58700 1.000 82.52053  ? 378  THR A CG2   1 
ATOM   2657  N  N     . LEU A 1 379  ? -79.68100 -37.71800 -29.59300 1.000 84.27593  ? 379  LEU A N     1 
ATOM   2658  C  CA    . LEU A 1 379  ? -79.11900 -38.21400 -30.84000 1.000 82.79783  ? 379  LEU A CA    1 
ATOM   2659  C  C     . LEU A 1 379  ? -80.10800 -39.16900 -31.49200 1.000 79.56840  ? 379  LEU A C     1 
ATOM   2660  O  O     . LEU A 1 379  ? -80.55600 -40.13100 -30.85900 1.000 79.53469  ? 379  LEU A O     1 
ATOM   2661  C  CB    . LEU A 1 379  ? -77.78200 -38.91500 -30.59200 1.000 70.24435  ? 379  LEU A CB    1 
ATOM   2662  C  CG    . LEU A 1 379  ? -76.77500 -38.12400 -29.75500 1.000 68.49580  ? 379  LEU A CG    1 
ATOM   2663  C  CD1   . LEU A 1 379  ? -75.60100 -38.99900 -29.35700 1.000 75.07897  ? 379  LEU A CD1   1 
ATOM   2664  C  CD2   . LEU A 1 379  ? -76.29800 -36.89700 -30.51400 1.000 78.45905  ? 379  LEU A CD2   1 
ATOM   2665  N  N     . ASN A 1 380  ? -80.44800 -38.90000 -32.75100 1.000 74.75374  ? 380  ASN A N     1 
ATOM   2666  C  CA    . ASN A 1 380  ? -81.39700 -39.72700 -33.49600 1.000 80.67496  ? 380  ASN A CA    1 
ATOM   2667  C  C     . ASN A 1 380  ? -80.61700 -40.81600 -34.21900 1.000 81.41851  ? 380  ASN A C     1 
ATOM   2668  O  O     . ASN A 1 380  ? -80.12800 -40.62900 -35.33400 1.000 81.05071  ? 380  ASN A O     1 
ATOM   2669  C  CB    . ASN A 1 380  ? -82.21100 -38.87700 -34.46300 1.000 80.06587  ? 380  ASN A CB    1 
ATOM   2670  C  CG    . ASN A 1 380  ? -82.99400 -37.78700 -33.76100 1.000 80.69578  ? 380  ASN A CG    1 
ATOM   2671  O  OD1   . ASN A 1 380  ? -83.51900 -37.99000 -32.66700 1.000 89.30167  ? 380  ASN A OD1   1 
ATOM   2672  N  ND2   . ASN A 1 380  ? -83.07600 -36.62000 -34.38900 1.000 78.63266  ? 380  ASN A ND2   1 
ATOM   2673  N  N     . LEU A 1 381  ? -80.50000 -41.97200 -33.57400 1.000 75.84924  ? 381  LEU A N     1 
ATOM   2674  C  CA    . LEU A 1 381  ? -79.81000 -43.11300 -34.15400 1.000 76.02032  ? 381  LEU A CA    1 
ATOM   2675  C  C     . LEU A 1 381  ? -80.77400 -43.92100 -35.01100 1.000 83.10978  ? 381  LEU A C     1 
ATOM   2676  O  O     . LEU A 1 381  ? -81.93400 -44.12300 -34.64300 1.000 95.58991  ? 381  LEU A O     1 
ATOM   2677  C  CB    . LEU A 1 381  ? -79.21600 -44.00200 -33.06200 1.000 74.38641  ? 381  LEU A CB    1 
ATOM   2678  C  CG    . LEU A 1 381  ? -78.52800 -43.30500 -31.88800 1.000 80.12863  ? 381  LEU A CG    1 
ATOM   2679  C  CD1   . LEU A 1 381  ? -77.93400 -44.33800 -30.94700 1.000 83.51770  ? 381  LEU A CD1   1 
ATOM   2680  C  CD2   . LEU A 1 381  ? -77.46000 -42.33600 -32.37200 1.000 78.50233  ? 381  LEU A CD2   1 
ATOM   2681  N  N     . LEU A 1 382  ? -80.28800 -44.37900 -36.16100 1.000 75.21331  ? 382  LEU A N     1 
ATOM   2682  C  CA    . LEU A 1 382  ? -81.08100 -45.20200 -37.06200 1.000 74.52936  ? 382  LEU A CA    1 
ATOM   2683  C  C     . LEU A 1 382  ? -80.31600 -46.47600 -37.37300 1.000 80.95280  ? 382  LEU A C     1 
ATOM   2684  O  O     . LEU A 1 382  ? -79.16200 -46.42300 -37.80900 1.000 83.66000  ? 382  LEU A O     1 
ATOM   2685  C  CB    . LEU A 1 382  ? -81.41700 -44.45500 -38.35500 1.000 77.82637  ? 382  LEU A CB    1 
ATOM   2686  C  CG    . LEU A 1 382  ? -82.31800 -45.20200 -39.33900 1.000 87.63227  ? 382  LEU A CG    1 
ATOM   2687  C  CD1   . LEU A 1 382  ? -83.57400 -45.69600 -38.64300 1.000 87.89385  ? 382  LEU A CD1   1 
ATOM   2688  C  CD2   . LEU A 1 382  ? -82.67300 -44.31400 -40.52000 1.000 80.71806  ? 382  LEU A CD2   1 
ATOM   2689  N  N     . SER A 1 383  ? -80.95800 -47.61300 -37.13900 1.000 89.84517  ? 383  SER A N     1 
ATOM   2690  C  CA    . SER A 1 383  ? -80.41000 -48.92200 -37.45000 1.000 89.00395  ? 383  SER A CA    1 
ATOM   2691  C  C     . SER A 1 383  ? -81.20000 -49.54200 -38.59500 1.000 92.60731  ? 383  SER A C     1 
ATOM   2692  O  O     . SER A 1 383  ? -82.19700 -48.98900 -39.07000 1.000 91.29520  ? 383  SER A O     1 
ATOM   2693  C  CB    . SER A 1 383  ? -80.43600 -49.82400 -36.21300 1.000 91.26811  ? 383  SER A CB    1 
ATOM   2694  O  OG    . SER A 1 383  ? -79.97600 -51.12800 -36.52300 1.000 97.51408  ? 383  SER A OG    1 
ATOM   2695  N  N     . LYS A 1 384  ? -80.74100 -50.71000 -39.04700 1.000 98.36898  ? 384  LYS A N     1 
ATOM   2696  C  CA    . LYS A 1 384  ? -81.51400 -51.46300 -40.02400 1.000 100.45518 ? 384  LYS A CA    1 
ATOM   2697  C  C     . LYS A 1 384  ? -82.75900 -52.07800 -39.40100 1.000 105.19336 ? 384  LYS A C     1 
ATOM   2698  O  O     . LYS A 1 384  ? -83.70800 -52.39900 -40.12600 1.000 101.60451 ? 384  LYS A O     1 
ATOM   2699  C  CB    . LYS A 1 384  ? -80.64800 -52.55200 -40.65800 1.000 88.03576  ? 384  LYS A CB    1 
ATOM   2700  C  CG    . LYS A 1 384  ? -81.13400 -53.00500 -42.02400 1.000 86.63235  ? 384  LYS A CG    1 
ATOM   2701  C  CD    . LYS A 1 384  ? -80.18300 -54.01100 -42.64500 1.000 92.94873  ? 384  LYS A CD    1 
ATOM   2702  C  CE    . LYS A 1 384  ? -80.86200 -55.35300 -42.84500 1.000 101.22417 ? 384  LYS A CE    1 
ATOM   2703  N  NZ    . LYS A 1 384  ? -79.98200 -56.31600 -43.56200 1.000 106.87655 ? 384  LYS A NZ    1 
ATOM   2704  N  N     . GLU A 1 385  ? -82.77900 -52.23800 -38.07800 1.000 105.82526 ? 385  GLU A N     1 
ATOM   2705  C  CA    . GLU A 1 385  ? -83.94400 -52.76900 -37.38300 1.000 104.88798 ? 385  GLU A CA    1 
ATOM   2706  C  C     . GLU A 1 385  ? -84.96200 -51.69300 -37.03400 1.000 99.00628  ? 385  GLU A C     1 
ATOM   2707  O  O     . GLU A 1 385  ? -86.15500 -51.99800 -36.92100 1.000 108.12491 ? 385  GLU A O     1 
ATOM   2708  C  CB    . GLU A 1 385  ? -83.51200 -53.49800 -36.10700 1.000 102.81148 ? 385  GLU A CB    1 
ATOM   2709  C  CG    . GLU A 1 385  ? -82.56700 -52.70200 -35.22200 1.000 100.61526 ? 385  GLU A CG    1 
ATOM   2710  C  CD    . GLU A 1 385  ? -82.18000 -53.45000 -33.96100 1.000 112.18384 ? 385  GLU A CD    1 
ATOM   2711  O  OE1   . GLU A 1 385  ? -82.91200 -53.34100 -32.95400 1.000 118.97417 ? 385  GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A 1 385  ? -81.14500 -54.14900 -33.97600 1.000 113.79349 ? 385  GLU A OE2   1 
ATOM   2713  N  N     . GLY A 1 386  ? -84.53200 -50.45400 -36.86000 1.000 95.71229  ? 386  GLY A N     1 
ATOM   2714  C  CA    . GLY A 1 386  ? -85.46000 -49.38200 -36.56500 1.000 101.63567 ? 386  GLY A CA    1 
ATOM   2715  C  C     . GLY A 1 386  ? -84.75600 -48.19100 -35.95400 1.000 94.51084  ? 386  GLY A C     1 
ATOM   2716  O  O     . GLY A 1 386  ? -83.54300 -48.19100 -35.73700 1.000 87.19312  ? 386  GLY A O     1 
ATOM   2717  N  N     . LYS A 1 387  ? -85.55900 -47.16500 -35.67800 1.000 93.01310  ? 387  LYS A N     1 
ATOM   2718  C  CA    . LYS A 1 387  ? -85.05500 -45.92900 -35.10100 1.000 85.07063  ? 387  LYS A CA    1 
ATOM   2719  C  C     . LYS A 1 387  ? -84.68700 -46.13000 -33.63100 1.000 92.27497  ? 387  LYS A C     1 
ATOM   2720  O  O     . LYS A 1 387  ? -85.02500 -47.13900 -33.00300 1.000 96.49738  ? 387  LYS A O     1 
ATOM   2721  C  CB    . LYS A 1 387  ? -86.09300 -44.81400 -35.22900 1.000 77.78060  ? 387  LYS A CB    1 
ATOM   2722  C  CG    . LYS A 1 387  ? -86.21900 -44.22000 -36.62100 1.000 82.66084  ? 387  LYS A CG    1 
ATOM   2723  C  CD    . LYS A 1 387  ? -87.66800 -43.89300 -36.94600 1.000 96.48626  ? 387  LYS A CD    1 
ATOM   2724  C  CE    . LYS A 1 387  ? -87.85200 -42.41500 -37.25300 1.000 93.50800  ? 387  LYS A CE    1 
ATOM   2725  N  NZ    . LYS A 1 387  ? -87.28900 -42.04500 -38.58000 1.000 88.25415  ? 387  LYS A NZ    1 
ATOM   2726  N  N     . ARG A 1 388  ? -83.98500 -45.14000 -33.08400 1.000 82.32746  ? 388  ARG A N     1 
ATOM   2727  C  CA    . ARG A 1 388  ? -83.60000 -45.11900 -31.68000 1.000 83.18866  ? 388  ARG A CA    1 
ATOM   2728  C  C     . ARG A 1 388  ? -83.12600 -43.71500 -31.33900 1.000 85.31954  ? 388  ARG A C     1 
ATOM   2729  O  O     . ARG A 1 388  ? -82.49800 -43.05400 -32.16900 1.000 91.59606  ? 388  ARG A O     1 
ATOM   2730  C  CB    . ARG A 1 388  ? -82.49700 -46.14500 -31.38100 1.000 76.88295  ? 388  ARG A CB    1 
ATOM   2731  C  CG    . ARG A 1 388  ? -82.10300 -46.22600 -29.91500 1.000 72.64568  ? 388  ARG A CG    1 
ATOM   2732  C  CD    . ARG A 1 388  ? -81.44900 -47.55900 -29.58900 1.000 69.95857  ? 388  ARG A CD    1 
ATOM   2733  N  NE    . ARG A 1 388  ? -80.58700 -47.47200 -28.41400 1.000 74.82414  ? 388  ARG A NE    1 
ATOM   2734  C  CZ    . ARG A 1 388  ? -79.26400 -47.35900 -28.46300 1.000 84.63130  ? 388  ARG A CZ    1 
ATOM   2735  N  NH1   . ARG A 1 388  ? -78.64500 -47.31400 -29.63200 1.000 81.69206  ? 388  ARG A NH1   1 
ATOM   2736  N  NH2   . ARG A 1 388  ? -78.56000 -47.28700 -27.34100 1.000 91.59591  ? 388  ARG A NH2   1 
ATOM   2737  N  N     . GLN A 1 389  ? -83.43400 -43.26300 -30.12600 1.000 83.72662  ? 389  GLN A N     1 
ATOM   2738  C  CA    . GLN A 1 389  ? -83.07900 -41.91900 -29.68100 1.000 85.61825  ? 389  GLN A CA    1 
ATOM   2739  C  C     . GLN A 1 389  ? -82.48100 -42.00300 -28.28400 1.000 82.52577  ? 389  GLN A C     1 
ATOM   2740  O  O     . GLN A 1 389  ? -83.19500 -42.28100 -27.31500 1.000 83.96631  ? 389  GLN A O     1 
ATOM   2741  C  CB    . GLN A 1 389  ? -84.29500 -40.99300 -29.70200 1.000 81.58389  ? 389  GLN A CB    1 
ATOM   2742  C  CG    . GLN A 1 389  ? -83.96700 -39.53700 -29.41900 1.000 86.72402  ? 389  GLN A CG    1 
ATOM   2743  C  CD    . GLN A 1 389  ? -85.18900 -38.72800 -29.03300 1.000 96.85651  ? 389  GLN A CD    1 
ATOM   2744  O  OE1   . GLN A 1 389  ? -85.94200 -38.27200 -29.89300 1.000 94.88793  ? 389  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN A 1 389  ? -85.39100 -38.54500 -27.73300 1.000 96.62817  ? 389  GLN A NE2   1 
ATOM   2746  N  N     . ILE A 1 390  ? -81.17700 -41.76300 -28.18300 1.000 78.84755  ? 390  ILE A N     1 
ATOM   2747  C  CA    . ILE A 1 390  ? -80.48300 -41.75300 -26.89800 1.000 81.89238  ? 390  ILE A CA    1 
ATOM   2748  C  C     . ILE A 1 390  ? -80.06600 -40.32100 -26.58300 1.000 87.46741  ? 390  ILE A C     1 
ATOM   2749  O  O     . ILE A 1 390  ? -79.86000 -39.52000 -27.50700 1.000 86.38829  ? 390  ILE A O     1 
ATOM   2750  C  CB    . ILE A 1 390  ? -79.26900 -42.69500 -26.90500 1.000 81.87470  ? 390  ILE A CB    1 
ATOM   2751  C  CG1   . ILE A 1 390  ? -78.22800 -42.22100 -27.92200 1.000 81.20125  ? 390  ILE A CG1   1 
ATOM   2752  C  CG2   . ILE A 1 390  ? -79.70400 -44.11900 -27.20400 1.000 83.04865  ? 390  ILE A CG2   1 
ATOM   2753  C  CD1   . ILE A 1 390  ? -76.89000 -42.91200 -27.79200 1.000 82.36587  ? 390  ILE A CD1   1 
ATOM   2754  N  N     . PRO A 1 391  ? -79.94000 -39.94900 -25.30900 1.000 84.73894  ? 391  PRO A N     1 
ATOM   2755  C  CA    . PRO A 1 391  ? -79.49800 -38.59100 -24.97500 1.000 83.10194  ? 391  PRO A CA    1 
ATOM   2756  C  C     . PRO A 1 391  ? -77.98300 -38.46000 -24.93400 1.000 86.12049  ? 391  PRO A C     1 
ATOM   2757  O  O     . PRO A 1 391  ? -77.25900 -39.36300 -24.50800 1.000 89.87207  ? 391  PRO A O     1 
ATOM   2758  C  CB    . PRO A 1 391  ? -80.10800 -38.37400 -23.58400 1.000 82.57937  ? 391  PRO A CB    1 
ATOM   2759  C  CG    . PRO A 1 391  ? -80.11600 -39.73700 -22.98100 1.000 82.81217  ? 391  PRO A CG    1 
ATOM   2760  C  CD    . PRO A 1 391  ? -80.35000 -40.70900 -24.11400 1.000 78.24161  ? 391  PRO A CD    1 
ATOM   2761  N  N     . LEU A 1 392  ? -77.50500 -37.30800 -25.39600 1.000 85.22111  ? 392  LEU A N     1 
ATOM   2762  C  CA    . LEU A 1 392  ? -76.08300 -36.97300 -25.36400 1.000 83.93002  ? 392  LEU A CA    1 
ATOM   2763  C  C     . LEU A 1 392  ? -75.74400 -36.51600 -23.95100 1.000 84.99933  ? 392  LEU A C     1 
ATOM   2764  O  O     . LEU A 1 392  ? -76.06700 -35.39400 -23.55200 1.000 93.19352  ? 392  LEU A O     1 
ATOM   2765  C  CB    . LEU A 1 392  ? -75.77100 -35.90600 -26.40800 1.000 88.40823  ? 392  LEU A CB    1 
ATOM   2766  C  CG    . LEU A 1 392  ? -74.47100 -35.10000 -26.37600 1.000 88.23919  ? 392  LEU A CG    1 
ATOM   2767  C  CD1   . LEU A 1 392  ? -73.25900 -35.99200 -26.20500 1.000 80.29041  ? 392  LEU A CD1   1 
ATOM   2768  C  CD2   . LEU A 1 392  ? -74.35000 -34.29000 -27.65500 1.000 85.16630  ? 392  LEU A CD2   1 
ATOM   2769  N  N     . ASN A 1 393  ? -75.09300 -37.38500 -23.18600 1.000 79.11165  ? 393  ASN A N     1 
ATOM   2770  C  CA    . ASN A 1 393  ? -74.91600 -37.16900 -21.75300 1.000 85.70012  ? 393  ASN A CA    1 
ATOM   2771  C  C     . ASN A 1 393  ? -73.48900 -37.54400 -21.36400 1.000 89.58228  ? 393  ASN A C     1 
ATOM   2772  O  O     . ASN A 1 393  ? -72.57700 -37.58500 -22.19800 1.000 86.31014  ? 393  ASN A O     1 
ATOM   2773  C  CB    . ASN A 1 393  ? -75.97600 -37.95700 -20.96800 1.000 91.85818  ? 393  ASN A CB    1 
ATOM   2774  C  CG    . ASN A 1 393  ? -76.00600 -39.43100 -21.34100 1.000 90.47374  ? 393  ASN A CG    1 
ATOM   2775  O  OD1   . ASN A 1 393  ? -74.96600 -40.07200 -21.49200 1.000 93.34869  ? 393  ASN A OD1   1 
ATOM   2776  N  ND2   . ASN A 1 393  ? -77.20700 -39.97300 -21.49300 1.000 91.54380  ? 393  ASN A ND2   1 
ATOM   2777  N  N     . GLU A 1 394  ? -73.29300 -37.82800 -20.07300 1.000 94.02606  ? 394  GLU A N     1 
ATOM   2778  C  CA    . GLU A 1 394  ? -71.95800 -38.11500 -19.55700 1.000 91.46880  ? 394  GLU A CA    1 
ATOM   2779  C  C     . GLU A 1 394  ? -71.47300 -39.48800 -20.00500 1.000 91.50762  ? 394  GLU A C     1 
ATOM   2780  O  O     . GLU A 1 394  ? -70.35200 -39.62700 -20.50800 1.000 98.04831  ? 394  GLU A O     1 
ATOM   2781  C  CB    . GLU A 1 394  ? -71.95300 -38.02500 -18.02800 1.000 100.93057 ? 394  GLU A CB    1 
ATOM   2782  C  CG    . GLU A 1 394  ? -72.27300 -36.64900 -17.46200 1.000 105.86482 ? 394  GLU A CG    1 
ATOM   2783  C  CD    . GLU A 1 394  ? -73.76200 -36.36300 -17.39200 1.000 104.99741 ? 394  GLU A CD    1 
ATOM   2784  O  OE1   . GLU A 1 394  ? -74.39200 -36.20100 -18.45900 1.000 103.25098 ? 394  GLU A OE1   1 
ATOM   2785  O  OE2   . GLU A 1 394  ? -74.30300 -36.30000 -16.26800 1.000 97.09755  ? 394  GLU A OE2   1 
ATOM   2786  N  N     . GLN A 1 395  ? -72.30400 -40.51900 -19.82200 1.000 99.54134  ? 395  GLN A N     1 
ATOM   2787  C  CA    . GLN A 1 395  ? -71.88100 -41.87900 -20.14400 1.000 99.57672  ? 395  GLN A CA    1 
ATOM   2788  C  C     . GLN A 1 395  ? -71.62100 -42.05700 -21.63400 1.000 93.75123  ? 395  GLN A C     1 
ATOM   2789  O  O     . GLN A 1 395  ? -70.82700 -42.92200 -22.02200 1.000 96.41064  ? 395  GLN A O     1 
ATOM   2790  C  CB    . GLN A 1 395  ? -72.92700 -42.88800 -19.66800 1.000 96.27324  ? 395  GLN A CB    1 
ATOM   2791  C  CG    . GLN A 1 395  ? -73.13500 -42.91600 -18.16100 1.000 94.86496  ? 395  GLN A CG    1 
ATOM   2792  C  CD    . GLN A 1 395  ? -74.19000 -41.93200 -17.69500 1.000 102.65122 ? 395  GLN A CD    1 
ATOM   2793  O  OE1   . GLN A 1 395  ? -73.98800 -40.71800 -17.74100 1.000 102.04016 ? 395  GLN A OE1   1 
ATOM   2794  N  NE2   . GLN A 1 395  ? -75.32400 -42.45200 -17.24100 1.000 105.78550 ? 395  GLN A NE2   1 
ATOM   2795  N  N     . PHE A 1 396  ? -72.27100 -41.25700 -22.48100 1.000 88.76100  ? 396  PHE A N     1 
ATOM   2796  C  CA    . PHE A 1 396  ? -72.04900 -41.37200 -23.91900 1.000 90.49886  ? 396  PHE A CA    1 
ATOM   2797  C  C     . PHE A 1 396  ? -70.66900 -40.85500 -24.30500 1.000 91.06112  ? 396  PHE A C     1 
ATOM   2798  O  O     . PHE A 1 396  ? -69.92900 -41.52100 -25.03900 1.000 92.54738  ? 396  PHE A O     1 
ATOM   2799  C  CB    . PHE A 1 396  ? -73.13800 -40.61800 -24.68200 1.000 88.82695  ? 396  PHE A CB    1 
ATOM   2800  C  CG    . PHE A 1 396  ? -72.84800 -40.45800 -26.14600 1.000 83.40685  ? 396  PHE A CG    1 
ATOM   2801  C  CD1   . PHE A 1 396  ? -73.05300 -41.50700 -27.02500 1.000 87.61072  ? 396  PHE A CD1   1 
ATOM   2802  C  CD2   . PHE A 1 396  ? -72.36200 -39.26100 -26.64300 1.000 81.76214  ? 396  PHE A CD2   1 
ATOM   2803  C  CE1   . PHE A 1 396  ? -72.78300 -41.36200 -28.37100 1.000 86.52703  ? 396  PHE A CE1   1 
ATOM   2804  C  CE2   . PHE A 1 396  ? -72.09000 -39.11000 -27.98800 1.000 83.91233  ? 396  PHE A CE2   1 
ATOM   2805  C  CZ    . PHE A 1 396  ? -72.30000 -40.16300 -28.85300 1.000 80.07349  ? 396  PHE A CZ    1 
ATOM   2806  N  N     . LEU A 1 397  ? -70.30800 -39.66100 -23.82600 1.000 92.72459  ? 397  LEU A N     1 
ATOM   2807  C  CA    . LEU A 1 397  ? -68.99900 -39.10200 -24.14700 1.000 83.15930  ? 397  LEU A CA    1 
ATOM   2808  C  C     . LEU A 1 397  ? -67.87200 -39.94600 -23.56900 1.000 86.59296  ? 397  LEU A C     1 
ATOM   2809  O  O     . LEU A 1 397  ? -66.77600 -39.99400 -24.14000 1.000 87.91335  ? 397  LEU A O     1 
ATOM   2810  C  CB    . LEU A 1 397  ? -68.90600 -37.66200 -23.64400 1.000 78.63243  ? 397  LEU A CB    1 
ATOM   2811  C  CG    . LEU A 1 397  ? -69.86700 -36.67400 -24.30900 1.000 72.66191  ? 397  LEU A CG    1 
ATOM   2812  C  CD1   . LEU A 1 397  ? -69.68400 -35.27400 -23.74500 1.000 74.88335  ? 397  LEU A CD1   1 
ATOM   2813  C  CD2   . LEU A 1 397  ? -69.67200 -36.67700 -25.81700 1.000 72.47210  ? 397  LEU A CD2   1 
ATOM   2814  N  N     . SER A 1 398  ? -68.11700 -40.61700 -22.44500 1.000 94.39119  ? 398  SER A N     1 
ATOM   2815  C  CA    . SER A 1 398  ? -67.16000 -41.56300 -21.88800 1.000 93.49282  ? 398  SER A CA    1 
ATOM   2816  C  C     . SER A 1 398  ? -67.16100 -42.89600 -22.62300 1.000 95.31614  ? 398  SER A C     1 
ATOM   2817  O  O     . SER A 1 398  ? -66.36600 -43.77700 -22.27600 1.000 99.39402  ? 398  SER A O     1 
ATOM   2818  C  CB    . SER A 1 398  ? -67.45200 -41.79100 -20.40200 1.000 97.76456  ? 398  SER A CB    1 
ATOM   2819  O  OG    . SER A 1 398  ? -67.43000 -40.56800 -19.68700 1.000 90.40034  ? 398  SER A OG    1 
ATOM   2820  N  N     . LYS A 1 399  ? -68.03600 -43.05700 -23.61800 1.000 92.29415  ? 399  LYS A N     1 
ATOM   2821  C  CA    . LYS A 1 399  ? -68.12000 -44.26900 -24.43500 1.000 91.87519  ? 399  LYS A CA    1 
ATOM   2822  C  C     . LYS A 1 399  ? -68.47000 -45.49500 -23.59200 1.000 100.61437 ? 399  LYS A C     1 
ATOM   2823  O  O     . LYS A 1 399  ? -67.86500 -46.56200 -23.71900 1.000 101.50018 ? 399  LYS A O     1 
ATOM   2824  C  CB    . LYS A 1 399  ? -66.83200 -44.49500 -25.23100 1.000 95.04405  ? 399  LYS A CB    1 
ATOM   2825  C  CG    . LYS A 1 399  ? -66.79200 -43.74000 -26.54900 1.000 92.45415  ? 399  LYS A CG    1 
ATOM   2826  C  CD    . LYS A 1 399  ? -65.55500 -44.09200 -27.35800 1.000 87.07115  ? 399  LYS A CD    1 
ATOM   2827  C  CE    . LYS A 1 399  ? -64.29000 -43.60700 -26.67300 1.000 99.33246  ? 399  LYS A CE    1 
ATOM   2828  N  NZ    . LYS A 1 399  ? -64.31300 -42.13500 -26.45500 1.000 100.43876 ? 399  LYS A NZ    1 
ATOM   2829  N  N     . CYS A 1 400  ? -69.46300 -45.33600 -22.72600 1.000 106.19298 ? 400  CYS A N     1 
ATOM   2830  C  CA    . CYS A 1 400  ? -70.05000 -46.49000 -22.05800 1.000 100.09295 ? 400  CYS A CA    1 
ATOM   2831  C  C     . CYS A 1 400  ? -70.97500 -47.21300 -23.03100 1.000 100.55250 ? 400  CYS A C     1 
ATOM   2832  O  O     . CYS A 1 400  ? -71.82200 -46.57100 -23.66000 1.000 94.46639  ? 400  CYS A O     1 
ATOM   2833  C  CB    . CYS A 1 400  ? -70.82300 -46.06400 -20.81200 1.000 96.54517  ? 400  CYS A CB    1 
ATOM   2834  S  SG    . CYS A 1 400  ? -69.78600 -45.58700 -19.40800 1.000 114.02628 ? 400  CYS A SG    1 
ATOM   2835  N  N     . PRO A 1 401  ? -70.84500 -48.53400 -23.18300 1.000 103.86399 ? 401  PRO A N     1 
ATOM   2836  C  CA    . PRO A 1 401  ? -71.62400 -49.23300 -24.21900 1.000 100.37887 ? 401  PRO A CA    1 
ATOM   2837  C  C     . PRO A 1 401  ? -73.12800 -49.14600 -24.02600 1.000 101.29103 ? 401  PRO A C     1 
ATOM   2838  O  O     . PRO A 1 401  ? -73.86900 -49.28200 -25.00700 1.000 100.32905 ? 401  PRO A O     1 
ATOM   2839  C  CB    . PRO A 1 401  ? -71.13000 -50.68300 -24.11100 1.000 96.26112  ? 401  PRO A CB    1 
ATOM   2840  C  CG    . PRO A 1 401  ? -70.60000 -50.79800 -22.71800 1.000 98.41019  ? 401  PRO A CG    1 
ATOM   2841  C  CD    . PRO A 1 401  ? -70.00500 -49.45800 -22.40200 1.000 103.25148 ? 401  PRO A CD    1 
ATOM   2842  N  N     . ASN A 1 402  ? -73.60400 -48.91900 -22.80000 1.000 100.59316 ? 402  ASN A N     1 
ATOM   2843  C  CA    . ASN A 1 402  ? -75.04200 -48.82800 -22.57700 1.000 99.71980  ? 402  ASN A CA    1 
ATOM   2844  C  C     . ASN A 1 402  ? -75.61800 -47.53400 -23.13600 1.000 100.51327 ? 402  ASN A C     1 
ATOM   2845  O  O     . ASN A 1 402  ? -76.75300 -47.52400 -23.62800 1.000 98.58541  ? 402  ASN A O     1 
ATOM   2846  C  CB    . ASN A 1 402  ? -75.34900 -48.94900 -21.08500 1.000 101.40838 ? 402  ASN A CB    1 
ATOM   2847  C  CG    . ASN A 1 402  ? -74.71100 -50.17300 -20.45900 1.000 103.80763 ? 402  ASN A CG    1 
ATOM   2848  O  OD1   . ASN A 1 402  ? -73.60600 -50.10400 -19.91900 1.000 104.97452 ? 402  ASN A OD1   1 
ATOM   2849  N  ND2   . ASN A 1 402  ? -75.40000 -51.30500 -20.53800 1.000 95.72231  ? 402  ASN A ND2   1 
ATOM   2850  N  N     . ALA A 1 403  ? -74.86100 -46.44000 -23.07300 1.000 97.67330  ? 403  ALA A N     1 
ATOM   2851  C  CA    . ALA A 1 403  ? -75.29000 -45.15600 -23.60800 1.000 96.96177  ? 403  ALA A CA    1 
ATOM   2852  C  C     . ALA A 1 403  ? -74.66700 -44.85100 -24.96300 1.000 94.73343  ? 403  ALA A C     1 
ATOM   2853  O  O     . ALA A 1 403  ? -74.80700 -43.72900 -25.46100 1.000 91.87095  ? 403  ALA A O     1 
ATOM   2854  C  CB    . ALA A 1 403  ? -74.96200 -44.03600 -22.61800 1.000 89.73991  ? 403  ALA A CB    1 
ATOM   2855  N  N     . ASP A 1 404  ? -73.98600 -45.82000 -25.56900 1.000 95.84535  ? 404  ASP A N     1 
ATOM   2856  C  CA    . ASP A 1 404  ? -73.33600 -45.63000 -26.85400 1.000 93.19938  ? 404  ASP A CA    1 
ATOM   2857  C  C     . ASP A 1 404  ? -74.25400 -46.11000 -27.97700 1.000 90.00566  ? 404  ASP A C     1 
ATOM   2858  O  O     . ASP A 1 404  ? -75.38700 -46.54100 -27.75300 1.000 92.72448  ? 404  ASP A O     1 
ATOM   2859  C  CB    . ASP A 1 404  ? -71.99600 -46.36800 -26.87800 1.000 96.42599  ? 404  ASP A CB    1 
ATOM   2860  C  CG    . ASP A 1 404  ? -71.04300 -45.82300 -27.92700 1.000 92.68905  ? 404  ASP A CG    1 
ATOM   2861  O  OD1   . ASP A 1 404  ? -71.51400 -45.18900 -28.89500 1.000 85.41200  ? 404  ASP A OD1   1 
ATOM   2862  O  OD2   . ASP A 1 404  ? -69.82000 -46.03600 -27.78400 1.000 86.36992  ? 404  ASP A OD2   1 
ATOM   2863  N  N     . LEU A 1 405  ? -73.75900 -46.02600 -29.20800 1.000 85.72463  ? 405  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1 405  ? -74.45500 -46.57100 -30.36300 1.000 86.09841  ? 405  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1 405  ? -74.11500 -48.04600 -30.51500 1.000 87.81115  ? 405  LEU A C     1 
ATOM   2866  O  O     . LEU A 1 405  ? -72.97700 -48.46000 -30.27600 1.000 80.06916  ? 405  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1 405  ? -74.07000 -45.82900 -31.64500 1.000 82.43572  ? 405  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1 405  ? -74.38300 -44.34400 -31.84200 1.000 82.58979  ? 405  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1 405  ? -73.41200 -43.46100 -31.08100 1.000 82.67225  ? 405  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1 405  ? -74.36200 -44.00400 -33.32500 1.000 79.08933  ? 405  LEU A CD2   1 
ATOM   2871  N  N     . LYS A 1 406  ? -75.10500 -48.83700 -30.90800 1.000 91.18891  ? 406  LYS A N     1 
ATOM   2872  C  CA    . LYS A 1 406  ? -74.80800 -50.19000 -31.34400 1.000 95.43077  ? 406  LYS A CA    1 
ATOM   2873  C  C     . LYS A 1 406  ? -74.00000 -50.13000 -32.63800 1.000 92.89485  ? 406  LYS A C     1 
ATOM   2874  O  O     . LYS A 1 406  ? -74.23600 -49.25500 -33.47600 1.000 93.08970  ? 406  LYS A O     1 
ATOM   2875  C  CB    . LYS A 1 406  ? -76.09000 -50.99600 -31.55500 1.000 101.11577 ? 406  LYS A CB    1 
ATOM   2876  C  CG    . LYS A 1 406  ? -76.59800 -51.69400 -30.30200 1.000 107.66786 ? 406  LYS A CG    1 
ATOM   2877  C  CD    . LYS A 1 406  ? -77.23700 -53.03300 -30.64000 1.000 116.21688 ? 406  LYS A CD    1 
ATOM   2878  C  CE    . LYS A 1 406  ? -77.79000 -53.71600 -29.40000 1.000 119.42936 ? 406  LYS A CE    1 
ATOM   2879  N  NZ    . LYS A 1 406  ? -78.37900 -55.04800 -29.71700 1.000 102.95566 ? 406  LYS A NZ    1 
ATOM   2880  N  N     . PRO A 1 407  ? -73.03400 -51.03300 -32.82600 1.000 85.65350  ? 407  PRO A N     1 
ATOM   2881  C  CA    . PRO A 1 407  ? -72.16800 -50.94900 -34.01400 1.000 82.38365  ? 407  PRO A CA    1 
ATOM   2882  C  C     . PRO A 1 407  ? -72.91200 -51.07600 -35.33700 1.000 81.20682  ? 407  PRO A C     1 
ATOM   2883  O  O     . PRO A 1 407  ? -72.28800 -50.89900 -36.39100 1.000 86.86844  ? 407  PRO A O     1 
ATOM   2884  C  CB    . PRO A 1 407  ? -71.18500 -52.11100 -33.81300 1.000 88.41994  ? 407  PRO A CB    1 
ATOM   2885  C  CG    . PRO A 1 407  ? -71.20200 -52.37400 -32.34000 1.000 79.99742  ? 407  PRO A CG    1 
ATOM   2886  C  CD    . PRO A 1 407  ? -72.61300 -52.10700 -31.91100 1.000 83.35467  ? 407  PRO A CD    1 
ATOM   2887  N  N     . GLN A 1 408  ? -74.21500 -51.35800 -35.32100 1.000 77.59878  ? 408  GLN A N     1 
ATOM   2888  C  CA    . GLN A 1 408  ? -74.99100 -51.51900 -36.54200 1.000 84.84651  ? 408  GLN A CA    1 
ATOM   2889  C  C     . GLN A 1 408  ? -75.77200 -50.27100 -36.93500 1.000 84.81619  ? 408  GLN A C     1 
ATOM   2890  O  O     . GLN A 1 408  ? -76.26400 -50.20300 -38.06600 1.000 85.39425  ? 408  GLN A O     1 
ATOM   2891  C  CB    . GLN A 1 408  ? -75.96700 -52.69500 -36.40000 1.000 83.98804  ? 408  GLN A CB    1 
ATOM   2892  C  CG    . GLN A 1 408  ? -75.34700 -53.95800 -35.82500 1.000 87.30268  ? 408  GLN A CG    1 
ATOM   2893  C  CD    . GLN A 1 408  ? -75.48400 -54.03500 -34.31700 1.000 97.07612  ? 408  GLN A CD    1 
ATOM   2894  O  OE1   . GLN A 1 408  ? -76.50100 -53.62800 -33.75500 1.000 97.45531  ? 408  GLN A OE1   1 
ATOM   2895  N  NE2   . GLN A 1 408  ? -74.45800 -54.55500 -33.65400 1.000 94.21410  ? 408  GLN A NE2   1 
ATOM   2896  N  N     . GLU A 1 409  ? -75.89900 -49.29100 -36.04500 1.000 79.92836  ? 409  GLU A N     1 
ATOM   2897  C  CA    . GLU A 1 409  ? -76.70700 -48.10900 -36.30500 1.000 82.17180  ? 409  GLU A CA    1 
ATOM   2898  C  C     . GLU A 1 409  ? -75.82600 -46.88500 -36.52200 1.000 78.27746  ? 409  GLU A C     1 
ATOM   2899  O  O     . GLU A 1 409  ? -74.71100 -46.79700 -36.00100 1.000 74.54678  ? 409  GLU A O     1 
ATOM   2900  C  CB    . GLU A 1 409  ? -77.68600 -47.84100 -35.15800 1.000 87.63276  ? 409  GLU A CB    1 
ATOM   2901  C  CG    . GLU A 1 409  ? -77.05700 -47.81900 -33.78000 1.000 91.50594  ? 409  GLU A CG    1 
ATOM   2902  C  CD    . GLU A 1 409  ? -78.09200 -47.81800 -32.67500 1.000 94.10559  ? 409  GLU A CD    1 
ATOM   2903  O  OE1   . GLU A 1 409  ? -79.25200 -47.43900 -32.94600 1.000 90.47798  ? 409  GLU A OE1   1 
ATOM   2904  O  OE2   . GLU A 1 409  ? -77.74800 -48.20100 -31.53700 1.000 91.38081  ? 409  GLU A OE2   1 
ATOM   2905  N  N     . ILE A 1 410  ? -76.34800 -45.94100 -37.29800 1.000 77.34143  ? 410  ILE A N     1 
ATOM   2906  C  CA    . ILE A 1 410  ? -75.65700 -44.70000 -37.60000 1.000 72.10011  ? 410  ILE A CA    1 
ATOM   2907  C  C     . ILE A 1 410  ? -76.30500 -43.57100 -36.80600 1.000 79.05975  ? 410  ILE A C     1 
ATOM   2908  O  O     . ILE A 1 410  ? -77.33100 -43.74700 -36.15000 1.000 86.86223  ? 410  ILE A O     1 
ATOM   2909  C  CB    . ILE A 1 410  ? -75.67100 -44.38500 -39.10800 1.000 68.39398  ? 410  ILE A CB    1 
ATOM   2910  C  CG1   . ILE A 1 410  ? -77.08400 -43.99500 -39.54500 1.000 66.23757  ? 410  ILE A CG1   1 
ATOM   2911  C  CG2   . ILE A 1 410  ? -75.17000 -45.57600 -39.90700 1.000 78.66187  ? 410  ILE A CG2   1 
ATOM   2912  C  CD1   . ILE A 1 410  ? -77.20500 -43.65100 -41.01000 1.000 77.48069  ? 410  ILE A CD1   1 
ATOM   2913  N  N     . LEU A 1 411  ? -75.68900 -42.39400 -36.87400 1.000 77.85176  ? 411  LEU A N     1 
ATOM   2914  C  CA    . LEU A 1 411  ? -76.25300 -41.17700 -36.30700 1.000 71.11793  ? 411  LEU A CA    1 
ATOM   2915  C  C     . LEU A 1 411  ? -76.79100 -40.32500 -37.45000 1.000 71.79158  ? 411  LEU A C     1 
ATOM   2916  O  O     . LEU A 1 411  ? -76.04500 -39.97600 -38.37100 1.000 70.93889  ? 411  LEU A O     1 
ATOM   2917  C  CB    . LEU A 1 411  ? -75.20700 -40.40800 -35.50000 1.000 64.54529  ? 411  LEU A CB    1 
ATOM   2918  C  CG    . LEU A 1 411  ? -75.58300 -38.98500 -35.08100 1.000 65.52912  ? 411  LEU A CG    1 
ATOM   2919  C  CD1   . LEU A 1 411  ? -76.86600 -38.98800 -34.26000 1.000 78.83882  ? 411  LEU A CD1   1 
ATOM   2920  C  CD2   . LEU A 1 411  ? -74.44800 -38.33200 -34.30900 1.000 49.61262  ? 411  LEU A CD2   1 
ATOM   2921  N  N     . VAL A 1 412  ? -78.07800 -40.00300 -37.39500 1.000 73.37897  ? 412  VAL A N     1 
ATOM   2922  C  CA    . VAL A 1 412  ? -78.74100 -39.24600 -38.45300 1.000 76.61425  ? 412  VAL A CA    1 
ATOM   2923  C  C     . VAL A 1 412  ? -78.78200 -37.75700 -38.13800 1.000 78.20682  ? 412  VAL A C     1 
ATOM   2924  O  O     . VAL A 1 412  ? -78.42700 -36.92900 -38.97700 1.000 75.58237  ? 412  VAL A O     1 
ATOM   2925  C  CB    . VAL A 1 412  ? -80.16000 -39.80500 -38.70200 1.000 69.00326  ? 412  VAL A CB    1 
ATOM   2926  C  CG1   . VAL A 1 412  ? -80.87500 -38.98300 -39.76000 1.000 70.95238  ? 412  VAL A CG1   1 
ATOM   2927  C  CG2   . VAL A 1 412  ? -80.08200 -41.25600 -39.12700 1.000 75.79651  ? 412  VAL A CG2   1 
ATOM   2928  N  N     . SER A 1 413  ? -79.21000 -37.39500 -36.93000 1.000 75.02710  ? 413  SER A N     1 
ATOM   2929  C  CA    . SER A 1 413  ? -79.34600 -35.99200 -36.56900 1.000 76.78437  ? 413  SER A CA    1 
ATOM   2930  C  C     . SER A 1 413  ? -79.22500 -35.83800 -35.06000 1.000 79.60478  ? 413  SER A C     1 
ATOM   2931  O  O     . SER A 1 413  ? -79.29200 -36.81100 -34.30300 1.000 81.66264  ? 413  SER A O     1 
ATOM   2932  C  CB    . SER A 1 413  ? -80.67800 -35.41600 -37.06300 1.000 82.25903  ? 413  SER A CB    1 
ATOM   2933  O  OG    . SER A 1 413  ? -81.77700 -36.10600 -36.49500 1.000 84.17156  ? 413  SER A OG    1 
ATOM   2934  N  N     . VAL A 1 414  ? -79.04300 -34.59100 -34.63200 1.000 79.83344  ? 414  VAL A N     1 
ATOM   2935  C  CA    . VAL A 1 414  ? -78.97000 -34.22900 -33.22300 1.000 85.75996  ? 414  VAL A CA    1 
ATOM   2936  C  C     . VAL A 1 414  ? -79.94400 -33.08600 -32.97500 1.000 83.00772  ? 414  VAL A C     1 
ATOM   2937  O  O     . VAL A 1 414  ? -80.09500 -32.19300 -33.81600 1.000 77.18183  ? 414  VAL A O     1 
ATOM   2938  C  CB    . VAL A 1 414  ? -77.53300 -33.84000 -32.80600 1.000 82.02573  ? 414  VAL A CB    1 
ATOM   2939  C  CG1   . VAL A 1 414  ? -77.02600 -32.67300 -33.64000 1.000 76.24358  ? 414  VAL A CG1   1 
ATOM   2940  C  CG2   . VAL A 1 414  ? -77.47200 -33.50900 -31.32200 1.000 81.48271  ? 414  VAL A CG2   1 
ATOM   2941  N  N     . ASN A 1 415  ? -80.61900 -33.12400 -31.83100 1.000 91.44623  ? 415  ASN A N     1 
ATOM   2942  C  CA    . ASN A 1 415  ? -81.61200 -32.12200 -31.46900 1.000 86.62657  ? 415  ASN A CA    1 
ATOM   2943  C  C     . ASN A 1 415  ? -81.03000 -31.18500 -30.42200 1.000 85.74454  ? 415  ASN A C     1 
ATOM   2944  O  O     . ASN A 1 415  ? -80.53700 -31.63700 -29.38200 1.000 87.36341  ? 415  ASN A O     1 
ATOM   2945  C  CB    . ASN A 1 415  ? -82.88700 -32.78000 -30.93900 1.000 91.99755  ? 415  ASN A CB    1 
ATOM   2946  C  CG    . ASN A 1 415  ? -83.27000 -34.02100 -31.71900 1.000 97.05384  ? 415  ASN A CG    1 
ATOM   2947  O  OD1   . ASN A 1 415  ? -82.95000 -34.14800 -32.90100 1.000 99.60481  ? 415  ASN A OD1   1 
ATOM   2948  N  ND2   . ASN A 1 415  ? -83.96100 -34.94400 -31.06100 1.000 97.73635  ? 415  ASN A ND2   1 
ATOM   2949  N  N     . ILE A 1 416  ? -81.08500 -29.88700 -30.70000 1.000 83.41537  ? 416  ILE A N     1 
ATOM   2950  C  CA    . ILE A 1 416  ? -80.63500 -28.87100 -29.75400 1.000 83.16259  ? 416  ILE A CA    1 
ATOM   2951  C  C     . ILE A 1 416  ? -81.83300 -27.99900 -29.39400 1.000 84.35661  ? 416  ILE A C     1 
ATOM   2952  O  O     . ILE A 1 416  ? -82.30700 -27.21900 -30.23300 1.000 85.52298  ? 416  ILE A O     1 
ATOM   2953  C  CB    . ILE A 1 416  ? -79.48200 -28.03400 -30.32900 1.000 82.85478  ? 416  ILE A CB    1 
ATOM   2954  C  CG1   . ILE A 1 416  ? -78.29900 -28.92800 -30.70800 1.000 79.74034  ? 416  ILE A CG1   1 
ATOM   2955  C  CG2   . ILE A 1 416  ? -79.03700 -27.00200 -29.32400 1.000 83.37227  ? 416  ILE A CG2   1 
ATOM   2956  C  CD1   . ILE A 1 416  ? -78.22800 -29.26500 -32.18200 1.000 78.33427  ? 416  ILE A CD1   1 
ATOM   2957  N  N     . PRO A 1 417  ? -82.35100 -28.09200 -28.17400 1.000 87.11075  ? 417  PRO A N     1 
ATOM   2958  C  CA    . PRO A 1 417  ? -83.59300 -27.39300 -27.83800 1.000 89.47738  ? 417  PRO A CA    1 
ATOM   2959  C  C     . PRO A 1 417  ? -83.37400 -25.90700 -27.59200 1.000 89.77342  ? 417  PRO A C     1 
ATOM   2960  O  O     . PRO A 1 417  ? -82.27200 -25.44900 -27.28500 1.000 85.93515  ? 417  PRO A O     1 
ATOM   2961  C  CB    . PRO A 1 417  ? -84.04900 -28.09500 -26.55600 1.000 92.41289  ? 417  PRO A CB    1 
ATOM   2962  C  CG    . PRO A 1 417  ? -82.76700 -28.50600 -25.90500 1.000 85.11208  ? 417  PRO A CG    1 
ATOM   2963  C  CD    . PRO A 1 417  ? -81.81800 -28.85300 -27.02900 1.000 87.37312  ? 417  PRO A CD    1 
ATOM   2964  N  N     . TYR A 1 418  ? -84.46200 -25.15400 -27.73900 1.000 94.59304  ? 418  TYR A N     1 
ATOM   2965  C  CA    . TYR A 1 418  ? -84.44700 -23.75000 -27.36200 1.000 89.51235  ? 418  TYR A CA    1 
ATOM   2966  C  C     . TYR A 1 418  ? -84.27800 -23.61500 -25.85400 1.000 81.27623  ? 418  TYR A C     1 
ATOM   2967  O  O     . TYR A 1 418  ? -84.71400 -24.46900 -25.07800 1.000 74.54642  ? 418  TYR A O     1 
ATOM   2968  C  CB    . TYR A 1 418  ? -85.74000 -23.05200 -27.79000 1.000 93.84442  ? 418  TYR A CB    1 
ATOM   2969  C  CG    . TYR A 1 418  ? -86.00500 -23.04900 -29.27800 1.000 100.52631 ? 418  TYR A CG    1 
ATOM   2970  C  CD1   . TYR A 1 418  ? -85.06500 -22.55600 -30.17200 1.000 101.75993 ? 418  TYR A CD1   1 
ATOM   2971  C  CD2   . TYR A 1 418  ? -87.21300 -23.50900 -29.78600 1.000 105.50786 ? 418  TYR A CD2   1 
ATOM   2972  C  CE1   . TYR A 1 418  ? -85.31000 -22.54700 -31.53200 1.000 101.14800 ? 418  TYR A CE1   1 
ATOM   2973  C  CE2   . TYR A 1 418  ? -87.46800 -23.50000 -31.14400 1.000 103.65658 ? 418  TYR A CE2   1 
ATOM   2974  C  CZ    . TYR A 1 418  ? -86.51300 -23.01700 -32.01200 1.000 97.81546  ? 418  TYR A CZ    1 
ATOM   2975  O  OH    . TYR A 1 418  ? -86.76300 -23.00600 -33.36500 1.000 100.63578 ? 418  TYR A OH    1 
ATOM   2976  N  N     . SER A 1 419  ? -83.63600 -22.52900 -25.44100 1.000 81.67121  ? 419  SER A N     1 
ATOM   2977  C  CA    . SER A 1 419  ? -83.52900 -22.24600 -24.02200 1.000 85.64646  ? 419  SER A CA    1 
ATOM   2978  C  C     . SER A 1 419  ? -84.78700 -21.53600 -23.53100 1.000 95.56082  ? 419  SER A C     1 
ATOM   2979  O  O     . SER A 1 419  ? -85.51500 -20.90000 -24.29800 1.000 92.86985  ? 419  SER A O     1 
ATOM   2980  C  CB    . SER A 1 419  ? -82.29300 -21.39700 -23.72800 1.000 86.42022  ? 419  SER A CB    1 
ATOM   2981  O  OG    . SER A 1 419  ? -82.37100 -20.14400 -24.38200 1.000 91.67267  ? 419  SER A OG    1 
ATOM   2982  N  N     . ARG A 1 420  ? -85.03900 -21.65700 -22.23400 1.000 100.88756 ? 420  ARG A N     1 
ATOM   2983  C  CA    . ARG A 1 420  ? -86.21000 -21.06700 -21.60800 1.000 92.24874  ? 420  ARG A CA    1 
ATOM   2984  C  C     . ARG A 1 420  ? -85.85300 -19.73800 -20.95300 1.000 102.60824 ? 420  ARG A C     1 
ATOM   2985  O  O     . ARG A 1 420  ? -84.68400 -19.36300 -20.83400 1.000 106.28711 ? 420  ARG A O     1 
ATOM   2986  C  CB    . ARG A 1 420  ? -86.80300 -22.02700 -20.57300 1.000 84.81793  ? 420  ARG A CB    1 
ATOM   2987  C  CG    . ARG A 1 420  ? -87.34900 -23.31700 -21.15900 1.000 90.64059  ? 420  ARG A CG    1 
ATOM   2988  C  CD    . ARG A 1 420  ? -87.45300 -24.39400 -20.09100 1.000 91.36984  ? 420  ARG A CD    1 
ATOM   2989  N  NE    . ARG A 1 420  ? -86.14200 -24.75700 -19.56200 1.000 95.17446  ? 420  ARG A NE    1 
ATOM   2990  C  CZ    . ARG A 1 420  ? -85.93900 -25.68600 -18.63400 1.000 97.65626  ? 420  ARG A CZ    1 
ATOM   2991  N  NH1   . ARG A 1 420  ? -86.96600 -26.35100 -18.12300 1.000 100.09530 ? 420  ARG A NH1   1 
ATOM   2992  N  NH2   . ARG A 1 420  ? -84.70900 -25.94900 -18.21400 1.000 97.32519  ? 420  ARG A NH2   1 
ATOM   2993  N  N     . LYS A 1 421  ? -86.88800 -19.01700 -20.53100 1.000 99.59479  ? 421  LYS A N     1 
ATOM   2994  C  CA    . LYS A 1 421  ? -86.67800 -17.81200 -19.74500 1.000 101.59402 ? 421  LYS A CA    1 
ATOM   2995  C  C     . LYS A 1 421  ? -86.06800 -18.18600 -18.40000 1.000 99.11072  ? 421  LYS A C     1 
ATOM   2996  O  O     . LYS A 1 421  ? -86.41500 -19.21300 -17.80900 1.000 89.38897  ? 421  LYS A O     1 
ATOM   2997  C  CB    . LYS A 1 421  ? -87.99800 -17.06300 -19.55900 1.000 107.43231 ? 421  LYS A CB    1 
ATOM   2998  C  CG    . LYS A 1 421  ? -87.88200 -15.74600 -18.80700 1.000 110.50995 ? 421  LYS A CG    1 
ATOM   2999  C  CD    . LYS A 1 421  ? -89.03300 -14.81300 -19.16100 1.000 100.59023 ? 421  LYS A CD    1 
ATOM   3000  C  CE    . LYS A 1 421  ? -89.38300 -13.88400 -18.01000 1.000 93.16084  ? 421  LYS A CE    1 
ATOM   3001  N  NZ    . LYS A 1 421  ? -90.22600 -14.55900 -16.98500 1.000 79.52262  ? 421  LYS A NZ    1 
ATOM   3002  N  N     . TRP A 1 422  ? -85.13500 -17.35600 -17.93100 1.000 102.84736 ? 422  TRP A N     1 
ATOM   3003  C  CA    . TRP A 1 422  ? -84.33100 -17.62000 -16.73800 1.000 103.16987 ? 422  TRP A CA    1 
ATOM   3004  C  C     . TRP A 1 422  ? -83.45000 -18.85600 -16.89700 1.000 98.19316  ? 422  TRP A C     1 
ATOM   3005  O  O     . TRP A 1 422  ? -83.05600 -19.47500 -15.90300 1.000 95.21583  ? 422  TRP A O     1 
ATOM   3006  C  CB    . TRP A 1 422  ? -85.20400 -17.74500 -15.48300 1.000 108.13086 ? 422  TRP A CB    1 
ATOM   3007  C  CG    . TRP A 1 422  ? -86.12300 -16.58100 -15.28500 1.000 106.69719 ? 422  TRP A CG    1 
ATOM   3008  C  CD1   . TRP A 1 422  ? -87.46600 -16.54700 -15.51900 1.000 104.19755 ? 422  TRP A CD1   1 
ATOM   3009  C  CD2   . TRP A 1 422  ? -85.76300 -15.27600 -14.81900 1.000 107.04168 ? 422  TRP A CD2   1 
ATOM   3010  N  NE1   . TRP A 1 422  ? -87.96600 -15.30200 -15.22500 1.000 105.33554 ? 422  TRP A NE1   1 
ATOM   3011  C  CE2   . TRP A 1 422  ? -86.94000 -14.50200 -14.79400 1.000 108.80216 ? 422  TRP A CE2   1 
ATOM   3012  C  CE3   . TRP A 1 422  ? -84.56000 -14.68600 -14.41800 1.000 107.25279 ? 422  TRP A CE3   1 
ATOM   3013  C  CZ2   . TRP A 1 422  ? -86.95000 -13.17100 -14.38300 1.000 106.82031 ? 422  TRP A CZ2   1 
ATOM   3014  C  CZ3   . TRP A 1 422  ? -84.57200 -13.36400 -14.01200 1.000 109.39433 ? 422  TRP A CZ3   1 
ATOM   3015  C  CH2   . TRP A 1 422  ? -85.75900 -12.62100 -13.99700 1.000 105.26104 ? 422  TRP A CH2   1 
ATOM   3016  N  N     . GLU A 1 423  ? -83.13400 -19.22800 -18.13600 1.000 101.77066 ? 423  GLU A N     1 
ATOM   3017  C  CA    . GLU A 1 423  ? -82.17300 -20.28400 -18.43400 1.000 98.99657  ? 423  GLU A CA    1 
ATOM   3018  C  C     . GLU A 1 423  ? -81.02000 -19.66500 -19.20800 1.000 94.70560  ? 423  GLU A C     1 
ATOM   3019  O  O     . GLU A 1 423  ? -81.23700 -19.02900 -20.24600 1.000 89.43079  ? 423  GLU A O     1 
ATOM   3020  C  CB    . GLU A 1 423  ? -82.81400 -21.41900 -19.23600 1.000 94.79056  ? 423  GLU A CB    1 
ATOM   3021  C  CG    . GLU A 1 423  ? -81.92400 -22.64400 -19.37700 1.000 94.16546  ? 423  GLU A CG    1 
ATOM   3022  C  CD    . GLU A 1 423  ? -82.60200 -23.78200 -20.11300 1.000 93.72698  ? 423  GLU A CD    1 
ATOM   3023  O  OE1   . GLU A 1 423  ? -83.44500 -23.50700 -20.99200 1.000 93.76396  ? 423  GLU A OE1   1 
ATOM   3024  O  OE2   . GLU A 1 423  ? -82.28800 -24.95300 -19.81500 1.000 96.13269  ? 423  GLU A OE2   1 
ATOM   3025  N  N     . PHE A 1 424  ? -79.80100 -19.84800 -18.70600 1.000 88.85301  ? 424  PHE A N     1 
ATOM   3026  C  CA    . PHE A 1 424  ? -78.62900 -19.19900 -19.27300 1.000 95.18904  ? 424  PHE A CA    1 
ATOM   3027  C  C     . PHE A 1 424  ? -77.48500 -20.19600 -19.36400 1.000 96.42159  ? 424  PHE A C     1 
ATOM   3028  O  O     . PHE A 1 424  ? -77.23500 -20.95400 -18.42300 1.000 101.02407 ? 424  PHE A O     1 
ATOM   3029  C  CB    . PHE A 1 424  ? -78.21600 -17.98500 -18.43000 1.000 93.11786  ? 424  PHE A CB    1 
ATOM   3030  C  CG    . PHE A 1 424  ? -79.37400 -17.12900 -17.99800 1.000 91.08538  ? 424  PHE A CG    1 
ATOM   3031  C  CD1   . PHE A 1 424  ? -80.02700 -16.31300 -18.90600 1.000 88.10959  ? 424  PHE A CD1   1 
ATOM   3032  C  CD2   . PHE A 1 424  ? -79.82200 -17.15700 -16.68800 1.000 90.50763  ? 424  PHE A CD2   1 
ATOM   3033  C  CE1   . PHE A 1 424  ? -81.09700 -15.53100 -18.51100 1.000 93.90715  ? 424  PHE A CE1   1 
ATOM   3034  C  CE2   . PHE A 1 424  ? -80.88800 -16.37500 -16.28700 1.000 95.13987  ? 424  PHE A CE2   1 
ATOM   3035  C  CZ    . PHE A 1 424  ? -81.52600 -15.56100 -17.20000 1.000 97.55622  ? 424  PHE A CZ    1 
ATOM   3036  N  N     . VAL A 1 425  ? -76.79200 -20.18700 -20.50100 1.000 92.85179  ? 425  VAL A N     1 
ATOM   3037  C  CA    . VAL A 1 425  ? -75.68500 -21.09700 -20.76600 1.000 97.11770  ? 425  VAL A CA    1 
ATOM   3038  C  C     . VAL A 1 425  ? -74.53300 -20.30100 -21.36600 1.000 94.67205  ? 425  VAL A C     1 
ATOM   3039  O  O     . VAL A 1 425  ? -74.75100 -19.34900 -22.12400 1.000 94.08647  ? 425  VAL A O     1 
ATOM   3040  C  CB    . VAL A 1 425  ? -76.11600 -22.25500 -21.69800 1.000 97.54014  ? 425  VAL A CB    1 
ATOM   3041  C  CG1   . VAL A 1 425  ? -76.56800 -21.72400 -23.04300 1.000 93.28324  ? 425  VAL A CG1   1 
ATOM   3042  C  CG2   . VAL A 1 425  ? -74.99200 -23.26700 -21.87600 1.000 94.41952  ? 425  VAL A CG2   1 
ATOM   3043  N  N     . SER A 1 426  ? -73.30600 -20.67800 -21.00800 1.000 90.56263  ? 426  SER A N     1 
ATOM   3044  C  CA    . SER A 1 426  ? -72.11500 -20.00200 -21.50200 1.000 94.80316  ? 426  SER A CA    1 
ATOM   3045  C  C     . SER A 1 426  ? -71.00300 -21.02400 -21.68900 1.000 89.83610  ? 426  SER A C     1 
ATOM   3046  O  O     . SER A 1 426  ? -70.97800 -22.06400 -21.02600 1.000 88.08485  ? 426  SER A O     1 
ATOM   3047  C  CB    . SER A 1 426  ? -71.66100 -18.88900 -20.55000 1.000 97.07372  ? 426  SER A CB    1 
ATOM   3048  O  OG    . SER A 1 426  ? -72.65800 -17.89100 -20.41600 1.000 100.10791 ? 426  SER A OG    1 
ATOM   3049  N  N     . ALA A 1 427  ? -70.08000 -20.71300 -22.59800 1.000 88.23660  ? 427  ALA A N     1 
ATOM   3050  C  CA    . ALA A 1 427  ? -68.97700 -21.60100 -22.93300 1.000 80.24156  ? 427  ALA A CA    1 
ATOM   3051  C  C     . ALA A 1 427  ? -67.66200 -20.83600 -22.88700 1.000 83.15215  ? 427  ALA A C     1 
ATOM   3052  O  O     . ALA A 1 427  ? -67.61300 -19.63500 -23.16600 1.000 91.09062  ? 427  ALA A O     1 
ATOM   3053  C  CB    . ALA A 1 427  ? -69.16500 -22.22800 -24.31700 1.000 75.21391  ? 427  ALA A CB    1 
ATOM   3054  N  N     . PHE A 1 428  ? -66.59200 -21.55000 -22.53900 1.000 75.44925  ? 428  PHE A N     1 
ATOM   3055  C  CA    . PHE A 1 428  ? -65.27400 -20.95000 -22.39200 1.000 80.21705  ? 428  PHE A CA    1 
ATOM   3056  C  C     . PHE A 1 428  ? -64.21900 -21.89700 -22.94800 1.000 80.43921  ? 428  PHE A C     1 
ATOM   3057  O  O     . PHE A 1 428  ? -64.44100 -23.10300 -23.07300 1.000 79.52978  ? 428  PHE A O     1 
ATOM   3058  C  CB    . PHE A 1 428  ? -64.96600 -20.62300 -20.92500 1.000 79.25216  ? 428  PHE A CB    1 
ATOM   3059  C  CG    . PHE A 1 428  ? -65.99400 -19.74700 -20.27000 1.000 88.38310  ? 428  PHE A CG    1 
ATOM   3060  C  CD1   . PHE A 1 428  ? -65.90600 -18.36800 -20.35500 1.000 89.97441  ? 428  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE A 1 428  ? -67.05000 -20.30400 -19.56500 1.000 87.24542  ? 428  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE A 1 428  ? -66.85100 -17.55900 -19.75200 1.000 88.06198  ? 428  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE A 1 428  ? -67.99800 -19.50200 -18.96100 1.000 87.50588  ? 428  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE A 1 428  ? -67.89900 -18.12700 -19.05400 1.000 87.92670  ? 428  PHE A CZ    1 
ATOM   3065  N  N     . ARG A 1 429  ? -63.05900 -21.33100 -23.27700 1.000 81.90141  ? 429  ARG A N     1 
ATOM   3066  C  CA    . ARG A 1 429  ? -61.94200 -22.10500 -23.80200 1.000 77.14915  ? 429  ARG A CA    1 
ATOM   3067  C  C     . ARG A 1 429  ? -60.66100 -21.30100 -23.63900 1.000 70.25979  ? 429  ARG A C     1 
ATOM   3068  O  O     . ARG A 1 429  ? -60.69000 -20.08400 -23.43600 1.000 70.04482  ? 429  ARG A O     1 
ATOM   3069  C  CB    . ARG A 1 429  ? -62.15200 -22.47600 -25.27400 1.000 77.40185  ? 429  ARG A CB    1 
ATOM   3070  C  CG    . ARG A 1 429  ? -61.77600 -21.36700 -26.24500 1.000 73.66505  ? 429  ARG A CG    1 
ATOM   3071  C  CD    . ARG A 1 429  ? -62.04600 -21.76600 -27.68400 1.000 71.01850  ? 429  ARG A CD    1 
ATOM   3072  N  NE    . ARG A 1 429  ? -61.38800 -23.01900 -28.04300 1.000 71.79500  ? 429  ARG A NE    1 
ATOM   3073  C  CZ    . ARG A 1 429  ? -60.20400 -23.09600 -28.64200 1.000 76.88383  ? 429  ARG A CZ    1 
ATOM   3074  N  NH1   . ARG A 1 429  ? -59.54300 -21.99000 -28.95500 1.000 76.40171  ? 429  ARG A NH1   1 
ATOM   3075  N  NH2   . ARG A 1 429  ? -59.68100 -24.28000 -28.93200 1.000 79.82791  ? 429  ARG A NH2   1 
ATOM   3076  N  N     . GLN A 1 430  ? -59.53200 -22.00200 -23.73700 1.000 64.47963  ? 430  GLN A N     1 
ATOM   3077  C  CA    . GLN A 1 430  ? -58.22200 -21.35600 -23.69100 1.000 72.56404  ? 430  GLN A CA    1 
ATOM   3078  C  C     . GLN A 1 430  ? -57.20800 -22.27100 -24.35700 1.000 78.56357  ? 430  GLN A C     1 
ATOM   3079  O  O     . GLN A 1 430  ? -57.06700 -23.43200 -23.95700 1.000 74.32675  ? 430  GLN A O     1 
ATOM   3080  C  CB    . GLN A 1 430  ? -57.80600 -21.04300 -22.25300 1.000 68.25037  ? 430  GLN A CB    1 
ATOM   3081  C  CG    . GLN A 1 430  ? -56.47300 -20.31700 -22.14300 1.000 65.89364  ? 430  GLN A CG    1 
ATOM   3082  C  CD    . GLN A 1 430  ? -56.45200 -19.00700 -22.91300 1.000 77.42430  ? 430  GLN A CD    1 
ATOM   3083  O  OE1   . GLN A 1 430  ? -57.46700 -18.31800 -23.02100 1.000 82.33247  ? 430  GLN A OE1   1 
ATOM   3084  N  NE2   . GLN A 1 430  ? -55.29100 -18.66100 -23.45800 1.000 75.57230  ? 430  GLN A NE2   1 
ATOM   3085  N  N     . ALA A 1 431  ? -56.50700 -21.75400 -25.35900 1.000 77.85070  ? 431  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1 431  ? -55.50600 -22.52400 -26.08800 1.000 75.40437  ? 431  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1 431  ? -54.19900 -21.73300 -26.08900 1.000 72.86074  ? 431  ALA A C     1 
ATOM   3088  O  O     . ALA A 1 431  ? -54.00100 -20.79300 -25.30900 1.000 77.95292  ? 431  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1 431  ? -56.00300 -22.84800 -27.50200 1.000 74.52569  ? 431  ALA A CB    1 
ATOM   3090  N  N     . GLN A 1 432  ? -53.27900 -22.11400 -26.97900 1.000 75.04938  ? 432  GLN A N     1 
ATOM   3091  C  CA    . GLN A 1 432  ? -52.01300 -21.39500 -27.08100 1.000 68.40673  ? 432  GLN A CA    1 
ATOM   3092  C  C     . GLN A 1 432  ? -52.19700 -20.05400 -27.78100 1.000 72.76539  ? 432  GLN A C     1 
ATOM   3093  O  O     . GLN A 1 432  ? -51.54300 -19.06700 -27.42500 1.000 71.90028  ? 432  GLN A O     1 
ATOM   3094  C  CB    . GLN A 1 432  ? -50.98100 -22.25200 -27.81300 1.000 65.69654  ? 432  GLN A CB    1 
ATOM   3095  C  CG    . GLN A 1 432  ? -49.56200 -22.09100 -27.29100 1.000 67.68328  ? 432  GLN A CG    1 
ATOM   3096  C  CD    . GLN A 1 432  ? -49.36400 -22.72300 -25.92700 1.000 75.37522  ? 432  GLN A CD    1 
ATOM   3097  O  OE1   . GLN A 1 432  ? -50.16400 -23.55100 -25.48900 1.000 73.89255  ? 432  GLN A OE1   1 
ATOM   3098  N  NE2   . GLN A 1 432  ? -48.29400 -22.33300 -25.24400 1.000 79.79858  ? 432  GLN A NE2   1 
ATOM   3099  N  N     . ARG A 1 433  ? -53.07500 -20.00100 -28.77900 1.000 69.03482  ? 433  ARG A N     1 
ATOM   3100  C  CA    . ARG A 1 433  ? -53.45000 -18.76000 -29.44000 1.000 67.99937  ? 433  ARG A CA    1 
ATOM   3101  C  C     . ARG A 1 433  ? -54.97000 -18.70100 -29.54200 1.000 70.09696  ? 433  ARG A C     1 
ATOM   3102  O  O     . ARG A 1 433  ? -55.68000 -19.60800 -29.09700 1.000 76.26893  ? 433  ARG A O     1 
ATOM   3103  C  CB    . ARG A 1 433  ? -52.78800 -18.63700 -30.81800 1.000 73.61357  ? 433  ARG A CB    1 
ATOM   3104  C  CG    . ARG A 1 433  ? -53.19000 -19.71300 -31.80300 1.000 77.29975  ? 433  ARG A CG    1 
ATOM   3105  C  CD    . ARG A 1 433  ? -52.24500 -19.74600 -32.99200 1.000 69.21009  ? 433  ARG A CD    1 
ATOM   3106  N  NE    . ARG A 1 433  ? -52.60300 -20.79600 -33.94000 1.000 72.58066  ? 433  ARG A NE    1 
ATOM   3107  C  CZ    . ARG A 1 433  ? -51.78000 -21.28300 -34.86200 1.000 71.97067  ? 433  ARG A CZ    1 
ATOM   3108  N  NH1   . ARG A 1 433  ? -50.54400 -20.81600 -34.96300 1.000 68.77253  ? 433  ARG A NH1   1 
ATOM   3109  N  NH2   . ARG A 1 433  ? -52.19300 -22.24000 -35.68300 1.000 79.58507  ? 433  ARG A NH2   1 
ATOM   3110  N  N     . GLN A 1 434  ? -55.47200 -17.62100 -30.14500 1.000 71.64520  ? 434  GLN A N     1 
ATOM   3111  C  CA    . GLN A 1 434  ? -56.90400 -17.34300 -30.08300 1.000 82.74895  ? 434  GLN A CA    1 
ATOM   3112  C  C     . GLN A 1 434  ? -57.70900 -18.31400 -30.93900 1.000 80.30889  ? 434  GLN A C     1 
ATOM   3113  O  O     . GLN A 1 434  ? -58.82100 -18.70200 -30.56300 1.000 80.63167  ? 434  GLN A O     1 
ATOM   3114  C  CB    . GLN A 1 434  ? -57.17300 -15.90000 -30.50500 1.000 91.97412  ? 434  GLN A CB    1 
ATOM   3115  C  CG    . GLN A 1 434  ? -58.47900 -15.33500 -29.97000 1.000 98.17128  ? 434  GLN A CG    1 
ATOM   3116  C  CD    . GLN A 1 434  ? -58.28100 -14.04000 -29.20500 1.000 107.96731 ? 434  GLN A CD    1 
ATOM   3117  O  OE1   . GLN A 1 434  ? -57.28200 -13.34300 -29.38600 1.000 93.93154  ? 434  GLN A OE1   1 
ATOM   3118  N  NE2   . GLN A 1 434  ? -59.23500 -13.71300 -28.34000 1.000 112.87071 ? 434  GLN A NE2   1 
ATOM   3119  N  N     . GLU A 1 435  ? -57.17300 -18.71700 -32.08900 1.000 79.94561  ? 435  GLU A N     1 
ATOM   3120  C  CA    . GLU A 1 435  ? -57.90300 -19.60300 -32.98500 1.000 83.99292  ? 435  GLU A CA    1 
ATOM   3121  C  C     . GLU A 1 435  ? -56.92700 -20.54500 -33.67400 1.000 81.96131  ? 435  GLU A C     1 
ATOM   3122  O  O     . GLU A 1 435  ? -55.71400 -20.31900 -33.68100 1.000 81.74652  ? 435  GLU A O     1 
ATOM   3123  C  CB    . GLU A 1 435  ? -58.70900 -18.81300 -34.02400 1.000 78.04941  ? 435  GLU A CB    1 
ATOM   3124  C  CG    . GLU A 1 435  ? -57.85400 -18.03800 -35.01000 1.000 75.28843  ? 435  GLU A CG    1 
ATOM   3125  C  CD    . GLU A 1 435  ? -58.68200 -17.23900 -35.99700 1.000 93.66895  ? 435  GLU A CD    1 
ATOM   3126  O  OE1   . GLU A 1 435  ? -59.92600 -17.34100 -35.95100 1.000 94.85265  ? 435  GLU A OE1   1 
ATOM   3127  O  OE2   . GLU A 1 435  ? -58.08800 -16.50800 -36.81800 1.000 95.89689  ? 435  GLU A OE2   1 
ATOM   3128  N  N     . ASN A 1 436  ? -57.48200 -21.60800 -34.26000 1.000 73.42618  ? 436  ASN A N     1 
ATOM   3129  C  CA    . ASN A 1 436  ? -56.70300 -22.64100 -34.94400 1.000 72.88919  ? 436  ASN A CA    1 
ATOM   3130  C  C     . ASN A 1 436  ? -55.65700 -23.24500 -34.00700 1.000 68.95346  ? 436  ASN A C     1 
ATOM   3131  O  O     . ASN A 1 436  ? -54.48100 -23.38300 -34.35100 1.000 75.02070  ? 436  ASN A O     1 
ATOM   3132  C  CB    . ASN A 1 436  ? -56.05300 -22.09300 -36.21700 1.000 75.85853  ? 436  ASN A CB    1 
ATOM   3133  C  CG    . ASN A 1 436  ? -55.68800 -23.18700 -37.20300 1.000 76.38878  ? 436  ASN A CG    1 
ATOM   3134  O  OD1   . ASN A 1 436  ? -55.76100 -24.37500 -36.88500 1.000 70.33547  ? 436  ASN A OD1   1 
ATOM   3135  N  ND2   . ASN A 1 436  ? -55.29100 -22.79100 -38.40600 1.000 73.72104  ? 436  ASN A ND2   1 
ATOM   3136  N  N     . ALA A 1 437  ? -56.10100 -23.60600 -32.80600 1.000 63.96120  ? 437  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1 437  ? -55.22500 -24.20900 -31.81000 1.000 64.05507  ? 437  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1 437  ? -56.07400 -25.01800 -30.84400 1.000 65.32529  ? 437  ALA A C     1 
ATOM   3139  O  O     . ALA A 1 437  ? -57.08800 -24.52100 -30.34500 1.000 65.93342  ? 437  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1 437  ? -54.42100 -23.14300 -31.05800 1.000 68.95433  ? 437  ALA A CB    1 
ATOM   3141  N  N     . LEU A 1 438  ? -55.66100 -26.25600 -30.58700 1.000 69.47015  ? 438  LEU A N     1 
ATOM   3142  C  CA    . LEU A 1 438  ? -56.41900 -27.12600 -29.70000 1.000 70.27362  ? 438  LEU A CA    1 
ATOM   3143  C  C     . LEU A 1 438  ? -56.43900 -26.56200 -28.28500 1.000 71.56110  ? 438  LEU A C     1 
ATOM   3144  O  O     . LEU A 1 438  ? -55.42700 -26.07100 -27.77800 1.000 76.80653  ? 438  LEU A O     1 
ATOM   3145  C  CB    . LEU A 1 438  ? -55.82400 -28.53400 -29.70600 1.000 80.79459  ? 438  LEU A CB    1 
ATOM   3146  C  CG    . LEU A 1 438  ? -55.79500 -29.21200 -31.07700 1.000 75.53888  ? 438  LEU A CG    1 
ATOM   3147  C  CD1   . LEU A 1 438  ? -55.24100 -30.62400 -30.97900 1.000 79.53155  ? 438  LEU A CD1   1 
ATOM   3148  C  CD2   . LEU A 1 438  ? -57.18300 -29.21800 -31.70100 1.000 69.10153  ? 438  LEU A CD2   1 
ATOM   3149  N  N     . ALA A 1 439  ? -57.60400 -26.63700 -27.64900 1.000 67.88363  ? 439  ALA A N     1 
ATOM   3150  C  CA    . ALA A 1 439  ? -57.78100 -26.03500 -26.33600 1.000 68.66388  ? 439  ALA A CA    1 
ATOM   3151  C  C     . ALA A 1 439  ? -57.04800 -26.83300 -25.26600 1.000 74.81261  ? 439  ALA A C     1 
ATOM   3152  O  O     . ALA A 1 439  ? -56.99700 -28.06500 -25.30900 1.000 77.20305  ? 439  ALA A O     1 
ATOM   3153  C  CB    . ALA A 1 439  ? -59.26700 -25.94500 -25.99200 1.000 69.87897  ? 439  ALA A CB    1 
ATOM   3154  N  N     . ILE A 1 440  ? -56.47000 -26.11500 -24.30400 1.000 75.21203  ? 440  ILE A N     1 
ATOM   3155  C  CA    . ILE A 1 440  ? -55.91500 -26.76600 -23.12300 1.000 76.06930  ? 440  ILE A CA    1 
ATOM   3156  C  C     . ILE A 1 440  ? -57.03400 -27.18900 -22.18100 1.000 75.41781  ? 440  ILE A C     1 
ATOM   3157  O  O     . ILE A 1 440  ? -57.12400 -28.35500 -21.78100 1.000 80.74677  ? 440  ILE A O     1 
ATOM   3158  C  CB    . ILE A 1 440  ? -54.90500 -25.83700 -22.42400 1.000 75.70318  ? 440  ILE A CB    1 
ATOM   3159  C  CG1   . ILE A 1 440  ? -53.90400 -25.27800 -23.43700 1.000 75.97154  ? 440  ILE A CG1   1 
ATOM   3160  C  CG2   . ILE A 1 440  ? -54.18100 -26.57800 -21.31200 1.000 73.18449  ? 440  ILE A CG2   1 
ATOM   3161  C  CD1   . ILE A 1 440  ? -53.49600 -23.84500 -23.16700 1.000 69.37752  ? 440  ILE A CD1   1 
ATOM   3162  N  N     . VAL A 1 441  ? -57.90300 -26.24700 -21.81900 1.000 76.92968  ? 441  VAL A N     1 
ATOM   3163  C  CA    . VAL A 1 441  ? -59.11100 -26.52000 -21.04700 1.000 74.59447  ? 441  VAL A CA    1 
ATOM   3164  C  C     . VAL A 1 441  ? -60.24000 -25.67200 -21.61300 1.000 77.58984  ? 441  VAL A C     1 
ATOM   3165  O  O     . VAL A 1 441  ? -60.11100 -24.44800 -21.71800 1.000 81.01380  ? 441  VAL A O     1 
ATOM   3166  C  CB    . VAL A 1 441  ? -58.92800 -26.22600 -19.54500 1.000 76.72395  ? 441  VAL A CB    1 
ATOM   3167  C  CG1   . VAL A 1 441  ? -60.27700 -26.21700 -18.84200 1.000 81.33064  ? 441  VAL A CG1   1 
ATOM   3168  C  CG2   . VAL A 1 441  ? -58.02100 -27.25600 -18.90500 1.000 77.53744  ? 441  VAL A CG2   1 
ATOM   3169  N  N     . ASN A 1 442  ? -61.33700 -26.32000 -21.98800 1.000 77.81274  ? 442  ASN A N     1 
ATOM   3170  C  CA    . ASN A 1 442  ? -62.56200 -25.64500 -22.38700 1.000 78.20248  ? 442  ASN A CA    1 
ATOM   3171  C  C     . ASN A 1 442  ? -63.70600 -26.13100 -21.50700 1.000 83.46591  ? 442  ASN A C     1 
ATOM   3172  O  O     . ASN A 1 442  ? -63.56800 -27.09500 -20.74900 1.000 84.57038  ? 442  ASN A O     1 
ATOM   3173  C  CB    . ASN A 1 442  ? -62.87300 -25.87900 -23.87200 1.000 77.02404  ? 442  ASN A CB    1 
ATOM   3174  C  CG    . ASN A 1 442  ? -62.84000 -27.34600 -24.25400 1.000 75.61061  ? 442  ASN A CG    1 
ATOM   3175  O  OD1   . ASN A 1 442  ? -62.80000 -28.22300 -23.39400 1.000 75.42600  ? 442  ASN A OD1   1 
ATOM   3176  N  ND2   . ASN A 1 442  ? -62.85900 -27.61700 -25.55200 1.000 77.09984  ? 442  ASN A ND2   1 
ATOM   3177  N  N     . SER A 1 443  ? -64.84900 -25.45700 -21.60800 1.000 80.45709  ? 443  SER A N     1 
ATOM   3178  C  CA    . SER A 1 443  ? -65.96400 -25.79300 -20.73400 1.000 77.53973  ? 443  SER A CA    1 
ATOM   3179  C  C     . SER A 1 443  ? -67.26800 -25.27900 -21.32200 1.000 78.24293  ? 443  SER A C     1 
ATOM   3180  O  O     . SER A 1 443  ? -67.28900 -24.35500 -22.13900 1.000 75.78277  ? 443  SER A O     1 
ATOM   3181  C  CB    . SER A 1 443  ? -65.75900 -25.22300 -19.32700 1.000 86.06159  ? 443  SER A CB    1 
ATOM   3182  O  OG    . SER A 1 443  ? -66.79600 -25.64300 -18.45900 1.000 94.56553  ? 443  SER A OG    1 
ATOM   3183  N  N     . GLY A 1 444  ? -68.35900 -25.90400 -20.88400 1.000 81.45320  ? 444  GLY A N     1 
ATOM   3184  C  CA    . GLY A 1 444  ? -69.70600 -25.44900 -21.16500 1.000 79.94636  ? 444  GLY A CA    1 
ATOM   3185  C  C     . GLY A 1 444  ? -70.56700 -25.58900 -19.92500 1.000 92.36894  ? 444  GLY A C     1 
ATOM   3186  O  O     . GLY A 1 444  ? -70.56800 -26.64700 -19.28900 1.000 90.09101  ? 444  GLY A O     1 
ATOM   3187  N  N     . MET A 1 445  ? -71.28900 -24.53100 -19.55500 1.000 92.08412  ? 445  MET A N     1 
ATOM   3188  C  CA    . MET A 1 445  ? -72.03700 -24.51100 -18.30400 1.000 84.74643  ? 445  MET A CA    1 
ATOM   3189  C  C     . MET A 1 445  ? -73.41600 -23.91400 -18.53500 1.000 83.83781  ? 445  MET A C     1 
ATOM   3190  O  O     . MET A 1 445  ? -73.53400 -22.84000 -19.13100 1.000 86.49724  ? 445  MET A O     1 
ATOM   3191  C  CB    . MET A 1 445  ? -71.29900 -23.70100 -17.23000 1.000 87.51180  ? 445  MET A CB    1 
ATOM   3192  C  CG    . MET A 1 445  ? -69.84200 -24.08800 -17.02700 1.000 80.97364  ? 445  MET A CG    1 
ATOM   3193  S  SD    . MET A 1 445  ? -68.93400 -22.84700 -16.08700 1.000 85.57873  ? 445  MET A SD    1 
ATOM   3194  C  CE    . MET A 1 445  ? -67.29500 -23.56500 -16.05800 1.000 83.61432  ? 445  MET A CE    1 
ATOM   3195  N  N     . ARG A 1 446  ? -74.44900 -24.59900 -18.04600 1.000 91.01299  ? 446  ARG A N     1 
ATOM   3196  C  CA    . ARG A 1 446  ? -75.82600 -24.13500 -18.14300 1.000 92.36617  ? 446  ARG A CA    1 
ATOM   3197  C  C     . ARG A 1 446  ? -76.45700 -24.11100 -16.75900 1.000 96.25897  ? 446  ARG A C     1 
ATOM   3198  O  O     . ARG A 1 446  ? -76.29700 -25.05400 -15.97800 1.000 93.99575  ? 446  ARG A O     1 
ATOM   3199  C  CB    . ARG A 1 446  ? -76.65400 -25.02800 -19.07800 1.000 92.75079  ? 446  ARG A CB    1 
ATOM   3200  C  CG    . ARG A 1 446  ? -78.12400 -24.64400 -19.16500 1.000 92.44277  ? 446  ARG A CG    1 
ATOM   3201  C  CD    . ARG A 1 446  ? -78.94100 -25.72000 -19.86300 1.000 89.12382  ? 446  ARG A CD    1 
ATOM   3202  N  NE    . ARG A 1 446  ? -78.91700 -26.98600 -19.13500 1.000 85.61100  ? 446  ARG A NE    1 
ATOM   3203  C  CZ    . ARG A 1 446  ? -79.88100 -27.40200 -18.32000 1.000 91.91859  ? 446  ARG A CZ    1 
ATOM   3204  N  NH1   . ARG A 1 446  ? -80.95800 -26.65300 -18.12400 1.000 97.04356  ? 446  ARG A NH1   1 
ATOM   3205  N  NH2   . ARG A 1 446  ? -79.77000 -28.57000 -17.70100 1.000 83.80562  ? 446  ARG A NH2   1 
ATOM   3206  N  N     . VAL A 1 447  ? -77.17500 -23.02900 -16.46000 1.000 98.67399  ? 447  VAL A N     1 
ATOM   3207  C  CA    . VAL A 1 447  ? -77.87200 -22.87200 -15.19100 1.000 101.87566 ? 447  VAL A CA    1 
ATOM   3208  C  C     . VAL A 1 447  ? -79.31800 -22.48400 -15.47200 1.000 104.81046 ? 447  VAL A C     1 
ATOM   3209  O  O     . VAL A 1 447  ? -79.63100 -21.88000 -16.50400 1.000 106.18257 ? 447  VAL A O     1 
ATOM   3210  C  CB    . VAL A 1 447  ? -77.18200 -21.82800 -14.27900 1.000 100.43880 ? 447  VAL A CB    1 
ATOM   3211  C  CG1   . VAL A 1 447  ? -77.49500 -20.41100 -14.73900 1.000 97.10320  ? 447  VAL A CG1   1 
ATOM   3212  C  CG2   . VAL A 1 447  ? -77.58500 -22.03100 -12.82300 1.000 103.70545 ? 447  VAL A CG2   1 
ATOM   3213  N  N     . PHE A 1 448  ? -80.20700 -22.85500 -14.55200 1.000 104.23421 ? 448  PHE A N     1 
ATOM   3214  C  CA    . PHE A 1 448  ? -81.63200 -22.58200 -14.69000 1.000 102.94168 ? 448  PHE A CA    1 
ATOM   3215  C  C     . PHE A 1 448  ? -82.21200 -22.22400 -13.33200 1.000 101.84169 ? 448  PHE A C     1 
ATOM   3216  O  O     . PHE A 1 448  ? -82.02600 -22.96400 -12.36200 1.000 104.22316 ? 448  PHE A O     1 
ATOM   3217  C  CB    . PHE A 1 448  ? -82.37300 -23.78800 -15.28100 1.000 99.00221  ? 448  PHE A CB    1 
ATOM   3218  C  CG    . PHE A 1 448  ? -83.84800 -23.56500 -15.46000 1.000 100.10941 ? 448  PHE A CG    1 
ATOM   3219  C  CD1   . PHE A 1 448  ? -84.31600 -22.59900 -16.33500 1.000 102.70419 ? 448  PHE A CD1   1 
ATOM   3220  C  CD2   . PHE A 1 448  ? -84.76800 -24.32400 -14.75600 1.000 103.08079 ? 448  PHE A CD2   1 
ATOM   3221  C  CE1   . PHE A 1 448  ? -85.67300 -22.39100 -16.50300 1.000 102.00768 ? 448  PHE A CE1   1 
ATOM   3222  C  CE2   . PHE A 1 448  ? -86.12600 -24.12200 -14.91900 1.000 101.42688 ? 448  PHE A CE2   1 
ATOM   3223  C  CZ    . PHE A 1 448  ? -86.57900 -23.15500 -15.79400 1.000 99.70331  ? 448  PHE A CZ    1 
ATOM   3224  N  N     . PHE A 1 449  ? -82.91200 -21.09300 -13.26900 1.000 101.78376 ? 449  PHE A N     1 
ATOM   3225  C  CA    . PHE A 1 449  ? -83.55300 -20.62800 -12.04600 1.000 106.33867 ? 449  PHE A CA    1 
ATOM   3226  C  C     . PHE A 1 449  ? -85.06200 -20.81600 -12.06300 1.000 110.48596 ? 449  PHE A C     1 
ATOM   3227  O  O     . PHE A 1 449  ? -85.62200 -21.41800 -11.14100 1.000 110.18559 ? 449  PHE A O     1 
ATOM   3228  C  CB    . PHE A 1 449  ? -83.21300 -19.15000 -11.80300 1.000 95.04331  ? 449  PHE A CB    1 
ATOM   3229  C  CG    . PHE A 1 449  ? -81.73800 -18.86200 -11.78400 1.000 88.31884  ? 449  PHE A CG    1 
ATOM   3230  C  CD1   . PHE A 1 449  ? -80.96800 -19.19500 -10.68200 1.000 89.16395  ? 449  PHE A CD1   1 
ATOM   3231  C  CD2   . PHE A 1 449  ? -81.12200 -18.26100 -12.86800 1.000 92.58930  ? 449  PHE A CD2   1 
ATOM   3232  C  CE1   . PHE A 1 449  ? -79.61200 -18.93100 -10.66000 1.000 91.31621  ? 449  PHE A CE1   1 
ATOM   3233  C  CE2   . PHE A 1 449  ? -79.76500 -17.99600 -12.85200 1.000 96.10516  ? 449  PHE A CE2   1 
ATOM   3234  C  CZ    . PHE A 1 449  ? -79.01000 -18.33200 -11.74600 1.000 95.45029  ? 449  PHE A CZ    1 
ATOM   3235  N  N     . GLY A 1 450  ? -85.74100 -20.31200 -13.09100 1.000 108.07230 ? 450  GLY A N     1 
ATOM   3236  C  CA    . GLY A 1 450  ? -87.17100 -20.50600 -13.22000 1.000 102.72929 ? 450  GLY A CA    1 
ATOM   3237  C  C     . GLY A 1 450  ? -88.00400 -19.58100 -12.35700 1.000 117.86747 ? 450  GLY A C     1 
ATOM   3238  O  O     . GLY A 1 450  ? -87.58500 -19.19800 -11.26100 1.000 123.81474 ? 450  GLY A O     1 
ATOM   3239  N  N     . GLU A 1 451  ? -89.18200 -19.20500 -12.86600 1.000 119.63544 ? 451  GLU A N     1 
ATOM   3240  C  CA    . GLU A 1 451  ? -90.18900 -18.38200 -12.17800 1.000 115.89019 ? 451  GLU A CA    1 
ATOM   3241  C  C     . GLU A 1 451  ? -89.60400 -17.12200 -11.52600 1.000 118.10387 ? 451  GLU A C     1 
ATOM   3242  O  O     . GLU A 1 451  ? -90.25100 -16.49900 -10.67800 1.000 121.62407 ? 451  GLU A O     1 
ATOM   3243  C  CB    . GLU A 1 451  ? -90.98600 -19.20900 -11.15600 1.000 111.04225 ? 451  GLU A CB    1 
ATOM   3244  C  CG    . GLU A 1 451  ? -90.27400 -19.55500 -9.85800  1.000 122.96565 ? 451  GLU A CG    1 
ATOM   3245  C  CD    . GLU A 1 451  ? -89.75900 -20.98200 -9.84100  1.000 124.53282 ? 451  GLU A CD    1 
ATOM   3246  O  OE1   . GLU A 1 451  ? -89.92900 -21.68900 -10.85700 1.000 121.13774 ? 451  GLU A OE1   1 
ATOM   3247  O  OE2   . GLU A 1 451  ? -89.18600 -21.39700 -8.81100  1.000 120.55479 ? 451  GLU A OE2   1 
ATOM   3248  N  N     . GLY A 1 452  ? -88.39700 -16.72400 -11.91600 1.000 110.81961 ? 452  GLY A N     1 
ATOM   3249  C  CA    . GLY A 1 452  ? -87.89900 -15.39600 -11.60000 1.000 111.89967 ? 452  GLY A CA    1 
ATOM   3250  C  C     . GLY A 1 452  ? -87.42700 -15.15000 -10.18300 1.000 115.56572 ? 452  GLY A C     1 
ATOM   3251  O  O     . GLY A 1 452  ? -87.64000 -14.05400 -9.64800  1.000 114.15151 ? 452  GLY A O     1 
ATOM   3252  N  N     . ASP A 1 453  ? -86.77900 -16.12900 -9.55800  1.000 117.05343 ? 453  ASP A N     1 
ATOM   3253  C  CA    . ASP A 1 453  ? -86.15600 -15.93100 -8.25700  1.000 114.96736 ? 453  ASP A CA    1 
ATOM   3254  C  C     . ASP A 1 453  ? -84.75500 -16.52600 -8.27000  1.000 111.95594 ? 453  ASP A C     1 
ATOM   3255  O  O     . ASP A 1 453  ? -84.47600 -17.48600 -8.99400  1.000 117.33381 ? 453  ASP A O     1 
ATOM   3256  C  CB    . ASP A 1 453  ? -86.99000 -16.54500 -7.12100  1.000 115.44588 ? 453  ASP A CB    1 
ATOM   3257  C  CG    . ASP A 1 453  ? -87.53000 -17.91400 -7.46500  1.000 125.66144 ? 453  ASP A CG    1 
ATOM   3258  O  OD1   . ASP A 1 453  ? -87.65600 -18.21600 -8.66700  1.000 124.31365 ? 453  ASP A OD1   1 
ATOM   3259  O  OD2   . ASP A 1 453  ? -87.84400 -18.68200 -6.53100  1.000 125.47647 ? 453  ASP A OD2   1 
ATOM   3260  N  N     . GLY A 1 454  ? -83.87600 -15.94300 -7.45700  1.000 112.40769 ? 454  GLY A N     1 
ATOM   3261  C  CA    . GLY A 1 454  ? -82.46000 -16.26200 -7.49200  1.000 107.21431 ? 454  GLY A CA    1 
ATOM   3262  C  C     . GLY A 1 454  ? -82.06200 -17.59000 -6.88200  1.000 106.00499 ? 454  GLY A C     1 
ATOM   3263  O  O     . GLY A 1 454  ? -81.01900 -17.68700 -6.22900  1.000 106.08591 ? 454  GLY A O     1 
ATOM   3264  N  N     . ILE A 1 455  ? -82.87300 -18.62100 -7.09000  1.000 107.64535 ? 455  ILE A N     1 
ATOM   3265  C  CA    . ILE A 1 455  ? -82.56400 -19.97700 -6.65300  1.000 112.44442 ? 455  ILE A CA    1 
ATOM   3266  C  C     . ILE A 1 455  ? -82.32200 -20.83600 -7.88400  1.000 109.87060 ? 455  ILE A C     1 
ATOM   3267  O  O     . ILE A 1 455  ? -83.02600 -20.70600 -8.89200  1.000 107.73415 ? 455  ILE A O     1 
ATOM   3268  C  CB    . ILE A 1 455  ? -83.69100 -20.55900 -5.77400  1.000 113.07961 ? 455  ILE A CB    1 
ATOM   3269  C  CG1   . ILE A 1 455  ? -84.98500 -20.70900 -6.57900  1.000 116.24161 ? 455  ILE A CG1   1 
ATOM   3270  C  CG2   . ILE A 1 455  ? -83.92000 -19.68800 -4.55200  1.000 104.70615 ? 455  ILE A CG2   1 
ATOM   3271  C  CD1   . ILE A 1 455  ? -84.97800 -21.83900 -7.57800  1.000 115.91096 ? 455  ILE A CD1   1 
ATOM   3272  N  N     . ILE A 1 456  ? -81.32000 -21.70400 -7.81200  1.000 104.66134 ? 456  ILE A N     1 
ATOM   3273  C  CA    . ILE A 1 456  ? -81.00000 -22.58600 -8.92600  1.000 105.03442 ? 456  ILE A CA    1 
ATOM   3274  C  C     . ILE A 1 456  ? -81.81200 -23.86800 -8.78200  1.000 107.23350 ? 456  ILE A C     1 
ATOM   3275  O  O     . ILE A 1 456  ? -81.90900 -24.44400 -7.69100  1.000 108.13917 ? 456  ILE A O     1 
ATOM   3276  C  CB    . ILE A 1 456  ? -79.48400 -22.86000 -9.00800  1.000 99.30853  ? 456  ILE A CB    1 
ATOM   3277  C  CG1   . ILE A 1 456  ? -79.04300 -24.03000 -8.12700  1.000 96.76019  ? 456  ILE A CG1   1 
ATOM   3278  C  CG2   . ILE A 1 456  ? -78.69900 -21.61400 -8.62700  1.000 97.37283  ? 456  ILE A CG2   1 
ATOM   3279  C  CD1   . ILE A 1 456  ? -77.59200 -24.41500 -8.32400  1.000 105.85374 ? 456  ILE A CD1   1 
ATOM   3280  N  N     . ARG A 1 457  ? -82.45900 -24.27400 -9.87300  1.000 108.75484 ? 457  ARG A N     1 
ATOM   3281  C  CA    . ARG A 1 457  ? -83.22900 -25.50900 -9.91900  1.000 106.94538 ? 457  ARG A CA    1 
ATOM   3282  C  C     . ARG A 1 457  ? -82.57000 -26.58500 -10.76300 1.000 99.34937  ? 457  ARG A C     1 
ATOM   3283  O  O     . ARG A 1 457  ? -82.75600 -27.77100 -10.48700 1.000 97.69585  ? 457  ARG A O     1 
ATOM   3284  C  CB    . ARG A 1 457  ? -84.63800 -25.24100 -10.46600 1.000 107.88412 ? 457  ARG A CB    1 
ATOM   3285  C  CG    . ARG A 1 457  ? -85.48400 -24.30100 -9.61400  1.000 109.49414 ? 457  ARG A CG    1 
ATOM   3286  C  CD    . ARG A 1 457  ? -86.63600 -25.04100 -8.94700  1.000 115.22072 ? 457  ARG A CD    1 
ATOM   3287  N  NE    . ARG A 1 457  ? -87.64100 -24.12800 -8.40800  1.000 122.95661 ? 457  ARG A NE    1 
ATOM   3288  C  CZ    . ARG A 1 457  ? -87.78800 -23.85100 -7.11600  1.000 119.46571 ? 457  ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A 1 457  ? -86.99100 -24.41400 -6.21900  1.000 117.99547 ? 457  ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A 1 457  ? -88.73000 -23.00600 -6.72100  1.000 113.76540 ? 457  ARG A NH2   1 
ATOM   3291  N  N     . GLU A 1 458  ? -81.81000 -26.19300 -11.78200 1.000 102.94427 ? 458  GLU A N     1 
ATOM   3292  C  CA    . GLU A 1 458  ? -81.04000 -27.10800 -12.60900 1.000 101.92804 ? 458  GLU A CA    1 
ATOM   3293  C  C     . GLU A 1 458  ? -79.64400 -26.53500 -12.79700 1.000 102.88613 ? 458  GLU A C     1 
ATOM   3294  O  O     . GLU A 1 458  ? -79.47800 -25.32100 -12.94800 1.000 103.41183 ? 458  GLU A O     1 
ATOM   3295  C  CB    . GLU A 1 458  ? -81.70300 -27.32900 -13.97500 1.000 105.09128 ? 458  GLU A CB    1 
ATOM   3296  C  CG    . GLU A 1 458  ? -83.17500 -27.69900 -13.90600 1.000 106.54371 ? 458  GLU A CG    1 
ATOM   3297  C  CD    . GLU A 1 458  ? -83.81500 -27.80400 -15.27500 1.000 97.95058  ? 458  GLU A CD    1 
ATOM   3298  O  OE1   . GLU A 1 458  ? -85.02300 -28.10900 -15.34500 1.000 90.17125  ? 458  GLU A OE1   1 
ATOM   3299  O  OE2   . GLU A 1 458  ? -83.11000 -27.58300 -16.28200 1.000 98.71020  ? 458  GLU A OE2   1 
ATOM   3300  N  N     . LEU A 1 459  ? -78.64200 -27.41000 -12.78000 1.000 99.20937  ? 459  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1 459  ? -77.26400 -26.99200 -12.98800 1.000 101.90860 ? 459  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1 459  ? -76.50700 -28.12600 -13.66100 1.000 105.48597 ? 459  LEU A C     1 
ATOM   3303  O  O     . LEU A 1 459  ? -76.63500 -29.28800 -13.26500 1.000 104.44422 ? 459  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1 459  ? -76.58500 -26.60300 -11.67000 1.000 94.41152  ? 459  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1 459  ? -75.15200 -26.07900 -11.79000 1.000 95.95304  ? 459  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1 459  ? -75.11300 -24.82300 -12.64700 1.000 93.25393  ? 459  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1 459  ? -74.55200 -25.81400 -10.41800 1.000 77.74302  ? 459  LEU A CD2   1 
ATOM   3308  N  N     . CYS A 1 460  ? -75.72400 -27.78100 -14.68000 1.000 102.02113 ? 460  CYS A N     1 
ATOM   3309  C  CA    . CYS A 1 460  ? -74.97300 -28.77300 -15.44200 1.000 101.49595 ? 460  CYS A CA    1 
ATOM   3310  C  C     . CYS A 1 460  ? -73.74600 -28.10100 -16.03500 1.000 97.06073  ? 460  CYS A C     1 
ATOM   3311  O  O     . CYS A 1 460  ? -73.87600 -27.18700 -16.85500 1.000 96.12757  ? 460  CYS A O     1 
ATOM   3312  C  CB    . CYS A 1 460  ? -75.83900 -29.38900 -16.54300 1.000 97.00888  ? 460  CYS A CB    1 
ATOM   3313  S  SG    . CYS A 1 460  ? -75.20300 -30.94000 -17.21600 1.000 107.26775 ? 460  CYS A SG    1 
ATOM   3314  N  N     . ILE A 1 461  ? -72.56400 -28.54800 -15.61900 1.000 93.51175  ? 461  ILE A N     1 
ATOM   3315  C  CA    . ILE A 1 461  ? -71.30300 -28.00200 -16.10100 1.000 92.56280  ? 461  ILE A CA    1 
ATOM   3316  C  C     . ILE A 1 461  ? -70.43800 -29.14600 -16.61100 1.000 96.81970  ? 461  ILE A C     1 
ATOM   3317  O  O     . ILE A 1 461  ? -70.53500 -30.28300 -16.13800 1.000 95.39056  ? 461  ILE A O     1 
ATOM   3318  C  CB    . ILE A 1 461  ? -70.56700 -27.19500 -15.00500 1.000 91.03633  ? 461  ILE A CB    1 
ATOM   3319  C  CG1   . ILE A 1 461  ? -70.11700 -28.11000 -13.86700 1.000 95.27908  ? 461  ILE A CG1   1 
ATOM   3320  C  CG2   . ILE A 1 461  ? -71.45700 -26.08800 -14.46300 1.000 93.62517  ? 461  ILE A CG2   1 
ATOM   3321  C  CD1   . ILE A 1 461  ? -68.62600 -28.29300 -13.79900 1.000 92.71872  ? 461  ILE A CD1   1 
ATOM   3322  N  N     . SER A 1 462  ? -69.58900 -28.83900 -17.59000 1.000 95.73499  ? 462  SER A N     1 
ATOM   3323  C  CA    . SER A 1 462  ? -68.74600 -29.84200 -18.22300 1.000 92.77431  ? 462  SER A CA    1 
ATOM   3324  C  C     . SER A 1 462  ? -67.37400 -29.25100 -18.50800 1.000 91.94958  ? 462  SER A C     1 
ATOM   3325  O  O     . SER A 1 462  ? -67.22700 -28.03900 -18.67800 1.000 93.04757  ? 462  SER A O     1 
ATOM   3326  C  CB    . SER A 1 462  ? -69.37200 -30.36000 -19.52400 1.000 93.42685  ? 462  SER A CB    1 
ATOM   3327  O  OG    . SER A 1 462  ? -68.52900 -31.31000 -20.15100 1.000 93.03151  ? 462  SER A OG    1 
ATOM   3328  N  N     . TYR A 1 463  ? -66.36900 -30.12500 -18.56400 1.000 88.99042  ? 463  TYR A N     1 
ATOM   3329  C  CA    . TYR A 1 463  ? -64.99600 -29.71600 -18.82400 1.000 88.72820  ? 463  TYR A CA    1 
ATOM   3330  C  C     . TYR A 1 463  ? -64.35100 -30.65900 -19.82700 1.000 87.30297  ? 463  TYR A C     1 
ATOM   3331  O  O     . TYR A 1 463  ? -64.53800 -31.87700 -19.75700 1.000 92.50744  ? 463  TYR A O     1 
ATOM   3332  C  CB    . TYR A 1 463  ? -64.16100 -29.69000 -17.53700 1.000 90.54622  ? 463  TYR A CB    1 
ATOM   3333  C  CG    . TYR A 1 463  ? -64.44700 -28.51000 -16.63900 1.000 85.32045  ? 463  TYR A CG    1 
ATOM   3334  C  CD1   . TYR A 1 463  ? -64.03800 -27.23200 -16.99300 1.000 80.26718  ? 463  TYR A CD1   1 
ATOM   3335  C  CD2   . TYR A 1 463  ? -65.11400 -28.67500 -15.43400 1.000 84.08331  ? 463  TYR A CD2   1 
ATOM   3336  C  CE1   . TYR A 1 463  ? -64.29400 -26.14900 -16.17500 1.000 84.80466  ? 463  TYR A CE1   1 
ATOM   3337  C  CE2   . TYR A 1 463  ? -65.37200 -27.59900 -14.61000 1.000 82.98016  ? 463  TYR A CE2   1 
ATOM   3338  C  CZ    . TYR A 1 463  ? -64.96300 -26.33900 -14.98500 1.000 81.07392  ? 463  TYR A CZ    1 
ATOM   3339  O  OH    . TYR A 1 463  ? -65.22000 -25.26600 -14.16400 1.000 75.01394  ? 463  TYR A OH    1 
ATOM   3340  N  N     . GLY A 1 464  ? -63.58800 -30.08700 -20.75500 1.000 83.77063  ? 464  GLY A N     1 
ATOM   3341  C  CA    . GLY A 1 464  ? -62.82300 -30.86700 -21.70800 1.000 81.19974  ? 464  GLY A CA    1 
ATOM   3342  C  C     . GLY A 1 464  ? -61.34600 -30.54100 -21.63800 1.000 80.60736  ? 464  GLY A C     1 
ATOM   3343  O  O     . GLY A 1 464  ? -60.96200 -29.49400 -21.10800 1.000 77.08102  ? 464  GLY A O     1 
ATOM   3344  N  N     . GLY A 1 465  ? -60.50300 -31.42100 -22.17000 1.000 77.00815  ? 465  GLY A N     1 
ATOM   3345  C  CA    . GLY A 1 465  ? -59.07200 -31.23100 -22.06700 1.000 69.23641  ? 465  GLY A CA    1 
ATOM   3346  C  C     . GLY A 1 465  ? -58.48700 -31.56200 -20.71500 1.000 78.08507  ? 465  GLY A C     1 
ATOM   3347  O  O     . GLY A 1 465  ? -57.28900 -31.33900 -20.50200 1.000 77.82112  ? 465  GLY A O     1 
ATOM   3348  N  N     . VAL A 1 466  ? -59.29300 -32.08800 -19.79400 1.000 82.65807  ? 466  VAL A N     1 
ATOM   3349  C  CA    . VAL A 1 466  ? -58.84400 -32.45400 -18.45700 1.000 85.70107  ? 466  VAL A CA    1 
ATOM   3350  C  C     . VAL A 1 466  ? -58.78400 -33.95800 -18.25900 1.000 80.30358  ? 466  VAL A C     1 
ATOM   3351  O  O     . VAL A 1 466  ? -58.39100 -34.41500 -17.17600 1.000 84.52417  ? 466  VAL A O     1 
ATOM   3352  C  CB    . VAL A 1 466  ? -59.73100 -31.80900 -17.37600 1.000 85.24331  ? 466  VAL A CB    1 
ATOM   3353  C  CG1   . VAL A 1 466  ? -59.88800 -30.32000 -17.64100 1.000 82.20908  ? 466  VAL A CG1   1 
ATOM   3354  C  CG2   . VAL A 1 466  ? -61.08900 -32.48800 -17.33800 1.000 90.50899  ? 466  VAL A CG2   1 
ATOM   3355  N  N     . GLY A 1 467  ? -59.15900 -34.74400 -19.26300 1.000 74.51283  ? 467  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1 467  ? -59.12400 -36.18200 -19.16000 1.000 78.26734  ? 467  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1 467  ? -59.24000 -36.84000 -20.51700 1.000 77.07460  ? 467  GLY A C     1 
ATOM   3358  O  O     . GLY A 1 467  ? -59.30500 -36.16900 -21.55100 1.000 74.99362  ? 467  GLY A O     1 
ATOM   3359  N  N     . PRO A 1 468  ? -59.26700 -38.17500 -20.54200 1.000 72.04310  ? 468  PRO A N     1 
ATOM   3360  C  CA    . PRO A 1 468  ? -59.38200 -38.88200 -21.82900 1.000 73.64865  ? 468  PRO A CA    1 
ATOM   3361  C  C     . PRO A 1 468  ? -60.68100 -38.60200 -22.56200 1.000 76.40037  ? 468  PRO A C     1 
ATOM   3362  O  O     . PRO A 1 468  ? -60.74000 -38.79900 -23.78200 1.000 79.54371  ? 468  PRO A O     1 
ATOM   3363  C  CB    . PRO A 1 468  ? -59.27000 -40.36000 -21.42900 1.000 68.26705  ? 468  PRO A CB    1 
ATOM   3364  C  CG    . PRO A 1 468  ? -59.67300 -40.39400 -19.98900 1.000 78.05926  ? 468  PRO A CG    1 
ATOM   3365  C  CD    . PRO A 1 468  ? -59.17900 -39.10500 -19.40400 1.000 72.82867  ? 468  PRO A CD    1 
ATOM   3366  N  N     . ALA A 1 469  ? -61.71900 -38.14800 -21.86400 1.000 72.09149  ? 469  ALA A N     1 
ATOM   3367  C  CA    . ALA A 1 469  ? -62.98600 -37.80700 -22.48900 1.000 76.79003  ? 469  ALA A CA    1 
ATOM   3368  C  C     . ALA A 1 469  ? -63.58200 -36.59900 -21.78100 1.000 79.65078  ? 469  ALA A C     1 
ATOM   3369  O  O     . ALA A 1 469  ? -63.19500 -36.25500 -20.66200 1.000 78.69942  ? 469  ALA A O     1 
ATOM   3370  C  CB    . ALA A 1 469  ? -63.97300 -38.98200 -22.45600 1.000 77.96830  ? 469  ALA A CB    1 
ATOM   3371  N  N     . THR A 1 470  ? -64.53100 -35.95300 -22.45600 1.000 80.63906  ? 470  THR A N     1 
ATOM   3372  C  CA    . THR A 1 470  ? -65.23700 -34.82800 -21.86100 1.000 76.59638  ? 470  THR A CA    1 
ATOM   3373  C  C     . THR A 1 470  ? -66.06100 -35.30200 -20.67100 1.000 84.84198  ? 470  THR A C     1 
ATOM   3374  O  O     . THR A 1 470  ? -66.85700 -36.23800 -20.78600 1.000 90.48196  ? 470  THR A O     1 
ATOM   3375  C  CB    . THR A 1 470  ? -66.13800 -34.16000 -22.90000 1.000 75.80914  ? 470  THR A CB    1 
ATOM   3376  O  OG1   . THR A 1 470  ? -65.34400 -33.71600 -24.00800 1.000 89.96429  ? 470  THR A OG1   1 
ATOM   3377  C  CG2   . THR A 1 470  ? -66.85700 -32.96800 -22.29500 1.000 83.00299  ? 470  THR A CG2   1 
ATOM   3378  N  N     . ILE A 1 471  ? -65.86300 -34.65900 -19.52400 1.000 88.48869  ? 471  ILE A N     1 
ATOM   3379  C  CA    . ILE A 1 471  ? -66.50800 -35.07200 -18.28500 1.000 91.78365  ? 471  ILE A CA    1 
ATOM   3380  C  C     . ILE A 1 471  ? -67.37400 -33.93600 -17.76100 1.000 93.99227  ? 471  ILE A C     1 
ATOM   3381  O  O     . ILE A 1 471  ? -67.11000 -32.75500 -18.00800 1.000 92.82632  ? 471  ILE A O     1 
ATOM   3382  C  CB    . ILE A 1 471  ? -65.47900 -35.50500 -17.21900 1.000 84.86504  ? 471  ILE A CB    1 
ATOM   3383  C  CG1   . ILE A 1 471  ? -64.53900 -34.35000 -16.87500 1.000 78.69318  ? 471  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE A 1 471  ? -64.68600 -36.71000 -17.69900 1.000 92.76515  ? 471  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE A 1 471  ? -63.57300 -34.67600 -15.76500 1.000 81.92784  ? 471  ILE A CD1   1 
ATOM   3386  N  N     . CYS A 1 472  ? -68.42200 -34.31000 -17.03100 1.000 100.95343 ? 472  CYS A N     1 
ATOM   3387  C  CA    . CYS A 1 472  ? -69.31500 -33.36700 -16.37600 1.000 99.44933  ? 472  CYS A CA    1 
ATOM   3388  C  C     . CYS A 1 472  ? -69.27500 -33.60600 -14.87400 1.000 97.34864  ? 472  CYS A C     1 
ATOM   3389  O  O     . CYS A 1 472  ? -69.26300 -34.75500 -14.42100 1.000 96.54144  ? 472  CYS A O     1 
ATOM   3390  C  CB    . CYS A 1 472  ? -70.75400 -33.51100 -16.88200 1.000 99.27141  ? 472  CYS A CB    1 
ATOM   3391  S  SG    . CYS A 1 472  ? -70.95000 -33.40100 -18.67400 1.000 111.93485 ? 472  CYS A SG    1 
ATOM   3392  N  N     . ALA A 1 473  ? -69.25500 -32.51900 -14.10400 1.000 95.63375  ? 473  ALA A N     1 
ATOM   3393  C  CA    . ALA A 1 473  ? -69.26700 -32.60900 -12.64400 1.000 98.36287  ? 473  ALA A CA    1 
ATOM   3394  C  C     . ALA A 1 473  ? -70.70900 -32.81700 -12.18900 1.000 99.25102  ? 473  ALA A C     1 
ATOM   3395  O  O     . ALA A 1 473  ? -71.38300 -31.91100 -11.69300 1.000 96.11821  ? 473  ALA A O     1 
ATOM   3396  C  CB    . ALA A 1 473  ? -68.64900 -31.36600 -12.01800 1.000 96.68921  ? 473  ALA A CB    1 
ATOM   3397  N  N     . LYS A 1 474  ? -71.18700 -34.05100 -12.37000 1.000 102.70550 ? 474  LYS A N     1 
ATOM   3398  C  CA    . LYS A 1 474  ? -72.55400 -34.38000 -11.98000 1.000 98.12810  ? 474  LYS A CA    1 
ATOM   3399  C  C     . LYS A 1 474  ? -72.72500 -34.37700 -10.46600 1.000 101.02782 ? 474  LYS A C     1 
ATOM   3400  O  O     . LYS A 1 474  ? -73.80600 -34.04400 -9.96800  1.000 101.61821 ? 474  LYS A O     1 
ATOM   3401  C  CB    . LYS A 1 474  ? -72.95100 -35.73700 -12.56100 1.000 96.40361  ? 474  LYS A CB    1 
ATOM   3402  C  CG    . LYS A 1 474  ? -71.87700 -36.80700 -12.42800 1.000 94.36884  ? 474  LYS A CG    1 
ATOM   3403  C  CD    . LYS A 1 474  ? -72.21600 -38.03400 -13.25800 1.000 95.10631  ? 474  LYS A CD    1 
ATOM   3404  C  CE    . LYS A 1 474  ? -71.04500 -39.00200 -13.31800 1.000 91.19863  ? 474  LYS A CE    1 
ATOM   3405  N  NZ    . LYS A 1 474  ? -71.30900 -40.14000 -14.24200 1.000 99.38653  ? 474  LYS A NZ    1 
ATOM   3406  N  N     . ASN A 1 475  ? -71.67800 -34.74000 -9.72100  1.000 99.00082  ? 475  ASN A N     1 
ATOM   3407  C  CA    . ASN A 1 475  ? -71.77400 -34.72700 -8.26600  1.000 101.97998 ? 475  ASN A CA    1 
ATOM   3408  C  C     . ASN A 1 475  ? -71.71800 -33.30500 -7.72100  1.000 103.45857 ? 475  ASN A C     1 
ATOM   3409  O  O     . ASN A 1 475  ? -72.40700 -32.98100 -6.74700  1.000 105.61638 ? 475  ASN A O     1 
ATOM   3410  C  CB    . ASN A 1 475  ? -70.66100 -35.58100 -7.65800  1.000 102.80195 ? 475  ASN A CB    1 
ATOM   3411  C  CG    . ASN A 1 475  ? -70.63300 -36.98900 -8.22100  1.000 100.89484 ? 475  ASN A CG    1 
ATOM   3412  O  OD1   . ASN A 1 475  ? -71.57600 -37.42500 -8.88200  1.000 92.48829  ? 475  ASN A OD1   1 
ATOM   3413  N  ND2   . ASN A 1 475  ? -69.54800 -37.70800 -7.96100  1.000 108.10569 ? 475  ASN A ND2   1 
ATOM   3414  N  N     . SER A 1 476  ? -70.90300 -32.44300 -8.33400  1.000 100.52846 ? 476  SER A N     1 
ATOM   3415  C  CA    . SER A 1 476  ? -70.82200 -31.05700 -7.88300  1.000 98.81306  ? 476  SER A CA    1 
ATOM   3416  C  C     . SER A 1 476  ? -72.12900 -30.31700 -8.13600  1.000 97.01545  ? 476  SER A C     1 
ATOM   3417  O  O     . SER A 1 476  ? -72.61100 -29.58300 -7.26700  1.000 97.52201  ? 476  SER A O     1 
ATOM   3418  C  CB    . SER A 1 476  ? -69.66000 -30.34500 -8.57300  1.000 102.99984 ? 476  SER A CB    1 
ATOM   3419  O  OG    . SER A 1 476  ? -68.42800 -30.99000 -8.30000  1.000 103.00822 ? 476  SER A OG    1 
ATOM   3420  N  N     . CYS A 1 477  ? -72.71600 -30.49800 -9.32100  1.000 103.18347 ? 477  CYS A N     1 
ATOM   3421  C  CA    . CYS A 1 477  ? -73.99000 -29.85800 -9.62700  1.000 110.62362 ? 477  CYS A CA    1 
ATOM   3422  C  C     . CYS A 1 477  ? -75.13300 -30.41500 -8.79100  1.000 108.12263 ? 477  CYS A C     1 
ATOM   3423  O  O     . CYS A 1 477  ? -76.15900 -29.74300 -8.64300  1.000 107.28181 ? 477  CYS A O     1 
ATOM   3424  C  CB    . CYS A 1 477  ? -74.31200 -30.00900 -11.11400 1.000 109.53747 ? 477  CYS A CB    1 
ATOM   3425  S  SG    . CYS A 1 477  ? -73.14500 -29.18000 -12.21700 1.000 103.74970 ? 477  CYS A SG    1 
ATOM   3426  N  N     . GLN A 1 478  ? -74.98300 -31.62300 -8.24500  1.000 106.28673 ? 478  GLN A N     1 
ATOM   3427  C  CA    . GLN A 1 478  ? -76.03000 -32.19200 -7.40400  1.000 109.61945 ? 478  GLN A CA    1 
ATOM   3428  C  C     . GLN A 1 478  ? -76.05500 -31.52700 -6.03300  1.000 109.01759 ? 478  GLN A C     1 
ATOM   3429  O  O     . GLN A 1 478  ? -77.12100 -31.14400 -5.53600  1.000 108.23236 ? 478  GLN A O     1 
ATOM   3430  C  CB    . GLN A 1 478  ? -75.82600 -33.70200 -7.26600  1.000 112.78589 ? 478  GLN A CB    1 
ATOM   3431  C  CG    . GLN A 1 478  ? -76.96400 -34.42500 -6.56200  1.000 111.41438 ? 478  GLN A CG    1 
ATOM   3432  C  CD    . GLN A 1 478  ? -78.19100 -34.57700 -7.44000  1.000 116.54916 ? 478  GLN A CD    1 
ATOM   3433  O  OE1   . GLN A 1 478  ? -78.29700 -35.52500 -8.21800  1.000 117.96327 ? 478  GLN A OE1   1 
ATOM   3434  N  NE2   . GLN A 1 478  ? -79.12700 -33.64300 -7.31700  1.000 105.19477 ? 478  GLN A NE2   1 
ATOM   3435  N  N     . LYS A 1 479  ? -74.88600 -31.37300 -5.41100  1.000 107.40990 ? 479  LYS A N     1 
ATOM   3436  C  CA    . LYS A 1 479  ? -74.78500 -30.83000 -4.06100  1.000 104.25389 ? 479  LYS A CA    1 
ATOM   3437  C  C     . LYS A 1 479  ? -75.00900 -29.32400 -3.99800  1.000 103.79310 ? 479  LYS A C     1 
ATOM   3438  O  O     . LYS A 1 479  ? -74.88200 -28.75000 -2.91200  1.000 109.86366 ? 479  LYS A O     1 
ATOM   3439  C  CB    . LYS A 1 479  ? -73.41600 -31.16900 -3.46700  1.000 101.00963 ? 479  LYS A CB    1 
ATOM   3440  C  CG    . LYS A 1 479  ? -73.14900 -32.65900 -3.32600  1.000 105.27103 ? 479  LYS A CG    1 
ATOM   3441  C  CD    . LYS A 1 479  ? -71.65800 -32.95600 -3.33900  1.000 107.15510 ? 479  LYS A CD    1 
ATOM   3442  C  CE    . LYS A 1 479  ? -71.39200 -34.45200 -3.29600  1.000 112.40371 ? 479  LYS A CE    1 
ATOM   3443  N  NZ    . LYS A 1 479  ? -70.05000 -34.79800 -3.83900  1.000 105.97496 ? 479  LYS A NZ    1 
ATOM   3444  N  N     . LEU A 1 480  ? -75.33400 -28.67200 -5.11600  1.000 103.43984 ? 480  LEU A N     1 
ATOM   3445  C  CA    . LEU A 1 480  ? -75.51600 -27.22800 -5.14200  1.000 102.84248 ? 480  LEU A CA    1 
ATOM   3446  C  C     . LEU A 1 480  ? -76.92300 -26.78300 -5.50800  1.000 103.47067 ? 480  LEU A C     1 
ATOM   3447  O  O     . LEU A 1 480  ? -77.20800 -25.58300 -5.41900  1.000 101.66988 ? 480  LEU A O     1 
ATOM   3448  C  CB    . LEU A 1 480  ? -74.52700 -26.58000 -6.12400  1.000 102.11245 ? 480  LEU A CB    1 
ATOM   3449  C  CG    . LEU A 1 480  ? -73.20000 -26.06100 -5.56600  1.000 106.97383 ? 480  LEU A CG    1 
ATOM   3450  C  CD1   . LEU A 1 480  ? -72.41500 -27.16200 -4.87000  1.000 107.84241 ? 480  LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A 1 480  ? -72.37900 -25.43900 -6.68100  1.000 102.71079 ? 480  LEU A CD2   1 
ATOM   3452  N  N     . ILE A 1 481  ? -77.80600 -27.69900 -5.91100  1.000 108.81502 ? 481  ILE A N     1 
ATOM   3453  C  CA    . ILE A 1 481  ? -79.14600 -27.31100 -6.33700  1.000 112.55172 ? 481  ILE A CA    1 
ATOM   3454  C  C     . ILE A 1 481  ? -79.90300 -26.69700 -5.16900  1.000 110.31395 ? 481  ILE A C     1 
ATOM   3455  O  O     . ILE A 1 481  ? -79.99800 -27.28900 -4.08600  1.000 114.67906 ? 481  ILE A O     1 
ATOM   3456  C  CB    . ILE A 1 481  ? -79.89500 -28.52100 -6.91400  1.000 106.46143 ? 481  ILE A CB    1 
ATOM   3457  C  CG1   . ILE A 1 481  ? -79.23900 -28.99000 -8.21400  1.000 97.61717  ? 481  ILE A CG1   1 
ATOM   3458  C  CG2   . ILE A 1 481  ? -81.35900 -28.18200 -7.15100  1.000 92.43278  ? 481  ILE A CG2   1 
ATOM   3459  C  CD1   . ILE A 1 481  ? -79.26800 -27.96000 -9.32100  1.000 97.87452  ? 481  ILE A CD1   1 
ATOM   3460  N  N     . GLY A 1 482  ? -80.44400 -25.49800 -5.38400  1.000 105.43554 ? 482  GLY A N     1 
ATOM   3461  C  CA    . GLY A 1 482  ? -81.26000 -24.81200 -4.40500  1.000 105.77654 ? 482  GLY A CA    1 
ATOM   3462  C  C     . GLY A 1 482  ? -80.64800 -23.54600 -3.84400  1.000 106.13052 ? 482  GLY A C     1 
ATOM   3463  O  O     . GLY A 1 482  ? -81.37800 -22.72300 -3.27500  1.000 101.35245 ? 482  GLY A O     1 
ATOM   3464  N  N     . ARG A 1 483  ? -79.33800 -23.35900 -3.99000  1.000 106.89025 ? 483  ARG A N     1 
ATOM   3465  C  CA    . ARG A 1 483  ? -78.66500 -22.21100 -3.40500  1.000 103.53114 ? 483  ARG A CA    1 
ATOM   3466  C  C     . ARG A 1 483  ? -78.91000 -20.95900 -4.24600  1.000 103.41875 ? 483  ARG A C     1 
ATOM   3467  O  O     . ARG A 1 483  ? -79.61500 -20.98100 -5.26000  1.000 101.50105 ? 483  ARG A O     1 
ATOM   3468  C  CB    . ARG A 1 483  ? -77.17100 -22.49000 -3.26100  1.000 103.52135 ? 483  ARG A CB    1 
ATOM   3469  C  CG    . ARG A 1 483  ? -76.85200 -23.83600 -2.63400  1.000 104.86095 ? 483  ARG A CG    1 
ATOM   3470  C  CD    . ARG A 1 483  ? -75.63600 -23.75200 -1.72800  1.000 105.13501 ? 483  ARG A CD    1 
ATOM   3471  N  NE    . ARG A 1 483  ? -75.22300 -25.06800 -1.25100  1.000 108.09837 ? 483  ARG A NE    1 
ATOM   3472  C  CZ    . ARG A 1 483  ? -74.54600 -25.27600 -0.12700  1.000 107.48562 ? 483  ARG A CZ    1 
ATOM   3473  N  NH1   . ARG A 1 483  ? -74.20900 -24.25300 0.64500   1.000 111.21370 ? 483  ARG A NH1   1 
ATOM   3474  N  NH2   . ARG A 1 483  ? -74.21000 -26.50900 0.22900   1.000 105.70161 ? 483  ARG A NH2   1 
ATOM   3475  N  N     . HIS A 1 484  ? -78.31800 -19.84900 -3.81500  1.000 104.52916 ? 484  HIS A N     1 
ATOM   3476  C  CA    . HIS A 1 484  ? -78.42300 -18.57100 -4.50100  1.000 104.01982 ? 484  HIS A CA    1 
ATOM   3477  C  C     . HIS A 1 484  ? -77.09600 -18.20400 -5.15300  1.000 110.20229 ? 484  HIS A C     1 
ATOM   3478  O  O     . HIS A 1 484  ? -76.03200 -18.70900 -4.78500  1.000 116.27462 ? 484  HIS A O     1 
ATOM   3479  C  CB    . HIS A 1 484  ? -78.85400 -17.46100 -3.53400  1.000 111.02501 ? 484  HIS A CB    1 
ATOM   3480  C  CG    . HIS A 1 484  ? -80.23200 -17.64600 -2.98100  1.000 109.20076 ? 484  HIS A CG    1 
ATOM   3481  N  ND1   . HIS A 1 484  ? -80.53300 -18.60000 -2.03400  1.000 106.92811 ? 484  HIS A ND1   1 
ATOM   3482  C  CD2   . HIS A 1 484  ? -81.39000 -16.99100 -3.23600  1.000 104.33376 ? 484  HIS A CD2   1 
ATOM   3483  C  CE1   . HIS A 1 484  ? -81.81800 -18.53200 -1.73600  1.000 109.64326 ? 484  HIS A CE1   1 
ATOM   3484  N  NE2   . HIS A 1 484  ? -82.36000 -17.56100 -2.44900  1.000 108.19686 ? 484  HIS A NE2   1 
ATOM   3485  N  N     . TRP A 1 485  ? -77.17800 -17.30700 -6.13300  1.000 106.63969 ? 485  TRP A N     1 
ATOM   3486  C  CA    . TRP A 1 485  ? -76.00100 -16.83100 -6.85300  1.000 109.56858 ? 485  TRP A CA    1 
ATOM   3487  C  C     . TRP A 1 485  ? -75.29200 -15.78800 -5.99900  1.000 105.62537 ? 485  TRP A C     1 
ATOM   3488  O  O     . TRP A 1 485  ? -75.83000 -14.70200 -5.75800  1.000 105.72232 ? 485  TRP A O     1 
ATOM   3489  C  CB    . TRP A 1 485  ? -76.40100 -16.25600 -8.20700  1.000 113.90326 ? 485  TRP A CB    1 
ATOM   3490  C  CG    . TRP A 1 485  ? -75.50700 -16.68800 -9.32500  1.000 114.55478 ? 485  TRP A CG    1 
ATOM   3491  C  CD1   . TRP A 1 485  ? -74.75500 -15.88200 -10.12600 1.000 108.05111 ? 485  TRP A CD1   1 
ATOM   3492  C  CD2   . TRP A 1 485  ? -75.28900 -18.02900 -9.78400  1.000 109.87182 ? 485  TRP A CD2   1 
ATOM   3493  N  NE1   . TRP A 1 485  ? -74.06700 -16.63800 -11.04300 1.000 103.06959 ? 485  TRP A NE1   1 
ATOM   3494  C  CE2   . TRP A 1 485  ? -74.38000 -17.95800 -10.85800 1.000 106.22167 ? 485  TRP A CE2   1 
ATOM   3495  C  CE3   . TRP A 1 485  ? -75.77000 -19.28100 -9.38900  1.000 110.79181 ? 485  TRP A CE3   1 
ATOM   3496  C  CZ2   . TRP A 1 485  ? -73.94200 -19.09100 -11.54100 1.000 104.77223 ? 485  TRP A CZ2   1 
ATOM   3497  C  CZ3   . TRP A 1 485  ? -75.33300 -20.40500 -10.06900 1.000 113.91820 ? 485  TRP A CZ3   1 
ATOM   3498  C  CH2   . TRP A 1 485  ? -74.42900 -20.30200 -11.13200 1.000 103.25710 ? 485  TRP A CH2   1 
ATOM   3499  N  N     . ASN A 1 486  ? -74.08200 -16.10900 -5.55400  1.000 102.59943 ? 486  ASN A N     1 
ATOM   3500  C  CA    . ASN A 1 486  ? -73.34400 -15.27700 -4.61100  1.000 103.96459 ? 486  ASN A CA    1 
ATOM   3501  C  C     . ASN A 1 486  ? -71.90200 -15.76400 -4.54500  1.000 112.40069 ? 486  ASN A C     1 
ATOM   3502  O  O     . ASN A 1 486  ? -71.55700 -16.82100 -5.08000  1.000 115.94274 ? 486  ASN A O     1 
ATOM   3503  C  CB    . ASN A 1 486  ? -74.00600 -15.29500 -3.22900  1.000 109.82060 ? 486  ASN A CB    1 
ATOM   3504  C  CG    . ASN A 1 486  ? -74.12000 -16.69400 -2.65700  1.000 114.97610 ? 486  ASN A CG    1 
ATOM   3505  O  OD1   . ASN A 1 486  ? -73.16100 -17.46000 -2.65900  1.000 117.49571 ? 486  ASN A OD1   1 
ATOM   3506  N  ND2   . ASN A 1 486  ? -75.29900 -17.02600 -2.14400  1.000 109.54863 ? 486  ASN A ND2   1 
ATOM   3507  N  N     . GLU A 1 487  ? -71.06100 -14.97700 -3.86900  1.000 111.04183 ? 487  GLU A N     1 
ATOM   3508  C  CA    . GLU A 1 487  ? -69.65600 -15.34400 -3.71900  1.000 110.89162 ? 487  GLU A CA    1 
ATOM   3509  C  C     . GLU A 1 487  ? -69.44800 -16.41800 -2.65900  1.000 113.76658 ? 487  GLU A C     1 
ATOM   3510  O  O     . GLU A 1 487  ? -68.47200 -17.17200 -2.73500  1.000 113.43134 ? 487  GLU A O     1 
ATOM   3511  C  CB    . GLU A 1 487  ? -68.81600 -14.11100 -3.38100  1.000 105.90282 ? 487  GLU A CB    1 
ATOM   3512  C  CG    . GLU A 1 487  ? -68.46200 -13.24400 -4.57700  1.000 114.15199 ? 487  GLU A CG    1 
ATOM   3513  C  CD    . GLU A 1 487  ? -67.06900 -12.65400 -4.46900  1.000 120.94926 ? 487  GLU A CD    1 
ATOM   3514  O  OE1   . GLU A 1 487  ? -66.10200 -13.32800 -4.88600  1.000 115.03338 ? 487  GLU A OE1   1 
ATOM   3515  O  OE2   . GLU A 1 487  ? -66.93800 -11.51800 -3.96400  1.000 110.73877 ? 487  GLU A OE2   1 
ATOM   3516  N  N     . GLN A 1 488  ? -70.34100 -16.50400 -1.66900  1.000 117.02661 ? 488  GLN A N     1 
ATOM   3517  C  CA    . GLN A 1 488  ? -70.17600 -17.49900 -0.61400  1.000 122.50948 ? 488  GLN A CA    1 
ATOM   3518  C  C     . GLN A 1 488  ? -70.42000 -18.91400 -1.12900  1.000 120.99731 ? 488  GLN A C     1 
ATOM   3519  O  O     . GLN A 1 488  ? -69.79500 -19.86300 -0.64300  1.000 119.46306 ? 488  GLN A O     1 
ATOM   3520  C  CB    . GLN A 1 488  ? -71.10600 -17.17600 0.55800   1.000 118.34117 ? 488  GLN A CB    1 
ATOM   3521  C  CG    . GLN A 1 488  ? -72.57400 -17.38200 0.25100   1.000 117.50476 ? 488  GLN A CG    1 
ATOM   3522  C  CD    . GLN A 1 488  ? -73.48200 -17.01200 1.39300   1.000 120.91620 ? 488  GLN A CD    1 
ATOM   3523  O  OE1   . GLN A 1 488  ? -73.21700 -17.35100 2.53700   1.000 115.65116 ? 488  GLN A OE1   1 
ATOM   3524  N  NE2   . GLN A 1 488  ? -74.57000 -16.31500 1.08600   1.000 123.64659 ? 488  GLN A NE2   1 
ATOM   3525  N  N     . MET A 1 489  ? -71.31300 -19.07600 -2.11000  1.000 117.04624 ? 489  MET A N     1 
ATOM   3526  C  CA    . MET A 1 489  ? -71.52100 -20.38400 -2.72200  1.000 118.74538 ? 489  MET A CA    1 
ATOM   3527  C  C     . MET A 1 489  ? -70.39600 -20.72900 -3.68700  1.000 118.48401 ? 489  MET A C     1 
ATOM   3528  O  O     . MET A 1 489  ? -69.99900 -21.89500 -3.79000  1.000 109.40087 ? 489  MET A O     1 
ATOM   3529  C  CB    . MET A 1 489  ? -72.87400 -20.42200 -3.44100  1.000 114.17135 ? 489  MET A CB    1 
ATOM   3530  C  CG    . MET A 1 489  ? -73.10900 -21.63000 -4.35500  1.000 117.73858 ? 489  MET A CG    1 
ATOM   3531  S  SD    . MET A 1 489  ? -72.41900 -21.46800 -6.01900  1.000 121.22615 ? 489  MET A SD    1 
ATOM   3532  C  CE    . MET A 1 489  ? -73.86600 -20.95900 -6.93600  1.000 116.10107 ? 489  MET A CE    1 
ATOM   3533  N  N     . LEU A 1 490  ? -69.88100 -19.73000 -4.40700  1.000 119.48954 ? 490  LEU A N     1 
ATOM   3534  C  CA    . LEU A 1 490  ? -68.87900 -19.99500 -5.43300  1.000 114.00665 ? 490  LEU A CA    1 
ATOM   3535  C  C     . LEU A 1 490  ? -67.62700 -20.62000 -4.83000  1.000 113.60853 ? 490  LEU A C     1 
ATOM   3536  O  O     . LEU A 1 490  ? -67.05400 -21.55300 -5.40300  1.000 115.46544 ? 490  LEU A O     1 
ATOM   3537  C  CB    . LEU A 1 490  ? -68.54500 -18.69800 -6.17300  1.000 108.23716 ? 490  LEU A CB    1 
ATOM   3538  C  CG    . LEU A 1 490  ? -67.16900 -18.49400 -6.81300  1.000 106.51961 ? 490  LEU A CG    1 
ATOM   3539  C  CD1   . LEU A 1 490  ? -66.92800 -19.50000 -7.93000  1.000 106.95978 ? 490  LEU A CD1   1 
ATOM   3540  C  CD2   . LEU A 1 490  ? -67.03000 -17.07000 -7.33100  1.000 98.53620  ? 490  LEU A CD2   1 
ATOM   3541  N  N     . ASP A 1 491  ? -67.20200 -20.13500 -3.65900  1.000 114.26936 ? 491  ASP A N     1 
ATOM   3542  C  CA    . ASP A 1 491  ? -65.99300 -20.66500 -3.03600  1.000 116.75311 ? 491  ASP A CA    1 
ATOM   3543  C  C     . ASP A 1 491  ? -66.14600 -22.12900 -2.64400  1.000 118.86981 ? 491  ASP A C     1 
ATOM   3544  O  O     . ASP A 1 491  ? -65.16300 -22.87800 -2.65800  1.000 120.91817 ? 491  ASP A O     1 
ATOM   3545  C  CB    . ASP A 1 491  ? -65.61300 -19.82400 -1.81700  1.000 118.83326 ? 491  ASP A CB    1 
ATOM   3546  C  CG    . ASP A 1 491  ? -64.84900 -18.56800 -2.19100  1.000 125.87329 ? 491  ASP A CG    1 
ATOM   3547  O  OD1   . ASP A 1 491  ? -65.41800 -17.71200 -2.90200  1.000 122.90320 ? 491  ASP A OD1   1 
ATOM   3548  O  OD2   . ASP A 1 491  ? -63.67800 -18.43900 -1.77700  1.000 120.56309 ? 491  ASP A OD2   1 
ATOM   3549  N  N     . ILE A 1 492  ? -67.35900 -22.56000 -2.29100  1.000 115.21377 ? 492  ILE A N     1 
ATOM   3550  C  CA    . ILE A 1 492  ? -67.56900 -23.97800 -2.01400  1.000 116.43541 ? 492  ILE A CA    1 
ATOM   3551  C  C     . ILE A 1 492  ? -67.79300 -24.76900 -3.29700  1.000 115.84020 ? 492  ILE A C     1 
ATOM   3552  O  O     . ILE A 1 492  ? -67.55800 -25.98300 -3.31500  1.000 116.13868 ? 492  ILE A O     1 
ATOM   3553  C  CB    . ILE A 1 492  ? -68.74100 -24.19700 -1.04100  1.000 123.53680 ? 492  ILE A CB    1 
ATOM   3554  C  CG1   . ILE A 1 492  ? -70.07200 -24.27400 -1.79200  1.000 117.62336 ? 492  ILE A CG1   1 
ATOM   3555  C  CG2   . ILE A 1 492  ? -68.78300 -23.08900 0.00100   1.000 124.77683 ? 492  ILE A CG2   1 
ATOM   3556  C  CD1   . ILE A 1 492  ? -71.26900 -24.44700 -0.89400  1.000 109.32097 ? 492  ILE A CD1   1 
ATOM   3557  N  N     . ALA A 1 493  ? -68.23500 -24.11300 -4.37400  1.000 111.24500 ? 493  ALA A N     1 
ATOM   3558  C  CA    . ALA A 1 493  ? -68.34000 -24.79200 -5.65900  1.000 104.88805 ? 493  ALA A CA    1 
ATOM   3559  C  C     . ALA A 1 493  ? -66.96700 -25.11900 -6.22600  1.000 101.56612 ? 493  ALA A C     1 
ATOM   3560  O  O     . ALA A 1 493  ? -66.81000 -26.12300 -6.92900  1.000 97.70364  ? 493  ALA A O     1 
ATOM   3561  C  CB    . ALA A 1 493  ? -69.12700 -23.93300 -6.64800  1.000 104.91424 ? 493  ALA A CB    1 
ATOM   3562  N  N     . CYS A 1 494  ? -65.96600 -24.28800 -5.93000  1.000 104.80928 ? 494  CYS A N     1 
ATOM   3563  C  CA    . CYS A 1 494  ? -64.61400 -24.54100 -6.41600  1.000 103.26056 ? 494  CYS A CA    1 
ATOM   3564  C  C     . CYS A 1 494  ? -64.01200 -25.76200 -5.73400  1.000 106.40367 ? 494  CYS A C     1 
ATOM   3565  O  O     . CYS A 1 494  ? -63.67000 -26.75200 -6.39000  1.000 104.48373 ? 494  CYS A O     1 
ATOM   3566  C  CB    . CYS A 1 494  ? -63.73900 -23.30900 -6.18400  1.000 98.62302  ? 494  CYS A CB    1 
ATOM   3567  S  SG    . CYS A 1 494  ? -64.39800 -21.78400 -6.88400  1.000 96.83095  ? 494  CYS A SG    1 
ATOM   3568  N  N     . ARG A 1 495  ? -63.88400 -25.70900 -4.40500  1.000 108.66254 ? 495  ARG A N     1 
ATOM   3569  C  CA    . ARG A 1 495  ? -63.28300 -26.80800 -3.65800  1.000 109.82091 ? 495  ARG A CA    1 
ATOM   3570  C  C     . ARG A 1 495  ? -64.04200 -28.11500 -3.84400  1.000 107.95985 ? 495  ARG A C     1 
ATOM   3571  O  O     . ARG A 1 495  ? -63.46200 -29.18900 -3.64800  1.000 109.66382 ? 495  ARG A O     1 
ATOM   3572  C  CB    . ARG A 1 495  ? -63.20500 -26.44000 -2.17600  1.000 107.87778 ? 495  ARG A CB    1 
ATOM   3573  C  CG    . ARG A 1 495  ? -62.48700 -25.12200 -1.92600  1.000 113.68200 ? 495  ARG A CG    1 
ATOM   3574  C  CD    . ARG A 1 495  ? -62.66600 -24.63400 -0.49900  1.000 116.72448 ? 495  ARG A CD    1 
ATOM   3575  N  NE    . ARG A 1 495  ? -62.43100 -23.19600 -0.39600  1.000 118.80126 ? 495  ARG A NE    1 
ATOM   3576  C  CZ    . ARG A 1 495  ? -61.26600 -22.64900 -0.06600  1.000 123.14410 ? 495  ARG A CZ    1 
ATOM   3577  N  NH1   . ARG A 1 495  ? -60.21800 -23.41900 0.19400   1.000 117.77658 ? 495  ARG A NH1   1 
ATOM   3578  N  NH2   . ARG A 1 495  ? -61.14700 -21.32900 0.00000   1.000 117.87905 ? 495  ARG A NH2   1 
ATOM   3579  N  N     . LEU A 1 496  ? -65.32100 -28.05000 -4.21900  1.000 100.27548 ? 496  LEU A N     1 
ATOM   3580  C  CA    . LEU A 1 496  ? -66.05500 -29.26100 -4.56700  1.000 104.68141 ? 496  LEU A CA    1 
ATOM   3581  C  C     . LEU A 1 496  ? -65.67800 -29.74900 -5.96000  1.000 102.49421 ? 496  LEU A C     1 
ATOM   3582  O  O     . LEU A 1 496  ? -65.46400 -30.95000 -6.16400  1.000 101.73250 ? 496  LEU A O     1 
ATOM   3583  C  CB    . LEU A 1 496  ? -67.56100 -29.00400 -4.47800  1.000 101.36401 ? 496  LEU A CB    1 
ATOM   3584  C  CG    . LEU A 1 496  ? -68.48200 -30.14200 -4.02700  1.000 101.35580 ? 496  LEU A CG    1 
ATOM   3585  C  CD1   . LEU A 1 496  ? -69.88800 -29.61300 -3.78800  1.000 90.26811  ? 496  LEU A CD1   1 
ATOM   3586  C  CD2   . LEU A 1 496  ? -68.51000 -31.28800 -5.02800  1.000 108.20017 ? 496  LEU A CD2   1 
ATOM   3587  N  N     . ILE A 1 497  ? -65.59000 -28.83300 -6.92700  1.000 105.70671 ? 497  ILE A N     1 
ATOM   3588  C  CA    . ILE A 1 497  ? -65.24600 -29.21500 -8.29300  1.000 101.55166 ? 497  ILE A CA    1 
ATOM   3589  C  C     . ILE A 1 497  ? -63.80400 -29.70300 -8.36300  1.000 96.69139  ? 497  ILE A C     1 
ATOM   3590  O  O     . ILE A 1 497  ? -63.51000 -30.73300 -8.98100  1.000 97.90351  ? 497  ILE A O     1 
ATOM   3591  C  CB    . ILE A 1 497  ? -65.49600 -28.03900 -9.25500  1.000 86.52642  ? 497  ILE A CB    1 
ATOM   3592  C  CG1   . ILE A 1 497  ? -66.97900 -27.95500 -9.62300  1.000 84.42003  ? 497  ILE A CG1   1 
ATOM   3593  C  CG2   . ILE A 1 497  ? -64.64700 -28.17600 -10.50500 1.000 78.92013  ? 497  ILE A CG2   1 
ATOM   3594  C  CD1   . ILE A 1 497  ? -67.29400 -26.89700 -10.65900 1.000 87.16356  ? 497  ILE A CD1   1 
ATOM   3595  N  N     . LEU A 1 498  ? -62.88500 -28.97900 -7.71600  1.000 91.23310  ? 498  LEU A N     1 
ATOM   3596  C  CA    . LEU A 1 498  ? -61.47400 -29.35900 -7.74400  1.000 92.32476  ? 498  LEU A CA    1 
ATOM   3597  C  C     . LEU A 1 498  ? -61.25200 -30.76400 -7.20100  1.000 96.09132  ? 498  LEU A C     1 
ATOM   3598  O  O     . LEU A 1 498  ? -60.28900 -31.43400 -7.59300  1.000 102.26886 ? 498  LEU A O     1 
ATOM   3599  C  CB    . LEU A 1 498  ? -60.64100 -28.35000 -6.95200  1.000 100.53514 ? 498  LEU A CB    1 
ATOM   3600  C  CG    . LEU A 1 498  ? -60.09400 -27.13300 -7.70100  1.000 96.59104  ? 498  LEU A CG    1 
ATOM   3601  C  CD1   . LEU A 1 498  ? -61.21400 -26.29200 -8.27800  1.000 95.94577  ? 498  LEU A CD1   1 
ATOM   3602  C  CD2   . LEU A 1 498  ? -59.22300 -26.29700 -6.77700  1.000 94.71721  ? 498  LEU A CD2   1 
ATOM   3603  N  N     . ASN A 1 499  ? -62.12600 -31.22800 -6.30700  1.000 98.04826  ? 499  ASN A N     1 
ATOM   3604  C  CA    . ASN A 1 499  ? -61.98800 -32.57600 -5.77000  1.000 102.22164 ? 499  ASN A CA    1 
ATOM   3605  C  C     . ASN A 1 499  ? -62.58100 -33.61900 -6.71000  1.000 95.53769  ? 499  ASN A C     1 
ATOM   3606  O  O     . ASN A 1 499  ? -62.04500 -34.72600 -6.82600  1.000 97.99366  ? 499  ASN A O     1 
ATOM   3607  C  CB    . ASN A 1 499  ? -62.64700 -32.66000 -4.39300  1.000 107.96935 ? 499  ASN A CB    1 
ATOM   3608  C  CG    . ASN A 1 499  ? -61.83000 -31.97600 -3.31600  1.000 119.86338 ? 499  ASN A CG    1 
ATOM   3609  O  OD1   . ASN A 1 499  ? -61.04300 -31.07200 -3.59700  1.000 120.02660 ? 499  ASN A OD1   1 
ATOM   3610  N  ND2   . ASN A 1 499  ? -62.01200 -32.40600 -2.07300  1.000 126.48141 ? 499  ASN A ND2   1 
ATOM   3611  N  N     . GLU A 1 500  ? -63.68000 -33.28600 -7.38800  1.000 95.57569  ? 500  GLU A N     1 
ATOM   3612  C  CA    . GLU A 1 500  ? -64.31700 -34.22700 -8.30200  1.000 96.94452  ? 500  GLU A CA    1 
ATOM   3613  C  C     . GLU A 1 500  ? -63.46100 -34.43900 -9.54400  1.000 103.16377 ? 500  GLU A C     1 
ATOM   3614  O  O     . GLU A 1 500  ? -62.92000 -35.53100 -9.74900  1.000 98.92251  ? 500  GLU A O     1 
ATOM   3615  C  CB    . GLU A 1 500  ? -65.71500 -33.74200 -8.68900  1.000 83.87102  ? 500  GLU A CB    1 
ATOM   3616  C  CG    . GLU A 1 500  ? -66.57000 -34.81100 -9.35300  1.000 93.21118  ? 500  GLU A CG    1 
ATOM   3617  C  CD    . GLU A 1 500  ? -67.96200 -34.31700 -9.69200  1.000 100.72145 ? 500  GLU A CD    1 
ATOM   3618  O  OE1   . GLU A 1 500  ? -68.27400 -33.15200 -9.37100  1.000 102.16928 ? 500  GLU A OE1   1 
ATOM   3619  O  OE2   . GLU A 1 500  ? -68.74500 -35.09300 -10.28200 1.000 97.50416  ? 500  GLU A OE2   1 
ATOM   3620  N  N     . VAL A 1 501  ? -63.33200 -33.41000 -10.38000 1.000 100.11375 ? 501  VAL A N     1 
ATOM   3621  C  CA    . VAL A 1 501  ? -62.43200 -33.47000 -11.53100 1.000 98.49167  ? 501  VAL A CA    1 
ATOM   3622  C  C     . VAL A 1 501  ? -61.01100 -33.25600 -11.01300 1.000 98.16398  ? 501  VAL A C     1 
ATOM   3623  O  O     . VAL A 1 501  ? -60.59500 -32.13500 -10.71100 1.000 89.53182  ? 501  VAL A O     1 
ATOM   3624  C  CB    . VAL A 1 501  ? -62.81500 -32.46500 -12.62200 1.000 91.58866  ? 501  VAL A CB    1 
ATOM   3625  C  CG1   . VAL A 1 501  ? -63.07000 -31.08000 -12.04900 1.000 87.26730  ? 501  VAL A CG1   1 
ATOM   3626  C  CG2   . VAL A 1 501  ? -61.72200 -32.39600 -13.67800 1.000 96.62985  ? 501  VAL A CG2   1 
ATOM   3627  N  N     . SER A 1 502  ? -60.26400 -34.34800 -10.88800 1.000 100.50989 ? 502  SER A N     1 
ATOM   3628  C  CA    . SER A 1 502  ? -58.91000 -34.32100 -10.35700 1.000 97.81093  ? 502  SER A CA    1 
ATOM   3629  C  C     . SER A 1 502  ? -57.92100 -34.70600 -11.44600 1.000 89.29858  ? 502  SER A C     1 
ATOM   3630  O  O     . SER A 1 502  ? -58.14100 -35.66800 -12.18900 1.000 88.10606  ? 502  SER A O     1 
ATOM   3631  C  CB    . SER A 1 502  ? -58.76700 -35.27000 -9.16400  1.000 105.80604 ? 502  SER A CB    1 
ATOM   3632  O  OG    . SER A 1 502  ? -58.92200 -36.62000 -9.56600  1.000 106.95673 ? 502  SER A OG    1 
ATOM   3633  N  N     . LEU A 1 503  ? -56.83400 -33.94900 -11.53600 1.000 89.58733  ? 503  LEU A N     1 
ATOM   3634  C  CA    . LEU A 1 503  ? -55.75600 -34.22000 -12.47700 1.000 85.82328  ? 503  LEU A CA    1 
ATOM   3635  C  C     . LEU A 1 503  ? -54.52100 -34.61300 -11.68300 1.000 83.76834  ? 503  LEU A C     1 
ATOM   3636  O  O     . LEU A 1 503  ? -54.03800 -33.83100 -10.85700 1.000 90.88113  ? 503  LEU A O     1 
ATOM   3637  C  CB    . LEU A 1 503  ? -55.46000 -33.00300 -13.35400 1.000 78.63046  ? 503  LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1 503  ? -56.62800 -32.12700 -13.80900 1.000 82.09116  ? 503  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1 503  ? -56.12800 -31.02100 -14.72400 1.000 81.20063  ? 503  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1 503  ? -57.69900 -32.95000 -14.49900 1.000 90.33955  ? 503  LEU A CD2   1 
ATOM   3641  N  N     . LEU A 1 504  ? -54.02000 -35.82200 -11.92200 1.000 77.27471  ? 504  LEU A N     1 
ATOM   3642  C  CA    . LEU A 1 504  ? -52.76200 -36.22200 -11.31300 1.000 85.16227  ? 504  LEU A CA    1 
ATOM   3643  C  C     . LEU A 1 504  ? -51.64000 -35.31900 -11.80700 1.000 87.52503  ? 504  LEU A C     1 
ATOM   3644  O  O     . LEU A 1 504  ? -51.70500 -34.75400 -12.90200 1.000 92.85595  ? 504  LEU A O     1 
ATOM   3645  C  CB    . LEU A 1 504  ? -52.45000 -37.68400 -11.63700 1.000 90.63176  ? 504  LEU A CB    1 
ATOM   3646  C  CG    . LEU A 1 504  ? -52.72200 -38.69700 -10.52300 1.000 94.77740  ? 504  LEU A CG    1 
ATOM   3647  C  CD1   . LEU A 1 504  ? -51.80000 -38.44900 -9.33800  1.000 96.34787  ? 504  LEU A CD1   1 
ATOM   3648  C  CD2   . LEU A 1 504  ? -54.18100 -38.64900 -10.09200 1.000 93.42340  ? 504  LEU A CD2   1 
ATOM   3649  N  N     . GLY A 1 505  ? -50.60500 -35.17000 -10.97800 1.000 94.63105  ? 505  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1 505  ? -49.46200 -34.36900 -11.38300 1.000 100.92096 ? 505  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1 505  ? -48.83100 -34.85300 -12.67200 1.000 100.43070 ? 505  GLY A C     1 
ATOM   3652  O  O     . GLY A 1 505  ? -48.23500 -34.06500 -13.41200 1.000 97.25323  ? 505  GLY A O     1 
ATOM   3653  N  N     . SER A 1 506  ? -48.95700 -36.15000 -12.96100 1.000 98.83882  ? 506  SER A N     1 
ATOM   3654  C  CA    . SER A 1 506  ? -48.44500 -36.75200 -14.18500 1.000 94.36630  ? 506  SER A CA    1 
ATOM   3655  C  C     . SER A 1 506  ? -49.48200 -36.79000 -15.30100 1.000 89.70101  ? 506  SER A C     1 
ATOM   3656  O  O     . SER A 1 506  ? -49.43200 -37.68300 -16.15800 1.000 90.57708  ? 506  SER A O     1 
ATOM   3657  C  CB    . SER A 1 506  ? -47.93300 -38.16300 -13.89300 1.000 92.72055  ? 506  SER A CB    1 
ATOM   3658  O  OG    . SER A 1 506  ? -48.91800 -38.93100 -13.22500 1.000 85.93004  ? 506  SER A OG    1 
ATOM   3659  N  N     . ALA A 1 507  ? -50.42100 -35.84800 -15.31500 1.000 86.99518  ? 507  ALA A N     1 
ATOM   3660  C  CA    . ALA A 1 507  ? -51.48400 -35.87900 -16.30700 1.000 82.60350  ? 507  ALA A CA    1 
ATOM   3661  C  C     . ALA A 1 507  ? -50.92700 -35.57200 -17.69500 1.000 84.27066  ? 507  ALA A C     1 
ATOM   3662  O  O     . ALA A 1 507  ? -50.04400 -34.72000 -17.83700 1.000 82.07797  ? 507  ALA A O     1 
ATOM   3663  C  CB    . ALA A 1 507  ? -52.58100 -34.87500 -15.95600 1.000 80.83889  ? 507  ALA A CB    1 
ATOM   3664  N  N     . PRO A 1 508  ? -51.41600 -36.25000 -18.73300 1.000 83.38073  ? 508  PRO A N     1 
ATOM   3665  C  CA    . PRO A 1 508  ? -50.97900 -35.93100 -20.09500 1.000 79.26368  ? 508  PRO A CA    1 
ATOM   3666  C  C     . PRO A 1 508  ? -51.36200 -34.51000 -20.48000 1.000 81.81848  ? 508  PRO A C     1 
ATOM   3667  O  O     . PRO A 1 508  ? -52.27400 -33.90300 -19.91400 1.000 85.17318  ? 508  PRO A O     1 
ATOM   3668  C  CB    . PRO A 1 508  ? -51.71400 -36.96400 -20.95900 1.000 78.55731  ? 508  PRO A CB    1 
ATOM   3669  C  CG    . PRO A 1 508  ? -52.87300 -37.40400 -20.12200 1.000 70.88502  ? 508  PRO A CG    1 
ATOM   3670  C  CD    . PRO A 1 508  ? -52.38100 -37.36100 -18.70800 1.000 74.00916  ? 508  PRO A CD    1 
ATOM   3671  N  N     . GLY A 1 509  ? -50.64000 -33.97800 -21.46500 1.000 85.39541  ? 509  GLY A N     1 
ATOM   3672  C  CA    . GLY A 1 509  ? -50.80300 -32.60100 -21.87500 1.000 85.99174  ? 509  GLY A CA    1 
ATOM   3673  C  C     . GLY A 1 509  ? -50.06700 -31.59000 -21.02600 1.000 82.02922  ? 509  GLY A C     1 
ATOM   3674  O  O     . GLY A 1 509  ? -49.96600 -30.42400 -21.43200 1.000 76.08034  ? 509  GLY A O     1 
ATOM   3675  N  N     . GLY A 1 510  ? -49.54500 -31.99100 -19.86800 1.000 78.81263  ? 510  GLY A N     1 
ATOM   3676  C  CA    . GLY A 1 510  ? -48.84300 -31.08800 -18.98300 1.000 78.19284  ? 510  GLY A CA    1 
ATOM   3677  C  C     . GLY A 1 510  ? -49.74900 -29.96800 -18.49300 1.000 80.24506  ? 510  GLY A C     1 
ATOM   3678  O  O     . GLY A 1 510  ? -50.97900 -30.05900 -18.52000 1.000 83.80232  ? 510  GLY A O     1 
ATOM   3679  N  N     . LYS A 1 511  ? -49.10400 -28.89300 -18.03500 1.000 80.01149  ? 511  LYS A N     1 
ATOM   3680  C  CA    . LYS A 1 511  ? -49.79800 -27.68100 -17.59700 1.000 87.15431  ? 511  LYS A CA    1 
ATOM   3681  C  C     . LYS A 1 511  ? -50.83700 -27.99300 -16.52200 1.000 87.22783  ? 511  LYS A C     1 
ATOM   3682  O  O     . LYS A 1 511  ? -51.91100 -27.39000 -16.48000 1.000 83.44183  ? 511  LYS A O     1 
ATOM   3683  C  CB    . LYS A 1 511  ? -50.44900 -26.96500 -18.78300 1.000 82.52034  ? 511  LYS A CB    1 
ATOM   3684  C  CG    . LYS A 1 511  ? -49.50900 -26.70100 -19.94700 1.000 81.00596  ? 511  LYS A CG    1 
ATOM   3685  C  CD    . LYS A 1 511  ? -50.25500 -26.09900 -21.12700 1.000 79.24180  ? 511  LYS A CD    1 
ATOM   3686  C  CE    . LYS A 1 511  ? -49.29800 -25.48000 -22.13100 1.000 79.51681  ? 511  LYS A CE    1 
ATOM   3687  N  NZ    . LYS A 1 511  ? -48.34900 -26.48500 -22.68600 1.000 85.95723  ? 511  LYS A NZ    1 
ATOM   3688  N  N     . VAL A 1 512  ? -50.51400 -28.94800 -15.64600 1.000 90.75748  ? 512  VAL A N     1 
ATOM   3689  C  CA    . VAL A 1 512  ? -51.49300 -29.42600 -14.67200 1.000 90.95738  ? 512  VAL A CA    1 
ATOM   3690  C  C     . VAL A 1 512  ? -51.89400 -28.30700 -13.71800 1.000 87.39804  ? 512  VAL A C     1 
ATOM   3691  O  O     . VAL A 1 512  ? -53.08000 -28.12300 -13.42000 1.000 81.73016  ? 512  VAL A O     1 
ATOM   3692  C  CB    . VAL A 1 512  ? -50.94500 -30.65600 -13.92200 1.000 89.56440  ? 512  VAL A CB    1 
ATOM   3693  C  CG1   . VAL A 1 512  ? -49.52600 -30.40500 -13.42600 1.000 92.58805  ? 512  VAL A CG1   1 
ATOM   3694  C  CG2   . VAL A 1 512  ? -51.86700 -31.03500 -12.77200 1.000 86.61600  ? 512  VAL A CG2   1 
ATOM   3695  N  N     . GLU A 1 513  ? -50.91900 -27.53000 -13.23800 1.000 92.73897  ? 513  GLU A N     1 
ATOM   3696  C  CA    . GLU A 1 513  ? -51.24200 -26.41200 -12.35800 1.000 93.74106  ? 513  GLU A CA    1 
ATOM   3697  C  C     . GLU A 1 513  ? -51.99400 -25.31600 -13.10100 1.000 86.11916  ? 513  GLU A C     1 
ATOM   3698  O  O     . GLU A 1 513  ? -52.80800 -24.60600 -12.49800 1.000 80.36283  ? 513  GLU A O     1 
ATOM   3699  C  CB    . GLU A 1 513  ? -49.96600 -25.85600 -11.72600 1.000 96.26852  ? 513  GLU A CB    1 
ATOM   3700  C  CG    . GLU A 1 513  ? -49.66400 -26.42500 -10.34900 1.000 96.62574  ? 513  GLU A CG    1 
ATOM   3701  C  CD    . GLU A 1 513  ? -48.17800 -26.53400 -10.07200 1.000 108.35709 ? 513  GLU A CD    1 
ATOM   3702  O  OE1   . GLU A 1 513  ? -47.73500 -27.60900 -9.61600  1.000 103.44460 ? 513  GLU A OE1   1 
ATOM   3703  O  OE2   . GLU A 1 513  ? -47.45300 -25.54300 -10.30800 1.000 111.71574 ? 513  GLU A OE2   1 
ATOM   3704  N  N     . PHE A 1 514  ? -51.73900 -25.16200 -14.40200 1.000 87.33822  ? 514  PHE A N     1 
ATOM   3705  C  CA    . PHE A 1 514  ? -52.50700 -24.21300 -15.20000 1.000 84.16033  ? 514  PHE A CA    1 
ATOM   3706  C  C     . PHE A 1 514  ? -53.92300 -24.72200 -15.43900 1.000 85.44650  ? 514  PHE A C     1 
ATOM   3707  O  O     . PHE A 1 514  ? -54.88900 -23.95400 -15.35300 1.000 79.74576  ? 514  PHE A O     1 
ATOM   3708  C  CB    . PHE A 1 514  ? -51.79900 -23.95700 -16.53100 1.000 79.63485  ? 514  PHE A CB    1 
ATOM   3709  C  CG    . PHE A 1 514  ? -52.42900 -22.87200 -17.36200 1.000 73.03112  ? 514  PHE A CG    1 
ATOM   3710  C  CD1   . PHE A 1 514  ? -53.10300 -21.81800 -16.76500 1.000 77.54145  ? 514  PHE A CD1   1 
ATOM   3711  C  CD2   . PHE A 1 514  ? -52.36000 -22.91600 -18.74400 1.000 74.13449  ? 514  PHE A CD2   1 
ATOM   3712  C  CE1   . PHE A 1 514  ? -53.68300 -20.82400 -17.53100 1.000 76.29028  ? 514  PHE A CE1   1 
ATOM   3713  C  CE2   . PHE A 1 514  ? -52.93900 -21.92500 -19.51500 1.000 72.54842  ? 514  PHE A CE2   1 
ATOM   3714  C  CZ    . PHE A 1 514  ? -53.60200 -20.87900 -18.90800 1.000 71.41619  ? 514  PHE A CZ    1 
ATOM   3715  N  N     . LYS A 1 515  ? -54.06600 -26.01600 -15.73800 1.000 89.96414  ? 515  LYS A N     1 
ATOM   3716  C  CA    . LYS A 1 515  ? -55.38900 -26.57500 -15.99200 1.000 83.86918  ? 515  LYS A CA    1 
ATOM   3717  C  C     . LYS A 1 515  ? -56.24800 -26.58100 -14.73400 1.000 88.00195  ? 515  LYS A C     1 
ATOM   3718  O  O     . LYS A 1 515  ? -57.47400 -26.44600 -14.82400 1.000 88.99497  ? 515  LYS A O     1 
ATOM   3719  C  CB    . LYS A 1 515  ? -55.26400 -27.99100 -16.55700 1.000 88.25219  ? 515  LYS A CB    1 
ATOM   3720  C  CG    . LYS A 1 515  ? -54.67800 -28.04800 -17.96000 1.000 87.78384  ? 515  LYS A CG    1 
ATOM   3721  C  CD    . LYS A 1 515  ? -55.03000 -29.35200 -18.65900 1.000 81.64738  ? 515  LYS A CD    1 
ATOM   3722  C  CE    . LYS A 1 515  ? -54.11500 -30.48300 -18.22600 1.000 84.30566  ? 515  LYS A CE    1 
ATOM   3723  N  NZ    . LYS A 1 515  ? -54.28000 -31.68800 -19.08700 1.000 81.92263  ? 515  LYS A NZ    1 
ATOM   3724  N  N     . ARG A 1 516  ? -55.63100 -26.73700 -13.55900 1.000 91.43046  ? 516  ARG A N     1 
ATOM   3725  C  CA    . ARG A 1 516  ? -56.38700 -26.66200 -12.31300 1.000 90.47117  ? 516  ARG A CA    1 
ATOM   3726  C  C     . ARG A 1 516  ? -56.97600 -25.27500 -12.10100 1.000 86.87438  ? 516  ARG A C     1 
ATOM   3727  O  O     . ARG A 1 516  ? -58.06600 -25.14500 -11.53500 1.000 86.63068  ? 516  ARG A O     1 
ATOM   3728  C  CB    . ARG A 1 516  ? -55.49800 -27.04200 -11.12800 1.000 82.03970  ? 516  ARG A CB    1 
ATOM   3729  C  CG    . ARG A 1 516  ? -55.12000 -28.51200 -11.06500 1.000 79.68815  ? 516  ARG A CG    1 
ATOM   3730  C  CD    . ARG A 1 516  ? -54.52400 -28.86600 -9.71300  1.000 77.54681  ? 516  ARG A CD    1 
ATOM   3731  N  NE    . ARG A 1 516  ? -54.18400 -30.28200 -9.61200  1.000 78.76767  ? 516  ARG A NE    1 
ATOM   3732  C  CZ    . ARG A 1 516  ? -52.94500 -30.74700 -9.49300  1.000 78.33057  ? 516  ARG A CZ    1 
ATOM   3733  N  NH1   . ARG A 1 516  ? -51.91800 -29.90900 -9.46400  1.000 85.70939  ? 516  ARG A NH1   1 
ATOM   3734  N  NH2   . ARG A 1 516  ? -52.73100 -32.05300 -9.40600  1.000 86.05836  ? 516  ARG A NH2   1 
ATOM   3735  N  N     . THR A 1 517  ? -56.27700 -24.23200 -12.55000 1.000 83.49687  ? 517  THR A N     1 
ATOM   3736  C  CA    . THR A 1 517  ? -56.75300 -22.86900 -12.34700 1.000 78.08610  ? 517  THR A CA    1 
ATOM   3737  C  C     . THR A 1 517  ? -57.81400 -22.48300 -13.37100 1.000 83.35342  ? 517  THR A C     1 
ATOM   3738  O  O     . THR A 1 517  ? -58.78600 -21.79700 -13.03100 1.000 79.00604  ? 517  THR A O     1 
ATOM   3739  C  CB    . THR A 1 517  ? -55.57900 -21.89200 -12.40800 1.000 76.31587  ? 517  THR A CB    1 
ATOM   3740  O  OG1   . THR A 1 517  ? -54.57900 -22.28400 -11.45800 1.000 86.73577  ? 517  THR A OG1   1 
ATOM   3741  C  CG2   . THR A 1 517  ? -56.04100 -20.48300 -12.09100 1.000 77.71694  ? 517  THR A CG2   1 
ATOM   3742  N  N     . LEU A 1 518  ? -57.64700 -22.91200 -14.62500 1.000 86.31674  ? 518  LEU A N     1 
ATOM   3743  C  CA    . LEU A 1 518  ? -58.62500 -22.58100 -15.65800 1.000 84.95774  ? 518  LEU A CA    1 
ATOM   3744  C  C     . LEU A 1 518  ? -59.99400 -23.16500 -15.34100 1.000 85.66963  ? 518  LEU A C     1 
ATOM   3745  O  O     . LEU A 1 518  ? -61.01800 -22.59800 -15.74100 1.000 79.88448  ? 518  LEU A O     1 
ATOM   3746  C  CB    . LEU A 1 518  ? -58.14000 -23.07700 -17.02000 1.000 81.15993  ? 518  LEU A CB    1 
ATOM   3747  C  CG    . LEU A 1 518  ? -57.00600 -22.28400 -17.67100 1.000 74.39926  ? 518  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A 1 518  ? -56.51400 -22.98800 -18.92500 1.000 83.39511  ? 518  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A 1 518  ? -57.45600 -20.86600 -17.98900 1.000 72.45374  ? 518  LEU A CD2   1 
ATOM   3750  N  N     . ILE A 1 519  ? -60.03300 -24.29500 -14.63300 1.000 87.80959  ? 519  ILE A N     1 
ATOM   3751  C  CA    . ILE A 1 519  ? -61.30700 -24.86500 -14.20500 1.000 84.33390  ? 519  ILE A CA    1 
ATOM   3752  C  C     . ILE A 1 519  ? -62.01700 -23.91500 -13.24900 1.000 87.32975  ? 519  ILE A C     1 
ATOM   3753  O  O     . ILE A 1 519  ? -63.23900 -23.73400 -13.32000 1.000 83.50326  ? 519  ILE A O     1 
ATOM   3754  C  CB    . ILE A 1 519  ? -61.07900 -26.25000 -13.57000 1.000 85.92322  ? 519  ILE A CB    1 
ATOM   3755  C  CG1   . ILE A 1 519  ? -60.64100 -27.25900 -14.63400 1.000 91.42490  ? 519  ILE A CG1   1 
ATOM   3756  C  CG2   . ILE A 1 519  ? -62.32700 -26.73000 -12.85400 1.000 72.84727  ? 519  ILE A CG2   1 
ATOM   3757  C  CD1   . ILE A 1 519  ? -60.41100 -28.65400 -14.09300 1.000 90.52683  ? 519  ILE A CD1   1 
ATOM   3758  N  N     . ILE A 1 520  ? -61.26200 -23.28100 -12.35200 1.000 88.46962  ? 520  ILE A N     1 
ATOM   3759  C  CA    . ILE A 1 520  ? -61.85300 -22.35000 -11.39800 1.000 85.84435  ? 520  ILE A CA    1 
ATOM   3760  C  C     . ILE A 1 520  ? -62.19000 -21.02700 -12.07000 1.000 86.59139  ? 520  ILE A C     1 
ATOM   3761  O  O     . ILE A 1 520  ? -63.25800 -20.45200 -11.83300 1.000 84.17910  ? 520  ILE A O     1 
ATOM   3762  C  CB    . ILE A 1 520  ? -60.90300 -22.13900 -10.20700 1.000 94.87070  ? 520  ILE A CB    1 
ATOM   3763  C  CG1   . ILE A 1 520  ? -60.11100 -23.41000 -9.92100  1.000 91.00379  ? 520  ILE A CG1   1 
ATOM   3764  C  CG2   . ILE A 1 520  ? -61.68000 -21.72600 -8.98000  1.000 102.01677 ? 520  ILE A CG2   1 
ATOM   3765  C  CD1   . ILE A 1 520  ? -59.09500 -23.25100 -8.81400  1.000 92.28004  ? 520  ILE A CD1   1 
ATOM   3766  N  N     . SER A 1 521  ? -61.28200 -20.52000 -12.90700 1.000 85.20700  ? 521  SER A N     1 
ATOM   3767  C  CA    . SER A 1 521  ? -61.47100 -19.20000 -13.50100 1.000 83.82261  ? 521  SER A CA    1 
ATOM   3768  C  C     . SER A 1 521  ? -62.67800 -19.17300 -14.43000 1.000 84.85689  ? 521  SER A C     1 
ATOM   3769  O  O     . SER A 1 521  ? -63.40500 -18.17500 -14.48000 1.000 79.32319  ? 521  SER A O     1 
ATOM   3770  C  CB    . SER A 1 521  ? -60.20600 -18.78000 -14.24500 1.000 88.32535  ? 521  SER A CB    1 
ATOM   3771  O  OG    . SER A 1 521  ? -59.06700 -18.88000 -13.40700 1.000 84.29461  ? 521  SER A OG    1 
ATOM   3772  N  N     . PHE A 1 522  ? -62.90600 -20.25700 -15.17600 1.000 88.93367  ? 522  PHE A N     1 
ATOM   3773  C  CA    . PHE A 1 522  ? -64.10700 -20.33700 -16.00100 1.000 89.33915  ? 522  PHE A CA    1 
ATOM   3774  C  C     . PHE A 1 522  ? -65.36500 -20.34500 -15.14500 1.000 87.15066  ? 522  PHE A C     1 
ATOM   3775  O  O     . PHE A 1 522  ? -66.40300 -19.81500 -15.55900 1.000 86.27497  ? 522  PHE A O     1 
ATOM   3776  C  CB    . PHE A 1 522  ? -64.05900 -21.58200 -16.88800 1.000 87.90367  ? 522  PHE A CB    1 
ATOM   3777  C  CG    . PHE A 1 522  ? -63.04100 -21.50200 -17.99000 1.000 87.64171  ? 522  PHE A CG    1 
ATOM   3778  C  CD1   . PHE A 1 522  ? -62.54800 -20.27800 -18.41200 1.000 87.60934  ? 522  PHE A CD1   1 
ATOM   3779  C  CD2   . PHE A 1 522  ? -62.58000 -22.65300 -18.60600 1.000 81.45743  ? 522  PHE A CD2   1 
ATOM   3780  C  CE1   . PHE A 1 522  ? -61.61400 -20.20300 -19.42700 1.000 74.24371  ? 522  PHE A CE1   1 
ATOM   3781  C  CE2   . PHE A 1 522  ? -61.64500 -22.58400 -19.62100 1.000 83.93275  ? 522  PHE A CE2   1 
ATOM   3782  C  CZ    . PHE A 1 522  ? -61.16200 -21.35800 -20.03200 1.000 78.76799  ? 522  PHE A CZ    1 
ATOM   3783  N  N     . LEU A 1 523  ? -65.29300 -20.93800 -13.95100 1.000 84.63242  ? 523  LEU A N     1 
ATOM   3784  C  CA    . LEU A 1 523  ? -66.42400 -20.89200 -13.03100 1.000 86.00149  ? 523  LEU A CA    1 
ATOM   3785  C  C     . LEU A 1 523  ? -66.64300 -19.48000 -12.50300 1.000 87.43288  ? 523  LEU A C     1 
ATOM   3786  O  O     . LEU A 1 523  ? -67.78700 -19.06000 -12.29100 1.000 86.76577  ? 523  LEU A O     1 
ATOM   3787  C  CB    . LEU A 1 523  ? -66.19700 -21.86900 -11.87700 1.000 82.54571  ? 523  LEU A CB    1 
ATOM   3788  C  CG    . LEU A 1 523  ? -67.43300 -22.36700 -11.12800 1.000 69.58975  ? 523  LEU A CG    1 
ATOM   3789  C  CD1   . LEU A 1 523  ? -68.32400 -23.18600 -12.04700 1.000 64.83647  ? 523  LEU A CD1   1 
ATOM   3790  C  CD2   . LEU A 1 523  ? -67.02400 -23.17700 -9.90900  1.000 82.62841  ? 523  LEU A CD2   1 
ATOM   3791  N  N     . PHE A 1 524  ? -65.55800 -18.73200 -12.28800 1.000 85.71433  ? 524  PHE A N     1 
ATOM   3792  C  CA    . PHE A 1 524  ? -65.68700 -17.35100 -11.83600 1.000 82.88682  ? 524  PHE A CA    1 
ATOM   3793  C  C     . PHE A 1 524  ? -66.24200 -16.46000 -12.94000 1.000 80.63864  ? 524  PHE A C     1 
ATOM   3794  O  O     . PHE A 1 524  ? -67.10200 -15.60900 -12.68400 1.000 84.19710  ? 524  PHE A O     1 
ATOM   3795  C  CB    . PHE A 1 524  ? -64.33400 -16.83200 -11.35000 1.000 83.54035  ? 524  PHE A CB    1 
ATOM   3796  C  CG    . PHE A 1 524  ? -64.36400 -15.40800 -10.87200 1.000 88.79053  ? 524  PHE A CG    1 
ATOM   3797  C  CD1   . PHE A 1 524  ? -64.98900 -15.07500 -9.68100  1.000 94.69712  ? 524  PHE A CD1   1 
ATOM   3798  C  CD2   . PHE A 1 524  ? -63.75900 -14.40300 -11.60900 1.000 87.37200  ? 524  PHE A CD2   1 
ATOM   3799  C  CE1   . PHE A 1 524  ? -65.01500 -13.76600 -9.23700  1.000 96.18150  ? 524  PHE A CE1   1 
ATOM   3800  C  CE2   . PHE A 1 524  ? -63.78100 -13.09300 -11.17000 1.000 88.89013  ? 524  PHE A CE2   1 
ATOM   3801  C  CZ    . PHE A 1 524  ? -64.41000 -12.77400 -9.98300  1.000 91.37572  ? 524  PHE A CZ    1 
ATOM   3802  N  N     . LYS A 1 525  ? -65.76300 -16.64000 -14.17300 1.000 81.04968  ? 525  LYS A N     1 
ATOM   3803  C  CA    . LYS A 1 525  ? -66.29300 -15.86300 -15.28900 1.000 84.26935  ? 525  LYS A CA    1 
ATOM   3804  C  C     . LYS A 1 525  ? -67.75400 -16.20400 -15.55200 1.000 83.92696  ? 525  LYS A C     1 
ATOM   3805  O  O     . LYS A 1 525  ? -68.54300 -15.32800 -15.92200 1.000 84.43778  ? 525  LYS A O     1 
ATOM   3806  C  CB    . LYS A 1 525  ? -65.45300 -16.09800 -16.54500 1.000 88.85859  ? 525  LYS A CB    1 
ATOM   3807  C  CG    . LYS A 1 525  ? -63.99800 -15.68500 -16.40800 1.000 84.94041  ? 525  LYS A CG    1 
ATOM   3808  C  CD    . LYS A 1 525  ? -63.17500 -16.14100 -17.60300 1.000 87.58336  ? 525  LYS A CD    1 
ATOM   3809  C  CE    . LYS A 1 525  ? -63.37700 -15.21800 -18.79500 1.000 90.24008  ? 525  LYS A CE    1 
ATOM   3810  N  NZ    . LYS A 1 525  ? -62.81800 -13.86000 -18.54700 1.000 85.47758  ? 525  LYS A NZ    1 
ATOM   3811  N  N     . PHE A 1 526  ? -68.13200 -17.47100 -15.36700 1.000 85.51993  ? 526  PHE A N     1 
ATOM   3812  C  CA    . PHE A 1 526  ? -69.53000 -17.84900 -15.54200 1.000 93.10729  ? 526  PHE A CA    1 
ATOM   3813  C  C     . PHE A 1 526  ? -70.40800 -17.22100 -14.46800 1.000 96.61535  ? 526  PHE A C     1 
ATOM   3814  O  O     . PHE A 1 526  ? -71.49000 -16.70500 -14.76900 1.000 99.93959  ? 526  PHE A O     1 
ATOM   3815  C  CB    . PHE A 1 526  ? -69.67400 -19.37000 -15.52900 1.000 93.29958  ? 526  PHE A CB    1 
ATOM   3816  C  CG    . PHE A 1 526  ? -71.08800 -19.84400 -15.71300 1.000 92.61304  ? 526  PHE A CG    1 
ATOM   3817  C  CD1   . PHE A 1 526  ? -71.79300 -19.52700 -16.86300 1.000 93.24063  ? 526  PHE A CD1   1 
ATOM   3818  C  CD2   . PHE A 1 526  ? -71.71300 -20.60300 -14.73800 1.000 89.15469  ? 526  PHE A CD2   1 
ATOM   3819  C  CE1   . PHE A 1 526  ? -73.09500 -19.95800 -17.03700 1.000 94.91017  ? 526  PHE A CE1   1 
ATOM   3820  C  CE2   . PHE A 1 526  ? -73.01500 -21.03800 -14.90600 1.000 89.00806  ? 526  PHE A CE2   1 
ATOM   3821  C  CZ    . PHE A 1 526  ? -73.70600 -20.71500 -16.05700 1.000 89.38216  ? 526  PHE A CZ    1 
ATOM   3822  N  N     . TYR A 1 527  ? -69.95800 -17.25600 -13.20900 1.000 97.42798  ? 527  TYR A N     1 
ATOM   3823  C  CA    . TYR A 1 527  ? -70.69500 -16.59500 -12.13600 1.000 96.69957  ? 527  TYR A CA    1 
ATOM   3824  C  C     . TYR A 1 527  ? -70.85900 -15.10600 -12.40400 1.000 95.26516  ? 527  TYR A C     1 
ATOM   3825  O  O     . TYR A 1 527  ? -71.88000 -14.51600 -12.03200 1.000 100.25284 ? 527  TYR A O     1 
ATOM   3826  C  CB    . TYR A 1 527  ? -69.98700 -16.82100 -10.79700 1.000 98.82199  ? 527  TYR A CB    1 
ATOM   3827  C  CG    . TYR A 1 527  ? -70.36900 -15.83100 -9.71600  1.000 106.64531 ? 527  TYR A CG    1 
ATOM   3828  C  CD1   . TYR A 1 527  ? -71.62700 -15.86200 -9.13000  1.000 99.95081  ? 527  TYR A CD1   1 
ATOM   3829  C  CD2   . TYR A 1 527  ? -69.46900 -14.86900 -9.27900  1.000 110.51362 ? 527  TYR A CD2   1 
ATOM   3830  C  CE1   . TYR A 1 527  ? -71.98000 -14.95900 -8.14400  1.000 101.70112 ? 527  TYR A CE1   1 
ATOM   3831  C  CE2   . TYR A 1 527  ? -69.81200 -13.96200 -8.29300  1.000 111.14330 ? 527  TYR A CE2   1 
ATOM   3832  C  CZ    . TYR A 1 527  ? -71.06800 -14.01200 -7.72800  1.000 109.44499 ? 527  TYR A CZ    1 
ATOM   3833  O  OH    . TYR A 1 527  ? -71.41300 -13.11300 -6.74600  1.000 116.91459 ? 527  TYR A OH    1 
ATOM   3834  N  N     . LEU A 1 528  ? -69.87300 -14.48500 -13.05400 1.000 87.55605  ? 528  LEU A N     1 
ATOM   3835  C  CA    . LEU A 1 528  ? -69.96000 -13.06600 -13.38300 1.000 91.98215  ? 528  LEU A CA    1 
ATOM   3836  C  C     . LEU A 1 528  ? -70.91500 -12.80900 -14.54400 1.000 94.79981  ? 528  LEU A C     1 
ATOM   3837  O  O     . LEU A 1 528  ? -71.61900 -11.79300 -14.55600 1.000 93.37711  ? 528  LEU A O     1 
ATOM   3838  C  CB    . LEU A 1 528  ? -68.57100 -12.52200 -13.71300 1.000 88.08037  ? 528  LEU A CB    1 
ATOM   3839  C  CG    . LEU A 1 528  ? -67.76700 -11.82600 -12.61500 1.000 90.78678  ? 528  LEU A CG    1 
ATOM   3840  C  CD1   . LEU A 1 528  ? -67.70500 -12.66800 -11.35500 1.000 93.03121  ? 528  LEU A CD1   1 
ATOM   3841  C  CD2   . LEU A 1 528  ? -66.36700 -11.49700 -13.11300 1.000 90.56191  ? 528  LEU A CD2   1 
ATOM   3842  N  N     . GLU A 1 529  ? -70.95100 -13.71100 -15.52500 1.000 95.30435  ? 529  GLU A N     1 
ATOM   3843  C  CA    . GLU A 1 529  ? -71.76700 -13.49000 -16.71600 1.000 94.04019  ? 529  GLU A CA    1 
ATOM   3844  C  C     . GLU A 1 529  ? -73.25500 -13.57800 -16.39600 1.000 92.50779  ? 529  GLU A C     1 
ATOM   3845  O  O     . GLU A 1 529  ? -74.01300 -12.63300 -16.64200 1.000 96.59333  ? 529  GLU A O     1 
ATOM   3846  C  CB    . GLU A 1 529  ? -71.39200 -14.49900 -17.80400 1.000 95.37700  ? 529  GLU A CB    1 
ATOM   3847  C  CG    . GLU A 1 529  ? -70.10100 -14.18000 -18.53900 1.000 104.25052 ? 529  GLU A CG    1 
ATOM   3848  C  CD    . GLU A 1 529  ? -70.05800 -14.78900 -19.92800 1.000 101.17231 ? 529  GLU A CD    1 
ATOM   3849  O  OE1   . GLU A 1 529  ? -71.11300 -15.26000 -20.40500 1.000 96.54257  ? 529  GLU A OE1   1 
ATOM   3850  O  OE2   . GLU A 1 529  ? -68.97100 -14.79600 -20.54300 1.000 96.55675  ? 529  GLU A OE2   1 
ATOM   3851  N  N     . VAL A 1 530  ? -73.69300 -14.71500 -15.85000 1.000 96.06743  ? 530  VAL A N     1 
ATOM   3852  C  CA    . VAL A 1 530  ? -75.12100 -14.93200 -15.63700 1.000 101.50260 ? 530  VAL A CA    1 
ATOM   3853  C  C     . VAL A 1 530  ? -75.65900 -14.01900 -14.53800 1.000 98.58556  ? 530  VAL A C     1 
ATOM   3854  O  O     . VAL A 1 530  ? -76.83700 -13.64000 -14.56100 1.000 95.96731  ? 530  VAL A O     1 
ATOM   3855  C  CB    . VAL A 1 530  ? -75.38700 -16.42200 -15.34300 1.000 100.18310 ? 530  VAL A CB    1 
ATOM   3856  C  CG1   . VAL A 1 530  ? -74.55500 -16.88900 -14.17700 1.000 99.78162  ? 530  VAL A CG1   1 
ATOM   3857  C  CG2   . VAL A 1 530  ? -76.86000 -16.67100 -15.07700 1.000 105.90009 ? 530  VAL A CG2   1 
ATOM   3858  N  N     . SER A 1 531  ? -74.81800 -13.63400 -13.57400 1.000 98.43207  ? 531  SER A N     1 
ATOM   3859  C  CA    . SER A 1 531  ? -75.25600 -12.65500 -12.58300 1.000 95.84189  ? 531  SER A CA    1 
ATOM   3860  C  C     . SER A 1 531  ? -75.49500 -11.29200 -13.21900 1.000 92.30355  ? 531  SER A C     1 
ATOM   3861  O  O     . SER A 1 531  ? -76.27700 -10.49100 -12.69400 1.000 95.29020  ? 531  SER A O     1 
ATOM   3862  C  CB    . SER A 1 531  ? -74.23300 -12.54100 -11.45300 1.000 88.75648  ? 531  SER A CB    1 
ATOM   3863  O  OG    . SER A 1 531  ? -73.15300 -11.70200 -11.82400 1.000 96.46889  ? 531  SER A OG    1 
ATOM   3864  N  N     . GLN A 1 532  ? -74.83400 -11.01000 -14.34400 1.000 91.00319  ? 532  GLN A N     1 
ATOM   3865  C  CA    . GLN A 1 532  ? -75.11800 -9.79100  -15.09000 1.000 92.60074  ? 532  GLN A CA    1 
ATOM   3866  C  C     . GLN A 1 532  ? -76.39000 -9.92300  -15.91700 1.000 95.71479  ? 532  GLN A C     1 
ATOM   3867  O  O     . GLN A 1 532  ? -77.08500 -8.92500  -16.14100 1.000 104.19269 ? 532  GLN A O     1 
ATOM   3868  C  CB    . GLN A 1 532  ? -73.93800 -9.43700  -15.99700 1.000 101.51741 ? 532  GLN A CB    1 
ATOM   3869  C  CG    . GLN A 1 532  ? -74.00300 -8.03400  -16.58000 1.000 107.25332 ? 532  GLN A CG    1 
ATOM   3870  C  CD    . GLN A 1 532  ? -73.04000 -7.83400  -17.73300 1.000 111.19011 ? 532  GLN A CD    1 
ATOM   3871  O  OE1   . GLN A 1 532  ? -72.78700 -8.75200  -18.51200 1.000 113.20213 ? 532  GLN A OE1   1 
ATOM   3872  N  NE2   . GLN A 1 532  ? -72.49300 -6.62800  -17.84500 1.000 106.39167 ? 532  GLN A NE2   1 
ATOM   3873  N  N     . ILE A 1 533  ? -76.71100 -11.13600 -16.37600 1.000 92.59658  ? 533  ILE A N     1 
ATOM   3874  C  CA    . ILE A 1 533  ? -77.95900 -11.33800 -17.10200 1.000 96.28200  ? 533  ILE A CA    1 
ATOM   3875  C  C     . ILE A 1 533  ? -79.14600 -11.23300 -16.15600 1.000 97.72978  ? 533  ILE A C     1 
ATOM   3876  O  O     . ILE A 1 533  ? -80.21800 -10.75300 -16.54300 1.000 97.05978  ? 533  ILE A O     1 
ATOM   3877  C  CB    . ILE A 1 533  ? -77.94400 -12.69100 -17.83800 1.000 92.90043  ? 533  ILE A CB    1 
ATOM   3878  C  CG1   . ILE A 1 533  ? -76.59600 -12.91500 -18.52600 1.000 99.52206  ? 533  ILE A CG1   1 
ATOM   3879  C  CG2   . ILE A 1 533  ? -79.06100 -12.74200 -18.86600 1.000 88.93783  ? 533  ILE A CG2   1 
ATOM   3880  C  CD1   . ILE A 1 533  ? -76.30300 -11.93100 -19.63800 1.000 111.51353 ? 533  ILE A CD1   1 
ATOM   3881  N  N     . LEU A 1 534  ? -78.98300 -11.67800 -14.90700 1.000 99.66477  ? 534  LEU A N     1 
ATOM   3882  C  CA    . LEU A 1 534  ? -80.03800 -11.49800 -13.91500 1.000 98.10084  ? 534  LEU A CA    1 
ATOM   3883  C  C     . LEU A 1 534  ? -80.22200 -10.02500 -13.57500 1.000 97.80590  ? 534  LEU A C     1 
ATOM   3884  O  O     . LEU A 1 534  ? -81.35200 -9.56400  -13.37500 1.000 98.65885  ? 534  LEU A O     1 
ATOM   3885  C  CB    . LEU A 1 534  ? -79.71900 -12.30300 -12.65500 1.000 92.66186  ? 534  LEU A CB    1 
ATOM   3886  C  CG    . LEU A 1 534  ? -79.73600 -13.82800 -12.77300 1.000 94.78636  ? 534  LEU A CG    1 
ATOM   3887  C  CD1   . LEU A 1 534  ? -79.29600 -14.46900 -11.46600 1.000 83.47684  ? 534  LEU A CD1   1 
ATOM   3888  C  CD2   . LEU A 1 534  ? -81.11900 -14.32000 -13.17400 1.000 95.73942  ? 534  LEU A CD2   1 
ATOM   3889  N  N     . LYS A 1 535  ? -79.12100 -9.27200  -13.50500 1.000 93.78725  ? 535  LYS A N     1 
ATOM   3890  C  CA    . LYS A 1 535  ? -79.20900 -7.84600  -13.21500 1.000 90.88541  ? 535  LYS A CA    1 
ATOM   3891  C  C     . LYS A 1 535  ? -79.91700 -7.08800  -14.33100 1.000 89.96125  ? 535  LYS A C     1 
ATOM   3892  O  O     . LYS A 1 535  ? -80.59900 -6.09200  -14.06600 1.000 99.79758  ? 535  LYS A O     1 
ATOM   3893  C  CB    . LYS A 1 535  ? -77.80900 -7.27300  -12.98600 1.000 95.42054  ? 535  LYS A CB    1 
ATOM   3894  C  CG    . LYS A 1 535  ? -77.78400 -5.80500  -12.59400 1.000 97.66196  ? 535  LYS A CG    1 
ATOM   3895  C  CD    . LYS A 1 535  ? -78.41000 -5.58700  -11.22800 1.000 107.80701 ? 535  LYS A CD    1 
ATOM   3896  C  CE    . LYS A 1 535  ? -78.44500 -4.11200  -10.86600 1.000 109.98798 ? 535  LYS A CE    1 
ATOM   3897  N  NZ    . LYS A 1 535  ? -79.02500 -3.88600  -9.51300  1.000 107.64301 ? 535  LYS A NZ    1 
ATOM   3898  N  N     . LYS A 1 536  ? -79.77500 -7.54200  -15.57600 1.000 96.16913  ? 536  LYS A N     1 
ATOM   3899  C  CA    . LYS A 1 536  ? -80.41500 -6.85900  -16.69400 1.000 101.11272 ? 536  LYS A CA    1 
ATOM   3900  C  C     . LYS A 1 536  ? -81.89900 -7.18600  -16.79300 1.000 99.76735  ? 536  LYS A C     1 
ATOM   3901  O  O     . LYS A 1 536  ? -82.69100 -6.33200  -17.20600 1.000 101.44454 ? 536  LYS A O     1 
ATOM   3902  C  CB    . LYS A 1 536  ? -79.70800 -7.21900  -18.00300 1.000 101.07787 ? 536  LYS A CB    1 
ATOM   3903  C  CG    . LYS A 1 536  ? -80.18000 -6.41800  -19.20600 1.000 100.44749 ? 536  LYS A CG    1 
ATOM   3904  C  CD    . LYS A 1 536  ? -79.51900 -6.90000  -20.48700 1.000 96.44100  ? 536  LYS A CD    1 
ATOM   3905  C  CE    . LYS A 1 536  ? -79.97600 -6.08100  -21.68200 1.000 98.07190  ? 536  LYS A CE    1 
ATOM   3906  N  NZ    . LYS A 1 536  ? -79.40700 -6.59600  -22.95800 1.000 99.38794  ? 536  LYS A NZ    1 
ATOM   3907  N  N     . MET A 1 537  ? -82.29600 -8.40200  -16.41600 1.000 98.87785  ? 537  MET A N     1 
ATOM   3908  C  CA    . MET A 1 537  ? -83.69200 -8.81100  -16.51200 1.000 99.75219  ? 537  MET A CA    1 
ATOM   3909  C  C     . MET A 1 537  ? -84.49900 -8.42600  -15.27700 1.000 97.17615  ? 537  MET A C     1 
ATOM   3910  O  O     . MET A 1 537  ? -85.63300 -7.95100  -15.40500 1.000 98.15480  ? 537  MET A O     1 
ATOM   3911  C  CB    . MET A 1 537  ? -83.78100 -10.32200 -16.74300 1.000 105.84592 ? 537  MET A CB    1 
ATOM   3912  C  CG    . MET A 1 537  ? -83.23300 -10.77300 -18.08800 1.000 108.03257 ? 537  MET A CG    1 
ATOM   3913  S  SD    . MET A 1 537  ? -83.31000 -12.55900 -18.32000 1.000 102.30054 ? 537  MET A SD    1 
ATOM   3914  C  CE    . MET A 1 537  ? -85.04800 -12.86500 -18.01600 1.000 103.05896 ? 537  MET A CE    1 
ATOM   3915  N  N     . ASP A 1 538  ? -83.93900 -8.62000  -14.08400 1.000 97.93167  ? 538  ASP A N     1 
ATOM   3916  C  CA    . ASP A 1 538  ? -84.60500 -8.28800  -12.82400 1.000 97.12670  ? 538  ASP A CA    1 
ATOM   3917  C  C     . ASP A 1 538  ? -83.67000 -7.38600  -12.03000 1.000 100.09237 ? 538  ASP A C     1 
ATOM   3918  O  O     . ASP A 1 538  ? -82.90900 -7.85500  -11.17300 1.000 96.25608  ? 538  ASP A O     1 
ATOM   3919  C  CB    . ASP A 1 538  ? -84.97200 -9.55000  -12.04300 1.000 103.54125 ? 538  ASP A CB    1 
ATOM   3920  C  CG    . ASP A 1 538  ? -85.95600 -9.27900  -10.92200 1.000 106.11319 ? 538  ASP A CG    1 
ATOM   3921  O  OD1   . ASP A 1 538  ? -86.33600 -8.10500  -10.72900 1.000 110.02666 ? 538  ASP A OD1   1 
ATOM   3922  O  OD2   . ASP A 1 538  ? -86.35300 -10.24300 -10.23400 1.000 101.19676 ? 538  ASP A OD2   1 
ATOM   3923  N  N     . PRO A 1 539  ? -83.70500 -6.07500  -12.28800 1.000 100.92490 ? 539  PRO A N     1 
ATOM   3924  C  CA    . PRO A 1 539  ? -82.70000 -5.18600  -11.68200 1.000 102.18320 ? 539  PRO A CA    1 
ATOM   3925  C  C     . PRO A 1 539  ? -82.91100 -4.93700  -10.19800 1.000 107.99631 ? 539  PRO A C     1 
ATOM   3926  O  O     . PRO A 1 539  ? -81.93300 -4.67800  -9.48500  1.000 109.41274 ? 539  PRO A O     1 
ATOM   3927  C  CB    . PRO A 1 539  ? -82.84600 -3.88700  -12.49100 1.000 94.67046  ? 539  PRO A CB    1 
ATOM   3928  C  CG    . PRO A 1 539  ? -83.68100 -4.24600  -13.69400 1.000 93.52405  ? 539  PRO A CG    1 
ATOM   3929  C  CD    . PRO A 1 539  ? -84.56100 -5.36500  -13.24900 1.000 93.93863  ? 539  PRO A CD    1 
ATOM   3930  N  N     . VAL A 1 540  ? -84.14900 -5.00500  -9.70800  1.000 105.15981 ? 540  VAL A N     1 
ATOM   3931  C  CA    . VAL A 1 540  ? -84.42100 -4.60400  -8.33100  1.000 100.46156 ? 540  VAL A CA    1 
ATOM   3932  C  C     . VAL A 1 540  ? -83.95500 -5.66800  -7.34400  1.000 100.54806 ? 540  VAL A C     1 
ATOM   3933  O  O     . VAL A 1 540  ? -83.44700 -5.34600  -6.26400  1.000 98.53210  ? 540  VAL A O     1 
ATOM   3934  C  CB    . VAL A 1 540  ? -85.91900 -4.29100  -8.16000  1.000 99.18081  ? 540  VAL A CB    1 
ATOM   3935  C  CG1   . VAL A 1 540  ? -86.15900 -3.54700  -6.85400  1.000 102.66441 ? 540  VAL A CG1   1 
ATOM   3936  C  CG2   . VAL A 1 540  ? -86.43100 -3.48600  -9.34300  1.000 96.01229  ? 540  VAL A CG2   1 
ATOM   3937  N  N     . HIS A 1 541  ? -84.11100 -6.94600  -7.69200  1.000 107.35793 ? 541  HIS A N     1 
ATOM   3938  C  CA    . HIS A 1 541  ? -83.81600 -8.01500  -6.74400  1.000 110.71960 ? 541  HIS A CA    1 
ATOM   3939  C  C     . HIS A 1 541  ? -82.33000 -8.34700  -6.67400  1.000 109.02524 ? 541  HIS A C     1 
ATOM   3940  O  O     . HIS A 1 541  ? -81.83900 -8.73300  -5.60800  1.000 107.33075 ? 541  HIS A O     1 
ATOM   3941  C  CB    . HIS A 1 541  ? -84.61100 -9.27000  -7.10600  1.000 112.35337 ? 541  HIS A CB    1 
ATOM   3942  C  CG    . HIS A 1 541  ? -86.08800 -9.12300  -6.91700  1.000 115.59266 ? 541  HIS A CG    1 
ATOM   3943  N  ND1   . HIS A 1 541  ? -86.95400 -8.88400  -7.96300  1.000 110.84129 ? 541  HIS A ND1   1 
ATOM   3944  C  CD2   . HIS A 1 541  ? -86.85300 -9.18500  -5.80200  1.000 110.43154 ? 541  HIS A CD2   1 
ATOM   3945  C  CE1   . HIS A 1 541  ? -88.18800 -8.80200  -7.49900  1.000 114.95100 ? 541  HIS A CE1   1 
ATOM   3946  N  NE2   . HIS A 1 541  ? -88.15500 -8.98100  -6.19100  1.000 114.61278 ? 541  HIS A NE2   1 
ATOM   3947  N  N     . TYR A 1 542  ? -81.60400 -8.20700  -7.78000  1.000 107.62547 ? 542  TYR A N     1 
ATOM   3948  C  CA    . TYR A 1 542  ? -80.21700 -8.63800  -7.79600  1.000 106.71772 ? 542  TYR A CA    1 
ATOM   3949  C  C     . TYR A 1 542  ? -79.27200 -7.44100  -7.75500  1.000 105.00045 ? 542  TYR A C     1 
ATOM   3950  O  O     . TYR A 1 542  ? -79.57800 -6.37900  -8.30700  1.000 103.19129 ? 542  TYR A O     1 
ATOM   3951  C  CB    . TYR A 1 542  ? -79.92600 -9.48200  -9.04300  1.000 102.62457 ? 542  TYR A CB    1 
ATOM   3952  C  CG    . TYR A 1 542  ? -80.84300 -10.67500 -9.17500  1.000 97.53414  ? 542  TYR A CG    1 
ATOM   3953  C  CD1   . TYR A 1 542  ? -80.56600 -11.86600 -8.51500  1.000 88.00651  ? 542  TYR A CD1   1 
ATOM   3954  C  CD2   . TYR A 1 542  ? -81.99400 -10.60800 -9.95000  1.000 96.65418  ? 542  TYR A CD2   1 
ATOM   3955  C  CE1   . TYR A 1 542  ? -81.40700 -12.95800 -8.62900  1.000 93.48454  ? 542  TYR A CE1   1 
ATOM   3956  C  CE2   . TYR A 1 542  ? -82.83900 -11.69300 -10.07000 1.000 96.47072  ? 542  TYR A CE2   1 
ATOM   3957  C  CZ    . TYR A 1 542  ? -82.54100 -12.86500 -9.40900  1.000 99.15261  ? 542  TYR A CZ    1 
ATOM   3958  O  OH    . TYR A 1 542  ? -83.38400 -13.94600 -9.52900  1.000 100.05932 ? 542  TYR A OH    1 
ATOM   3959  N  N     . PRO A 1 543  ? -78.12200 -7.57800  -7.10300  1.000 104.00653 ? 543  PRO A N     1 
ATOM   3960  C  CA    . PRO A 1 543  ? -77.19700 -6.44900  -6.98200  1.000 108.45035 ? 543  PRO A CA    1 
ATOM   3961  C  C     . PRO A 1 543  ? -76.38600 -6.23500  -8.25100  1.000 106.56460 ? 543  PRO A C     1 
ATOM   3962  O  O     . PRO A 1 543  ? -76.20000 -7.13600  -9.07100  1.000 108.13849 ? 543  PRO A O     1 
ATOM   3963  C  CB    . PRO A 1 543  ? -76.29100 -6.86600  -5.81900  1.000 110.59886 ? 543  PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1 543  ? -76.26800 -8.35500  -5.90200  1.000 101.74936 ? 543  PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1 543  ? -77.64200 -8.76600  -6.37400  1.000 97.68659  ? 543  PRO A CD    1 
ATOM   3966  N  N     . SER A 1 544  ? -75.89800 -5.00600  -8.39600  1.000 103.73724 ? 544  SER A N     1 
ATOM   3967  C  CA    . SER A 1 544  ? -75.02600 -4.66300  -9.50900  1.000 108.95388 ? 544  SER A CA    1 
ATOM   3968  C  C     . SER A 1 544  ? -73.62000 -5.18600  -9.24800  1.000 108.94911 ? 544  SER A C     1 
ATOM   3969  O  O     . SER A 1 544  ? -73.14400 -5.19000  -8.10900  1.000 105.39998 ? 544  SER A O     1 
ATOM   3970  C  CB    . SER A 1 544  ? -74.99800 -3.15000  -9.72200  1.000 103.06706 ? 544  SER A CB    1 
ATOM   3971  O  OG    . SER A 1 544  ? -74.42300 -2.82000  -10.97400 1.000 109.15867 ? 544  SER A OG    1 
ATOM   3972  N  N     . LEU A 1 545  ? -72.95600 -5.62800  -10.31300 1.000 107.24090 ? 545  LEU A N     1 
ATOM   3973  C  CA    . LEU A 1 545  ? -71.63700 -6.22600  -10.18300 1.000 107.28201 ? 545  LEU A CA    1 
ATOM   3974  C  C     . LEU A 1 545  ? -70.61100 -5.19000  -9.73200  1.000 105.72796 ? 545  LEU A C     1 
ATOM   3975  O  O     . LEU A 1 545  ? -70.84200 -3.97800  -9.78100  1.000 106.26984 ? 545  LEU A O     1 
ATOM   3976  C  CB    . LEU A 1 545  ? -71.19400 -6.85200  -11.50700 1.000 101.62143 ? 545  LEU A CB    1 
ATOM   3977  C  CG    . LEU A 1 545  ? -72.15300 -7.82000  -12.20300 1.000 100.11617 ? 545  LEU A CG    1 
ATOM   3978  C  CD1   . LEU A 1 545  ? -73.05300 -7.08800  -13.18900 1.000 100.39109 ? 545  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU A 1 545  ? -71.37900 -8.92800  -12.89900 1.000 96.61090  ? 545  LEU A CD2   1 
ATOM   3980  N  N     . ALA A 1 546  ? -69.46200 -5.68900  -9.28100  1.000 97.52648  ? 546  ALA A N     1 
ATOM   3981  C  CA    . ALA A 1 546  ? -68.37300 -4.81100  -8.87900  1.000 97.96807  ? 546  ALA A CA    1 
ATOM   3982  C  C     . ALA A 1 546  ? -67.87400 -4.00900  -10.07400 1.000 106.34442 ? 546  ALA A C     1 
ATOM   3983  O  O     . ALA A 1 546  ? -67.71000 -4.54100  -11.17600 1.000 105.61279 ? 546  ALA A O     1 
ATOM   3984  C  CB    . ALA A 1 546  ? -67.23100 -5.62300  -8.26800  1.000 97.73995  ? 546  ALA A CB    1 
ATOM   3985  N  N     . ASP A 1 547  ? -67.63100 -2.71600  -9.84800  1.000 108.13061 ? 547  ASP A N     1 
ATOM   3986  C  CA    . ASP A 1 547  ? -67.26900 -1.82800  -10.94700 1.000 109.92208 ? 547  ASP A CA    1 
ATOM   3987  C  C     . ASP A 1 547  ? -65.90300 -2.17100  -11.52900 1.000 106.95220 ? 547  ASP A C     1 
ATOM   3988  O  O     . ASP A 1 547  ? -65.66400 -1.94200  -12.72100 1.000 108.76676 ? 547  ASP A O     1 
ATOM   3989  C  CB    . ASP A 1 547  ? -67.29800 -0.37600  -10.47500 1.000 110.39977 ? 547  ASP A CB    1 
ATOM   3990  C  CG    . ASP A 1 547  ? -67.47400 0.60400   -11.61700 1.000 120.66601 ? 547  ASP A CG    1 
ATOM   3991  O  OD1   . ASP A 1 547  ? -67.58900 0.15600   -12.77700 1.000 115.17900 ? 547  ASP A OD1   1 
ATOM   3992  O  OD2   . ASP A 1 547  ? -67.50100 1.82400   -11.35300 1.000 124.86035 ? 547  ASP A OD2   1 
ATOM   3993  N  N     . LYS A 1 548  ? -65.00200 -2.71700  -10.71700 1.000 102.93042 ? 548  LYS A N     1 
ATOM   3994  C  CA    . LYS A 1 548  ? -63.67900 -3.11300  -11.17700 1.000 97.45096  ? 548  LYS A CA    1 
ATOM   3995  C  C     . LYS A 1 548  ? -63.65400 -4.52200  -11.75800 1.000 96.32413  ? 548  LYS A C     1 
ATOM   3996  O  O     . LYS A 1 548  ? -62.57200 -5.03400  -12.06400 1.000 97.01247  ? 548  LYS A O     1 
ATOM   3997  C  CB    . LYS A 1 548  ? -62.66900 -3.00700  -10.03100 1.000 95.71180  ? 548  LYS A CB    1 
ATOM   3998  C  CG    . LYS A 1 548  ? -62.98500 -3.89500  -8.83700  1.000 96.80992  ? 548  LYS A CG    1 
ATOM   3999  C  CD    . LYS A 1 548  ? -62.09500 -3.56200  -7.65100  1.000 91.69834  ? 548  LYS A CD    1 
ATOM   4000  C  CE    . LYS A 1 548  ? -62.19200 -4.62700  -6.57000  1.000 95.30821  ? 548  LYS A CE    1 
ATOM   4001  N  NZ    . LYS A 1 548  ? -63.59700 -4.86100  -6.13900  1.000 109.08578 ? 548  LYS A NZ    1 
ATOM   4002  N  N     . TYR A 1 549  ? -64.81700 -5.15700  -11.91900 1.000 97.41565  ? 549  TYR A N     1 
ATOM   4003  C  CA    . TYR A 1 549  ? -64.90200 -6.52700  -12.40900 1.000 97.54130  ? 549  TYR A CA    1 
ATOM   4004  C  C     . TYR A 1 549  ? -65.49500 -6.64800  -13.80600 1.000 93.00808  ? 549  TYR A C     1 
ATOM   4005  O  O     . TYR A 1 549  ? -65.53300 -7.75900  -14.34500 1.000 95.68652  ? 549  TYR A O     1 
ATOM   4006  C  CB    . TYR A 1 549  ? -65.74100 -7.38700  -11.45100 1.000 97.19738  ? 549  TYR A CB    1 
ATOM   4007  C  CG    . TYR A 1 549  ? -65.02700 -7.84700  -10.19700 1.000 97.55441  ? 549  TYR A CG    1 
ATOM   4008  C  CD1   . TYR A 1 549  ? -63.83300 -7.26400  -9.79300  1.000 90.13272  ? 549  TYR A CD1   1 
ATOM   4009  C  CD2   . TYR A 1 549  ? -65.55900 -8.86200  -9.41200  1.000 98.06970  ? 549  TYR A CD2   1 
ATOM   4010  C  CE1   . TYR A 1 549  ? -63.18700 -7.68400  -8.64600  1.000 91.67778  ? 549  TYR A CE1   1 
ATOM   4011  C  CE2   . TYR A 1 549  ? -64.92100 -9.28800  -8.26400  1.000 93.58848  ? 549  TYR A CE2   1 
ATOM   4012  C  CZ    . TYR A 1 549  ? -63.73600 -8.69600  -7.88500  1.000 90.99871  ? 549  TYR A CZ    1 
ATOM   4013  O  OH    . TYR A 1 549  ? -63.09700 -9.11800  -6.74200  1.000 86.29181  ? 549  TYR A OH    1 
ATOM   4014  N  N     . GLU A 1 550  ? -65.95900 -5.54800  -14.40400 1.000 91.63699  ? 550  GLU A N     1 
ATOM   4015  C  CA    . GLU A 1 550  ? -66.69600 -5.64400  -15.66200 1.000 94.15933  ? 550  GLU A CA    1 
ATOM   4016  C  C     . GLU A 1 550  ? -65.80100 -6.06000  -16.82400 1.000 95.45024  ? 550  GLU A C     1 
ATOM   4017  O  O     . GLU A 1 550  ? -66.28700 -6.65700  -17.79200 1.000 95.05910  ? 550  GLU A O     1 
ATOM   4018  C  CB    . GLU A 1 550  ? -67.37800 -4.31000  -15.97300 1.000 93.76813  ? 550  GLU A CB    1 
ATOM   4019  C  CG    . GLU A 1 550  ? -68.31700 -4.35200  -17.17100 1.000 103.07324 ? 550  GLU A CG    1 
ATOM   4020  C  CD    . GLU A 1 550  ? -69.08900 -3.06100  -17.36100 1.000 118.45557 ? 550  GLU A CD    1 
ATOM   4021  O  OE1   . GLU A 1 550  ? -69.21300 -2.60600  -18.51800 1.000 114.70925 ? 550  GLU A OE1   1 
ATOM   4022  O  OE2   . GLU A 1 550  ? -69.57300 -2.50100  -16.35400 1.000 126.65061 ? 550  GLU A OE2   1 
ATOM   4023  N  N     . SER A 1 551  ? -64.50100 -5.76100  -16.75200 1.000 98.78970  ? 551  SER A N     1 
ATOM   4024  C  CA    . SER A 1 551  ? -63.61100 -6.06500  -17.86800 1.000 91.76238  ? 551  SER A CA    1 
ATOM   4025  C  C     . SER A 1 551  ? -63.45400 -7.56400  -18.08400 1.000 93.26533  ? 551  SER A C     1 
ATOM   4026  O  O     . SER A 1 551  ? -63.17400 -7.99800  -19.20800 1.000 97.48728  ? 551  SER A O     1 
ATOM   4027  C  CB    . SER A 1 551  ? -62.24300 -5.42400  -17.63900 1.000 87.19224  ? 551  SER A CB    1 
ATOM   4028  O  OG    . SER A 1 551  ? -61.72400 -5.76800  -16.36600 1.000 92.78976  ? 551  SER A OG    1 
ATOM   4029  N  N     . ALA A 1 552  ? -63.63200 -8.36800  -17.03200 1.000 90.64585  ? 552  ALA A N     1 
ATOM   4030  C  CA    . ALA A 1 552  ? -63.46000 -9.81100  -17.15500 1.000 89.78015  ? 552  ALA A CA    1 
ATOM   4031  C  C     . ALA A 1 552  ? -64.45600 -10.43800 -18.12200 1.000 91.69412  ? 552  ALA A C     1 
ATOM   4032  O  O     . ALA A 1 552  ? -64.21200 -11.54500 -18.61300 1.000 91.00269  ? 552  ALA A O     1 
ATOM   4033  C  CB    . ALA A 1 552  ? -63.58200 -10.47400 -15.78300 1.000 86.00187  ? 552  ALA A CB    1 
ATOM   4034  N  N     . LEU A 1 553  ? -65.56700 -9.75900  -18.40500 1.000 98.45508  ? 553  LEU A N     1 
ATOM   4035  C  CA    . LEU A 1 553  ? -66.56700 -10.27500 -19.33100 1.000 104.03252 ? 553  LEU A CA    1 
ATOM   4036  C  C     . LEU A 1 553  ? -66.26400 -9.93500  -20.78200 1.000 103.34734 ? 553  LEU A C     1 
ATOM   4037  O  O     . LEU A 1 553  ? -66.74000 -10.63800 -21.68100 1.000 99.25245  ? 553  LEU A O     1 
ATOM   4038  C  CB    . LEU A 1 553  ? -67.95600 -9.74100  -18.96300 1.000 108.17200 ? 553  LEU A CB    1 
ATOM   4039  C  CG    . LEU A 1 553  ? -68.78300 -10.54400 -17.95400 1.000 100.48619 ? 553  LEU A CG    1 
ATOM   4040  C  CD1   . LEU A 1 553  ? -67.93000 -11.05100 -16.80900 1.000 86.46629  ? 553  LEU A CD1   1 
ATOM   4041  C  CD2   . LEU A 1 553  ? -69.92700 -9.70000  -17.42300 1.000 104.23441 ? 553  LEU A CD2   1 
ATOM   4042  N  N     . GLU A 1 554  ? -65.49400 -8.88000  -21.03000 1.000 102.66738 ? 554  GLU A N     1 
ATOM   4043  C  CA    . GLU A 1 554  ? -65.09100 -8.54900  -22.38800 1.000 107.32796 ? 554  GLU A CA    1 
ATOM   4044  C  C     . GLU A 1 554  ? -64.10400 -9.58300  -22.91100 1.000 104.98068 ? 554  GLU A C     1 
ATOM   4045  O  O     . GLU A 1 554  ? -63.20600 -10.02900 -22.19200 1.000 96.76265  ? 554  GLU A O     1 
ATOM   4046  C  CB    . GLU A 1 554  ? -64.46700 -7.15400  -22.42900 1.000 110.45028 ? 554  GLU A CB    1 
ATOM   4047  C  CG    . GLU A 1 554  ? -64.03200 -6.70200  -23.81300 1.000 113.47414 ? 554  GLU A CG    1 
ATOM   4048  C  CD    . GLU A 1 554  ? -65.13900 -5.99500  -24.56900 1.000 117.22887 ? 554  GLU A CD    1 
ATOM   4049  O  OE1   . GLU A 1 554  ? -66.01600 -5.39200  -23.91600 1.000 113.06594 ? 554  GLU A OE1   1 
ATOM   4050  O  OE2   . GLU A 1 554  ? -65.13100 -6.04300  -25.81800 1.000 121.76136 ? 554  GLU A OE2   1 
ATOM   4051  N  N     . ASP A 1 555  ? -64.28000 -9.97500  -24.16800 1.000 110.23742 ? 555  ASP A N     1 
ATOM   4052  C  CA    . ASP A 1 555  ? -63.37500 -10.90300 -24.82800 1.000 115.33613 ? 555  ASP A CA    1 
ATOM   4053  C  C     . ASP A 1 555  ? -62.37900 -10.13000 -25.68000 1.000 111.91826 ? 555  ASP A C     1 
ATOM   4054  O  O     . ASP A 1 555  ? -62.72900 -9.12600  -26.30700 1.000 111.86714 ? 555  ASP A O     1 
ATOM   4055  C  CB    . ASP A 1 555  ? -64.14500 -11.90100 -25.69700 1.000 121.40171 ? 555  ASP A CB    1 
ATOM   4056  C  CG    . ASP A 1 555  ? -65.06500 -12.79000 -24.88500 1.000 122.26120 ? 555  ASP A CG    1 
ATOM   4057  O  OD1   . ASP A 1 555  ? -64.87600 -12.87700 -23.65300 1.000 126.67055 ? 555  ASP A OD1   1 
ATOM   4058  O  OD2   . ASP A 1 555  ? -65.97700 -13.40400 -25.47800 1.000 111.05008 ? 555  ASP A OD2   1 
ATOM   4059  N  N     . LEU A 1 556  ? -61.13400 -10.59900 -25.69200 1.000 104.63219 ? 556  LEU A N     1 
ATOM   4060  C  CA    . LEU A 1 556  ? -60.06900 -9.95300  -26.45700 1.000 103.87216 ? 556  LEU A CA    1 
ATOM   4061  C  C     . LEU A 1 556  ? -60.24600 -10.31400 -27.92700 1.000 111.18573 ? 556  LEU A C     1 
ATOM   4062  O  O     . LEU A 1 556  ? -59.67400 -11.28200 -28.43000 1.000 107.77851 ? 556  LEU A O     1 
ATOM   4063  C  CB    . LEU A 1 556  ? -58.70000 -10.36800 -25.93300 1.000 99.79939  ? 556  LEU A CB    1 
ATOM   4064  C  CG    . LEU A 1 556  ? -58.45000 -10.09400 -24.44800 1.000 79.04245  ? 556  LEU A CG    1 
ATOM   4065  C  CD1   . LEU A 1 556  ? -56.98500 -10.30100 -24.09800 1.000 72.82568  ? 556  LEU A CD1   1 
ATOM   4066  C  CD2   . LEU A 1 556  ? -58.90100 -8.69200  -24.07500 1.000 85.11481  ? 556  LEU A CD2   1 
ATOM   4067  N  N     . HIS A 1 557  ? -61.05400 -9.52000  -28.62200 1.000 120.73253 ? 557  HIS A N     1 
ATOM   4068  C  CA    . HIS A 1 557  ? -61.34500 -9.72200  -30.03300 1.000 121.92151 ? 557  HIS A CA    1 
ATOM   4069  C  C     . HIS A 1 557  ? -60.74300 -8.58200  -30.84300 1.000 118.26554 ? 557  HIS A C     1 
ATOM   4070  O  O     . HIS A 1 557  ? -60.70500 -7.43600  -30.38400 1.000 121.48379 ? 557  HIS A O     1 
ATOM   4071  C  CB    . HIS A 1 557  ? -62.85600 -9.80000  -30.27300 1.000 130.36427 ? 557  HIS A CB    1 
ATOM   4072  C  CG    . HIS A 1 557  ? -63.26300 -10.88500 -31.22100 1.000 139.35581 ? 557  HIS A CG    1 
ATOM   4073  N  ND1   . HIS A 1 557  ? -63.11600 -12.22400 -30.92500 1.000 138.79862 ? 557  HIS A ND1   1 
ATOM   4074  C  CD2   . HIS A 1 557  ? -63.81800 -10.83100 -32.45400 1.000 136.55430 ? 557  HIS A CD2   1 
ATOM   4075  C  CE1   . HIS A 1 557  ? -63.56000 -12.94700 -31.93800 1.000 135.71895 ? 557  HIS A CE1   1 
ATOM   4076  N  NE2   . HIS A 1 557  ? -63.99100 -12.12600 -32.87900 1.000 133.00855 ? 557  HIS A NE2   1 
ATOM   4077  N  N     . SER A 1 558  ? -60.27400 -8.90300  -32.04500 1.000 114.88151 ? 558  SER A N     1 
ATOM   4078  C  CA    . SER A 1 558  ? -59.62200 -7.92200  -32.90800 1.000 115.17360 ? 558  SER A CA    1 
ATOM   4079  C  C     . SER A 1 558  ? -60.56100 -6.77400  -33.26900 1.000 118.74610 ? 558  SER A C     1 
ATOM   4080  O  O     . SER A 1 558  ? -60.32300 -5.62500  -32.89700 1.000 115.67009 ? 558  SER A O     1 
ATOM   4081  C  CB    . SER A 1 558  ? -59.10500 -8.59200  -34.18300 1.000 110.43907 ? 558  SER A CB    1 
ATOM   4082  O  OG    . SER A 1 558  ? -60.17700 -8.98900  -35.02000 1.000 107.29817 ? 558  SER A OG    1 
ATOM   4083  N  N     . HIS A 1 560  ? -59.98100 -6.36400  -37.06000 1.000 109.51062 ? 560  HIS A N     1 
ATOM   4084  C  CA    . HIS A 1 560  ? -59.41700 -5.03100  -37.24300 1.000 111.00730 ? 560  HIS A CA    1 
ATOM   4085  C  C     . HIS A 1 560  ? -57.90000 -5.10200  -37.38200 1.000 107.94105 ? 560  HIS A C     1 
ATOM   4086  O  O     . HIS A 1 560  ? -57.20800 -5.55800  -36.47200 1.000 107.29616 ? 560  HIS A O     1 
ATOM   4087  C  CB    . HIS A 1 560  ? -59.79500 -4.11900  -36.07300 1.000 109.79571 ? 560  HIS A CB    1 
ATOM   4088  C  CG    . HIS A 1 560  ? -61.27000 -3.98700  -35.86000 1.000 114.47503 ? 560  HIS A CG    1 
ATOM   4089  N  ND1   . HIS A 1 560  ? -62.19700 -4.34300  -36.81600 1.000 113.00130 ? 560  HIS A ND1   1 
ATOM   4090  C  CD2   . HIS A 1 560  ? -61.98000 -3.53700  -34.79800 1.000 112.13586 ? 560  HIS A CD2   1 
ATOM   4091  C  CE1   . HIS A 1 560  ? -63.41400 -4.11900  -36.35200 1.000 108.84349 ? 560  HIS A CE1   1 
ATOM   4092  N  NE2   . HIS A 1 560  ? -63.31000 -3.63000  -35.13000 1.000 112.35086 ? 560  HIS A NE2   1 
ATOM   4093  N  N     . HIS A 1 561  ? -57.38700 -4.65000  -38.52400 1.000 104.16602 ? 561  HIS A N     1 
ATOM   4094  C  CA    . HIS A 1 561  ? -55.95000 -4.66200  -38.79100 1.000 100.27348 ? 561  HIS A CA    1 
ATOM   4095  C  C     . HIS A 1 561  ? -55.59600 -3.42400  -39.60300 1.000 104.32858 ? 561  HIS A C     1 
ATOM   4096  O  O     . HIS A 1 561  ? -55.98100 -3.31300  -40.77100 1.000 100.89966 ? 561  HIS A O     1 
ATOM   4097  C  CB    . HIS A 1 561  ? -55.53100 -5.93800  -39.52200 1.000 95.03448  ? 561  HIS A CB    1 
ATOM   4098  C  CG    . HIS A 1 561  ? -55.78400 -7.19100  -38.74200 1.000 102.49374 ? 561  HIS A CG    1 
ATOM   4099  N  ND1   . HIS A 1 561  ? -54.99200 -7.58100  -37.68300 1.000 94.44933  ? 561  HIS A ND1   1 
ATOM   4100  C  CD2   . HIS A 1 561  ? -56.74200 -8.14100  -38.86400 1.000 107.98268 ? 561  HIS A CD2   1 
ATOM   4101  C  CE1   . HIS A 1 561  ? -55.45000 -8.71700  -37.18800 1.000 94.28823  ? 561  HIS A CE1   1 
ATOM   4102  N  NE2   . HIS A 1 561  ? -56.51100 -9.07800  -37.88600 1.000 102.42010 ? 561  HIS A NE2   1 
ATOM   4103  N  N     . CYS A 1 562  ? -54.86500 -2.50000  -38.98400 1.000 103.02473 ? 562  CYS A N     1 
ATOM   4104  C  CA    . CYS A 1 562  ? -54.42400 -1.27100  -39.62400 1.000 97.20704  ? 562  CYS A CA    1 
ATOM   4105  C  C     . CYS A 1 562  ? -52.90400 -1.26100  -39.71700 1.000 90.79506  ? 562  CYS A C     1 
ATOM   4106  O  O     . CYS A 1 562  ? -52.21100 -1.82200  -38.86300 1.000 82.54740  ? 562  CYS A O     1 
ATOM   4107  C  CB    . CYS A 1 562  ? -54.91100 -0.03800  -38.85100 1.000 93.63030  ? 562  CYS A CB    1 
ATOM   4108  S  SG    . CYS A 1 562  ? -54.40400 1.54500   -39.56300 1.000 110.05808 ? 562  CYS A SG    1 
ATOM   4109  N  N     . SER A 1 563  ? -52.38800 -0.61600  -40.76300 1.000 88.14963  ? 563  SER A N     1 
ATOM   4110  C  CA    . SER A 1 563  ? -50.95100 -0.59500  -41.00300 1.000 83.92874  ? 563  SER A CA    1 
ATOM   4111  C  C     . SER A 1 563  ? -50.57100 0.65900   -41.77600 1.000 88.95765  ? 563  SER A C     1 
ATOM   4112  O  O     . SER A 1 563  ? -51.22600 1.00300   -42.76400 1.000 95.68907  ? 563  SER A O     1 
ATOM   4113  C  CB    . SER A 1 563  ? -50.50700 -1.84300  -41.77400 1.000 80.92745  ? 563  SER A CB    1 
ATOM   4114  O  OG    . SER A 1 563  ? -51.15300 -1.91900  -43.03300 1.000 82.61928  ? 563  SER A OG    1 
ATOM   4115  N  N     . THR A 1 564  ? -49.51500 1.33300   -41.32100 1.000 84.05085  ? 564  THR A N     1 
ATOM   4116  C  CA    . THR A 1 564  ? -48.95500 2.49300   -42.00400 1.000 83.24946  ? 564  THR A CA    1 
ATOM   4117  C  C     . THR A 1 564  ? -47.45300 2.29800   -42.14700 1.000 81.06810  ? 564  THR A C     1 
ATOM   4118  O  O     . THR A 1 564  ? -46.78300 1.90000   -41.18900 1.000 80.39608  ? 564  THR A O     1 
ATOM   4119  C  CB    . THR A 1 564  ? -49.24100 3.79600   -41.24500 1.000 82.17498  ? 564  THR A CB    1 
ATOM   4120  O  OG1   . THR A 1 564  ? -48.54100 3.78900   -39.99500 1.000 80.30428  ? 564  THR A OG1   1 
ATOM   4121  C  CG2   . THR A 1 564  ? -50.73300 3.95900   -40.99000 1.000 78.46398  ? 564  THR A CG2   1 
ATOM   4122  N  N     . LEU A 1 565  ? -46.92900 2.58100   -43.33800 1.000 86.00228  ? 565  LEU A N     1 
ATOM   4123  C  CA    . LEU A 1 565  ? -45.51400 2.39800   -43.63900 1.000 81.78903  ? 565  LEU A CA    1 
ATOM   4124  C  C     . LEU A 1 565  ? -44.94900 3.69300   -44.20200 1.000 86.35282  ? 565  LEU A C     1 
ATOM   4125  O  O     . LEU A 1 565  ? -45.53700 4.28600   -45.11200 1.000 87.83177  ? 565  LEU A O     1 
ATOM   4126  C  CB    . LEU A 1 565  ? -45.30600 1.24800   -44.63000 1.000 78.82362  ? 565  LEU A CB    1 
ATOM   4127  C  CG    . LEU A 1 565  ? -46.02800 -0.06100  -44.29800 1.000 85.54633  ? 565  LEU A CG    1 
ATOM   4128  C  CD1   . LEU A 1 565  ? -45.79800 -1.09500  -45.38600 1.000 89.18820  ? 565  LEU A CD1   1 
ATOM   4129  C  CD2   . LEU A 1 565  ? -45.58500 -0.59900  -42.94600 1.000 82.06396  ? 565  LEU A CD2   1 
ATOM   4130  N  N     . LYS A 1 566  ? -43.81000 4.12500   -43.66500 1.000 83.79902  ? 566  LYS A N     1 
ATOM   4131  C  CA    . LYS A 1 566  ? -43.18100 5.38300   -44.04600 1.000 85.98594  ? 566  LYS A CA    1 
ATOM   4132  C  C     . LYS A 1 566  ? -41.76700 5.11400   -44.54300 1.000 86.38601  ? 566  LYS A C     1 
ATOM   4133  O  O     . LYS A 1 566  ? -41.00000 4.40000   -43.88700 1.000 80.62635  ? 566  LYS A O     1 
ATOM   4134  C  CB    . LYS A 1 566  ? -43.15700 6.35900   -42.86500 1.000 84.37704  ? 566  LYS A CB    1 
ATOM   4135  C  CG    . LYS A 1 566  ? -42.99400 7.81800   -43.26000 1.000 89.30987  ? 566  LYS A CG    1 
ATOM   4136  C  CD    . LYS A 1 566  ? -43.34800 8.73800   -42.10200 1.000 94.64690  ? 566  LYS A CD    1 
ATOM   4137  C  CE    . LYS A 1 566  ? -43.71200 10.13100  -42.59100 1.000 98.85316  ? 566  LYS A CE    1 
ATOM   4138  N  NZ    . LYS A 1 566  ? -44.37200 10.93600  -41.52600 1.000 87.98977  ? 566  LYS A NZ    1 
ATOM   4139  N  N     . TYR A 1 567  ? -41.42800 5.68700   -45.69500 1.000 87.46252  ? 567  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1 567  ? -40.11500 5.49400   -46.29800 1.000 86.99828  ? 567  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1 567  ? -39.85100 6.64700   -47.25800 1.000 92.80565  ? 567  TYR A C     1 
ATOM   4142  O  O     . TYR A 1 567  ? -40.73100 7.46500   -47.53500 1.000 93.50756  ? 567  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1 567  ? -40.02100 4.14000   -47.01100 1.000 82.39667  ? 567  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1 567  ? -40.95500 3.99200   -48.19300 1.000 90.47300  ? 567  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1 567  ? -42.30600 3.72900   -48.00800 1.000 94.58433  ? 567  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1 567  ? -40.48200 4.10400   -49.49300 1.000 94.88569  ? 567  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1 567  ? -43.16100 3.59200   -49.08500 1.000 93.74075  ? 567  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1 567  ? -41.32900 3.96800   -50.57600 1.000 93.86309  ? 567  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1 567  ? -42.66600 3.71200   -50.36700 1.000 93.42627  ? 567  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1 567  ? -43.51100 3.57500   -51.44400 1.000 97.95962  ? 567  TYR A OH    1 
ATOM   4151  N  N     . GLN A 1 568  ? -38.62100 6.70200   -47.76100 1.000 89.65164  ? 568  GLN A N     1 
ATOM   4152  C  CA    . GLN A 1 568  ? -38.19900 7.78000   -48.64300 1.000 99.71099  ? 568  GLN A CA    1 
ATOM   4153  C  C     . GLN A 1 568  ? -38.48600 7.44400   -50.10400 1.000 103.93772 ? 568  GLN A C     1 
ATOM   4154  O  O     . GLN A 1 568  ? -38.56800 6.28000   -50.50000 1.000 102.11571 ? 568  GLN A O     1 
ATOM   4155  C  CB    . GLN A 1 568  ? -36.71100 8.08100   -48.46300 1.000 104.88601 ? 568  GLN A CB    1 
ATOM   4156  C  CG    . GLN A 1 568  ? -36.38700 8.88900   -47.22000 1.000 109.63543 ? 568  GLN A CG    1 
ATOM   4157  C  CD    . GLN A 1 568  ? -35.59200 10.14200  -47.53800 1.000 117.84500 ? 568  GLN A CD    1 
ATOM   4158  O  OE1   . GLN A 1 568  ? -34.37300 10.17800  -47.37500 1.000 117.61172 ? 568  GLN A OE1   1 
ATOM   4159  N  NE2   . GLN A 1 568  ? -36.28400 11.17800  -47.99800 1.000 104.76141 ? 568  GLN A NE2   1 
ATOM   4160  N  N     . ASN A 1 569  ? -38.62500 8.49400   -50.90700 1.000 107.93461 ? 569  ASN A N     1 
ATOM   4161  C  CA    . ASN A 1 569  ? -38.93500 8.34600   -52.32400 1.000 105.13589 ? 569  ASN A CA    1 
ATOM   4162  C  C     . ASN A 1 569  ? -38.25300 9.43500   -53.14700 1.000 110.16478 ? 569  ASN A C     1 
ATOM   4163  O  O     . ASN A 1 569  ? -37.64000 9.15600   -54.17800 1.000 110.92580 ? 569  ASN A O     1 
ATOM   4164  C  CB    . ASN A 1 569  ? -40.44900 8.38700   -52.54300 1.000 107.11469 ? 569  ASN A CB    1 
ATOM   4165  C  CG    . ASN A 1 569  ? -40.87400 7.68000   -53.81500 1.000 117.86968 ? 569  ASN A CG    1 
ATOM   4166  O  OD1   . ASN A 1 569  ? -40.14100 7.66200   -54.80500 1.000 114.26890 ? 569  ASN A OD1   1 
ATOM   4167  N  ND2   . ASN A 1 569  ? -42.06400 7.09100   -53.79400 1.000 119.88335 ? 569  ASN A ND2   1 
ATOM   4168  N  N     . PRO A 1 572  ? -35.53400 12.00200  -56.90200 1.000 126.76895 ? 572  PRO A N     1 
ATOM   4169  C  CA    . PRO A 1 572  ? -35.65600 13.27500  -57.62000 1.000 126.99011 ? 572  PRO A CA    1 
ATOM   4170  C  C     . PRO A 1 572  ? -34.61700 13.43400  -58.72700 1.000 125.14848 ? 572  PRO A C     1 
ATOM   4171  O  O     . PRO A 1 572  ? -34.97300 13.43800  -59.90500 1.000 119.95056 ? 572  PRO A O     1 
ATOM   4172  C  CB    . PRO A 1 572  ? -35.44100 14.31300  -56.51700 1.000 124.75522 ? 572  PRO A CB    1 
ATOM   4173  C  CG    . PRO A 1 572  ? -35.94300 13.64400  -55.28700 1.000 124.90129 ? 572  PRO A CG    1 
ATOM   4174  C  CD    . PRO A 1 572  ? -35.59900 12.18400  -55.44100 1.000 128.92005 ? 572  PRO A CD    1 
ATOM   4175  N  N     . LYS A 1 573  ? -33.34500 13.56100  -58.34700 1.000 122.19586 ? 573  LYS A N     1 
ATOM   4176  C  CA    . LYS A 1 573  ? -32.25700 13.75000  -59.29600 1.000 119.30606 ? 573  LYS A CA    1 
ATOM   4177  C  C     . LYS A 1 573  ? -31.71000 12.43000  -59.83300 1.000 128.43806 ? 573  LYS A C     1 
ATOM   4178  O  O     . LYS A 1 573  ? -30.57000 12.38900  -60.31100 1.000 126.07828 ? 573  LYS A O     1 
ATOM   4179  C  CB    . LYS A 1 573  ? -31.13400 14.56400  -58.65000 1.000 121.01025 ? 573  LYS A CB    1 
ATOM   4180  C  CG    . LYS A 1 573  ? -30.43000 15.51900  -59.60200 1.000 121.06433 ? 573  LYS A CG    1 
ATOM   4181  C  CD    . LYS A 1 573  ? -29.50300 16.46400  -58.85300 1.000 114.28330 ? 573  LYS A CD    1 
ATOM   4182  C  CE    . LYS A 1 573  ? -28.96100 17.54800  -59.77100 1.000 105.26846 ? 573  LYS A CE    1 
ATOM   4183  N  NZ    . LYS A 1 573  ? -28.12900 18.53900  -59.03400 1.000 102.88237 ? 573  LYS A NZ    1 
ATOM   4184  N  N     . GLN A 1 574  ? -32.49400 11.35900  -59.76700 1.000 131.72361 ? 574  GLN A N     1 
ATOM   4185  C  CA    . GLN A 1 574  ? -32.09000 10.04600  -60.24300 1.000 122.80084 ? 574  GLN A CA    1 
ATOM   4186  C  C     . GLN A 1 574  ? -32.85100 9.70500   -61.51900 1.000 117.80655 ? 574  GLN A C     1 
ATOM   4187  O  O     . GLN A 1 574  ? -34.00400 10.11000  -61.69800 1.000 115.78939 ? 574  GLN A O     1 
ATOM   4188  C  CB    . GLN A 1 574  ? -32.34200 8.98000   -59.16700 1.000 121.15352 ? 574  GLN A CB    1 
ATOM   4189  C  CG    . GLN A 1 574  ? -32.01400 7.55400   -59.58000 1.000 114.25624 ? 574  GLN A CG    1 
ATOM   4190  C  CD    . GLN A 1 574  ? -32.38200 6.54200   -58.51200 1.000 103.51468 ? 574  GLN A CD    1 
ATOM   4191  O  OE1   . GLN A 1 574  ? -31.78200 6.51000   -57.43800 1.000 101.25383 ? 574  GLN A OE1   1 
ATOM   4192  N  NE2   . GLN A 1 574  ? -33.37500 5.71000   -58.80300 1.000 88.79302  ? 574  GLN A NE2   1 
ATOM   4193  N  N     . HIS A 1 575  ? -32.18800 8.97300   -62.41100 1.000 120.09880 ? 575  HIS A N     1 
ATOM   4194  C  CA    . HIS A 1 575  ? -32.82100 8.56600   -63.65600 1.000 120.82728 ? 575  HIS A CA    1 
ATOM   4195  C  C     . HIS A 1 575  ? -34.08000 7.75200   -63.36500 1.000 116.85491 ? 575  HIS A C     1 
ATOM   4196  O  O     . HIS A 1 575  ? -34.09000 6.93100   -62.44000 1.000 112.75588 ? 575  HIS A O     1 
ATOM   4197  C  CB    . HIS A 1 575  ? -31.85500 7.74000   -64.50900 1.000 121.97719 ? 575  HIS A CB    1 
ATOM   4198  C  CG    . HIS A 1 575  ? -30.75900 8.54300   -65.13700 1.000 137.20722 ? 575  HIS A CG    1 
ATOM   4199  N  ND1   . HIS A 1 575  ? -29.43000 8.36600   -64.81800 1.000 132.51171 ? 575  HIS A ND1   1 
ATOM   4200  C  CD2   . HIS A 1 575  ? -30.79500 9.52100   -66.07300 1.000 136.09105 ? 575  HIS A CD2   1 
ATOM   4201  C  CE1   . HIS A 1 575  ? -28.69400 9.20400   -65.52700 1.000 130.32818 ? 575  HIS A CE1   1 
ATOM   4202  N  NE2   . HIS A 1 575  ? -29.49800 9.91600   -66.29600 1.000 138.27847 ? 575  HIS A NE2   1 
ATOM   4203  N  N     . PRO A 1 576  ? -35.16000 7.95500   -64.12700 1.000 119.64616 ? 576  PRO A N     1 
ATOM   4204  C  CA    . PRO A 1 576  ? -36.38200 7.17200   -63.88400 1.000 118.22407 ? 576  PRO A CA    1 
ATOM   4205  C  C     . PRO A 1 576  ? -36.24600 5.70600   -64.25300 1.000 114.06607 ? 576  PRO A C     1 
ATOM   4206  O  O     . PRO A 1 576  ? -37.05500 4.89300   -63.79000 1.000 107.14116 ? 576  PRO A O     1 
ATOM   4207  C  CB    . PRO A 1 576  ? -37.42900 7.87500   -64.75700 1.000 116.86812 ? 576  PRO A CB    1 
ATOM   4208  C  CG    . PRO A 1 576  ? -36.63300 8.50000   -65.85400 1.000 123.54579 ? 576  PRO A CG    1 
ATOM   4209  C  CD    . PRO A 1 576  ? -35.32000 8.90700   -65.24000 1.000 120.77827 ? 576  PRO A CD    1 
ATOM   4210  N  N     . GLU A 1 577  ? -35.25900 5.34300   -65.06900 1.000 110.95055 ? 577  GLU A N     1 
ATOM   4211  C  CA    . GLU A 1 577  ? -34.99500 3.94900   -65.39800 1.000 101.87823 ? 577  GLU A CA    1 
ATOM   4212  C  C     . GLU A 1 577  ? -34.05200 3.28100   -64.40600 1.000 96.76143  ? 577  GLU A C     1 
ATOM   4213  O  O     . GLU A 1 577  ? -33.78500 2.08200   -64.54000 1.000 93.79219  ? 577  GLU A O     1 
ATOM   4214  C  CB    . GLU A 1 577  ? -34.42400 3.83400   -66.81600 1.000 106.09323 ? 577  GLU A CB    1 
ATOM   4215  C  CG    . GLU A 1 577  ? -35.31700 4.41900   -67.90100 1.000 108.14893 ? 577  GLU A CG    1 
ATOM   4216  C  CD    . GLU A 1 577  ? -35.11100 5.90800   -68.09400 1.000 119.31116 ? 577  GLU A CD    1 
ATOM   4217  O  OE1   . GLU A 1 577  ? -34.11500 6.44500   -67.56600 1.000 128.54809 ? 577  GLU A OE1   1 
ATOM   4218  O  OE2   . GLU A 1 577  ? -35.94700 6.54100   -68.77300 1.000 115.98487 ? 577  GLU A OE2   1 
ATOM   4219  N  N     . ASP A 1 578  ? -33.54100 4.02500   -63.42700 1.000 95.48370  ? 578  ASP A N     1 
ATOM   4220  C  CA    . ASP A 1 578  ? -32.72400 3.46500   -62.35800 1.000 91.29540  ? 578  ASP A CA    1 
ATOM   4221  C  C     . ASP A 1 578  ? -33.64900 2.84500   -61.31900 1.000 84.94598  ? 578  ASP A C     1 
ATOM   4222  O  O     . ASP A 1 578  ? -34.37200 3.56600   -60.62000 1.000 89.98700  ? 578  ASP A O     1 
ATOM   4223  C  CB    . ASP A 1 578  ? -31.84000 4.54500   -61.73000 1.000 94.38391  ? 578  ASP A CB    1 
ATOM   4224  C  CG    . ASP A 1 578  ? -30.74400 3.97100   -60.84700 1.000 84.77038  ? 578  ASP A CG    1 
ATOM   4225  O  OD1   . ASP A 1 578  ? -30.90200 2.84200   -60.33600 1.000 83.45680  ? 578  ASP A OD1   1 
ATOM   4226  O  OD2   . ASP A 1 578  ? -29.71700 4.65800   -60.66100 1.000 80.68031  ? 578  ASP A OD2   1 
ATOM   4227  N  N     . PRO A 1 579  ? -33.65900 1.51700   -61.18700 1.000 79.21850  ? 579  PRO A N     1 
ATOM   4228  C  CA    . PRO A 1 579  ? -34.62300 0.86200   -60.29600 1.000 71.46772  ? 579  PRO A CA    1 
ATOM   4229  C  C     . PRO A 1 579  ? -34.20100 0.80600   -58.83700 1.000 69.35360  ? 579  PRO A C     1 
ATOM   4230  O  O     . PRO A 1 579  ? -34.98400 0.33000   -58.00800 1.000 66.64281  ? 579  PRO A O     1 
ATOM   4231  C  CB    . PRO A 1 579  ? -34.70800 -0.54600  -60.88800 1.000 72.07832  ? 579  PRO A CB    1 
ATOM   4232  C  CG    . PRO A 1 579  ? -33.33600 -0.79100  -61.40400 1.000 77.32680  ? 579  PRO A CG    1 
ATOM   4233  C  CD    . PRO A 1 579  ? -32.84000 0.53800   -61.92400 1.000 80.09134  ? 579  PRO A CD    1 
ATOM   4234  N  N     . ILE A 1 580  ? -32.99600 1.26300   -58.49900 1.000 70.59232  ? 580  ILE A N     1 
ATOM   4235  C  CA    . ILE A 1 580  ? -32.54000 1.21700   -57.11600 1.000 67.07874  ? 580  ILE A CA    1 
ATOM   4236  C  C     . ILE A 1 580  ? -33.39400 2.15100   -56.27100 1.000 75.49658  ? 580  ILE A C     1 
ATOM   4237  O  O     . ILE A 1 580  ? -33.62700 3.31100   -56.63800 1.000 79.77712  ? 580  ILE A O     1 
ATOM   4238  C  CB    . ILE A 1 580  ? -31.05200 1.58500   -57.02700 1.000 70.48737  ? 580  ILE A CB    1 
ATOM   4239  C  CG1   . ILE A 1 580  ? -30.21800 0.65600   -57.91200 1.000 71.39821  ? 580  ILE A CG1   1 
ATOM   4240  C  CG2   . ILE A 1 580  ? -30.57100 1.52400   -55.58400 1.000 80.50760  ? 580  ILE A CG2   1 
ATOM   4241  C  CD1   . ILE A 1 580  ? -30.14500 -0.76900  -57.40900 1.000 70.74398  ? 580  ILE A CD1   1 
ATOM   4242  N  N     . GLY A 1 581  ? -33.87300 1.64700   -55.13500 1.000 74.88145  ? 581  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1 581  ? -34.69600 2.42200   -54.23400 1.000 73.29633  ? 581  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1 581  ? -36.18300 2.35800   -54.50200 1.000 73.36471  ? 581  GLY A C     1 
ATOM   4245  O  O     . GLY A 1 581  ? -36.96100 2.91200   -53.71400 1.000 74.92975  ? 581  GLY A O     1 
ATOM   4246  N  N     . HIS A 1 582  ? -36.61000 1.70000   -55.59200 1.000 68.33799  ? 582  HIS A N     1 
ATOM   4247  C  CA    . HIS A 1 582  ? -38.02700 1.58800   -55.89900 1.000 71.39831  ? 582  HIS A CA    1 
ATOM   4248  C  C     . HIS A 1 582  ? -38.60600 0.30100   -55.31800 1.000 75.99598  ? 582  HIS A C     1 
ATOM   4249  O  O     . HIS A 1 582  ? -37.90400 -0.70900  -55.20500 1.000 73.86329  ? 582  HIS A O     1 
ATOM   4250  C  CB    . HIS A 1 582  ? -38.25000 1.61000   -57.40900 1.000 72.50952  ? 582  HIS A CB    1 
ATOM   4251  C  CG    . HIS A 1 582  ? -38.06100 2.95900   -58.03000 1.000 77.54414  ? 582  HIS A CG    1 
ATOM   4252  N  ND1   . HIS A 1 582  ? -36.86200 3.36800   -58.57400 1.000 74.04990  ? 582  HIS A ND1   1 
ATOM   4253  C  CD2   . HIS A 1 582  ? -38.92000 3.99300   -58.19300 1.000 79.82450  ? 582  HIS A CD2   1 
ATOM   4254  C  CE1   . HIS A 1 582  ? -36.99100 4.59400   -59.04600 1.000 75.61802  ? 582  HIS A CE1   1 
ATOM   4255  N  NE2   . HIS A 1 582  ? -38.23000 4.99700   -58.82800 1.000 80.06195  ? 582  HIS A NE2   1 
ATOM   4256  N  N     . PRO A 1 583  ? -39.88600 0.31300   -54.93700 1.000 76.53949  ? 583  PRO A N     1 
ATOM   4257  C  CA    . PRO A 1 583  ? -40.53300 -0.91300  -54.42100 1.000 73.44521  ? 583  PRO A CA    1 
ATOM   4258  C  C     . PRO A 1 583  ? -40.88400 -1.89000  -55.53800 1.000 78.60637  ? 583  PRO A C     1 
ATOM   4259  O  O     . PRO A 1 583  ? -42.04300 -2.08100  -55.92200 1.000 79.49151  ? 583  PRO A O     1 
ATOM   4260  C  CB    . PRO A 1 583  ? -41.76900 -0.35300  -53.71000 1.000 71.86383  ? 583  PRO A CB    1 
ATOM   4261  C  CG    . PRO A 1 583  ? -42.10600 0.87600   -54.47700 1.000 72.39549  ? 583  PRO A CG    1 
ATOM   4262  C  CD    . PRO A 1 583  ? -40.79100 1.47600   -54.89600 1.000 78.06419  ? 583  PRO A CD    1 
ATOM   4263  N  N     . ILE A 1 584  ? -39.85600 -2.53600  -56.08000 1.000 75.97875  ? 584  ILE A N     1 
ATOM   4264  C  CA    . ILE A 1 584  ? -40.03300 -3.46300  -57.19100 1.000 71.02133  ? 584  ILE A CA    1 
ATOM   4265  C  C     . ILE A 1 584  ? -40.50400 -4.80900  -56.65900 1.000 73.82982  ? 584  ILE A C     1 
ATOM   4266  O  O     . ILE A 1 584  ? -39.98600 -5.31900  -55.65800 1.000 73.21103  ? 584  ILE A O     1 
ATOM   4267  C  CB    . ILE A 1 584  ? -38.72600 -3.60000  -57.99100 1.000 64.09000  ? 584  ILE A CB    1 
ATOM   4268  C  CG1   . ILE A 1 584  ? -38.28100 -2.23300  -58.51500 1.000 67.81618  ? 584  ILE A CG1   1 
ATOM   4269  C  CG2   . ILE A 1 584  ? -38.90200 -4.58500  -59.13500 1.000 67.32003  ? 584  ILE A CG2   1 
ATOM   4270  C  CD1   . ILE A 1 584  ? -39.30900 -1.54700  -59.38900 1.000 79.12955  ? 584  ILE A CD1   1 
ATOM   4271  N  N     . MET A 1 585  ? -41.49400 -5.38900  -57.33500 1.000 66.16081  ? 585  MET A N     1 
ATOM   4272  C  CA    . MET A 1 585  ? -42.06500 -6.65700  -56.90300 1.000 63.33018  ? 585  MET A CA    1 
ATOM   4273  C  C     . MET A 1 585  ? -41.06400 -7.79200  -57.08300 1.000 65.71889  ? 585  MET A C     1 
ATOM   4274  O  O     . MET A 1 585  ? -40.27000 -7.79700  -58.02900 1.000 66.11313  ? 585  MET A O     1 
ATOM   4275  C  CB    . MET A 1 585  ? -43.34200 -6.95400  -57.69000 1.000 59.78449  ? 585  MET A CB    1 
ATOM   4276  C  CG    . MET A 1 585  ? -43.99000 -8.29200  -57.36600 1.000 57.11229  ? 585  MET A CG    1 
ATOM   4277  S  SD    . MET A 1 585  ? -45.46200 -8.60100  -58.35500 1.000 67.06777  ? 585  MET A SD    1 
ATOM   4278  C  CE    . MET A 1 585  ? -44.81000 -8.35500  -60.00500 1.000 69.70665  ? 585  MET A CE    1 
ATOM   4279  N  N     . HIS A 1 586  ? -41.10200 -8.74800  -56.15400 1.000 61.69664  ? 586  HIS A N     1 
ATOM   4280  C  CA    . HIS A 1 586  ? -40.30800 -9.96500  -56.26200 1.000 56.51847  ? 586  HIS A CA    1 
ATOM   4281  C  C     . HIS A 1 586  ? -40.51300 -10.61300 -57.62600 1.000 60.13738  ? 586  HIS A C     1 
ATOM   4282  O  O     . HIS A 1 586  ? -41.64600 -10.75500 -58.09300 1.000 65.08538  ? 586  HIS A O     1 
ATOM   4283  C  CB    . HIS A 1 586  ? -40.70200 -10.93200 -55.14300 1.000 54.78991  ? 586  HIS A CB    1 
ATOM   4284  C  CG    . HIS A 1 586  ? -39.75300 -12.07500 -54.95900 1.000 61.41658  ? 586  HIS A CG    1 
ATOM   4285  N  ND1   . HIS A 1 586  ? -39.71600 -13.15800 -55.81100 1.000 66.84580  ? 586  HIS A ND1   1 
ATOM   4286  C  CD2   . HIS A 1 586  ? -38.81500 -12.31000 -54.01200 1.000 61.83045  ? 586  HIS A CD2   1 
ATOM   4287  C  CE1   . HIS A 1 586  ? -38.79200 -14.00700 -55.40000 1.000 69.01096  ? 586  HIS A CE1   1 
ATOM   4288  N  NE2   . HIS A 1 586  ? -38.23000 -13.51700 -54.31000 1.000 61.51309  ? 586  HIS A NE2   1 
ATOM   4289  N  N     . LEU A 1 587  ? -39.40300 -10.99600 -58.26400 1.000 57.51872  ? 587  LEU A N     1 
ATOM   4290  C  CA    . LEU A 1 587  ? -39.46400 -11.49200 -59.63700 1.000 55.20036  ? 587  LEU A CA    1 
ATOM   4291  C  C     . LEU A 1 587  ? -40.35800 -12.72000 -59.75100 1.000 62.83090  ? 587  LEU A C     1 
ATOM   4292  O  O     . LEU A 1 587  ? -41.16300 -12.82600 -60.68400 1.000 64.67692  ? 587  LEU A O     1 
ATOM   4293  C  CB    . LEU A 1 587  ? -38.05800 -11.80800 -60.14100 1.000 54.46267  ? 587  LEU A CB    1 
ATOM   4294  C  CG    . LEU A 1 587  ? -37.04600 -10.66700 -60.05300 1.000 61.11562  ? 587  LEU A CG    1 
ATOM   4295  C  CD1   . LEU A 1 587  ? -35.68100 -11.15900 -60.48400 1.000 61.13685  ? 587  LEU A CD1   1 
ATOM   4296  C  CD2   . LEU A 1 587  ? -37.48900 -9.48500  -60.90100 1.000 62.56517  ? 587  LEU A CD2   1 
ATOM   4297  N  N     . SER A 1 588  ? -40.23200 -13.65700 -58.81500 1.000 63.61720  ? 588  SER A N     1 
ATOM   4298  C  CA    . SER A 1 588  ? -41.07500 -14.84300 -58.79200 1.000 64.78423  ? 588  SER A CA    1 
ATOM   4299  C  C     . SER A 1 588  ? -42.42000 -14.59700 -58.11900 1.000 67.10526  ? 588  SER A C     1 
ATOM   4300  O  O     . SER A 1 588  ? -43.11700 -15.56400 -57.78900 1.000 65.93463  ? 588  SER A O     1 
ATOM   4301  C  CB    . SER A 1 588  ? -40.34300 -15.99500 -58.09800 1.000 67.59596  ? 588  SER A CB    1 
ATOM   4302  O  OG    . SER A 1 588  ? -39.14100 -16.31600 -58.77600 1.000 81.65707  ? 588  SER A OG    1 
ATOM   4303  N  N     . GLY A 1 589  ? -42.79600 -13.33400 -57.92200 1.000 65.20196  ? 589  GLY A N     1 
ATOM   4304  C  CA    . GLY A 1 589  ? -44.01900 -12.97900 -57.22700 1.000 62.79022  ? 589  GLY A CA    1 
ATOM   4305  C  C     . GLY A 1 589  ? -45.27500 -13.59100 -57.81100 1.000 58.17524  ? 589  GLY A C     1 
ATOM   4306  O  O     . GLY A 1 589  ? -45.96600 -14.35800 -57.13300 1.000 57.07796  ? 589  GLY A O     1 
ATOM   4307  N  N     . VAL A 1 590  ? -45.58600 -13.26000 -59.06700 1.000 57.87370  ? 590  VAL A N     1 
ATOM   4308  C  CA    . VAL A 1 590  ? -46.76100 -13.84300 -59.70900 1.000 59.59502  ? 590  VAL A CA    1 
ATOM   4309  C  C     . VAL A 1 590  ? -46.58400 -15.34500 -59.89000 1.000 60.47985  ? 590  VAL A C     1 
ATOM   4310  O  O     . VAL A 1 590  ? -47.56800 -16.09600 -59.90600 1.000 59.52805  ? 590  VAL A O     1 
ATOM   4311  C  CB    . VAL A 1 590  ? -47.05300 -13.13600 -61.04900 1.000 51.32094  ? 590  VAL A CB    1 
ATOM   4312  C  CG1   . VAL A 1 590  ? -47.30800 -11.65400 -60.82000 1.000 43.88856  ? 590  VAL A CG1   1 
ATOM   4313  C  CG2   . VAL A 1 590  ? -45.90400 -13.33400 -62.02700 1.000 69.76009  ? 590  VAL A CG2   1 
ATOM   4314  N  N     . LYS A 1 591  ? -45.33900 -15.81100 -60.02100 1.000 58.79989  ? 591  LYS A N     1 
ATOM   4315  C  CA    . LYS A 1 591  ? -45.09500 -17.24800 -60.08000 1.000 54.88970  ? 591  LYS A CA    1 
ATOM   4316  C  C     . LYS A 1 591  ? -45.43900 -17.91500 -58.75400 1.000 60.93881  ? 591  LYS A C     1 
ATOM   4317  O  O     . LYS A 1 591  ? -45.92100 -19.05400 -58.73300 1.000 65.22148  ? 591  LYS A O     1 
ATOM   4318  C  CB    . LYS A 1 591  ? -43.64200 -17.52400 -60.46700 1.000 61.03805  ? 591  LYS A CB    1 
ATOM   4319  C  CG    . LYS A 1 591  ? -43.34100 -17.29800 -61.94200 1.000 63.40943  ? 591  LYS A CG    1 
ATOM   4320  C  CD    . LYS A 1 591  ? -41.99300 -17.88700 -62.33200 1.000 61.12449  ? 591  LYS A CD    1 
ATOM   4321  C  CE    . LYS A 1 591  ? -40.84100 -17.07800 -61.75800 1.000 62.87931  ? 591  LYS A CE    1 
ATOM   4322  N  NZ    . LYS A 1 591  ? -40.72800 -15.74000 -62.40200 1.000 64.40233  ? 591  LYS A NZ    1 
ATOM   4323  N  N     . HIS A 1 592  ? -45.19600 -17.22300 -57.63600 1.000 61.96380  ? 592  HIS A N     1 
ATOM   4324  C  CA    . HIS A 1 592  ? -45.67700 -17.71900 -56.35100 1.000 57.05235  ? 592  HIS A CA    1 
ATOM   4325  C  C     . HIS A 1 592  ? -47.19800 -17.74600 -56.30600 1.000 57.25452  ? 592  HIS A C     1 
ATOM   4326  O  O     . HIS A 1 592  ? -47.78700 -18.63700 -55.68400 1.000 55.93475  ? 592  HIS A O     1 
ATOM   4327  C  CB    . HIS A 1 592  ? -45.14700 -16.85600 -55.20300 1.000 57.72934  ? 592  HIS A CB    1 
ATOM   4328  C  CG    . HIS A 1 592  ? -43.65500 -16.85100 -55.07700 1.000 60.16893  ? 592  HIS A CG    1 
ATOM   4329  N  ND1   . HIS A 1 592  ? -42.89700 -18.00000 -55.13900 1.000 62.50849  ? 592  HIS A ND1   1 
ATOM   4330  C  CD2   . HIS A 1 592  ? -42.78300 -15.83700 -54.86300 1.000 58.03985  ? 592  HIS A CD2   1 
ATOM   4331  C  CE1   . HIS A 1 592  ? -41.62100 -17.69200 -54.98700 1.000 62.65806  ? 592  HIS A CE1   1 
ATOM   4332  N  NE2   . HIS A 1 592  ? -41.52500 -16.38600 -54.81800 1.000 60.45152  ? 592  HIS A NE2   1 
ATOM   4333  N  N     . ALA A 1 593  ? -47.84900 -16.78400 -56.96400 1.000 57.46805  ? 593  ALA A N     1 
ATOM   4334  C  CA    . ALA A 1 593  ? -49.29600 -16.64800 -56.88700 1.000 56.39407  ? 593  ALA A CA    1 
ATOM   4335  C  C     . ALA A 1 593  ? -50.03800 -17.60600 -57.80800 1.000 59.76147  ? 593  ALA A C     1 
ATOM   4336  O  O     . ALA A 1 593  ? -51.21100 -17.90000 -57.55300 1.000 67.13816  ? 593  ALA A O     1 
ATOM   4337  C  CB    . ALA A 1 593  ? -49.70400 -15.21000 -57.21000 1.000 52.70319  ? 593  ALA A CB    1 
ATOM   4338  N  N     . THR A 1 594  ? -49.39400 -18.09300 -58.86700 1.000 52.16805  ? 594  THR A N     1 
ATOM   4339  C  CA    . THR A 1 594  ? -50.02900 -18.99900 -59.81400 1.000 55.09853  ? 594  THR A CA    1 
ATOM   4340  C  C     . THR A 1 594  ? -49.57700 -20.44300 -59.64800 1.000 52.45578  ? 594  THR A C     1 
ATOM   4341  O  O     . THR A 1 594  ? -50.01900 -21.30700 -60.41300 1.000 60.33054  ? 594  THR A O     1 
ATOM   4342  C  CB    . THR A 1 594  ? -49.75700 -18.54200 -61.25100 1.000 58.12177  ? 594  THR A CB    1 
ATOM   4343  O  OG1   . THR A 1 594  ? -48.34600 -18.54500 -61.49700 1.000 59.78012  ? 594  THR A OG1   1 
ATOM   4344  C  CG2   . THR A 1 594  ? -50.29900 -17.14000 -61.47400 1.000 50.96759  ? 594  THR A CG2   1 
ATOM   4345  N  N     . GLY A 1 595  ? -48.71600 -20.72600 -58.67400 1.000 48.06943  ? 595  GLY A N     1 
ATOM   4346  C  CA    . GLY A 1 595  ? -48.19300 -22.06000 -58.47900 1.000 48.41316  ? 595  GLY A CA    1 
ATOM   4347  C  C     . GLY A 1 595  ? -47.15000 -22.49300 -59.48400 1.000 58.19821  ? 595  GLY A C     1 
ATOM   4348  O  O     . GLY A 1 595  ? -46.65800 -23.62500 -59.39100 1.000 69.68669  ? 595  GLY A O     1 
ATOM   4349  N  N     . GLU A 1 596  ? -46.79400 -21.63500 -60.44100 1.000 57.33000  ? 596  GLU A N     1 
ATOM   4350  C  CA    . GLU A 1 596  ? -45.80000 -21.98000 -61.44900 1.000 58.95605  ? 596  GLU A CA    1 
ATOM   4351  C  C     . GLU A 1 596  ? -44.37500 -21.95800 -60.91400 1.000 60.91676  ? 596  GLU A C     1 
ATOM   4352  O  O     . GLU A 1 596  ? -43.47100 -22.45200 -61.59700 1.000 65.24027  ? 596  GLU A O     1 
ATOM   4353  C  CB    . GLU A 1 596  ? -45.90900 -21.03200 -62.64400 1.000 61.42129  ? 596  GLU A CB    1 
ATOM   4354  C  CG    . GLU A 1 596  ? -47.27300 -21.02400 -63.30600 1.000 63.45465  ? 596  GLU A CG    1 
ATOM   4355  C  CD    . GLU A 1 596  ? -47.39100 -19.95300 -64.37100 1.000 68.76598  ? 596  GLU A CD    1 
ATOM   4356  O  OE1   . GLU A 1 596  ? -46.80100 -20.12700 -65.45800 1.000 69.70981  ? 596  GLU A OE1   1 
ATOM   4357  O  OE2   . GLU A 1 596  ? -48.07500 -18.93900 -64.12000 1.000 63.68337  ? 596  GLU A OE2   1 
ATOM   4358  N  N     . ALA A 1 597  ? -44.15000 -21.39800 -59.72900 1.000 55.52750  ? 597  ALA A N     1 
ATOM   4359  C  CA    . ALA A 1 597  ? -42.82500 -21.41300 -59.12000 1.000 56.06589  ? 597  ALA A CA    1 
ATOM   4360  C  C     . ALA A 1 597  ? -42.46700 -22.84500 -58.74100 1.000 58.77933  ? 597  ALA A C     1 
ATOM   4361  O  O     . ALA A 1 597  ? -43.08900 -23.43400 -57.85100 1.000 61.20909  ? 597  ALA A O     1 
ATOM   4362  C  CB    . ALA A 1 597  ? -42.78800 -20.49600 -57.90300 1.000 54.53798  ? 597  ALA A CB    1 
ATOM   4363  N  N     . ILE A 1 598  ? -41.47400 -23.41000 -59.41800 1.000 53.00818  ? 598  ILE A N     1 
ATOM   4364  C  CA    . ILE A 1 598  ? -41.06300 -24.78800 -59.17200 1.000 50.85732  ? 598  ILE A CA    1 
ATOM   4365  C  C     . ILE A 1 598  ? -40.14300 -24.82000 -57.95900 1.000 51.87735  ? 598  ILE A C     1 
ATOM   4366  O  O     . ILE A 1 598  ? -39.04500 -24.25400 -57.98400 1.000 51.45089  ? 598  ILE A O     1 
ATOM   4367  C  CB    . ILE A 1 598  ? -40.36900 -25.38900 -60.40200 1.000 53.46479  ? 598  ILE A CB    1 
ATOM   4368  C  CG1   . ILE A 1 598  ? -41.35300 -25.51400 -61.56700 1.000 54.26134  ? 598  ILE A CG1   1 
ATOM   4369  C  CG2   . ILE A 1 598  ? -39.75700 -26.74000 -60.06200 1.000 53.41406  ? 598  ILE A CG2   1 
ATOM   4370  C  CD1   . ILE A 1 598  ? -42.35900 -26.63300 -61.39900 1.000 64.74436  ? 598  ILE A CD1   1 
ATOM   4371  N  N     . TYR A 1 599  ? -40.59100 -25.47700 -56.89400 1.000 59.34287  ? 599  TYR A N     1 
ATOM   4372  C  CA    . TYR A 1 599  ? -39.73400 -25.74800 -55.75300 1.000 54.77483  ? 599  TYR A CA    1 
ATOM   4373  C  C     . TYR A 1 599  ? -39.07800 -27.11600 -55.93300 1.000 56.82453  ? 599  TYR A C     1 
ATOM   4374  O  O     . TYR A 1 599  ? -39.23200 -27.77200 -56.96600 1.000 55.29605  ? 599  TYR A O     1 
ATOM   4375  C  CB    . TYR A 1 599  ? -40.53100 -25.64500 -54.45300 1.000 54.32092  ? 599  TYR A CB    1 
ATOM   4376  C  CG    . TYR A 1 599  ? -40.99800 -24.23600 -54.16100 1.000 53.65669  ? 599  TYR A CG    1 
ATOM   4377  C  CD1   . TYR A 1 599  ? -42.20200 -23.76500 -54.66400 1.000 56.75315  ? 599  TYR A CD1   1 
ATOM   4378  C  CD2   . TYR A 1 599  ? -40.22700 -23.37300 -53.39500 1.000 53.65574  ? 599  TYR A CD2   1 
ATOM   4379  C  CE1   . TYR A 1 599  ? -42.63000 -22.47800 -54.40700 1.000 53.53047  ? 599  TYR A CE1   1 
ATOM   4380  C  CE2   . TYR A 1 599  ? -40.64700 -22.08400 -53.13100 1.000 52.60022  ? 599  TYR A CE2   1 
ATOM   4381  C  CZ    . TYR A 1 599  ? -41.84800 -21.64200 -53.64000 1.000 51.55305  ? 599  TYR A CZ    1 
ATOM   4382  O  OH    . TYR A 1 599  ? -42.26900 -20.36000 -53.38300 1.000 53.29404  ? 599  TYR A OH    1 
ATOM   4383  N  N     . CYS A 1 600  ? -38.33000 -27.55600 -54.91900 1.000 62.40489  ? 600  CYS A N     1 
ATOM   4384  C  CA    . CYS A 1 600  ? -37.49600 -28.74500 -55.07400 1.000 59.65475  ? 600  CYS A CA    1 
ATOM   4385  C  C     . CYS A 1 600  ? -38.34100 -29.98800 -55.33200 1.000 56.68141  ? 600  CYS A C     1 
ATOM   4386  O  O     . CYS A 1 600  ? -38.14600 -30.69100 -56.33000 1.000 58.33223  ? 600  CYS A O     1 
ATOM   4387  C  CB    . CYS A 1 600  ? -36.61500 -28.93500 -53.84000 1.000 61.91797  ? 600  CYS A CB    1 
ATOM   4388  S  SG    . CYS A 1 600  ? -35.32300 -30.17200 -54.06300 1.000 77.28904  ? 600  CYS A SG    1 
ATOM   4389  N  N     . ASP A 1 601  ? -39.28900 -30.27900 -54.43900 1.000 57.69347  ? 601  ASP A N     1 
ATOM   4390  C  CA    . ASP A 1 601  ? -40.16400 -31.42600 -54.64800 1.000 56.05185  ? 601  ASP A CA    1 
ATOM   4391  C  C     . ASP A 1 601  ? -41.13700 -31.21200 -55.80200 1.000 56.71225  ? 601  ASP A C     1 
ATOM   4392  O  O     . ASP A 1 601  ? -41.75900 -32.17900 -56.25400 1.000 59.08555  ? 601  ASP A O     1 
ATOM   4393  C  CB    . ASP A 1 601  ? -40.93100 -31.74700 -53.36300 1.000 60.43837  ? 601  ASP A CB    1 
ATOM   4394  C  CG    . ASP A 1 601  ? -41.69300 -33.05700 -53.44900 1.000 66.27155  ? 601  ASP A CG    1 
ATOM   4395  O  OD1   . ASP A 1 601  ? -41.05400 -34.10200 -53.69800 1.000 63.67456  ? 601  ASP A OD1   1 
ATOM   4396  O  OD2   . ASP A 1 601  ? -42.92900 -33.04400 -53.26900 1.000 66.52849  ? 601  ASP A OD2   1 
ATOM   4397  N  N     . ASP A 1 602  ? -41.27400 -29.97900 -56.29300 1.000 56.98745  ? 602  ASP A N     1 
ATOM   4398  C  CA    . ASP A 1 602  ? -42.10200 -29.71700 -57.46200 1.000 52.42251  ? 602  ASP A CA    1 
ATOM   4399  C  C     . ASP A 1 602  ? -41.45900 -30.19200 -58.75700 1.000 54.97860  ? 602  ASP A C     1 
ATOM   4400  O  O     . ASP A 1 602  ? -42.11500 -30.14700 -59.80300 1.000 66.38216  ? 602  ASP A O     1 
ATOM   4401  C  CB    . ASP A 1 602  ? -42.40700 -28.22300 -57.57000 1.000 60.93383  ? 602  ASP A CB    1 
ATOM   4402  C  CG    . ASP A 1 602  ? -43.30400 -27.73000 -56.45900 1.000 59.53851  ? 602  ASP A CG    1 
ATOM   4403  O  OD1   . ASP A 1 602  ? -43.62700 -28.52600 -55.55200 1.000 63.25665  ? 602  ASP A OD1   1 
ATOM   4404  O  OD2   . ASP A 1 602  ? -43.68800 -26.54300 -56.49400 1.000 61.97638  ? 602  ASP A OD2   1 
ATOM   4405  N  N     . MET A 1 603  ? -40.20400 -30.63000 -58.71600 1.000 49.64873  ? 603  MET A N     1 
ATOM   4406  C  CA    . MET A 1 603  ? -39.54600 -31.09800 -59.92500 1.000 53.71523  ? 603  MET A CA    1 
ATOM   4407  C  C     . MET A 1 603  ? -40.20200 -32.38900 -60.40900 1.000 56.87368  ? 603  MET A C     1 
ATOM   4408  O  O     . MET A 1 603  ? -40.54900 -33.25200 -59.59500 1.000 55.99681  ? 603  MET A O     1 
ATOM   4409  C  CB    . MET A 1 603  ? -38.05700 -31.33100 -59.67400 1.000 48.42487  ? 603  MET A CB    1 
ATOM   4410  C  CG    . MET A 1 603  ? -37.23600 -30.05600 -59.59400 1.000 56.16564  ? 603  MET A CG    1 
ATOM   4411  S  SD    . MET A 1 603  ? -35.52100 -30.36400 -59.13700 1.000 51.19737  ? 603  MET A SD    1 
ATOM   4412  C  CE    . MET A 1 603  ? -35.03000 -31.50400 -60.42900 1.000 66.31286  ? 603  MET A CE    1 
ATOM   4413  N  N     . PRO A 1 604  ? -40.38900 -32.54800 -61.71800 1.000 46.97316  ? 604  PRO A N     1 
ATOM   4414  C  CA    . PRO A 1 604  ? -41.05900 -33.75000 -62.22800 1.000 46.64364  ? 604  PRO A CA    1 
ATOM   4415  C  C     . PRO A 1 604  ? -40.30800 -35.01600 -61.84600 1.000 46.78807  ? 604  PRO A C     1 
ATOM   4416  O  O     . PRO A 1 604  ? -39.07700 -35.03600 -61.78000 1.000 55.85030  ? 604  PRO A O     1 
ATOM   4417  C  CB    . PRO A 1 604  ? -41.06600 -33.53500 -63.74600 1.000 51.10829  ? 604  PRO A CB    1 
ATOM   4418  C  CG    . PRO A 1 604  ? -40.93400 -32.05400 -63.91800 1.000 57.01335  ? 604  PRO A CG    1 
ATOM   4419  C  CD    . PRO A 1 604  ? -40.04900 -31.60500 -62.79600 1.000 44.86330  ? 604  PRO A CD    1 
ATOM   4420  N  N     . LEU A 1 605  ? -41.06900 -36.07500 -61.58400 1.000 51.58613  ? 605  LEU A N     1 
ATOM   4421  C  CA    . LEU A 1 605  ? -40.48400 -37.36000 -61.22700 1.000 55.01520  ? 605  LEU A CA    1 
ATOM   4422  C  C     . LEU A 1 605  ? -39.62500 -37.88300 -62.37000 1.000 55.90145  ? 605  LEU A C     1 
ATOM   4423  O  O     . LEU A 1 605  ? -40.11800 -38.09900 -63.48200 1.000 60.16790  ? 605  LEU A O     1 
ATOM   4424  C  CB    . LEU A 1 605  ? -41.59200 -38.35500 -60.88000 1.000 55.01929  ? 605  LEU A CB    1 
ATOM   4425  C  CG    . LEU A 1 605  ? -41.23100 -39.83500 -60.75100 1.000 58.35246  ? 605  LEU A CG    1 
ATOM   4426  C  CD1   . LEU A 1 605  ? -41.88300 -40.42800 -59.51400 1.000 67.12911  ? 605  LEU A CD1   1 
ATOM   4427  C  CD2   . LEU A 1 605  ? -41.66300 -40.60100 -61.99300 1.000 50.71449  ? 605  LEU A CD2   1 
ATOM   4428  N  N     . VAL A 1 606  ? -38.33600 -38.08000 -62.09900 1.000 52.03726  ? 606  VAL A N     1 
ATOM   4429  C  CA    . VAL A 1 606  ? -37.42700 -38.56500 -63.12800 1.000 53.27368  ? 606  VAL A CA    1 
ATOM   4430  C  C     . VAL A 1 606  ? -37.55900 -40.07900 -63.26200 1.000 54.48949  ? 606  VAL A C     1 
ATOM   4431  O  O     . VAL A 1 606  ? -38.10900 -40.76600 -62.39600 1.000 50.43173  ? 606  VAL A O     1 
ATOM   4432  C  CB    . VAL A 1 606  ? -35.97600 -38.14900 -62.83200 1.000 44.44169  ? 606  VAL A CB    1 
ATOM   4433  C  CG1   . VAL A 1 606  ? -35.92000 -36.69000 -62.39900 1.000 46.56053  ? 606  VAL A CG1   1 
ATOM   4434  C  CG2   . VAL A 1 606  ? -35.37500 -39.04500 -61.77700 1.000 37.88111  ? 606  VAL A CG2   1 
ATOM   4435  N  N     . ASP A 1 607  ? -37.03500 -40.60000 -64.36900 1.000 54.94495  ? 607  ASP A N     1 
ATOM   4436  C  CA    . ASP A 1 607  ? -37.27900 -41.98700 -64.74600 1.000 52.81001  ? 607  ASP A CA    1 
ATOM   4437  C  C     . ASP A 1 607  ? -36.69100 -42.95300 -63.72300 1.000 51.96562  ? 607  ASP A C     1 
ATOM   4438  O  O     . ASP A 1 607  ? -35.50400 -42.88200 -63.39000 1.000 59.36416  ? 607  ASP A O     1 
ATOM   4439  C  CB    . ASP A 1 607  ? -36.69100 -42.25800 -66.13100 1.000 56.11181  ? 607  ASP A CB    1 
ATOM   4440  C  CG    . ASP A 1 607  ? -36.89500 -43.68900 -66.58400 1.000 58.99748  ? 607  ASP A CG    1 
ATOM   4441  O  OD1   . ASP A 1 607  ? -38.06300 -44.12000 -66.68500 1.000 52.97983  ? 607  ASP A OD1   1 
ATOM   4442  O  OD2   . ASP A 1 607  ? -35.88800 -44.38000 -66.84500 1.000 66.84980  ? 607  ASP A OD2   1 
ATOM   4443  N  N     . GLN A 1 608  ? -37.54100 -43.85400 -63.22200 1.000 53.28120  ? 608  GLN A N     1 
ATOM   4444  C  CA    . GLN A 1 608  ? -37.16000 -44.94200 -62.32000 1.000 54.67212  ? 608  GLN A CA    1 
ATOM   4445  C  C     . GLN A 1 608  ? -36.62200 -44.44900 -60.98100 1.000 51.64526  ? 608  GLN A C     1 
ATOM   4446  O  O     . GLN A 1 608  ? -35.87100 -45.16800 -60.31400 1.000 47.93305  ? 608  GLN A O     1 
ATOM   4447  C  CB    . GLN A 1 608  ? -36.13200 -45.87600 -62.97000 1.000 51.18460  ? 608  GLN A CB    1 
ATOM   4448  C  CG    . GLN A 1 608  ? -36.68300 -46.78400 -64.05000 1.000 57.60252  ? 608  GLN A CG    1 
ATOM   4449  C  CD    . GLN A 1 608  ? -35.61900 -47.69700 -64.62600 1.000 63.54993  ? 608  GLN A CD    1 
ATOM   4450  O  OE1   . GLN A 1 608  ? -34.45600 -47.31100 -64.75200 1.000 63.09810  ? 608  GLN A OE1   1 
ATOM   4451  N  NE2   . GLN A 1 608  ? -36.01000 -48.91800 -64.97100 1.000 67.27809  ? 608  GLN A NE2   1 
ATOM   4452  N  N     . GLU A 1 609  ? -36.98900 -43.24300 -60.55600 1.000 51.58623  ? 609  GLU A N     1 
ATOM   4453  C  CA    . GLU A 1 609  ? -36.43200 -42.71200 -59.32100 1.000 51.33093  ? 609  GLU A CA    1 
ATOM   4454  C  C     . GLU A 1 609  ? -36.98500 -43.45500 -58.11000 1.000 51.69800  ? 609  GLU A C     1 
ATOM   4455  O  O     . GLU A 1 609  ? -38.12000 -43.94300 -58.11000 1.000 54.49198  ? 609  GLU A O     1 
ATOM   4456  C  CB    . GLU A 1 609  ? -36.71400 -41.21300 -59.19400 1.000 51.75409  ? 609  GLU A CB    1 
ATOM   4457  C  CG    . GLU A 1 609  ? -38.11600 -40.85700 -58.73200 1.000 56.91261  ? 609  GLU A CG    1 
ATOM   4458  C  CD    . GLU A 1 609  ? -38.28800 -39.36700 -58.51200 1.000 65.36154  ? 609  GLU A CD    1 
ATOM   4459  O  OE1   . GLU A 1 609  ? -37.60100 -38.58000 -59.19800 1.000 64.43689  ? 609  GLU A OE1   1 
ATOM   4460  O  OE2   . GLU A 1 609  ? -39.10400 -38.98200 -57.64900 1.000 65.82299  ? 609  GLU A OE2   1 
ATOM   4461  N  N     . LEU A 1 610  ? -36.15800 -43.55000 -57.07500 1.000 49.18766  ? 610  LEU A N     1 
ATOM   4462  C  CA    . LEU A 1 610  ? -36.51400 -44.20100 -55.82500 1.000 52.17215  ? 610  LEU A CA    1 
ATOM   4463  C  C     . LEU A 1 610  ? -36.68600 -43.15900 -54.72700 1.000 54.94787  ? 610  LEU A C     1 
ATOM   4464  O  O     . LEU A 1 610  ? -36.14400 -42.05300 -54.79700 1.000 52.53456  ? 610  LEU A O     1 
ATOM   4465  C  CB    . LEU A 1 610  ? -35.44500 -45.22200 -55.41500 1.000 51.59266  ? 610  LEU A CB    1 
ATOM   4466  C  CG    . LEU A 1 610  ? -35.13900 -46.34700 -56.40700 1.000 56.99283  ? 610  LEU A CG    1 
ATOM   4467  C  CD1   . LEU A 1 610  ? -33.95100 -47.17300 -55.93300 1.000 48.01946  ? 610  LEU A CD1   1 
ATOM   4468  C  CD2   . LEU A 1 610  ? -36.35900 -47.22900 -56.61400 1.000 55.04517  ? 610  LEU A CD2   1 
ATOM   4469  N  N     . PHE A 1 611  ? -37.45200 -43.52400 -53.70400 1.000 49.41076  ? 611  PHE A N     1 
ATOM   4470  C  CA    . PHE A 1 611  ? -37.68900 -42.65900 -52.55900 1.000 45.81585  ? 611  PHE A CA    1 
ATOM   4471  C  C     . PHE A 1 611  ? -36.95400 -43.20400 -51.34300 1.000 49.74961  ? 611  PHE A C     1 
ATOM   4472  O  O     . PHE A 1 611  ? -36.86100 -44.42200 -51.15600 1.000 54.99337  ? 611  PHE A O     1 
ATOM   4473  C  CB    . PHE A 1 611  ? -39.18500 -42.53600 -52.25600 1.000 56.59231  ? 611  PHE A CB    1 
ATOM   4474  C  CG    . PHE A 1 611  ? -39.52500 -41.39200 -51.34300 1.000 52.45626  ? 611  PHE A CG    1 
ATOM   4475  C  CD1   . PHE A 1 611  ? -39.80600 -40.13700 -51.86000 1.000 49.53217  ? 611  PHE A CD1   1 
ATOM   4476  C  CD2   . PHE A 1 611  ? -39.56000 -41.56800 -49.97000 1.000 54.51173  ? 611  PHE A CD2   1 
ATOM   4477  C  CE1   . PHE A 1 611  ? -40.11700 -39.08100 -51.02500 1.000 48.97986  ? 611  PHE A CE1   1 
ATOM   4478  C  CE2   . PHE A 1 611  ? -39.87000 -40.51600 -49.12800 1.000 58.62175  ? 611  PHE A CE2   1 
ATOM   4479  C  CZ    . PHE A 1 611  ? -40.14900 -39.27000 -49.65700 1.000 57.89324  ? 611  PHE A CZ    1 
ATOM   4480  N  N     . LEU A 1 612  ? -36.43300 -42.29900 -50.51900 1.000 50.05224  ? 612  LEU A N     1 
ATOM   4481  C  CA    . LEU A 1 612  ? -35.67200 -42.66300 -49.33100 1.000 49.91584  ? 612  LEU A CA    1 
ATOM   4482  C  C     . LEU A 1 612  ? -36.32600 -42.04800 -48.10400 1.000 53.29831  ? 612  LEU A C     1 
ATOM   4483  O  O     . LEU A 1 612  ? -36.52400 -40.82900 -48.04600 1.000 55.34399  ? 612  LEU A O     1 
ATOM   4484  C  CB    . LEU A 1 612  ? -34.21800 -42.20200 -49.44100 1.000 55.28356  ? 612  LEU A CB    1 
ATOM   4485  C  CG    . LEU A 1 612  ? -33.32700 -42.59700 -48.26100 1.000 57.70737  ? 612  LEU A CG    1 
ATOM   4486  C  CD1   . LEU A 1 612  ? -32.63300 -43.92400 -48.52700 1.000 54.65473  ? 612  LEU A CD1   1 
ATOM   4487  C  CD2   . LEU A 1 612  ? -32.31100 -41.50600 -47.95800 1.000 59.49058  ? 612  LEU A CD2   1 
ATOM   4488  N  N     . THR A 1 613  ? -36.66100 -42.89000 -47.13200 1.000 56.45996  ? 613  THR A N     1 
ATOM   4489  C  CA    . THR A 1 613  ? -37.13400 -42.45100 -45.83100 1.000 53.21365  ? 613  THR A CA    1 
ATOM   4490  C  C     . THR A 1 613  ? -36.19000 -42.97600 -44.75800 1.000 52.45530  ? 613  THR A C     1 
ATOM   4491  O  O     . THR A 1 613  ? -35.44100 -43.93300 -44.97400 1.000 59.66541  ? 613  THR A O     1 
ATOM   4492  C  CB    . THR A 1 613  ? -38.56600 -42.93000 -45.55300 1.000 57.05900  ? 613  THR A CB    1 
ATOM   4493  O  OG1   . THR A 1 613  ? -39.04700 -42.32800 -44.34400 1.000 71.83437  ? 613  THR A OG1   1 
ATOM   4494  C  CG2   . THR A 1 613  ? -38.60300 -44.44100 -45.40100 1.000 52.72153  ? 613  THR A CG2   1 
ATOM   4495  N  N     . PHE A 1 614  ? -36.22700 -42.33500 -43.59600 1.000 56.81766  ? 614  PHE A N     1 
ATOM   4496  C  CA    . PHE A 1 614  ? -35.36600 -42.69300 -42.48200 1.000 64.24828  ? 614  PHE A CA    1 
ATOM   4497  C  C     . PHE A 1 614  ? -36.18800 -43.26200 -41.33400 1.000 61.68728  ? 614  PHE A C     1 
ATOM   4498  O  O     . PHE A 1 614  ? -37.34900 -42.89400 -41.13600 1.000 68.93316  ? 614  PHE A O     1 
ATOM   4499  C  CB    . PHE A 1 614  ? -34.58000 -41.48000 -41.97100 1.000 56.84249  ? 614  PHE A CB    1 
ATOM   4500  C  CG    . PHE A 1 614  ? -33.65200 -40.88100 -42.98300 1.000 55.04340  ? 614  PHE A CG    1 
ATOM   4501  C  CD1   . PHE A 1 614  ? -34.09300 -39.89300 -43.84700 1.000 62.02810  ? 614  PHE A CD1   1 
ATOM   4502  C  CD2   . PHE A 1 614  ? -32.33300 -41.29500 -43.06300 1.000 56.04007  ? 614  PHE A CD2   1 
ATOM   4503  C  CE1   . PHE A 1 614  ? -33.23900 -39.33400 -44.77600 1.000 57.80093  ? 614  PHE A CE1   1 
ATOM   4504  C  CE2   . PHE A 1 614  ? -31.47500 -40.74000 -43.99000 1.000 53.02371  ? 614  PHE A CE2   1 
ATOM   4505  C  CZ    . PHE A 1 614  ? -31.92900 -39.75800 -44.84800 1.000 56.99757  ? 614  PHE A CZ    1 
ATOM   4506  N  N     . VAL A 1 615  ? -35.57400 -44.16600 -40.57900 1.000 55.69765  ? 615  VAL A N     1 
ATOM   4507  C  CA    . VAL A 1 615  ? -36.04400 -44.49900 -39.24100 1.000 71.31325  ? 615  VAL A CA    1 
ATOM   4508  C  C     . VAL A 1 615  ? -35.12800 -43.78200 -38.26200 1.000 73.80560  ? 615  VAL A C     1 
ATOM   4509  O  O     . VAL A 1 615  ? -33.90900 -43.70200 -38.47300 1.000 70.63479  ? 615  VAL A O     1 
ATOM   4510  C  CB    . VAL A 1 615  ? -36.08100 -46.02200 -38.98900 1.000 68.68061  ? 615  VAL A CB    1 
ATOM   4511  C  CG1   . VAL A 1 615  ? -36.68200 -46.74900 -40.18500 1.000 71.48238  ? 615  VAL A CG1   1 
ATOM   4512  C  CG2   . VAL A 1 615  ? -34.71100 -46.57500 -38.63300 1.000 73.15039  ? 615  VAL A CG2   1 
ATOM   4513  N  N     . THR A 1 616  ? -35.71400 -43.21200 -37.21900 1.000 74.97335  ? 616  THR A N     1 
ATOM   4514  C  CA    . THR A 1 616  ? -34.98300 -42.36100 -36.29700 1.000 67.90166  ? 616  THR A CA    1 
ATOM   4515  C  C     . THR A 1 616  ? -34.98400 -42.97800 -34.90600 1.000 73.95701  ? 616  THR A C     1 
ATOM   4516  O  O     . THR A 1 616  ? -35.74300 -43.90500 -34.60800 1.000 84.90901  ? 616  THR A O     1 
ATOM   4517  C  CB    . THR A 1 616  ? -35.58400 -40.95000 -36.26000 1.000 72.13397  ? 616  THR A CB    1 
ATOM   4518  O  OG1   . THR A 1 616  ? -36.94800 -41.02000 -35.82500 1.000 75.66967  ? 616  THR A OG1   1 
ATOM   4519  C  CG2   . THR A 1 616  ? -35.52400 -40.31000 -37.64100 1.000 57.99641  ? 616  THR A CG2   1 
ATOM   4520  N  N     . SER A 1 617  ? -34.11000 -42.45200 -34.05400 1.000 68.29485  ? 617  SER A N     1 
ATOM   4521  C  CA    . SER A 1 617  ? -34.00900 -42.94500 -32.68900 1.000 73.16910  ? 617  SER A CA    1 
ATOM   4522  C  C     . SER A 1 617  ? -35.27500 -42.62100 -31.90800 1.000 76.02769  ? 617  SER A C     1 
ATOM   4523  O  O     . SER A 1 617  ? -35.86500 -41.54700 -32.06200 1.000 76.49333  ? 617  SER A O     1 
ATOM   4524  C  CB    . SER A 1 617  ? -32.79300 -42.33600 -31.99300 1.000 72.33034  ? 617  SER A CB    1 
ATOM   4525  O  OG    . SER A 1 617  ? -32.73200 -42.73500 -30.63500 1.000 74.68448  ? 617  SER A OG    1 
ATOM   4526  N  N     . SER A 1 618  ? -35.69700 -43.56500 -31.06900 1.000 72.64311  ? 618  SER A N     1 
ATOM   4527  C  CA    . SER A 1 618  ? -36.85400 -43.38800 -30.20600 1.000 66.22302  ? 618  SER A CA    1 
ATOM   4528  C  C     . SER A 1 618  ? -36.47300 -43.23600 -28.74100 1.000 70.80193  ? 618  SER A C     1 
ATOM   4529  O  O     . SER A 1 618  ? -37.35800 -43.05100 -27.89900 1.000 74.19978  ? 618  SER A O     1 
ATOM   4530  C  CB    . SER A 1 618  ? -37.82400 -44.56200 -30.37500 1.000 68.32866  ? 618  SER A CB    1 
ATOM   4531  O  OG    . SER A 1 618  ? -37.20800 -45.78800 -30.02500 1.000 75.64955  ? 618  SER A OG    1 
ATOM   4532  N  N     . ARG A 1 619  ? -35.18500 -43.31200 -28.41500 1.000 70.33242  ? 619  ARG A N     1 
ATOM   4533  C  CA    . ARG A 1 619  ? -34.69200 -43.11600 -27.06200 1.000 76.13625  ? 619  ARG A CA    1 
ATOM   4534  C  C     . ARG A 1 619  ? -33.69600 -41.96400 -27.05500 1.000 70.59035  ? 619  ARG A C     1 
ATOM   4535  O  O     . ARG A 1 619  ? -33.00800 -41.71300 -28.04800 1.000 73.75594  ? 619  ARG A O     1 
ATOM   4536  C  CB    . ARG A 1 619  ? -34.03000 -44.39100 -26.51900 1.000 78.13387  ? 619  ARG A CB    1 
ATOM   4537  C  CG    . ARG A 1 619  ? -34.84200 -45.66000 -26.74600 1.000 75.49257  ? 619  ARG A CG    1 
ATOM   4538  C  CD    . ARG A 1 619  ? -36.04900 -45.73800 -25.82400 1.000 75.64153  ? 619  ARG A CD    1 
ATOM   4539  N  NE    . ARG A 1 619  ? -36.57000 -47.09900 -25.72300 1.000 78.86398  ? 619  ARG A NE    1 
ATOM   4540  C  CZ    . ARG A 1 619  ? -36.13800 -48.00500 -24.85200 1.000 85.35505  ? 619  ARG A CZ    1 
ATOM   4541  N  NH1   . ARG A 1 619  ? -35.17000 -47.70000 -24.00000 1.000 88.58448  ? 619  ARG A NH1   1 
ATOM   4542  N  NH2   . ARG A 1 619  ? -36.67200 -49.21900 -24.83300 1.000 80.48444  ? 619  ARG A NH2   1 
ATOM   4543  N  N     . ALA A 1 620  ? -33.62500 -41.26100 -25.92300 1.000 69.81920  ? 620  ALA A N     1 
ATOM   4544  C  CA    . ALA A 1 620  ? -32.76100 -40.08900 -25.84000 1.000 69.41081  ? 620  ALA A CA    1 
ATOM   4545  C  C     . ALA A 1 620  ? -31.30500 -40.45800 -25.58400 1.000 73.71979  ? 620  ALA A C     1 
ATOM   4546  O  O     . ALA A 1 620  ? -30.40400 -39.75000 -26.04400 1.000 73.55668  ? 620  ALA A O     1 
ATOM   4547  C  CB    . ALA A 1 620  ? -33.26200 -39.14200 -24.75100 1.000 73.83685  ? 620  ALA A CB    1 
ATOM   4548  N  N     . HIS A 1 621  ? -31.05100 -41.54300 -24.85100 1.000 81.02251  ? 621  HIS A N     1 
ATOM   4549  C  CA    . HIS A 1 621  ? -29.68400 -42.01000 -24.63000 1.000 72.03811  ? 621  HIS A CA    1 
ATOM   4550  C  C     . HIS A 1 621  ? -29.76600 -43.50100 -24.31100 1.000 75.38683  ? 621  HIS A C     1 
ATOM   4551  O  O     . HIS A 1 621  ? -30.14900 -43.87700 -23.20000 1.000 78.57430  ? 621  HIS A O     1 
ATOM   4552  C  CB    . HIS A 1 621  ? -29.00100 -41.23400 -23.51200 1.000 77.83471  ? 621  HIS A CB    1 
ATOM   4553  C  CG    . HIS A 1 621  ? -27.52400 -41.46800 -23.43100 1.000 84.45566  ? 621  HIS A CG    1 
ATOM   4554  N  ND1   . HIS A 1 621  ? -26.84100 -42.23900 -24.34700 1.000 85.69200  ? 621  HIS A ND1   1 
ATOM   4555  C  CD2   . HIS A 1 621  ? -26.59900 -41.03300 -22.54200 1.000 81.49483  ? 621  HIS A CD2   1 
ATOM   4556  C  CE1   . HIS A 1 621  ? -25.55900 -42.27000 -24.02500 1.000 82.33674  ? 621  HIS A CE1   1 
ATOM   4557  N  NE2   . HIS A 1 621  ? -25.38600 -41.54600 -22.93500 1.000 85.59413  ? 621  HIS A NE2   1 
ATOM   4558  N  N     . ALA A 1 622  ? -29.41000 -44.33100 -25.28800 1.000 74.17994  ? 622  ALA A N     1 
ATOM   4559  C  CA    . ALA A 1 622  ? -29.48500 -45.77500 -25.13500 1.000 71.17184  ? 622  ALA A CA    1 
ATOM   4560  C  C     . ALA A 1 622  ? -28.45000 -46.42400 -26.04200 1.000 77.94939  ? 622  ALA A C     1 
ATOM   4561  O  O     . ALA A 1 622  ? -27.81600 -45.76500 -26.87100 1.000 81.99444  ? 622  ALA A O     1 
ATOM   4562  C  CB    . ALA A 1 622  ? -30.88900 -46.30200 -25.45100 1.000 79.51791  ? 622  ALA A CB    1 
ATOM   4563  N  N     . LYS A 1 623  ? -28.28700 -47.73200 -25.87500 1.000 80.75317  ? 623  LYS A N     1 
ATOM   4564  C  CA    . LYS A 1 623  ? -27.37400 -48.52600 -26.68400 1.000 81.75792  ? 623  LYS A CA    1 
ATOM   4565  C  C     . LYS A 1 623  ? -28.17300 -49.38400 -27.65400 1.000 81.56629  ? 623  LYS A C     1 
ATOM   4566  O  O     . LYS A 1 623  ? -29.13000 -50.05400 -27.25400 1.000 85.36192  ? 623  LYS A O     1 
ATOM   4567  C  CB    . LYS A 1 623  ? -26.48500 -49.41000 -25.80600 1.000 85.21203  ? 623  LYS A CB    1 
ATOM   4568  C  CG    . LYS A 1 623  ? -25.57500 -50.33600 -26.59500 1.000 92.59439  ? 623  LYS A CG    1 
ATOM   4569  C  CD    . LYS A 1 623  ? -24.47300 -50.91600 -25.72800 1.000 90.10510  ? 623  LYS A CD    1 
ATOM   4570  C  CE    . LYS A 1 623  ? -23.41000 -51.58800 -26.58000 1.000 99.37753  ? 623  LYS A CE    1 
ATOM   4571  N  NZ    . LYS A 1 623  ? -22.85600 -50.66000 -27.60600 1.000 95.34550  ? 623  LYS A NZ    1 
ATOM   4572  N  N     . ILE A 1 624  ? -27.78100 -49.35500 -28.92400 1.000 83.59726  ? 624  ILE A N     1 
ATOM   4573  C  CA    . ILE A 1 624  ? -28.41100 -50.18400 -29.94600 1.000 83.52175  ? 624  ILE A CA    1 
ATOM   4574  C  C     . ILE A 1 624  ? -27.90700 -51.61100 -29.76200 1.000 82.04704  ? 624  ILE A C     1 
ATOM   4575  O  O     . ILE A 1 624  ? -26.72900 -51.89600 -29.98900 1.000 83.45203  ? 624  ILE A O     1 
ATOM   4576  C  CB    . ILE A 1 624  ? -28.11000 -49.66600 -31.35500 1.000 89.45901  ? 624  ILE A CB    1 
ATOM   4577  C  CG1   . ILE A 1 624  ? -28.49300 -48.19000 -31.47400 1.000 78.74927  ? 624  ILE A CG1   1 
ATOM   4578  C  CG2   . ILE A 1 624  ? -28.85300 -50.49100 -32.38900 1.000 90.19720  ? 624  ILE A CG2   1 
ATOM   4579  C  CD1   . ILE A 1 624  ? -28.17000 -47.58400 -32.82200 1.000 72.92553  ? 624  ILE A CD1   1 
ATOM   4580  N  N     . VAL A 1 625  ? -28.79600 -52.51200 -29.35000 1.000 79.70982  ? 625  VAL A N     1 
ATOM   4581  C  CA    . VAL A 1 625  ? -28.39600 -53.88400 -29.06300 1.000 84.36481  ? 625  VAL A CA    1 
ATOM   4582  C  C     . VAL A 1 625  ? -28.69800 -54.78900 -30.25200 1.000 83.53467  ? 625  VAL A C     1 
ATOM   4583  O  O     . VAL A 1 625  ? -28.03000 -55.81000 -30.44700 1.000 88.61921  ? 625  VAL A O     1 
ATOM   4584  C  CB    . VAL A 1 625  ? -29.07300 -54.40500 -27.78100 1.000 83.28949  ? 625  VAL A CB    1 
ATOM   4585  C  CG1   . VAL A 1 625  ? -28.64600 -53.57000 -26.58200 1.000 86.17188  ? 625  VAL A CG1   1 
ATOM   4586  C  CG2   . VAL A 1 625  ? -30.58100 -54.39600 -27.92700 1.000 83.89124  ? 625  VAL A CG2   1 
ATOM   4587  N  N     . SER A 1 626  ? -29.69500 -54.42300 -31.05800 1.000 85.83035  ? 626  SER A N     1 
ATOM   4588  C  CA    . SER A 1 626  ? -30.05600 -55.22800 -32.21800 1.000 87.86179  ? 626  SER A CA    1 
ATOM   4589  C  C     . SER A 1 626  ? -30.94300 -54.41400 -33.14900 1.000 84.31988  ? 626  SER A C     1 
ATOM   4590  O  O     . SER A 1 626  ? -31.72800 -53.57200 -32.70300 1.000 80.86397  ? 626  SER A O     1 
ATOM   4591  C  CB    . SER A 1 626  ? -30.77000 -56.52300 -31.80800 1.000 84.79654  ? 626  SER A CB    1 
ATOM   4592  O  OG    . SER A 1 626  ? -31.99400 -56.24600 -31.15100 1.000 86.25378  ? 626  SER A OG    1 
ATOM   4593  N  N     . ILE A 1 627  ? -30.80400 -54.67900 -34.44700 1.000 76.45383  ? 627  ILE A N     1 
ATOM   4594  C  CA    . ILE A 1 627  ? -31.61800 -54.05900 -35.48700 1.000 76.99052  ? 627  ILE A CA    1 
ATOM   4595  C  C     . ILE A 1 627  ? -32.10500 -55.16300 -36.41400 1.000 76.25471  ? 627  ILE A C     1 
ATOM   4596  O  O     . ILE A 1 627  ? -31.29600 -55.81700 -37.08300 1.000 73.43985  ? 627  ILE A O     1 
ATOM   4597  C  CB    . ILE A 1 627  ? -30.84000 -52.99500 -36.28000 1.000 80.40205  ? 627  ILE A CB    1 
ATOM   4598  C  CG1   . ILE A 1 627  ? -30.37900 -51.86400 -35.35900 1.000 76.63275  ? 627  ILE A CG1   1 
ATOM   4599  C  CG2   . ILE A 1 627  ? -31.69100 -52.44800 -37.41600 1.000 73.69951  ? 627  ILE A CG2   1 
ATOM   4600  C  CD1   . ILE A 1 627  ? -29.58000 -50.78900 -36.06400 1.000 69.34818  ? 627  ILE A CD1   1 
ATOM   4601  N  N     . ASP A 1 628  ? -33.41900 -55.37100 -36.45600 1.000 70.58238  ? 628  ASP A N     1 
ATOM   4602  C  CA    . ASP A 1 628  ? -34.02400 -56.42800 -37.25900 1.000 68.45558  ? 628  ASP A CA    1 
ATOM   4603  C  C     . ASP A 1 628  ? -34.57700 -55.81900 -38.54300 1.000 75.80037  ? 628  ASP A C     1 
ATOM   4604  O  O     . ASP A 1 628  ? -35.59800 -55.12300 -38.52000 1.000 75.24523  ? 628  ASP A O     1 
ATOM   4605  C  CB    . ASP A 1 628  ? -35.12300 -57.14300 -36.47500 1.000 80.79905  ? 628  ASP A CB    1 
ATOM   4606  C  CG    . ASP A 1 628  ? -35.67700 -58.34700 -37.21300 1.000 87.77131  ? 628  ASP A CG    1 
ATOM   4607  O  OD1   . ASP A 1 628  ? -35.02600 -58.81000 -38.17300 1.000 88.37040  ? 628  ASP A OD1   1 
ATOM   4608  O  OD2   . ASP A 1 628  ? -36.76600 -58.82900 -36.83400 1.000 84.25803  ? 628  ASP A OD2   1 
ATOM   4609  N  N     . LEU A 1 629  ? -33.90400 -56.08700 -39.66000 1.000 72.62291  ? 629  LEU A N     1 
ATOM   4610  C  CA    . LEU A 1 629  ? -34.34200 -55.63500 -40.97300 1.000 70.06657  ? 629  LEU A CA    1 
ATOM   4611  C  C     . LEU A 1 629  ? -35.00300 -56.74500 -41.78000 1.000 78.42581  ? 629  LEU A C     1 
ATOM   4612  O  O     . LEU A 1 629  ? -35.25200 -56.56200 -42.97600 1.000 75.41672  ? 629  LEU A O     1 
ATOM   4613  C  CB    . LEU A 1 629  ? -33.15800 -55.06100 -41.75400 1.000 57.73474  ? 629  LEU A CB    1 
ATOM   4614  C  CG    . LEU A 1 629  ? -32.36700 -53.94300 -41.07500 1.000 62.86237  ? 629  LEU A CG    1 
ATOM   4615  C  CD1   . LEU A 1 629  ? -31.22200 -53.48100 -41.96200 1.000 60.76614  ? 629  LEU A CD1   1 
ATOM   4616  C  CD2   . LEU A 1 629  ? -33.28300 -52.78100 -40.73300 1.000 65.92814  ? 629  LEU A CD2   1 
ATOM   4617  N  N     . SER A 1 630  ? -35.29700 -57.88500 -41.15300 1.000 81.55555  ? 630  SER A N     1 
ATOM   4618  C  CA    . SER A 1 630  ? -35.80600 -59.04000 -41.88600 1.000 76.65945  ? 630  SER A CA    1 
ATOM   4619  C  C     . SER A 1 630  ? -37.17100 -58.75100 -42.50000 1.000 76.26410  ? 630  SER A C     1 
ATOM   4620  O  O     . SER A 1 630  ? -37.35300 -58.84800 -43.71900 1.000 76.86969  ? 630  SER A O     1 
ATOM   4621  C  CB    . SER A 1 630  ? -35.87500 -60.25400 -40.95800 1.000 78.61099  ? 630  SER A CB    1 
ATOM   4622  O  OG    . SER A 1 630  ? -36.72200 -59.99900 -39.85100 1.000 83.89092  ? 630  SER A OG    1 
ATOM   4623  N  N     . GLU A 1 631  ? -38.14900 -58.39300 -41.66400 1.000 78.94971  ? 631  GLU A N     1 
ATOM   4624  C  CA    . GLU A 1 631  ? -39.50500 -58.18700 -42.16100 1.000 78.38822  ? 631  GLU A CA    1 
ATOM   4625  C  C     . GLU A 1 631  ? -39.57700 -56.99700 -43.11000 1.000 81.79616  ? 631  GLU A C     1 
ATOM   4626  O  O     . GLU A 1 631  ? -40.33100 -57.02400 -44.09000 1.000 87.22461  ? 631  GLU A O     1 
ATOM   4627  C  CB    . GLU A 1 631  ? -40.47100 -57.99700 -40.99100 1.000 81.63531  ? 631  GLU A CB    1 
ATOM   4628  C  CG    . GLU A 1 631  ? -41.93300 -57.92800 -41.40200 1.000 83.42884  ? 631  GLU A CG    1 
ATOM   4629  C  CD    . GLU A 1 631  ? -42.86900 -57.78800 -40.21800 1.000 90.67810  ? 631  GLU A CD    1 
ATOM   4630  O  OE1   . GLU A 1 631  ? -42.37500 -57.60800 -39.08400 1.000 89.61078  ? 631  GLU A OE1   1 
ATOM   4631  O  OE2   . GLU A 1 631  ? -44.10000 -57.85800 -40.42100 1.000 80.57468  ? 631  GLU A OE2   1 
ATOM   4632  N  N     . ALA A 1 632  ? -38.79500 -55.94900 -42.84400 1.000 76.60301  ? 632  ALA A N     1 
ATOM   4633  C  CA    . ALA A 1 632  ? -38.86200 -54.75100 -43.67500 1.000 65.87020  ? 632  ALA A CA    1 
ATOM   4634  C  C     . ALA A 1 632  ? -38.24500 -54.98600 -45.04800 1.000 65.31342  ? 632  ALA A C     1 
ATOM   4635  O  O     . ALA A 1 632  ? -38.72900 -54.44700 -46.05000 1.000 67.37617  ? 632  ALA A O     1 
ATOM   4636  C  CB    . ALA A 1 632  ? -38.17300 -53.58700 -42.96800 1.000 68.39454  ? 632  ALA A CB    1 
ATOM   4637  N  N     . LEU A 1 633  ? -37.17800 -55.78700 -45.11700 1.000 67.40663  ? 633  LEU A N     1 
ATOM   4638  C  CA    . LEU A 1 633  ? -36.51500 -56.02800 -46.39600 1.000 62.64847  ? 633  LEU A CA    1 
ATOM   4639  C  C     . LEU A 1 633  ? -37.40900 -56.78700 -47.36800 1.000 63.94564  ? 633  LEU A C     1 
ATOM   4640  O  O     . LEU A 1 633  ? -37.29100 -56.60600 -48.58500 1.000 67.78007  ? 633  LEU A O     1 
ATOM   4641  C  CB    . LEU A 1 633  ? -35.21100 -56.79500 -46.17700 1.000 59.65801  ? 633  LEU A CB    1 
ATOM   4642  C  CG    . LEU A 1 633  ? -33.95600 -55.97000 -45.88800 1.000 60.37430  ? 633  LEU A CG    1 
ATOM   4643  C  CD1   . LEU A 1 633  ? -32.84500 -56.86000 -45.35300 1.000 48.40777  ? 633  LEU A CD1   1 
ATOM   4644  C  CD2   . LEU A 1 633  ? -33.50000 -55.23700 -47.14000 1.000 54.16359  ? 633  LEU A CD2   1 
ATOM   4645  N  N     . SER A 1 634  ? -38.30400 -57.63000 -46.85800 1.000 68.76663  ? 634  SER A N     1 
ATOM   4646  C  CA    . SER A 1 634  ? -39.15400 -58.46000 -47.70100 1.000 71.33207  ? 634  SER A CA    1 
ATOM   4647  C  C     . SER A 1 634  ? -40.44200 -57.76800 -48.12700 1.000 73.68293  ? 634  SER A C     1 
ATOM   4648  O  O     . SER A 1 634  ? -41.19700 -58.33900 -48.92200 1.000 75.13916  ? 634  SER A O     1 
ATOM   4649  C  CB    . SER A 1 634  ? -39.50100 -59.76400 -46.97400 1.000 78.09497  ? 634  SER A CB    1 
ATOM   4650  O  OG    . SER A 1 634  ? -40.21900 -59.50500 -45.77900 1.000 76.91018  ? 634  SER A OG    1 
ATOM   4651  N  N     . MET A 1 635  ? -40.70800 -56.56300 -47.63000 1.000 74.52444  ? 635  MET A N     1 
ATOM   4652  C  CA    . MET A 1 635  ? -41.96400 -55.89300 -47.91700 1.000 70.39379  ? 635  MET A CA    1 
ATOM   4653  C  C     . MET A 1 635  ? -41.98300 -55.38100 -49.35800 1.000 65.35893  ? 635  MET A C     1 
ATOM   4654  O  O     . MET A 1 635  ? -40.93300 -55.23100 -49.98800 1.000 64.31462  ? 635  MET A O     1 
ATOM   4655  C  CB    . MET A 1 635  ? -42.18600 -54.75200 -46.92700 1.000 65.62972  ? 635  MET A CB    1 
ATOM   4656  C  CG    . MET A 1 635  ? -42.54800 -55.23800 -45.53100 1.000 67.92734  ? 635  MET A CG    1 
ATOM   4657  S  SD    . MET A 1 635  ? -43.06200 -53.92700 -44.41200 1.000 81.77925  ? 635  MET A SD    1 
ATOM   4658  C  CE    . MET A 1 635  ? -44.48500 -53.27900 -45.28600 1.000 73.66381  ? 635  MET A CE    1 
ATOM   4659  N  N     . PRO A 1 636  ? -43.17400 -55.12800 -49.90900 1.000 66.85688  ? 636  PRO A N     1 
ATOM   4660  C  CA    . PRO A 1 636  ? -43.26200 -54.72200 -51.31900 1.000 63.60436  ? 636  PRO A CA    1 
ATOM   4661  C  C     . PRO A 1 636  ? -42.52300 -53.42000 -51.59300 1.000 60.22085  ? 636  PRO A C     1 
ATOM   4662  O  O     . PRO A 1 636  ? -42.54600 -52.48500 -50.79000 1.000 61.41113  ? 636  PRO A O     1 
ATOM   4663  C  CB    . PRO A 1 636  ? -44.77000 -54.56600 -51.54800 1.000 49.89463  ? 636  PRO A CB    1 
ATOM   4664  C  CG    . PRO A 1 636  ? -45.39900 -55.44100 -50.52600 1.000 57.69526  ? 636  PRO A CG    1 
ATOM   4665  C  CD    . PRO A 1 636  ? -44.50600 -55.36500 -49.32400 1.000 66.29104  ? 636  PRO A CD    1 
ATOM   4666  N  N     . GLY A 1 637  ? -41.85900 -53.37200 -52.74900 1.000 57.74798  ? 637  GLY A N     1 
ATOM   4667  C  CA    . GLY A 1 637  ? -41.19500 -52.17400 -53.21500 1.000 57.45305  ? 637  GLY A CA    1 
ATOM   4668  C  C     . GLY A 1 637  ? -39.84900 -51.88100 -52.59200 1.000 56.04848  ? 637  GLY A C     1 
ATOM   4669  O  O     . GLY A 1 637  ? -39.11500 -51.03800 -53.12200 1.000 56.44517  ? 637  GLY A O     1 
ATOM   4670  N  N     . VAL A 1 638  ? -39.49300 -52.54400 -51.49200 1.000 53.76187  ? 638  VAL A N     1 
ATOM   4671  C  CA    . VAL A 1 638  ? -38.24400 -52.24100 -50.80400 1.000 55.99603  ? 638  VAL A CA    1 
ATOM   4672  C  C     . VAL A 1 638  ? -37.06700 -52.67100 -51.66800 1.000 55.60442  ? 638  VAL A C     1 
ATOM   4673  O  O     . VAL A 1 638  ? -37.00000 -53.81500 -52.13400 1.000 60.22095  ? 638  VAL A O     1 
ATOM   4674  C  CB    . VAL A 1 638  ? -38.20500 -52.92400 -49.43000 1.000 58.23919  ? 638  VAL A CB    1 
ATOM   4675  C  CG1   . VAL A 1 638  ? -36.98400 -52.46800 -48.64500 1.000 57.38820  ? 638  VAL A CG1   1 
ATOM   4676  C  CG2   . VAL A 1 638  ? -39.48000 -52.62800 -48.66300 1.000 56.55287  ? 638  VAL A CG2   1 
ATOM   4677  N  N     . VAL A 1 639  ? -36.13200 -51.75100 -51.88400 1.000 54.41764  ? 639  VAL A N     1 
ATOM   4678  C  CA    . VAL A 1 639  ? -34.94000 -52.01900 -52.67400 1.000 50.22139  ? 639  VAL A CA    1 
ATOM   4679  C  C     . VAL A 1 639  ? -33.72800 -52.28100 -51.79000 1.000 57.36734  ? 639  VAL A C     1 
ATOM   4680  O  O     . VAL A 1 639  ? -32.94900 -53.19700 -52.05700 1.000 59.70557  ? 639  VAL A O     1 
ATOM   4681  C  CB    . VAL A 1 639  ? -34.67500 -50.84800 -53.64600 1.000 50.71762  ? 639  VAL A CB    1 
ATOM   4682  C  CG1   . VAL A 1 639  ? -33.39900 -51.08700 -54.43900 1.000 51.16206  ? 639  VAL A CG1   1 
ATOM   4683  C  CG2   . VAL A 1 639  ? -35.86300 -50.65200 -54.57500 1.000 53.14165  ? 639  VAL A CG2   1 
ATOM   4684  N  N     . ASP A 1 640  ? -33.56300 -51.49500 -50.72900 1.000 59.73748  ? 640  ASP A N     1 
ATOM   4685  C  CA    . ASP A 1 640  ? -32.40400 -51.60500 -49.85600 1.000 57.32704  ? 640  ASP A CA    1 
ATOM   4686  C  C     . ASP A 1 640  ? -32.68800 -50.85600 -48.56400 1.000 63.26245  ? 640  ASP A C     1 
ATOM   4687  O  O     . ASP A 1 640  ? -33.44000 -49.87700 -48.55200 1.000 63.12683  ? 640  ASP A O     1 
ATOM   4688  C  CB    . ASP A 1 640  ? -31.14500 -51.04400 -50.52900 1.000 58.71112  ? 640  ASP A CB    1 
ATOM   4689  C  CG    . ASP A 1 640  ? -29.87800 -51.35900 -49.76100 1.000 69.56527  ? 640  ASP A CG    1 
ATOM   4690  O  OD1   . ASP A 1 640  ? -29.94000 -52.15700 -48.80200 1.000 76.77044  ? 640  ASP A OD1   1 
ATOM   4691  O  OD2   . ASP A 1 640  ? -28.81600 -50.80400 -50.11800 1.000 69.16573  ? 640  ASP A OD2   1 
ATOM   4692  N  N     . ILE A 1 641  ? -32.08600 -51.33400 -47.47700 1.000 60.79210  ? 641  ILE A N     1 
ATOM   4693  C  CA    . ILE A 1 641  ? -32.12300 -50.66500 -46.18300 1.000 56.03880  ? 641  ILE A CA    1 
ATOM   4694  C  C     . ILE A 1 641  ? -30.69300 -50.58800 -45.67100 1.000 63.44511  ? 641  ILE A C     1 
ATOM   4695  O  O     . ILE A 1 641  ? -30.02700 -51.62000 -45.52800 1.000 67.64595  ? 641  ILE A O     1 
ATOM   4696  C  CB    . ILE A 1 641  ? -33.02300 -51.39300 -45.17100 1.000 53.73593  ? 641  ILE A CB    1 
ATOM   4697  C  CG1   . ILE A 1 641  ? -34.42000 -51.60800 -45.75200 1.000 61.13759  ? 641  ILE A CG1   1 
ATOM   4698  C  CG2   . ILE A 1 641  ? -33.10500 -50.60600 -43.87200 1.000 60.63952  ? 641  ILE A CG2   1 
ATOM   4699  C  CD1   . ILE A 1 641  ? -35.34400 -52.37500 -44.83900 1.000 59.91579  ? 641  ILE A CD1   1 
ATOM   4700  N  N     . MET A 1 642  ? -30.22300 -49.37500 -45.40000 1.000 66.71681  ? 642  MET A N     1 
ATOM   4701  C  CA    . MET A 1 642  ? -28.83600 -49.13400 -45.02800 1.000 66.88185  ? 642  MET A CA    1 
ATOM   4702  C  C     . MET A 1 642  ? -28.74100 -48.78900 -43.55000 1.000 70.67638  ? 642  MET A C     1 
ATOM   4703  O  O     . MET A 1 642  ? -29.48500 -47.93500 -43.05700 1.000 71.25222  ? 642  MET A O     1 
ATOM   4704  C  CB    . MET A 1 642  ? -28.23600 -48.00600 -45.86800 1.000 67.91175  ? 642  MET A CB    1 
ATOM   4705  C  CG    . MET A 1 642  ? -27.78700 -48.43500 -47.25100 1.000 76.34999  ? 642  MET A CG    1 
ATOM   4706  S  SD    . MET A 1 642  ? -27.83600 -47.06100 -48.41200 1.000 80.02592  ? 642  MET A SD    1 
ATOM   4707  C  CE    . MET A 1 642  ? -29.57600 -46.64300 -48.33900 1.000 72.46822  ? 642  MET A CE    1 
ATOM   4708  N  N     . THR A 1 643  ? -27.82600 -49.45200 -42.85200 1.000 72.36198  ? 643  THR A N     1 
ATOM   4709  C  CA    . THR A 1 643  ? -27.47900 -49.13400 -41.47800 1.000 77.23573  ? 643  THR A CA    1 
ATOM   4710  C  C     . THR A 1 643  ? -26.06900 -48.54700 -41.44500 1.000 77.17396  ? 643  THR A C     1 
ATOM   4711  O  O     . THR A 1 643  ? -25.47100 -48.25400 -42.48800 1.000 76.88312  ? 643  THR A O     1 
ATOM   4712  C  CB    . THR A 1 643  ? -27.61000 -50.37800 -40.59400 1.000 80.99379  ? 643  THR A CB    1 
ATOM   4713  O  OG1   . THR A 1 643  ? -27.06700 -50.10500 -39.29600 1.000 97.24437  ? 643  THR A OG1   1 
ATOM   4714  C  CG2   . THR A 1 643  ? -26.87600 -51.55400 -41.21400 1.000 76.10529  ? 643  THR A CG2   1 
ATOM   4715  N  N     . ALA A 1 644  ? -25.53100 -48.37700 -40.23600 1.000 80.73818  ? 644  ALA A N     1 
ATOM   4716  C  CA    . ALA A 1 644  ? -24.23200 -47.72700 -40.09100 1.000 74.75301  ? 644  ALA A CA    1 
ATOM   4717  C  C     . ALA A 1 644  ? -23.11800 -48.55100 -40.72400 1.000 78.68634  ? 644  ALA A C     1 
ATOM   4718  O  O     . ALA A 1 644  ? -22.18100 -47.99500 -41.31000 1.000 80.93226  ? 644  ALA A O     1 
ATOM   4719  C  CB    . ALA A 1 644  ? -23.93400 -47.47100 -38.61400 1.000 84.10010  ? 644  ALA A CB    1 
ATOM   4720  N  N     . GLU A 1 645  ? -23.19900 -49.88000 -40.61900 1.000 80.53028  ? 645  GLU A N     1 
ATOM   4721  C  CA    . GLU A 1 645  ? -22.15100 -50.72800 -41.17300 1.000 84.27538  ? 645  GLU A CA    1 
ATOM   4722  C  C     . GLU A 1 645  ? -22.15400 -50.73800 -42.69600 1.000 82.40709  ? 645  GLU A C     1 
ATOM   4723  O  O     . GLU A 1 645  ? -21.11400 -51.01700 -43.30200 1.000 80.50146  ? 645  GLU A O     1 
ATOM   4724  C  CB    . GLU A 1 645  ? -22.28900 -52.15800 -40.64600 1.000 89.95658  ? 645  GLU A CB    1 
ATOM   4725  C  CG    . GLU A 1 645  ? -23.52100 -52.89300 -41.14500 1.000 92.61085  ? 645  GLU A CG    1 
ATOM   4726  C  CD    . GLU A 1 645  ? -23.45400 -54.38500 -40.88800 1.000 99.29108  ? 645  GLU A CD    1 
ATOM   4727  O  OE1   . GLU A 1 645  ? -22.44900 -54.84400 -40.30600 1.000 99.37945  ? 645  GLU A OE1   1 
ATOM   4728  O  OE2   . GLU A 1 645  ? -24.40600 -55.09900 -41.27000 1.000 103.16310 ? 645  GLU A OE2   1 
ATOM   4729  N  N     . HIS A 1 646  ? -23.29000 -50.43700 -43.32700 1.000 82.87078  ? 646  HIS A N     1 
ATOM   4730  C  CA    . HIS A 1 646  ? -23.37000 -50.42600 -44.78200 1.000 82.68230  ? 646  HIS A CA    1 
ATOM   4731  C  C     . HIS A 1 646  ? -22.70700 -49.20600 -45.40500 1.000 79.41507  ? 646  HIS A C     1 
ATOM   4732  O  O     . HIS A 1 646  ? -22.59800 -49.14100 -46.63500 1.000 86.66156  ? 646  HIS A O     1 
ATOM   4733  C  CB    . HIS A 1 646  ? -24.83200 -50.50600 -45.22900 1.000 79.95885  ? 646  HIS A CB    1 
ATOM   4734  C  CG    . HIS A 1 646  ? -25.53800 -51.74000 -44.75800 1.000 79.81167  ? 646  HIS A CG    1 
ATOM   4735  N  ND1   . HIS A 1 646  ? -26.91000 -51.86900 -44.78200 1.000 82.52201  ? 646  HIS A ND1   1 
ATOM   4736  C  CD2   . HIS A 1 646  ? -25.06000 -52.90100 -44.25300 1.000 74.78792  ? 646  HIS A CD2   1 
ATOM   4737  C  CE1   . HIS A 1 646  ? -27.24700 -53.05600 -44.31100 1.000 79.66118  ? 646  HIS A CE1   1 
ATOM   4738  N  NE2   . HIS A 1 646  ? -26.14200 -53.70200 -43.98100 1.000 74.28697  ? 646  HIS A NE2   1 
ATOM   4739  N  N     . LEU A 1 647  ? -22.26700 -48.24200 -44.59600 1.000 76.59514  ? 647  LEU A N     1 
ATOM   4740  C  CA    . LEU A 1 647  ? -21.51300 -47.10000 -45.09100 1.000 80.05860  ? 647  LEU A CA    1 
ATOM   4741  C  C     . LEU A 1 647  ? -20.02500 -47.19000 -44.78100 1.000 88.68163  ? 647  LEU A C     1 
ATOM   4742  O  O     . LEU A 1 647  ? -19.23300 -46.49800 -45.42800 1.000 89.31223  ? 647  LEU A O     1 
ATOM   4743  C  CB    . LEU A 1 647  ? -22.07100 -45.79400 -44.50900 1.000 76.57944  ? 647  LEU A CB    1 
ATOM   4744  C  CG    . LEU A 1 647  ? -23.24200 -45.13000 -45.24400 1.000 72.61699  ? 647  LEU A CG    1 
ATOM   4745  C  CD1   . LEU A 1 647  ? -24.48700 -46.00800 -45.24200 1.000 66.39068  ? 647  LEU A CD1   1 
ATOM   4746  C  CD2   . LEU A 1 647  ? -23.54700 -43.76700 -44.64200 1.000 69.98859  ? 647  LEU A CD2   1 
ATOM   4747  N  N     . SER A 1 648  ? -19.63500 -48.03000 -43.82100 1.000 93.10849  ? 648  SER A N     1 
ATOM   4748  C  CA    . SER A 1 648  ? -18.23800 -48.26800 -43.46600 1.000 92.02094  ? 648  SER A CA    1 
ATOM   4749  C  C     . SER A 1 648  ? -17.49200 -46.97700 -43.14700 1.000 93.00307  ? 648  SER A C     1 
ATOM   4750  O  O     . SER A 1 648  ? -17.79100 -46.31000 -42.15100 1.000 90.58294  ? 648  SER A O     1 
ATOM   4751  C  CB    . SER A 1 648  ? -17.51600 -49.03000 -44.58500 1.000 84.71642  ? 648  SER A CB    1 
ATOM   4752  O  OG    . SER A 1 648  ? -17.54700 -48.32300 -45.81300 1.000 86.77706  ? 648  SER A OG    1 
ATOM   4753  N  N     . ASP A 1 649  ? -16.52200 -46.61600 -43.98900 1.000 96.93441  ? 649  ASP A N     1 
ATOM   4754  C  CA    . ASP A 1 649  ? -15.62700 -45.50800 -43.68200 1.000 94.54743  ? 649  ASP A CA    1 
ATOM   4755  C  C     . ASP A 1 649  ? -16.21600 -44.14300 -44.01200 1.000 93.79579  ? 649  ASP A C     1 
ATOM   4756  O  O     . ASP A 1 649  ? -15.71200 -43.13300 -43.50900 1.000 96.47938  ? 649  ASP A O     1 
ATOM   4757  C  CB    . ASP A 1 649  ? -14.30200 -45.68200 -44.42800 1.000 94.12338  ? 649  ASP A CB    1 
ATOM   4758  C  CG    . ASP A 1 649  ? -14.48100 -45.70900 -45.93300 1.000 99.51043  ? 649  ASP A CG    1 
ATOM   4759  O  OD1   . ASP A 1 649  ? -15.59200 -46.04300 -46.39500 1.000 103.02627 ? 649  ASP A OD1   1 
ATOM   4760  O  OD2   . ASP A 1 649  ? -13.51000 -45.39500 -46.65400 1.000 102.23329 ? 649  ASP A OD2   1 
ATOM   4761  N  N     . VAL A 1 650  ? -17.25900 -44.07900 -44.83900 1.000 91.46033  ? 650  VAL A N     1 
ATOM   4762  C  CA    . VAL A 1 650  ? -17.83200 -42.79400 -45.22600 1.000 87.92134  ? 650  VAL A CA    1 
ATOM   4763  C  C     . VAL A 1 650  ? -19.09800 -42.52800 -44.42200 1.000 84.51906  ? 650  VAL A C     1 
ATOM   4764  O  O     . VAL A 1 650  ? -20.08900 -42.01100 -44.95000 1.000 76.57591  ? 650  VAL A O     1 
ATOM   4765  C  CB    . VAL A 1 650  ? -18.10700 -42.73200 -46.74000 1.000 82.42463  ? 650  VAL A CB    1 
ATOM   4766  C  CG1   . VAL A 1 650  ? -16.79800 -42.61100 -47.50600 1.000 84.69787  ? 650  VAL A CG1   1 
ATOM   4767  C  CG2   . VAL A 1 650  ? -18.88300 -43.95300 -47.20000 1.000 79.81276  ? 650  VAL A CG2   1 
ATOM   4768  N  N     . ASN A 1 651  ? -19.07100 -42.87400 -43.13600 1.000 83.96722  ? 651  ASN A N     1 
ATOM   4769  C  CA    . ASN A 1 651  ? -20.15300 -42.56100 -42.21500 1.000 81.83584  ? 651  ASN A CA    1 
ATOM   4770  C  C     . ASN A 1 651  ? -19.83500 -41.34800 -41.35000 1.000 88.63788  ? 651  ASN A C     1 
ATOM   4771  O  O     . ASN A 1 651  ? -20.51900 -41.11200 -40.35000 1.000 85.17106  ? 651  ASN A O     1 
ATOM   4772  C  CB    . ASN A 1 651  ? -20.45800 -43.77200 -41.32800 1.000 86.14885  ? 651  ASN A CB    1 
ATOM   4773  C  CG    . ASN A 1 651  ? -21.91500 -43.83500 -40.89200 1.000 83.41000  ? 651  ASN A CG    1 
ATOM   4774  O  OD1   . ASN A 1 651  ? -22.52900 -42.82000 -40.56500 1.000 79.72893  ? 651  ASN A OD1   1 
ATOM   4775  N  ND2   . ASN A 1 651  ? -22.47100 -45.03900 -40.88000 1.000 90.35208  ? 651  ASN A ND2   1 
ATOM   4776  N  N     . SER A 1 652  ? -18.81100 -40.57600 -41.70700 1.000 94.59233  ? 652  SER A N     1 
ATOM   4777  C  CA    . SER A 1 652  ? -18.39800 -39.44400 -40.89000 1.000 89.45557  ? 652  SER A CA    1 
ATOM   4778  C  C     . SER A 1 652  ? -17.87300 -38.33200 -41.78400 1.000 88.64341  ? 652  SER A C     1 
ATOM   4779  O  O     . SER A 1 652  ? -17.03700 -38.57700 -42.65900 1.000 95.38016  ? 652  SER A O     1 
ATOM   4780  C  CB    . SER A 1 652  ? -17.32500 -39.85800 -39.87700 1.000 95.22187  ? 652  SER A CB    1 
ATOM   4781  O  OG    . SER A 1 652  ? -16.13800 -40.27000 -40.53200 1.000 95.27819  ? 652  SER A OG    1 
ATOM   4782  N  N     . PHE A 1 653  ? -18.36900 -37.11900 -41.56000 1.000 92.53012  ? 653  PHE A N     1 
ATOM   4783  C  CA    . PHE A 1 653  ? -17.86700 -35.92100 -42.21500 1.000 97.03174  ? 653  PHE A CA    1 
ATOM   4784  C  C     . PHE A 1 653  ? -17.52800 -34.89100 -41.15100 1.000 103.67382 ? 653  PHE A C     1 
ATOM   4785  O  O     . PHE A 1 653  ? -18.25600 -34.74300 -40.16500 1.000 107.30108 ? 653  PHE A O     1 
ATOM   4786  C  CB    . PHE A 1 653  ? -18.88700 -35.34400 -43.20500 1.000 86.22299  ? 653  PHE A CB    1 
ATOM   4787  C  CG    . PHE A 1 653  ? -18.36600 -34.17900 -43.99900 1.000 85.25085  ? 653  PHE A CG    1 
ATOM   4788  C  CD1   . PHE A 1 653  ? -17.54900 -34.38200 -45.09900 1.000 79.93130  ? 653  PHE A CD1   1 
ATOM   4789  C  CD2   . PHE A 1 653  ? -18.69400 -32.88000 -43.64600 1.000 84.31523  ? 653  PHE A CD2   1 
ATOM   4790  C  CE1   . PHE A 1 653  ? -17.06800 -33.31200 -45.83200 1.000 70.87507  ? 653  PHE A CE1   1 
ATOM   4791  C  CE2   . PHE A 1 653  ? -18.21700 -31.80600 -44.37500 1.000 77.90990  ? 653  PHE A CE2   1 
ATOM   4792  C  CZ    . PHE A 1 653  ? -17.40300 -32.02300 -45.46900 1.000 73.06483  ? 653  PHE A CZ    1 
ATOM   4793  N  N     . CYS A 1 654  ? -16.42000 -34.18400 -41.35000 1.000 103.16526 ? 654  CYS A N     1 
ATOM   4794  C  CA    . CYS A 1 654  ? -15.92300 -33.21700 -40.38200 1.000 113.02217 ? 654  CYS A CA    1 
ATOM   4795  C  C     . CYS A 1 654  ? -16.36600 -31.81700 -40.79000 1.000 118.98449 ? 654  CYS A C     1 
ATOM   4796  O  O     . CYS A 1 654  ? -16.03800 -31.35300 -41.88700 1.000 115.11957 ? 654  CYS A O     1 
ATOM   4797  C  CB    . CYS A 1 654  ? -14.40000 -33.28900 -40.27600 1.000 111.63294 ? 654  CYS A CB    1 
ATOM   4798  S  SG    . CYS A 1 654  ? -13.56100 -33.62100 -41.84400 1.000 119.98585 ? 654  CYS A SG    1 
ATOM   4799  N  N     . PHE A 1 655  ? -17.11200 -31.14900 -39.90600 1.000 121.21071 ? 655  PHE A N     1 
ATOM   4800  C  CA    . PHE A 1 655  ? -17.49600 -29.75600 -40.10300 1.000 124.79944 ? 655  PHE A CA    1 
ATOM   4801  C  C     . PHE A 1 655  ? -16.45500 -28.78800 -39.55000 1.000 131.18630 ? 655  PHE A C     1 
ATOM   4802  O  O     . PHE A 1 655  ? -16.81000 -27.70700 -39.05900 1.000 125.16034 ? 655  PHE A O     1 
ATOM   4803  C  CB    . PHE A 1 655  ? -18.86700 -29.49200 -39.47900 1.000 121.53171 ? 655  PHE A CB    1 
ATOM   4804  C  CG    . PHE A 1 655  ? -19.57600 -28.29800 -40.05700 1.000 122.04344 ? 655  PHE A CG    1 
ATOM   4805  C  CD1   . PHE A 1 655  ? -19.92600 -28.26700 -41.39700 1.000 112.54698 ? 655  PHE A CD1   1 
ATOM   4806  C  CD2   . PHE A 1 655  ? -19.89700 -27.21100 -39.26000 1.000 121.91088 ? 655  PHE A CD2   1 
ATOM   4807  C  CE1   . PHE A 1 655  ? -20.57700 -27.17200 -41.93400 1.000 101.56015 ? 655  PHE A CE1   1 
ATOM   4808  C  CE2   . PHE A 1 655  ? -20.54900 -26.11300 -39.79200 1.000 120.23360 ? 655  PHE A CE2   1 
ATOM   4809  C  CZ    . PHE A 1 655  ? -20.89000 -26.09400 -41.13100 1.000 109.67518 ? 655  PHE A CZ    1 
ATOM   4810  N  N     . PHE A 1 656  ? -15.17700 -29.16700 -39.60500 1.000 135.29976 ? 656  PHE A N     1 
ATOM   4811  C  CA    . PHE A 1 656  ? -14.05600 -28.32000 -39.19900 1.000 137.80584 ? 656  PHE A CA    1 
ATOM   4812  C  C     . PHE A 1 656  ? -14.12000 -27.94400 -37.71900 1.000 137.65911 ? 656  PHE A C     1 
ATOM   4813  O  O     . PHE A 1 656  ? -13.63100 -26.88800 -37.31200 1.000 134.96095 ? 656  PHE A O     1 
ATOM   4814  C  CB    . PHE A 1 656  ? -13.95700 -27.07200 -40.08300 1.000 139.44312 ? 656  PHE A CB    1 
ATOM   4815  C  CG    . PHE A 1 656  ? -13.18200 -27.29800 -41.35300 1.000 143.49587 ? 656  PHE A CG    1 
ATOM   4816  C  CD1   . PHE A 1 656  ? -12.91900 -28.58700 -41.79200 1.000 140.22238 ? 656  PHE A CD1   1 
ATOM   4817  C  CD2   . PHE A 1 656  ? -12.71900 -26.23200 -42.10700 1.000 141.81806 ? 656  PHE A CD2   1 
ATOM   4818  C  CE1   . PHE A 1 656  ? -12.20800 -28.81000 -42.95600 1.000 134.52285 ? 656  PHE A CE1   1 
ATOM   4819  C  CE2   . PHE A 1 656  ? -12.00700 -26.44900 -43.27500 1.000 140.72930 ? 656  PHE A CE2   1 
ATOM   4820  C  CZ    . PHE A 1 656  ? -11.75200 -27.74100 -43.69800 1.000 136.63832 ? 656  PHE A CZ    1 
ATOM   4821  N  N     . THR A 1 657  ? -14.73400 -28.80100 -36.90500 1.000 133.13493 ? 657  THR A N     1 
ATOM   4822  C  CA    . THR A 1 657  ? -14.52200 -28.78600 -35.46100 1.000 121.70786 ? 657  THR A CA    1 
ATOM   4823  C  C     . THR A 1 657  ? -14.17100 -30.19500 -34.98500 1.000 120.36264 ? 657  THR A C     1 
ATOM   4824  O  O     . THR A 1 657  ? -13.02600 -30.44900 -34.59100 1.000 114.60720 ? 657  THR A O     1 
ATOM   4825  C  CB    . THR A 1 657  ? -15.72900 -28.14700 -34.72400 1.000 118.12640 ? 657  THR A CB    1 
ATOM   4826  O  OG1   . THR A 1 657  ? -15.47100 -28.04600 -33.31200 1.000 109.45805 ? 657  THR A OG1   1 
ATOM   4827  C  CG2   . THR A 1 657  ? -17.11500 -28.78000 -35.04700 1.000 118.84311 ? 657  THR A CG2   1 
ATOM   4828  N  N     . GLU A 1 658  ? -15.12700 -31.11800 -35.05400 1.000 125.84346 ? 658  GLU A N     1 
ATOM   4829  C  CA    . GLU A 1 658  ? -14.89900 -32.54200 -34.85300 1.000 118.47742 ? 658  GLU A CA    1 
ATOM   4830  C  C     . GLU A 1 658  ? -15.89000 -33.29000 -35.72600 1.000 115.22152 ? 658  GLU A C     1 
ATOM   4831  O  O     . GLU A 1 658  ? -16.96800 -32.77600 -36.03300 1.000 118.41745 ? 658  GLU A O     1 
ATOM   4832  C  CB    . GLU A 1 658  ? -15.06200 -32.96000 -33.38300 1.000 117.08728 ? 658  GLU A CB    1 
ATOM   4833  C  CG    . GLU A 1 658  ? -13.86000 -32.66100 -32.51100 1.000 113.04246 ? 658  GLU A CG    1 
ATOM   4834  C  CD    . GLU A 1 658  ? -13.47700 -33.83000 -31.62500 1.000 107.94685 ? 658  GLU A CD    1 
ATOM   4835  O  OE1   . GLU A 1 658  ? -14.37800 -34.60700 -31.23300 1.000 107.59581 ? 658  GLU A OE1   1 
ATOM   4836  O  OE2   . GLU A 1 658  ? -12.27300 -33.98100 -31.33500 1.000 102.42432 ? 658  GLU A OE2   1 
ATOM   4837  N  N     . ALA A 1 659  ? -15.52200 -34.50300 -36.12200 1.000 113.73991 ? 659  ALA A N     1 
ATOM   4838  C  CA    . ALA A 1 659  ? -16.34800 -35.25700 -37.05300 1.000 109.03314 ? 659  ALA A CA    1 
ATOM   4839  C  C     . ALA A 1 659  ? -17.65900 -35.67900 -36.39900 1.000 110.41978 ? 659  ALA A C     1 
ATOM   4840  O  O     . ALA A 1 659  ? -17.69000 -36.09200 -35.23700 1.000 111.02022 ? 659  ALA A O     1 
ATOM   4841  C  CB    . ALA A 1 659  ? -15.59500 -36.48500 -37.56200 1.000 98.95277  ? 659  ALA A CB    1 
ATOM   4842  N  N     . GLU A 1 660  ? -18.74900 -35.56100 -37.15300 1.000 106.24002 ? 660  GLU A N     1 
ATOM   4843  C  CA    . GLU A 1 660  ? -20.05500 -36.04000 -36.72800 1.000 108.61539 ? 660  GLU A CA    1 
ATOM   4844  C  C     . GLU A 1 660  ? -20.48900 -37.17800 -37.64200 1.000 105.99460 ? 660  GLU A C     1 
ATOM   4845  O  O     . GLU A 1 660  ? -20.25800 -37.13900 -38.85500 1.000 103.60830 ? 660  GLU A O     1 
ATOM   4846  C  CB    . GLU A 1 660  ? -21.10000 -34.90700 -36.72200 1.000 113.42629 ? 660  GLU A CB    1 
ATOM   4847  C  CG    . GLU A 1 660  ? -21.71600 -34.56800 -38.07400 1.000 119.90706 ? 660  GLU A CG    1 
ATOM   4848  C  CD    . GLU A 1 660  ? -21.16600 -33.27900 -38.66200 1.000 122.80185 ? 660  GLU A CD    1 
ATOM   4849  O  OE1   . GLU A 1 660  ? -20.30700 -32.64400 -38.01400 1.000 122.67912 ? 660  GLU A OE1   1 
ATOM   4850  O  OE2   . GLU A 1 660  ? -21.59600 -32.90000 -39.77200 1.000 115.86459 ? 660  GLU A OE2   1 
ATOM   4851  N  N     . LYS A 1 661  ? -21.08900 -38.20500 -37.05000 1.000 99.70601  ? 661  LYS A N     1 
ATOM   4852  C  CA    . LYS A 1 661  ? -21.50400 -39.38200 -37.79600 1.000 88.75532  ? 661  LYS A CA    1 
ATOM   4853  C  C     . LYS A 1 661  ? -22.90200 -39.18900 -38.37000 1.000 94.23739  ? 661  LYS A C     1 
ATOM   4854  O  O     . LYS A 1 661  ? -23.75900 -38.53600 -37.76800 1.000 100.81763 ? 661  LYS A O     1 
ATOM   4855  C  CB    . LYS A 1 661  ? -21.46900 -40.62900 -36.90900 1.000 90.42748  ? 661  LYS A CB    1 
ATOM   4856  C  CG    . LYS A 1 661  ? -21.63600 -40.34700 -35.42500 1.000 104.31771 ? 661  LYS A CG    1 
ATOM   4857  C  CD    . LYS A 1 661  ? -21.02600 -41.45800 -34.58300 1.000 103.96625 ? 661  LYS A CD    1 
ATOM   4858  C  CE    . LYS A 1 661  ? -20.76600 -40.99900 -33.15600 1.000 103.61903 ? 661  LYS A CE    1 
ATOM   4859  N  NZ    . LYS A 1 661  ? -19.60400 -40.07100 -33.07100 1.000 95.27506  ? 661  LYS A NZ    1 
ATOM   4860  N  N     . PHE A 1 662  ? -23.12100 -39.76600 -39.55200 1.000 91.99051  ? 662  PHE A N     1 
ATOM   4861  C  CA    . PHE A 1 662  ? -24.42100 -39.69100 -40.20800 1.000 79.58082  ? 662  PHE A CA    1 
ATOM   4862  C  C     . PHE A 1 662  ? -25.41500 -40.62000 -39.52600 1.000 78.36163  ? 662  PHE A C     1 
ATOM   4863  O  O     . PHE A 1 662  ? -26.30500 -40.16600 -38.80200 1.000 87.47952  ? 662  PHE A O     1 
ATOM   4864  C  CB    . PHE A 1 662  ? -24.30300 -40.04700 -41.69200 1.000 71.08442  ? 662  PHE A CB    1 
ATOM   4865  C  CG    . PHE A 1 662  ? -23.34000 -39.17800 -42.45100 1.000 67.37967  ? 662  PHE A CG    1 
ATOM   4866  C  CD1   . PHE A 1 662  ? -23.19400 -37.84000 -42.13000 1.000 71.93429  ? 662  PHE A CD1   1 
ATOM   4867  C  CD2   . PHE A 1 662  ? -22.59200 -39.69800 -43.49500 1.000 69.27524  ? 662  PHE A CD2   1 
ATOM   4868  C  CE1   . PHE A 1 662  ? -22.31300 -37.04100 -42.82400 1.000 79.49280  ? 662  PHE A CE1   1 
ATOM   4869  C  CE2   . PHE A 1 662  ? -21.71000 -38.90200 -44.19500 1.000 72.78313  ? 662  PHE A CE2   1 
ATOM   4870  C  CZ    . PHE A 1 662  ? -21.57100 -37.57200 -43.86000 1.000 76.97084  ? 662  PHE A CZ    1 
ATOM   4871  N  N     . LEU A 1 663  ? -25.26800 -41.92200 -39.75200 1.000 73.94565  ? 663  LEU A N     1 
ATOM   4872  C  CA    . LEU A 1 663  ? -26.14600 -42.91400 -39.15100 1.000 74.92431  ? 663  LEU A CA    1 
ATOM   4873  C  C     . LEU A 1 663  ? -25.58100 -43.37500 -37.81400 1.000 73.16164  ? 663  LEU A C     1 
ATOM   4874  O  O     . LEU A 1 663  ? -24.36400 -43.50200 -37.65100 1.000 74.08608  ? 663  LEU A O     1 
ATOM   4875  C  CB    . LEU A 1 663  ? -26.32800 -44.10900 -40.08800 1.000 76.49500  ? 663  LEU A CB    1 
ATOM   4876  C  CG    . LEU A 1 663  ? -26.95000 -43.80000 -41.45200 1.000 74.72452  ? 663  LEU A CG    1 
ATOM   4877  C  CD1   . LEU A 1 663  ? -26.94500 -45.03300 -42.34300 1.000 70.74186  ? 663  LEU A CD1   1 
ATOM   4878  C  CD2   . LEU A 1 663  ? -28.36100 -43.25800 -41.28900 1.000 71.40270  ? 663  LEU A CD2   1 
ATOM   4879  N  N     . ALA A 1 664  ? -26.47500 -43.62100 -36.86000 1.000 73.35763  ? 664  ALA A N     1 
ATOM   4880  C  CA    . ALA A 1 664  ? -26.05400 -44.05300 -35.53400 1.000 76.00320  ? 664  ALA A CA    1 
ATOM   4881  C  C     . ALA A 1 664  ? -25.38500 -45.42000 -35.60200 1.000 80.14305  ? 664  ALA A C     1 
ATOM   4882  O  O     . ALA A 1 664  ? -25.83100 -46.31500 -36.32700 1.000 82.02958  ? 664  ALA A O     1 
ATOM   4883  C  CB    . ALA A 1 664  ? -27.25100 -44.09700 -34.58400 1.000 78.01760  ? 664  ALA A CB    1 
ATOM   4884  N  N     . THR A 1 665  ? -24.30700 -45.57900 -34.83600 1.000 82.19624  ? 665  THR A N     1 
ATOM   4885  C  CA    . THR A 1 665  ? -23.53500 -46.81500 -34.85000 1.000 78.46724  ? 665  THR A CA    1 
ATOM   4886  C  C     . THR A 1 665  ? -24.00700 -47.77300 -33.76300 1.000 77.31636  ? 665  THR A C     1 
ATOM   4887  O  O     . THR A 1 665  ? -24.87200 -48.62000 -34.00800 1.000 81.86955  ? 665  THR A O     1 
ATOM   4888  C  CB    . THR A 1 665  ? -22.04300 -46.51700 -34.67900 1.000 79.58966  ? 665  THR A CB    1 
ATOM   4889  O  OG1   . THR A 1 665  ? -21.84400 -45.71600 -33.50800 1.000 90.82590  ? 665  THR A OG1   1 
ATOM   4890  C  CG2   . THR A 1 665  ? -21.50700 -45.77200 -35.89200 1.000 76.55585  ? 665  THR A CG2   1 
ATOM   4891  N  N     . ASP A 1 666  ? -23.44400 -47.65000 -32.55900 1.000 79.51354  ? 666  ASP A N     1 
ATOM   4892  C  CA    . ASP A 1 666  ? -23.79800 -48.52400 -31.45000 1.000 84.81247  ? 666  ASP A CA    1 
ATOM   4893  C  C     . ASP A 1 666  ? -24.62700 -47.84600 -30.36900 1.000 85.88375  ? 666  ASP A C     1 
ATOM   4894  O  O     . ASP A 1 666  ? -25.30000 -48.54500 -29.60500 1.000 85.53432  ? 666  ASP A O     1 
ATOM   4895  C  CB    . ASP A 1 666  ? -22.53100 -49.11200 -30.80800 1.000 90.18057  ? 666  ASP A CB    1 
ATOM   4896  C  CG    . ASP A 1 666  ? -21.58400 -48.04200 -30.30000 1.000 97.77427  ? 666  ASP A CG    1 
ATOM   4897  O  OD1   . ASP A 1 666  ? -21.64300 -46.90300 -30.80900 1.000 98.23414  ? 666  ASP A OD1   1 
ATOM   4898  O  OD2   . ASP A 1 666  ? -20.77900 -48.34200 -29.39300 1.000 96.91740  ? 666  ASP A OD2   1 
ATOM   4899  N  N     . LYS A 1 667  ? -24.59700 -46.51800 -30.28300 1.000 83.93941  ? 667  LYS A N     1 
ATOM   4900  C  CA    . LYS A 1 667  ? -25.38200 -45.78200 -29.30600 1.000 78.00982  ? 667  LYS A CA    1 
ATOM   4901  C  C     . LYS A 1 667  ? -26.15800 -44.67200 -29.99800 1.000 79.10817  ? 667  LYS A C     1 
ATOM   4902  O  O     . LYS A 1 667  ? -25.76700 -44.18800 -31.06400 1.000 83.67783  ? 667  LYS A O     1 
ATOM   4903  C  CB    . LYS A 1 667  ? -24.50400 -45.16800 -28.20500 1.000 80.09222  ? 667  LYS A CB    1 
ATOM   4904  C  CG    . LYS A 1 667  ? -23.78800 -46.17100 -27.32000 1.000 90.19888  ? 667  LYS A CG    1 
ATOM   4905  C  CD    . LYS A 1 667  ? -23.04600 -45.45300 -26.20100 1.000 90.25920  ? 667  LYS A CD    1 
ATOM   4906  C  CE    . LYS A 1 667  ? -21.71200 -46.11100 -25.89800 1.000 85.47879  ? 667  LYS A CE    1 
ATOM   4907  N  NZ    . LYS A 1 667  ? -20.75600 -45.14600 -25.28600 1.000 92.77473  ? 667  LYS A NZ    1 
ATOM   4908  N  N     . VAL A 1 668  ? -27.26500 -44.27400 -29.37700 1.000 69.68475  ? 668  VAL A N     1 
ATOM   4909  C  CA    . VAL A 1 668  ? -28.03300 -43.10800 -29.78900 1.000 69.76601  ? 668  VAL A CA    1 
ATOM   4910  C  C     . VAL A 1 668  ? -27.87400 -42.03700 -28.71900 1.000 75.07574  ? 668  VAL A C     1 
ATOM   4911  O  O     . VAL A 1 668  ? -27.81200 -42.34200 -27.52200 1.000 84.38839  ? 668  VAL A O     1 
ATOM   4912  C  CB    . VAL A 1 668  ? -29.51700 -43.45200 -30.03400 1.000 72.57769  ? 668  VAL A CB    1 
ATOM   4913  C  CG1   . VAL A 1 668  ? -29.63500 -44.59700 -31.02900 1.000 74.87199  ? 668  VAL A CG1   1 
ATOM   4914  C  CG2   . VAL A 1 668  ? -30.21700 -43.81500 -28.73200 1.000 75.65433  ? 668  VAL A CG2   1 
ATOM   4915  N  N     . PHE A 1 669  ? -27.77800 -40.78100 -29.15300 1.000 69.37919  ? 669  PHE A N     1 
ATOM   4916  C  CA    . PHE A 1 669  ? -27.53900 -39.67200 -28.24100 1.000 69.80883  ? 669  PHE A CA    1 
ATOM   4917  C  C     . PHE A 1 669  ? -28.69100 -38.68100 -28.18000 1.000 73.45945  ? 669  PHE A C     1 
ATOM   4918  O  O     . PHE A 1 669  ? -28.63100 -37.73900 -27.38100 1.000 75.05230  ? 669  PHE A O     1 
ATOM   4919  C  CB    . PHE A 1 669  ? -26.24600 -38.93900 -28.62300 1.000 72.56190  ? 669  PHE A CB    1 
ATOM   4920  C  CG    . PHE A 1 669  ? -24.99700 -39.71300 -28.30500 1.000 80.17764  ? 669  PHE A CG    1 
ATOM   4921  C  CD1   . PHE A 1 669  ? -24.47800 -40.62300 -29.21200 1.000 75.71857  ? 669  PHE A CD1   1 
ATOM   4922  C  CD2   . PHE A 1 669  ? -24.34500 -39.53600 -27.09500 1.000 85.08683  ? 669  PHE A CD2   1 
ATOM   4923  C  CE1   . PHE A 1 669  ? -23.33100 -41.33800 -28.92000 1.000 79.78896  ? 669  PHE A CE1   1 
ATOM   4924  C  CE2   . PHE A 1 669  ? -23.19800 -40.24700 -26.79700 1.000 82.53077  ? 669  PHE A CE2   1 
ATOM   4925  C  CZ    . PHE A 1 669  ? -22.69000 -41.14900 -27.71100 1.000 83.82934  ? 669  PHE A CZ    1 
ATOM   4926  N  N     . CYS A 1 670  ? -29.73600 -38.86800 -28.98100 1.000 75.27342  ? 670  CYS A N     1 
ATOM   4927  C  CA    . CYS A 1 670  ? -30.91800 -38.01800 -28.93700 1.000 74.00664  ? 670  CYS A CA    1 
ATOM   4928  C  C     . CYS A 1 670  ? -32.00700 -38.66500 -29.77700 1.000 73.67627  ? 670  CYS A C     1 
ATOM   4929  O  O     . CYS A 1 670  ? -31.73100 -39.50100 -30.64300 1.000 72.82832  ? 670  CYS A O     1 
ATOM   4930  C  CB    . CYS A 1 670  ? -30.62500 -36.60300 -29.44500 1.000 68.99523  ? 670  CYS A CB    1 
ATOM   4931  S  SG    . CYS A 1 670  ? -30.17600 -36.51200 -31.19100 1.000 71.89632  ? 670  CYS A SG    1 
ATOM   4932  N  N     . VAL A 1 671  ? -33.25200 -38.26900 -29.51000 1.000 71.08958  ? 671  VAL A N     1 
ATOM   4933  C  CA    . VAL A 1 671  ? -34.36300 -38.73600 -30.32600 1.000 66.96700  ? 671  VAL A CA    1 
ATOM   4934  C  C     . VAL A 1 671  ? -34.31200 -38.04900 -31.68600 1.000 70.35630  ? 671  VAL A C     1 
ATOM   4935  O  O     . VAL A 1 671  ? -33.89100 -36.89100 -31.81400 1.000 73.73742  ? 671  VAL A O     1 
ATOM   4936  C  CB    . VAL A 1 671  ? -35.71100 -38.49000 -29.62300 1.000 75.65027  ? 671  VAL A CB    1 
ATOM   4937  C  CG1   . VAL A 1 671  ? -35.72900 -39.16600 -28.26000 1.000 74.60374  ? 671  VAL A CG1   1 
ATOM   4938  C  CG2   . VAL A 1 671  ? -35.98700 -36.99900 -29.49000 1.000 80.58846  ? 671  VAL A CG2   1 
ATOM   4939  N  N     . GLY A 1 672  ? -34.72900 -38.77500 -32.71800 1.000 70.97518  ? 672  GLY A N     1 
ATOM   4940  C  CA    . GLY A 1 672  ? -34.67600 -38.24500 -34.06300 1.000 71.96410  ? 672  GLY A CA    1 
ATOM   4941  C  C     . GLY A 1 672  ? -33.33600 -38.36500 -34.75100 1.000 67.41318  ? 672  GLY A C     1 
ATOM   4942  O  O     . GLY A 1 672  ? -33.15500 -37.77500 -35.82200 1.000 68.79458  ? 672  GLY A O     1 
ATOM   4943  N  N     . GLN A 1 673  ? -32.38900 -39.09900 -34.17200 1.000 66.98516  ? 673  GLN A N     1 
ATOM   4944  C  CA    . GLN A 1 673  ? -31.10800 -39.32400 -34.82500 1.000 68.82358  ? 673  GLN A CA    1 
ATOM   4945  C  C     . GLN A 1 673  ? -31.25200 -40.40700 -35.88500 1.000 67.35609  ? 673  GLN A C     1 
ATOM   4946  O  O     . GLN A 1 673  ? -31.97400 -41.39000 -35.69500 1.000 68.95182  ? 673  GLN A O     1 
ATOM   4947  C  CB    . GLN A 1 673  ? -30.04100 -39.72400 -33.80600 1.000 66.36657  ? 673  GLN A CB    1 
ATOM   4948  C  CG    . GLN A 1 673  ? -28.64700 -39.87300 -34.40200 1.000 78.13448  ? 673  GLN A CG    1 
ATOM   4949  C  CD    . GLN A 1 673  ? -27.67200 -40.55600 -33.46200 1.000 72.38314  ? 673  GLN A CD    1 
ATOM   4950  O  OE1   . GLN A 1 673  ? -28.03300 -40.95600 -32.35700 1.000 69.59666  ? 673  GLN A OE1   1 
ATOM   4951  N  NE2   . GLN A 1 673  ? -26.42500 -40.68900 -33.90000 1.000 75.47262  ? 673  GLN A NE2   1 
ATOM   4952  N  N     . LEU A 1 674  ? -30.56000 -40.22100 -37.00600 1.000 58.78351  ? 674  LEU A N     1 
ATOM   4953  C  CA    . LEU A 1 674  ? -30.66700 -41.15400 -38.11800 1.000 60.62267  ? 674  LEU A CA    1 
ATOM   4954  C  C     . LEU A 1 674  ? -30.05500 -42.50000 -37.74600 1.000 65.36012  ? 674  LEU A C     1 
ATOM   4955  O  O     . LEU A 1 674  ? -28.90000 -42.57300 -37.31600 1.000 67.46082  ? 674  LEU A O     1 
ATOM   4956  C  CB    . LEU A 1 674  ? -29.97900 -40.57800 -39.35400 1.000 66.83484  ? 674  LEU A CB    1 
ATOM   4957  C  CG    . LEU A 1 674  ? -30.35600 -39.13900 -39.71800 1.000 62.31783  ? 674  LEU A CG    1 
ATOM   4958  C  CD1   . LEU A 1 674  ? -29.71100 -38.72700 -41.03200 1.000 58.64279  ? 674  LEU A CD1   1 
ATOM   4959  C  CD2   . LEU A 1 674  ? -31.86700 -38.97000 -39.78300 1.000 56.30659  ? 674  LEU A CD2   1 
ATOM   4960  N  N     . VAL A 1 675  ? -30.83700 -43.56600 -37.90800 1.000 68.32513  ? 675  VAL A N     1 
ATOM   4961  C  CA    . VAL A 1 675  ? -30.39800 -44.92800 -37.60800 1.000 71.86441  ? 675  VAL A CA    1 
ATOM   4962  C  C     . VAL A 1 675  ? -30.32500 -45.77600 -38.87700 1.000 75.69366  ? 675  VAL A C     1 
ATOM   4963  O  O     . VAL A 1 675  ? -29.27300 -46.32500 -39.20800 1.000 73.56216  ? 675  VAL A O     1 
ATOM   4964  C  CB    . VAL A 1 675  ? -31.30600 -45.58400 -36.54500 1.000 69.86278  ? 675  VAL A CB    1 
ATOM   4965  C  CG1   . VAL A 1 675  ? -30.87300 -47.01900 -36.29000 1.000 62.43605  ? 675  VAL A CG1   1 
ATOM   4966  C  CG2   . VAL A 1 675  ? -31.28200 -44.77500 -35.25700 1.000 66.83398  ? 675  VAL A CG2   1 
ATOM   4967  N  N     . CYS A 1 676  ? -31.43700 -45.89600 -39.59800 1.000 68.75664  ? 676  CYS A N     1 
ATOM   4968  C  CA    . CYS A 1 676  ? -31.47000 -46.60400 -40.86800 1.000 67.44482  ? 676  CYS A CA    1 
ATOM   4969  C  C     . CYS A 1 676  ? -32.02800 -45.69400 -41.95300 1.000 68.59986  ? 676  CYS A C     1 
ATOM   4970  O  O     . CYS A 1 676  ? -32.64200 -44.65900 -41.67700 1.000 60.15344  ? 676  CYS A O     1 
ATOM   4971  C  CB    . CYS A 1 676  ? -32.31300 -47.88500 -40.78600 1.000 63.18387  ? 676  CYS A CB    1 
ATOM   4972  S  SG    . CYS A 1 676  ? -31.72000 -49.12100 -39.61000 1.000 87.30411  ? 676  CYS A SG    1 
ATOM   4973  N  N     . ALA A 1 677  ? -31.80200 -46.09700 -43.20200 1.000 68.79849  ? 677  ALA A N     1 
ATOM   4974  C  CA    . ALA A 1 677  ? -32.31300 -45.38900 -44.37100 1.000 58.02074  ? 677  ALA A CA    1 
ATOM   4975  C  C     . ALA A 1 677  ? -32.99100 -46.40800 -45.27600 1.000 56.68127  ? 677  ALA A C     1 
ATOM   4976  O  O     . ALA A 1 677  ? -32.31600 -47.22700 -45.90800 1.000 62.67846  ? 677  ALA A O     1 
ATOM   4977  C  CB    . ALA A 1 677  ? -31.19200 -44.65600 -45.10900 1.000 60.37093  ? 677  ALA A CB    1 
ATOM   4978  N  N     . VAL A 1 678  ? -34.31800 -46.36300 -45.33200 1.000 54.23519  ? 678  VAL A N     1 
ATOM   4979  C  CA    . VAL A 1 678  ? -35.09400 -47.29600 -46.14000 1.000 55.05897  ? 678  VAL A CA    1 
ATOM   4980  C  C     . VAL A 1 678  ? -35.21200 -46.74300 -47.55300 1.000 57.75242  ? 678  VAL A C     1 
ATOM   4981  O  O     . VAL A 1 678  ? -35.55000 -45.56900 -47.74800 1.000 55.21577  ? 678  VAL A O     1 
ATOM   4982  C  CB    . VAL A 1 678  ? -36.48200 -47.53700 -45.52100 1.000 52.49169  ? 678  VAL A CB    1 
ATOM   4983  C  CG1   . VAL A 1 678  ? -37.27800 -48.52000 -46.36700 1.000 57.73256  ? 678  VAL A CG1   1 
ATOM   4984  C  CG2   . VAL A 1 678  ? -36.34400 -48.04400 -44.09400 1.000 52.33223  ? 678  VAL A CG2   1 
ATOM   4985  N  N     . LEU A 1 679  ? -34.93200 -47.59000 -48.54100 1.000 56.56874  ? 679  LEU A N     1 
ATOM   4986  C  CA    . LEU A 1 679  ? -34.97800 -47.21900 -49.95000 1.000 55.38265  ? 679  LEU A CA    1 
ATOM   4987  C  C     . LEU A 1 679  ? -35.97700 -48.12600 -50.65300 1.000 52.73717  ? 679  LEU A C     1 
ATOM   4988  O  O     . LEU A 1 679  ? -35.80400 -49.35000 -50.66800 1.000 59.44553  ? 679  LEU A O     1 
ATOM   4989  C  CB    . LEU A 1 679  ? -33.59200 -47.33700 -50.58800 1.000 50.89366  ? 679  LEU A CB    1 
ATOM   4990  C  CG    . LEU A 1 679  ? -33.42300 -46.84200 -52.02400 1.000 53.28194  ? 679  LEU A CG    1 
ATOM   4991  C  CD1   . LEU A 1 679  ? -33.68600 -45.34700 -52.10600 1.000 52.69389  ? 679  LEU A CD1   1 
ATOM   4992  C  CD2   . LEU A 1 679  ? -32.03300 -47.17400 -52.54100 1.000 54.55469  ? 679  LEU A CD2   1 
ATOM   4993  N  N     . ALA A 1 680  ? -37.01900 -47.53200 -51.23200 1.000 43.16192  ? 680  ALA A N     1 
ATOM   4994  C  CA    . ALA A 1 680  ? -38.09200 -48.29700 -51.84900 1.000 53.09548  ? 680  ALA A CA    1 
ATOM   4995  C  C     . ALA A 1 680  ? -38.49400 -47.65600 -53.17000 1.000 56.14736  ? 680  ALA A C     1 
ATOM   4996  O  O     . ALA A 1 680  ? -38.06500 -46.55000 -53.51000 1.000 52.42475  ? 680  ALA A O     1 
ATOM   4997  C  CB    . ALA A 1 680  ? -39.30600 -48.41200 -50.91900 1.000 59.83372  ? 680  ALA A CB    1 
ATOM   4998  N  N     . ASP A 1 681  ? -39.34000 -48.37500 -53.91500 1.000 53.57011  ? 681  ASP A N     1 
ATOM   4999  C  CA    . ASP A 1 681  ? -39.77500 -47.90400 -55.22600 1.000 55.12958  ? 681  ASP A CA    1 
ATOM   5000  C  C     . ASP A 1 681  ? -40.65800 -46.66800 -55.12200 1.000 58.32839  ? 681  ASP A C     1 
ATOM   5001  O  O     . ASP A 1 681  ? -40.61500 -45.80300 -56.00400 1.000 60.73693  ? 681  ASP A O     1 
ATOM   5002  C  CB    . ASP A 1 681  ? -40.52000 -49.01800 -55.96300 1.000 58.57991  ? 681  ASP A CB    1 
ATOM   5003  C  CG    . ASP A 1 681  ? -39.60600 -50.14700 -56.39400 1.000 70.69269  ? 681  ASP A CG    1 
ATOM   5004  O  OD1   . ASP A 1 681  ? -38.40700 -49.88900 -56.62900 1.000 75.46361  ? 681  ASP A OD1   1 
ATOM   5005  O  OD2   . ASP A 1 681  ? -40.08800 -51.29500 -56.49900 1.000 72.58242  ? 681  ASP A OD2   1 
ATOM   5006  N  N     . SER A 1 682  ? -41.46500 -46.56900 -54.06900 1.000 60.09962  ? 682  SER A N     1 
ATOM   5007  C  CA    . SER A 1 682  ? -42.36600 -45.44500 -53.88100 1.000 59.92195  ? 682  SER A CA    1 
ATOM   5008  C  C     . SER A 1 682  ? -42.26300 -44.94100 -52.44800 1.000 57.72990  ? 682  SER A C     1 
ATOM   5009  O  O     . SER A 1 682  ? -41.76900 -45.63400 -51.55500 1.000 59.54057  ? 682  SER A O     1 
ATOM   5010  C  CB    . SER A 1 682  ? -43.81800 -45.82700 -54.20300 1.000 59.50580  ? 682  SER A CB    1 
ATOM   5011  O  OG    . SER A 1 682  ? -44.30300 -46.79900 -53.29400 1.000 63.44371  ? 682  SER A OG    1 
ATOM   5012  N  N     . GLU A 1 683  ? -42.73900 -43.71000 -52.24200 1.000 58.14506  ? 683  GLU A N     1 
ATOM   5013  C  CA    . GLU A 1 683  ? -42.71200 -43.11800 -50.90900 1.000 55.48460  ? 683  GLU A CA    1 
ATOM   5014  C  C     . GLU A 1 683  ? -43.55900 -43.91800 -49.92800 1.000 60.45885  ? 683  GLU A C     1 
ATOM   5015  O  O     . GLU A 1 683  ? -43.16300 -44.11900 -48.77400 1.000 61.03989  ? 683  GLU A O     1 
ATOM   5016  C  CB    . GLU A 1 683  ? -43.19500 -41.66900 -50.97100 1.000 54.12009  ? 683  GLU A CB    1 
ATOM   5017  C  CG    . GLU A 1 683  ? -43.35300 -41.01300 -49.60900 1.000 56.71746  ? 683  GLU A CG    1 
ATOM   5018  C  CD    . GLU A 1 683  ? -43.85300 -39.58500 -49.69900 1.000 70.05182  ? 683  GLU A CD    1 
ATOM   5019  O  OE1   . GLU A 1 683  ? -44.20500 -39.14500 -50.81400 1.000 64.43216  ? 683  GLU A OE1   1 
ATOM   5020  O  OE2   . GLU A 1 683  ? -43.89800 -38.90300 -48.65300 1.000 76.51553  ? 683  GLU A OE2   1 
ATOM   5021  N  N     . VAL A 1 684  ? -44.72800 -44.38500 -50.37200 1.000 66.78984  ? 684  VAL A N     1 
ATOM   5022  C  CA    . VAL A 1 684  ? -45.63700 -45.10100 -49.47900 1.000 64.62845  ? 684  VAL A CA    1 
ATOM   5023  C  C     . VAL A 1 684  ? -45.00900 -46.41100 -49.01900 1.000 63.40000  ? 684  VAL A C     1 
ATOM   5024  O  O     . VAL A 1 684  ? -44.97700 -46.71800 -47.82100 1.000 70.32526  ? 684  VAL A O     1 
ATOM   5025  C  CB    . VAL A 1 684  ? -46.99200 -45.33700 -50.17100 1.000 64.53162  ? 684  VAL A CB    1 
ATOM   5026  C  CG1   . VAL A 1 684  ? -47.88400 -46.20700 -49.30300 1.000 61.19703  ? 684  VAL A CG1   1 
ATOM   5027  C  CG2   . VAL A 1 684  ? -47.66700 -44.00900 -50.47800 1.000 59.89754  ? 684  VAL A CG2   1 
ATOM   5028  N  N     . GLN A 1 685  ? -44.49900 -47.20300 -49.96600 1.000 56.43470  ? 685  GLN A N     1 
ATOM   5029  C  CA    . GLN A 1 685  ? -43.85100 -48.46200 -49.61400 1.000 53.87104  ? 685  GLN A CA    1 
ATOM   5030  C  C     . GLN A 1 685  ? -42.61100 -48.25100 -48.75700 1.000 59.04687  ? 685  GLN A C     1 
ATOM   5031  O  O     . GLN A 1 685  ? -42.22200 -49.16000 -48.01500 1.000 63.00919  ? 685  GLN A O     1 
ATOM   5032  C  CB    . GLN A 1 685  ? -43.48300 -49.23500 -50.88200 1.000 53.01024  ? 685  GLN A CB    1 
ATOM   5033  C  CG    . GLN A 1 685  ? -44.67800 -49.63600 -51.73200 1.000 60.06250  ? 685  GLN A CG    1 
ATOM   5034  C  CD    . GLN A 1 685  ? -44.27900 -50.08900 -53.12100 1.000 58.58493  ? 685  GLN A CD    1 
ATOM   5035  O  OE1   . GLN A 1 685  ? -43.48200 -49.43600 -53.79400 1.000 60.57014  ? 685  GLN A OE1   1 
ATOM   5036  N  NE2   . GLN A 1 685  ? -44.83300 -51.21400 -53.56000 1.000 63.83420  ? 685  GLN A NE2   1 
ATOM   5037  N  N     . ALA A 1 686  ? -41.98800 -47.07500 -48.83700 1.000 61.68802  ? 686  ALA A N     1 
ATOM   5038  C  CA    . ALA A 1 686  ? -40.80700 -46.80200 -48.02600 1.000 59.22807  ? 686  ALA A CA    1 
ATOM   5039  C  C     . ALA A 1 686  ? -41.16900 -46.67600 -46.55100 1.000 60.41127  ? 686  ALA A C     1 
ATOM   5040  O  O     . ALA A 1 686  ? -40.58300 -47.35300 -45.69800 1.000 66.28859  ? 686  ALA A O     1 
ATOM   5041  C  CB    . ALA A 1 686  ? -40.11300 -45.53400 -48.52500 1.000 58.61462  ? 686  ALA A CB    1 
ATOM   5042  N  N     . LYS A 1 687  ? -42.13800 -45.81300 -46.23100 1.000 55.46159  ? 687  LYS A N     1 
ATOM   5043  C  CA    . LYS A 1 687  ? -42.52000 -45.61400 -44.83500 1.000 62.22161  ? 687  LYS A CA    1 
ATOM   5044  C  C     . LYS A 1 687  ? -43.11400 -46.87900 -44.23100 1.000 61.07495  ? 687  LYS A C     1 
ATOM   5045  O  O     . LYS A 1 687  ? -42.90200 -47.16700 -43.04700 1.000 64.82433  ? 687  LYS A O     1 
ATOM   5046  C  CB    . LYS A 1 687  ? -43.50900 -44.45400 -44.71600 1.000 64.87744  ? 687  LYS A CB    1 
ATOM   5047  C  CG    . LYS A 1 687  ? -43.12300 -43.20800 -45.49200 1.000 62.31163  ? 687  LYS A CG    1 
ATOM   5048  C  CD    . LYS A 1 687  ? -43.60200 -41.95900 -44.76800 1.000 70.80752  ? 687  LYS A CD    1 
ATOM   5049  C  CE    . LYS A 1 687  ? -42.70200 -40.77000 -45.05500 1.000 71.54162  ? 687  LYS A CE    1 
ATOM   5050  N  NZ    . LYS A 1 687  ? -42.89400 -40.25300 -46.43600 1.000 76.56702  ? 687  LYS A NZ    1 
ATOM   5051  N  N     . ARG A 1 688  ? -43.86800 -47.64300 -45.02500 1.000 62.50811  ? 688  ARG A N     1 
ATOM   5052  C  CA    . ARG A 1 688  ? -44.46600 -48.87800 -44.52400 1.000 61.58758  ? 688  ARG A CA    1 
ATOM   5053  C  C     . ARG A 1 688  ? -43.39700 -49.83600 -44.01700 1.000 62.04122  ? 688  ARG A C     1 
ATOM   5054  O  O     . ARG A 1 688  ? -43.53600 -50.43100 -42.94200 1.000 65.78618  ? 688  ARG A O     1 
ATOM   5055  C  CB    . ARG A 1 688  ? -45.30100 -49.53700 -45.62200 1.000 61.00897  ? 688  ARG A CB    1 
ATOM   5056  C  CG    . ARG A 1 688  ? -46.70000 -48.97100 -45.77600 1.000 51.83683  ? 688  ARG A CG    1 
ATOM   5057  C  CD    . ARG A 1 688  ? -47.43500 -49.66700 -46.90700 1.000 56.65282  ? 688  ARG A CD    1 
ATOM   5058  N  NE    . ARG A 1 688  ? -48.71300 -49.03400 -47.21000 1.000 63.34287  ? 688  ARG A NE    1 
ATOM   5059  C  CZ    . ARG A 1 688  ? -49.38200 -49.21600 -48.34400 1.000 71.42337  ? 688  ARG A CZ    1 
ATOM   5060  N  NH1   . ARG A 1 688  ? -48.88900 -50.01300 -49.28300 1.000 79.71928  ? 688  ARG A NH1   1 
ATOM   5061  N  NH2   . ARG A 1 688  ? -50.54000 -48.60200 -48.54100 1.000 69.91990  ? 688  ARG A NH2   1 
ATOM   5062  N  N     . ALA A 1 689  ? -42.31600 -49.99900 -44.78300 1.000 63.31828  ? 689  ALA A N     1 
ATOM   5063  C  CA    . ALA A 1 689  ? -41.21800 -50.84700 -44.33600 1.000 64.07738  ? 689  ALA A CA    1 
ATOM   5064  C  C     . ALA A 1 689  ? -40.45100 -50.20900 -43.18600 1.000 66.22196  ? 689  ALA A C     1 
ATOM   5065  O  O     . ALA A 1 689  ? -39.90300 -50.92100 -42.33700 1.000 68.89541  ? 689  ALA A O     1 
ATOM   5066  C  CB    . ALA A 1 689  ? -40.27600 -51.14600 -45.49900 1.000 61.60104  ? 689  ALA A CB    1 
ATOM   5067  N  N     . ALA A 1 690  ? -40.40100 -48.87500 -43.14200 1.000 61.95159  ? 690  ALA A N     1 
ATOM   5068  C  CA    . ALA A 1 690  ? -39.71300 -48.19700 -42.04900 1.000 63.64120  ? 690  ALA A CA    1 
ATOM   5069  C  C     . ALA A 1 690  ? -40.39400 -48.47400 -40.71400 1.000 69.76549  ? 690  ALA A C     1 
ATOM   5070  O  O     . ALA A 1 690  ? -39.72300 -48.62800 -39.68700 1.000 73.20357  ? 690  ALA A O     1 
ATOM   5071  C  CB    . ALA A 1 690  ? -39.65200 -46.69400 -42.32100 1.000 63.11672  ? 690  ALA A CB    1 
ATOM   5072  N  N     . LYS A 1 691  ? -41.72700 -48.54600 -40.71000 1.000 65.59228  ? 691  LYS A N     1 
ATOM   5073  C  CA    . LYS A 1 691  ? -42.46000 -48.84100 -39.48600 1.000 66.83480  ? 691  LYS A CA    1 
ATOM   5074  C  C     . LYS A 1 691  ? -42.36200 -50.30400 -39.07700 1.000 66.86680  ? 691  LYS A C     1 
ATOM   5075  O  O     . LYS A 1 691  ? -42.77800 -50.64500 -37.96400 1.000 64.81286  ? 691  LYS A O     1 
ATOM   5076  C  CB    . LYS A 1 691  ? -43.93100 -48.44800 -39.64200 1.000 63.13588  ? 691  LYS A CB    1 
ATOM   5077  C  CG    . LYS A 1 691  ? -44.15200 -46.98900 -40.00400 1.000 69.51906  ? 691  LYS A CG    1 
ATOM   5078  C  CD    . LYS A 1 691  ? -45.58100 -46.56200 -39.70700 1.000 86.19327  ? 691  LYS A CD    1 
ATOM   5079  C  CE    . LYS A 1 691  ? -45.89400 -45.20000 -40.30800 1.000 89.34108  ? 691  LYS A CE    1 
ATOM   5080  N  NZ    . LYS A 1 691  ? -46.06300 -45.26800 -41.78600 1.000 83.32739  ? 691  LYS A NZ    1 
ATOM   5081  N  N     . ARG A 1 692  ? -41.82800 -51.17000 -39.93500 1.000 64.65330  ? 692  ARG A N     1 
ATOM   5082  C  CA    . ARG A 1 692  ? -41.65200 -52.57800 -39.61000 1.000 70.18050  ? 692  ARG A CA    1 
ATOM   5083  C  C     . ARG A 1 692  ? -40.21900 -52.92100 -39.22900 1.000 69.63118  ? 692  ARG A C     1 
ATOM   5084  O  O     . ARG A 1 692  ? -39.92600 -54.09100 -38.96200 1.000 74.64477  ? 692  ARG A O     1 
ATOM   5085  C  CB    . ARG A 1 692  ? -42.10600 -53.45400 -40.78200 1.000 70.02907  ? 692  ARG A CB    1 
ATOM   5086  C  CG    . ARG A 1 692  ? -43.61900 -53.65200 -40.87300 1.000 70.91383  ? 692  ARG A CG    1 
ATOM   5087  C  CD    . ARG A 1 692  ? -44.14500 -54.61700 -39.81400 1.000 82.88303  ? 692  ARG A CD    1 
ATOM   5088  N  NE    . ARG A 1 692  ? -44.29000 -53.99700 -38.49900 1.000 89.97969  ? 692  ARG A NE    1 
ATOM   5089  C  CZ    . ARG A 1 692  ? -44.40900 -54.67600 -37.36300 1.000 92.04585  ? 692  ARG A CZ    1 
ATOM   5090  N  NH1   . ARG A 1 692  ? -44.40000 -56.00200 -37.37700 1.000 91.49956  ? 692  ARG A NH1   1 
ATOM   5091  N  NH2   . ARG A 1 692  ? -44.53600 -54.03000 -36.21100 1.000 89.36193  ? 692  ARG A NH2   1 
ATOM   5092  N  N     . VAL A 1 693  ? -39.32300 -51.93900 -39.20300 1.000 74.75287  ? 693  VAL A N     1 
ATOM   5093  C  CA    . VAL A 1 693  ? -37.97000 -52.14500 -38.69800 1.000 73.37587  ? 693  VAL A CA    1 
ATOM   5094  C  C     . VAL A 1 693  ? -38.02900 -52.18700 -37.17700 1.000 74.20687  ? 693  VAL A C     1 
ATOM   5095  O  O     . VAL A 1 693  ? -38.45600 -51.22100 -36.53600 1.000 75.28819  ? 693  VAL A O     1 
ATOM   5096  C  CB    . VAL A 1 693  ? -37.02000 -51.04000 -39.18300 1.000 69.91237  ? 693  VAL A CB    1 
ATOM   5097  C  CG1   . VAL A 1 693  ? -35.67800 -51.15100 -38.47800 1.000 70.04553  ? 693  VAL A CG1   1 
ATOM   5098  C  CG2   . VAL A 1 693  ? -36.84200 -51.11300 -40.69000 1.000 68.10876  ? 693  VAL A CG2   1 
ATOM   5099  N  N     . LYS A 1 694  ? -37.60800 -53.30600 -36.59700 1.000 77.35092  ? 694  LYS A N     1 
ATOM   5100  C  CA    . LYS A 1 694  ? -37.63900 -53.49900 -35.15300 1.000 80.99137  ? 694  LYS A CA    1 
ATOM   5101  C  C     . LYS A 1 694  ? -36.25000 -53.23500 -34.58500 1.000 73.99226  ? 694  LYS A C     1 
ATOM   5102  O  O     . LYS A 1 694  ? -35.28400 -53.91100 -34.95500 1.000 76.66708  ? 694  LYS A O     1 
ATOM   5103  C  CB    . LYS A 1 694  ? -38.10900 -54.91000 -34.80000 1.000 84.25779  ? 694  LYS A CB    1 
ATOM   5104  C  CG    . LYS A 1 694  ? -39.60900 -55.11700 -34.95600 1.000 83.40064  ? 694  LYS A CG    1 
ATOM   5105  C  CD    . LYS A 1 694  ? -40.38500 -54.42200 -33.84800 1.000 94.88654  ? 694  LYS A CD    1 
ATOM   5106  C  CE    . LYS A 1 694  ? -41.86900 -54.74200 -33.92900 1.000 100.39091 ? 694  LYS A CE    1 
ATOM   5107  N  NZ    . LYS A 1 694  ? -42.61500 -54.23500 -32.74400 1.000 88.03082  ? 694  LYS A NZ    1 
ATOM   5108  N  N     . ILE A 1 695  ? -36.15500 -52.25200 -33.69400 1.000 73.78466  ? 695  ILE A N     1 
ATOM   5109  C  CA    . ILE A 1 695  ? -34.90200 -51.87200 -33.05200 1.000 78.38051  ? 695  ILE A CA    1 
ATOM   5110  C  C     . ILE A 1 695  ? -35.08200 -51.99400 -31.54600 1.000 77.90714  ? 695  ILE A C     1 
ATOM   5111  O  O     . ILE A 1 695  ? -36.04200 -51.45200 -30.98600 1.000 83.45724  ? 695  ILE A O     1 
ATOM   5112  C  CB    . ILE A 1 695  ? -34.47500 -50.44200 -33.43600 1.000 77.66869  ? 695  ILE A CB    1 
ATOM   5113  C  CG1   . ILE A 1 695  ? -34.37900 -50.30100 -34.95600 1.000 75.35245  ? 695  ILE A CG1   1 
ATOM   5114  C  CG2   . ILE A 1 695  ? -33.14800 -50.08900 -32.78300 1.000 70.87323  ? 695  ILE A CG2   1 
ATOM   5115  C  CD1   . ILE A 1 695  ? -34.15000 -48.87900 -35.42400 1.000 71.74127  ? 695  ILE A CD1   1 
ATOM   5116  N  N     . VAL A 1 696  ? -34.16400 -52.70400 -30.89600 1.000 77.41986  ? 696  VAL A N     1 
ATOM   5117  C  CA    . VAL A 1 696  ? -34.18900 -52.90400 -29.45200 1.000 80.92173  ? 696  VAL A CA    1 
ATOM   5118  C  C     . VAL A 1 696  ? -33.10600 -52.03400 -28.82800 1.000 78.77764  ? 696  VAL A C     1 
ATOM   5119  O  O     . VAL A 1 696  ? -32.01900 -51.87500 -29.39600 1.000 79.38898  ? 696  VAL A O     1 
ATOM   5120  C  CB    . VAL A 1 696  ? -33.99500 -54.38800 -29.08500 1.000 77.41226  ? 696  VAL A CB    1 
ATOM   5121  C  CG1   . VAL A 1 696  ? -34.31500 -54.62400 -27.61700 1.000 80.29926  ? 696  VAL A CG1   1 
ATOM   5122  C  CG2   . VAL A 1 696  ? -34.86300 -55.26900 -29.97100 1.000 80.92648  ? 696  VAL A CG2   1 
ATOM   5123  N  N     . TYR A 1 697  ? -33.40600 -51.46900 -27.66200 1.000 78.69268  ? 697  TYR A N     1 
ATOM   5124  C  CA    . TYR A 1 697  ? -32.52900 -50.51800 -26.99800 1.000 80.69702  ? 697  TYR A CA    1 
ATOM   5125  C  C     . TYR A 1 697  ? -32.19300 -50.98500 -25.58700 1.000 85.18893  ? 697  TYR A C     1 
ATOM   5126  O  O     . TYR A 1 697  ? -32.79200 -51.91900 -25.04700 1.000 90.85040  ? 697  TYR A O     1 
ATOM   5127  C  CB    . TYR A 1 697  ? -33.17000 -49.12500 -26.93700 1.000 78.03644  ? 697  TYR A CB    1 
ATOM   5128  C  CG    . TYR A 1 697  ? -33.47500 -48.51200 -28.28300 1.000 75.16132  ? 697  TYR A CG    1 
ATOM   5129  C  CD1   . TYR A 1 697  ? -34.70500 -48.70900 -28.89500 1.000 78.04174  ? 697  TYR A CD1   1 
ATOM   5130  C  CD2   . TYR A 1 697  ? -32.53800 -47.72100 -28.93600 1.000 79.52453  ? 697  TYR A CD2   1 
ATOM   5131  C  CE1   . TYR A 1 697  ? -34.99200 -48.14500 -30.12300 1.000 78.18636  ? 697  TYR A CE1   1 
ATOM   5132  C  CE2   . TYR A 1 697  ? -32.81600 -47.15200 -30.16500 1.000 79.05953  ? 697  TYR A CE2   1 
ATOM   5133  C  CZ    . TYR A 1 697  ? -34.04400 -47.36700 -30.75300 1.000 77.82229  ? 697  TYR A CZ    1 
ATOM   5134  O  OH    . TYR A 1 697  ? -34.32500 -46.80300 -31.97600 1.000 79.33228  ? 697  TYR A OH    1 
ATOM   5135  N  N     . GLN A 1 698  ? -31.21200 -50.30500 -24.99600 1.000 84.59927  ? 698  GLN A N     1 
ATOM   5136  C  CA    . GLN A 1 698  ? -30.86200 -50.45900 -23.58700 1.000 81.86786  ? 698  GLN A CA    1 
ATOM   5137  C  C     . GLN A 1 698  ? -30.43700 -49.08500 -23.08900 1.000 84.38799  ? 698  GLN A C     1 
ATOM   5138  O  O     . GLN A 1 698  ? -29.35900 -48.60400 -23.45100 1.000 84.80342  ? 698  GLN A O     1 
ATOM   5139  C  CB    . GLN A 1 698  ? -29.74800 -51.48800 -23.38900 1.000 89.91079  ? 698  GLN A CB    1 
ATOM   5140  C  CG    . GLN A 1 698  ? -29.21600 -51.55600 -21.96500 1.000 89.51262  ? 698  GLN A CG    1 
ATOM   5141  C  CD    . GLN A 1 698  ? -27.99900 -52.45100 -21.83600 1.000 92.26253  ? 698  GLN A CD    1 
ATOM   5142  O  OE1   . GLN A 1 698  ? -27.92600 -53.51400 -22.45300 1.000 96.01408  ? 698  GLN A OE1   1 
ATOM   5143  N  NE2   . GLN A 1 698  ? -27.03300 -52.02500 -21.03000 1.000 87.64254  ? 698  GLN A NE2   1 
ATOM   5144  N  N     . ASP A 1 699  ? -31.28300 -48.45600 -22.27600 1.000 81.80497  ? 699  ASP A N     1 
ATOM   5145  C  CA    . ASP A 1 699  ? -31.05800 -47.07300 -21.87700 1.000 76.02331  ? 699  ASP A CA    1 
ATOM   5146  C  C     . ASP A 1 699  ? -29.74100 -46.92200 -21.12300 1.000 80.22296  ? 699  ASP A C     1 
ATOM   5147  O  O     . ASP A 1 699  ? -29.31600 -47.80800 -20.37700 1.000 85.62589  ? 699  ASP A O     1 
ATOM   5148  C  CB    . ASP A 1 699  ? -32.21500 -46.57000 -21.01300 1.000 81.83773  ? 699  ASP A CB    1 
ATOM   5149  C  CG    . ASP A 1 699  ? -33.45000 -46.24200 -21.82900 1.000 88.88185  ? 699  ASP A CG    1 
ATOM   5150  O  OD1   . ASP A 1 699  ? -33.30900 -45.98000 -23.04200 1.000 86.78085  ? 699  ASP A OD1   1 
ATOM   5151  O  OD2   . ASP A 1 699  ? -34.56100 -46.24400 -21.25800 1.000 93.13458  ? 699  ASP A OD2   1 
ATOM   5152  N  N     . LEU A 1 700  ? -29.09500 -45.78000 -21.32900 1.000 80.57749  ? 700  LEU A N     1 
ATOM   5153  C  CA    . LEU A 1 700  ? -27.82200 -45.45600 -20.70600 1.000 76.21193  ? 700  LEU A CA    1 
ATOM   5154  C  C     . LEU A 1 700  ? -27.99300 -44.30000 -19.72800 1.000 87.30609  ? 700  LEU A C     1 
ATOM   5155  O  O     . LEU A 1 700  ? -29.02900 -43.63000 -19.68700 1.000 89.80310  ? 700  LEU A O     1 
ATOM   5156  C  CB    . LEU A 1 700  ? -26.77000 -45.11000 -21.76700 1.000 79.20899  ? 700  LEU A CB    1 
ATOM   5157  C  CG    . LEU A 1 700  ? -25.74500 -46.19700 -22.09900 1.000 88.58355  ? 700  LEU A CG    1 
ATOM   5158  C  CD1   . LEU A 1 700  ? -24.82900 -46.45200 -20.91100 1.000 98.95419  ? 700  LEU A CD1   1 
ATOM   5159  C  CD2   . LEU A 1 700  ? -26.43500 -47.48000 -22.53300 1.000 81.91729  ? 700  LEU A CD2   1 
ATOM   5160  N  N     . GLU A 1 701  ? -26.94700 -44.07400 -18.93700 1.000 87.31158  ? 701  GLU A N     1 
ATOM   5161  C  CA    . GLU A 1 701  ? -26.91400 -43.03800 -17.91900 1.000 90.47064  ? 701  GLU A CA    1 
ATOM   5162  C  C     . GLU A 1 701  ? -25.61300 -42.25700 -18.04800 1.000 90.74014  ? 701  GLU A C     1 
ATOM   5163  O  O     . GLU A 1 701  ? -24.57300 -42.84300 -18.37200 1.000 93.92062  ? 701  GLU A O     1 
ATOM   5164  C  CB    . GLU A 1 701  ? -27.02800 -43.66100 -16.51600 1.000 91.05547  ? 701  GLU A CB    1 
ATOM   5165  C  CG    . GLU A 1 701  ? -27.74600 -42.80600 -15.48100 1.000 102.36201 ? 701  GLU A CG    1 
ATOM   5166  C  CD    . GLU A 1 701  ? -29.15500 -42.43200 -15.90300 1.000 109.25883 ? 701  GLU A CD    1 
ATOM   5167  O  OE1   . GLU A 1 701  ? -29.85200 -43.28900 -16.48700 1.000 104.57467 ? 701  GLU A OE1   1 
ATOM   5168  O  OE2   . GLU A 1 701  ? -29.56500 -41.27800 -15.65300 1.000 104.14727 ? 701  GLU A OE2   1 
ATOM   5169  N  N     . PRO A 1 702  ? -25.62800 -40.93500 -17.80900 1.000 86.39728  ? 702  PRO A N     1 
ATOM   5170  C  CA    . PRO A 1 702  ? -26.76600 -40.10400 -17.40100 1.000 87.15513  ? 702  PRO A CA    1 
ATOM   5171  C  C     . PRO A 1 702  ? -27.59400 -39.57200 -18.56800 1.000 88.00437  ? 702  PRO A C     1 
ATOM   5172  O  O     . PRO A 1 702  ? -27.08200 -39.42000 -19.67700 1.000 87.93997  ? 702  PRO A O     1 
ATOM   5173  C  CB    . PRO A 1 702  ? -26.09100 -38.95600 -16.65700 1.000 89.48958  ? 702  PRO A CB    1 
ATOM   5174  C  CG    . PRO A 1 702  ? -24.81000 -38.77100 -17.39800 1.000 98.91489  ? 702  PRO A CG    1 
ATOM   5175  C  CD    . PRO A 1 702  ? -24.38000 -40.15100 -17.85400 1.000 86.72034  ? 702  PRO A CD    1 
ATOM   5176  N  N     . LEU A 1 703  ? -28.86900 -39.29100 -18.30600 1.000 83.72731  ? 703  LEU A N     1 
ATOM   5177  C  CA    . LEU A 1 703  ? -29.77300 -38.71300 -19.29900 1.000 76.89282  ? 703  LEU A CA    1 
ATOM   5178  C  C     . LEU A 1 703  ? -29.81200 -37.20800 -19.05700 1.000 82.13415  ? 703  LEU A C     1 
ATOM   5179  O  O     . LEU A 1 703  ? -30.59000 -36.70600 -18.24400 1.000 78.66443  ? 703  LEU A O     1 
ATOM   5180  C  CB    . LEU A 1 703  ? -31.15900 -39.34200 -19.21100 1.000 75.64613  ? 703  LEU A CB    1 
ATOM   5181  C  CG    . LEU A 1 703  ? -32.21200 -38.76900 -20.16200 1.000 78.94606  ? 703  LEU A CG    1 
ATOM   5182  C  CD1   . LEU A 1 703  ? -31.66200 -38.69800 -21.57500 1.000 79.82113  ? 703  LEU A CD1   1 
ATOM   5183  C  CD2   . LEU A 1 703  ? -33.48700 -39.59700 -20.12000 1.000 78.96827  ? 703  LEU A CD2   1 
ATOM   5184  N  N     . ILE A 1 704  ? -28.95800 -36.48500 -19.77300 1.000 82.12974  ? 704  ILE A N     1 
ATOM   5185  C  CA    . ILE A 1 704  ? -28.84100 -35.04000 -19.62700 1.000 85.99568  ? 704  ILE A CA    1 
ATOM   5186  C  C     . ILE A 1 704  ? -29.87000 -34.36800 -20.52600 1.000 79.93239  ? 704  ILE A C     1 
ATOM   5187  O  O     . ILE A 1 704  ? -29.93300 -34.64600 -21.72900 1.000 83.49101  ? 704  ILE A O     1 
ATOM   5188  C  CB    . ILE A 1 704  ? -27.41800 -34.57100 -19.96900 1.000 84.41891  ? 704  ILE A CB    1 
ATOM   5189  C  CG1   . ILE A 1 704  ? -26.38700 -35.38500 -19.18400 1.000 88.86733  ? 704  ILE A CG1   1 
ATOM   5190  C  CG2   . ILE A 1 704  ? -27.26800 -33.09100 -19.68400 1.000 88.28711  ? 704  ILE A CG2   1 
ATOM   5191  C  CD1   . ILE A 1 704  ? -24.95200 -35.03500 -19.50800 1.000 95.38984  ? 704  ILE A CD1   1 
ATOM   5192  N  N     . LEU A 1 705  ? -30.67400 -33.47800 -19.94400 1.000 77.37471  ? 705  LEU A N     1 
ATOM   5193  C  CA    . LEU A 1 705  ? -31.72200 -32.80000 -20.69800 1.000 76.09707  ? 705  LEU A CA    1 
ATOM   5194  C  C     . LEU A 1 705  ? -31.65400 -31.28800 -20.52800 1.000 77.37937  ? 705  LEU A C     1 
ATOM   5195  O  O     . LEU A 1 705  ? -31.67100 -30.54700 -21.51600 1.000 78.38050  ? 705  LEU A O     1 
ATOM   5196  C  CB    . LEU A 1 705  ? -33.10100 -33.31300 -20.27700 1.000 82.95614  ? 705  LEU A CB    1 
ATOM   5197  C  CG    . LEU A 1 705  ? -33.43300 -34.76100 -20.63900 1.000 82.42671  ? 705  LEU A CG    1 
ATOM   5198  C  CD1   . LEU A 1 705  ? -34.67400 -35.21700 -19.89300 1.000 75.49092  ? 705  LEU A CD1   1 
ATOM   5199  C  CD2   . LEU A 1 705  ? -33.61900 -34.91300 -22.14100 1.000 71.72166  ? 705  LEU A CD2   1 
ATOM   5200  N  N     . THR A 1 706  ? -31.58400 -30.81800 -19.28600 1.000 84.97372  ? 706  THR A N     1 
ATOM   5201  C  CA    . THR A 1 706  ? -31.55900 -29.38900 -19.01800 1.000 84.47507  ? 706  THR A CA    1 
ATOM   5202  C  C     . THR A 1 706  ? -30.12800 -28.85500 -19.06600 1.000 86.25427  ? 706  THR A C     1 
ATOM   5203  O  O     . THR A 1 706  ? -29.15400 -29.60800 -19.14200 1.000 76.08208  ? 706  THR A O     1 
ATOM   5204  C  CB    . THR A 1 706  ? -32.19100 -29.08000 -17.65900 1.000 80.95954  ? 706  THR A CB    1 
ATOM   5205  O  OG1   . THR A 1 706  ? -31.27800 -29.43100 -16.61300 1.000 85.49257  ? 706  THR A OG1   1 
ATOM   5206  C  CG2   . THR A 1 706  ? -33.47900 -29.87000 -17.47900 1.000 84.31729  ? 706  THR A CG2   1 
ATOM   5207  N  N     . ILE A 1 707  ? -30.01300 -27.52600 -19.02100 1.000 87.00359  ? 707  ILE A N     1 
ATOM   5208  C  CA    . ILE A 1 707  ? -28.70100 -26.88500 -19.03800 1.000 80.24505  ? 707  ILE A CA    1 
ATOM   5209  C  C     . ILE A 1 707  ? -27.93500 -27.20800 -17.76000 1.000 86.71162  ? 707  ILE A C     1 
ATOM   5210  O  O     . ILE A 1 707  ? -26.76400 -27.60500 -17.80200 1.000 87.38993  ? 707  ILE A O     1 
ATOM   5211  C  CB    . ILE A 1 707  ? -28.84900 -25.36500 -19.23800 1.000 74.21565  ? 707  ILE A CB    1 
ATOM   5212  C  CG1   . ILE A 1 707  ? -29.41700 -25.05500 -20.62700 1.000 77.81713  ? 707  ILE A CG1   1 
ATOM   5213  C  CG2   . ILE A 1 707  ? -27.51400 -24.66700 -19.02000 1.000 84.19321  ? 707  ILE A CG2   1 
ATOM   5214  C  CD1   . ILE A 1 707  ? -29.01700 -23.69300 -21.17800 1.000 73.69068  ? 707  ILE A CD1   1 
ATOM   5215  N  N     . GLU A 1 708  ? -28.58800 -27.04700 -16.60500 1.000 89.41263  ? 708  GLU A N     1 
ATOM   5216  C  CA    . GLU A 1 708  ? -27.92400 -27.30900 -15.33200 1.000 91.94924  ? 708  GLU A CA    1 
ATOM   5217  C  C     . GLU A 1 708  ? -27.50900 -28.77100 -15.21300 1.000 94.12130  ? 708  GLU A C     1 
ATOM   5218  O  O     . GLU A 1 708  ? -26.47300 -29.08200 -14.61400 1.000 97.54882  ? 708  GLU A O     1 
ATOM   5219  C  CB    . GLU A 1 708  ? -28.83800 -26.91300 -14.17300 1.000 95.12383  ? 708  GLU A CB    1 
ATOM   5220  C  CG    . GLU A 1 708  ? -28.77600 -25.43800 -13.80700 1.000 100.98920 ? 708  GLU A CG    1 
ATOM   5221  C  CD    . GLU A 1 708  ? -27.72100 -25.14300 -12.75900 1.000 115.65651 ? 708  GLU A CD    1 
ATOM   5222  O  OE1   . GLU A 1 708  ? -27.08200 -24.07200 -12.83900 1.000 106.47911 ? 708  GLU A OE1   1 
ATOM   5223  O  OE2   . GLU A 1 708  ? -27.52800 -25.98500 -11.85600 1.000 116.96139 ? 708  GLU A OE2   1 
ATOM   5224  N  N     . GLU A 1 709  ? -28.30500 -29.68300 -15.77700 1.000 86.55857  ? 709  GLU A N     1 
ATOM   5225  C  CA    . GLU A 1 709  ? -27.92300 -31.09100 -15.77700 1.000 86.86799  ? 709  GLU A CA    1 
ATOM   5226  C  C     . GLU A 1 709  ? -26.64900 -31.32300 -16.58000 1.000 92.15331  ? 709  GLU A C     1 
ATOM   5227  O  O     . GLU A 1 709  ? -25.91000 -32.27600 -16.30800 1.000 95.51085  ? 709  GLU A O     1 
ATOM   5228  C  CB    . GLU A 1 709  ? -29.06500 -31.94600 -16.32500 1.000 85.79855  ? 709  GLU A CB    1 
ATOM   5229  C  CG    . GLU A 1 709  ? -30.21200 -32.14300 -15.34700 1.000 91.59688  ? 709  GLU A CG    1 
ATOM   5230  C  CD    . GLU A 1 709  ? -31.40000 -32.84700 -15.97200 1.000 91.06702  ? 709  GLU A CD    1 
ATOM   5231  O  OE1   . GLU A 1 709  ? -31.39500 -33.04600 -17.20500 1.000 87.89459  ? 709  GLU A OE1   1 
ATOM   5232  O  OE2   . GLU A 1 709  ? -32.34100 -33.19800 -15.23000 1.000 96.68787  ? 709  GLU A OE2   1 
ATOM   5233  N  N     . SER A 1 710  ? -26.37500 -30.46500 -17.56500 1.000 86.89443  ? 710  SER A N     1 
ATOM   5234  C  CA    . SER A 1 710  ? -25.13100 -30.56800 -18.31800 1.000 86.54982  ? 710  SER A CA    1 
ATOM   5235  C  C     . SER A 1 710  ? -23.97100 -29.88900 -17.60200 1.000 90.05076  ? 710  SER A C     1 
ATOM   5236  O  O     . SER A 1 710  ? -22.81900 -30.30500 -17.76600 1.000 90.44287  ? 710  SER A O     1 
ATOM   5237  C  CB    . SER A 1 710  ? -25.30700 -29.96800 -19.71300 1.000 82.72608  ? 710  SER A CB    1 
ATOM   5238  O  OG    . SER A 1 710  ? -24.05600 -29.80000 -20.35600 1.000 88.47317  ? 710  SER A OG    1 
ATOM   5239  N  N     . ILE A 1 711  ? -24.25000 -28.85000 -16.81000 1.000 92.39504  ? 711  ILE A N     1 
ATOM   5240  C  CA    . ILE A 1 711  ? -23.18900 -28.16900 -16.07900 1.000 91.30337  ? 711  ILE A CA    1 
ATOM   5241  C  C     . ILE A 1 711  ? -22.63000 -29.03700 -14.96000 1.000 97.65538  ? 711  ILE A C     1 
ATOM   5242  O  O     . ILE A 1 711  ? -21.50100 -28.80900 -14.50900 1.000 96.64382  ? 711  ILE A O     1 
ATOM   5243  C  CB    . ILE A 1 711  ? -23.69400 -26.82200 -15.52600 1.000 89.01074  ? 711  ILE A CB    1 
ATOM   5244  C  CG1   . ILE A 1 711  ? -22.60800 -25.75400 -15.63400 1.000 93.07190  ? 711  ILE A CG1   1 
ATOM   5245  C  CG2   . ILE A 1 711  ? -24.15900 -26.95300 -14.08200 1.000 98.05725  ? 711  ILE A CG2   1 
ATOM   5246  C  CD1   . ILE A 1 711  ? -23.13800 -24.35700 -15.46300 1.000 100.37044 ? 711  ILE A CD1   1 
ATOM   5247  N  N     . GLN A 1 712  ? -23.39000 -30.03500 -14.50200 1.000 93.85831  ? 712  GLN A N     1 
ATOM   5248  C  CA    . GLN A 1 712  ? -22.90100 -30.91700 -13.44900 1.000 91.61972  ? 712  GLN A CA    1 
ATOM   5249  C  C     . GLN A 1 712  ? -21.74000 -31.77500 -13.93200 1.000 103.81954 ? 712  GLN A C     1 
ATOM   5250  O  O     . GLN A 1 712  ? -20.84200 -32.10200 -13.14700 1.000 114.77481 ? 712  GLN A O     1 
ATOM   5251  C  CB    . GLN A 1 712  ? -24.03500 -31.80600 -12.94100 1.000 94.21076  ? 712  GLN A CB    1 
ATOM   5252  C  CG    . GLN A 1 712  ? -25.21500 -31.04700 -12.35600 1.000 104.51259 ? 712  GLN A CG    1 
ATOM   5253  C  CD    . GLN A 1 712  ? -25.72800 -31.67100 -11.07300 1.000 109.26176 ? 712  GLN A CD    1 
ATOM   5254  O  OE1   . GLN A 1 712  ? -25.49500 -32.85000 -10.80700 1.000 112.26604 ? 712  GLN A OE1   1 
ATOM   5255  N  NE2   . GLN A 1 712  ? -26.43500 -30.88200 -10.27200 1.000 103.04086 ? 712  GLN A NE2   1 
ATOM   5256  N  N     . HIS A 1 713  ? -21.73400 -32.14100 -15.20900 1.000 103.43489 ? 713  HIS A N     1 
ATOM   5257  C  CA    . HIS A 1 713  ? -20.71000 -33.02400 -15.75100 1.000 99.94301  ? 713  HIS A CA    1 
ATOM   5258  C  C     . HIS A 1 713  ? -19.78400 -32.26700 -16.69800 1.000 92.86564  ? 713  HIS A C     1 
ATOM   5259  O  O     . HIS A 1 713  ? -18.67800 -31.88000 -16.32200 1.000 90.46229  ? 713  HIS A O     1 
ATOM   5260  C  CB    . HIS A 1 713  ? -21.34700 -34.21600 -16.47700 1.000 95.63101  ? 713  HIS A CB    1 
ATOM   5261  C  CG    . HIS A 1 713  ? -22.37000 -34.95400 -15.66600 1.000 104.20662 ? 713  HIS A CG    1 
ATOM   5262  N  ND1   . HIS A 1 713  ? -23.45200 -34.33400 -15.07800 1.000 101.98792 ? 713  HIS A ND1   1 
ATOM   5263  C  CD2   . HIS A 1 713  ? -22.47200 -36.26600 -15.34600 1.000 109.87893 ? 713  HIS A CD2   1 
ATOM   5264  C  CE1   . HIS A 1 713  ? -24.17600 -35.23100 -14.43200 1.000 105.58636 ? 713  HIS A CE1   1 
ATOM   5265  N  NE2   . HIS A 1 713  ? -23.60300 -36.41100 -14.58000 1.000 107.63797 ? 713  HIS A NE2   1 
ATOM   5266  N  N     . SER A 1 716  ? -16.18000 -32.35500 -17.36600 1.000 108.51007 ? 716  SER A N     1 
ATOM   5267  C  CA    . SER A 1 716  ? -14.89900 -32.41400 -18.05900 1.000 110.42923 ? 716  SER A CA    1 
ATOM   5268  C  C     . SER A 1 716  ? -14.37000 -31.01200 -18.35400 1.000 112.58646 ? 716  SER A C     1 
ATOM   5269  O  O     . SER A 1 716  ? -14.34400 -30.15200 -17.47200 1.000 111.04552 ? 716  SER A O     1 
ATOM   5270  C  CB    . SER A 1 716  ? -15.02800 -33.21500 -19.35600 1.000 105.33201 ? 716  SER A CB    1 
ATOM   5271  O  OG    . SER A 1 716  ? -16.10700 -32.74200 -20.14200 1.000 102.13426 ? 716  SER A OG    1 
ATOM   5272  N  N     . PHE A 1 717  ? -13.94900 -30.78700 -19.59600 1.000 107.80854 ? 717  PHE A N     1 
ATOM   5273  C  CA    . PHE A 1 717  ? -13.41500 -29.50200 -20.02500 1.000 105.54412 ? 717  PHE A CA    1 
ATOM   5274  C  C     . PHE A 1 717  ? -14.29500 -28.91600 -21.12000 1.000 98.50599  ? 717  PHE A C     1 
ATOM   5275  O  O     . PHE A 1 717  ? -14.72200 -29.62700 -22.03500 1.000 96.70420  ? 717  PHE A O     1 
ATOM   5276  C  CB    . PHE A 1 717  ? -11.97300 -29.63800 -20.52700 1.000 98.50857  ? 717  PHE A CB    1 
ATOM   5277  C  CG    . PHE A 1 717  ? -11.44500 -28.39800 -21.19000 1.000 93.52161  ? 717  PHE A CG    1 
ATOM   5278  C  CD1   . PHE A 1 717  ? -11.04800 -27.30800 -20.43200 1.000 95.65684  ? 717  PHE A CD1   1 
ATOM   5279  C  CD2   . PHE A 1 717  ? -11.34000 -28.32300 -22.56900 1.000 93.48619  ? 717  PHE A CD2   1 
ATOM   5280  C  CE1   . PHE A 1 717  ? -10.56100 -26.16400 -21.03800 1.000 90.62633  ? 717  PHE A CE1   1 
ATOM   5281  C  CE2   . PHE A 1 717  ? -10.85300 -27.18300 -23.18000 1.000 92.80107  ? 717  PHE A CE2   1 
ATOM   5282  C  CZ    . PHE A 1 717  ? -10.46300 -26.10200 -22.41400 1.000 83.59002  ? 717  PHE A CZ    1 
ATOM   5283  N  N     . LYS A 1 718  ? -14.55700 -27.61300 -21.02100 1.000 98.07495  ? 718  LYS A N     1 
ATOM   5284  C  CA    . LYS A 1 718  ? -15.40700 -26.90700 -21.96500 1.000 97.60788  ? 718  LYS A CA    1 
ATOM   5285  C  C     . LYS A 1 718  ? -14.68100 -25.64900 -22.42600 1.000 96.03287  ? 718  LYS A C     1 
ATOM   5286  O  O     . LYS A 1 718  ? -14.17400 -24.88500 -21.58500 1.000 98.18013  ? 718  LYS A O     1 
ATOM   5287  C  CB    . LYS A 1 718  ? -16.75300 -26.55100 -21.32100 1.000 97.90280  ? 718  LYS A CB    1 
ATOM   5288  C  CG    . LYS A 1 718  ? -17.65400 -27.75200 -21.08200 1.000 98.67217  ? 718  LYS A CG    1 
ATOM   5289  C  CD    . LYS A 1 718  ? -19.05100 -27.52300 -21.62500 1.000 106.47144 ? 718  LYS A CD    1 
ATOM   5290  C  CE    . LYS A 1 718  ? -19.99900 -27.05700 -20.53000 1.000 101.22560 ? 718  LYS A CE    1 
ATOM   5291  N  NZ    . LYS A 1 718  ? -20.10400 -28.04000 -19.41500 1.000 103.92576 ? 718  LYS A NZ    1 
ATOM   5292  N  N     . PRO A 1 719  ? -14.60300 -25.39400 -23.73400 1.000 97.31260  ? 719  PRO A N     1 
ATOM   5293  C  CA    . PRO A 1 719  ? -13.89200 -24.20000 -24.22100 1.000 96.41057  ? 719  PRO A CA    1 
ATOM   5294  C  C     . PRO A 1 719  ? -14.59900 -22.92700 -23.77900 1.000 97.74676  ? 719  PRO A C     1 
ATOM   5295  O  O     . PRO A 1 719  ? -15.75900 -22.69300 -24.12500 1.000 100.72118 ? 719  PRO A O     1 
ATOM   5296  C  CB    . PRO A 1 719  ? -13.91800 -24.36700 -25.74500 1.000 99.01610  ? 719  PRO A CB    1 
ATOM   5297  C  CG    . PRO A 1 719  ? -15.08100 -25.26800 -26.00900 1.000 108.01592 ? 719  PRO A CG    1 
ATOM   5298  C  CD    . PRO A 1 719  ? -15.14900 -26.20300 -24.83600 1.000 102.41432 ? 719  PRO A CD    1 
ATOM   5299  N  N     . GLU A 1 720  ? -13.89100 -22.10300 -23.01300 1.000 97.86760  ? 720  GLU A N     1 
ATOM   5300  C  CA    . GLU A 1 720  ? -14.44900 -20.87700 -22.46500 1.000 102.42310 ? 720  GLU A CA    1 
ATOM   5301  C  C     . GLU A 1 720  ? -14.21700 -19.71300 -23.42100 1.000 96.32687  ? 720  GLU A C     1 
ATOM   5302  O  O     . GLU A 1 720  ? -13.24400 -19.69000 -24.18000 1.000 96.77008  ? 720  GLU A O     1 
ATOM   5303  C  CB    . GLU A 1 720  ? -13.82300 -20.56400 -21.10200 1.000 102.97885 ? 720  GLU A CB    1 
ATOM   5304  C  CG    . GLU A 1 720  ? -14.37800 -19.32100 -20.41500 1.000 101.93753 ? 720  GLU A CG    1 
ATOM   5305  C  CD    . GLU A 1 720  ? -13.29200 -18.44500 -19.82300 1.000 103.60816 ? 720  GLU A CD    1 
ATOM   5306  O  OE1   . GLU A 1 720  ? -12.51600 -17.85100 -20.60300 1.000 104.40679 ? 720  GLU A OE1   1 
ATOM   5307  O  OE2   . GLU A 1 720  ? -13.21400 -18.34800 -18.58100 1.000 108.24137 ? 720  GLU A OE2   1 
ATOM   5308  N  N     . ARG A 1 721  ? -15.13000 -18.74400 -23.38200 1.000 93.76657  ? 721  ARG A N     1 
ATOM   5309  C  CA    . ARG A 1 721  ? -14.99800 -17.52100 -24.15600 1.000 95.19707  ? 721  ARG A CA    1 
ATOM   5310  C  C     . ARG A 1 721  ? -15.47800 -16.34900 -23.31500 1.000 94.87163  ? 721  ARG A C     1 
ATOM   5311  O  O     . ARG A 1 721  ? -16.49500 -16.44800 -22.62300 1.000 90.37363  ? 721  ARG A O     1 
ATOM   5312  C  CB    . ARG A 1 721  ? -15.78700 -17.60000 -25.46400 1.000 92.30787  ? 721  ARG A CB    1 
ATOM   5313  C  CG    . ARG A 1 721  ? -15.17100 -16.79400 -26.58600 1.000 94.67525  ? 721  ARG A CG    1 
ATOM   5314  C  CD    . ARG A 1 721  ? -15.23200 -17.57200 -27.88000 1.000 100.70348 ? 721  ARG A CD    1 
ATOM   5315  N  NE    . ARG A 1 721  ? -14.74300 -18.93500 -27.70800 1.000 108.33181 ? 721  ARG A NE    1 
ATOM   5316  C  CZ    . ARG A 1 721  ? -13.53600 -19.34800 -28.07900 1.000 108.50295 ? 721  ARG A CZ    1 
ATOM   5317  N  NH1   . ARG A 1 721  ? -12.68900 -18.50300 -28.65000 1.000 107.96889 ? 721  ARG A NH1   1 
ATOM   5318  N  NH2   . ARG A 1 721  ? -13.17600 -20.60800 -27.88000 1.000 109.19198 ? 721  ARG A NH2   1 
ATOM   5319  N  N     . LYS A 1 722  ? -14.74300 -15.24100 -23.38000 1.000 94.01311  ? 722  LYS A N     1 
ATOM   5320  C  CA    . LYS A 1 722  ? -15.00100 -14.11700 -22.49300 1.000 91.15376  ? 722  LYS A CA    1 
ATOM   5321  C  C     . LYS A 1 722  ? -14.50800 -12.83100 -23.13800 1.000 88.87956  ? 722  LYS A C     1 
ATOM   5322  O  O     . LYS A 1 722  ? -13.55100 -12.83700 -23.91600 1.000 89.31888  ? 722  LYS A O     1 
ATOM   5323  C  CB    . LYS A 1 722  ? -14.32100 -14.32400 -21.13400 1.000 98.49227  ? 722  LYS A CB    1 
ATOM   5324  C  CG    . LYS A 1 722  ? -14.64000 -13.26200 -20.09500 1.000 99.17944  ? 722  LYS A CG    1 
ATOM   5325  C  CD    . LYS A 1 722  ? -13.72100 -13.37600 -18.89100 1.000 98.44791  ? 722  LYS A CD    1 
ATOM   5326  C  CE    . LYS A 1 722  ? -12.30300 -12.96000 -19.24300 1.000 89.81008  ? 722  LYS A CE    1 
ATOM   5327  N  NZ    . LYS A 1 722  ? -11.42600 -12.90300 -18.04200 1.000 97.42395  ? 722  LYS A NZ    1 
ATOM   5328  N  N     . LEU A 1 723  ? -15.18300 -11.73000 -22.80900 1.000 83.84154  ? 723  LEU A N     1 
ATOM   5329  C  CA    . LEU A 1 723  ? -14.69900 -10.39500 -23.12300 1.000 90.84329  ? 723  LEU A CA    1 
ATOM   5330  C  C     . LEU A 1 723  ? -14.91300 -9.50600  -21.90600 1.000 92.40802  ? 723  LEU A C     1 
ATOM   5331  O  O     . LEU A 1 723  ? -15.91600 -9.64000  -21.19800 1.000 83.92944  ? 723  LEU A O     1 
ATOM   5332  C  CB    . LEU A 1 723  ? -15.38700 -9.81700  -24.37700 1.000 81.93925  ? 723  LEU A CB    1 
ATOM   5333  C  CG    . LEU A 1 723  ? -16.89300 -9.92400  -24.66800 1.000 84.12896  ? 723  LEU A CG    1 
ATOM   5334  C  CD1   . LEU A 1 723  ? -17.76600 -9.27600  -23.60200 1.000 92.16233  ? 723  LEU A CD1   1 
ATOM   5335  C  CD2   . LEU A 1 723  ? -17.21200 -9.35000  -26.04200 1.000 79.64122  ? 723  LEU A CD2   1 
ATOM   5336  N  N     . GLU A 1 724  ? -13.95100 -8.62200  -21.64700 1.000 98.11604  ? 724  GLU A N     1 
ATOM   5337  C  CA    . GLU A 1 724  ? -14.00500 -7.72500  -20.50200 1.000 90.23323  ? 724  GLU A CA    1 
ATOM   5338  C  C     . GLU A 1 724  ? -13.71600 -6.29900  -20.94300 1.000 95.62496  ? 724  GLU A C     1 
ATOM   5339  O  O     . GLU A 1 724  ? -12.90100 -6.05900  -21.83800 1.000 101.00192 ? 724  GLU A O     1 
ATOM   5340  C  CB    . GLU A 1 724  ? -13.01100 -8.13300  -19.40100 1.000 93.98520  ? 724  GLU A CB    1 
ATOM   5341  C  CG    . GLU A 1 724  ? -13.34800 -9.43900  -18.69900 1.000 101.14171 ? 724  GLU A CG    1 
ATOM   5342  C  CD    . GLU A 1 724  ? -12.50000 -9.67300  -17.46100 1.000 104.59898 ? 724  GLU A CD    1 
ATOM   5343  O  OE1   . GLU A 1 724  ? -12.95200 -9.30600  -16.35500 1.000 105.18468 ? 724  GLU A OE1   1 
ATOM   5344  O  OE2   . GLU A 1 724  ? -11.38700 -10.22500 -17.59000 1.000 106.89094 ? 724  GLU A OE2   1 
ATOM   5345  N  N     . TYR A 1 725  ? -14.39400 -5.35500  -20.29600 1.000 98.78990  ? 725  TYR A N     1 
ATOM   5346  C  CA    . TYR A 1 725  ? -14.23800 -3.93300  -20.57200 1.000 99.45417  ? 725  TYR A CA    1 
ATOM   5347  C  C     . TYR A 1 725  ? -14.06600 -3.21200  -19.24400 1.000 100.85620 ? 725  TYR A C     1 
ATOM   5348  O  O     . TYR A 1 725  ? -14.95200 -3.27500  -18.38500 1.000 96.11373  ? 725  TYR A O     1 
ATOM   5349  C  CB    . TYR A 1 725  ? -15.44500 -3.38400  -21.33700 1.000 91.07986  ? 725  TYR A CB    1 
ATOM   5350  C  CG    . TYR A 1 725  ? -15.23500 -2.00600  -21.91800 1.000 92.67439  ? 725  TYR A CG    1 
ATOM   5351  C  CD1   . TYR A 1 725  ? -14.11800 -1.72100  -22.69100 1.000 93.81633  ? 725  TYR A CD1   1 
ATOM   5352  C  CD2   . TYR A 1 725  ? -16.15700 -0.99100  -21.70000 1.000 93.59765  ? 725  TYR A CD2   1 
ATOM   5353  C  CE1   . TYR A 1 725  ? -13.92200 -0.46300  -23.22700 1.000 88.32330  ? 725  TYR A CE1   1 
ATOM   5354  C  CE2   . TYR A 1 725  ? -15.97100 0.27000   -22.23200 1.000 89.79789  ? 725  TYR A CE2   1 
ATOM   5355  C  CZ    . TYR A 1 725  ? -14.85200 0.52800   -22.99400 1.000 91.35710  ? 725  TYR A CZ    1 
ATOM   5356  O  OH    . TYR A 1 725  ? -14.66100 1.78200   -23.52700 1.000 93.80161  ? 725  TYR A OH    1 
ATOM   5357  N  N     . GLY A 1 726  ? -12.93200 -2.53600  -19.07500 1.000 105.42890 ? 726  GLY A N     1 
ATOM   5358  C  CA    . GLY A 1 726  ? -12.65100 -1.91000  -17.80000 1.000 100.08920 ? 726  GLY A CA    1 
ATOM   5359  C  C     . GLY A 1 726  ? -12.42900 -2.95000  -16.71000 1.000 95.69996  ? 726  GLY A C     1 
ATOM   5360  O  O     . GLY A 1 726  ? -12.05100 -4.09700  -16.96300 1.000 95.73230  ? 726  GLY A O     1 
ATOM   5361  N  N     . ASN A 1 727  ? -12.67700 -2.52700  -15.47300 1.000 96.98662  ? 727  ASN A N     1 
ATOM   5362  C  CA    . ASN A 1 727  ? -12.55700 -3.39100  -14.30500 1.000 101.49117 ? 727  ASN A CA    1 
ATOM   5363  C  C     . ASN A 1 727  ? -13.90000 -3.42300  -13.59100 1.000 102.70279 ? 727  ASN A C     1 
ATOM   5364  O  O     . ASN A 1 727  ? -14.40300 -2.37900  -13.16300 1.000 108.51827 ? 727  ASN A O     1 
ATOM   5365  C  CB    . ASN A 1 727  ? -11.45200 -2.90100  -13.36600 1.000 108.27957 ? 727  ASN A CB    1 
ATOM   5366  C  CG    . ASN A 1 727  ? -11.04300 -3.95000  -12.34700 1.000 113.79151 ? 727  ASN A CG    1 
ATOM   5367  O  OD1   . ASN A 1 727  ? -11.82000 -4.84200  -12.00500 1.000 107.20520 ? 727  ASN A OD1   1 
ATOM   5368  N  ND2   . ASN A 1 727  ? -9.81200  -3.84800  -11.85800 1.000 121.61867 ? 727  ASN A ND2   1 
ATOM   5369  N  N     . VAL A 1 728  ? -14.47400 -4.61700  -13.46300 1.000 98.36508  ? 728  VAL A N     1 
ATOM   5370  C  CA    . VAL A 1 728  ? -15.78500 -4.75800  -12.84100 1.000 97.66002  ? 728  VAL A CA    1 
ATOM   5371  C  C     . VAL A 1 728  ? -15.68200 -5.00300  -11.33600 1.000 105.92749 ? 728  VAL A C     1 
ATOM   5372  O  O     . VAL A 1 728  ? -16.55200 -4.56000  -10.57800 1.000 107.69543 ? 728  VAL A O     1 
ATOM   5373  C  CB    . VAL A 1 728  ? -16.57700 -5.88000  -13.54000 1.000 100.88445 ? 728  VAL A CB    1 
ATOM   5374  C  CG1   . VAL A 1 728  ? -15.78800 -7.18300  -13.53300 1.000 105.08204 ? 728  VAL A CG1   1 
ATOM   5375  C  CG2   . VAL A 1 728  ? -17.94800 -6.06500  -12.90000 1.000 99.49168  ? 728  VAL A CG2   1 
ATOM   5376  N  N     . ASP A 1 729  ? -14.62600 -5.68400  -10.88100 1.000 110.97682 ? 729  ASP A N     1 
ATOM   5377  C  CA    . ASP A 1 729  ? -14.47700 -5.95400  -9.45400  1.000 114.11655 ? 729  ASP A CA    1 
ATOM   5378  C  C     . ASP A 1 729  ? -14.32100 -4.67000  -8.65100  1.000 114.31646 ? 729  ASP A C     1 
ATOM   5379  O  O     . ASP A 1 729  ? -14.77100 -4.59800  -7.50100  1.000 110.30763 ? 729  ASP A O     1 
ATOM   5380  C  CB    . ASP A 1 729  ? -13.28100 -6.87700  -9.21500  1.000 115.86303 ? 729  ASP A CB    1 
ATOM   5381  C  CG    . ASP A 1 729  ? -13.53300 -8.29300  -9.69400  1.000 115.04957 ? 729  ASP A CG    1 
ATOM   5382  O  OD1   . ASP A 1 729  ? -14.60900 -8.84400  -9.38300  1.000 114.73367 ? 729  ASP A OD1   1 
ATOM   5383  O  OD2   . ASP A 1 729  ? -12.65300 -8.85400  -10.38100 1.000 108.96682 ? 729  ASP A OD2   1 
ATOM   5384  N  N     . GLU A 1 730  ? -13.69000 -3.64800  -9.23300  1.000 113.81108 ? 730  GLU A N     1 
ATOM   5385  C  CA    . GLU A 1 730  ? -13.53100 -2.37700  -8.53600  1.000 113.34344 ? 730  GLU A CA    1 
ATOM   5386  C  C     . GLU A 1 730  ? -14.82600 -1.57700  -8.50200  1.000 113.56630 ? 730  GLU A C     1 
ATOM   5387  O  O     . GLU A 1 730  ? -15.02600 -0.76900  -7.58800  1.000 116.42611 ? 730  GLU A O     1 
ATOM   5388  C  CB    . GLU A 1 730  ? -12.42300 -1.55200  -9.19400  1.000 112.76944 ? 730  GLU A CB    1 
ATOM   5389  C  CG    . GLU A 1 730  ? -11.02300 -2.14000  -9.05500  1.000 119.40856 ? 730  GLU A CG    1 
ATOM   5390  C  CD    . GLU A 1 730  ? -10.46800 -2.02700  -7.64600  1.000 120.38932 ? 730  GLU A CD    1 
ATOM   5391  O  OE1   . GLU A 1 730  ? -10.94300 -2.75500  -6.74800  1.000 108.74638 ? 730  GLU A OE1   1 
ATOM   5392  O  OE2   . GLU A 1 730  ? -9.55100  -1.20500  -7.43500  1.000 121.09545 ? 730  GLU A OE2   1 
ATOM   5393  N  N     . ALA A 1 731  ? -15.71200 -1.78600  -9.47800  1.000 110.93173 ? 731  ALA A N     1 
ATOM   5394  C  CA    . ALA A 1 731  ? -16.96500 -1.04400  -9.53100  1.000 107.82149 ? 731  ALA A CA    1 
ATOM   5395  C  C     . ALA A 1 731  ? -18.03800 -1.62600  -8.62200  1.000 111.45790 ? 731  ALA A C     1 
ATOM   5396  O  O     . ALA A 1 731  ? -18.98600 -0.91400  -8.27500  1.000 113.27472 ? 731  ALA A O     1 
ATOM   5397  C  CB    . ALA A 1 731  ? -17.48500 -0.99000  -10.96900 1.000 107.14204 ? 731  ALA A CB    1 
ATOM   5398  N  N     . PHE A 1 732  ? -17.91500 -2.89600  -8.22900  1.000 113.85577 ? 732  PHE A N     1 
ATOM   5399  C  CA    . PHE A 1 732  ? -18.90400 -3.51100  -7.35200  1.000 114.58641 ? 732  PHE A CA    1 
ATOM   5400  C  C     . PHE A 1 732  ? -18.83800 -2.99000  -5.92300  1.000 115.58116 ? 732  PHE A C     1 
ATOM   5401  O  O     . PHE A 1 732  ? -19.70500 -3.34100  -5.11500  1.000 109.73739 ? 732  PHE A O     1 
ATOM   5402  C  CB    . PHE A 1 732  ? -18.73700 -5.03100  -7.35500  1.000 114.07590 ? 732  PHE A CB    1 
ATOM   5403  C  CG    . PHE A 1 732  ? -19.61100 -5.73600  -8.35400  1.000 114.27320 ? 732  PHE A CG    1 
ATOM   5404  C  CD1   . PHE A 1 732  ? -20.94400 -5.38500  -8.49600  1.000 111.57119 ? 732  PHE A CD1   1 
ATOM   5405  C  CD2   . PHE A 1 732  ? -19.10200 -6.75000  -9.14800  1.000 111.37505 ? 732  PHE A CD2   1 
ATOM   5406  C  CE1   . PHE A 1 732  ? -21.75300 -6.03200  -9.41300  1.000 104.47861 ? 732  PHE A CE1   1 
ATOM   5407  C  CE2   . PHE A 1 732  ? -19.90500 -7.40000  -10.06600 1.000 107.71960 ? 732  PHE A CE2   1 
ATOM   5408  C  CZ    . PHE A 1 732  ? -21.23200 -7.04100  -10.19800 1.000 106.44122 ? 732  PHE A CZ    1 
ATOM   5409  N  N     . LYS A 1 733  ? -17.83900 -2.17100  -5.59000  1.000 115.68205 ? 733  LYS A N     1 
ATOM   5410  C  CA    . LYS A 1 733  ? -17.72700 -1.57900  -4.26700  1.000 112.94179 ? 733  LYS A CA    1 
ATOM   5411  C  C     . LYS A 1 733  ? -18.10200 -0.10400  -4.23000  1.000 111.21313 ? 733  LYS A C     1 
ATOM   5412  O  O     . LYS A 1 733  ? -18.20100 0.46400   -3.13600  1.000 113.52839 ? 733  LYS A O     1 
ATOM   5413  C  CB    . LYS A 1 733  ? -16.29900 -1.74800  -3.72700  1.000 109.82298 ? 733  LYS A CB    1 
ATOM   5414  C  CG    . LYS A 1 733  ? -15.91000 -3.18900  -3.44200  1.000 100.81850 ? 733  LYS A CG    1 
ATOM   5415  C  CD    . LYS A 1 733  ? -14.47900 -3.28700  -2.94000  1.000 109.02075 ? 733  LYS A CD    1 
ATOM   5416  C  CE    . LYS A 1 733  ? -13.48100 -2.92900  -4.02900  1.000 112.14044 ? 733  LYS A CE    1 
ATOM   5417  N  NZ    . LYS A 1 733  ? -12.07600 -3.09700  -3.56500  1.000 101.72121 ? 733  LYS A NZ    1 
ATOM   5418  N  N     . VAL A 1 734  ? -18.31300 0.52900   -5.38500  1.000 113.01480 ? 734  VAL A N     1 
ATOM   5419  C  CA    . VAL A 1 734  ? -18.65600 1.94600   -5.46100  1.000 110.39664 ? 734  VAL A CA    1 
ATOM   5420  C  C     . VAL A 1 734  ? -20.07300 2.17900   -5.95700  1.000 107.17158 ? 734  VAL A C     1 
ATOM   5421  O  O     . VAL A 1 734  ? -20.45900 3.33700   -6.16600  1.000 103.34323 ? 734  VAL A O     1 
ATOM   5422  C  CB    . VAL A 1 734  ? -17.65600 2.72100   -6.33700  1.000 96.46265  ? 734  VAL A CB    1 
ATOM   5423  C  CG1   . VAL A 1 734  ? -16.23600 2.47400   -5.86200  1.000 94.32549  ? 734  VAL A CG1   1 
ATOM   5424  C  CG2   . VAL A 1 734  ? -17.80700 2.31900   -7.79400  1.000 101.77159 ? 734  VAL A CG2   1 
ATOM   5425  N  N     . VAL A 1 735  ? -20.85600 1.12500   -6.16500  1.000 107.92245 ? 735  VAL A N     1 
ATOM   5426  C  CA    . VAL A 1 735  ? -22.23100 1.25800   -6.61700  1.000 108.30559 ? 735  VAL A CA    1 
ATOM   5427  C  C     . VAL A 1 735  ? -23.16300 1.12600   -5.42000  1.000 106.70109 ? 735  VAL A C     1 
ATOM   5428  O  O     . VAL A 1 735  ? -22.79000 0.63000   -4.35400  1.000 102.28520 ? 735  VAL A O     1 
ATOM   5429  C  CB    . VAL A 1 735  ? -22.58100 0.22400   -7.71000  1.000 102.76205 ? 735  VAL A CB    1 
ATOM   5430  C  CG1   . VAL A 1 735  ? -21.80300 0.51500   -8.98200  1.000 101.44047 ? 735  VAL A CG1   1 
ATOM   5431  C  CG2   . VAL A 1 735  ? -22.29000 -1.18300  -7.21500  1.000 105.22218 ? 735  VAL A CG2   1 
ATOM   5432  N  N     . ASP A 1 736  ? -24.40800 1.57100   -5.60600  1.000 101.09917 ? 736  ASP A N     1 
ATOM   5433  C  CA    . ASP A 1 736  ? -25.36100 1.61100   -4.50000  1.000 96.65109  ? 736  ASP A CA    1 
ATOM   5434  C  C     . ASP A 1 736  ? -25.92700 0.23000   -4.19100  1.000 101.83083 ? 736  ASP A C     1 
ATOM   5435  O  O     . ASP A 1 736  ? -25.90000 -0.21600  -3.03800  1.000 103.29671 ? 736  ASP A O     1 
ATOM   5436  C  CB    . ASP A 1 736  ? -26.48900 2.59400   -4.81900  1.000 99.66518  ? 736  ASP A CB    1 
ATOM   5437  C  CG    . ASP A 1 736  ? -25.97300 3.96300   -5.21300  1.000 108.39558 ? 736  ASP A CG    1 
ATOM   5438  O  OD1   . ASP A 1 736  ? -24.73900 4.15400   -5.21900  1.000 111.36582 ? 736  ASP A OD1   1 
ATOM   5439  O  OD2   . ASP A 1 736  ? -26.80000 4.84600   -5.52100  1.000 112.87126 ? 736  ASP A OD2   1 
ATOM   5440  N  N     . GLN A 1 737  ? -26.44800 -0.46100  -5.20200  1.000 105.97720 ? 737  GLN A N     1 
ATOM   5441  C  CA    . GLN A 1 737  ? -27.08500 -1.75400  -5.01000  1.000 104.08218 ? 737  GLN A CA    1 
ATOM   5442  C  C     . GLN A 1 737  ? -26.45400 -2.79400  -5.92500  1.000 101.14691 ? 737  GLN A C     1 
ATOM   5443  O  O     . GLN A 1 737  ? -25.87400 -2.47400  -6.96600  1.000 94.73185  ? 737  GLN A O     1 
ATOM   5444  C  CB    . GLN A 1 737  ? -28.59700 -1.68300  -5.27400  1.000 98.12633  ? 737  GLN A CB    1 
ATOM   5445  C  CG    . GLN A 1 737  ? -29.33400 -0.66100  -4.42500  1.000 103.01428 ? 737  GLN A CG    1 
ATOM   5446  C  CD    . GLN A 1 737  ? -30.84000 -0.77300  -4.56100  1.000 105.62376 ? 737  GLN A CD    1 
ATOM   5447  O  OE1   . GLN A 1 737  ? -31.48900 0.09800   -5.13900  1.000 108.11044 ? 737  GLN A OE1   1 
ATOM   5448  N  NE2   . GLN A 1 737  ? -31.40300 -1.85300  -4.03000  1.000 106.18752 ? 737  GLN A NE2   1 
ATOM   5449  N  N     . ILE A 1 738  ? -26.57700 -4.05300  -5.51400  1.000 102.03398 ? 738  ILE A N     1 
ATOM   5450  C  CA    . ILE A 1 738  ? -26.13300 -5.19900  -6.29600  1.000 97.25758  ? 738  ILE A CA    1 
ATOM   5451  C  C     . ILE A 1 738  ? -27.31400 -6.14600  -6.44700  1.000 96.99735  ? 738  ILE A C     1 
ATOM   5452  O  O     . ILE A 1 738  ? -27.94200 -6.52400  -5.45200  1.000 84.16451  ? 738  ILE A O     1 
ATOM   5453  C  CB    . ILE A 1 738  ? -24.93800 -5.91800  -5.64100  1.000 92.76680  ? 738  ILE A CB    1 
ATOM   5454  C  CG1   . ILE A 1 738  ? -23.68600 -5.04300  -5.71700  1.000 87.90153  ? 738  ILE A CG1   1 
ATOM   5455  C  CG2   . ILE A 1 738  ? -24.69600 -7.26600  -6.30300  1.000 98.34082  ? 738  ILE A CG2   1 
ATOM   5456  C  CD1   . ILE A 1 738  ? -22.44500 -5.70400  -5.16100  1.000 101.27417 ? 738  ILE A CD1   1 
ATOM   5457  N  N     . LEU A 1 739  ? -27.61800 -6.52400  -7.68700  1.000 104.32796 ? 739  LEU A N     1 
ATOM   5458  C  CA    . LEU A 1 739  ? -28.78400 -7.34000  -7.99900  1.000 94.19275  ? 739  LEU A CA    1 
ATOM   5459  C  C     . LEU A 1 739  ? -28.34600 -8.58500  -8.75500  1.000 85.77106  ? 739  LEU A C     1 
ATOM   5460  O  O     . LEU A 1 739  ? -27.73800 -8.48300  -9.82700  1.000 89.21136  ? 739  LEU A O     1 
ATOM   5461  C  CB    . LEU A 1 739  ? -29.80100 -6.54500  -8.81900  1.000 91.41963  ? 739  LEU A CB    1 
ATOM   5462  C  CG    . LEU A 1 739  ? -30.94100 -7.33800  -9.45900  1.000 92.63739  ? 739  LEU A CG    1 
ATOM   5463  C  CD1   . LEU A 1 739  ? -31.73900 -8.09900  -8.41000  1.000 95.70334  ? 739  LEU A CD1   1 
ATOM   5464  C  CD2   . LEU A 1 739  ? -31.84000 -6.40700  -10.24800 1.000 89.77647  ? 739  LEU A CD2   1 
ATOM   5465  N  N     . GLU A 1 740  ? -28.65900 -9.75100  -8.20100  1.000 85.49793  ? 740  GLU A N     1 
ATOM   5466  C  CA    . GLU A 1 740  ? -28.43100 -11.02400 -8.86800  1.000 95.23167  ? 740  GLU A CA    1 
ATOM   5467  C  C     . GLU A 1 740  ? -29.74300 -11.54500 -9.43700  1.000 95.77220  ? 740  GLU A C     1 
ATOM   5468  O  O     . GLU A 1 740  ? -30.80300 -11.39100 -8.82300  1.000 97.07930  ? 740  GLU A O     1 
ATOM   5469  C  CB    . GLU A 1 740  ? -27.83300 -12.05400 -7.90700  1.000 95.26014  ? 740  GLU A CB    1 
ATOM   5470  C  CG    . GLU A 1 740  ? -26.40400 -11.75900 -7.48600  1.000 98.63533  ? 740  GLU A CG    1 
ATOM   5471  C  CD    . GLU A 1 740  ? -25.75300 -12.93400 -6.78400  1.000 103.56422 ? 740  GLU A CD    1 
ATOM   5472  O  OE1   . GLU A 1 740  ? -24.50600 -13.00800 -6.78000  1.000 105.72072 ? 740  GLU A OE1   1 
ATOM   5473  O  OE2   . GLU A 1 740  ? -26.48800 -13.78600 -6.24000  1.000 101.41374 ? 740  GLU A OE2   1 
ATOM   5474  N  N     . GLY A 1 741  ? -29.66500 -12.15900 -10.61100 1.000 91.92976  ? 741  GLY A N     1 
ATOM   5475  C  CA    . GLY A 1 741  ? -30.85500 -12.69100 -11.25100 1.000 93.16898  ? 741  GLY A CA    1 
ATOM   5476  C  C     . GLY A 1 741  ? -30.47900 -13.54100 -12.44200 1.000 90.50862  ? 741  GLY A C     1 
ATOM   5477  O  O     . GLY A 1 741  ? -29.32500 -13.56900 -12.87900 1.000 93.49150  ? 741  GLY A O     1 
ATOM   5478  N  N     . GLU A 1 742  ? -31.48300 -14.24100 -12.96300 1.000 86.04697  ? 742  GLU A N     1 
ATOM   5479  C  CA    . GLU A 1 742  ? -31.28700 -15.10700 -14.11600 1.000 88.48968  ? 742  GLU A CA    1 
ATOM   5480  C  C     . GLU A 1 742  ? -32.62300 -15.30500 -14.81400 1.000 90.75184  ? 742  GLU A C     1 
ATOM   5481  O  O     . GLU A 1 742  ? -33.68600 -15.03600 -14.24900 1.000 93.32426  ? 742  GLU A O     1 
ATOM   5482  C  CB    . GLU A 1 742  ? -30.68100 -16.45500 -13.71300 1.000 88.76716  ? 742  GLU A CB    1 
ATOM   5483  C  CG    . GLU A 1 742  ? -31.53300 -17.25100 -12.74000 1.000 92.67939  ? 742  GLU A CG    1 
ATOM   5484  C  CD    . GLU A 1 742  ? -30.87700 -18.55200 -12.32500 1.000 98.40638  ? 742  GLU A CD    1 
ATOM   5485  O  OE1   . GLU A 1 742  ? -30.00300 -19.04200 -13.07000 1.000 102.68992 ? 742  GLU A OE1   1 
ATOM   5486  O  OE2   . GLU A 1 742  ? -31.23300 -19.08300 -11.25200 1.000 104.97238 ? 742  GLU A OE2   1 
ATOM   5487  N  N     . ILE A 1 743  ? -32.55200 -15.78100 -16.05400 1.000 89.18376  ? 743  ILE A N     1 
ATOM   5488  C  CA    . ILE A 1 743  ? -33.74100 -16.00700 -16.87000 1.000 84.90106  ? 743  ILE A CA    1 
ATOM   5489  C  C     . ILE A 1 743  ? -33.46200 -17.15100 -17.83400 1.000 82.13419  ? 743  ILE A C     1 
ATOM   5490  O  O     . ILE A 1 743  ? -32.42200 -17.17600 -18.50000 1.000 83.54272  ? 743  ILE A O     1 
ATOM   5491  C  CB    . ILE A 1 743  ? -34.16400 -14.73200 -17.63200 1.000 82.85767  ? 743  ILE A CB    1 
ATOM   5492  C  CG1   . ILE A 1 743  ? -35.25600 -15.05300 -18.65600 1.000 69.72681  ? 743  ILE A CG1   1 
ATOM   5493  C  CG2   . ILE A 1 743  ? -32.96100 -14.07200 -18.29300 1.000 77.35874  ? 743  ILE A CG2   1 
ATOM   5494  C  CD1   . ILE A 1 743  ? -35.75800 -13.84500 -19.41300 1.000 69.50232  ? 743  ILE A CD1   1 
ATOM   5495  N  N     . HIS A 1 744  ? -34.38400 -18.10500 -17.89500 1.000 79.40372  ? 744  HIS A N     1 
ATOM   5496  C  CA    . HIS A 1 744  ? -34.32600 -19.17600 -18.87500 1.000 78.49715  ? 744  HIS A CA    1 
ATOM   5497  C  C     . HIS A 1 744  ? -35.04400 -18.74700 -20.14800 1.000 79.52349  ? 744  HIS A C     1 
ATOM   5498  O  O     . HIS A 1 744  ? -35.99100 -17.95700 -20.11400 1.000 81.75505  ? 744  HIS A O     1 
ATOM   5499  C  CB    . HIS A 1 744  ? -34.95800 -20.45600 -18.32600 1.000 79.47693  ? 744  HIS A CB    1 
ATOM   5500  C  CG    . HIS A 1 744  ? -34.35100 -20.93000 -17.04200 1.000 88.71514  ? 744  HIS A CG    1 
ATOM   5501  N  ND1   . HIS A 1 744  ? -33.36100 -21.88700 -16.99600 1.000 86.90683  ? 744  HIS A ND1   1 
ATOM   5502  C  CD2   . HIS A 1 744  ? -34.59700 -20.58000 -15.75700 1.000 90.98758  ? 744  HIS A CD2   1 
ATOM   5503  C  CE1   . HIS A 1 744  ? -33.02200 -22.10700 -15.73800 1.000 95.97182  ? 744  HIS A CE1   1 
ATOM   5504  N  NE2   . HIS A 1 744  ? -33.75600 -21.32500 -14.96600 1.000 100.03833 ? 744  HIS A NE2   1 
ATOM   5505  N  N     . MET A 1 745  ? -34.58200 -19.27600 -21.27900 1.000 80.91868  ? 745  MET A N     1 
ATOM   5506  C  CA    . MET A 1 745  ? -35.16500 -18.94700 -22.57500 1.000 72.24521  ? 745  MET A CA    1 
ATOM   5507  C  C     . MET A 1 745  ? -35.28400 -20.22200 -23.39400 1.000 74.96770  ? 745  MET A C     1 
ATOM   5508  O  O     . MET A 1 745  ? -34.28600 -20.91400 -23.61500 1.000 76.59357  ? 745  MET A O     1 
ATOM   5509  C  CB    . MET A 1 745  ? -34.32200 -17.90400 -23.31400 1.000 64.62889  ? 745  MET A CB    1 
ATOM   5510  C  CG    . MET A 1 745  ? -34.92000 -17.44800 -24.63100 1.000 66.27306  ? 745  MET A CG    1 
ATOM   5511  S  SD    . MET A 1 745  ? -33.99500 -16.09100 -25.37100 1.000 86.82762  ? 745  MET A SD    1 
ATOM   5512  C  CE    . MET A 1 745  ? -34.79500 -15.97100 -26.96900 1.000 66.39079  ? 745  MET A CE    1 
ATOM   5513  N  N     . GLY A 1 746  ? -36.50300 -20.52800 -23.84000 1.000 77.20223  ? 746  GLY A N     1 
ATOM   5514  C  CA    . GLY A 1 746  ? -36.74400 -21.74200 -24.58800 1.000 75.36349  ? 746  GLY A CA    1 
ATOM   5515  C  C     . GLY A 1 746  ? -36.28000 -21.65500 -26.02900 1.000 71.11383  ? 746  GLY A C     1 
ATOM   5516  O  O     . GLY A 1 746  ? -35.98000 -20.58700 -26.56100 1.000 70.78582  ? 746  GLY A O     1 
ATOM   5517  N  N     . GLY A 1 747  ? -36.22700 -22.82000 -26.66700 1.000 72.08846  ? 747  GLY A N     1 
ATOM   5518  C  CA    . GLY A 1 747  ? -35.78200 -22.92500 -28.03800 1.000 79.71944  ? 747  GLY A CA    1 
ATOM   5519  C  C     . GLY A 1 747  ? -36.85600 -22.51800 -29.02900 1.000 84.29558  ? 747  GLY A C     1 
ATOM   5520  O  O     . GLY A 1 747  ? -37.91100 -21.98500 -28.68300 1.000 93.15826  ? 747  GLY A O     1 
ATOM   5521  N  N     . GLN A 1 748  ? -36.56700 -22.78800 -30.30000 1.000 74.34660  ? 748  GLN A N     1 
ATOM   5522  C  CA    . GLN A 1 748  ? -37.45900 -22.42300 -31.38900 1.000 68.41917  ? 748  GLN A CA    1 
ATOM   5523  C  C     . GLN A 1 748  ? -37.26800 -23.39800 -32.53900 1.000 76.37916  ? 748  GLN A C     1 
ATOM   5524  O  O     . GLN A 1 748  ? -36.18600 -23.95900 -32.72400 1.000 86.93440  ? 748  GLN A O     1 
ATOM   5525  C  CB    . GLN A 1 748  ? -37.20300 -20.98900 -31.87000 1.000 68.13707  ? 748  GLN A CB    1 
ATOM   5526  C  CG    . GLN A 1 748  ? -38.44500 -20.23600 -32.31000 1.000 71.44218  ? 748  GLN A CG    1 
ATOM   5527  C  CD    . GLN A 1 748  ? -38.11100 -18.99200 -33.11400 1.000 71.46171  ? 748  GLN A CD    1 
ATOM   5528  O  OE1   . GLN A 1 748  ? -36.95800 -18.77100 -33.48400 1.000 73.98641  ? 748  GLN A OE1   1 
ATOM   5529  N  NE2   . GLN A 1 748  ? -39.12200 -18.17800 -33.39500 1.000 62.61971  ? 748  GLN A NE2   1 
ATOM   5530  N  N     . GLU A 1 749  ? -38.33300 -23.59400 -33.30700 1.000 74.07407  ? 749  GLU A N     1 
ATOM   5531  C  CA    . GLU A 1 749  ? -38.28400 -24.37700 -34.53200 1.000 69.32581  ? 749  GLU A CA    1 
ATOM   5532  C  C     . GLU A 1 749  ? -38.28000 -23.43700 -35.72800 1.000 69.18575  ? 749  GLU A C     1 
ATOM   5533  O  O     . GLU A 1 749  ? -38.98900 -22.42600 -35.73500 1.000 70.46149  ? 749  GLU A O     1 
ATOM   5534  C  CB    . GLU A 1 749  ? -39.47500 -25.33500 -34.62100 1.000 70.18391  ? 749  GLU A CB    1 
ATOM   5535  C  CG    . GLU A 1 749  ? -39.14400 -26.79300 -34.32700 1.000 80.74754  ? 749  GLU A CG    1 
ATOM   5536  C  CD    . GLU A 1 749  ? -38.16300 -27.39100 -35.32200 1.000 98.89161  ? 749  GLU A CD    1 
ATOM   5537  O  OE1   . GLU A 1 749  ? -38.11300 -26.91600 -36.47800 1.000 98.15759  ? 749  GLU A OE1   1 
ATOM   5538  O  OE2   . GLU A 1 749  ? -37.44600 -28.34400 -34.95000 1.000 87.67789  ? 749  GLU A OE2   1 
ATOM   5539  N  N     . HIS A 1 750  ? -37.46500 -23.76700 -36.73300 1.000 69.69868  ? 750  HIS A N     1 
ATOM   5540  C  CA    . HIS A 1 750  ? -37.44700 -22.97400 -37.95800 1.000 61.39579  ? 750  HIS A CA    1 
ATOM   5541  C  C     . HIS A 1 750  ? -38.83700 -22.90800 -38.57600 1.000 63.64384  ? 750  HIS A C     1 
ATOM   5542  O  O     . HIS A 1 750  ? -39.33000 -21.82500 -38.91300 1.000 64.94925  ? 750  HIS A O     1 
ATOM   5543  C  CB    . HIS A 1 750  ? -36.44500 -23.56100 -38.95300 1.000 63.81594  ? 750  HIS A CB    1 
ATOM   5544  C  CG    . HIS A 1 750  ? -35.10300 -23.86000 -38.36100 1.000 69.27819  ? 750  HIS A CG    1 
ATOM   5545  N  ND1   . HIS A 1 750  ? -34.12600 -22.90000 -38.20700 1.000 60.91547  ? 750  HIS A ND1   1 
ATOM   5546  C  CD2   . HIS A 1 750  ? -34.57200 -25.01500 -37.89400 1.000 75.97641  ? 750  HIS A CD2   1 
ATOM   5547  C  CE1   . HIS A 1 750  ? -33.05300 -23.45000 -37.66600 1.000 72.22426  ? 750  HIS A CE1   1 
ATOM   5548  N  NE2   . HIS A 1 750  ? -33.29700 -24.73200 -37.46700 1.000 80.73044  ? 750  HIS A NE2   1 
ATOM   5549  N  N     . PHE A 1 751  ? -39.48800 -24.06200 -38.70400 1.000 67.85762  ? 751  PHE A N     1 
ATOM   5550  C  CA    . PHE A 1 751  ? -40.82000 -24.18200 -39.29300 1.000 63.10842  ? 751  PHE A CA    1 
ATOM   5551  C  C     . PHE A 1 751  ? -40.89900 -23.45500 -40.63300 1.000 59.66977  ? 751  PHE A C     1 
ATOM   5552  O  O     . PHE A 1 751  ? -41.83400 -22.70000 -40.91100 1.000 68.57533  ? 751  PHE A O     1 
ATOM   5553  C  CB    . PHE A 1 751  ? -41.90100 -23.68700 -38.33100 1.000 54.72948  ? 751  PHE A CB    1 
ATOM   5554  C  CG    . PHE A 1 751  ? -43.18200 -24.47000 -38.41600 1.000 58.77043  ? 751  PHE A CG    1 
ATOM   5555  C  CD1   . PHE A 1 751  ? -44.05800 -24.28000 -39.47200 1.000 61.47453  ? 751  PHE A CD1   1 
ATOM   5556  C  CD2   . PHE A 1 751  ? -43.50100 -25.40800 -37.44800 1.000 62.14105  ? 751  PHE A CD2   1 
ATOM   5557  C  CE1   . PHE A 1 751  ? -45.23200 -25.00300 -39.55800 1.000 65.04542  ? 751  PHE A CE1   1 
ATOM   5558  C  CE2   . PHE A 1 751  ? -44.67500 -26.13500 -37.52700 1.000 66.69962  ? 751  PHE A CE2   1 
ATOM   5559  C  CZ    . PHE A 1 751  ? -45.54100 -25.93100 -38.58300 1.000 71.95021  ? 751  PHE A CZ    1 
ATOM   5560  N  N     . TYR A 1 752  ? -39.88200 -23.67200 -41.46000 1.000 54.16904  ? 752  TYR A N     1 
ATOM   5561  C  CA    . TYR A 1 752  ? -39.97400 -23.28400 -42.85700 1.000 53.94396  ? 752  TYR A CA    1 
ATOM   5562  C  C     . TYR A 1 752  ? -41.13200 -24.02900 -43.50700 1.000 60.72245  ? 752  TYR A C     1 
ATOM   5563  O  O     . TYR A 1 752  ? -41.41400 -25.18400 -43.17300 1.000 56.61278  ? 752  TYR A O     1 
ATOM   5564  C  CB    . TYR A 1 752  ? -38.66100 -23.58900 -43.58000 1.000 51.03956  ? 752  TYR A CB    1 
ATOM   5565  C  CG    . TYR A 1 752  ? -37.90100 -24.75500 -42.98600 1.000 51.63157  ? 752  TYR A CG    1 
ATOM   5566  C  CD1   . TYR A 1 752  ? -38.40800 -26.04600 -43.05100 1.000 53.55590  ? 752  TYR A CD1   1 
ATOM   5567  C  CD2   . TYR A 1 752  ? -36.67600 -24.56500 -42.36000 1.000 54.71998  ? 752  TYR A CD2   1 
ATOM   5568  C  CE1   . TYR A 1 752  ? -37.72100 -27.11400 -42.50900 1.000 48.27712  ? 752  TYR A CE1   1 
ATOM   5569  C  CE2   . TYR A 1 752  ? -35.98000 -25.62900 -41.81600 1.000 57.18189  ? 752  TYR A CE2   1 
ATOM   5570  C  CZ    . TYR A 1 752  ? -36.50800 -26.90100 -41.89300 1.000 55.31986  ? 752  TYR A CZ    1 
ATOM   5571  O  OH    . TYR A 1 752  ? -35.82200 -27.96400 -41.35400 1.000 60.07941  ? 752  TYR A OH    1 
ATOM   5572  N  N     . MET A 1 753  ? -41.82200 -23.35800 -44.43000 1.000 54.78047  ? 753  MET A N     1 
ATOM   5573  C  CA    . MET A 1 753  ? -43.01300 -23.96700 -45.01000 1.000 55.94617  ? 753  MET A CA    1 
ATOM   5574  C  C     . MET A 1 753  ? -42.66100 -25.11600 -45.94700 1.000 57.48341  ? 753  MET A C     1 
ATOM   5575  O  O     . MET A 1 753  ? -43.46900 -26.03500 -46.12200 1.000 59.57442  ? 753  MET A O     1 
ATOM   5576  C  CB    . MET A 1 753  ? -43.84700 -22.91200 -45.73200 1.000 61.10472  ? 753  MET A CB    1 
ATOM   5577  C  CG    . MET A 1 753  ? -44.63700 -22.01900 -44.78500 1.000 55.22178  ? 753  MET A CG    1 
ATOM   5578  S  SD    . MET A 1 753  ? -45.60500 -22.94700 -43.57600 1.000 58.83691  ? 753  MET A SD    1 
ATOM   5579  C  CE    . MET A 1 753  ? -46.70700 -23.87000 -44.64300 1.000 56.31132  ? 753  MET A CE    1 
ATOM   5580  N  N     . GLU A 1 754  ? -41.47300 -25.09200 -46.54800 1.000 56.45654  ? 754  GLU A N     1 
ATOM   5581  C  CA    . GLU A 1 754  ? -40.98600 -26.19900 -47.36500 1.000 48.58769  ? 754  GLU A CA    1 
ATOM   5582  C  C     . GLU A 1 754  ? -40.04100 -27.03900 -46.51400 1.000 49.60782  ? 754  GLU A C     1 
ATOM   5583  O  O     . GLU A 1 754  ? -38.95400 -26.58200 -46.14700 1.000 53.66146  ? 754  GLU A O     1 
ATOM   5584  C  CB    . GLU A 1 754  ? -40.28300 -25.69700 -48.62400 1.000 49.55393  ? 754  GLU A CB    1 
ATOM   5585  C  CG    . GLU A 1 754  ? -39.73000 -26.81900 -49.49200 1.000 52.49237  ? 754  GLU A CG    1 
ATOM   5586  C  CD    . GLU A 1 754  ? -38.72700 -26.33300 -50.52000 1.000 61.27964  ? 754  GLU A CD    1 
ATOM   5587  O  OE1   . GLU A 1 754  ? -37.90600 -25.45400 -50.18300 1.000 63.07192  ? 754  GLU A OE1   1 
ATOM   5588  O  OE2   . GLU A 1 754  ? -38.75300 -26.83700 -51.66400 1.000 60.30286  ? 754  GLU A OE2   1 
ATOM   5589  N  N     . THR A 1 755  ? -40.45600 -28.26500 -46.20200 1.000 49.88577  ? 755  THR A N     1 
ATOM   5590  C  CA    . THR A 1 755  ? -39.63700 -29.15900 -45.39800 1.000 50.63520  ? 755  THR A CA    1 
ATOM   5591  C  C     . THR A 1 755  ? -38.39000 -29.57600 -46.17700 1.000 47.24317  ? 755  THR A C     1 
ATOM   5592  O  O     . THR A 1 755  ? -38.20000 -29.22300 -47.34500 1.000 53.41932  ? 755  THR A O     1 
ATOM   5593  C  CB    . THR A 1 755  ? -40.44600 -30.38200 -44.97100 1.000 53.12362  ? 755  THR A CB    1 
ATOM   5594  O  OG1   . THR A 1 755  ? -40.94200 -31.05800 -46.13300 1.000 57.63897  ? 755  THR A OG1   1 
ATOM   5595  C  CG2   . THR A 1 755  ? -41.61800 -29.96700 -44.09600 1.000 56.40940  ? 755  THR A CG2   1 
ATOM   5596  N  N     . GLN A 1 756  ? -37.52400 -30.33700 -45.51100 1.000 49.66647  ? 756  GLN A N     1 
ATOM   5597  C  CA    . GLN A 1 756  ? -36.30500 -30.82700 -46.14200 1.000 50.94602  ? 756  GLN A CA    1 
ATOM   5598  C  C     . GLN A 1 756  ? -36.64500 -31.63500 -47.38600 1.000 51.31545  ? 756  GLN A C     1 
ATOM   5599  O  O     . GLN A 1 756  ? -37.30400 -32.67600 -47.30200 1.000 60.26968  ? 756  GLN A O     1 
ATOM   5600  C  CB    . GLN A 1 756  ? -35.50300 -31.67700 -45.15500 1.000 53.81233  ? 756  GLN A CB    1 
ATOM   5601  C  CG    . GLN A 1 756  ? -35.11700 -30.96400 -43.86400 1.000 51.53718  ? 756  GLN A CG    1 
ATOM   5602  C  CD    . GLN A 1 756  ? -34.04600 -29.90400 -44.06000 1.000 56.80613  ? 756  GLN A CD    1 
ATOM   5603  O  OE1   . GLN A 1 756  ? -33.54400 -29.70100 -45.16600 1.000 62.96534  ? 756  GLN A OE1   1 
ATOM   5604  N  NE2   . GLN A 1 756  ? -33.69200 -29.21900 -42.97800 1.000 59.69023  ? 756  GLN A NE2   1 
ATOM   5605  N  N     . SER A 1 757  ? -36.19900 -31.14800 -48.54100 1.000 49.75593  ? 757  SER A N     1 
ATOM   5606  C  CA    . SER A 1 757  ? -36.50300 -31.77100 -49.82000 1.000 48.93042  ? 757  SER A CA    1 
ATOM   5607  C  C     . SER A 1 757  ? -35.25100 -31.78700 -50.67900 1.000 48.88593  ? 757  SER A C     1 
ATOM   5608  O  O     . SER A 1 757  ? -34.50400 -30.80500 -50.71600 1.000 52.15008  ? 757  SER A O     1 
ATOM   5609  C  CB    . SER A 1 757  ? -37.62600 -31.02400 -50.55000 1.000 49.93579  ? 757  SER A CB    1 
ATOM   5610  O  OG    . SER A 1 757  ? -38.69500 -30.72400 -49.67100 1.000 54.50222  ? 757  SER A OG    1 
ATOM   5611  N  N     . MET A 1 758  ? -35.02500 -32.90200 -51.36900 1.000 48.02610  ? 758  MET A N     1 
ATOM   5612  C  CA    . MET A 1 758  ? -33.88000 -33.00400 -52.26100 1.000 54.18033  ? 758  MET A CA    1 
ATOM   5613  C  C     . MET A 1 758  ? -34.09100 -34.14600 -53.24300 1.000 53.74265  ? 758  MET A C     1 
ATOM   5614  O  O     . MET A 1 758  ? -34.79300 -35.11900 -52.95000 1.000 44.92555  ? 758  MET A O     1 
ATOM   5615  C  CB    . MET A 1 758  ? -32.57400 -33.20900 -51.48700 1.000 51.17727  ? 758  MET A CB    1 
ATOM   5616  C  CG    . MET A 1 758  ? -32.45800 -34.55600 -50.80800 1.000 49.74902  ? 758  MET A CG    1 
ATOM   5617  S  SD    . MET A 1 758  ? -31.16100 -34.55100 -49.56300 1.000 62.07769  ? 758  MET A SD    1 
ATOM   5618  C  CE    . MET A 1 758  ? -31.76700 -33.29400 -48.44200 1.000 57.03141  ? 758  MET A CE    1 
ATOM   5619  N  N     . LEU A 1 759  ? -33.47500 -34.00300 -54.41400 1.000 49.62666  ? 759  LEU A N     1 
ATOM   5620  C  CA    . LEU A 1 759  ? -33.44400 -35.03600 -55.44000 1.000 44.89555  ? 759  LEU A CA    1 
ATOM   5621  C  C     . LEU A 1 759  ? -32.01200 -35.16500 -55.93500 1.000 46.85445  ? 759  LEU A C     1 
ATOM   5622  O  O     . LEU A 1 759  ? -31.35600 -34.15500 -56.20900 1.000 50.86597  ? 759  LEU A O     1 
ATOM   5623  C  CB    . LEU A 1 759  ? -34.38800 -34.70500 -56.60000 1.000 44.84763  ? 759  LEU A CB    1 
ATOM   5624  C  CG    . LEU A 1 759  ? -34.31500 -35.62700 -57.81800 1.000 45.40814  ? 759  LEU A CG    1 
ATOM   5625  C  CD1   . LEU A 1 759  ? -34.84000 -37.01500 -57.48400 1.000 51.40113  ? 759  LEU A CD1   1 
ATOM   5626  C  CD2   . LEU A 1 759  ? -35.07800 -35.02900 -58.98800 1.000 49.71937  ? 759  LEU A CD2   1 
ATOM   5627  N  N     . VAL A 1 760  ? -31.52900 -36.39900 -56.03600 1.000 45.42458  ? 760  VAL A N     1 
ATOM   5628  C  CA    . VAL A 1 760  ? -30.14100 -36.68300 -56.38200 1.000 46.97709  ? 760  VAL A CA    1 
ATOM   5629  C  C     . VAL A 1 760  ? -30.13500 -37.58000 -57.61300 1.000 49.23353  ? 760  VAL A C     1 
ATOM   5630  O  O     . VAL A 1 760  ? -30.65900 -38.70000 -57.57100 1.000 48.51672  ? 760  VAL A O     1 
ATOM   5631  C  CB    . VAL A 1 760  ? -29.39100 -37.33900 -55.21300 1.000 46.98749  ? 760  VAL A CB    1 
ATOM   5632  C  CG1   . VAL A 1 760  ? -27.90800 -37.21200 -55.41000 1.000 48.29882  ? 760  VAL A CG1   1 
ATOM   5633  C  CG2   . VAL A 1 760  ? -29.79700 -36.69000 -53.90100 1.000 51.29289  ? 760  VAL A CG2   1 
ATOM   5634  N  N     . VAL A 1 761  ? -29.54100 -37.09400 -58.70000 1.000 46.86952  ? 761  VAL A N     1 
ATOM   5635  C  CA    . VAL A 1 761  ? -29.63200 -37.76300 -59.99700 1.000 50.33668  ? 761  VAL A CA    1 
ATOM   5636  C  C     . VAL A 1 761  ? -28.24400 -38.09300 -60.53500 1.000 54.00556  ? 761  VAL A C     1 
ATOM   5637  O  O     . VAL A 1 761  ? -27.50900 -37.18600 -60.95200 1.000 58.96898  ? 761  VAL A O     1 
ATOM   5638  C  CB    . VAL A 1 761  ? -30.40700 -36.90000 -61.00600 1.000 44.48881  ? 761  VAL A CB    1 
ATOM   5639  C  CG1   . VAL A 1 761  ? -30.51400 -37.61400 -62.34400 1.000 40.32700  ? 761  VAL A CG1   1 
ATOM   5640  C  CG2   . VAL A 1 761  ? -31.78600 -36.55400 -60.46500 1.000 45.51945  ? 761  VAL A CG2   1 
ATOM   5641  N  N     . PRO A 1 762  ? -27.84800 -39.36500 -60.56000 1.000 48.08299  ? 762  PRO A N     1 
ATOM   5642  C  CA    . PRO A 1 762  ? -26.56600 -39.72200 -61.17900 1.000 48.24170  ? 762  PRO A CA    1 
ATOM   5643  C  C     . PRO A 1 762  ? -26.64000 -39.62100 -62.69400 1.000 50.41917  ? 762  PRO A C     1 
ATOM   5644  O  O     . PRO A 1 762  ? -27.63700 -40.00000 -63.31400 1.000 56.18522  ? 762  PRO A O     1 
ATOM   5645  C  CB    . PRO A 1 762  ? -26.34600 -41.16800 -60.72300 1.000 52.80442  ? 762  PRO A CB    1 
ATOM   5646  C  CG    . PRO A 1 762  ? -27.72700 -41.69800 -60.52100 1.000 52.35942  ? 762  PRO A CG    1 
ATOM   5647  C  CD    . PRO A 1 762  ? -28.53300 -40.53800 -59.99100 1.000 53.08430  ? 762  PRO A CD    1 
ATOM   5648  N  N     . LYS A 1 763  ? -25.56400 -39.10600 -63.29200 1.000 53.53258  ? 763  LYS A N     1 
ATOM   5649  C  CA    . LYS A 1 763  ? -25.55200 -38.89800 -64.73600 1.000 60.72135  ? 763  LYS A CA    1 
ATOM   5650  C  C     . LYS A 1 763  ? -25.26300 -40.18200 -65.50300 1.000 60.06388  ? 763  LYS A C     1 
ATOM   5651  O  O     . LYS A 1 763  ? -25.71300 -40.33000 -66.64500 1.000 59.80067  ? 763  LYS A O     1 
ATOM   5652  C  CB    . LYS A 1 763  ? -24.52500 -37.82800 -65.10700 1.000 56.63453  ? 763  LYS A CB    1 
ATOM   5653  C  CG    . LYS A 1 763  ? -24.79700 -37.14200 -66.43700 1.000 55.39711  ? 763  LYS A CG    1 
ATOM   5654  C  CD    . LYS A 1 763  ? -25.99700 -36.21600 -66.33400 1.000 66.21140  ? 763  LYS A CD    1 
ATOM   5655  C  CE    . LYS A 1 763  ? -26.30700 -35.55300 -67.66500 1.000 71.62110  ? 763  LYS A CE    1 
ATOM   5656  N  NZ    . LYS A 1 763  ? -27.44900 -34.60100 -67.55600 1.000 60.84119  ? 763  LYS A NZ    1 
ATOM   5657  N  N     . GLY A 1 764  ? -24.52100 -41.11300 -64.90500 1.000 59.15709  ? 764  GLY A N     1 
ATOM   5658  C  CA    . GLY A 1 764  ? -24.16000 -42.34900 -65.56300 1.000 49.60232  ? 764  GLY A CA    1 
ATOM   5659  C  C     . GLY A 1 764  ? -22.80000 -42.35300 -66.22500 1.000 53.26198  ? 764  GLY A C     1 
ATOM   5660  O  O     . GLY A 1 764  ? -22.44200 -43.35500 -66.85400 1.000 59.08569  ? 764  GLY A O     1 
ATOM   5661  N  N     . GLU A 1 765  ? -22.03700 -41.26800 -66.11200 1.000 53.80238  ? 765  GLU A N     1 
ATOM   5662  C  CA    . GLU A 1 765  ? -20.69300 -41.18300 -66.66800 1.000 51.73099  ? 765  GLU A CA    1 
ATOM   5663  C  C     . GLU A 1 765  ? -19.75900 -40.60400 -65.61700 1.000 51.76744  ? 765  GLU A C     1 
ATOM   5664  O  O     . GLU A 1 765  ? -20.09600 -39.60700 -64.97100 1.000 62.38166  ? 765  GLU A O     1 
ATOM   5665  C  CB    . GLU A 1 765  ? -20.65500 -40.30800 -67.92500 1.000 55.00853  ? 765  GLU A CB    1 
ATOM   5666  C  CG    . GLU A 1 765  ? -21.61400 -40.71800 -69.02400 1.000 59.50345  ? 765  GLU A CG    1 
ATOM   5667  C  CD    . GLU A 1 765  ? -21.46100 -39.85100 -70.25800 1.000 64.07961  ? 765  GLU A CD    1 
ATOM   5668  O  OE1   . GLU A 1 765  ? -20.62000 -38.92700 -70.23000 1.000 65.74575  ? 765  GLU A OE1   1 
ATOM   5669  O  OE2   . GLU A 1 765  ? -22.17200 -40.09200 -71.25500 1.000 66.96347  ? 765  GLU A OE2   1 
ATOM   5670  N  N     . ASP A 1 766  ? -18.59000 -41.22900 -65.45200 1.000 53.56997  ? 766  ASP A N     1 
ATOM   5671  C  CA    . ASP A 1 766  ? -17.54800 -40.74200 -64.54300 1.000 57.76142  ? 766  ASP A CA    1 
ATOM   5672  C  C     . ASP A 1 766  ? -18.08800 -40.49900 -63.13700 1.000 59.08572  ? 766  ASP A C     1 
ATOM   5673  O  O     . ASP A 1 766  ? -17.57100 -39.65800 -62.39600 1.000 61.85372  ? 766  ASP A O     1 
ATOM   5674  C  CB    . ASP A 1 766  ? -16.88900 -39.47300 -65.08800 1.000 52.87243  ? 766  ASP A CB    1 
ATOM   5675  C  CG    . ASP A 1 766  ? -16.39300 -39.63800 -66.50900 1.000 60.11907  ? 766  ASP A CG    1 
ATOM   5676  O  OD1   . ASP A 1 766  ? -15.64400 -40.60300 -66.77000 1.000 69.59279  ? 766  ASP A OD1   1 
ATOM   5677  O  OD2   . ASP A 1 766  ? -16.75200 -38.80300 -67.36500 1.000 64.40213  ? 766  ASP A OD2   1 
ATOM   5678  N  N     . GLN A 1 767  ? -19.12600 -41.25100 -62.75700 1.000 56.54051  ? 767  GLN A N     1 
ATOM   5679  C  CA    . GLN A 1 767  ? -19.79900 -41.08800 -61.46600 1.000 63.66492  ? 767  GLN A CA    1 
ATOM   5680  C  C     . GLN A 1 767  ? -20.22300 -39.63900 -61.22700 1.000 61.44688  ? 767  GLN A C     1 
ATOM   5681  O  O     . GLN A 1 767  ? -20.21300 -39.15200 -60.09400 1.000 64.61690  ? 767  GLN A O     1 
ATOM   5682  C  CB    . GLN A 1 767  ? -18.92900 -41.60400 -60.31300 1.000 64.72126  ? 767  GLN A CB    1 
ATOM   5683  C  CG    . GLN A 1 767  ? -17.88600 -42.63900 -60.72900 1.000 71.80879  ? 767  GLN A CG    1 
ATOM   5684  C  CD    . GLN A 1 767  ? -17.05700 -43.14400 -59.56800 1.000 76.92677  ? 767  GLN A CD    1 
ATOM   5685  O  OE1   . GLN A 1 767  ? -17.58800 -43.67300 -58.59100 1.000 80.20279  ? 767  GLN A OE1   1 
ATOM   5686  N  NE2   . GLN A 1 767  ? -15.74200 -42.98900 -59.67200 1.000 67.64819  ? 767  GLN A NE2   1 
ATOM   5687  N  N     . GLU A 1 768  ? -20.59600 -38.94100 -62.29900 1.000 59.32584  ? 768  GLU A N     1 
ATOM   5688  C  CA    . GLU A 1 768  ? -21.13000 -37.59200 -62.16400 1.000 54.50784  ? 768  GLU A CA    1 
ATOM   5689  C  C     . GLU A 1 768  ? -22.45700 -37.62800 -61.41900 1.000 58.06053  ? 768  GLU A C     1 
ATOM   5690  O  O     . GLU A 1 768  ? -23.28600 -38.51700 -61.63500 1.000 61.51502  ? 768  GLU A O     1 
ATOM   5691  C  CB    . GLU A 1 768  ? -21.32400 -36.95100 -63.53700 1.000 54.44403  ? 768  GLU A CB    1 
ATOM   5692  C  CG    . GLU A 1 768  ? -20.12700 -36.17800 -64.05900 1.000 56.58777  ? 768  GLU A CG    1 
ATOM   5693  C  CD    . GLU A 1 768  ? -20.26500 -35.83700 -65.53100 1.000 61.78037  ? 768  GLU A CD    1 
ATOM   5694  O  OE1   . GLU A 1 768  ? -19.32100 -36.10700 -66.30300 1.000 67.84930  ? 768  GLU A OE1   1 
ATOM   5695  O  OE2   . GLU A 1 768  ? -21.32600 -35.30300 -65.91800 1.000 61.23976  ? 768  GLU A OE2   1 
ATOM   5696  N  N     . MET A 1 769  ? -22.65900 -36.65500 -60.53500 1.000 55.45313  ? 769  MET A N     1 
ATOM   5697  C  CA    . MET A 1 769  ? -23.86800 -36.59600 -59.72700 1.000 59.66925  ? 769  MET A CA    1 
ATOM   5698  C  C     . MET A 1 769  ? -24.34900 -35.15500 -59.65700 1.000 59.37789  ? 769  MET A C     1 
ATOM   5699  O  O     . MET A 1 769  ? -23.56700 -34.25300 -59.34100 1.000 57.62153  ? 769  MET A O     1 
ATOM   5700  C  CB    . MET A 1 769  ? -23.61700 -37.14000 -58.31400 1.000 57.08677  ? 769  MET A CB    1 
ATOM   5701  C  CG    . MET A 1 769  ? -23.09300 -38.57200 -58.28300 1.000 74.07145  ? 769  MET A CG    1 
ATOM   5702  S  SD    . MET A 1 769  ? -24.36000 -39.84000 -58.09400 1.000 82.26224  ? 769  MET A SD    1 
ATOM   5703  C  CE    . MET A 1 769  ? -25.39900 -39.09400 -56.85100 1.000 51.64354  ? 769  MET A CE    1 
ATOM   5704  N  N     . ASP A 1 770  ? -25.62600 -34.94100 -59.96200 1.000 50.57143  ? 770  ASP A N     1 
ATOM   5705  C  CA    . ASP A 1 770  ? -26.27700 -33.64700 -59.79300 1.000 52.53824  ? 770  ASP A CA    1 
ATOM   5706  C  C     . ASP A 1 770  ? -27.26100 -33.75000 -58.63700 1.000 52.40547  ? 770  ASP A C     1 
ATOM   5707  O  O     . ASP A 1 770  ? -28.18700 -34.56800 -58.67700 1.000 48.10000  ? 770  ASP A O     1 
ATOM   5708  C  CB    . ASP A 1 770  ? -27.00000 -33.20800 -61.06800 1.000 53.28931  ? 770  ASP A CB    1 
ATOM   5709  C  CG    . ASP A 1 770  ? -26.18000 -33.44200 -62.31800 1.000 57.45222  ? 770  ASP A CG    1 
ATOM   5710  O  OD1   . ASP A 1 770  ? -25.16900 -32.73400 -62.50700 1.000 54.74062  ? 770  ASP A OD1   1 
ATOM   5711  O  OD2   . ASP A 1 770  ? -26.55200 -34.32900 -63.11600 1.000 65.65470  ? 770  ASP A OD2   1 
ATOM   5712  N  N     . VAL A 1 771  ? -27.06100 -32.92700 -57.61300 1.000 50.50020  ? 771  VAL A N     1 
ATOM   5713  C  CA    . VAL A 1 771  ? -27.96800 -32.86000 -56.47500 1.000 50.71370  ? 771  VAL A CA    1 
ATOM   5714  C  C     . VAL A 1 771  ? -28.83000 -31.61200 -56.62000 1.000 48.62621  ? 771  VAL A C     1 
ATOM   5715  O  O     . VAL A 1 771  ? -28.33100 -30.53400 -56.96800 1.000 50.08030  ? 771  VAL A O     1 
ATOM   5716  C  CB    . VAL A 1 771  ? -27.20200 -32.87300 -55.13800 1.000 43.50212  ? 771  VAL A CB    1 
ATOM   5717  C  CG1   . VAL A 1 771  ? -26.30000 -34.08900 -55.06100 1.000 45.88012  ? 771  VAL A CG1   1 
ATOM   5718  C  CG2   . VAL A 1 771  ? -26.37800 -31.61500 -54.95500 1.000 56.75141  ? 771  VAL A CG2   1 
ATOM   5719  N  N     . TYR A 1 772  ? -30.13100 -31.77000 -56.40100 1.000 42.21639  ? 772  TYR A N     1 
ATOM   5720  C  CA    . TYR A 1 772  ? -31.08500 -30.66500 -56.41100 1.000 49.65923  ? 772  TYR A CA    1 
ATOM   5721  C  C     . TYR A 1 772  ? -31.66400 -30.59600 -55.00400 1.000 55.12624  ? 772  TYR A C     1 
ATOM   5722  O  O     . TYR A 1 772  ? -32.52300 -31.40300 -54.64000 1.000 55.33304  ? 772  TYR A O     1 
ATOM   5723  C  CB    . TYR A 1 772  ? -32.16700 -30.87300 -57.46700 1.000 48.69023  ? 772  TYR A CB    1 
ATOM   5724  C  CG    . TYR A 1 772  ? -31.61800 -31.04300 -58.86500 1.000 48.52620  ? 772  TYR A CG    1 
ATOM   5725  C  CD1   . TYR A 1 772  ? -31.27400 -29.94200 -59.63500 1.000 52.77001  ? 772  TYR A CD1   1 
ATOM   5726  C  CD2   . TYR A 1 772  ? -31.43600 -32.30600 -59.41100 1.000 47.73301  ? 772  TYR A CD2   1 
ATOM   5727  C  CE1   . TYR A 1 772  ? -30.76800 -30.09100 -60.91100 1.000 50.51486  ? 772  TYR A CE1   1 
ATOM   5728  C  CE2   . TYR A 1 772  ? -30.93100 -32.46600 -60.68700 1.000 42.81874  ? 772  TYR A CE2   1 
ATOM   5729  C  CZ    . TYR A 1 772  ? -30.59800 -31.35500 -61.43200 1.000 46.80423  ? 772  TYR A CZ    1 
ATOM   5730  O  OH    . TYR A 1 772  ? -30.09500 -31.50800 -62.70300 1.000 56.02750  ? 772  TYR A OH    1 
ATOM   5731  N  N     . VAL A 1 773  ? -31.17700 -29.64600 -54.21200 1.000 54.28136  ? 773  VAL A N     1 
ATOM   5732  C  CA    . VAL A 1 773  ? -31.45700 -29.60700 -52.78500 1.000 49.58874  ? 773  VAL A CA    1 
ATOM   5733  C  C     . VAL A 1 773  ? -32.08900 -28.27000 -52.42700 1.000 55.71332  ? 773  VAL A C     1 
ATOM   5734  O  O     . VAL A 1 773  ? -31.85100 -27.24800 -53.07900 1.000 53.57520  ? 773  VAL A O     1 
ATOM   5735  C  CB    . VAL A 1 773  ? -30.17400 -29.83500 -51.95200 1.000 48.77761  ? 773  VAL A CB    1 
ATOM   5736  C  CG1   . VAL A 1 773  ? -30.52300 -30.29700 -50.55000 1.000 52.72650  ? 773  VAL A CG1   1 
ATOM   5737  C  CG2   . VAL A 1 773  ? -29.25600 -30.83500 -52.63800 1.000 52.95428  ? 773  VAL A CG2   1 
ATOM   5738  N  N     . SER A 1 774  ? -32.91300 -28.29100 -51.38200 1.000 53.87310  ? 774  SER A N     1 
ATOM   5739  C  CA    . SER A 1 774  ? -33.39900 -27.07300 -50.73800 1.000 57.41403  ? 774  SER A CA    1 
ATOM   5740  C  C     . SER A 1 774  ? -32.44000 -26.77500 -49.59300 1.000 59.32273  ? 774  SER A C     1 
ATOM   5741  O  O     . SER A 1 774  ? -32.57200 -27.30200 -48.48800 1.000 58.29138  ? 774  SER A O     1 
ATOM   5742  C  CB    . SER A 1 774  ? -34.83300 -27.25000 -50.25600 1.000 55.80572  ? 774  SER A CB    1 
ATOM   5743  O  OG    . SER A 1 774  ? -35.30500 -26.08100 -49.61000 1.000 57.72005  ? 774  SER A OG    1 
ATOM   5744  N  N     . THR A 1 775  ? -31.44700 -25.93100 -49.86700 1.000 54.24364  ? 775  THR A N     1 
ATOM   5745  C  CA    . THR A 1 775  ? -30.38900 -25.66300 -48.90500 1.000 53.30180  ? 775  THR A CA    1 
ATOM   5746  C  C     . THR A 1 775  ? -29.90600 -24.22900 -49.06500 1.000 50.42247  ? 775  THR A C     1 
ATOM   5747  O  O     . THR A 1 775  ? -30.23100 -23.54300 -50.03700 1.000 50.40605  ? 775  THR A O     1 
ATOM   5748  C  CB    . THR A 1 775  ? -29.21800 -26.63800 -49.07400 1.000 58.88487  ? 775  THR A CB    1 
ATOM   5749  O  OG1   . THR A 1 775  ? -28.11500 -26.20900 -48.26600 1.000 58.64491  ? 775  THR A OG1   1 
ATOM   5750  C  CG2   . THR A 1 775  ? -28.77900 -26.68700 -50.52900 1.000 60.40940  ? 775  THR A CG2   1 
ATOM   5751  N  N     . GLN A 1 776  ? -29.11600 -23.78400 -48.08700 1.000 53.02469  ? 776  GLN A N     1 
ATOM   5752  C  CA    . GLN A 1 776  ? -28.50600 -22.46300 -48.11300 1.000 49.14636  ? 776  GLN A CA    1 
ATOM   5753  C  C     . GLN A 1 776  ? -27.05200 -22.48400 -48.55300 1.000 57.42386  ? 776  GLN A C     1 
ATOM   5754  O  O     . GLN A 1 776  ? -26.53800 -21.44800 -48.98800 1.000 61.73908  ? 776  GLN A O     1 
ATOM   5755  C  CB    . GLN A 1 776  ? -28.57600 -21.81500 -46.72600 1.000 54.28612  ? 776  GLN A CB    1 
ATOM   5756  C  CG    . GLN A 1 776  ? -29.96900 -21.69100 -46.15900 1.000 57.95896  ? 776  GLN A CG    1 
ATOM   5757  C  CD    . GLN A 1 776  ? -29.95800 -21.43800 -44.66600 1.000 63.55169  ? 776  GLN A CD    1 
ATOM   5758  O  OE1   . GLN A 1 776  ? -30.00700 -22.37300 -43.86900 1.000 66.30534  ? 776  GLN A OE1   1 
ATOM   5759  N  NE2   . GLN A 1 776  ? -29.88800 -20.16900 -44.27900 1.000 62.84054  ? 776  GLN A NE2   1 
ATOM   5760  N  N     . PHE A 1 777  ? -26.38100 -23.63000 -48.44700 1.000 57.78861  ? 777  PHE A N     1 
ATOM   5761  C  CA    . PHE A 1 777  ? -24.93800 -23.73400 -48.65300 1.000 58.74568  ? 777  PHE A CA    1 
ATOM   5762  C  C     . PHE A 1 777  ? -24.67400 -24.80500 -49.70400 1.000 57.92447  ? 777  PHE A C     1 
ATOM   5763  O  O     . PHE A 1 777  ? -24.33000 -25.94700 -49.37000 1.000 62.87295  ? 777  PHE A O     1 
ATOM   5764  C  CB    . PHE A 1 777  ? -24.22700 -24.05700 -47.33800 1.000 59.60292  ? 777  PHE A CB    1 
ATOM   5765  C  CG    . PHE A 1 777  ? -22.79700 -23.60500 -47.28700 1.000 57.29387  ? 777  PHE A CG    1 
ATOM   5766  C  CD1   . PHE A 1 777  ? -22.19000 -23.04300 -48.39700 1.000 55.12359  ? 777  PHE A CD1   1 
ATOM   5767  C  CD2   . PHE A 1 777  ? -22.06200 -23.73600 -46.12000 1.000 58.00165  ? 777  PHE A CD2   1 
ATOM   5768  C  CE1   . PHE A 1 777  ? -20.87500 -22.62500 -48.34600 1.000 62.92329  ? 777  PHE A CE1   1 
ATOM   5769  C  CE2   . PHE A 1 777  ? -20.74600 -23.32100 -46.06200 1.000 60.76102  ? 777  PHE A CE2   1 
ATOM   5770  C  CZ    . PHE A 1 777  ? -20.15200 -22.76400 -47.17600 1.000 65.99580  ? 777  PHE A CZ    1 
ATOM   5771  N  N     . PRO A 1 778  ? -24.83000 -24.47100 -50.98900 1.000 55.32654  ? 778  PRO A N     1 
ATOM   5772  C  CA    . PRO A 1 778  ? -24.58600 -25.47600 -52.03800 1.000 53.28777  ? 778  PRO A CA    1 
ATOM   5773  C  C     . PRO A 1 778  ? -23.16200 -26.00000 -52.05600 1.000 54.23368  ? 778  PRO A C     1 
ATOM   5774  O  O     . PRO A 1 778  ? -22.94500 -27.15900 -52.43000 1.000 61.05889  ? 778  PRO A O     1 
ATOM   5775  C  CB    . PRO A 1 778  ? -24.92200 -24.72000 -53.33000 1.000 48.05821  ? 778  PRO A CB    1 
ATOM   5776  C  CG    . PRO A 1 778  ? -25.82400 -23.61900 -52.90100 1.000 47.54734  ? 778  PRO A CG    1 
ATOM   5777  C  CD    . PRO A 1 778  ? -25.34000 -23.20800 -51.54500 1.000 50.91699  ? 778  PRO A CD    1 
ATOM   5778  N  N     . LYS A 1 779  ? -22.18200 -25.17800 -51.67200 1.000 55.83834  ? 779  LYS A N     1 
ATOM   5779  C  CA    . LYS A 1 779  ? -20.80600 -25.65800 -51.60500 1.000 58.36638  ? 779  LYS A CA    1 
ATOM   5780  C  C     . LYS A 1 779  ? -20.65800 -26.75600 -50.56100 1.000 56.55916  ? 779  LYS A C     1 
ATOM   5781  O  O     . LYS A 1 779  ? -19.96300 -27.75300 -50.79000 1.000 56.21227  ? 779  LYS A O     1 
ATOM   5782  C  CB    . LYS A 1 779  ? -19.85800 -24.49900 -51.30000 1.000 55.74916  ? 779  LYS A CB    1 
ATOM   5783  C  CG    . LYS A 1 779  ? -18.42400 -24.93200 -51.05200 1.000 51.58064  ? 779  LYS A CG    1 
ATOM   5784  C  CD    . LYS A 1 779  ? -17.60800 -23.82500 -50.41100 1.000 66.15514  ? 779  LYS A CD    1 
ATOM   5785  C  CE    . LYS A 1 779  ? -16.28500 -24.35800 -49.89200 1.000 70.33833  ? 779  LYS A CE    1 
ATOM   5786  N  NZ    . LYS A 1 779  ? -16.48700 -25.46200 -48.91300 1.000 67.41028  ? 779  LYS A NZ    1 
ATOM   5787  N  N     . TYR A 1 780  ? -21.30600 -26.59200 -49.40500 1.000 56.14441  ? 780  TYR A N     1 
ATOM   5788  C  CA    . TYR A 1 780  ? -21.23900 -27.61600 -48.36800 1.000 58.17803  ? 780  TYR A CA    1 
ATOM   5789  C  C     . TYR A 1 780  ? -21.88300 -28.91500 -48.83300 1.000 59.75406  ? 780  TYR A C     1 
ATOM   5790  O  O     . TYR A 1 780  ? -21.35000 -30.00300 -48.58500 1.000 58.67119  ? 780  TYR A O     1 
ATOM   5791  C  CB    . TYR A 1 780  ? -21.90700 -27.11400 -47.08800 1.000 55.68401  ? 780  TYR A CB    1 
ATOM   5792  C  CG    . TYR A 1 780  ? -22.06000 -28.17800 -46.02700 1.000 54.87008  ? 780  TYR A CG    1 
ATOM   5793  C  CD1   . TYR A 1 780  ? -20.96100 -28.63800 -45.31600 1.000 66.15277  ? 780  TYR A CD1   1 
ATOM   5794  C  CD2   . TYR A 1 780  ? -23.30400 -28.72200 -45.73300 1.000 58.25718  ? 780  TYR A CD2   1 
ATOM   5795  C  CE1   . TYR A 1 780  ? -21.09400 -29.61200 -44.34500 1.000 77.98170  ? 780  TYR A CE1   1 
ATOM   5796  C  CE2   . TYR A 1 780  ? -23.44800 -29.69500 -44.76300 1.000 60.92395  ? 780  TYR A CE2   1 
ATOM   5797  C  CZ    . TYR A 1 780  ? -22.33900 -30.13600 -44.07100 1.000 71.70780  ? 780  TYR A CZ    1 
ATOM   5798  O  OH    . TYR A 1 780  ? -22.47500 -31.10500 -43.10400 1.000 75.98542  ? 780  TYR A OH    1 
ATOM   5799  N  N     . ILE A 1 781  ? -23.03400 -28.82100 -49.50500 1.000 58.28491  ? 781  ILE A N     1 
ATOM   5800  C  CA    . ILE A 1 781  ? -23.66500 -30.00800 -50.07600 1.000 59.11177  ? 781  ILE A CA    1 
ATOM   5801  C  C     . ILE A 1 781  ? -22.72700 -30.67600 -51.07200 1.000 58.91606  ? 781  ILE A C     1 
ATOM   5802  O  O     . ILE A 1 781  ? -22.60900 -31.90700 -51.11100 1.000 53.44448  ? 781  ILE A O     1 
ATOM   5803  C  CB    . ILE A 1 781  ? -25.00900 -29.63700 -50.73000 1.000 56.37199  ? 781  ILE A CB    1 
ATOM   5804  C  CG1   . ILE A 1 781  ? -25.93900 -28.97000 -49.71400 1.000 53.37312  ? 781  ILE A CG1   1 
ATOM   5805  C  CG2   . ILE A 1 781  ? -25.66400 -30.86900 -51.34000 1.000 48.47295  ? 781  ILE A CG2   1 
ATOM   5806  C  CD1   . ILE A 1 781  ? -26.65300 -29.94000 -48.80600 1.000 54.90273  ? 781  ILE A CD1   1 
ATOM   5807  N  N     . GLN A 1 782  ? -22.04100 -29.87200 -51.88800 1.000 52.65087  ? 782  GLN A N     1 
ATOM   5808  C  CA    . GLN A 1 782  ? -21.08400 -30.41500 -52.84500 1.000 50.64225  ? 782  GLN A CA    1 
ATOM   5809  C  C     . GLN A 1 782  ? -19.94600 -31.14000 -52.13800 1.000 57.32839  ? 782  GLN A C     1 
ATOM   5810  O  O     . GLN A 1 782  ? -19.48700 -32.19100 -52.60000 1.000 57.76587  ? 782  GLN A O     1 
ATOM   5811  C  CB    . GLN A 1 782  ? -20.53800 -29.28900 -53.72300 1.000 53.77166  ? 782  GLN A CB    1 
ATOM   5812  C  CG    . GLN A 1 782  ? -19.47600 -29.72000 -54.71800 1.000 51.94043  ? 782  GLN A CG    1 
ATOM   5813  C  CD    . GLN A 1 782  ? -18.97200 -28.56400 -55.56100 1.000 61.55668  ? 782  GLN A CD    1 
ATOM   5814  O  OE1   . GLN A 1 782  ? -18.69500 -27.48000 -55.04500 1.000 63.15457  ? 782  GLN A OE1   1 
ATOM   5815  N  NE2   . GLN A 1 782  ? -18.84900 -28.78900 -56.86400 1.000 56.67838  ? 782  GLN A NE2   1 
ATOM   5816  N  N     . ASP A 1 783  ? -19.48500 -30.59800 -51.00900 1.000 62.42292  ? 783  ASP A N     1 
ATOM   5817  C  CA    . ASP A 1 783  ? -18.34500 -31.18700 -50.31300 1.000 60.49368  ? 783  ASP A CA    1 
ATOM   5818  C  C     . ASP A 1 783  ? -18.72300 -32.50300 -49.64300 1.000 64.41068  ? 783  ASP A C     1 
ATOM   5819  O  O     . ASP A 1 783  ? -18.03600 -33.51700 -49.81400 1.000 65.63037  ? 783  ASP A O     1 
ATOM   5820  C  CB    . ASP A 1 783  ? -17.79500 -30.19900 -49.28400 1.000 57.86496  ? 783  ASP A CB    1 
ATOM   5821  C  CG    . ASP A 1 783  ? -17.22000 -28.95100 -49.92400 1.000 73.19544  ? 783  ASP A CG    1 
ATOM   5822  O  OD1   . ASP A 1 783  ? -17.06400 -28.93600 -51.16300 1.000 71.27015  ? 783  ASP A OD1   1 
ATOM   5823  O  OD2   . ASP A 1 783  ? -16.92700 -27.98500 -49.18700 1.000 76.71504  ? 783  ASP A OD2   1 
ATOM   5824  N  N     . ILE A 1 784  ? -19.81500 -32.50600 -48.87500 1.000 61.53599  ? 784  ILE A N     1 
ATOM   5825  C  CA    . ILE A 1 784  ? -20.17400 -33.69500 -48.10900 1.000 60.71791  ? 784  ILE A CA    1 
ATOM   5826  C  C     . ILE A 1 784  ? -20.59600 -34.83300 -49.03000 1.000 60.65317  ? 784  ILE A C     1 
ATOM   5827  O  O     . ILE A 1 784  ? -20.38400 -36.00900 -48.71000 1.000 59.66990  ? 784  ILE A O     1 
ATOM   5828  C  CB    . ILE A 1 784  ? -21.26800 -33.35400 -47.07700 1.000 58.27045  ? 784  ILE A CB    1 
ATOM   5829  C  CG1   . ILE A 1 784  ? -21.48100 -34.52200 -46.11200 1.000 55.98769  ? 784  ILE A CG1   1 
ATOM   5830  C  CG2   . ILE A 1 784  ? -22.57200 -32.97400 -47.76600 1.000 54.87831  ? 784  ILE A CG2   1 
ATOM   5831  C  CD1   . ILE A 1 784  ? -22.43600 -34.21000 -44.98300 1.000 66.18529  ? 784  ILE A CD1   1 
ATOM   5832  N  N     . VAL A 1 785  ? -21.18100 -34.51600 -50.18800 1.000 59.42630  ? 785  VAL A N     1 
ATOM   5833  C  CA    . VAL A 1 785  ? -21.54900 -35.56300 -51.13500 1.000 57.24680  ? 785  VAL A CA    1 
ATOM   5834  C  C     . VAL A 1 785  ? -20.31000 -36.09900 -51.84100 1.000 61.09430  ? 785  VAL A C     1 
ATOM   5835  O  O     . VAL A 1 785  ? -20.14900 -37.31500 -52.00200 1.000 57.29161  ? 785  VAL A O     1 
ATOM   5836  C  CB    . VAL A 1 785  ? -22.59600 -35.03800 -52.13500 1.000 56.72037  ? 785  VAL A CB    1 
ATOM   5837  C  CG1   . VAL A 1 785  ? -22.72300 -35.98300 -53.31800 1.000 51.58812  ? 785  VAL A CG1   1 
ATOM   5838  C  CG2   . VAL A 1 785  ? -23.94200 -34.86500 -51.44800 1.000 49.66474  ? 785  VAL A CG2   1 
ATOM   5839  N  N     . ALA A 1 786  ? -19.41300 -35.20600 -52.26800 1.000 62.16001  ? 786  ALA A N     1 
ATOM   5840  C  CA    . ALA A 1 786  ? -18.17500 -35.65000 -52.90000 1.000 60.08430  ? 786  ALA A CA    1 
ATOM   5841  C  C     . ALA A 1 786  ? -17.30800 -36.43400 -51.92300 1.000 62.57732  ? 786  ALA A C     1 
ATOM   5842  O  O     . ALA A 1 786  ? -16.70000 -37.44500 -52.29300 1.000 61.15125  ? 786  ALA A O     1 
ATOM   5843  C  CB    . ALA A 1 786  ? -17.40700 -34.45200 -53.45700 1.000 52.54656  ? 786  ALA A CB    1 
ATOM   5844  N  N     . SER A 1 787  ? -17.24100 -35.98300 -50.66800 1.000 58.12886  ? 787  SER A N     1 
ATOM   5845  C  CA    . SER A 1 787  ? -16.48000 -36.71500 -49.66100 1.000 58.80118  ? 787  SER A CA    1 
ATOM   5846  C  C     . SER A 1 787  ? -17.09400 -38.08300 -49.39300 1.000 61.07574  ? 787  SER A C     1 
ATOM   5847  O  O     . SER A 1 787  ? -16.37400 -39.07400 -49.22800 1.000 60.02417  ? 787  SER A O     1 
ATOM   5848  C  CB    . SER A 1 787  ? -16.39900 -35.90100 -48.36900 1.000 70.22944  ? 787  SER A CB    1 
ATOM   5849  O  OG    . SER A 1 787  ? -15.96100 -36.70400 -47.28600 1.000 81.88055  ? 787  SER A OG    1 
ATOM   5850  N  N     . THR A 1 788  ? -18.42700 -38.15600 -49.34800 1.000 65.01598  ? 788  THR A N     1 
ATOM   5851  C  CA    . THR A 1 788  ? -19.09100 -39.43600 -49.12300 1.000 62.94576  ? 788  THR A CA    1 
ATOM   5852  C  C     . THR A 1 788  ? -18.84400 -40.39600 -50.28000 1.000 61.83073  ? 788  THR A C     1 
ATOM   5853  O  O     . THR A 1 788  ? -18.54100 -41.57500 -50.06300 1.000 61.69238  ? 788  THR A O     1 
ATOM   5854  C  CB    . THR A 1 788  ? -20.59100 -39.22100 -48.91700 1.000 57.60128  ? 788  THR A CB    1 
ATOM   5855  O  OG1   . THR A 1 788  ? -20.81000 -38.48800 -47.70500 1.000 57.92333  ? 788  THR A OG1   1 
ATOM   5856  C  CG2   . THR A 1 788  ? -21.31900 -40.55400 -48.83300 1.000 50.24197  ? 788  THR A CG2   1 
ATOM   5857  N  N     . LEU A 1 789  ? -18.95900 -39.91000 -51.51400 1.000 62.42577  ? 789  LEU A N     1 
ATOM   5858  C  CA    . LEU A 1 789  ? -18.74500 -40.74000 -52.69200 1.000 63.36252  ? 789  LEU A CA    1 
ATOM   5859  C  C     . LEU A 1 789  ? -17.27100 -40.92300 -53.03100 1.000 67.20967  ? 789  LEU A C     1 
ATOM   5860  O  O     . LEU A 1 789  ? -16.96300 -41.60200 -54.01700 1.000 65.53669  ? 789  LEU A O     1 
ATOM   5861  C  CB    . LEU A 1 789  ? -19.47900 -40.14100 -53.89400 1.000 57.05367  ? 789  LEU A CB    1 
ATOM   5862  C  CG    . LEU A 1 789  ? -20.98900 -39.95500 -53.73300 1.000 57.47762  ? 789  LEU A CG    1 
ATOM   5863  C  CD1   . LEU A 1 789  ? -21.59200 -39.35500 -54.99300 1.000 58.61148  ? 789  LEU A CD1   1 
ATOM   5864  C  CD2   . LEU A 1 789  ? -21.66100 -41.27200 -53.38500 1.000 52.41496  ? 789  LEU A CD2   1 
ATOM   5865  N  N     . LYS A 1 790  ? -16.36500 -40.34000 -52.24200 1.000 58.72444  ? 790  LYS A N     1 
ATOM   5866  C  CA    . LYS A 1 790  ? -14.92400 -40.41400 -52.49200 1.000 53.19087  ? 790  LYS A CA    1 
ATOM   5867  C  C     . LYS A 1 790  ? -14.58200 -39.91000 -53.89200 1.000 54.32653  ? 790  LYS A C     1 
ATOM   5868  O  O     . LYS A 1 790  ? -13.71500 -40.45700 -54.57700 1.000 59.42415  ? 790  LYS A O     1 
ATOM   5869  C  CB    . LYS A 1 790  ? -14.39500 -41.83400 -52.27600 1.000 55.64105  ? 790  LYS A CB    1 
ATOM   5870  C  CG    . LYS A 1 790  ? -14.92200 -42.50200 -51.01700 1.000 70.22109  ? 790  LYS A CG    1 
ATOM   5871  C  CD    . LYS A 1 790  ? -14.22000 -43.82100 -50.75400 1.000 78.31024  ? 790  LYS A CD    1 
ATOM   5872  C  CE    . LYS A 1 790  ? -12.92000 -43.60500 -49.99900 1.000 82.40755  ? 790  LYS A CE    1 
ATOM   5873  N  NZ    . LYS A 1 790  ? -12.97500 -44.18200 -48.62800 1.000 84.10184  ? 790  LYS A NZ    1 
ATOM   5874  N  N     . LEU A 1 791  ? -15.27300 -38.85600 -54.32000 1.000 53.41621  ? 791  LEU A N     1 
ATOM   5875  C  CA    . LEU A 1 791  ? -15.09600 -38.26400 -55.63200 1.000 50.65968  ? 791  LEU A CA    1 
ATOM   5876  C  C     . LEU A 1 791  ? -14.52300 -36.85700 -55.51400 1.000 56.94820  ? 791  LEU A C     1 
ATOM   5877  O  O     . LEU A 1 791  ? -14.74000 -36.17500 -54.50700 1.000 52.64185  ? 791  LEU A O     1 
ATOM   5878  C  CB    . LEU A 1 791  ? -16.42700 -38.19500 -56.39100 1.000 54.72885  ? 791  LEU A CB    1 
ATOM   5879  C  CG    . LEU A 1 791  ? -17.11400 -39.52100 -56.70900 1.000 58.83836  ? 791  LEU A CG    1 
ATOM   5880  C  CD1   . LEU A 1 791  ? -18.47000 -39.27400 -57.34800 1.000 53.07402  ? 791  LEU A CD1   1 
ATOM   5881  C  CD2   . LEU A 1 791  ? -16.23700 -40.36600 -57.61500 1.000 62.04056  ? 791  LEU A CD2   1 
ATOM   5882  N  N     . PRO A 1 792  ? -13.78000 -36.39800 -56.51600 1.000 58.01619  ? 792  PRO A N     1 
ATOM   5883  C  CA    . PRO A 1 792  ? -13.37600 -34.99000 -56.54500 1.000 57.63912  ? 792  PRO A CA    1 
ATOM   5884  C  C     . PRO A 1 792  ? -14.59100 -34.08800 -56.70100 1.000 56.74494  ? 792  PRO A C     1 
ATOM   5885  O  O     . PRO A 1 792  ? -15.65400 -34.50200 -57.16700 1.000 53.54354  ? 792  PRO A O     1 
ATOM   5886  C  CB    . PRO A 1 792  ? -12.45300 -34.90100 -57.76600 1.000 61.09306  ? 792  PRO A CB    1 
ATOM   5887  C  CG    . PRO A 1 792  ? -12.04500 -36.31600 -58.05200 1.000 55.83522  ? 792  PRO A CG    1 
ATOM   5888  C  CD    . PRO A 1 792  ? -13.20600 -37.16100 -57.63700 1.000 56.12165  ? 792  PRO A CD    1 
ATOM   5889  N  N     . ALA A 1 793  ? -14.41600 -32.82900 -56.29200 1.000 57.22963  ? 793  ALA A N     1 
ATOM   5890  C  CA    . ALA A 1 793  ? -15.52900 -31.88600 -56.31700 1.000 53.84324  ? 793  ALA A CA    1 
ATOM   5891  C  C     . ALA A 1 793  ? -16.04600 -31.65000 -57.73000 1.000 56.38830  ? 793  ALA A C     1 
ATOM   5892  O  O     . ALA A 1 793  ? -17.24000 -31.39100 -57.91700 1.000 59.65436  ? 793  ALA A O     1 
ATOM   5893  C  CB    . ALA A 1 793  ? -15.11000 -30.56100 -55.67900 1.000 56.77328  ? 793  ALA A CB    1 
ATOM   5894  N  N     . ASN A 1 794  ? -15.17300 -31.74700 -58.73700 1.000 55.39570  ? 794  ASN A N     1 
ATOM   5895  C  CA    . ASN A 1 794  ? -15.57000 -31.45200 -60.10900 1.000 57.01979  ? 794  ASN A CA    1 
ATOM   5896  C  C     . ASN A 1 794  ? -16.55900 -32.46200 -60.68000 1.000 61.81291  ? 794  ASN A C     1 
ATOM   5897  O  O     . ASN A 1 794  ? -17.11900 -32.21100 -61.75200 1.000 67.77923  ? 794  ASN A O     1 
ATOM   5898  C  CB    . ASN A 1 794  ? -14.33300 -31.36900 -61.01000 1.000 61.12714  ? 794  ASN A CB    1 
ATOM   5899  C  CG    . ASN A 1 794  ? -13.48300 -32.62600 -60.96300 1.000 57.95931  ? 794  ASN A CG    1 
ATOM   5900  O  OD1   . ASN A 1 794  ? -13.86300 -33.62800 -60.35800 1.000 67.75709  ? 794  ASN A OD1   1 
ATOM   5901  N  ND2   . ASN A 1 794  ? -12.32300 -32.57700 -61.60600 1.000 56.48572  ? 794  ASN A ND2   1 
ATOM   5902  N  N     . LYS A 1 795  ? -16.78800 -33.58600 -60.00000 1.000 58.58501  ? 795  LYS A N     1 
ATOM   5903  C  CA    . LYS A 1 795  ? -17.75400 -34.57800 -60.44900 1.000 57.16337  ? 795  LYS A CA    1 
ATOM   5904  C  C     . LYS A 1 795  ? -19.12400 -34.41300 -59.80500 1.000 60.66499  ? 795  LYS A C     1 
ATOM   5905  O  O     . LYS A 1 795  ? -20.09200 -35.01200 -60.28400 1.000 63.27685  ? 795  LYS A O     1 
ATOM   5906  C  CB    . LYS A 1 795  ? -17.23300 -35.99300 -60.16500 1.000 50.17389  ? 795  LYS A CB    1 
ATOM   5907  C  CG    . LYS A 1 795  ? -15.78300 -36.21100 -60.55300 1.000 57.47551  ? 795  LYS A CG    1 
ATOM   5908  C  CD    . LYS A 1 795  ? -15.61400 -36.31000 -62.05900 1.000 56.98987  ? 795  LYS A CD    1 
ATOM   5909  C  CE    . LYS A 1 795  ? -14.15100 -36.48700 -62.43000 1.000 64.17422  ? 795  LYS A CE    1 
ATOM   5910  N  NZ    . LYS A 1 795  ? -13.51600 -37.58800 -61.65300 1.000 64.88753  ? 795  LYS A NZ    1 
ATOM   5911  N  N     . VAL A 1 796  ? -19.22900 -33.62100 -58.74100 1.000 57.04327  ? 796  VAL A N     1 
ATOM   5912  C  CA    . VAL A 1 796  ? -20.47400 -33.43400 -58.00500 1.000 56.76790  ? 796  VAL A CA    1 
ATOM   5913  C  C     . VAL A 1 796  ? -20.85900 -31.96500 -58.08700 1.000 57.42122  ? 796  VAL A C     1 
ATOM   5914  O  O     . VAL A 1 796  ? -20.13300 -31.09800 -57.58500 1.000 62.84262  ? 796  VAL A O     1 
ATOM   5915  C  CB    . VAL A 1 796  ? -20.34400 -33.88100 -56.54100 1.000 52.20437  ? 796  VAL A CB    1 
ATOM   5916  C  CG1   . VAL A 1 796  ? -21.62400 -33.57700 -55.78200 1.000 49.67780  ? 796  VAL A CG1   1 
ATOM   5917  C  CG2   . VAL A 1 796  ? -20.00800 -35.36300 -56.46500 1.000 53.83868  ? 796  VAL A CG2   1 
ATOM   5918  N  N     . MET A 1 797  ? -21.99900 -31.68600 -58.71200 1.000 48.70505  ? 797  MET A N     1 
ATOM   5919  C  CA    . MET A 1 797  ? -22.52400 -30.33500 -58.82600 1.000 49.31807  ? 797  MET A CA    1 
ATOM   5920  C  C     . MET A 1 797  ? -23.81700 -30.20700 -58.02900 1.000 56.07230  ? 797  MET A C     1 
ATOM   5921  O  O     . MET A 1 797  ? -24.56600 -31.17500 -57.86700 1.000 56.41820  ? 797  MET A O     1 
ATOM   5922  C  CB    . MET A 1 797  ? -22.77100 -29.96200 -60.29100 1.000 51.53084  ? 797  MET A CB    1 
ATOM   5923  C  CG    . MET A 1 797  ? -21.51000 -29.91300 -61.13900 1.000 54.68309  ? 797  MET A CG    1 
ATOM   5924  S  SD    . MET A 1 797  ? -20.31500 -28.70200 -60.54200 1.000 55.96136  ? 797  MET A SD    1 
ATOM   5925  C  CE    . MET A 1 797  ? -18.88400 -29.74300 -60.27400 1.000 53.06423  ? 797  MET A CE    1 
ATOM   5926  N  N     . CYS A 1 798  ? -24.06900 -28.99900 -57.53000 1.000 54.43799  ? 798  CYS A N     1 
ATOM   5927  C  CA    . CYS A 1 798  ? -25.23600 -28.70700 -56.70800 1.000 51.13700  ? 798  CYS A CA    1 
ATOM   5928  C  C     . CYS A 1 798  ? -26.02800 -27.57600 -57.34600 1.000 53.46812  ? 798  CYS A C     1 
ATOM   5929  O  O     . CYS A 1 798  ? -25.45700 -26.54400 -57.71300 1.000 56.26714  ? 798  CYS A O     1 
ATOM   5930  C  CB    . CYS A 1 798  ? -24.81900 -28.33200 -55.28300 1.000 44.82943  ? 798  CYS A CB    1 
ATOM   5931  S  SG    . CYS A 1 798  ? -26.19200 -28.09200 -54.13300 1.000 65.01471  ? 798  CYS A SG    1 
ATOM   5932  N  N     . HIS A 1 799  ? -27.34000 -27.76800 -57.47100 1.000 52.39201  ? 799  HIS A N     1 
ATOM   5933  C  CA    . HIS A 1 799  ? -28.21200 -26.81700 -58.14800 1.000 52.02862  ? 799  HIS A CA    1 
ATOM   5934  C  C     . HIS A 1 799  ? -29.36500 -26.44000 -57.23100 1.000 55.05043  ? 799  HIS A C     1 
ATOM   5935  O  O     . HIS A 1 799  ? -30.08300 -27.31700 -56.73800 1.000 55.62075  ? 799  HIS A O     1 
ATOM   5936  C  CB    . HIS A 1 799  ? -28.74800 -27.40000 -59.45900 1.000 49.01546  ? 799  HIS A CB    1 
ATOM   5937  C  CG    . HIS A 1 799  ? -27.71700 -28.13300 -60.25800 1.000 52.08935  ? 799  HIS A CG    1 
ATOM   5938  N  ND1   . HIS A 1 799  ? -26.90400 -27.50700 -61.17800 1.000 55.50823  ? 799  HIS A ND1   1 
ATOM   5939  C  CD2   . HIS A 1 799  ? -27.36500 -29.44100 -60.27400 1.000 56.35375  ? 799  HIS A CD2   1 
ATOM   5940  C  CE1   . HIS A 1 799  ? -26.09700 -28.39700 -61.72700 1.000 59.79688  ? 799  HIS A CE1   1 
ATOM   5941  N  NE2   . HIS A 1 799  ? -26.35600 -29.57900 -61.19600 1.000 58.23862  ? 799  HIS A NE2   1 
ATOM   5942  N  N     . VAL A 1 800  ? -29.54300 -25.13800 -57.01000 1.000 48.22024  ? 800  VAL A N     1 
ATOM   5943  C  CA    . VAL A 1 800  ? -30.60400 -24.61200 -56.15900 1.000 49.95670  ? 800  VAL A CA    1 
ATOM   5944  C  C     . VAL A 1 800  ? -31.26300 -23.45200 -56.89100 1.000 49.27370  ? 800  VAL A C     1 
ATOM   5945  O  O     . VAL A 1 800  ? -30.61200 -22.43500 -57.15800 1.000 54.35381  ? 800  VAL A O     1 
ATOM   5946  C  CB    . VAL A 1 800  ? -30.07600 -24.14800 -54.79000 1.000 41.33763  ? 800  VAL A CB    1 
ATOM   5947  C  CG1   . VAL A 1 800  ? -31.19000 -23.49200 -53.98600 1.000 46.36939  ? 800  VAL A CG1   1 
ATOM   5948  C  CG2   . VAL A 1 800  ? -29.46600 -25.31300 -54.02300 1.000 50.63796  ? 800  VAL A CG2   1 
ATOM   5949  N  N     . ARG A 1 801  ? -32.54800 -23.59800 -57.21300 1.000 52.64029  ? 801  ARG A N     1 
ATOM   5950  C  CA    . ARG A 1 801  ? -33.28600 -22.51900 -57.85900 1.000 46.81415  ? 801  ARG A CA    1 
ATOM   5951  C  C     . ARG A 1 801  ? -33.93200 -21.58900 -56.83700 1.000 46.42895  ? 801  ARG A C     1 
ATOM   5952  O  O     . ARG A 1 801  ? -33.73300 -20.37200 -56.88900 1.000 57.91665  ? 801  ARG A O     1 
ATOM   5953  C  CB    . ARG A 1 801  ? -34.34800 -23.09000 -58.80400 1.000 45.81078  ? 801  ARG A CB    1 
ATOM   5954  C  CG    . ARG A 1 801  ? -35.04900 -22.03100 -59.64300 1.000 49.85991  ? 801  ARG A CG    1 
ATOM   5955  C  CD    . ARG A 1 801  ? -36.02500 -22.65200 -60.62800 1.000 55.37272  ? 801  ARG A CD    1 
ATOM   5956  N  NE    . ARG A 1 801  ? -35.46000 -22.72800 -61.97200 1.000 68.57976  ? 801  ARG A NE    1 
ATOM   5957  C  CZ    . ARG A 1 801  ? -35.52600 -21.75000 -62.86900 1.000 65.69882  ? 801  ARG A CZ    1 
ATOM   5958  N  NH1   . ARG A 1 801  ? -36.13200 -20.61000 -62.57000 1.000 62.77823  ? 801  ARG A NH1   1 
ATOM   5959  N  NH2   . ARG A 1 801  ? -34.98200 -21.91300 -64.06700 1.000 61.11571  ? 801  ARG A NH2   1 
ATOM   5960  N  N     . ARG A 1 802  ? -34.70400 -22.14400 -55.90700 1.000 48.24347  ? 802  ARG A N     1 
ATOM   5961  C  CA    . ARG A 1 802  ? -35.31900 -21.35200 -54.85300 1.000 42.10208  ? 802  ARG A CA    1 
ATOM   5962  C  C     . ARG A 1 802  ? -35.61000 -22.25300 -53.66300 1.000 51.37518  ? 802  ARG A C     1 
ATOM   5963  O  O     . ARG A 1 802  ? -35.79800 -23.46400 -53.81300 1.000 49.48971  ? 802  ARG A O     1 
ATOM   5964  C  CB    . ARG A 1 802  ? -36.60400 -20.66700 -55.33400 1.000 48.08191  ? 802  ARG A CB    1 
ATOM   5965  C  CG    . ARG A 1 802  ? -37.73500 -21.62400 -55.66900 1.000 48.84045  ? 802  ARG A CG    1 
ATOM   5966  C  CD    . ARG A 1 802  ? -39.01600 -20.87200 -55.99600 1.000 56.07956  ? 802  ARG A CD    1 
ATOM   5967  N  NE    . ARG A 1 802  ? -38.85500 -19.97400 -57.13500 1.000 59.62038  ? 802  ARG A NE    1 
ATOM   5968  C  CZ    . ARG A 1 802  ? -38.92100 -20.35800 -58.40600 1.000 57.56163  ? 802  ARG A CZ    1 
ATOM   5969  N  NH1   . ARG A 1 802  ? -39.14500 -21.63000 -58.70500 1.000 54.46181  ? 802  ARG A NH1   1 
ATOM   5970  N  NH2   . ARG A 1 802  ? -38.76400 -19.47000 -59.37700 1.000 57.32249  ? 802  ARG A NH2   1 
ATOM   5971  N  N     . VAL A 1 803  ? -35.64200 -21.64700 -52.47900 1.000 56.96851  ? 803  VAL A N     1 
ATOM   5972  C  CA    . VAL A 1 803  ? -35.90100 -22.34700 -51.22600 1.000 54.83588  ? 803  VAL A CA    1 
ATOM   5973  C  C     . VAL A 1 803  ? -37.09500 -21.68900 -50.55100 1.000 57.70737  ? 803  VAL A C     1 
ATOM   5974  O  O     . VAL A 1 803  ? -37.15500 -20.45900 -50.44500 1.000 61.81134  ? 803  VAL A O     1 
ATOM   5975  C  CB    . VAL A 1 803  ? -34.66800 -22.33000 -50.30300 1.000 48.35300  ? 803  VAL A CB    1 
ATOM   5976  C  CG1   . VAL A 1 803  ? -34.99500 -22.96300 -48.96200 1.000 53.46217  ? 803  VAL A CG1   1 
ATOM   5977  C  CG2   . VAL A 1 803  ? -33.50400 -23.05300 -50.96300 1.000 45.97133  ? 803  VAL A CG2   1 
ATOM   5978  N  N     . GLY A 1 804  ? -38.04700 -22.50600 -50.10400 1.000 56.88587  ? 804  GLY A N     1 
ATOM   5979  C  CA    . GLY A 1 804  ? -39.21900 -21.99500 -49.42100 1.000 58.81828  ? 804  GLY A CA    1 
ATOM   5980  C  C     . GLY A 1 804  ? -38.97200 -21.73900 -47.94900 1.000 58.65986  ? 804  GLY A C     1 
ATOM   5981  O  O     . GLY A 1 804  ? -39.56900 -22.39200 -47.08800 1.000 56.25298  ? 804  GLY A O     1 
ATOM   5982  N  N     . GLY A 1 805  ? -38.09300 -20.78700 -47.64900 1.000 56.69000  ? 805  GLY A N     1 
ATOM   5983  C  CA    . GLY A 1 805  ? -37.72500 -20.50800 -46.27600 1.000 60.18038  ? 805  GLY A CA    1 
ATOM   5984  C  C     . GLY A 1 805  ? -36.63400 -21.43100 -45.77600 1.000 60.19607  ? 805  GLY A C     1 
ATOM   5985  O  O     . GLY A 1 805  ? -36.59500 -22.61000 -46.13900 1.000 63.91465  ? 805  GLY A O     1 
ATOM   5986  N  N     . ALA A 1 806  ? -35.73700 -20.90700 -44.94100 1.000 62.16440  ? 806  ALA A N     1 
ATOM   5987  C  CA    . ALA A 1 806  ? -34.63000 -21.70400 -44.42800 1.000 61.96049  ? 806  ALA A CA    1 
ATOM   5988  C  C     . ALA A 1 806  ? -34.30100 -21.31300 -42.99400 1.000 64.52711  ? 806  ALA A C     1 
ATOM   5989  O  O     . ALA A 1 806  ? -34.37700 -22.14800 -42.08600 1.000 63.26007  ? 806  ALA A O     1 
ATOM   5990  C  CB    . ALA A 1 806  ? -33.40200 -21.54500 -45.32300 1.000 59.66778  ? 806  ALA A CB    1 
ATOM   5991  N  N     . PHE A 1 807  ? -33.92400 -20.04900 -42.78900 1.000 66.56993  ? 807  PHE A N     1 
ATOM   5992  C  CA    . PHE A 1 807  ? -33.67300 -19.49500 -41.45800 1.000 70.22428  ? 807  PHE A CA    1 
ATOM   5993  C  C     . PHE A 1 807  ? -32.56000 -20.24200 -40.72800 1.000 67.71264  ? 807  PHE A C     1 
ATOM   5994  O  O     . PHE A 1 807  ? -32.58200 -20.36400 -39.50100 1.000 69.11836  ? 807  PHE A O     1 
ATOM   5995  C  CB    . PHE A 1 807  ? -34.95400 -19.48500 -40.61800 1.000 72.07759  ? 807  PHE A CB    1 
ATOM   5996  C  CG    . PHE A 1 807  ? -36.15200 -18.95800 -41.35400 1.000 68.40563  ? 807  PHE A CG    1 
ATOM   5997  C  CD1   . PHE A 1 807  ? -36.12000 -17.70900 -41.95300 1.000 69.20579  ? 807  PHE A CD1   1 
ATOM   5998  C  CD2   . PHE A 1 807  ? -37.30300 -19.71900 -41.46400 1.000 62.15971  ? 807  PHE A CD2   1 
ATOM   5999  C  CE1   . PHE A 1 807  ? -37.21900 -17.22500 -42.63600 1.000 68.67806  ? 807  PHE A CE1   1 
ATOM   6000  C  CE2   . PHE A 1 807  ? -38.40300 -19.24100 -42.14800 1.000 67.02307  ? 807  PHE A CE2   1 
ATOM   6001  C  CZ    . PHE A 1 807  ? -38.36200 -17.99200 -42.73400 1.000 65.78573  ? 807  PHE A CZ    1 
ATOM   6002  N  N     . GLY A 1 808  ? -31.58000 -20.74800 -41.47600 1.000 66.23280  ? 808  GLY A N     1 
ATOM   6003  C  CA    . GLY A 1 808  ? -30.45400 -21.44600 -40.89800 1.000 69.93271  ? 808  GLY A CA    1 
ATOM   6004  C  C     . GLY A 1 808  ? -30.64800 -22.93200 -40.69000 1.000 68.12264  ? 808  GLY A C     1 
ATOM   6005  O  O     . GLY A 1 808  ? -29.68400 -23.61900 -40.33000 1.000 74.15385  ? 808  GLY A O     1 
ATOM   6006  N  N     . GLY A 1 809  ? -31.85000 -23.45400 -40.90900 1.000 64.10856  ? 809  GLY A N     1 
ATOM   6007  C  CA    . GLY A 1 809  ? -32.13700 -24.85200 -40.67300 1.000 65.31557  ? 809  GLY A CA    1 
ATOM   6008  C  C     . GLY A 1 809  ? -31.93200 -25.77600 -41.85100 1.000 64.76486  ? 809  GLY A C     1 
ATOM   6009  O  O     . GLY A 1 809  ? -32.38700 -26.92400 -41.80300 1.000 67.97318  ? 809  GLY A O     1 
ATOM   6010  N  N     . LYS A 1 810  ? -31.25900 -25.32300 -42.90900 1.000 59.83101  ? 810  LYS A N     1 
ATOM   6011  C  CA    . LYS A 1 810  ? -31.04300 -26.13100 -44.10600 1.000 60.42102  ? 810  LYS A CA    1 
ATOM   6012  C  C     . LYS A 1 810  ? -29.56300 -26.09400 -44.49800 1.000 63.15411  ? 810  LYS A C     1 
ATOM   6013  O  O     . LYS A 1 810  ? -29.18900 -25.65200 -45.58400 1.000 57.22497  ? 810  LYS A O     1 
ATOM   6014  C  CB    . LYS A 1 810  ? -31.93300 -25.65800 -45.25400 1.000 52.84611  ? 810  LYS A CB    1 
ATOM   6015  C  CG    . LYS A 1 810  ? -33.42300 -25.79500 -44.97600 1.000 55.47939  ? 810  LYS A CG    1 
ATOM   6016  C  CD    . LYS A 1 810  ? -34.23500 -25.76900 -46.26000 1.000 56.83060  ? 810  LYS A CD    1 
ATOM   6017  C  CE    . LYS A 1 810  ? -35.71500 -25.97700 -45.98200 1.000 54.61939  ? 810  LYS A CE    1 
ATOM   6018  N  NZ    . LYS A 1 810  ? -36.56100 -24.97700 -46.68600 1.000 54.86554  ? 810  LYS A NZ    1 
ATOM   6019  N  N     . VAL A 1 811  ? -28.71000 -26.57800 -43.59500 1.000 63.69192  ? 811  VAL A N     1 
ATOM   6020  C  CA    . VAL A 1 811  ? -27.27100 -26.61600 -43.83700 1.000 62.78693  ? 811  VAL A CA    1 
ATOM   6021  C  C     . VAL A 1 811  ? -26.67400 -27.94600 -43.38300 1.000 64.77869  ? 811  VAL A C     1 
ATOM   6022  O  O     . VAL A 1 811  ? -26.51900 -28.87100 -44.18800 1.000 68.69595  ? 811  VAL A O     1 
ATOM   6023  C  CB    . VAL A 1 811  ? -26.56500 -25.41700 -43.17000 1.000 65.43598  ? 811  VAL A CB    1 
ATOM   6024  C  CG1   . VAL A 1 811  ? -26.68300 -24.18900 -44.04900 1.000 61.76836  ? 811  VAL A CG1   1 
ATOM   6025  C  CG2   . VAL A 1 811  ? -27.18900 -25.10700 -41.81300 1.000 74.22706  ? 811  VAL A CG2   1 
ATOM   6026  N  N     . LEU A 1 812  ? -26.33700 -28.05500 -42.09500 1.000 65.61445  ? 812  LEU A N     1 
ATOM   6027  C  CA    . LEU A 1 812  ? -25.59800 -29.21700 -41.61000 1.000 66.68178  ? 812  LEU A CA    1 
ATOM   6028  C  C     . LEU A 1 812  ? -26.42500 -30.49300 -41.71900 1.000 67.72743  ? 812  LEU A C     1 
ATOM   6029  O  O     . LEU A 1 812  ? -25.95600 -31.50300 -42.25600 1.000 71.41768  ? 812  LEU A O     1 
ATOM   6030  C  CB    . LEU A 1 812  ? -25.15100 -28.98600 -40.16600 1.000 73.21676  ? 812  LEU A CB    1 
ATOM   6031  C  CG    . LEU A 1 812  ? -24.19100 -30.02400 -39.58100 1.000 86.47915  ? 812  LEU A CG    1 
ATOM   6032  C  CD1   . LEU A 1 812  ? -22.99200 -29.34500 -38.93800 1.000 97.38277  ? 812  LEU A CD1   1 
ATOM   6033  C  CD2   . LEU A 1 812  ? -24.90800 -30.91800 -38.57900 1.000 80.05384  ? 812  LEU A CD2   1 
ATOM   6034  N  N     . LYS A 1 813  ? -27.65800 -30.47100 -41.20700 1.000 65.51455  ? 813  LYS A N     1 
ATOM   6035  C  CA    . LYS A 1 813  ? -28.49500 -31.66400 -41.27500 1.000 62.68552  ? 813  LYS A CA    1 
ATOM   6036  C  C     . LYS A 1 813  ? -28.93200 -31.96100 -42.70300 1.000 62.45432  ? 813  LYS A C     1 
ATOM   6037  O  O     . LYS A 1 813  ? -29.12000 -33.12900 -43.06200 1.000 62.39403  ? 813  LYS A O     1 
ATOM   6038  C  CB    . LYS A 1 813  ? -29.71200 -31.50700 -40.36400 1.000 61.02869  ? 813  LYS A CB    1 
ATOM   6039  C  CG    . LYS A 1 813  ? -30.28600 -32.82500 -39.87200 1.000 65.82855  ? 813  LYS A CG    1 
ATOM   6040  C  CD    . LYS A 1 813  ? -29.25800 -33.60700 -39.06800 1.000 61.11864  ? 813  LYS A CD    1 
ATOM   6041  C  CE    . LYS A 1 813  ? -28.86700 -32.87000 -37.79600 1.000 76.66785  ? 813  LYS A CE    1 
ATOM   6042  N  NZ    . LYS A 1 813  ? -29.71300 -33.27100 -36.63900 1.000 74.71370  ? 813  LYS A NZ    1 
ATOM   6043  N  N     . THR A 1 814  ? -29.09500 -30.92600 -43.53000 1.000 62.46496  ? 814  THR A N     1 
ATOM   6044  C  CA    . THR A 1 814  ? -29.45400 -31.14600 -44.92700 1.000 55.15552  ? 814  THR A CA    1 
ATOM   6045  C  C     . THR A 1 814  ? -28.32200 -31.82900 -45.68500 1.000 55.64037  ? 814  THR A C     1 
ATOM   6046  O  O     . THR A 1 814  ? -28.56900 -32.70900 -46.51700 1.000 59.24507  ? 814  THR A O     1 
ATOM   6047  C  CB    . THR A 1 814  ? -29.82300 -29.81900 -45.58900 1.000 56.94790  ? 814  THR A CB    1 
ATOM   6048  O  OG1   . THR A 1 814  ? -30.84000 -29.17200 -44.81600 1.000 62.92193  ? 814  THR A OG1   1 
ATOM   6049  C  CG2   . THR A 1 814  ? -30.34100 -30.04900 -46.99400 1.000 55.47904  ? 814  THR A CG2   1 
ATOM   6050  N  N     . GLY A 1 815  ? -27.07600 -31.43800 -45.41000 1.000 56.36921  ? 815  GLY A N     1 
ATOM   6051  C  CA    . GLY A 1 815  ? -25.94800 -32.10800 -46.03200 1.000 52.81009  ? 815  GLY A CA    1 
ATOM   6052  C  C     . GLY A 1 815  ? -25.81100 -33.55400 -45.60300 1.000 55.70827  ? 815  GLY A C     1 
ATOM   6053  O  O     . GLY A 1 815  ? -25.39700 -34.40500 -46.39600 1.000 54.30261  ? 815  GLY A O     1 
ATOM   6054  N  N     . ILE A 1 816  ? -26.15500 -33.85500 -44.34900 1.000 58.24588  ? 816  ILE A N     1 
ATOM   6055  C  CA    . ILE A 1 816  ? -26.11100 -35.23400 -43.87300 1.000 58.95849  ? 816  ILE A CA    1 
ATOM   6056  C  C     . ILE A 1 816  ? -27.11600 -36.09000 -44.63200 1.000 59.08560  ? 816  ILE A C     1 
ATOM   6057  O  O     . ILE A 1 816  ? -26.80800 -37.21200 -45.05300 1.000 57.07961  ? 816  ILE A O     1 
ATOM   6058  C  CB    . ILE A 1 816  ? -26.35800 -35.28100 -42.35300 1.000 60.76221  ? 816  ILE A CB    1 
ATOM   6059  C  CG1   . ILE A 1 816  ? -25.17300 -34.66900 -41.60200 1.000 73.10067  ? 816  ILE A CG1   1 
ATOM   6060  C  CG2   . ILE A 1 816  ? -26.61100 -36.70900 -41.89300 1.000 59.15113  ? 816  ILE A CG2   1 
ATOM   6061  C  CD1   . ILE A 1 816  ? -25.31800 -34.70600 -40.09400 1.000 86.84221  ? 816  ILE A CD1   1 
ATOM   6062  N  N     . ILE A 1 817  ? -28.33200 -35.57300 -44.82300 1.000 56.88741  ? 817  ILE A N     1 
ATOM   6063  C  CA    . ILE A 1 817  ? -29.34100 -36.30600 -45.58200 1.000 53.56883  ? 817  ILE A CA    1 
ATOM   6064  C  C     . ILE A 1 817  ? -28.90400 -36.46400 -47.03300 1.000 57.84235  ? 817  ILE A C     1 
ATOM   6065  O  O     . ILE A 1 817  ? -29.06400 -37.53400 -47.63200 1.000 64.22932  ? 817  ILE A O     1 
ATOM   6066  C  CB    . ILE A 1 817  ? -30.70700 -35.60200 -45.47500 1.000 56.55786  ? 817  ILE A CB    1 
ATOM   6067  C  CG1   . ILE A 1 817  ? -31.14200 -35.50200 -44.01200 1.000 56.40989  ? 817  ILE A CG1   1 
ATOM   6068  C  CG2   . ILE A 1 817  ? -31.75300 -36.33900 -46.29300 1.000 53.91510  ? 817  ILE A CG2   1 
ATOM   6069  C  CD1   . ILE A 1 817  ? -32.44500 -34.76200 -43.81300 1.000 49.99209  ? 817  ILE A CD1   1 
ATOM   6070  N  N     . ALA A 1 818  ? -28.33700 -35.40500 -47.61800 1.000 57.00851  ? 818  ALA A N     1 
ATOM   6071  C  CA    . ALA A 1 818  ? -27.87300 -35.48300 -48.99900 1.000 52.63130  ? 818  ALA A CA    1 
ATOM   6072  C  C     . ALA A 1 818  ? -26.68300 -36.42100 -49.14300 1.000 57.24216  ? 818  ALA A C     1 
ATOM   6073  O  O     . ALA A 1 818  ? -26.48400 -37.00600 -50.21400 1.000 55.79610  ? 818  ALA A O     1 
ATOM   6074  C  CB    . ALA A 1 818  ? -27.51700 -34.08800 -49.51400 1.000 50.11722  ? 818  ALA A CB    1 
ATOM   6075  N  N     . ALA A 1 819  ? -25.88600 -36.57600 -48.08400 1.000 58.76137  ? 819  ALA A N     1 
ATOM   6076  C  CA    . ALA A 1 819  ? -24.75300 -37.49300 -48.13800 1.000 56.22434  ? 819  ALA A CA    1 
ATOM   6077  C  C     . ALA A 1 819  ? -25.22500 -38.93200 -48.29900 1.000 57.32321  ? 819  ALA A C     1 
ATOM   6078  O  O     . ALA A 1 819  ? -24.77300 -39.65000 -49.19900 1.000 58.23782  ? 819  ALA A O     1 
ATOM   6079  C  CB    . ALA A 1 819  ? -23.89500 -37.34100 -46.88200 1.000 55.84994  ? 819  ALA A CB    1 
ATOM   6080  N  N     . VAL A 1 820  ? -26.14600 -39.37100 -47.43700 1.000 54.21651  ? 820  VAL A N     1 
ATOM   6081  C  CA    . VAL A 1 820  ? -26.63800 -40.74100 -47.51500 1.000 57.78145  ? 820  VAL A CA    1 
ATOM   6082  C  C     . VAL A 1 820  ? -27.58000 -40.93600 -48.69500 1.000 58.80469  ? 820  VAL A C     1 
ATOM   6083  O  O     . VAL A 1 820  ? -27.73800 -42.06500 -49.17400 1.000 65.92235  ? 820  VAL A O     1 
ATOM   6084  C  CB    . VAL A 1 820  ? -27.32500 -41.14700 -46.19700 1.000 51.52184  ? 820  VAL A CB    1 
ATOM   6085  C  CG1   . VAL A 1 820  ? -26.46700 -40.74600 -45.00700 1.000 60.77658  ? 820  VAL A CG1   1 
ATOM   6086  C  CG2   . VAL A 1 820  ? -28.70400 -40.52400 -46.09800 1.000 54.27598  ? 820  VAL A CG2   1 
ATOM   6087  N  N     . THR A 1 821  ? -28.21000 -39.86500 -49.18500 1.000 55.92572  ? 821  THR A N     1 
ATOM   6088  C  CA    . THR A 1 821  ? -29.08900 -40.00100 -50.34100 1.000 57.99338  ? 821  THR A CA    1 
ATOM   6089  C  C     . THR A 1 821  ? -28.28100 -40.20100 -51.61700 1.000 59.47481  ? 821  THR A C     1 
ATOM   6090  O  O     . THR A 1 821  ? -28.64900 -41.01700 -52.47100 1.000 53.71958  ? 821  THR A O     1 
ATOM   6091  C  CB    . THR A 1 821  ? -29.99500 -38.77600 -50.46600 1.000 52.84828  ? 821  THR A CB    1 
ATOM   6092  O  OG1   . THR A 1 821  ? -30.65100 -38.53700 -49.21400 1.000 60.81155  ? 821  THR A OG1   1 
ATOM   6093  C  CG2   . THR A 1 821  ? -31.05200 -39.00800 -51.52900 1.000 51.98366  ? 821  THR A CG2   1 
ATOM   6094  N  N     . ALA A 1 822  ? -27.17400 -39.46800 -51.76200 1.000 62.85327  ? 822  ALA A N     1 
ATOM   6095  C  CA    . ALA A 1 822  ? -26.30300 -39.66500 -52.91400 1.000 53.32912  ? 822  ALA A CA    1 
ATOM   6096  C  C     . ALA A 1 822  ? -25.55900 -40.99000 -52.83200 1.000 53.48612  ? 822  ALA A C     1 
ATOM   6097  O  O     . ALA A 1 822  ? -25.24900 -41.58900 -53.86800 1.000 52.08437  ? 822  ALA A O     1 
ATOM   6098  C  CB    . ALA A 1 822  ? -25.31400 -38.50700 -53.03000 1.000 55.20189  ? 822  ALA A CB    1 
ATOM   6099  N  N     . PHE A 1 823  ? -25.26100 -41.45900 -51.61800 1.000 60.66083  ? 823  PHE A N     1 
ATOM   6100  C  CA    . PHE A 1 823  ? -24.62800 -42.76500 -51.46200 1.000 59.12962  ? 823  PHE A CA    1 
ATOM   6101  C  C     . PHE A 1 823  ? -25.54600 -43.87500 -51.95700 1.000 58.16333  ? 823  PHE A C     1 
ATOM   6102  O  O     . PHE A 1 823  ? -25.11000 -44.78700 -52.66900 1.000 59.27074  ? 823  PHE A O     1 
ATOM   6103  C  CB    . PHE A 1 823  ? -24.24600 -42.99200 -49.99900 1.000 55.89686  ? 823  PHE A CB    1 
ATOM   6104  C  CG    . PHE A 1 823  ? -23.63600 -44.34000 -49.73400 1.000 63.96998  ? 823  PHE A CG    1 
ATOM   6105  C  CD1   . PHE A 1 823  ? -22.29800 -44.57700 -50.00400 1.000 65.86971  ? 823  PHE A CD1   1 
ATOM   6106  C  CD2   . PHE A 1 823  ? -24.40100 -45.37000 -49.21200 1.000 65.08443  ? 823  PHE A CD2   1 
ATOM   6107  C  CE1   . PHE A 1 823  ? -21.73500 -45.81500 -49.76000 1.000 59.06586  ? 823  PHE A CE1   1 
ATOM   6108  C  CE2   . PHE A 1 823  ? -23.84500 -46.61000 -48.96800 1.000 68.90864  ? 823  PHE A CE2   1 
ATOM   6109  C  CZ    . PHE A 1 823  ? -22.51000 -46.83300 -49.24100 1.000 63.70515  ? 823  PHE A CZ    1 
ATOM   6110  N  N     . ALA A 1 824  ? -26.82600 -43.81400 -51.58600 1.000 61.34310  ? 824  ALA A N     1 
ATOM   6111  C  CA    . ALA A 1 824  ? -27.78600 -44.79900 -52.07300 1.000 53.20590  ? 824  ALA A CA    1 
ATOM   6112  C  C     . ALA A 1 824  ? -28.00400 -44.65900 -53.57300 1.000 55.75542  ? 824  ALA A C     1 
ATOM   6113  O  O     . ALA A 1 824  ? -28.18300 -45.66100 -54.27600 1.000 61.59546  ? 824  ALA A O     1 
ATOM   6114  C  CB    . ALA A 1 824  ? -29.10900 -44.65700 -51.32300 1.000 48.79714  ? 824  ALA A CB    1 
ATOM   6115  N  N     . ALA A 1 825  ? -27.99000 -43.42400 -54.08000 1.000 54.12660  ? 825  ALA A N     1 
ATOM   6116  C  CA    . ALA A 1 825  ? -28.18900 -43.20400 -55.50800 1.000 47.27017  ? 825  ALA A CA    1 
ATOM   6117  C  C     . ALA A 1 825  ? -27.05500 -43.81000 -56.32400 1.000 54.63005  ? 825  ALA A C     1 
ATOM   6118  O  O     . ALA A 1 825  ? -27.29500 -44.44800 -57.35600 1.000 60.89541  ? 825  ALA A O     1 
ATOM   6119  C  CB    . ALA A 1 825  ? -28.31800 -41.70800 -55.79400 1.000 49.75855  ? 825  ALA A CB    1 
ATOM   6120  N  N     . ASN A 1 826  ? -25.81200 -43.62400 -55.87600 1.000 54.58552  ? 826  ASN A N     1 
ATOM   6121  C  CA    . ASN A 1 826  ? -24.67500 -44.17800 -56.60200 1.000 58.52860  ? 826  ASN A CA    1 
ATOM   6122  C  C     . ASN A 1 826  ? -24.60900 -45.69400 -56.47300 1.000 54.09599  ? 826  ASN A C     1 
ATOM   6123  O  O     . ASN A 1 826  ? -24.21000 -46.37800 -57.42200 1.000 53.41560  ? 826  ASN A O     1 
ATOM   6124  C  CB    . ASN A 1 826  ? -23.37600 -43.54700 -56.10000 1.000 55.18265  ? 826  ASN A CB    1 
ATOM   6125  C  CG    . ASN A 1 826  ? -22.14900 -44.12400 -56.77600 1.000 59.46942  ? 826  ASN A CG    1 
ATOM   6126  O  OD1   . ASN A 1 826  ? -21.83600 -43.78400 -57.91700 1.000 69.08035  ? 826  ASN A OD1   1 
ATOM   6127  N  ND2   . ASN A 1 826  ? -21.44500 -45.00400 -56.07300 1.000 58.74425  ? 826  ASN A ND2   1 
ATOM   6128  N  N     . LYS A 1 827  ? -24.99800 -46.23400 -55.31500 1.000 58.21834  ? 827  LYS A N     1 
ATOM   6129  C  CA    . LYS A 1 827  ? -24.90900 -47.67500 -55.09700 1.000 58.14109  ? 827  LYS A CA    1 
ATOM   6130  C  C     . LYS A 1 827  ? -25.83600 -48.44000 -56.03200 1.000 55.72466  ? 827  LYS A C     1 
ATOM   6131  O  O     . LYS A 1 827  ? -25.45900 -49.48900 -56.56800 1.000 57.01384  ? 827  LYS A O     1 
ATOM   6132  C  CB    . LYS A 1 827  ? -25.23000 -48.00100 -53.63800 1.000 58.04663  ? 827  LYS A CB    1 
ATOM   6133  C  CG    . LYS A 1 827  ? -25.09400 -49.47100 -53.27400 1.000 54.43886  ? 827  LYS A CG    1 
ATOM   6134  C  CD    . LYS A 1 827  ? -25.76800 -49.76300 -51.94200 1.000 62.71198  ? 827  LYS A CD    1 
ATOM   6135  C  CE    . LYS A 1 827  ? -25.41600 -51.14900 -51.42900 1.000 62.95792  ? 827  LYS A CE    1 
ATOM   6136  N  NZ    . LYS A 1 827  ? -24.63400 -51.08100 -50.16300 1.000 72.21073  ? 827  LYS A NZ    1 
ATOM   6137  N  N     . HIS A 1 828  ? -27.04900 -47.93400 -56.24400 1.000 56.28536  ? 828  HIS A N     1 
ATOM   6138  C  CA    . HIS A 1 828  ? -28.03600 -48.60600 -57.07600 1.000 56.91414  ? 828  HIS A CA    1 
ATOM   6139  C  C     . HIS A 1 828  ? -28.16400 -47.99400 -58.46500 1.000 57.78332  ? 828  HIS A C     1 
ATOM   6140  O  O     . HIS A 1 828  ? -29.00900 -48.44100 -59.24500 1.000 56.83232  ? 828  HIS A O     1 
ATOM   6141  C  CB    . HIS A 1 828  ? -29.39700 -48.60600 -56.37500 1.000 49.08468  ? 828  HIS A CB    1 
ATOM   6142  C  CG    . HIS A 1 828  ? -29.38300 -49.28400 -55.04100 1.000 49.07060  ? 828  HIS A CG    1 
ATOM   6143  N  ND1   . HIS A 1 828  ? -29.61700 -50.63400 -54.88900 1.000 52.35164  ? 828  HIS A ND1   1 
ATOM   6144  C  CD2   . HIS A 1 828  ? -29.14500 -48.80200 -53.79800 1.000 55.23751  ? 828  HIS A CD2   1 
ATOM   6145  C  CE1   . HIS A 1 828  ? -29.53200 -50.95200 -53.61000 1.000 59.17109  ? 828  HIS A CE1   1 
ATOM   6146  N  NE2   . HIS A 1 828  ? -29.24600 -49.85900 -52.92600 1.000 56.90716  ? 828  HIS A NE2   1 
ATOM   6147  N  N     . GLY A 1 829  ? -27.34500 -46.99500 -58.79200 1.000 58.96972  ? 829  GLY A N     1 
ATOM   6148  C  CA    . GLY A 1 829  ? -27.36400 -46.40800 -60.12200 1.000 52.46298  ? 829  GLY A CA    1 
ATOM   6149  C  C     . GLY A 1 829  ? -28.69500 -45.81700 -60.52300 1.000 45.28468  ? 829  GLY A C     1 
ATOM   6150  O  O     . GLY A 1 829  ? -29.06600 -45.87900 -61.70000 1.000 54.50002  ? 829  GLY A O     1 
ATOM   6151  N  N     . ARG A 1 830  ? -29.43300 -45.25300 -59.57200 1.000 50.35435  ? 830  ARG A N     1 
ATOM   6152  C  CA    . ARG A 1 830  ? -30.73200 -44.65600 -59.83100 1.000 50.96817  ? 830  ARG A CA    1 
ATOM   6153  C  C     . ARG A 1 830  ? -30.80300 -43.30100 -59.14200 1.000 44.22339  ? 830  ARG A C     1 
ATOM   6154  O  O     . ARG A 1 830  ? -29.99100 -42.98100 -58.27200 1.000 51.50028  ? 830  ARG A O     1 
ATOM   6155  C  CB    . ARG A 1 830  ? -31.87500 -45.55600 -59.33600 1.000 48.29242  ? 830  ARG A CB    1 
ATOM   6156  C  CG    . ARG A 1 830  ? -31.83100 -46.97400 -59.88000 1.000 48.37873  ? 830  ARG A CG    1 
ATOM   6157  C  CD    . ARG A 1 830  ? -32.74800 -47.14800 -61.07500 1.000 50.50489  ? 830  ARG A CD    1 
ATOM   6158  N  NE    . ARG A 1 830  ? -34.14100 -47.29000 -60.66400 1.000 59.22899  ? 830  ARG A NE    1 
ATOM   6159  C  CZ    . ARG A 1 830  ? -34.70800 -48.44700 -60.33800 1.000 58.77028  ? 830  ARG A CZ    1 
ATOM   6160  N  NH1   . ARG A 1 830  ? -34.00000 -49.56700 -60.37500 1.000 63.72150  ? 830  ARG A NH1   1 
ATOM   6161  N  NH2   . ARG A 1 830  ? -35.98300 -48.48400 -59.97400 1.000 62.44908  ? 830  ARG A NH2   1 
ATOM   6162  N  N     . ALA A 1 831  ? -31.78600 -42.50300 -59.54300 1.000 42.58453  ? 831  ALA A N     1 
ATOM   6163  C  CA    . ALA A 1 831  ? -32.02600 -41.23000 -58.88200 1.000 46.15941  ? 831  ALA A CA    1 
ATOM   6164  C  C     . ALA A 1 831  ? -32.87900 -41.44500 -57.64000 1.000 48.75650  ? 831  ALA A C     1 
ATOM   6165  O  O     . ALA A 1 831  ? -33.83700 -42.22100 -57.65500 1.000 54.37656  ? 831  ALA A O     1 
ATOM   6166  C  CB    . ALA A 1 831  ? -32.70800 -40.24800 -59.83100 1.000 43.04698  ? 831  ALA A CB    1 
ATOM   6167  N  N     . VAL A 1 832  ? -32.52100 -40.76200 -56.55700 1.000 49.40366  ? 832  VAL A N     1 
ATOM   6168  C  CA    . VAL A 1 832  ? -33.18800 -40.92400 -55.27000 1.000 47.17020  ? 832  VAL A CA    1 
ATOM   6169  C  C     . VAL A 1 832  ? -33.70500 -39.56800 -54.81400 1.000 46.89593  ? 832  VAL A C     1 
ATOM   6170  O  O     . VAL A 1 832  ? -32.98100 -38.56800 -54.87400 1.000 43.72046  ? 832  VAL A O     1 
ATOM   6171  C  CB    . VAL A 1 832  ? -32.25000 -41.54000 -54.21600 1.000 41.24274  ? 832  VAL A CB    1 
ATOM   6172  C  CG1   . VAL A 1 832  ? -32.98900 -41.74600 -52.90700 1.000 38.52973  ? 832  VAL A CG1   1 
ATOM   6173  C  CG2   . VAL A 1 832  ? -31.69200 -42.85900 -54.71600 1.000 41.55452  ? 832  VAL A CG2   1 
ATOM   6174  N  N     . ARG A 1 833  ? -34.95700 -39.54100 -54.36300 1.000 46.98995  ? 833  ARG A N     1 
ATOM   6175  C  CA    . ARG A 1 833  ? -35.59700 -38.34200 -53.84300 1.000 46.34596  ? 833  ARG A CA    1 
ATOM   6176  C  C     . ARG A 1 833  ? -35.91400 -38.54300 -52.36800 1.000 52.68718  ? 833  ARG A C     1 
ATOM   6177  O  O     . ARG A 1 833  ? -36.41300 -39.60000 -51.97000 1.000 53.26065  ? 833  ARG A O     1 
ATOM   6178  C  CB    . ARG A 1 833  ? -36.87900 -38.02300 -54.61800 1.000 48.35526  ? 833  ARG A CB    1 
ATOM   6179  C  CG    . ARG A 1 833  ? -37.64500 -36.82100 -54.09700 1.000 51.56160  ? 833  ARG A CG    1 
ATOM   6180  C  CD    . ARG A 1 833  ? -39.04000 -36.76900 -54.69400 1.000 56.08383  ? 833  ARG A CD    1 
ATOM   6181  N  NE    . ARG A 1 833  ? -39.00500 -36.73600 -56.15300 1.000 54.99496  ? 833  ARG A NE    1 
ATOM   6182  C  CZ    . ARG A 1 833  ? -39.23900 -35.65000 -56.88200 1.000 55.56863  ? 833  ARG A CZ    1 
ATOM   6183  N  NH1   . ARG A 1 833  ? -39.53000 -34.50100 -56.28700 1.000 54.77030  ? 833  ARG A NH1   1 
ATOM   6184  N  NH2   . ARG A 1 833  ? -39.18400 -35.71200 -58.20600 1.000 54.31246  ? 833  ARG A NH2   1 
ATOM   6185  N  N     . CYS A 1 834  ? -35.61900 -37.52800 -51.55700 1.000 55.89426  ? 834  CYS A N     1 
ATOM   6186  C  CA    . CYS A 1 834  ? -35.84900 -37.58200 -50.11600 1.000 49.33706  ? 834  CYS A CA    1 
ATOM   6187  C  C     . CYS A 1 834  ? -36.56600 -36.31000 -49.68400 1.000 53.60910  ? 834  CYS A C     1 
ATOM   6188  O  O     . CYS A 1 834  ? -35.97400 -35.22600 -49.69200 1.000 56.82854  ? 834  CYS A O     1 
ATOM   6189  C  CB    . CYS A 1 834  ? -34.53500 -37.75000 -49.35400 1.000 43.60230  ? 834  CYS A CB    1 
ATOM   6190  S  SG    . CYS A 1 834  ? -34.74100 -38.00800 -47.58100 1.000 58.17131  ? 834  CYS A SG    1 
ATOM   6191  N  N     . VAL A 1 835  ? -37.83500 -36.44500 -49.30600 1.000 52.16398  ? 835  VAL A N     1 
ATOM   6192  C  CA    . VAL A 1 835  ? -38.63800 -35.33800 -48.80100 1.000 44.63806  ? 835  VAL A CA    1 
ATOM   6193  C  C     . VAL A 1 835  ? -39.21000 -35.75600 -47.45500 1.000 49.59163  ? 835  VAL A C     1 
ATOM   6194  O  O     . VAL A 1 835  ? -39.89300 -36.78300 -47.36100 1.000 56.75527  ? 835  VAL A O     1 
ATOM   6195  C  CB    . VAL A 1 835  ? -39.76400 -34.94600 -49.77100 1.000 44.61217  ? 835  VAL A CB    1 
ATOM   6196  C  CG1   . VAL A 1 835  ? -40.65700 -33.88700 -49.14500 1.000 46.69663  ? 835  VAL A CG1   1 
ATOM   6197  C  CG2   . VAL A 1 835  ? -39.17900 -34.44600 -51.08100 1.000 56.02059  ? 835  VAL A CG2   1 
ATOM   6198  N  N     . LEU A 1 836  ? -38.93300 -34.96900 -46.42200 1.000 45.99947  ? 836  LEU A N     1 
ATOM   6199  C  CA    . LEU A 1 836  ? -39.37000 -35.28700 -45.07300 1.000 52.16716  ? 836  LEU A CA    1 
ATOM   6200  C  C     . LEU A 1 836  ? -40.74500 -34.69500 -44.79300 1.000 55.69738  ? 836  LEU A C     1 
ATOM   6201  O  O     . LEU A 1 836  ? -41.09900 -33.62400 -45.29300 1.000 55.42856  ? 836  LEU A O     1 
ATOM   6202  C  CB    . LEU A 1 836  ? -38.36700 -34.76500 -44.04300 1.000 55.05737  ? 836  LEU A CB    1 
ATOM   6203  C  CG    . LEU A 1 836  ? -36.92900 -35.26700 -44.17700 1.000 49.61981  ? 836  LEU A CG    1 
ATOM   6204  C  CD1   . LEU A 1 836  ? -36.05700 -34.68900 -43.07500 1.000 50.10432  ? 836  LEU A CD1   1 
ATOM   6205  C  CD2   . LEU A 1 836  ? -36.88900 -36.78700 -44.15700 1.000 57.25671  ? 836  LEU A CD2   1 
ATOM   6206  N  N     . GLU A 1 837  ? -41.52200 -35.41300 -43.98700 1.000 60.13966  ? 837  GLU A N     1 
ATOM   6207  C  CA    . GLU A 1 837  ? -42.78500 -34.89200 -43.49500 1.000 56.30726  ? 837  GLU A CA    1 
ATOM   6208  C  C     . GLU A 1 837  ? -42.53000 -33.92100 -42.34200 1.000 65.90104  ? 837  GLU A C     1 
ATOM   6209  O  O     . GLU A 1 837  ? -41.42400 -33.83400 -41.80100 1.000 65.45066  ? 837  GLU A O     1 
ATOM   6210  C  CB    . GLU A 1 837  ? -43.70000 -36.03500 -43.05800 1.000 63.56048  ? 837  GLU A CB    1 
ATOM   6211  C  CG    . GLU A 1 837  ? -43.90600 -37.10000 -44.12600 1.000 70.68306  ? 837  GLU A CG    1 
ATOM   6212  C  CD    . GLU A 1 837  ? -44.87800 -38.18300 -43.69500 1.000 80.15824  ? 837  GLU A CD    1 
ATOM   6213  O  OE1   . GLU A 1 837  ? -45.71200 -38.60100 -44.52600 1.000 82.81098  ? 837  GLU A OE1   1 
ATOM   6214  O  OE2   . GLU A 1 837  ? -44.80800 -38.61600 -42.52500 1.000 84.83470  ? 837  GLU A OE2   1 
ATOM   6215  N  N     . ARG A 1 838  ? -43.57500 -33.17900 -41.96900 1.000 62.55584  ? 838  ARG A N     1 
ATOM   6216  C  CA    . ARG A 1 838  ? -43.42300 -32.14700 -40.94600 1.000 56.91837  ? 838  ARG A CA    1 
ATOM   6217  C  C     . ARG A 1 838  ? -42.98000 -32.74600 -39.61700 1.000 55.32898  ? 838  ARG A C     1 
ATOM   6218  O  O     . ARG A 1 838  ? -42.04800 -32.24500 -38.97800 1.000 58.54418  ? 838  ARG A O     1 
ATOM   6219  C  CB    . ARG A 1 838  ? -44.73000 -31.37300 -40.78200 1.000 64.43523  ? 838  ARG A CB    1 
ATOM   6220  C  CG    . ARG A 1 838  ? -44.66100 -30.26700 -39.74100 1.000 63.04779  ? 838  ARG A CG    1 
ATOM   6221  C  CD    . ARG A 1 838  ? -43.55900 -29.27200 -40.07000 1.000 60.46954  ? 838  ARG A CD    1 
ATOM   6222  N  NE    . ARG A 1 838  ? -43.82300 -28.54900 -41.31100 1.000 58.93448  ? 838  ARG A NE    1 
ATOM   6223  C  CZ    . ARG A 1 838  ? -43.00700 -27.63900 -41.83300 1.000 61.53397  ? 838  ARG A CZ    1 
ATOM   6224  N  NH1   . ARG A 1 838  ? -41.86800 -27.33900 -41.22500 1.000 59.67473  ? 838  ARG A NH1   1 
ATOM   6225  N  NH2   . ARG A 1 838  ? -43.32900 -27.03000 -42.96600 1.000 56.54457  ? 838  ARG A NH2   1 
ATOM   6226  N  N     . GLY A 1 839  ? -43.64100 -33.82200 -39.18200 1.000 64.40698  ? 839  GLY A N     1 
ATOM   6227  C  CA    . GLY A 1 839  ? -43.24400 -34.46800 -37.94100 1.000 66.29090  ? 839  GLY A CA    1 
ATOM   6228  C  C     . GLY A 1 839  ? -41.82800 -35.00900 -37.99300 1.000 66.72440  ? 839  GLY A C     1 
ATOM   6229  O  O     . GLY A 1 839  ? -41.07600 -34.90300 -37.02100 1.000 60.35643  ? 839  GLY A O     1 
ATOM   6230  N  N     . GLU A 1 840  ? -41.44900 -35.60100 -39.12700 1.000 70.68246  ? 840  GLU A N     1 
ATOM   6231  C  CA    . GLU A 1 840  ? -40.06600 -36.02400 -39.31800 1.000 62.27652  ? 840  GLU A CA    1 
ATOM   6232  C  C     . GLU A 1 840  ? -39.11700 -34.83500 -39.26600 1.000 64.90468  ? 840  GLU A C     1 
ATOM   6233  O  O     . GLU A 1 840  ? -38.02500 -34.92500 -38.69400 1.000 63.92352  ? 840  GLU A O     1 
ATOM   6234  C  CB    . GLU A 1 840  ? -39.91800 -36.74800 -40.65700 1.000 67.22777  ? 840  GLU A CB    1 
ATOM   6235  C  CG    . GLU A 1 840  ? -40.21500 -38.23300 -40.62700 1.000 76.24110  ? 840  GLU A CG    1 
ATOM   6236  C  CD    . GLU A 1 840  ? -40.08300 -38.86700 -42.00000 1.000 84.88924  ? 840  GLU A CD    1 
ATOM   6237  O  OE1   . GLU A 1 840  ? -40.74800 -38.38600 -42.94200 1.000 69.92744  ? 840  GLU A OE1   1 
ATOM   6238  O  OE2   . GLU A 1 840  ? -39.31000 -39.83800 -42.13900 1.000 89.47909  ? 840  GLU A OE2   1 
ATOM   6239  N  N     . ASP A 1 841  ? -39.52300 -33.70900 -39.85500 1.000 62.59383  ? 841  ASP A N     1 
ATOM   6240  C  CA    . ASP A 1 841  ? -38.62000 -32.57400 -40.01000 1.000 60.50847  ? 841  ASP A CA    1 
ATOM   6241  C  C     . ASP A 1 841  ? -38.26700 -31.95900 -38.66000 1.000 69.74761  ? 841  ASP A C     1 
ATOM   6242  O  O     . ASP A 1 841  ? -37.08900 -31.73800 -38.35800 1.000 72.94396  ? 841  ASP A O     1 
ATOM   6243  C  CB    . ASP A 1 841  ? -39.25200 -31.53400 -40.93600 1.000 64.97222  ? 841  ASP A CB    1 
ATOM   6244  C  CG    . ASP A 1 841  ? -38.26000 -30.49000 -41.40800 1.000 64.04950  ? 841  ASP A CG    1 
ATOM   6245  O  OD1   . ASP A 1 841  ? -37.72900 -29.73600 -40.56600 1.000 72.55735  ? 841  ASP A OD1   1 
ATOM   6246  O  OD2   . ASP A 1 841  ? -38.01500 -30.42200 -42.63000 1.000 62.90176  ? 841  ASP A OD2   1 
ATOM   6247  N  N     . MET A 1 842  ? -39.27700 -31.67300 -37.83400 1.000 68.87302  ? 842  MET A N     1 
ATOM   6248  C  CA    . MET A 1 842  ? -39.02100 -31.07200 -36.53000 1.000 75.47152  ? 842  MET A CA    1 
ATOM   6249  C  C     . MET A 1 842  ? -38.23600 -31.99400 -35.60700 1.000 71.75828  ? 842  MET A C     1 
ATOM   6250  O  O     . MET A 1 842  ? -37.58800 -31.50900 -34.67400 1.000 80.84622  ? 842  MET A O     1 
ATOM   6251  C  CB    . MET A 1 842  ? -40.33700 -30.67800 -35.85900 1.000 76.43060  ? 842  MET A CB    1 
ATOM   6252  C  CG    . MET A 1 842  ? -41.15000 -29.65200 -36.62800 1.000 74.78720  ? 842  MET A CG    1 
ATOM   6253  S  SD    . MET A 1 842  ? -42.68500 -29.22700 -35.78400 1.000 85.35074  ? 842  MET A SD    1 
ATOM   6254  C  CE    . MET A 1 842  ? -43.49400 -30.82500 -35.73300 1.000 67.59051  ? 842  MET A CE    1 
ATOM   6255  N  N     . LEU A 1 843  ? -38.27800 -33.30300 -35.84600 1.000 68.60637  ? 843  LEU A N     1 
ATOM   6256  C  CA    . LEU A 1 843  ? -37.57200 -34.25500 -35.00000 1.000 68.60220  ? 843  LEU A CA    1 
ATOM   6257  C  C     . LEU A 1 843  ? -36.12600 -34.45800 -35.42800 1.000 70.77628  ? 843  LEU A C     1 
ATOM   6258  O  O     . LEU A 1 843  ? -35.26100 -34.67900 -34.57400 1.000 74.91018  ? 843  LEU A O     1 
ATOM   6259  C  CB    . LEU A 1 843  ? -38.30300 -35.60000 -35.00300 1.000 64.61291  ? 843  LEU A CB    1 
ATOM   6260  C  CG    . LEU A 1 843  ? -37.94900 -36.59300 -33.89700 1.000 65.17895  ? 843  LEU A CG    1 
ATOM   6261  C  CD1   . LEU A 1 843  ? -38.09700 -35.93000 -32.53800 1.000 70.66906  ? 843  LEU A CD1   1 
ATOM   6262  C  CD2   . LEU A 1 843  ? -38.82000 -37.83600 -33.98900 1.000 60.67106  ? 843  LEU A CD2   1 
ATOM   6263  N  N     . ILE A 1 844  ? -35.84100 -34.39400 -36.72700 1.000 69.41118  ? 844  ILE A N     1 
ATOM   6264  C  CA    . ILE A 1 844  ? -34.46700 -34.55000 -37.19200 1.000 68.52745  ? 844  ILE A CA    1 
ATOM   6265  C  C     . ILE A 1 844  ? -33.72900 -33.22000 -37.14200 1.000 74.85316  ? 844  ILE A C     1 
ATOM   6266  O  O     . ILE A 1 844  ? -32.59600 -33.13900 -36.65700 1.000 78.29412  ? 844  ILE A O     1 
ATOM   6267  C  CB    . ILE A 1 844  ? -34.44600 -35.15500 -38.60800 1.000 65.99534  ? 844  ILE A CB    1 
ATOM   6268  C  CG1   . ILE A 1 844  ? -35.22700 -36.47200 -38.63700 1.000 62.64509  ? 844  ILE A CG1   1 
ATOM   6269  C  CG2   . ILE A 1 844  ? -33.01200 -35.35700 -39.07700 1.000 60.17592  ? 844  ILE A CG2   1 
ATOM   6270  C  CD1   . ILE A 1 844  ? -35.34300 -37.08300 -40.02000 1.000 57.44643  ? 844  ILE A CD1   1 
ATOM   6271  N  N     . THR A 1 845  ? -34.36200 -32.16000 -37.63500 1.000 78.54004  ? 845  THR A N     1 
ATOM   6272  C  CA    . THR A 1 845  ? -33.75600 -30.83800 -37.59300 1.000 81.41903  ? 845  THR A CA    1 
ATOM   6273  C  C     . THR A 1 845  ? -33.71900 -30.31600 -36.16100 1.000 84.50194  ? 845  THR A C     1 
ATOM   6274  O  O     . THR A 1 845  ? -34.55400 -30.66700 -35.32300 1.000 85.88252  ? 845  THR A O     1 
ATOM   6275  C  CB    . THR A 1 845  ? -34.53000 -29.86300 -38.48200 1.000 79.82895  ? 845  THR A CB    1 
ATOM   6276  O  OG1   . THR A 1 845  ? -34.94700 -30.53300 -39.67800 1.000 71.43947  ? 845  THR A OG1   1 
ATOM   6277  C  CG2   . THR A 1 845  ? -33.65800 -28.67300 -38.86000 1.000 76.38992  ? 845  THR A CG2   1 
ATOM   6278  N  N     . GLY A 1 846  ? -32.72800 -29.47300 -35.88300 1.000 82.15139  ? 846  GLY A N     1 
ATOM   6279  C  CA    . GLY A 1 846  ? -32.60500 -28.86600 -34.57500 1.000 86.01458  ? 846  GLY A CA    1 
ATOM   6280  C  C     . GLY A 1 846  ? -33.50700 -27.66300 -34.40000 1.000 87.00303  ? 846  GLY A C     1 
ATOM   6281  O  O     . GLY A 1 846  ? -34.73500 -27.79200 -34.38600 1.000 84.21072  ? 846  GLY A O     1 
ATOM   6282  N  N     . GLY A 1 847  ? -32.90700 -26.48700 -34.26800 1.000 87.84138  ? 847  GLY A N     1 
ATOM   6283  C  CA    . GLY A 1 847  ? -33.66800 -25.26800 -34.07100 1.000 79.24655  ? 847  GLY A CA    1 
ATOM   6284  C  C     . GLY A 1 847  ? -32.79100 -24.20300 -33.43500 1.000 83.12719  ? 847  GLY A C     1 
ATOM   6285  O  O     . GLY A 1 847  ? -31.56800 -24.24700 -33.54100 1.000 93.16415  ? 847  GLY A O     1 
ATOM   6286  N  N     . ARG A 1 848  ? -33.44700 -23.25200 -32.77700 1.000 82.32698  ? 848  ARG A N     1 
ATOM   6287  C  CA    . ARG A 1 848  ? -32.71500 -22.20900 -32.07800 1.000 77.26057  ? 848  ARG A CA    1 
ATOM   6288  C  C     . ARG A 1 848  ? -32.14100 -22.75000 -30.77200 1.000 88.17972  ? 848  ARG A C     1 
ATOM   6289  O  O     . ARG A 1 848  ? -32.63300 -23.72800 -30.20200 1.000 91.61853  ? 848  ARG A O     1 
ATOM   6290  C  CB    . ARG A 1 848  ? -33.61400 -21.00100 -31.80200 1.000 79.52968  ? 848  ARG A CB    1 
ATOM   6291  C  CG    . ARG A 1 848  ? -32.85300 -19.72000 -31.48200 1.000 79.48192  ? 848  ARG A CG    1 
ATOM   6292  C  CD    . ARG A 1 848  ? -33.79100 -18.56000 -31.18600 1.000 78.74713  ? 848  ARG A CD    1 
ATOM   6293  N  NE    . ARG A 1 848  ? -34.35800 -17.97700 -32.39900 1.000 78.73968  ? 848  ARG A NE    1 
ATOM   6294  C  CZ    . ARG A 1 848  ? -33.77700 -17.01300 -33.10600 1.000 76.90931  ? 848  ARG A CZ    1 
ATOM   6295  N  NH1   . ARG A 1 848  ? -32.60400 -16.52400 -32.72700 1.000 78.13119  ? 848  ARG A NH1   1 
ATOM   6296  N  NH2   . ARG A 1 848  ? -34.36700 -16.53700 -34.19400 1.000 73.23336  ? 848  ARG A NH2   1 
ATOM   6297  N  N     . HIS A 1 849  ? -31.08400 -22.09900 -30.30100 1.000 86.76840  ? 849  HIS A N     1 
ATOM   6298  C  CA    . HIS A 1 849  ? -30.39100 -22.54100 -29.09900 1.000 85.69749  ? 849  HIS A CA    1 
ATOM   6299  C  C     . HIS A 1 849  ? -31.12300 -22.04600 -27.85800 1.000 80.77025  ? 849  HIS A C     1 
ATOM   6300  O  O     . HIS A 1 849  ? -31.24200 -20.83000 -27.66700 1.000 81.87417  ? 849  HIS A O     1 
ATOM   6301  C  CB    . HIS A 1 849  ? -28.95900 -22.02200 -29.09500 1.000 92.50507  ? 849  HIS A CB    1 
ATOM   6302  C  CG    . HIS A 1 849  ? -27.99900 -22.88700 -29.85000 1.000 94.51800  ? 849  HIS A CG    1 
ATOM   6303  N  ND1   . HIS A 1 849  ? -27.15800 -23.78500 -29.22900 1.000 90.64116  ? 849  HIS A ND1   1 
ATOM   6304  C  CD2   . HIS A 1 849  ? -27.74500 -22.98900 -31.17600 1.000 94.31939  ? 849  HIS A CD2   1 
ATOM   6305  C  CE1   . HIS A 1 849  ? -26.42700 -24.40100 -30.14000 1.000 96.15253  ? 849  HIS A CE1   1 
ATOM   6306  N  NE2   . HIS A 1 849  ? -26.76500 -23.93800 -31.33000 1.000 102.05306 ? 849  HIS A NE2   1 
ATOM   6307  N  N     . PRO A 1 850  ? -31.62800 -22.93400 -27.00000 1.000 78.58374  ? 850  PRO A N     1 
ATOM   6308  C  CA    . PRO A 1 850  ? -32.17900 -22.48300 -25.71500 1.000 77.86092  ? 850  PRO A CA    1 
ATOM   6309  C  C     . PRO A 1 850  ? -31.07500 -21.89500 -24.84800 1.000 85.15497  ? 850  PRO A C     1 
ATOM   6310  O  O     . PRO A 1 850  ? -29.99200 -22.47100 -24.72200 1.000 86.10809  ? 850  PRO A O     1 
ATOM   6311  C  CB    . PRO A 1 850  ? -32.76200 -23.76300 -25.10300 1.000 73.97167  ? 850  PRO A CB    1 
ATOM   6312  C  CG    . PRO A 1 850  ? -32.92600 -24.70600 -26.25800 1.000 75.83513  ? 850  PRO A CG    1 
ATOM   6313  C  CD    . PRO A 1 850  ? -31.81100 -24.38000 -27.20100 1.000 78.69017  ? 850  PRO A CD    1 
ATOM   6314  N  N     . TYR A 1 851  ? -31.35400 -20.74000 -24.25300 1.000 81.39929  ? 851  TYR A N     1 
ATOM   6315  C  CA    . TYR A 1 851  ? -30.35500 -19.98000 -23.52000 1.000 75.87143  ? 851  TYR A CA    1 
ATOM   6316  C  C     . TYR A 1 851  ? -30.66100 -19.95400 -22.02800 1.000 78.56679  ? 851  TYR A C     1 
ATOM   6317  O  O     . TYR A 1 851  ? -31.79500 -20.16800 -21.59300 1.000 75.99994  ? 851  TYR A O     1 
ATOM   6318  C  CB    . TYR A 1 851  ? -30.26400 -18.54600 -24.05200 1.000 76.34230  ? 851  TYR A CB    1 
ATOM   6319  C  CG    . TYR A 1 851  ? -28.99700 -18.24400 -24.82000 1.000 79.36285  ? 851  TYR A CG    1 
ATOM   6320  C  CD1   . TYR A 1 851  ? -28.73000 -18.86600 -26.03300 1.000 86.79727  ? 851  TYR A CD1   1 
ATOM   6321  C  CD2   . TYR A 1 851  ? -28.07900 -17.31700 -24.34200 1.000 75.73030  ? 851  TYR A CD2   1 
ATOM   6322  C  CE1   . TYR A 1 851  ? -27.57600 -18.58200 -26.74200 1.000 91.46231  ? 851  TYR A CE1   1 
ATOM   6323  C  CE2   . TYR A 1 851  ? -26.92400 -17.02700 -25.04300 1.000 79.82926  ? 851  TYR A CE2   1 
ATOM   6324  C  CZ    . TYR A 1 851  ? -26.67800 -17.66200 -26.24300 1.000 90.57996  ? 851  TYR A CZ    1 
ATOM   6325  O  OH    . TYR A 1 851  ? -25.52900 -17.37600 -26.94500 1.000 93.37388  ? 851  TYR A OH    1 
ATOM   6326  N  N     . LEU A 1 852  ? -29.61300 -19.69000 -21.25000 1.000 81.12422  ? 852  LEU A N     1 
ATOM   6327  C  CA    . LEU A 1 852  ? -29.72300 -19.45100 -19.81600 1.000 83.12172  ? 852  LEU A CA    1 
ATOM   6328  C  C     . LEU A 1 852  ? -28.75400 -18.33700 -19.45600 1.000 84.49122  ? 852  LEU A C     1 
ATOM   6329  O  O     . LEU A 1 852  ? -27.54400 -18.48100 -19.65400 1.000 86.27814  ? 852  LEU A O     1 
ATOM   6330  C  CB    . LEU A 1 852  ? -29.41700 -20.71500 -19.00600 1.000 83.89238  ? 852  LEU A CB    1 
ATOM   6331  C  CG    . LEU A 1 852  ? -29.26700 -20.51000 -17.49600 1.000 83.83664  ? 852  LEU A CG    1 
ATOM   6332  C  CD1   . LEU A 1 852  ? -30.55500 -19.97300 -16.89000 1.000 82.83712  ? 852  LEU A CD1   1 
ATOM   6333  C  CD2   . LEU A 1 852  ? -28.84700 -21.80100 -16.81100 1.000 80.93105  ? 852  LEU A CD2   1 
ATOM   6334  N  N     . GLY A 1 853  ? -29.28200 -17.23200 -18.93800 1.000 79.15651  ? 853  GLY A N     1 
ATOM   6335  C  CA    . GLY A 1 853  ? -28.45200 -16.08100 -18.64700 1.000 85.08150  ? 853  GLY A CA    1 
ATOM   6336  C  C     . GLY A 1 853  ? -28.44000 -15.67000 -17.19000 1.000 88.68246  ? 853  GLY A C     1 
ATOM   6337  O  O     . GLY A 1 853  ? -29.43200 -15.14400 -16.67900 1.000 95.56848  ? 853  GLY A O     1 
ATOM   6338  N  N     . LYS A 1 854  ? -27.32100 -15.90600 -16.51200 1.000 83.47691  ? 854  LYS A N     1 
ATOM   6339  C  CA    . LYS A 1 854  ? -27.11800 -15.45500 -15.14300 1.000 85.35630  ? 854  LYS A CA    1 
ATOM   6340  C  C     . LYS A 1 854  ? -26.36400 -14.13200 -15.15700 1.000 91.33889  ? 854  LYS A C     1 
ATOM   6341  O  O     . LYS A 1 854  ? -25.45900 -13.93300 -15.97200 1.000 87.05512  ? 854  LYS A O     1 
ATOM   6342  C  CB    . LYS A 1 854  ? -26.33900 -16.49300 -14.33300 1.000 86.32788  ? 854  LYS A CB    1 
ATOM   6343  C  CG    . LYS A 1 854  ? -27.00300 -17.85800 -14.26000 1.000 78.49485  ? 854  LYS A CG    1 
ATOM   6344  C  CD    . LYS A 1 854  ? -26.22800 -18.79600 -13.34500 1.000 81.16010  ? 854  LYS A CD    1 
ATOM   6345  C  CE    . LYS A 1 854  ? -26.86600 -20.17500 -13.29500 1.000 90.19892  ? 854  LYS A CE    1 
ATOM   6346  N  NZ    . LYS A 1 854  ? -26.17800 -21.07100 -12.32500 1.000 98.47908  ? 854  LYS A NZ    1 
ATOM   6347  N  N     . TYR A 1 855  ? -26.74000 -13.22700 -14.25500 1.000 92.82254  ? 855  TYR A N     1 
ATOM   6348  C  CA    . TYR A 1 855  ? -26.12100 -11.91100 -14.23400 1.000 92.69853  ? 855  TYR A CA    1 
ATOM   6349  C  C     . TYR A 1 855  ? -26.08400 -11.35700 -12.81800 1.000 97.74272  ? 855  TYR A C     1 
ATOM   6350  O  O     . TYR A 1 855  ? -26.92900 -11.68100 -11.97900 1.000 95.09911  ? 855  TYR A O     1 
ATOM   6351  C  CB    . TYR A 1 855  ? -26.85100 -10.92700 -15.15700 1.000 90.27240  ? 855  TYR A CB    1 
ATOM   6352  C  CG    . TYR A 1 855  ? -28.34800 -10.86800 -14.96000 1.000 88.92961  ? 855  TYR A CG    1 
ATOM   6353  C  CD1   . TYR A 1 855  ? -28.91600 -9.99800  -14.03900 1.000 92.67997  ? 855  TYR A CD1   1 
ATOM   6354  C  CD2   . TYR A 1 855  ? -29.19600 -11.67100 -15.71100 1.000 93.23338  ? 855  TYR A CD2   1 
ATOM   6355  C  CE1   . TYR A 1 855  ? -30.28500 -9.93800  -13.86300 1.000 91.67250  ? 855  TYR A CE1   1 
ATOM   6356  C  CE2   . TYR A 1 855  ? -30.56500 -11.61800 -15.54300 1.000 92.53872  ? 855  TYR A CE2   1 
ATOM   6357  C  CZ    . TYR A 1 855  ? -31.10400 -10.75000 -14.61800 1.000 91.74147  ? 855  TYR A CZ    1 
ATOM   6358  O  OH    . TYR A 1 855  ? -32.46800 -10.69700 -14.45200 1.000 89.94220  ? 855  TYR A OH    1 
ATOM   6359  N  N     . LYS A 1 856  ? -25.08300 -10.51300 -12.57200 1.000 100.01760 ? 856  LYS A N     1 
ATOM   6360  C  CA    . LYS A 1 856  ? -24.94700 -9.75200  -11.33600 1.000 96.86024  ? 856  LYS A CA    1 
ATOM   6361  C  C     . LYS A 1 856  ? -24.64800 -8.31200  -11.72300 1.000 98.28716  ? 856  LYS A C     1 
ATOM   6362  O  O     . LYS A 1 856  ? -23.62200 -8.04000  -12.35600 1.000 97.96324  ? 856  LYS A O     1 
ATOM   6363  C  CB    . LYS A 1 856  ? -23.83800 -10.31700 -10.44000 1.000 98.04174  ? 856  LYS A CB    1 
ATOM   6364  C  CG    . LYS A 1 856  ? -23.95400 -11.81000 -10.14000 1.000 108.77361 ? 856  LYS A CG    1 
ATOM   6365  C  CD    . LYS A 1 856  ? -23.22700 -12.66600 -11.17000 1.000 108.11524 ? 856  LYS A CD    1 
ATOM   6366  C  CE    . LYS A 1 856  ? -23.83500 -14.05700 -11.25300 1.000 99.38210  ? 856  LYS A CE    1 
ATOM   6367  N  NZ    . LYS A 1 856  ? -23.04100 -14.96800 -12.12200 1.000 95.45756  ? 856  LYS A NZ    1 
ATOM   6368  N  N     . ALA A 1 857  ? -25.53900 -7.39600  -11.35300 1.000 96.78622  ? 857  ALA A N     1 
ATOM   6369  C  CA    . ALA A 1 857  ? -25.49300 -6.02100  -11.83000 1.000 94.78169  ? 857  ALA A CA    1 
ATOM   6370  C  C     . ALA A 1 857  ? -25.25400 -5.06200  -10.67400 1.000 97.45128  ? 857  ALA A C     1 
ATOM   6371  O  O     . ALA A 1 857  ? -25.97700 -5.09300  -9.67300  1.000 92.89533  ? 857  ALA A O     1 
ATOM   6372  C  CB    . ALA A 1 857  ? -26.79000 -5.65300  -12.55600 1.000 91.70480  ? 857  ALA A CB    1 
ATOM   6373  N  N     . GLY A 1 858  ? -24.24100 -4.21000  -10.82100 1.000 97.60985  ? 858  GLY A N     1 
ATOM   6374  C  CA    . GLY A 1 858  ? -24.00000 -3.12200  -9.89100  1.000 96.23133  ? 858  GLY A CA    1 
ATOM   6375  C  C     . GLY A 1 858  ? -24.48100 -1.81600  -10.49600 1.000 93.51130  ? 858  GLY A C     1 
ATOM   6376  O  O     . GLY A 1 858  ? -24.09500 -1.45500  -11.61000 1.000 96.27447  ? 858  GLY A O     1 
ATOM   6377  N  N     . PHE A 1 859  ? -25.32800 -1.11400  -9.74800  1.000 95.75074  ? 859  PHE A N     1 
ATOM   6378  C  CA    . PHE A 1 859  ? -26.00700 0.06200   -10.27200 1.000 96.54067  ? 859  PHE A CA    1 
ATOM   6379  C  C     . PHE A 1 859  ? -26.32100 1.01900   -9.13300  1.000 105.12284 ? 859  PHE A C     1 
ATOM   6380  O  O     . PHE A 1 859  ? -26.39900 0.62500   -7.96600  1.000 110.43521 ? 859  PHE A O     1 
ATOM   6381  C  CB    . PHE A 1 859  ? -27.29300 -0.32300  -11.01300 1.000 91.99786  ? 859  PHE A CB    1 
ATOM   6382  C  CG    . PHE A 1 859  ? -28.28800 -1.06000  -10.15700 1.000 95.07528  ? 859  PHE A CG    1 
ATOM   6383  C  CD1   . PHE A 1 859  ? -28.13900 -2.41500  -9.90500  1.000 99.22491  ? 859  PHE A CD1   1 
ATOM   6384  C  CD2   . PHE A 1 859  ? -29.36900 -0.39800  -9.59900  1.000 90.77005  ? 859  PHE A CD2   1 
ATOM   6385  C  CE1   . PHE A 1 859  ? -29.04800 -3.09400  -9.11700  1.000 99.73172  ? 859  PHE A CE1   1 
ATOM   6386  C  CE2   . PHE A 1 859  ? -30.28300 -1.07300  -8.81000  1.000 93.80998  ? 859  PHE A CE2   1 
ATOM   6387  C  CZ    . PHE A 1 859  ? -30.12200 -2.42300  -8.56900  1.000 96.05299  ? 859  PHE A CZ    1 
ATOM   6388  N  N     . MET A 1 860  ? -26.50400 2.28600   -9.48800  1.000 103.77079 ? 860  MET A N     1 
ATOM   6389  C  CA    . MET A 1 860  ? -26.90900 3.31400   -8.54200  1.000 101.76227 ? 860  MET A CA    1 
ATOM   6390  C  C     . MET A 1 860  ? -28.39400 3.62200   -8.70100  1.000 104.71356 ? 860  MET A C     1 
ATOM   6391  O  O     . MET A 1 860  ? -29.04400 3.21600   -9.66800  1.000 108.00649 ? 860  MET A O     1 
ATOM   6392  C  CB    . MET A 1 860  ? -26.07300 4.58500   -8.72400  1.000 102.80684 ? 860  MET A CB    1 
ATOM   6393  C  CG    . MET A 1 860  ? -24.57800 4.38200   -8.54800  1.000 105.53797 ? 860  MET A CG    1 
ATOM   6394  S  SD    . MET A 1 860  ? -23.66000 4.69200   -10.06600 1.000 126.96125 ? 860  MET A SD    1 
ATOM   6395  C  CE    . MET A 1 860  ? -23.64000 6.48300   -10.08400 1.000 115.34693 ? 860  MET A CE    1 
ATOM   6396  N  N     . ASN A 1 861  ? -28.92900 4.36400   -7.72900  1.000 105.47807 ? 861  ASN A N     1 
ATOM   6397  C  CA    . ASN A 1 861  ? -30.36300 4.62300   -7.67300  1.000 105.91973 ? 861  ASN A CA    1 
ATOM   6398  C  C     . ASN A 1 861  ? -30.85600 5.53200   -8.79200  1.000 100.41030 ? 861  ASN A C     1 
ATOM   6399  O  O     . ASN A 1 861  ? -32.07100 5.61400   -9.00300  1.000 95.36737  ? 861  ASN A O     1 
ATOM   6400  C  CB    . ASN A 1 861  ? -30.73200 5.22400   -6.31700  1.000 104.63670 ? 861  ASN A CB    1 
ATOM   6401  C  CG    . ASN A 1 861  ? -30.69200 4.20000   -5.19900  1.000 105.43663 ? 861  ASN A CG    1 
ATOM   6402  O  OD1   . ASN A 1 861  ? -29.62000 3.79800   -4.74700  1.000 104.37079 ? 861  ASN A OD1   1 
ATOM   6403  N  ND2   . ASN A 1 861  ? -31.86500 3.76700   -4.75000  1.000 108.01522 ? 861  ASN A ND2   1 
ATOM   6404  N  N     . ASP A 1 862  ? -29.96200 6.21100   -9.50900  1.000 101.28157 ? 862  ASP A N     1 
ATOM   6405  C  CA    . ASP A 1 862  ? -30.37700 7.00600   -10.65700 1.000 101.77334 ? 862  ASP A CA    1 
ATOM   6406  C  C     . ASP A 1 862  ? -30.66300 6.15500   -11.88600 1.000 105.81304 ? 862  ASP A C     1 
ATOM   6407  O  O     . ASP A 1 862  ? -31.03400 6.70500   -12.92900 1.000 104.71102 ? 862  ASP A O     1 
ATOM   6408  C  CB    . ASP A 1 862  ? -29.31200 8.05500   -10.99300 1.000 107.74834 ? 862  ASP A CB    1 
ATOM   6409  C  CG    . ASP A 1 862  ? -27.98800 7.43500   -11.38900 1.000 115.82000 ? 862  ASP A CG    1 
ATOM   6410  O  OD1   . ASP A 1 862  ? -27.64800 6.36200   -10.84800 1.000 118.23977 ? 862  ASP A OD1   1 
ATOM   6411  O  OD2   . ASP A 1 862  ? -27.28600 8.02100   -12.24000 1.000 111.82967 ? 862  ASP A OD2   1 
ATOM   6412  N  N     . GLY A 1 863  ? -30.50100 4.83500   -11.79100 1.000 107.07882 ? 863  GLY A N     1 
ATOM   6413  C  CA    . GLY A 1 863  ? -30.77000 3.93200   -12.88700 1.000 103.74882 ? 863  GLY A CA    1 
ATOM   6414  C  C     . GLY A 1 863  ? -29.55300 3.51400   -13.68400 1.000 101.70115 ? 863  GLY A C     1 
ATOM   6415  O  O     . GLY A 1 863  ? -29.64200 2.55100   -14.45600 1.000 98.82320  ? 863  GLY A O     1 
ATOM   6416  N  N     . ARG A 1 864  ? -28.42600 4.20100   -13.51900 1.000 105.44596 ? 864  ARG A N     1 
ATOM   6417  C  CA    . ARG A 1 864  ? -27.23100 3.89800   -14.29500 1.000 100.32663 ? 864  ARG A CA    1 
ATOM   6418  C  C     . ARG A 1 864  ? -26.56400 2.63300   -13.77000 1.000 100.72145 ? 864  ARG A C     1 
ATOM   6419  O  O     . ARG A 1 864  ? -26.40300 2.46000   -12.55800 1.000 101.28202 ? 864  ARG A O     1 
ATOM   6420  C  CB    . ARG A 1 864  ? -26.25400 5.07200   -14.24600 1.000 96.90174  ? 864  ARG A CB    1 
ATOM   6421  C  CG    . ARG A 1 864  ? -25.09700 4.95600   -15.22600 1.000 105.84417 ? 864  ARG A CG    1 
ATOM   6422  C  CD    . ARG A 1 864  ? -24.19000 6.17900   -15.18000 1.000 115.37311 ? 864  ARG A CD    1 
ATOM   6423  N  NE    . ARG A 1 864  ? -24.89100 7.41000   -15.53700 1.000 119.64179 ? 864  ARG A NE    1 
ATOM   6424  C  CZ    . ARG A 1 864  ? -25.31500 8.31400   -14.65900 1.000 121.05898 ? 864  ARG A CZ    1 
ATOM   6425  N  NH1   . ARG A 1 864  ? -25.10700 8.12900   -13.36200 1.000 112.90033 ? 864  ARG A NH1   1 
ATOM   6426  N  NH2   . ARG A 1 864  ? -25.94500 9.40300   -15.07700 1.000 116.08342 ? 864  ARG A NH2   1 
ATOM   6427  N  N     . ILE A 1 865  ? -26.17900 1.75000   -14.68700 1.000 102.72449 ? 865  ILE A N     1 
ATOM   6428  C  CA    . ILE A 1 865  ? -25.50300 0.50100   -14.35500 1.000 96.51666  ? 865  ILE A CA    1 
ATOM   6429  C  C     . ILE A 1 865  ? -24.01600 0.67000   -14.62900 1.000 98.15688  ? 865  ILE A C     1 
ATOM   6430  O  O     . ILE A 1 865  ? -23.62000 1.04400   -15.74000 1.000 100.77282 ? 865  ILE A O     1 
ATOM   6431  C  CB    . ILE A 1 865  ? -26.08000 -0.67600  -15.16000 1.000 91.12256  ? 865  ILE A CB    1 
ATOM   6432  C  CG1   . ILE A 1 865  ? -27.57300 -0.84200  -14.87200 1.000 93.61308  ? 865  ILE A CG1   1 
ATOM   6433  C  CG2   . ILE A 1 865  ? -25.32400 -1.95800  -14.84400 1.000 84.81308  ? 865  ILE A CG2   1 
ATOM   6434  C  CD1   . ILE A 1 865  ? -28.21400 -1.99100  -15.61700 1.000 89.52930  ? 865  ILE A CD1   1 
ATOM   6435  N  N     . LEU A 1 866  ? -23.19200 0.39800   -13.61800 1.000 96.39044  ? 866  LEU A N     1 
ATOM   6436  C  CA    . LEU A 1 866  ? -21.74300 0.48700   -13.74800 1.000 96.13184  ? 866  LEU A CA    1 
ATOM   6437  C  C     . LEU A 1 866  ? -21.08200 -0.88100  -13.86600 1.000 89.61974  ? 866  LEU A C     1 
ATOM   6438  O  O     . LEU A 1 866  ? -20.30000 -1.11300  -14.79100 1.000 97.17609  ? 866  LEU A O     1 
ATOM   6439  C  CB    . LEU A 1 866  ? -21.14700 1.24900   -12.55800 1.000 98.78424  ? 866  LEU A CB    1 
ATOM   6440  C  CG    . LEU A 1 866  ? -21.52100 2.72500   -12.40900 1.000 99.20512  ? 866  LEU A CG    1 
ATOM   6441  C  CD1   . LEU A 1 866  ? -20.59500 3.40700   -11.41300 1.000 98.10160  ? 866  LEU A CD1   1 
ATOM   6442  C  CD2   . LEU A 1 866  ? -21.48500 3.43400   -13.75500 1.000 102.30625 ? 866  LEU A CD2   1 
ATOM   6443  N  N     . ALA A 1 867  ? -21.38300 -1.79100  -12.94500 1.000 85.98262  ? 867  ALA A N     1 
ATOM   6444  C  CA    . ALA A 1 867  ? -20.79200 -3.12200  -12.92500 1.000 96.88392  ? 867  ALA A CA    1 
ATOM   6445  C  C     . ALA A 1 867  ? -21.82200 -4.14600  -13.37900 1.000 98.00405  ? 867  ALA A C     1 
ATOM   6446  O  O     . ALA A 1 867  ? -22.96300 -4.13700  -12.90400 1.000 102.90659 ? 867  ALA A O     1 
ATOM   6447  C  CB    . ALA A 1 867  ? -20.27900 -3.47100  -11.52600 1.000 104.92330 ? 867  ALA A CB    1 
ATOM   6448  N  N     . LEU A 1 868  ? -21.41700 -5.02400  -14.29400 1.000 91.68355  ? 868  LEU A N     1 
ATOM   6449  C  CA    . LEU A 1 868  ? -22.30300 -6.07500  -14.79100 1.000 93.68212  ? 868  LEU A CA    1 
ATOM   6450  C  C     . LEU A 1 868  ? -21.46000 -7.29700  -15.12500 1.000 93.48632  ? 868  LEU A C     1 
ATOM   6451  O  O     . LEU A 1 868  ? -20.63700 -7.25100  -16.04400 1.000 89.28743  ? 868  LEU A O     1 
ATOM   6452  C  CB    . LEU A 1 868  ? -23.09000 -5.60500  -16.01200 1.000 94.14432  ? 868  LEU A CB    1 
ATOM   6453  C  CG    . LEU A 1 868  ? -23.99400 -6.66300  -16.65200 1.000 94.19446  ? 868  LEU A CG    1 
ATOM   6454  C  CD1   . LEU A 1 868  ? -25.00300 -7.19700  -15.64600 1.000 91.29186  ? 868  LEU A CD1   1 
ATOM   6455  C  CD2   . LEU A 1 868  ? -24.69800 -6.11000  -17.88000 1.000 80.53859  ? 868  LEU A CD2   1 
ATOM   6456  N  N     . ASP A 1 869  ? -21.66400 -8.37800  -14.37900 1.000 95.17159  ? 869  ASP A N     1 
ATOM   6457  C  CA    . ASP A 1 869  ? -21.06400 -9.66900  -14.68000 1.000 93.18100  ? 869  ASP A CA    1 
ATOM   6458  C  C     . ASP A 1 869  ? -22.11900 -10.56200 -15.31900 1.000 100.54306 ? 869  ASP A C     1 
ATOM   6459  O  O     . ASP A 1 869  ? -23.26300 -10.61200 -14.85800 1.000 100.57634 ? 869  ASP A O     1 
ATOM   6460  C  CB    . ASP A 1 869  ? -20.49900 -10.32000 -13.41500 1.000 93.22549  ? 869  ASP A CB    1 
ATOM   6461  C  CG    . ASP A 1 869  ? -20.08300 -11.76400 -13.63200 1.000 101.26119 ? 869  ASP A CG    1 
ATOM   6462  O  OD1   . ASP A 1 869  ? -20.95900 -12.65500 -13.59800 1.000 102.58761 ? 869  ASP A OD1   1 
ATOM   6463  O  OD2   . ASP A 1 869  ? -18.87500 -12.00700 -13.83800 1.000 103.13732 ? 869  ASP A OD2   1 
ATOM   6464  N  N     . MET A 1 870  ? -21.73400 -11.26200 -16.38300 1.000 101.01801 ? 870  MET A N     1 
ATOM   6465  C  CA    . MET A 1 870  ? -22.68400 -12.01300 -17.19200 1.000 96.72305  ? 870  MET A CA    1 
ATOM   6466  C  C     . MET A 1 870  ? -22.16900 -13.41800 -17.46600 1.000 96.27173  ? 870  MET A C     1 
ATOM   6467  O  O     . MET A 1 870  ? -20.97000 -13.62300 -17.67800 1.000 97.83289  ? 870  MET A O     1 
ATOM   6468  C  CB    . MET A 1 870  ? -22.96000 -11.29500 -18.51800 1.000 94.51182  ? 870  MET A CB    1 
ATOM   6469  C  CG    . MET A 1 870  ? -24.16700 -11.82500 -19.26500 1.000 97.36451  ? 870  MET A CG    1 
ATOM   6470  S  SD    . MET A 1 870  ? -25.70500 -11.49600 -18.38900 1.000 99.30622  ? 870  MET A SD    1 
ATOM   6471  C  CE    . MET A 1 870  ? -25.78200 -9.70900  -18.49300 1.000 97.28712  ? 870  MET A CE    1 
ATOM   6472  N  N     . GLU A 1 871  ? -23.09000 -14.38100 -17.46300 1.000 92.48125  ? 871  GLU A N     1 
ATOM   6473  C  CA    . GLU A 1 871  ? -22.80700 -15.76000 -17.83800 1.000 89.15430  ? 871  GLU A CA    1 
ATOM   6474  C  C     . GLU A 1 871  ? -23.85600 -16.21700 -18.83900 1.000 89.08084  ? 871  GLU A C     1 
ATOM   6475  O  O     . GLU A 1 871  ? -25.05800 -16.10900 -18.57500 1.000 89.48944  ? 871  GLU A O     1 
ATOM   6476  C  CB    . GLU A 1 871  ? -22.80400 -16.68900 -16.61900 1.000 88.73532  ? 871  GLU A CB    1 
ATOM   6477  C  CG    . GLU A 1 871  ? -21.58400 -16.55600 -15.72400 1.000 92.65379  ? 871  GLU A CG    1 
ATOM   6478  C  CD    . GLU A 1 871  ? -21.61200 -17.52700 -14.55800 1.000 101.06100 ? 871  GLU A CD    1 
ATOM   6479  O  OE1   . GLU A 1 871  ? -22.71700 -17.96000 -14.16800 1.000 97.44425  ? 871  GLU A OE1   1 
ATOM   6480  O  OE2   . GLU A 1 871  ? -20.52800 -17.86000 -14.03300 1.000 106.21905 ? 871  GLU A OE2   1 
ATOM   6481  N  N     . HIS A 1 872  ? -23.40500 -16.72200 -19.98400 1.000 88.38376  ? 872  HIS A N     1 
ATOM   6482  C  CA    . HIS A 1 872  ? -24.28800 -17.23100 -21.02300 1.000 82.94897  ? 872  HIS A CA    1 
ATOM   6483  C  C     . HIS A 1 872  ? -24.15900 -18.74400 -21.12100 1.000 83.80220  ? 872  HIS A C     1 
ATOM   6484  O  O     . HIS A 1 872  ? -23.04900 -19.28600 -21.09800 1.000 91.20655  ? 872  HIS A O     1 
ATOM   6485  C  CB    . HIS A 1 872  ? -23.97200 -16.60100 -22.38300 1.000 86.19067  ? 872  HIS A CB    1 
ATOM   6486  C  CG    . HIS A 1 872  ? -24.37900 -15.16600 -22.49600 1.000 84.85575  ? 872  HIS A CG    1 
ATOM   6487  N  ND1   . HIS A 1 872  ? -24.27900 -14.45500 -23.67300 1.000 89.82286  ? 872  HIS A ND1   1 
ATOM   6488  C  CD2   . HIS A 1 872  ? -24.88200 -14.30600 -21.57900 1.000 75.91335  ? 872  HIS A CD2   1 
ATOM   6489  C  CE1   . HIS A 1 872  ? -24.70500 -13.22100 -23.47700 1.000 83.37350  ? 872  HIS A CE1   1 
ATOM   6490  N  NE2   . HIS A 1 872  ? -25.07400 -13.10300 -22.21500 1.000 76.89765  ? 872  HIS A NE2   1 
ATOM   6491  N  N     . TYR A 1 873  ? -25.29900 -19.42100 -21.23200 1.000 83.18230  ? 873  TYR A N     1 
ATOM   6492  C  CA    . TYR A 1 873  ? -25.34200 -20.86500 -21.41100 1.000 83.59099  ? 873  TYR A CA    1 
ATOM   6493  C  C     . TYR A 1 873  ? -26.28800 -21.18600 -22.55600 1.000 79.78291  ? 873  TYR A C     1 
ATOM   6494  O  O     . TYR A 1 873  ? -27.41000 -20.67200 -22.59900 1.000 80.31560  ? 873  TYR A O     1 
ATOM   6495  C  CB    . TYR A 1 873  ? -25.79700 -21.57500 -20.13300 1.000 85.62791  ? 873  TYR A CB    1 
ATOM   6496  C  CG    . TYR A 1 873  ? -24.88800 -21.34600 -18.95100 1.000 86.09639  ? 873  TYR A CG    1 
ATOM   6497  C  CD1   . TYR A 1 873  ? -23.69900 -22.04900 -18.82200 1.000 86.73659  ? 873  TYR A CD1   1 
ATOM   6498  C  CD2   . TYR A 1 873  ? -25.22200 -20.43300 -17.95900 1.000 86.83145  ? 873  TYR A CD2   1 
ATOM   6499  C  CE1   . TYR A 1 873  ? -22.86400 -21.84400 -17.74500 1.000 87.51751  ? 873  TYR A CE1   1 
ATOM   6500  C  CE2   . TYR A 1 873  ? -24.39200 -20.22300 -16.87400 1.000 91.15832  ? 873  TYR A CE2   1 
ATOM   6501  C  CZ    . TYR A 1 873  ? -23.21400 -20.93200 -16.77200 1.000 93.13808  ? 873  TYR A CZ    1 
ATOM   6502  O  OH    . TYR A 1 873  ? -22.38100 -20.73000 -15.69500 1.000 99.81513  ? 873  TYR A OH    1 
ATOM   6503  N  N     . SER A 1 874  ? -25.83700 -22.02900 -23.48000 1.000 79.69107  ? 874  SER A N     1 
ATOM   6504  C  CA    . SER A 1 874  ? -26.62400 -22.42100 -24.64000 1.000 78.26965  ? 874  SER A CA    1 
ATOM   6505  C  C     . SER A 1 874  ? -26.78500 -23.93300 -24.65200 1.000 77.39228  ? 874  SER A C     1 
ATOM   6506  O  O     . SER A 1 874  ? -25.79700 -24.66800 -24.55400 1.000 80.32392  ? 874  SER A O     1 
ATOM   6507  C  CB    . SER A 1 874  ? -25.96500 -21.94700 -25.93900 1.000 84.05411  ? 874  SER A CB    1 
ATOM   6508  O  OG    . SER A 1 874  ? -24.71900 -22.58900 -26.14200 1.000 85.39226  ? 874  SER A OG    1 
ATOM   6509  N  N     . ASN A 1 875  ? -28.03000 -24.39200 -24.76600 1.000 79.58379  ? 875  ASN A N     1 
ATOM   6510  C  CA    . ASN A 1 875  ? -28.32900 -25.81800 -24.88800 1.000 72.65280  ? 875  ASN A CA    1 
ATOM   6511  C  C     . ASN A 1 875  ? -28.00700 -26.23000 -26.31900 1.000 79.50654  ? 875  ASN A C     1 
ATOM   6512  O  O     . ASN A 1 875  ? -28.85200 -26.17600 -27.21300 1.000 85.21709  ? 875  ASN A O     1 
ATOM   6513  C  CB    . ASN A 1 875  ? -29.78300 -26.09700 -24.52700 1.000 68.00502  ? 875  ASN A CB    1 
ATOM   6514  C  CG    . ASN A 1 875  ? -30.05200 -27.56900 -24.27500 1.000 81.53778  ? 875  ASN A CG    1 
ATOM   6515  O  OD1   . ASN A 1 875  ? -29.46900 -28.44000 -24.92100 1.000 81.03492  ? 875  ASN A OD1   1 
ATOM   6516  N  ND2   . ASN A 1 875  ? -30.94200 -27.85400 -23.33000 1.000 82.93789  ? 875  ASN A ND2   1 
ATOM   6517  N  N     . ALA A 1 876  ? -26.75900 -26.65100 -26.53500 1.000 78.74915  ? 876  ALA A N     1 
ATOM   6518  C  CA    . ALA A 1 876  ? -26.28100 -26.91200 -27.88700 1.000 77.19122  ? 876  ALA A CA    1 
ATOM   6519  C  C     . ALA A 1 876  ? -26.84700 -28.19500 -28.48000 1.000 79.86711  ? 876  ALA A C     1 
ATOM   6520  O  O     . ALA A 1 876  ? -26.89300 -28.32500 -29.70800 1.000 89.13637  ? 876  ALA A O     1 
ATOM   6521  C  CB    . ALA A 1 876  ? -24.75400 -26.96500 -27.90100 1.000 81.08687  ? 876  ALA A CB    1 
ATOM   6522  N  N     . GLY A 1 877  ? -27.27200 -29.14100 -27.64900 1.000 78.11428  ? 877  GLY A N     1 
ATOM   6523  C  CA    . GLY A 1 877  ? -27.81800 -30.38300 -28.15800 1.000 76.54217  ? 877  GLY A CA    1 
ATOM   6524  C  C     . GLY A 1 877  ? -26.86100 -31.55400 -28.07100 1.000 79.76233  ? 877  GLY A C     1 
ATOM   6525  O  O     . GLY A 1 877  ? -26.05200 -31.63700 -27.14300 1.000 89.13455  ? 877  GLY A O     1 
ATOM   6526  N  N     . ALA A 1 878  ? -26.94000 -32.46600 -29.04100 1.000 79.54536  ? 878  ALA A N     1 
ATOM   6527  C  CA    . ALA A 1 878  ? -26.14600 -33.68600 -28.96200 1.000 77.17546  ? 878  ALA A CA    1 
ATOM   6528  C  C     . ALA A 1 878  ? -24.68600 -33.44000 -29.32100 1.000 89.77481  ? 878  ALA A C     1 
ATOM   6529  O  O     . ALA A 1 878  ? -23.79400 -34.07400 -28.74400 1.000 94.60649  ? 878  ALA A O     1 
ATOM   6530  C  CB    . ALA A 1 878  ? -26.74500 -34.76300 -29.86800 1.000 75.95573  ? 878  ALA A CB    1 
ATOM   6531  N  N     . SER A 1 879  ? -24.41900 -32.53200 -30.25500 1.000 88.76087  ? 879  SER A N     1 
ATOM   6532  C  CA    . SER A 1 879  ? -23.06100 -32.27300 -30.70600 1.000 92.90885  ? 879  SER A CA    1 
ATOM   6533  C  C     . SER A 1 879  ? -22.85100 -30.77400 -30.86200 1.000 97.87241  ? 879  SER A C     1 
ATOM   6534  O  O     . SER A 1 879  ? -23.80200 -30.00000 -30.98700 1.000 92.85813  ? 879  SER A O     1 
ATOM   6535  C  CB    . SER A 1 879  ? -22.76200 -32.99300 -32.02600 1.000 98.81734  ? 879  SER A CB    1 
ATOM   6536  O  OG    . SER A 1 879  ? -21.54600 -32.53700 -32.59000 1.000 100.28798 ? 879  SER A OG    1 
ATOM   6537  N  N     . LEU A 1 880  ? -21.58200 -30.37600 -30.85600 1.000 104.14011 ? 880  LEU A N     1 
ATOM   6538  C  CA    . LEU A 1 880  ? -21.21800 -28.96800 -30.96400 1.000 100.02424 ? 880  LEU A CA    1 
ATOM   6539  C  C     . LEU A 1 880  ? -20.67300 -28.64900 -32.35200 1.000 97.25169  ? 880  LEU A C     1 
ATOM   6540  O  O     . LEU A 1 880  ? -19.77400 -27.82200 -32.50100 1.000 98.84055  ? 880  LEU A O     1 
ATOM   6541  C  CB    . LEU A 1 880  ? -20.18500 -28.59400 -29.89700 1.000 95.09983  ? 880  LEU A CB    1 
ATOM   6542  C  CG    . LEU A 1 880  ? -20.35400 -29.17700 -28.49000 1.000 92.72476  ? 880  LEU A CG    1 
ATOM   6543  C  CD1   . LEU A 1 880  ? -19.31700 -28.59200 -27.54400 1.000 98.63786  ? 880  LEU A CD1   1 
ATOM   6544  C  CD2   . LEU A 1 880  ? -21.75600 -28.93400 -27.95600 1.000 89.94761  ? 880  LEU A CD2   1 
ATOM   6545  N  N     . SER A 1 883  ? -21.30500 -24.06500 -32.94200 1.000 103.76853 ? 883  SER A N     1 
ATOM   6546  C  CA    . SER A 1 883  ? -21.95300 -23.75300 -31.67300 1.000 117.29910 ? 883  SER A CA    1 
ATOM   6547  C  C     . SER A 1 883  ? -21.16000 -22.70100 -30.90600 1.000 119.21107 ? 883  SER A C     1 
ATOM   6548  O  O     . SER A 1 883  ? -21.72800 -21.90200 -30.16000 1.000 111.80498 ? 883  SER A O     1 
ATOM   6549  C  CB    . SER A 1 883  ? -22.11700 -25.01700 -30.82800 1.000 113.96377 ? 883  SER A CB    1 
ATOM   6550  O  OG    . SER A 1 883  ? -23.38600 -25.61100 -31.04600 1.000 111.78566 ? 883  SER A OG    1 
ATOM   6551  N  N     . LEU A 1 884  ? -19.83800 -22.71300 -31.09000 1.000 116.99564 ? 884  LEU A N     1 
ATOM   6552  C  CA    . LEU A 1 884  ? -19.00900 -21.65200 -30.52700 1.000 112.10426 ? 884  LEU A CA    1 
ATOM   6553  C  C     . LEU A 1 884  ? -19.34800 -20.30600 -31.15400 1.000 110.68341 ? 884  LEU A C     1 
ATOM   6554  O  O     . LEU A 1 884  ? -19.35300 -19.27700 -30.47000 1.000 106.79349 ? 884  LEU A O     1 
ATOM   6555  C  CB    . LEU A 1 884  ? -17.52900 -21.97800 -30.72600 1.000 111.71100 ? 884  LEU A CB    1 
ATOM   6556  C  CG    . LEU A 1 884  ? -16.61800 -21.90100 -29.50000 1.000 109.84681 ? 884  LEU A CG    1 
ATOM   6557  C  CD1   . LEU A 1 884  ? -17.17400 -22.73600 -28.35900 1.000 98.34238  ? 884  LEU A CD1   1 
ATOM   6558  C  CD2   . LEU A 1 884  ? -15.21500 -22.35300 -29.86300 1.000 102.55196 ? 884  LEU A CD2   1 
ATOM   6559  N  N     . PHE A 1 885  ? -19.64800 -20.30000 -32.45600 1.000 111.72561 ? 885  PHE A N     1 
ATOM   6560  C  CA    . PHE A 1 885  ? -19.95200 -19.05400 -33.15400 1.000 106.58196 ? 885  PHE A CA    1 
ATOM   6561  C  C     . PHE A 1 885  ? -21.19100 -18.37600 -32.58300 1.000 105.09173 ? 885  PHE A C     1 
ATOM   6562  O  O     . PHE A 1 885  ? -21.26400 -17.14200 -32.55300 1.000 102.51584 ? 885  PHE A O     1 
ATOM   6563  C  CB    . PHE A 1 885  ? -20.14200 -19.31300 -34.65100 1.000 110.31710 ? 885  PHE A CB    1 
ATOM   6564  C  CG    . PHE A 1 885  ? -19.09100 -20.20700 -35.26800 1.000 121.92057 ? 885  PHE A CG    1 
ATOM   6565  C  CD1   . PHE A 1 885  ? -17.80200 -20.27000 -34.75400 1.000 125.35148 ? 885  PHE A CD1   1 
ATOM   6566  C  CD2   . PHE A 1 885  ? -19.40500 -20.99500 -36.36300 1.000 121.79396 ? 885  PHE A CD2   1 
ATOM   6567  C  CE1   . PHE A 1 885  ? -16.85200 -21.09300 -35.32600 1.000 124.60417 ? 885  PHE A CE1   1 
ATOM   6568  C  CE2   . PHE A 1 885  ? -18.45900 -21.82000 -36.93800 1.000 121.18703 ? 885  PHE A CE2   1 
ATOM   6569  C  CZ    . PHE A 1 885  ? -17.18100 -21.86900 -36.41900 1.000 116.64555 ? 885  PHE A CZ    1 
ATOM   6570  N  N     . VAL A 1 886  ? -22.17300 -19.16200 -32.13400 1.000 102.15999 ? 886  VAL A N     1 
ATOM   6571  C  CA    . VAL A 1 886  ? -23.35800 -18.59000 -31.49900 1.000 100.84553 ? 886  VAL A CA    1 
ATOM   6572  C  C     . VAL A 1 886  ? -22.97600 -17.89700 -30.19700 1.000 100.65396 ? 886  VAL A C     1 
ATOM   6573  O  O     . VAL A 1 886  ? -23.44500 -16.78900 -29.90300 1.000 100.15227 ? 886  VAL A O     1 
ATOM   6574  C  CB    . VAL A 1 886  ? -24.42000 -19.68400 -31.27400 1.000 96.70908  ? 886  VAL A CB    1 
ATOM   6575  C  CG1   . VAL A 1 886  ? -25.39600 -19.28300 -30.17400 1.000 92.80705  ? 886  VAL A CG1   1 
ATOM   6576  C  CG2   . VAL A 1 886  ? -25.16300 -19.98000 -32.57100 1.000 94.33002  ? 886  VAL A CG2   1 
ATOM   6577  N  N     . ILE A 1 887  ? -22.11200 -18.53100 -29.40300 1.000 101.30017 ? 887  ILE A N     1 
ATOM   6578  C  CA    . ILE A 1 887  ? -21.65500 -17.91800 -28.16000 1.000 96.76469  ? 887  ILE A CA    1 
ATOM   6579  C  C     . ILE A 1 887  ? -20.80800 -16.68500 -28.45500 1.000 95.76501  ? 887  ILE A C     1 
ATOM   6580  O  O     . ILE A 1 887  ? -20.94600 -15.64900 -27.79300 1.000 97.65606  ? 887  ILE A O     1 
ATOM   6581  C  CB    . ILE A 1 887  ? -20.89000 -18.95000 -27.30900 1.000 93.72379  ? 887  ILE A CB    1 
ATOM   6582  C  CG1   . ILE A 1 887  ? -21.85300 -19.98700 -26.72300 1.000 91.34960  ? 887  ILE A CG1   1 
ATOM   6583  C  CG2   . ILE A 1 887  ? -20.11600 -18.26500 -26.19200 1.000 89.38981  ? 887  ILE A CG2   1 
ATOM   6584  C  CD1   . ILE A 1 887  ? -23.10700 -19.39800 -26.11300 1.000 84.46252  ? 887  ILE A CD1   1 
ATOM   6585  N  N     . GLU A 1 888  ? -19.93200 -16.77200 -29.45900 1.000 96.06668  ? 888  GLU A N     1 
ATOM   6586  C  CA    . GLU A 1 888  ? -19.10400 -15.63000 -29.83900 1.000 91.52899  ? 888  GLU A CA    1 
ATOM   6587  C  C     . GLU A 1 888  ? -19.96600 -14.43600 -30.23100 1.000 92.98180  ? 888  GLU A C     1 
ATOM   6588  O  O     . GLU A 1 888  ? -19.87900 -13.36100 -29.62500 1.000 95.28016  ? 888  GLU A O     1 
ATOM   6589  C  CB    . GLU A 1 888  ? -18.17400 -16.01500 -30.99000 1.000 98.23080  ? 888  GLU A CB    1 
ATOM   6590  C  CG    . GLU A 1 888  ? -17.17600 -17.09800 -30.64900 1.000 101.72370 ? 888  GLU A CG    1 
ATOM   6591  C  CD    . GLU A 1 888  ? -16.16900 -17.33400 -31.75400 1.000 110.62984 ? 888  GLU A CD    1 
ATOM   6592  O  OE1   . GLU A 1 888  ? -16.31100 -16.71200 -32.82700 1.000 109.71238 ? 888  GLU A OE1   1 
ATOM   6593  O  OE2   . GLU A 1 888  ? -15.23700 -18.13900 -31.54900 1.000 112.87623 ? 888  GLU A OE2   1 
ATOM   6594  N  N     . MET A 1 889  ? -20.81000 -14.61100 -31.25000 1.000 94.18190  ? 889  MET A N     1 
ATOM   6595  C  CA    . MET A 1 889  ? -21.70700 -13.54500 -31.68100 1.000 98.52976  ? 889  MET A CA    1 
ATOM   6596  C  C     . MET A 1 889  ? -22.64900 -13.10400 -30.56900 1.000 94.54529  ? 889  MET A C     1 
ATOM   6597  O  O     . MET A 1 889  ? -23.16200 -11.98000 -30.61500 1.000 91.99481  ? 889  MET A O     1 
ATOM   6598  C  CB    . MET A 1 889  ? -22.50900 -14.00200 -32.90100 1.000 100.43243 ? 889  MET A CB    1 
ATOM   6599  C  CG    . MET A 1 889  ? -21.66400 -14.24500 -34.14300 1.000 99.11951  ? 889  MET A CG    1 
ATOM   6600  S  SD    . MET A 1 889  ? -20.92600 -12.74300 -34.81600 1.000 102.15856 ? 889  MET A SD    1 
ATOM   6601  C  CE    . MET A 1 889  ? -22.08400 -12.35100 -36.12600 1.000 101.34003 ? 889  MET A CE    1 
ATOM   6602  N  N     . GLY A 1 890  ? -22.88800 -13.95900 -29.57400 1.000 90.42768  ? 890  GLY A N     1 
ATOM   6603  C  CA    . GLY A 1 890  ? -23.70600 -13.54800 -28.44500 1.000 94.77897  ? 890  GLY A CA    1 
ATOM   6604  C  C     . GLY A 1 890  ? -23.00800 -12.52600 -27.56700 1.000 93.49632  ? 890  GLY A C     1 
ATOM   6605  O  O     . GLY A 1 890  ? -23.58000 -11.48600 -27.22800 1.000 93.01603  ? 890  GLY A O     1 
ATOM   6606  N  N     . LEU A 1 891  ? -21.75600 -12.80300 -27.19400 1.000 88.07110  ? 891  LEU A N     1 
ATOM   6607  C  CA    . LEU A 1 891  ? -21.02700 -11.88400 -26.32400 1.000 83.61923  ? 891  LEU A CA    1 
ATOM   6608  C  C     . LEU A 1 891  ? -20.73000 -10.56800 -27.03300 1.000 82.24550  ? 891  LEU A C     1 
ATOM   6609  O  O     . LEU A 1 891  ? -20.78000 -9.49900  -26.41500 1.000 82.99567  ? 891  LEU A O     1 
ATOM   6610  C  CB    . LEU A 1 891  ? -19.73000 -12.53100 -25.83500 1.000 83.17281  ? 891  LEU A CB    1 
ATOM   6611  C  CG    . LEU A 1 891  ? -19.78500 -13.95600 -25.27900 1.000 79.48744  ? 891  LEU A CG    1 
ATOM   6612  C  CD1   . LEU A 1 891  ? -18.47100 -14.31100 -24.59900 1.000 84.10656  ? 891  LEU A CD1   1 
ATOM   6613  C  CD2   . LEU A 1 891  ? -20.95200 -14.13800 -24.32300 1.000 82.32537  ? 891  LEU A CD2   1 
ATOM   6614  N  N     . LEU A 1 892  ? -20.41800 -10.62500 -28.33000 1.000 81.20262  ? 892  LEU A N     1 
ATOM   6615  C  CA    . LEU A 1 892  ? -20.10200 -9.40700  -29.06700 1.000 79.69362  ? 892  LEU A CA    1 
ATOM   6616  C  C     . LEU A 1 892  ? -21.32500 -8.51600  -29.24300 1.000 85.19866  ? 892  LEU A C     1 
ATOM   6617  O  O     . LEU A 1 892  ? -21.18800 -7.29500  -29.36700 1.000 88.32902  ? 892  LEU A O     1 
ATOM   6618  C  CB    . LEU A 1 892  ? -19.50300 -9.75500  -30.43000 1.000 83.71354  ? 892  LEU A CB    1 
ATOM   6619  C  CG    . LEU A 1 892  ? -18.09200 -10.34900 -30.43900 1.000 83.82432  ? 892  LEU A CG    1 
ATOM   6620  C  CD1   . LEU A 1 892  ? -17.78900 -10.99400 -31.78400 1.000 86.28212  ? 892  LEU A CD1   1 
ATOM   6621  C  CD2   . LEU A 1 892  ? -17.05700 -9.28600  -30.10700 1.000 81.97973  ? 892  LEU A CD2   1 
ATOM   6622  N  N     . LYS A 1 893  ? -22.52400 -9.09500  -29.25500 1.000 83.23147  ? 893  LYS A N     1 
ATOM   6623  C  CA    . LYS A 1 893  ? -23.74500 -8.33000  -29.46500 1.000 84.27359  ? 893  LYS A CA    1 
ATOM   6624  C  C     . LYS A 1 893  ? -24.57900 -8.18300  -28.19900 1.000 83.76778  ? 893  LYS A C     1 
ATOM   6625  O  O     . LYS A 1 893  ? -25.69000 -7.64600  -28.26300 1.000 85.53549  ? 893  LYS A O     1 
ATOM   6626  C  CB    . LYS A 1 893  ? -24.58900 -8.96900  -30.56900 1.000 83.11828  ? 893  LYS A CB    1 
ATOM   6627  C  CG    . LYS A 1 893  ? -23.87200 -9.14300  -31.89600 1.000 89.37557  ? 893  LYS A CG    1 
ATOM   6628  C  CD    . LYS A 1 893  ? -24.86300 -9.47900  -32.99900 1.000 95.62046  ? 893  LYS A CD    1 
ATOM   6629  C  CE    . LYS A 1 893  ? -24.32400 -10.55400 -33.92600 1.000 97.40611  ? 893  LYS A CE    1 
ATOM   6630  N  NZ    . LYS A 1 893  ? -25.38300 -11.07500 -34.83400 1.000 92.29634  ? 893  LYS A NZ    1 
ATOM   6631  N  N     . MET A 1 894  ? -24.07500 -8.63900  -27.04900 1.000 83.96247  ? 894  MET A N     1 
ATOM   6632  C  CA    . MET A 1 894  ? -24.87400 -8.57800  -25.82900 1.000 84.74114  ? 894  MET A CA    1 
ATOM   6633  C  C     . MET A 1 894  ? -25.06800 -7.14700  -25.34500 1.000 86.68277  ? 894  MET A C     1 
ATOM   6634  O  O     . MET A 1 894  ? -26.06100 -6.85600  -24.66900 1.000 88.62089  ? 894  MET A O     1 
ATOM   6635  C  CB    . MET A 1 894  ? -24.23700 -9.42900  -24.72800 1.000 88.39389  ? 894  MET A CB    1 
ATOM   6636  C  CG    . MET A 1 894  ? -22.97400 -8.84200  -24.10300 1.000 91.23686  ? 894  MET A CG    1 
ATOM   6637  S  SD    . MET A 1 894  ? -23.29400 -7.76000  -22.69100 1.000 94.66819  ? 894  MET A SD    1 
ATOM   6638  C  CE    . MET A 1 894  ? -23.64800 -8.95200  -21.40500 1.000 87.46079  ? 894  MET A CE    1 
ATOM   6639  N  N     . ASP A 1 895  ? -24.14000 -6.24300  -25.67200 1.000 83.86092  ? 895  ASP A N     1 
ATOM   6640  C  CA    . ASP A 1 895  ? -24.23100 -4.87900  -25.16100 1.000 79.38920  ? 895  ASP A CA    1 
ATOM   6641  C  C     . ASP A 1 895  ? -25.46300 -4.15800  -25.69300 1.000 81.74598  ? 895  ASP A C     1 
ATOM   6642  O  O     . ASP A 1 895  ? -26.03000 -3.30800  -24.99600 1.000 80.98527  ? 895  ASP A O     1 
ATOM   6643  C  CB    . ASP A 1 895  ? -22.96400 -4.09900  -25.51200 1.000 77.61187  ? 895  ASP A CB    1 
ATOM   6644  C  CG    . ASP A 1 895  ? -22.72600 -4.01500  -27.00600 1.000 82.44383  ? 895  ASP A CG    1 
ATOM   6645  O  OD1   . ASP A 1 895  ? -22.96100 -5.02200  -27.70500 1.000 88.93254  ? 895  ASP A OD1   1 
ATOM   6646  O  OD2   . ASP A 1 895  ? -22.30500 -2.93900  -27.48100 1.000 85.64616  ? 895  ASP A OD2   1 
ATOM   6647  N  N     . ASN A 1 896  ? -25.89500 -4.49100  -26.91000 1.000 86.95733  ? 896  ASN A N     1 
ATOM   6648  C  CA    . ASN A 1 896  ? -27.05300 -3.87100  -27.56300 1.000 82.00226  ? 896  ASN A CA    1 
ATOM   6649  C  C     . ASN A 1 896  ? -26.80500 -2.36800  -27.62000 1.000 83.01745  ? 896  ASN A C     1 
ATOM   6650  O  O     . ASN A 1 896  ? -25.77700 -1.95500  -28.18300 1.000 81.81904  ? 896  ASN A O     1 
ATOM   6651  C  CB    . ASN A 1 896  ? -28.33200 -4.31100  -26.84900 1.000 75.10225  ? 896  ASN A CB    1 
ATOM   6652  C  CG    . ASN A 1 896  ? -29.58200 -3.97900  -27.63900 1.000 82.29031  ? 896  ASN A CG    1 
ATOM   6653  O  OD1   . ASN A 1 896  ? -29.51200 -3.65000  -28.82400 1.000 80.07515  ? 896  ASN A OD1   1 
ATOM   6654  N  ND2   . ASN A 1 896  ? -30.73500 -4.06100  -26.98600 1.000 80.40929  ? 896  ASN A ND2   1 
ATOM   6655  N  N     . ALA A 1 897  ? -27.67500 -1.52700  -27.06400 1.000 80.06600  ? 897  ALA A N     1 
ATOM   6656  C  CA    . ALA A 1 897  ? -27.51100 -0.08000  -27.12000 1.000 87.16677  ? 897  ALA A CA    1 
ATOM   6657  C  C     . ALA A 1 897  ? -27.16000 0.51000   -25.75700 1.000 85.62134  ? 897  ALA A C     1 
ATOM   6658  O  O     . ALA A 1 897  ? -27.59000 1.61600   -25.42500 1.000 84.88524  ? 897  ALA A O     1 
ATOM   6659  C  CB    . ALA A 1 897  ? -28.77400 0.57700   -27.67300 1.000 86.61044  ? 897  ALA A CB    1 
ATOM   6660  N  N     . TYR A 1 898  ? -26.37200 -0.21200  -24.96200 1.000 88.20878  ? 898  TYR A N     1 
ATOM   6661  C  CA    . TYR A 1 898  ? -26.04700 0.20000   -23.60400 1.000 88.57999  ? 898  TYR A CA    1 
ATOM   6662  C  C     . TYR A 1 898  ? -24.54000 0.19800   -23.40900 1.000 90.57770  ? 898  TYR A C     1 
ATOM   6663  O  O     . TYR A 1 898  ? -23.87600 -0.80800  -23.67500 1.000 90.17488  ? 898  TYR A O     1 
ATOM   6664  C  CB    . TYR A 1 898  ? -26.71700 -0.72000  -22.58000 1.000 82.15546  ? 898  TYR A CB    1 
ATOM   6665  C  CG    . TYR A 1 898  ? -28.17800 -0.96300  -22.86600 1.000 83.93173  ? 898  TYR A CG    1 
ATOM   6666  C  CD1   . TYR A 1 898  ? -29.09700 0.07600   -22.80500 1.000 83.06972  ? 898  TYR A CD1   1 
ATOM   6667  C  CD2   . TYR A 1 898  ? -28.63800 -2.22800  -23.20800 1.000 82.23486  ? 898  TYR A CD2   1 
ATOM   6668  C  CE1   . TYR A 1 898  ? -30.43300 -0.13800  -23.07000 1.000 82.46904  ? 898  TYR A CE1   1 
ATOM   6669  C  CE2   . TYR A 1 898  ? -29.97400 -2.45100  -23.47500 1.000 81.12235  ? 898  TYR A CE2   1 
ATOM   6670  C  CZ    . TYR A 1 898  ? -30.86600 -1.40200  -23.40400 1.000 80.00677  ? 898  TYR A CZ    1 
ATOM   6671  O  OH    . TYR A 1 898  ? -32.19600 -1.61500  -23.66500 1.000 77.02857  ? 898  TYR A OH    1 
ATOM   6672  N  N     . LYS A 1 899  ? -24.00800 1.32600   -22.94300 1.000 89.57178  ? 899  LYS A N     1 
ATOM   6673  C  CA    . LYS A 1 899  ? -22.58600 1.45600   -22.63500 1.000 87.82305  ? 899  LYS A CA    1 
ATOM   6674  C  C     . LYS A 1 899  ? -22.37100 0.99800   -21.19800 1.000 89.94621  ? 899  LYS A C     1 
ATOM   6675  O  O     . LYS A 1 899  ? -22.69300 1.71500   -20.24900 1.000 92.80633  ? 899  LYS A O     1 
ATOM   6676  C  CB    . LYS A 1 899  ? -22.11700 2.89200   -22.84300 1.000 83.18273  ? 899  LYS A CB    1 
ATOM   6677  C  CG    . LYS A 1 899  ? -20.70800 3.17500   -22.33400 1.000 83.16378  ? 899  LYS A CG    1 
ATOM   6678  C  CD    . LYS A 1 899  ? -19.69400 2.17900   -22.87900 1.000 95.64815  ? 899  LYS A CD    1 
ATOM   6679  C  CE    . LYS A 1 899  ? -18.33600 2.82900   -23.09200 1.000 97.39345  ? 899  LYS A CE    1 
ATOM   6680  N  NZ    . LYS A 1 899  ? -18.00000 3.79600   -22.01000 1.000 100.56973 ? 899  LYS A NZ    1 
ATOM   6681  N  N     . PHE A 1 900  ? -21.82900 -0.21000  -21.03900 1.000 88.47606  ? 900  PHE A N     1 
ATOM   6682  C  CA    . PHE A 1 900  ? -21.48700 -0.72700  -19.72200 1.000 92.46963  ? 900  PHE A CA    1 
ATOM   6683  C  C     . PHE A 1 900  ? -20.02600 -0.40700  -19.44200 1.000 99.80432  ? 900  PHE A C     1 
ATOM   6684  O  O     . PHE A 1 900  ? -19.14100 -1.03100  -20.04900 1.000 98.87263  ? 900  PHE A O     1 
ATOM   6685  C  CB    . PHE A 1 900  ? -21.73100 -2.22800  -19.65100 1.000 89.06116  ? 900  PHE A CB    1 
ATOM   6686  C  CG    . PHE A 1 900  ? -23.17600 -2.61500  -19.79400 1.000 88.78326  ? 900  PHE A CG    1 
ATOM   6687  C  CD1   . PHE A 1 900  ? -24.06000 -2.44300  -18.74200 1.000 87.69854  ? 900  PHE A CD1   1 
ATOM   6688  C  CD2   . PHE A 1 900  ? -23.64900 -3.15600  -20.97800 1.000 85.27827  ? 900  PHE A CD2   1 
ATOM   6689  C  CE1   . PHE A 1 900  ? -25.39000 -2.79800  -18.87000 1.000 83.92574  ? 900  PHE A CE1   1 
ATOM   6690  C  CE2   . PHE A 1 900  ? -24.97800 -3.51500  -21.11100 1.000 75.39911  ? 900  PHE A CE2   1 
ATOM   6691  C  CZ    . PHE A 1 900  ? -25.84900 -3.33600  -20.05600 1.000 80.53081  ? 900  PHE A CZ    1 
ATOM   6692  N  N     . PRO A 1 901  ? -19.72000 0.54600   -18.55600 1.000 100.54797 ? 901  PRO A N     1 
ATOM   6693  C  CA    . PRO A 1 901  ? -18.31200 0.92200   -18.34800 1.000 98.05458  ? 901  PRO A CA    1 
ATOM   6694  C  C     . PRO A 1 901  ? -17.46900 -0.19400  -17.75900 1.000 97.20915  ? 901  PRO A C     1 
ATOM   6695  O  O     . PRO A 1 901  ? -16.26800 -0.26400  -18.04800 1.000 101.89392 ? 901  PRO A O     1 
ATOM   6696  C  CB    . PRO A 1 901  ? -18.40500 2.12200   -17.39300 1.000 102.87941 ? 901  PRO A CB    1 
ATOM   6697  C  CG    . PRO A 1 901  ? -19.82500 2.60200   -17.50100 1.000 100.28438 ? 901  PRO A CG    1 
ATOM   6698  C  CD    . PRO A 1 901  ? -20.63800 1.37600   -17.76000 1.000 98.73878  ? 901  PRO A CD    1 
ATOM   6699  N  N     . ASN A 1 902  ? -18.05500 -1.06600  -16.94200 1.000 95.86148  ? 902  ASN A N     1 
ATOM   6700  C  CA    . ASN A 1 902  ? -17.34000 -2.17700  -16.31700 1.000 94.73921  ? 902  ASN A CA    1 
ATOM   6701  C  C     . ASN A 1 902  ? -18.14700 -3.44500  -16.57800 1.000 92.81192  ? 902  ASN A C     1 
ATOM   6702  O  O     . ASN A 1 902  ? -19.18400 -3.67000  -15.94600 1.000 94.94754  ? 902  ASN A O     1 
ATOM   6703  C  CB    . ASN A 1 902  ? -17.14300 -1.93100  -14.82500 1.000 98.70437  ? 902  ASN A CB    1 
ATOM   6704  C  CG    . ASN A 1 902  ? -16.61400 -0.54100  -14.53100 1.000 98.07000  ? 902  ASN A CG    1 
ATOM   6705  O  OD1   . ASN A 1 902  ? -17.32400 0.30300   -13.98300 1.000 96.50368  ? 902  ASN A OD1   1 
ATOM   6706  N  ND2   . ASN A 1 902  ? -15.36200 -0.29400  -14.89700 1.000 102.69566 ? 902  ASN A ND2   1 
ATOM   6707  N  N     . LEU A 1 903  ? -17.67000 -4.27200  -17.50500 1.000 98.37216  ? 903  LEU A N     1 
ATOM   6708  C  CA    . LEU A 1 903  ? -18.42500 -5.42500  -17.97100 1.000 95.19052  ? 903  LEU A CA    1 
ATOM   6709  C  C     . LEU A 1 903  ? -17.52300 -6.64600  -18.05700 1.000 89.43072  ? 903  LEU A C     1 
ATOM   6710  O  O     . LEU A 1 903  ? -16.39500 -6.56300  -18.55200 1.000 96.86241  ? 903  LEU A O     1 
ATOM   6711  C  CB    . LEU A 1 903  ? -19.05800 -5.14500  -19.34200 1.000 99.13133  ? 903  LEU A CB    1 
ATOM   6712  C  CG    . LEU A 1 903  ? -19.69600 -6.31200  -20.09900 1.000 95.16911  ? 903  LEU A CG    1 
ATOM   6713  C  CD1   . LEU A 1 903  ? -20.85800 -6.89800  -19.31400 1.000 96.90039  ? 903  LEU A CD1   1 
ATOM   6714  C  CD2   . LEU A 1 903  ? -20.14700 -5.86600  -21.48300 1.000 82.34265  ? 903  LEU A CD2   1 
ATOM   6715  N  N     . ARG A 1 904  ? -18.02600 -7.77500  -17.56200 1.000 89.20540  ? 904  ARG A N     1 
ATOM   6716  C  CA    . ARG A 1 904  ? -17.39400 -9.07600  -17.74200 1.000 92.55594  ? 904  ARG A CA    1 
ATOM   6717  C  C     . ARG A 1 904  ? -18.46600 -10.04600 -18.21300 1.000 96.60693  ? 904  ARG A C     1 
ATOM   6718  O  O     . ARG A 1 904  ? -19.45800 -10.26400 -17.51000 1.000 99.80019  ? 904  ARG A O     1 
ATOM   6719  C  CB    . ARG A 1 904  ? -16.74100 -9.57400  -16.44800 1.000 94.78025  ? 904  ARG A CB    1 
ATOM   6720  C  CG    . ARG A 1 904  ? -16.59300 -11.08900 -16.38000 1.000 95.82829  ? 904  ARG A CG    1 
ATOM   6721  C  CD    . ARG A 1 904  ? -15.34800 -11.51100 -15.61300 1.000 103.66963 ? 904  ARG A CD    1 
ATOM   6722  N  NE    . ARG A 1 904  ? -15.23300 -10.83700 -14.32400 1.000 116.43032 ? 904  ARG A NE    1 
ATOM   6723  C  CZ    . ARG A 1 904  ? -14.25900 -11.06400 -13.44800 1.000 116.01140 ? 904  ARG A CZ    1 
ATOM   6724  N  NH1   . ARG A 1 904  ? -13.31200 -11.95100 -13.72400 1.000 110.81323 ? 904  ARG A NH1   1 
ATOM   6725  N  NH2   . ARG A 1 904  ? -14.23100 -10.40600 -12.29700 1.000 110.66762 ? 904  ARG A NH2   1 
ATOM   6726  N  N     . CYS A 1 905  ? -18.27500 -10.61700 -19.40000 1.000 94.30345  ? 905  CYS A N     1 
ATOM   6727  C  CA    . CYS A 1 905  ? -19.28000 -11.46500 -20.03000 1.000 90.59857  ? 905  CYS A CA    1 
ATOM   6728  C  C     . CYS A 1 905  ? -18.64200 -12.78300 -20.43700 1.000 86.38595  ? 905  CYS A C     1 
ATOM   6729  O  O     . CYS A 1 905  ? -17.65400 -12.79300 -21.17800 1.000 85.97891  ? 905  CYS A O     1 
ATOM   6730  C  CB    . CYS A 1 905  ? -19.89900 -10.76900 -21.24400 1.000 93.71527  ? 905  CYS A CB    1 
ATOM   6731  S  SG    . CYS A 1 905  ? -21.35800 -11.58800 -21.91100 1.000 107.97692 ? 905  CYS A SG    1 
ATOM   6732  N  N     . ARG A 1 906  ? -19.21200 -13.88600 -19.96100 1.000 89.83798  ? 906  ARG A N     1 
ATOM   6733  C  CA    . ARG A 1 906  ? -18.72000 -15.22400 -20.24800 1.000 92.20841  ? 906  ARG A CA    1 
ATOM   6734  C  C     . ARG A 1 906  ? -19.82900 -16.05300 -20.88400 1.000 92.55893  ? 906  ARG A C     1 
ATOM   6735  O  O     . ARG A 1 906  ? -21.01900 -15.78000 -20.70200 1.000 92.66059  ? 906  ARG A O     1 
ATOM   6736  C  CB    . ARG A 1 906  ? -18.21000 -15.90900 -18.97300 1.000 91.43105  ? 906  ARG A CB    1 
ATOM   6737  C  CG    . ARG A 1 906  ? -17.01400 -15.21200 -18.34600 1.000 91.51189  ? 906  ARG A CG    1 
ATOM   6738  C  CD    . ARG A 1 906  ? -16.85700 -15.55700 -16.87400 1.000 93.45485  ? 906  ARG A CD    1 
ATOM   6739  N  NE    . ARG A 1 906  ? -15.77000 -16.50400 -16.64500 1.000 99.50903  ? 906  ARG A NE    1 
ATOM   6740  C  CZ    . ARG A 1 906  ? -15.73100 -17.36700 -15.63500 1.000 102.59969 ? 906  ARG A CZ    1 
ATOM   6741  N  NH1   . ARG A 1 906  ? -16.72200 -17.40500 -14.75400 1.000 98.63110  ? 906  ARG A NH1   1 
ATOM   6742  N  NH2   . ARG A 1 906  ? -14.70100 -18.19200 -15.50400 1.000 97.39848  ? 906  ARG A NH2   1 
ATOM   6743  N  N     . GLY A 1 907  ? -19.42800 -17.07000 -21.63200 1.000 92.25480  ? 907  GLY A N     1 
ATOM   6744  C  CA    . GLY A 1 907  ? -20.38400 -17.91600 -22.32700 1.000 84.39268  ? 907  GLY A CA    1 
ATOM   6745  C  C     . GLY A 1 907  ? -19.86300 -19.32600 -22.47600 1.000 85.75617  ? 907  GLY A C     1 
ATOM   6746  O  O     . GLY A 1 907  ? -18.65100 -19.55900 -22.53200 1.000 90.09012  ? 907  GLY A O     1 
ATOM   6747  N  N     . TRP A 1 908  ? -20.79300 -20.27600 -22.54600 1.000 83.08591  ? 908  TRP A N     1 
ATOM   6748  C  CA    . TRP A 1 908  ? -20.45600 -21.68400 -22.69600 1.000 85.99414  ? 908  TRP A CA    1 
ATOM   6749  C  C     . TRP A 1 908  ? -21.55300 -22.38300 -23.48600 1.000 86.17354  ? 908  TRP A C     1 
ATOM   6750  O  O     . TRP A 1 908  ? -22.68200 -21.89400 -23.58700 1.000 87.08101  ? 908  TRP A O     1 
ATOM   6751  C  CB    . TRP A 1 908  ? -20.26500 -22.37000 -21.33600 1.000 83.32084  ? 908  TRP A CB    1 
ATOM   6752  C  CG    . TRP A 1 908  ? -19.10900 -21.84800 -20.53400 1.000 90.22962  ? 908  TRP A CG    1 
ATOM   6753  C  CD1   . TRP A 1 908  ? -17.79300 -22.17700 -20.68200 1.000 99.40203  ? 908  TRP A CD1   1 
ATOM   6754  C  CD2   . TRP A 1 908  ? -19.16700 -20.90300 -19.45800 1.000 93.26518  ? 908  TRP A CD2   1 
ATOM   6755  N  NE1   . TRP A 1 908  ? -17.02800 -21.49800 -19.76500 1.000 94.32805  ? 908  TRP A NE1   1 
ATOM   6756  C  CE2   . TRP A 1 908  ? -17.84800 -20.70800 -19.00200 1.000 97.59520  ? 908  TRP A CE2   1 
ATOM   6757  C  CE3   . TRP A 1 908  ? -20.20400 -20.20100 -18.83800 1.000 93.92408  ? 908  TRP A CE3   1 
ATOM   6758  C  CZ2   . TRP A 1 908  ? -17.54000 -19.84300 -17.95400 1.000 98.22593  ? 908  TRP A CZ2   1 
ATOM   6759  C  CZ3   . TRP A 1 908  ? -19.89700 -19.34500 -17.79700 1.000 95.23275  ? 908  TRP A CZ3   1 
ATOM   6760  C  CH2   . TRP A 1 908  ? -18.57700 -19.17200 -17.36600 1.000 92.80311  ? 908  TRP A CH2   1 
ATOM   6761  N  N     . ALA A 1 909  ? -21.20400 -23.53700 -24.05000 1.000 81.12760  ? 909  ALA A N     1 
ATOM   6762  C  CA    . ALA A 1 909  ? -22.14100 -24.40000 -24.75600 1.000 76.86850  ? 909  ALA A CA    1 
ATOM   6763  C  C     . ALA A 1 909  ? -22.20400 -25.74600 -24.04800 1.000 79.50634  ? 909  ALA A C     1 
ATOM   6764  O  O     . ALA A 1 909  ? -21.17700 -26.27400 -23.61400 1.000 91.02136  ? 909  ALA A O     1 
ATOM   6765  C  CB    . ALA A 1 909  ? -21.73500 -24.58900 -26.22000 1.000 81.97313  ? 909  ALA A CB    1 
ATOM   6766  N  N     . CYS A 1 910  ? -23.40800 -26.30300 -23.94000 1.000 74.14878  ? 910  CYS A N     1 
ATOM   6767  C  CA    . CYS A 1 910  ? -23.65900 -27.46300 -23.09300 1.000 83.21863  ? 910  CYS A CA    1 
ATOM   6768  C  C     . CYS A 1 910  ? -24.19400 -28.61900 -23.92800 1.000 81.01511  ? 910  CYS A C     1 
ATOM   6769  O  O     . CYS A 1 910  ? -25.20500 -28.47200 -24.62400 1.000 79.82719  ? 910  CYS A O     1 
ATOM   6770  C  CB    . CYS A 1 910  ? -24.64200 -27.10900 -21.97600 1.000 82.43983  ? 910  CYS A CB    1 
ATOM   6771  S  SG    . CYS A 1 910  ? -24.09200 -25.75200 -20.91400 1.000 90.40271  ? 910  CYS A SG    1 
ATOM   6772  N  N     . ARG A 1 911  ? -23.52100 -29.76500 -23.84800 1.000 81.62298  ? 911  ARG A N     1 
ATOM   6773  C  CA    . ARG A 1 911  ? -24.01500 -30.97900 -24.48300 1.000 79.98297  ? 911  ARG A CA    1 
ATOM   6774  C  C     . ARG A 1 911  ? -25.22600 -31.51700 -23.73200 1.000 83.53522  ? 911  ARG A C     1 
ATOM   6775  O  O     . ARG A 1 911  ? -25.20400 -31.64400 -22.50400 1.000 83.17124  ? 911  ARG A O     1 
ATOM   6776  C  CB    . ARG A 1 911  ? -22.92100 -32.04500 -24.52500 1.000 89.19094  ? 911  ARG A CB    1 
ATOM   6777  C  CG    . ARG A 1 911  ? -22.14800 -32.12500 -25.82700 1.000 86.80235  ? 911  ARG A CG    1 
ATOM   6778  C  CD    . ARG A 1 911  ? -21.40300 -33.45300 -25.93700 1.000 93.66819  ? 911  ARG A CD    1 
ATOM   6779  N  NE    . ARG A 1 911  ? -22.28600 -34.56100 -26.30200 1.000 111.27197 ? 911  ARG A NE    1 
ATOM   6780  C  CZ    . ARG A 1 911  ? -22.86300 -35.38400 -25.43100 1.000 114.21894 ? 911  ARG A CZ    1 
ATOM   6781  N  NH1   . ARG A 1 911  ? -22.64900 -35.23900 -24.13000 1.000 104.48355 ? 911  ARG A NH1   1 
ATOM   6782  N  NH2   . ARG A 1 911  ? -23.65100 -36.36100 -25.86200 1.000 106.40373 ? 911  ARG A NH2   1 
ATOM   6783  N  N     . THR A 1 912  ? -26.28300 -31.83600 -24.47300 1.000 85.34058  ? 912  THR A N     1 
ATOM   6784  C  CA    . THR A 1 912  ? -27.46900 -32.47300 -23.92200 1.000 80.57884  ? 912  THR A CA    1 
ATOM   6785  C  C     . THR A 1 912  ? -27.87400 -33.63100 -24.82300 1.000 74.22109  ? 912  THR A C     1 
ATOM   6786  O  O     . THR A 1 912  ? -27.33300 -33.81700 -25.91500 1.000 80.23859  ? 912  THR A O     1 
ATOM   6787  C  CB    . THR A 1 912  ? -28.63300 -31.48100 -23.77300 1.000 78.33168  ? 912  THR A CB    1 
ATOM   6788  O  OG1   . THR A 1 912  ? -28.86500 -30.81900 -25.02300 1.000 75.63022  ? 912  THR A OG1   1 
ATOM   6789  C  CG2   . THR A 1 912  ? -28.32400 -30.44700 -22.69800 1.000 83.30709  ? 912  THR A CG2   1 
ATOM   6790  N  N     . ASN A 1 913  ? -28.83300 -34.41800 -24.35300 1.000 68.45030  ? 913  ASN A N     1 
ATOM   6791  C  CA    . ASN A 1 913  ? -29.35300 -35.54600 -25.12700 1.000 69.09415  ? 913  ASN A CA    1 
ATOM   6792  C  C     . ASN A 1 913  ? -30.60100 -35.14900 -25.90400 1.000 78.82046  ? 913  ASN A C     1 
ATOM   6793  O  O     . ASN A 1 913  ? -31.64100 -35.80700 -25.85300 1.000 79.51447  ? 913  ASN A O     1 
ATOM   6794  C  CB    . ASN A 1 913  ? -29.62200 -36.73300 -24.21100 1.000 73.41178  ? 913  ASN A CB    1 
ATOM   6795  C  CG    . ASN A 1 913  ? -28.34500 -37.41500 -23.75700 1.000 77.49454  ? 913  ASN A CG    1 
ATOM   6796  O  OD1   . ASN A 1 913  ? -27.98700 -37.36900 -22.58000 1.000 82.73088  ? 913  ASN A OD1   1 
ATOM   6797  N  ND2   . ASN A 1 913  ? -27.64500 -38.04400 -24.69400 1.000 83.59775  ? 913  ASN A ND2   1 
ATOM   6798  N  N     . LEU A 1 914  ? -30.49100 -34.04800 -26.63400 1.000 81.56929  ? 914  LEU A N     1 
ATOM   6799  C  CA    . LEU A 1 914  ? -31.52800 -33.50700 -27.49600 1.000 79.03445  ? 914  LEU A CA    1 
ATOM   6800  C  C     . LEU A 1 914  ? -30.93700 -33.28300 -28.87800 1.000 75.27254  ? 914  LEU A C     1 
ATOM   6801  O  O     . LEU A 1 914  ? -29.71200 -33.23700 -29.03400 1.000 77.46561  ? 914  LEU A O     1 
ATOM   6802  C  CB    . LEU A 1 914  ? -32.08000 -32.18900 -26.93300 1.000 72.83847  ? 914  LEU A CB    1 
ATOM   6803  C  CG    . LEU A 1 914  ? -32.71500 -32.25900 -25.54300 1.000 76.75434  ? 914  LEU A CG    1 
ATOM   6804  C  CD1   . LEU A 1 914  ? -33.13200 -30.87400 -25.07100 1.000 84.33064  ? 914  LEU A CD1   1 
ATOM   6805  C  CD2   . LEU A 1 914  ? -33.90200 -33.20800 -25.54500 1.000 82.67170  ? 914  LEU A CD2   1 
ATOM   6806  N  N     . PRO A 1 915  ? -31.77700 -33.16900 -29.91000 1.000 75.02672  ? 915  PRO A N     1 
ATOM   6807  C  CA    . PRO A 1 915  ? -31.25000 -32.90900 -31.25500 1.000 80.92862  ? 915  PRO A CA    1 
ATOM   6808  C  C     . PRO A 1 915  ? -30.41000 -31.64000 -31.29200 1.000 84.17183  ? 915  PRO A C     1 
ATOM   6809  O  O     . PRO A 1 915  ? -30.78100 -30.60900 -30.72600 1.000 84.28505  ? 915  PRO A O     1 
ATOM   6810  C  CB    . PRO A 1 915  ? -32.51400 -32.77700 -32.11100 1.000 81.36857  ? 915  PRO A CB    1 
ATOM   6811  C  CG    . PRO A 1 915  ? -33.53300 -33.58500 -31.39000 1.000 73.28241  ? 915  PRO A CG    1 
ATOM   6812  C  CD    . PRO A 1 915  ? -33.23000 -33.41700 -29.92800 1.000 77.53994  ? 915  PRO A CD    1 
ATOM   6813  N  N     . SER A 1 916  ? -29.26300 -31.73100 -31.96300 1.000 83.75304  ? 916  SER A N     1 
ATOM   6814  C  CA    . SER A 1 916  ? -28.32800 -30.61400 -32.01400 1.000 82.22990  ? 916  SER A CA    1 
ATOM   6815  C  C     . SER A 1 916  ? -28.94600 -29.43000 -32.74700 1.000 88.22972  ? 916  SER A C     1 
ATOM   6816  O  O     . SER A 1 916  ? -29.46500 -29.57100 -33.85800 1.000 95.22081  ? 916  SER A O     1 
ATOM   6817  C  CB    . SER A 1 916  ? -27.03000 -31.04300 -32.69700 1.000 83.99847  ? 916  SER A CB    1 
ATOM   6818  O  OG    . SER A 1 916  ? -27.23700 -31.29700 -34.07500 1.000 103.78434 ? 916  SER A OG    1 
ATOM   6819  N  N     . ASN A 1 917  ? -28.88300 -28.25900 -32.12000 1.000 89.01127  ? 917  ASN A N     1 
ATOM   6820  C  CA    . ASN A 1 917  ? -29.50300 -27.06700 -32.67100 1.000 90.34739  ? 917  ASN A CA    1 
ATOM   6821  C  C     . ASN A 1 917  ? -28.57400 -26.38400 -33.67300 1.000 93.32047  ? 917  ASN A C     1 
ATOM   6822  O  O     . ASN A 1 917  ? -27.36600 -26.63000 -33.71200 1.000 99.77227  ? 917  ASN A O     1 
ATOM   6823  C  CB    . ASN A 1 917  ? -29.88200 -26.09700 -31.55200 1.000 89.35023  ? 917  ASN A CB    1 
ATOM   6824  C  CG    . ASN A 1 917  ? -31.05100 -26.59600 -30.72400 1.000 91.48213  ? 917  ASN A CG    1 
ATOM   6825  O  OD1   . ASN A 1 917  ? -32.21100 -26.42200 -31.09800 1.000 91.64759  ? 917  ASN A OD1   1 
ATOM   6826  N  ND2   . ASN A 1 917  ? -30.74900 -27.22400 -29.59400 1.000 85.91468  ? 917  ASN A ND2   1 
ATOM   6827  N  N     . THR A 1 918  ? -29.16200 -25.51100 -34.48700 1.000 94.18814  ? 918  THR A N     1 
ATOM   6828  C  CA    . THR A 1 918  ? -28.45800 -24.82800 -35.55900 1.000 94.50996  ? 918  THR A CA    1 
ATOM   6829  C  C     . THR A 1 918  ? -28.60300 -23.32000 -35.38700 1.000 95.49958  ? 918  THR A C     1 
ATOM   6830  O  O     . THR A 1 918  ? -29.46400 -22.83900 -34.64500 1.000 99.21576  ? 918  THR A O     1 
ATOM   6831  C  CB    . THR A 1 918  ? -28.99900 -25.25800 -36.93300 1.000 96.75842  ? 918  THR A CB    1 
ATOM   6832  O  OG1   . THR A 1 918  ? -29.35700 -26.64500 -36.89000 1.000 95.21410  ? 918  THR A OG1   1 
ATOM   6833  C  CG2   . THR A 1 918  ? -27.94100 -25.07100 -38.01300 1.000 101.63343 ? 918  THR A CG2   1 
ATOM   6834  N  N     . ALA A 1 919  ? -27.74300 -22.57400 -36.07600 1.000 101.26473 ? 919  ALA A N     1 
ATOM   6835  C  CA    . ALA A 1 919  ? -27.82500 -21.12000 -36.04700 1.000 100.19893 ? 919  ALA A CA    1 
ATOM   6836  C  C     . ALA A 1 919  ? -29.11700 -20.64400 -36.70000 1.000 95.90551  ? 919  ALA A C     1 
ATOM   6837  O  O     . ALA A 1 919  ? -29.53800 -21.16400 -37.73800 1.000 99.16626  ? 919  ALA A O     1 
ATOM   6838  C  CB    . ALA A 1 919  ? -26.61800 -20.50400 -36.75200 1.000 104.09148 ? 919  ALA A CB    1 
ATOM   6839  N  N     . PHE A 1 920  ? -29.74500 -19.64800 -36.08500 1.000 89.37764  ? 920  PHE A N     1 
ATOM   6840  C  CA    . PHE A 1 920  ? -31.02600 -19.10500 -36.50800 1.000 89.88474  ? 920  PHE A CA    1 
ATOM   6841  C  C     . PHE A 1 920  ? -30.82900 -17.69200 -37.05600 1.000 93.15483  ? 920  PHE A C     1 
ATOM   6842  O  O     . PHE A 1 920  ? -29.70300 -17.24800 -37.30800 1.000 100.52522 ? 920  PHE A O     1 
ATOM   6843  C  CB    . PHE A 1 920  ? -32.00400 -19.12500 -35.32900 1.000 91.17802  ? 920  PHE A CB    1 
ATOM   6844  C  CG    . PHE A 1 920  ? -33.40300 -19.55300 -35.69000 1.000 78.30273  ? 920  PHE A CG    1 
ATOM   6845  C  CD1   . PHE A 1 920  ? -34.22100 -18.74400 -36.46000 1.000 77.04974  ? 920  PHE A CD1   1 
ATOM   6846  C  CD2   . PHE A 1 920  ? -33.90400 -20.76000 -35.23800 1.000 79.28253  ? 920  PHE A CD2   1 
ATOM   6847  C  CE1   . PHE A 1 920  ? -35.50400 -19.13200 -36.78200 1.000 72.25688  ? 920  PHE A CE1   1 
ATOM   6848  C  CE2   . PHE A 1 920  ? -35.18900 -21.15400 -35.55500 1.000 82.88133  ? 920  PHE A CE2   1 
ATOM   6849  C  CZ    . PHE A 1 920  ? -35.98900 -20.33600 -36.32700 1.000 74.74303  ? 920  PHE A CZ    1 
ATOM   6850  N  N     . ARG A 1 921  ? -31.94000 -16.98500 -37.24800 1.000 87.75297  ? 921  ARG A N     1 
ATOM   6851  C  CA    . ARG A 1 921  ? -31.88800 -15.56200 -37.54800 1.000 91.62800  ? 921  ARG A CA    1 
ATOM   6852  C  C     . ARG A 1 921  ? -31.43200 -14.79900 -36.31200 1.000 87.68307  ? 921  ARG A C     1 
ATOM   6853  O  O     . ARG A 1 921  ? -31.93900 -15.02300 -35.20800 1.000 77.85350  ? 921  ARG A O     1 
ATOM   6854  C  CB    . ARG A 1 921  ? -33.26000 -15.06200 -38.00100 1.000 92.62020  ? 921  ARG A CB    1 
ATOM   6855  C  CG    . ARG A 1 921  ? -33.44900 -14.98900 -39.50800 1.000 88.18509  ? 921  ARG A CG    1 
ATOM   6856  C  CD    . ARG A 1 921  ? -34.90200 -14.69300 -39.85200 1.000 77.84560  ? 921  ARG A CD    1 
ATOM   6857  N  NE    . ARG A 1 921  ? -35.06100 -13.40800 -40.52700 1.000 81.25560  ? 921  ARG A NE    1 
ATOM   6858  C  CZ    . ARG A 1 921  ? -36.19100 -12.99600 -41.09400 1.000 81.90838  ? 921  ARG A CZ    1 
ATOM   6859  N  NH1   . ARG A 1 921  ? -37.26900 -13.76900 -41.06900 1.000 75.89616  ? 921  ARG A NH1   1 
ATOM   6860  N  NH2   . ARG A 1 921  ? -36.24500 -11.81000 -41.68600 1.000 77.83328  ? 921  ARG A NH2   1 
ATOM   6861  N  N     . GLY A 1 922  ? -30.46900 -13.89600 -36.49500 1.000 95.16587  ? 922  GLY A N     1 
ATOM   6862  C  CA    . GLY A 1 922  ? -29.88900 -13.13300 -35.41900 1.000 93.77618  ? 922  GLY A CA    1 
ATOM   6863  C  C     . GLY A 1 922  ? -28.55900 -13.67100 -34.93200 1.000 99.10519  ? 922  GLY A C     1 
ATOM   6864  O  O     . GLY A 1 922  ? -27.72800 -12.89400 -34.44500 1.000 101.95304 ? 922  GLY A O     1 
ATOM   6865  N  N     . PHE A 1 923  ? -28.34400 -14.98400 -35.04900 1.000 100.00021 ? 923  PHE A N     1 
ATOM   6866  C  CA    . PHE A 1 923  ? -27.07900 -15.62500 -34.68700 1.000 101.53013 ? 923  PHE A CA    1 
ATOM   6867  C  C     . PHE A 1 923  ? -26.75500 -15.40900 -33.20800 1.000 99.60968  ? 923  PHE A C     1 
ATOM   6868  O  O     . PHE A 1 923  ? -25.67200 -14.94700 -32.84400 1.000 96.47170  ? 923  PHE A O     1 
ATOM   6869  C  CB    . PHE A 1 923  ? -25.93900 -15.13000 -35.58100 1.000 102.08360 ? 923  PHE A CB    1 
ATOM   6870  C  CG    . PHE A 1 923  ? -24.91600 -16.18200 -35.90100 1.000 105.30028 ? 923  PHE A CG    1 
ATOM   6871  C  CD1   . PHE A 1 923  ? -24.91000 -17.39300 -35.22900 1.000 107.38024 ? 923  PHE A CD1   1 
ATOM   6872  C  CD2   . PHE A 1 923  ? -23.96300 -15.96000 -36.88100 1.000 110.77279 ? 923  PHE A CD2   1 
ATOM   6873  C  CE1   . PHE A 1 923  ? -23.96900 -18.36200 -35.52600 1.000 112.90989 ? 923  PHE A CE1   1 
ATOM   6874  C  CE2   . PHE A 1 923  ? -23.02000 -16.92400 -37.18200 1.000 115.01880 ? 923  PHE A CE2   1 
ATOM   6875  C  CZ    . PHE A 1 923  ? -23.02300 -18.12700 -36.50400 1.000 114.31880 ? 923  PHE A CZ    1 
ATOM   6876  N  N     . GLY A 1 924  ? -27.71400 -15.75200 -32.34900 1.000 95.20961  ? 924  GLY A N     1 
ATOM   6877  C  CA    . GLY A 1 924  ? -27.54800 -15.62600 -30.91800 1.000 87.43568  ? 924  GLY A CA    1 
ATOM   6878  C  C     . GLY A 1 924  ? -27.95200 -14.28900 -30.33500 1.000 81.46124  ? 924  GLY A C     1 
ATOM   6879  O  O     . GLY A 1 924  ? -28.01800 -14.16500 -29.10500 1.000 81.44241  ? 924  GLY A O     1 
ATOM   6880  N  N     . PHE A 1 925  ? -28.22600 -13.28900 -31.17000 1.000 81.37407  ? 925  PHE A N     1 
ATOM   6881  C  CA    . PHE A 1 925  ? -28.58500 -11.95600 -30.69800 1.000 76.79904  ? 925  PHE A CA    1 
ATOM   6882  C  C     . PHE A 1 925  ? -29.93500 -11.92500 -29.98100 1.000 74.92547  ? 925  PHE A C     1 
ATOM   6883  O  O     . PHE A 1 925  ? -30.03900 -11.28300 -28.92800 1.000 81.53952  ? 925  PHE A O     1 
ATOM   6884  C  CB    . PHE A 1 925  ? -28.57800 -10.95700 -31.85900 1.000 75.56869  ? 925  PHE A CB    1 
ATOM   6885  C  CG    . PHE A 1 925  ? -28.90200 -9.55000  -31.44700 1.000 77.81996  ? 925  PHE A CG    1 
ATOM   6886  C  CD1   . PHE A 1 925  ? -28.02700 -8.83000  -30.65200 1.000 84.62049  ? 925  PHE A CD1   1 
ATOM   6887  C  CD2   . PHE A 1 925  ? -30.07700 -8.94500  -31.85600 1.000 75.00856  ? 925  PHE A CD2   1 
ATOM   6888  C  CE1   . PHE A 1 925  ? -28.31800 -7.53400  -30.26900 1.000 79.32119  ? 925  PHE A CE1   1 
ATOM   6889  C  CE2   . PHE A 1 925  ? -30.37300 -7.64900  -31.47800 1.000 75.43632  ? 925  PHE A CE2   1 
ATOM   6890  C  CZ    . PHE A 1 925  ? -29.49200 -6.94300  -30.68300 1.000 72.65478  ? 925  PHE A CZ    1 
ATOM   6891  N  N     . PRO A 1 926  ? -30.99000 -12.57600 -30.49300 1.000 72.85510  ? 926  PRO A N     1 
ATOM   6892  C  CA    . PRO A 1 926  ? -32.26600 -12.56800 -29.75500 1.000 74.78535  ? 926  PRO A CA    1 
ATOM   6893  C  C     . PRO A 1 926  ? -32.17300 -13.15800 -28.35700 1.000 77.07737  ? 926  PRO A C     1 
ATOM   6894  O  O     . PRO A 1 926  ? -33.08300 -12.93800 -27.54800 1.000 76.50384  ? 926  PRO A O     1 
ATOM   6895  C  CB    . PRO A 1 926  ? -33.19400 -13.39800 -30.65100 1.000 67.23932  ? 926  PRO A CB    1 
ATOM   6896  C  CG    . PRO A 1 926  ? -32.63800 -13.22300 -32.00800 1.000 70.26480  ? 926  PRO A CG    1 
ATOM   6897  C  CD    . PRO A 1 926  ? -31.15200 -13.21100 -31.81500 1.000 74.54396  ? 926  PRO A CD    1 
ATOM   6898  N  N     . GLN A 1 927  ? -31.11100 -13.89800 -28.04700 1.000 76.91755  ? 927  GLN A N     1 
ATOM   6899  C  CA    . GLN A 1 927  ? -30.90100 -14.45300 -26.71700 1.000 76.21800  ? 927  GLN A CA    1 
ATOM   6900  C  C     . GLN A 1 927  ? -29.97200 -13.60300 -25.86100 1.000 81.42304  ? 927  GLN A C     1 
ATOM   6901  O  O     . GLN A 1 927  ? -30.26900 -13.36100 -24.68700 1.000 89.29423  ? 927  GLN A O     1 
ATOM   6902  C  CB    . GLN A 1 927  ? -30.33400 -15.87100 -26.81900 1.000 77.57344  ? 927  GLN A CB    1 
ATOM   6903  C  CG    . GLN A 1 927  ? -31.24700 -16.86600 -27.51500 1.000 79.78810  ? 927  GLN A CG    1 
ATOM   6904  C  CD    . GLN A 1 927  ? -30.70000 -17.32200 -28.85100 1.000 80.46137  ? 927  GLN A CD    1 
ATOM   6905  O  OE1   . GLN A 1 927  ? -30.36500 -16.50500 -29.70800 1.000 84.21423  ? 927  GLN A OE1   1 
ATOM   6906  N  NE2   . GLN A 1 927  ? -30.60100 -18.63400 -29.03500 1.000 80.05199  ? 927  GLN A NE2   1 
ATOM   6907  N  N     . ALA A 1 928  ? -28.85200 -13.14400 -26.42400 1.000 78.68812  ? 928  ALA A N     1 
ATOM   6908  C  CA    . ALA A 1 928  ? -27.90900 -12.34300 -25.65100 1.000 83.01928  ? 928  ALA A CA    1 
ATOM   6909  C  C     . ALA A 1 928  ? -28.46000 -10.95700 -25.34800 1.000 81.60930  ? 928  ALA A C     1 
ATOM   6910  O  O     . ALA A 1 928  ? -28.10200 -10.35900 -24.32600 1.000 87.88379  ? 928  ALA A O     1 
ATOM   6911  C  CB    . ALA A 1 928  ? -26.58000 -12.23200 -26.39600 1.000 85.28769  ? 928  ALA A CB    1 
ATOM   6912  N  N     . ALA A 1 929  ? -29.32000 -10.42700 -26.21600 1.000 78.41312  ? 929  ALA A N     1 
ATOM   6913  C  CA    . ALA A 1 929  ? -29.91500 -9.12200  -25.96800 1.000 77.99185  ? 929  ALA A CA    1 
ATOM   6914  C  C     . ALA A 1 929  ? -31.13400 -9.19800  -25.05900 1.000 76.56056  ? 929  ALA A C     1 
ATOM   6915  O  O     . ALA A 1 929  ? -31.51400 -8.18100  -24.47100 1.000 75.68803  ? 929  ALA A O     1 
ATOM   6916  C  CB    . ALA A 1 929  ? -30.29100 -8.45400  -27.29200 1.000 72.48714  ? 929  ALA A CB    1 
ATOM   6917  N  N     . LEU A 1 930  ? -31.74900 -10.37500 -24.92300 1.000 79.08539  ? 930  LEU A N     1 
ATOM   6918  C  CA    . LEU A 1 930  ? -32.89500 -10.51000 -24.03000 1.000 75.00087  ? 930  LEU A CA    1 
ATOM   6919  C  C     . LEU A 1 930  ? -32.46500 -10.57600 -22.57000 1.000 83.46343  ? 930  LEU A C     1 
ATOM   6920  O  O     . LEU A 1 930  ? -33.12500 -9.99500  -21.70100 1.000 88.80465  ? 930  LEU A O     1 
ATOM   6921  C  CB    . LEU A 1 930  ? -33.71200 -11.75000 -24.39300 1.000 69.40331  ? 930  LEU A CB    1 
ATOM   6922  C  CG    . LEU A 1 930  ? -34.96500 -11.95400 -23.53500 1.000 66.32237  ? 930  LEU A CG    1 
ATOM   6923  C  CD1   . LEU A 1 930  ? -36.01100 -10.89600 -23.85200 1.000 72.85359  ? 930  LEU A CD1   1 
ATOM   6924  C  CD2   . LEU A 1 930  ? -35.53900 -13.35000 -23.70600 1.000 64.98604  ? 930  LEU A CD2   1 
ATOM   6925  N  N     . ILE A 1 931  ? -31.36600 -11.27800 -22.28100 1.000 80.73265  ? 931  ILE A N     1 
ATOM   6926  C  CA    . ILE A 1 931  ? -30.92200 -11.40800 -20.89700 1.000 85.76346  ? 931  ILE A CA    1 
ATOM   6927  C  C     . ILE A 1 931  ? -30.43900 -10.06800 -20.35300 1.000 84.68799  ? 931  ILE A C     1 
ATOM   6928  O  O     . ILE A 1 931  ? -30.49500 -9.82800  -19.14100 1.000 87.74068  ? 931  ILE A O     1 
ATOM   6929  C  CB    . ILE A 1 931  ? -29.84100 -12.50100 -20.78200 1.000 82.82106  ? 931  ILE A CB    1 
ATOM   6930  C  CG1   . ILE A 1 931  ? -28.74000 -12.29300 -21.82100 1.000 87.66639  ? 931  ILE A CG1   1 
ATOM   6931  C  CG2   . ILE A 1 931  ? -30.45700 -13.88000 -20.94600 1.000 74.54252  ? 931  ILE A CG2   1 
ATOM   6932  C  CD1   . ILE A 1 931  ? -27.59200 -11.45000 -21.33500 1.000 90.99289  ? 931  ILE A CD1   1 
ATOM   6933  N  N     . THR A 1 932  ? -29.95900 -9.17700  -21.22500 1.000 81.41539  ? 932  THR A N     1 
ATOM   6934  C  CA    . THR A 1 932  ? -29.60000 -7.83300  -20.78500 1.000 81.16254  ? 932  THR A CA    1 
ATOM   6935  C  C     . THR A 1 932  ? -30.84000 -6.97900  -20.55300 1.000 78.34562  ? 932  THR A C     1 
ATOM   6936  O  O     . THR A 1 932  ? -30.91000 -6.23800  -19.56600 1.000 81.74485  ? 932  THR A O     1 
ATOM   6937  C  CB    . THR A 1 932  ? -28.68400 -7.16000  -21.80800 1.000 74.48371  ? 932  THR A CB    1 
ATOM   6938  O  OG1   . THR A 1 932  ? -29.37200 -7.03000  -23.05800 1.000 80.67594  ? 932  THR A OG1   1 
ATOM   6939  C  CG2   . THR A 1 932  ? -27.41500 -7.96900  -22.00700 1.000 81.37618  ? 932  THR A CG2   1 
ATOM   6940  N  N     . GLU A 1 933  ? -31.82100 -7.06800  -21.45300 1.000 74.47333  ? 933  GLU A N     1 
ATOM   6941  C  CA    . GLU A 1 933  ? -33.07700 -6.35400  -21.25100 1.000 74.59104  ? 933  GLU A CA    1 
ATOM   6942  C  C     . GLU A 1 933  ? -33.81200 -6.87800  -20.02400 1.000 76.66507  ? 933  GLU A C     1 
ATOM   6943  O  O     . GLU A 1 933  ? -34.41400 -6.10200  -19.27300 1.000 77.81758  ? 933  GLU A O     1 
ATOM   6944  C  CB    . GLU A 1 933  ? -33.95300 -6.47500  -22.49700 1.000 76.88138  ? 933  GLU A CB    1 
ATOM   6945  C  CG    . GLU A 1 933  ? -33.41100 -5.75400  -23.71900 1.000 73.86113  ? 933  GLU A CG    1 
ATOM   6946  C  CD    . GLU A 1 933  ? -33.61000 -4.25500  -23.64900 1.000 75.90729  ? 933  GLU A CD    1 
ATOM   6947  O  OE1   . GLU A 1 933  ? -34.32500 -3.78900  -22.73700 1.000 76.44480  ? 933  GLU A OE1   1 
ATOM   6948  O  OE2   . GLU A 1 933  ? -33.05000 -3.54200  -24.50800 1.000 80.55970  ? 933  GLU A OE2   1 
ATOM   6949  N  N     . SER A 1 934  ? -33.77700 -8.19500  -19.80800 1.000 80.51400  ? 934  SER A N     1 
ATOM   6950  C  CA    . SER A 1 934  ? -34.32700 -8.75500  -18.57800 1.000 79.88899  ? 934  SER A CA    1 
ATOM   6951  C  C     . SER A 1 934  ? -33.57700 -8.23400  -17.36000 1.000 79.66888  ? 934  SER A C     1 
ATOM   6952  O  O     . SER A 1 934  ? -34.17800 -7.99200  -16.30600 1.000 83.00878  ? 934  SER A O     1 
ATOM   6953  C  CB    . SER A 1 934  ? -34.27600 -10.28200 -18.62800 1.000 78.49834  ? 934  SER A CB    1 
ATOM   6954  O  OG    . SER A 1 934  ? -34.51600 -10.84300 -17.34900 1.000 79.94378  ? 934  SER A OG    1 
ATOM   6955  N  N     . CYS A 1 935  ? -32.26100 -8.05100  -17.48700 1.000 85.20652  ? 935  CYS A N     1 
ATOM   6956  C  CA    . CYS A 1 935  ? -31.48100 -7.46600  -16.40100 1.000 88.78236  ? 935  CYS A CA    1 
ATOM   6957  C  C     . CYS A 1 935  ? -31.87300 -6.01200  -16.16700 1.000 89.92353  ? 935  CYS A C     1 
ATOM   6958  O  O     . CYS A 1 935  ? -32.05200 -5.58400  -15.02100 1.000 87.80408  ? 935  CYS A O     1 
ATOM   6959  C  CB    . CYS A 1 935  ? -29.98700 -7.57800  -16.71100 1.000 83.55322  ? 935  CYS A CB    1 
ATOM   6960  S  SG    . CYS A 1 935  ? -28.90200 -6.84600  -15.46300 1.000 95.23870  ? 935  CYS A SG    1 
ATOM   6961  N  N     . ILE A 1 936  ? -32.01500 -5.23900  -17.24600 1.000 86.40436  ? 936  ILE A N     1 
ATOM   6962  C  CA    . ILE A 1 936  ? -32.37400 -3.82900  -17.11400 1.000 80.17854  ? 936  ILE A CA    1 
ATOM   6963  C  C     . ILE A 1 936  ? -33.76500 -3.68700  -16.50900 1.000 82.52679  ? 936  ILE A C     1 
ATOM   6964  O  O     . ILE A 1 936  ? -34.01900 -2.78700  -15.69900 1.000 87.18787  ? 936  ILE A O     1 
ATOM   6965  C  CB    . ILE A 1 936  ? -32.26400 -3.12500  -18.48000 1.000 74.10328  ? 936  ILE A CB    1 
ATOM   6966  C  CG1   . ILE A 1 936  ? -30.79400 -2.91600  -18.84500 1.000 72.41822  ? 936  ILE A CG1   1 
ATOM   6967  C  CG2   . ILE A 1 936  ? -33.01300 -1.80000  -18.47600 1.000 80.62541  ? 936  ILE A CG2   1 
ATOM   6968  C  CD1   . ILE A 1 936  ? -30.58200 -2.03200  -20.04600 1.000 71.61678  ? 936  ILE A CD1   1 
ATOM   6969  N  N     . THR A 1 937  ? -34.68400 -4.58200  -16.88000 1.000 87.96672  ? 937  THR A N     1 
ATOM   6970  C  CA    . THR A 1 937  ? -36.01900 -4.55500  -16.29300 1.000 89.75784  ? 937  THR A CA    1 
ATOM   6971  C  C     . THR A 1 937  ? -35.98100 -4.87800  -14.80400 1.000 91.87390  ? 937  THR A C     1 
ATOM   6972  O  O     . THR A 1 937  ? -36.77500 -4.33000  -14.03000 1.000 95.39637  ? 937  THR A O     1 
ATOM   6973  C  CB    . THR A 1 937  ? -36.93500 -5.53100  -17.03600 1.000 82.12199  ? 937  THR A CB    1 
ATOM   6974  O  OG1   . THR A 1 937  ? -37.06600 -5.11700  -18.40200 1.000 77.16678  ? 937  THR A OG1   1 
ATOM   6975  C  CG2   . THR A 1 937  ? -38.31800 -5.57300  -16.40200 1.000 86.29779  ? 937  THR A CG2   1 
ATOM   6976  N  N     . GLU A 1 938  ? -35.05400 -5.73900  -14.37800 1.000 91.41512  ? 938  GLU A N     1 
ATOM   6977  C  CA    . GLU A 1 938  ? -34.99200 -6.11000  -12.96900 1.000 94.97218  ? 938  GLU A CA    1 
ATOM   6978  C  C     . GLU A 1 938  ? -34.39400 -4.99800  -12.11300 1.000 94.99819  ? 938  GLU A C     1 
ATOM   6979  O  O     . GLU A 1 938  ? -34.81600 -4.80500  -10.96700 1.000 95.41326  ? 938  GLU A O     1 
ATOM   6980  C  CB    . GLU A 1 938  ? -34.20000 -7.40600  -12.79600 1.000 93.43003  ? 938  GLU A CB    1 
ATOM   6981  C  CG    . GLU A 1 938  ? -34.86700 -8.61500  -13.44100 1.000 109.24476 ? 938  GLU A CG    1 
ATOM   6982  C  CD    . GLU A 1 938  ? -36.26300 -8.87400  -12.90800 1.000 126.17293 ? 938  GLU A CD    1 
ATOM   6983  O  OE1   . GLU A 1 938  ? -36.47000 -8.72800  -11.68700 1.000 131.13583 ? 938  GLU A OE1   1 
ATOM   6984  O  OE2   . GLU A 1 938  ? -37.15300 -9.22300  -13.71200 1.000 121.72575 ? 938  GLU A OE2   1 
ATOM   6985  N  N     . VAL A 1 939  ? -33.41200 -4.25900  -12.63900 1.000 89.08988  ? 939  VAL A N     1 
ATOM   6986  C  CA    . VAL A 1 939  ? -32.86600 -3.14100  -11.87300 1.000 86.16636  ? 939  VAL A CA    1 
ATOM   6987  C  C     . VAL A 1 939  ? -33.84200 -1.97200  -11.86500 1.000 88.71390  ? 939  VAL A C     1 
ATOM   6988  O  O     . VAL A 1 939  ? -33.85000 -1.16900  -10.92400 1.000 96.70664  ? 939  VAL A O     1 
ATOM   6989  C  CB    . VAL A 1 939  ? -31.48200 -2.72000  -12.40800 1.000 87.58816  ? 939  VAL A CB    1 
ATOM   6990  C  CG1   . VAL A 1 939  ? -30.62400 -3.93900  -12.70200 1.000 91.06362  ? 939  VAL A CG1   1 
ATOM   6991  C  CG2   . VAL A 1 939  ? -31.61200 -1.83700  -13.64300 1.000 87.33318  ? 939  VAL A CG2   1 
ATOM   6992  N  N     . ALA A 1 940  ? -34.68400 -1.85800  -12.89700 1.000 88.97450  ? 940  ALA A N     1 
ATOM   6993  C  CA    . ALA A 1 940  ? -35.70900 -0.82100  -12.90600 1.000 90.86831  ? 940  ALA A CA    1 
ATOM   6994  C  C     . ALA A 1 940  ? -36.72500 -1.03500  -11.79400 1.000 90.85385  ? 940  ALA A C     1 
ATOM   6995  O  O     . ALA A 1 940  ? -37.23600 -0.06500  -11.22300 1.000 91.80068  ? 940  ALA A O     1 
ATOM   6996  C  CB    . ALA A 1 940  ? -36.40700 -0.78300  -14.26400 1.000 89.43025  ? 940  ALA A CB    1 
ATOM   6997  N  N     . ALA A 1 941  ? -37.03000 -2.29500  -11.47200 1.000 88.40782  ? 941  ALA A N     1 
ATOM   6998  C  CA    . ALA A 1 941  ? -37.91600 -2.57700  -10.34900 1.000 88.84436  ? 941  ALA A CA    1 
ATOM   6999  C  C     . ALA A 1 941  ? -37.26200 -2.19800  -9.02700  1.000 91.13760  ? 941  ALA A C     1 
ATOM   7000  O  O     . ALA A 1 941  ? -37.91800 -1.63700  -8.14200  1.000 98.93647  ? 941  ALA A O     1 
ATOM   7001  C  CB    . ALA A 1 941  ? -38.31300 -4.05200  -10.34800 1.000 89.05155  ? 941  ALA A CB    1 
ATOM   7002  N  N     . LYS A 1 942  ? -35.97000 -2.49500  -8.87500  1.000 88.51187  ? 942  LYS A N     1 
ATOM   7003  C  CA    . LYS A 1 942  ? -35.25200 -2.14200  -7.65700  1.000 94.43185  ? 942  LYS A CA    1 
ATOM   7004  C  C     . LYS A 1 942  ? -34.97500 -0.64800  -7.54900  1.000 97.55725  ? 942  LYS A C     1 
ATOM   7005  O  O     . LYS A 1 942  ? -34.61900 -0.18000  -6.46300  1.000 106.94356 ? 942  LYS A O     1 
ATOM   7006  C  CB    . LYS A 1 942  ? -33.93600 -2.91800  -7.58000  1.000 86.69585  ? 942  LYS A CB    1 
ATOM   7007  C  CG    . LYS A 1 942  ? -34.10400 -4.42700  -7.66000  1.000 80.55003  ? 942  LYS A CG    1 
ATOM   7008  C  CD    . LYS A 1 942  ? -34.14400 -5.05700  -6.27800  1.000 80.10021  ? 942  LYS A CD    1 
ATOM   7009  C  CE    . LYS A 1 942  ? -34.35700 -6.56000  -6.36500  1.000 85.28417  ? 942  LYS A CE    1 
ATOM   7010  N  NZ    . LYS A 1 942  ? -34.12700 -7.23800  -5.05900  1.000 86.44277  ? 942  LYS A NZ    1 
ATOM   7011  N  N     . CYS A 1 943  ? -35.12700 0.10400   -8.63900  1.000 90.06944  ? 943  CYS A N     1 
ATOM   7012  C  CA    . CYS A 1 943  ? -34.92100 1.54500   -8.62600  1.000 87.59552  ? 943  CYS A CA    1 
ATOM   7013  C  C     . CYS A 1 943  ? -36.22100 2.33800   -8.61600  1.000 98.12542  ? 943  CYS A C     1 
ATOM   7014  O  O     . CYS A 1 943  ? -36.18700 3.54800   -8.36700  1.000 103.37531 ? 943  CYS A O     1 
ATOM   7015  C  CB    . CYS A 1 943  ? -34.07800 1.97200   -9.83500  1.000 87.47600  ? 943  CYS A CB    1 
ATOM   7016  S  SG    . CYS A 1 943  ? -32.31800 1.59000   -9.70200  1.000 98.13736  ? 943  CYS A SG    1 
ATOM   7017  N  N     . GLY A 1 944  ? -37.35800 1.69600   -8.87800  1.000 95.76686  ? 944  GLY A N     1 
ATOM   7018  C  CA    . GLY A 1 944  ? -38.63500 2.37600   -8.88600  1.000 91.21587  ? 944  GLY A CA    1 
ATOM   7019  C  C     . GLY A 1 944  ? -38.95100 3.14700   -10.14800 1.000 93.67291  ? 944  GLY A C     1 
ATOM   7020  O  O     . GLY A 1 944  ? -40.05500 3.69600   -10.25700 1.000 107.19346 ? 944  GLY A O     1 
ATOM   7021  N  N     . LEU A 1 945  ? -38.02700 3.21200   -11.10100 1.000 90.77594  ? 945  LEU A N     1 
ATOM   7022  C  CA    . LEU A 1 945  ? -38.25100 3.90300   -12.36000 1.000 94.00766  ? 945  LEU A CA    1 
ATOM   7023  C  C     . LEU A 1 945  ? -38.71400 2.91800   -13.42600 1.000 91.46791  ? 945  LEU A C     1 
ATOM   7024  O  O     . LEU A 1 945  ? -38.40500 1.72500   -13.37300 1.000 87.87835  ? 945  LEU A O     1 
ATOM   7025  C  CB    . LEU A 1 945  ? -36.98100 4.61700   -12.82900 1.000 96.73007  ? 945  LEU A CB    1 
ATOM   7026  C  CG    . LEU A 1 945  ? -36.39700 5.68100   -11.89800 1.000 101.29528 ? 945  LEU A CG    1 
ATOM   7027  C  CD1   . LEU A 1 945  ? -35.21100 5.13100   -11.12400 1.000 97.19354  ? 945  LEU A CD1   1 
ATOM   7028  C  CD2   . LEU A 1 945  ? -35.99600 6.92200   -12.68100 1.000 100.76663 ? 945  LEU A CD2   1 
ATOM   7029  N  N     . SER A 1 946  ? -39.46800 3.43200   -14.39500 1.000 92.87340  ? 946  SER A N     1 
ATOM   7030  C  CA    . SER A 1 946  ? -39.92300 2.60300   -15.49800 1.000 93.09816  ? 946  SER A CA    1 
ATOM   7031  C  C     . SER A 1 946  ? -38.72100 2.09100   -16.29300 1.000 94.04210  ? 946  SER A C     1 
ATOM   7032  O  O     . SER A 1 946  ? -37.67800 2.75000   -16.34800 1.000 94.39298  ? 946  SER A O     1 
ATOM   7033  C  CB    . SER A 1 946  ? -40.86200 3.39000   -16.40900 1.000 87.46943  ? 946  SER A CB    1 
ATOM   7034  O  OG    . SER A 1 946  ? -40.14000 4.29600   -17.22500 1.000 86.53079  ? 946  SER A OG    1 
ATOM   7035  N  N     . PRO A 1 947  ? -38.83500 0.90900   -16.90500 1.000 85.37709  ? 947  PRO A N     1 
ATOM   7036  C  CA    . PRO A 1 947  ? -37.69300 0.36900   -17.66200 1.000 79.42431  ? 947  PRO A CA    1 
ATOM   7037  C  C     . PRO A 1 947  ? -37.23600 1.26800   -18.79600 1.000 78.82977  ? 947  PRO A C     1 
ATOM   7038  O  O     . PRO A 1 947  ? -36.04500 1.26800   -19.13100 1.000 82.47848  ? 947  PRO A O     1 
ATOM   7039  C  CB    . PRO A 1 947  ? -38.22600 -0.97200  -18.18500 1.000 84.75750  ? 947  PRO A CB    1 
ATOM   7040  C  CG    . PRO A 1 947  ? -39.31700 -1.34000  -17.23400 1.000 87.68706  ? 947  PRO A CG    1 
ATOM   7041  C  CD    . PRO A 1 947  ? -39.95800 -0.04100  -16.84700 1.000 78.69891  ? 947  PRO A CD    1 
ATOM   7042  N  N     . GLU A 1 948  ? -38.14500 2.04100   -19.39500 1.000 78.18654  ? 948  GLU A N     1 
ATOM   7043  C  CA    . GLU A 1 948  ? -37.76300 2.91100   -20.50200 1.000 79.68401  ? 948  GLU A CA    1 
ATOM   7044  C  C     . GLU A 1 948  ? -36.82100 4.01800   -20.04800 1.000 85.10956  ? 948  GLU A C     1 
ATOM   7045  O  O     . GLU A 1 948  ? -35.93200 4.42200   -20.80600 1.000 87.97222  ? 948  GLU A O     1 
ATOM   7046  C  CB    . GLU A 1 948  ? -39.00700 3.50800   -21.16000 1.000 81.82905  ? 948  GLU A CB    1 
ATOM   7047  C  CG    . GLU A 1 948  ? -39.79100 2.53100   -22.02900 1.000 79.65507  ? 948  GLU A CG    1 
ATOM   7048  C  CD    . GLU A 1 948  ? -40.42600 1.40700   -21.23100 1.000 83.50948  ? 948  GLU A CD    1 
ATOM   7049  O  OE1   . GLU A 1 948  ? -40.53500 0.28400   -21.76600 1.000 78.62940  ? 948  GLU A OE1   1 
ATOM   7050  O  OE2   . GLU A 1 948  ? -40.81800 1.64800   -20.06900 1.000 88.40975  ? 948  GLU A OE2   1 
ATOM   7051  N  N     . LYS A 1 949  ? -36.99600 4.52100   -18.82300 1.000 86.03651  ? 949  LYS A N     1 
ATOM   7052  C  CA    . LYS A 1 949  ? -36.07400 5.52600   -18.30600 1.000 86.92851  ? 949  LYS A CA    1 
ATOM   7053  C  C     . LYS A 1 949  ? -34.72600 4.91700   -17.94600 1.000 80.45371  ? 949  LYS A C     1 
ATOM   7054  O  O     . LYS A 1 949  ? -33.69400 5.58400   -18.07000 1.000 74.95441  ? 949  LYS A O     1 
ATOM   7055  C  CB    . LYS A 1 949  ? -36.68400 6.23100   -17.09400 1.000 85.97933  ? 949  LYS A CB    1 
ATOM   7056  C  CG    . LYS A 1 949  ? -37.90000 7.08200   -17.41900 1.000 81.12920  ? 949  LYS A CG    1 
ATOM   7057  C  CD    . LYS A 1 949  ? -38.49900 7.69600   -16.16400 1.000 90.25834  ? 949  LYS A CD    1 
ATOM   7058  C  CE    . LYS A 1 949  ? -38.95100 6.62300   -15.18900 1.000 95.31649  ? 949  LYS A CE    1 
ATOM   7059  N  NZ    . LYS A 1 949  ? -39.59900 7.20000   -13.97900 1.000 95.31127  ? 949  LYS A NZ    1 
ATOM   7060  N  N     . VAL A 1 950  ? -34.71100 3.65900   -17.50200 1.000 77.31063  ? 950  VAL A N     1 
ATOM   7061  C  CA    . VAL A 1 950  ? -33.44400 3.00600   -17.19400 1.000 78.80195  ? 950  VAL A CA    1 
ATOM   7062  C  C     . VAL A 1 950  ? -32.67700 2.69400   -18.47400 1.000 82.64767  ? 950  VAL A C     1 
ATOM   7063  O  O     . VAL A 1 950  ? -31.44000 2.73100   -18.49100 1.000 81.58914  ? 950  VAL A O     1 
ATOM   7064  C  CB    . VAL A 1 950  ? -33.69500 1.74200   -16.34900 1.000 77.65438  ? 950  VAL A CB    1 
ATOM   7065  C  CG1   . VAL A 1 950  ? -32.39400 0.99800   -16.08400 1.000 77.33308  ? 950  VAL A CG1   1 
ATOM   7066  C  CG2   . VAL A 1 950  ? -34.37300 2.11400   -15.04100 1.000 79.63380  ? 950  VAL A CG2   1 
ATOM   7067  N  N     . ARG A 1 951  ? -33.38700 2.40200   -19.56600 1.000 80.68201  ? 951  ARG A N     1 
ATOM   7068  C  CA    . ARG A 1 951  ? -32.71800 2.11000   -20.82900 1.000 77.74328  ? 951  ARG A CA    1 
ATOM   7069  C  C     . ARG A 1 951  ? -32.05800 3.35700   -21.40800 1.000 80.46637  ? 951  ARG A C     1 
ATOM   7070  O  O     . ARG A 1 951  ? -30.90900 3.30800   -21.86300 1.000 81.90409  ? 951  ARG A O     1 
ATOM   7071  C  CB    . ARG A 1 951  ? -33.71200 1.51500   -21.82700 1.000 80.05971  ? 951  ARG A CB    1 
ATOM   7072  C  CG    . ARG A 1 951  ? -34.20100 0.12000   -21.47000 1.000 85.85087  ? 951  ARG A CG    1 
ATOM   7073  C  CD    . ARG A 1 951  ? -35.01900 -0.48600  -22.60300 1.000 81.92455  ? 951  ARG A CD    1 
ATOM   7074  N  NE    . ARG A 1 951  ? -35.53000 -1.81200  -22.26700 1.000 73.74821  ? 951  ARG A NE    1 
ATOM   7075  C  CZ    . ARG A 1 951  ? -36.79800 -2.07100  -21.96400 1.000 76.01424  ? 951  ARG A CZ    1 
ATOM   7076  N  NH1   . ARG A 1 951  ? -37.69500 -1.09500  -21.95800 1.000 78.53402  ? 951  ARG A NH1   1 
ATOM   7077  N  NH2   . ARG A 1 951  ? -37.16900 -3.31000  -21.67100 1.000 75.80800  ? 951  ARG A NH2   1 
ATOM   7078  N  N     . ILE A 1 952  ? -32.77000 4.48700   -21.39900 1.000 84.77863  ? 952  ILE A N     1 
ATOM   7079  C  CA    . ILE A 1 952  ? -32.23600 5.70100   -22.01000 1.000 85.17275  ? 952  ILE A CA    1 
ATOM   7080  C  C     . ILE A 1 952  ? -31.07700 6.26300   -21.19200 1.000 88.56014  ? 952  ILE A C     1 
ATOM   7081  O  O     . ILE A 1 952  ? -30.17900 6.91300   -21.74100 1.000 90.73093  ? 952  ILE A O     1 
ATOM   7082  C  CB    . ILE A 1 952  ? -33.36200 6.73800   -22.20200 1.000 82.47103  ? 952  ILE A CB    1 
ATOM   7083  C  CG1   . ILE A 1 952  ? -32.83800 7.99200   -22.90500 1.000 87.87668  ? 952  ILE A CG1   1 
ATOM   7084  C  CG2   . ILE A 1 952  ? -33.99600 7.10300   -20.87000 1.000 73.17694  ? 952  ILE A CG2   1 
ATOM   7085  C  CD1   . ILE A 1 952  ? -32.29300 7.73500   -24.29000 1.000 80.27202  ? 952  ILE A CD1   1 
ATOM   7086  N  N     . ILE A 1 953  ? -31.06200 6.01600   -19.88100 1.000 87.43311  ? 953  ILE A N     1 
ATOM   7087  C  CA    . ILE A 1 953  ? -29.97400 6.51900   -19.04600 1.000 87.86280  ? 953  ILE A CA    1 
ATOM   7088  C  C     . ILE A 1 953  ? -28.67700 5.77500   -19.34500 1.000 88.39243  ? 953  ILE A C     1 
ATOM   7089  O  O     . ILE A 1 953  ? -27.59100 6.36900   -19.34500 1.000 90.20808  ? 953  ILE A O     1 
ATOM   7090  C  CB    . ILE A 1 953  ? -30.36300 6.43500   -17.55600 1.000 93.20693  ? 953  ILE A CB    1 
ATOM   7091  C  CG1   . ILE A 1 953  ? -30.89700 7.78300   -17.05900 1.000 100.18131 ? 953  ILE A CG1   1 
ATOM   7092  C  CG2   . ILE A 1 953  ? -29.18600 5.98600   -16.69900 1.000 87.60239  ? 953  ILE A CG2   1 
ATOM   7093  C  CD1   . ILE A 1 953  ? -32.08400 8.31700   -17.82800 1.000 89.77826  ? 953  ILE A CD1   1 
ATOM   7094  N  N     . ASN A 1 954  ? -28.76600 4.47600   -19.62700 1.000 86.82562  ? 954  ASN A N     1 
ATOM   7095  C  CA    . ASN A 1 954  ? -27.59600 3.64900   -19.89300 1.000 79.16396  ? 954  ASN A CA    1 
ATOM   7096  C  C     . ASN A 1 954  ? -27.22100 3.59700   -21.37000 1.000 85.60885  ? 954  ASN A C     1 
ATOM   7097  O  O     . ASN A 1 954  ? -26.35300 2.80300   -21.74500 1.000 92.96063  ? 954  ASN A O     1 
ATOM   7098  C  CB    . ASN A 1 954  ? -27.83000 2.22500   -19.37900 1.000 78.20016  ? 954  ASN A CB    1 
ATOM   7099  C  CG    . ASN A 1 954  ? -27.54200 2.08200   -17.89800 1.000 85.58744  ? 954  ASN A CG    1 
ATOM   7100  O  OD1   . ASN A 1 954  ? -26.38600 2.09100   -17.47600 1.000 84.52563  ? 954  ASN A OD1   1 
ATOM   7101  N  ND2   . ASN A 1 954  ? -28.59500 1.94200   -17.10100 1.000 84.29735  ? 954  ASN A ND2   1 
ATOM   7102  N  N     . MET A 1 955  ? -27.84000 4.42000   -22.21000 1.000 84.92619  ? 955  MET A N     1 
ATOM   7103  C  CA    . MET A 1 955  ? -27.63200 4.31000   -23.64500 1.000 86.77249  ? 955  MET A CA    1 
ATOM   7104  C  C     . MET A 1 955  ? -26.28800 4.90400   -24.05900 1.000 87.42293  ? 955  MET A C     1 
ATOM   7105  O  O     . MET A 1 955  ? -25.71000 5.75000   -23.37200 1.000 95.76012  ? 955  MET A O     1 
ATOM   7106  C  CB    . MET A 1 955  ? -28.76200 4.99900   -24.41000 1.000 83.90130  ? 955  MET A CB    1 
ATOM   7107  C  CG    . MET A 1 955  ? -29.78800 4.03700   -24.98800 1.000 86.83248  ? 955  MET A CG    1 
ATOM   7108  S  SD    . MET A 1 955  ? -30.95100 4.83700   -26.10800 1.000 104.43933 ? 955  MET A SD    1 
ATOM   7109  C  CE    . MET A 1 955  ? -29.82600 5.51100   -27.32700 1.000 81.70572  ? 955  MET A CE    1 
ATOM   7110  N  N     . TYR A 1 956  ? -25.79400 4.43800   -25.20500 1.000 86.83190  ? 956  TYR A N     1 
ATOM   7111  C  CA    . TYR A 1 956  ? -24.56800 4.97600   -25.77700 1.000 87.87227  ? 956  TYR A CA    1 
ATOM   7112  C  C     . TYR A 1 956  ? -24.75000 6.44400   -26.14700 1.000 88.16348  ? 956  TYR A C     1 
ATOM   7113  O  O     . TYR A 1 956  ? -25.85300 6.89800   -26.46400 1.000 80.73125  ? 956  TYR A O     1 
ATOM   7114  C  CB    . TYR A 1 956  ? -24.16600 4.18600   -27.02600 1.000 87.72983  ? 956  TYR A CB    1 
ATOM   7115  C  CG    . TYR A 1 956  ? -23.49000 2.85500   -26.77000 1.000 88.70445  ? 956  TYR A CG    1 
ATOM   7116  C  CD1   . TYR A 1 956  ? -22.15500 2.79400   -26.39400 1.000 92.90662  ? 956  TYR A CD1   1 
ATOM   7117  C  CD2   . TYR A 1 956  ? -24.17800 1.66100   -26.93300 1.000 86.47346  ? 956  TYR A CD2   1 
ATOM   7118  C  CE1   . TYR A 1 956  ? -21.52900 1.58200   -26.17000 1.000 91.42999  ? 956  TYR A CE1   1 
ATOM   7119  C  CE2   . TYR A 1 956  ? -23.56000 0.44300   -26.71100 1.000 84.60108  ? 956  TYR A CE2   1 
ATOM   7120  C  CZ    . TYR A 1 956  ? -22.23600 0.41000   -26.33000 1.000 86.27216  ? 956  TYR A CZ    1 
ATOM   7121  O  OH    . TYR A 1 956  ? -21.61600 -0.79900  -26.10800 1.000 85.68203  ? 956  TYR A OH    1 
ATOM   7122  N  N     . LYS A 1 957  ? -23.64900 7.19000   -26.10700 1.000 93.85466  ? 957  LYS A N     1 
ATOM   7123  C  CA    . LYS A 1 957  ? -23.64400 8.54800   -26.62500 1.000 93.37400  ? 957  LYS A CA    1 
ATOM   7124  C  C     . LYS A 1 957  ? -23.45100 8.51300   -28.14000 1.000 86.60098  ? 957  LYS A C     1 
ATOM   7125  O  O     . LYS A 1 957  ? -23.30500 7.44800   -28.74700 1.000 89.21614  ? 957  LYS A O     1 
ATOM   7126  C  CB    . LYS A 1 957  ? -22.56700 9.38300   -25.93300 1.000 97.42836  ? 957  LYS A CB    1 
ATOM   7127  C  CG    . LYS A 1 957  ? -23.04200 10.11900  -24.68000 1.000 98.59220  ? 957  LYS A CG    1 
ATOM   7128  C  CD    . LYS A 1 957  ? -23.57600 9.16900   -23.61700 1.000 99.10820  ? 957  LYS A CD    1 
ATOM   7129  C  CE    . LYS A 1 957  ? -24.75600 9.77600   -22.87300 1.000 95.37527  ? 957  LYS A CE    1 
ATOM   7130  N  NZ    . LYS A 1 957  ? -24.35200 10.93600  -22.03000 1.000 89.69978  ? 957  LYS A NZ    1 
ATOM   7131  N  N     . GLU A 1 958  ? -23.45900 9.69500   -28.76500 1.000 81.07121  ? 958  GLU A N     1 
ATOM   7132  C  CA    . GLU A 1 958  ? -23.34300 9.76600   -30.22000 1.000 85.05348  ? 958  GLU A CA    1 
ATOM   7133  C  C     . GLU A 1 958  ? -22.07700 9.07000   -30.70500 1.000 92.71586  ? 958  GLU A C     1 
ATOM   7134  O  O     . GLU A 1 958  ? -22.12700 8.21300   -31.59400 1.000 93.04218  ? 958  GLU A O     1 
ATOM   7135  C  CB    . GLU A 1 958  ? -23.37200 11.22300  -30.68200 1.000 92.46960  ? 958  GLU A CB    1 
ATOM   7136  C  CG    . GLU A 1 958  ? -23.28600 11.38500  -32.19200 1.000 89.13437  ? 958  GLU A CG    1 
ATOM   7137  C  CD    . GLU A 1 958  ? -23.76000 12.74400  -32.66400 1.000 90.04254  ? 958  GLU A CD    1 
ATOM   7138  O  OE1   . GLU A 1 958  ? -24.36300 13.48000  -31.85600 1.000 97.14517  ? 958  GLU A OE1   1 
ATOM   7139  O  OE2   . GLU A 1 958  ? -23.53000 13.07600  -33.84600 1.000 91.58983  ? 958  GLU A OE2   1 
ATOM   7140  N  N     . ILE A 1 959  ? -20.93200 9.42400   -30.12900 1.000 93.16855  ? 959  ILE A N     1 
ATOM   7141  C  CA    . ILE A 1 959  ? -19.68400 8.70100   -30.33700 1.000 88.66453  ? 959  ILE A CA    1 
ATOM   7142  C  C     . ILE A 1 959  ? -19.34300 7.97800   -29.04100 1.000 92.52483  ? 959  ILE A C     1 
ATOM   7143  O  O     . ILE A 1 959  ? -19.31900 8.59000   -27.96600 1.000 93.60305  ? 959  ILE A O     1 
ATOM   7144  C  CB    . ILE A 1 959  ? -18.54500 9.63600   -30.78400 1.000 85.58649  ? 959  ILE A CB    1 
ATOM   7145  C  CG1   . ILE A 1 959  ? -18.36800 10.80200  -29.80800 1.000 104.28151 ? 959  ILE A CG1   1 
ATOM   7146  C  CG2   . ILE A 1 959  ? -18.80000 10.14900  -32.19200 1.000 88.06450  ? 959  ILE A CG2   1 
ATOM   7147  C  CD1   . ILE A 1 959  ? -16.99100 11.42600  -29.85200 1.000 106.65170 ? 959  ILE A CD1   1 
ATOM   7148  N  N     . ASP A 1 960  ? -19.11000 6.67200   -29.13700 1.000 87.53903  ? 960  ASP A N     1 
ATOM   7149  C  CA    . ASP A 1 960  ? -18.82900 5.86400   -27.96200 1.000 89.30909  ? 960  ASP A CA    1 
ATOM   7150  C  C     . ASP A 1 960  ? -18.02800 4.64100   -28.39000 1.000 90.14915  ? 960  ASP A C     1 
ATOM   7151  O  O     . ASP A 1 960  ? -17.75400 4.43600   -29.57600 1.000 92.93970  ? 960  ASP A O     1 
ATOM   7152  C  CB    . ASP A 1 960  ? -20.12300 5.47300   -27.24300 1.000 88.17156  ? 960  ASP A CB    1 
ATOM   7153  C  CG    . ASP A 1 960  ? -19.92300 5.27700   -25.75500 1.000 93.36879  ? 960  ASP A CG    1 
ATOM   7154  O  OD1   . ASP A 1 960  ? -18.77700 5.00000   -25.34400 1.000 91.70266  ? 960  ASP A OD1   1 
ATOM   7155  O  OD2   . ASP A 1 960  ? -20.90800 5.40000   -24.99700 1.000 89.76189  ? 960  ASP A OD2   1 
ATOM   7156  N  N     . GLN A 1 961  ? -17.65700 3.82100   -27.40900 1.000 90.07183  ? 961  GLN A N     1 
ATOM   7157  C  CA    . GLN A 1 961  ? -16.78100 2.67800   -27.62200 1.000 87.85285  ? 961  GLN A CA    1 
ATOM   7158  C  C     . GLN A 1 961  ? -17.47700 1.40300   -27.16700 1.000 87.75245  ? 961  GLN A C     1 
ATOM   7159  O  O     . GLN A 1 961  ? -18.00500 1.34200   -26.05100 1.000 89.78430  ? 961  GLN A O     1 
ATOM   7160  C  CB    . GLN A 1 961  ? -15.46000 2.86200   -26.86900 1.000 92.07359  ? 961  GLN A CB    1 
ATOM   7161  C  CG    . GLN A 1 961  ? -14.24700 2.28700   -27.57700 1.000 92.88193  ? 961  GLN A CG    1 
ATOM   7162  C  CD    . GLN A 1 961  ? -13.03900 2.18700   -26.66700 1.000 89.73379  ? 961  GLN A CD    1 
ATOM   7163  O  OE1   . GLN A 1 961  ? -13.13700 1.71200   -25.53600 1.000 89.60727  ? 961  GLN A OE1   1 
ATOM   7164  N  NE2   . GLN A 1 961  ? -11.89100 2.64000   -27.15700 1.000 90.20897  ? 961  GLN A NE2   1 
ATOM   7165  N  N     . THR A 1 962  ? -17.47400 0.39200   -28.03300 1.000 83.48341  ? 962  THR A N     1 
ATOM   7166  C  CA    . THR A 1 962  ? -18.03400 -0.90400  -27.69600 1.000 85.80456  ? 962  THR A CA    1 
ATOM   7167  C  C     . THR A 1 962  ? -17.09800 -1.65100  -26.74300 1.000 87.83098  ? 962  THR A C     1 
ATOM   7168  O  O     . THR A 1 962  ? -15.93200 -1.28000  -26.59300 1.000 90.66723  ? 962  THR A O     1 
ATOM   7169  C  CB    . THR A 1 962  ? -18.26400 -1.72000  -28.96700 1.000 82.49512  ? 962  THR A CB    1 
ATOM   7170  O  OG1   . THR A 1 962  ? -17.02600 -1.86400  -29.67100 1.000 85.68432  ? 962  THR A OG1   1 
ATOM   7171  C  CG2   . THR A 1 962  ? -19.28200 -1.03500  -29.86600 1.000 85.09330  ? 962  THR A CG2   1 
ATOM   7172  N  N     . PRO A 1 963  ? -17.59200 -2.69900  -26.07200 1.000 86.22874  ? 963  PRO A N     1 
ATOM   7173  C  CA    . PRO A 1 963  ? -16.70400 -3.47200  -25.18500 1.000 85.73418  ? 963  PRO A CA    1 
ATOM   7174  C  C     . PRO A 1 963  ? -15.48600 -4.05200  -25.88700 1.000 85.85221  ? 963  PRO A C     1 
ATOM   7175  O  O     . PRO A 1 963  ? -14.44800 -4.24700  -25.24100 1.000 91.63707  ? 963  PRO A O     1 
ATOM   7176  C  CB    . PRO A 1 963  ? -17.62200 -4.57700  -24.64000 1.000 82.98076  ? 963  PRO A CB    1 
ATOM   7177  C  CG    . PRO A 1 963  ? -18.99700 -4.03700  -24.77400 1.000 83.65012  ? 963  PRO A CG    1 
ATOM   7178  C  CD    . PRO A 1 963  ? -18.99800 -3.13400  -25.96600 1.000 84.13419  ? 963  PRO A CD    1 
ATOM   7179  N  N     . TYR A 1 964  ? -15.57400 -4.32800  -27.18700 1.000 85.33854  ? 964  TYR A N     1 
ATOM   7180  C  CA    . TYR A 1 964  ? -14.44700 -4.82800  -27.96300 1.000 87.94468  ? 964  TYR A CA    1 
ATOM   7181  C  C     . TYR A 1 964  ? -13.62900 -3.70400  -28.58900 1.000 85.29743  ? 964  TYR A C     1 
ATOM   7182  O  O     . TYR A 1 964  ? -12.90700 -3.94200  -29.56400 1.000 84.12328  ? 964  TYR A O     1 
ATOM   7183  C  CB    . TYR A 1 964  ? -14.93400 -5.79900  -29.04300 1.000 87.27632  ? 964  TYR A CB    1 
ATOM   7184  C  CG    . TYR A 1 964  ? -16.32500 -5.50200  -29.55600 1.000 81.77081  ? 964  TYR A CG    1 
ATOM   7185  C  CD1   . TYR A 1 964  ? -17.44800 -5.97500  -28.89100 1.000 76.48210  ? 964  TYR A CD1   1 
ATOM   7186  C  CD2   . TYR A 1 964  ? -16.51500 -4.75900  -30.71300 1.000 85.83590  ? 964  TYR A CD2   1 
ATOM   7187  C  CE1   . TYR A 1 964  ? -18.71400 -5.70200  -29.35300 1.000 84.41626  ? 964  TYR A CE1   1 
ATOM   7188  C  CE2   . TYR A 1 964  ? -17.78300 -4.48700  -31.18800 1.000 77.76448  ? 964  TYR A CE2   1 
ATOM   7189  C  CZ    . TYR A 1 964  ? -18.88000 -4.96100  -30.50300 1.000 83.94010  ? 964  TYR A CZ    1 
ATOM   7190  O  OH    . TYR A 1 964  ? -20.14600 -4.69300  -30.97000 1.000 86.07958  ? 964  TYR A OH    1 
ATOM   7191  N  N     . LYS A 1 965  ? -13.74600 -2.48600  -28.05600 1.000 87.39189  ? 965  LYS A N     1 
ATOM   7192  C  CA    . LYS A 1 965  ? -12.91200 -1.34600  -28.43700 1.000 93.16541  ? 965  LYS A CA    1 
ATOM   7193  C  C     . LYS A 1 965  ? -13.13400 -0.92800  -29.88800 1.000 87.76567  ? 965  LYS A C     1 
ATOM   7194  O  O     . LYS A 1 965  ? -12.20600 -0.47400  -30.56200 1.000 89.86835  ? 965  LYS A O     1 
ATOM   7195  C  CB    . LYS A 1 965  ? -11.42300 -1.62200  -28.17900 1.000 97.05325  ? 965  LYS A CB    1 
ATOM   7196  C  CG    . LYS A 1 965  ? -10.99300 -1.54100  -26.70600 1.000 92.47253  ? 965  LYS A CG    1 
ATOM   7197  C  CD    . LYS A 1 965  ? -11.67400 -2.59100  -25.83000 1.000 89.80631  ? 965  LYS A CD    1 
ATOM   7198  C  CE    . LYS A 1 965  ? -10.93900 -2.80400  -24.51700 1.000 105.51504 ? 965  LYS A CE    1 
ATOM   7199  N  NZ    . LYS A 1 965  ? -10.51500 -1.51400  -23.90600 1.000 112.40717 ? 965  LYS A NZ    1 
ATOM   7200  N  N     . GLN A 1 966  ? -14.36300 -1.07600  -30.37600 1.000 86.87175  ? 966  GLN A N     1 
ATOM   7201  C  CA    . GLN A 1 966  ? -14.76800 -0.58700  -31.68600 1.000 92.92728  ? 966  GLN A CA    1 
ATOM   7202  C  C     . GLN A 1 966  ? -15.63600 0.65000   -31.50200 1.000 86.16257  ? 966  GLN A C     1 
ATOM   7203  O  O     . GLN A 1 966  ? -16.59500 0.62900   -30.72400 1.000 89.79012  ? 966  GLN A O     1 
ATOM   7204  C  CB    . GLN A 1 966  ? -15.53700 -1.65900  -32.46200 1.000 85.32907  ? 966  GLN A CB    1 
ATOM   7205  C  CG    . GLN A 1 966  ? -16.34200 -1.12100  -33.63700 1.000 85.29783  ? 966  GLN A CG    1 
ATOM   7206  C  CD    . GLN A 1 966  ? -16.38500 -2.08300  -34.80800 1.000 83.29482  ? 966  GLN A CD    1 
ATOM   7207  O  OE1   . GLN A 1 966  ? -16.32500 -3.29800  -34.62900 1.000 86.96626  ? 966  GLN A OE1   1 
ATOM   7208  N  NE2   . GLN A 1 966  ? -16.49400 -1.54200  -36.01600 1.000 77.31749  ? 966  GLN A NE2   1 
ATOM   7209  N  N     . GLU A 1 967  ? -15.29700 1.72300   -32.21000 1.000 78.47389  ? 967  GLU A N     1 
ATOM   7210  C  CA    . GLU A 1 967  ? -16.07400 2.94900   -32.12200 1.000 91.69230  ? 967  GLU A CA    1 
ATOM   7211  C  C     . GLU A 1 967  ? -17.36400 2.81200   -32.92400 1.000 92.50512  ? 967  GLU A C     1 
ATOM   7212  O  O     . GLU A 1 967  ? -17.42400 2.10200   -33.93200 1.000 96.91362  ? 967  GLU A O     1 
ATOM   7213  C  CB    . GLU A 1 967  ? -15.25100 4.14500   -32.61800 1.000 100.20611 ? 967  GLU A CB    1 
ATOM   7214  C  CG    . GLU A 1 967  ? -15.11500 4.27700   -34.13600 1.000 109.64689 ? 967  GLU A CG    1 
ATOM   7215  C  CD    . GLU A 1 967  ? -16.23900 5.08100   -34.77300 1.000 108.25224 ? 967  GLU A CD    1 
ATOM   7216  O  OE1   . GLU A 1 967  ? -17.13700 5.54600   -34.03900 1.000 112.15832 ? 967  GLU A OE1   1 
ATOM   7217  O  OE2   . GLU A 1 967  ? -16.22600 5.24500   -36.01200 1.000 101.17412 ? 967  GLU A OE2   1 
ATOM   7218  N  N     . ILE A 1 968  ? -18.40600 3.49300   -32.45500 1.000 91.15086  ? 968  ILE A N     1 
ATOM   7219  C  CA    . ILE A 1 968  ? -19.69600 3.51900   -33.12900 1.000 87.81416  ? 968  ILE A CA    1 
ATOM   7220  C  C     . ILE A 1 968  ? -20.18300 4.95700   -33.19700 1.000 88.44182  ? 968  ILE A C     1 
ATOM   7221  O  O     . ILE A 1 968  ? -19.85100 5.78800   -32.34500 1.000 93.85243  ? 968  ILE A O     1 
ATOM   7222  C  CB    . ILE A 1 968  ? -20.74700 2.62900   -32.42600 1.000 86.24850  ? 968  ILE A CB    1 
ATOM   7223  C  CG1   . ILE A 1 968  ? -20.88000 3.01600   -30.95100 1.000 88.09251  ? 968  ILE A CG1   1 
ATOM   7224  C  CG2   . ILE A 1 968  ? -20.39200 1.16000   -32.57400 1.000 82.04369  ? 968  ILE A CG2   1 
ATOM   7225  C  CD1   . ILE A 1 968  ? -21.90900 2.20000   -30.19800 1.000 88.24608  ? 968  ILE A CD1   1 
ATOM   7226  N  N     . ASN A 1 969  ? -20.97100 5.25100   -34.22600 1.000 90.51916  ? 969  ASN A N     1 
ATOM   7227  C  CA    . ASN A 1 969  ? -21.60700 6.55300   -34.39700 1.000 90.58435  ? 969  ASN A CA    1 
ATOM   7228  C  C     . ASN A 1 969  ? -23.10100 6.35200   -34.16300 1.000 95.31864  ? 969  ASN A C     1 
ATOM   7229  O  O     . ASN A 1 969  ? -23.88200 6.15700   -35.09500 1.000 97.55162  ? 969  ASN A O     1 
ATOM   7230  C  CB    . ASN A 1 969  ? -21.31300 7.13500   -35.78400 1.000 83.87046  ? 969  ASN A CB    1 
ATOM   7231  C  CG    . ASN A 1 969  ? -22.01900 8.45500   -36.02500 1.000 88.14450  ? 969  ASN A CG    1 
ATOM   7232  O  OD1   . ASN A 1 969  ? -22.35600 9.17400   -35.08400 1.000 88.44782  ? 969  ASN A OD1   1 
ATOM   7233  N  ND2   . ASN A 1 969  ? -22.24400 8.78200   -37.29200 1.000 92.87052  ? 969  ASN A ND2   1 
ATOM   7234  N  N     . ALA A 1 970  ? -23.49700 6.39900   -32.89100 1.000 88.90393  ? 970  ALA A N     1 
ATOM   7235  C  CA    . ALA A 1 970  ? -24.87600 6.13100   -32.50300 1.000 85.35658  ? 970  ALA A CA    1 
ATOM   7236  C  C     . ALA A 1 970  ? -25.76800 7.34800   -32.71600 1.000 90.65101  ? 970  ALA A C     1 
ATOM   7237  O  O     . ALA A 1 970  ? -26.75100 7.53600   -31.99200 1.000 86.09052  ? 970  ALA A O     1 
ATOM   7238  C  CB    . ALA A 1 970  ? -24.93800 5.67900   -31.04300 1.000 81.09526  ? 970  ALA A CB    1 
ATOM   7239  N  N     . LYS A 1 971  ? -25.43300 8.18200   -33.70500 1.000 92.63826  ? 971  LYS A N     1 
ATOM   7240  C  CA    . LYS A 1 971  ? -26.28800 9.31800   -34.03300 1.000 89.63726  ? 971  LYS A CA    1 
ATOM   7241  C  C     . LYS A 1 971  ? -27.65300 8.85000   -34.52100 1.000 95.97983  ? 971  LYS A C     1 
ATOM   7242  O  O     . LYS A 1 971  ? -28.68300 9.43400   -34.16600 1.000 95.27850  ? 971  LYS A O     1 
ATOM   7243  C  CB    . LYS A 1 971  ? -25.60700 10.19700  -35.08300 1.000 90.59806  ? 971  LYS A CB    1 
ATOM   7244  C  CG    . LYS A 1 971  ? -26.46000 11.35200  -35.58800 1.000 93.28270  ? 971  LYS A CG    1 
ATOM   7245  C  CD    . LYS A 1 971  ? -26.90000 11.12200  -37.02500 1.000 100.38589 ? 971  LYS A CD    1 
ATOM   7246  C  CE    . LYS A 1 971  ? -27.80600 12.23900  -37.51400 1.000 95.70216  ? 971  LYS A CE    1 
ATOM   7247  N  NZ    . LYS A 1 971  ? -28.30700 11.98500  -38.89400 1.000 92.43623  ? 971  LYS A NZ    1 
ATOM   7248  N  N     . ASN A 1 972  ? -27.68100 7.79300   -35.33400 1.000 93.86063  ? 972  ASN A N     1 
ATOM   7249  C  CA    . ASN A 1 972  ? -28.94400 7.21500   -35.77300 1.000 90.87021  ? 972  ASN A CA    1 
ATOM   7250  C  C     . ASN A 1 972  ? -29.60300 6.36900   -34.69200 1.000 89.18234  ? 972  ASN A C     1 
ATOM   7251  O  O     . ASN A 1 972  ? -30.80800 6.11000   -34.77600 1.000 94.26034  ? 972  ASN A O     1 
ATOM   7252  C  CB    . ASN A 1 972  ? -28.72800 6.37200   -37.03100 1.000 85.05177  ? 972  ASN A CB    1 
ATOM   7253  C  CG    . ASN A 1 972  ? -28.46400 7.21800   -38.26100 1.000 92.43411  ? 972  ASN A CG    1 
ATOM   7254  O  OD1   . ASN A 1 972  ? -28.41800 8.44600   -38.18500 1.000 98.67911  ? 972  ASN A OD1   1 
ATOM   7255  N  ND2   . ASN A 1 972  ? -28.28500 6.56500   -39.40300 1.000 91.48606  ? 972  ASN A ND2   1 
ATOM   7256  N  N     . LEU A 1 973  ? -28.84300 5.93600   -33.68400 1.000 82.38315  ? 973  LEU A N     1 
ATOM   7257  C  CA    . LEU A 1 973  ? -29.42500 5.15300   -32.59900 1.000 83.61100  ? 973  LEU A CA    1 
ATOM   7258  C  C     . LEU A 1 973  ? -30.31200 6.01800   -31.71400 1.000 87.65979  ? 973  LEU A C     1 
ATOM   7259  O  O     . LEU A 1 973  ? -31.44600 5.64000   -31.39500 1.000 82.77227  ? 973  LEU A O     1 
ATOM   7260  C  CB    . LEU A 1 973  ? -28.31700 4.49900   -31.77400 1.000 80.44309  ? 973  LEU A CB    1 
ATOM   7261  C  CG    . LEU A 1 973  ? -28.75000 3.80000   -30.48500 1.000 70.48584  ? 973  LEU A CG    1 
ATOM   7262  C  CD1   . LEU A 1 973  ? -29.72000 2.66500   -30.78200 1.000 79.87522  ? 973  LEU A CD1   1 
ATOM   7263  C  CD2   . LEU A 1 973  ? -27.53700 3.29300   -29.72200 1.000 73.95412  ? 973  LEU A CD2   1 
ATOM   7264  N  N     . ILE A 1 974  ? -29.81000 7.18500   -31.30200 1.000 94.19179  ? 974  ILE A N     1 
ATOM   7265  C  CA    . ILE A 1 974  ? -30.61400 8.08400   -30.48200 1.000 89.71594  ? 974  ILE A CA    1 
ATOM   7266  C  C     . ILE A 1 974  ? -31.77600 8.65200   -31.28600 1.000 85.57496  ? 974  ILE A C     1 
ATOM   7267  O  O     . ILE A 1 974  ? -32.84000 8.94400   -30.72900 1.000 86.40655  ? 974  ILE A O     1 
ATOM   7268  C  CB    . ILE A 1 974  ? -29.73300 9.20100   -29.88800 1.000 88.28135  ? 974  ILE A CB    1 
ATOM   7269  C  CG1   . ILE A 1 974  ? -28.93600 9.91100   -30.98700 1.000 93.74801  ? 974  ILE A CG1   1 
ATOM   7270  C  CG2   . ILE A 1 974  ? -28.79200 8.63900   -28.83600 1.000 72.01922  ? 974  ILE A CG2   1 
ATOM   7271  C  CD1   . ILE A 1 974  ? -29.55100 11.21200  -31.45900 1.000 80.77397  ? 974  ILE A CD1   1 
ATOM   7272  N  N     . GLN A 1 975  ? -31.60200 8.81100   -32.60100 1.000 85.13508  ? 975  GLN A N     1 
ATOM   7273  C  CA    . GLN A 1 975  ? -32.67200 9.36100   -33.42500 1.000 83.96109  ? 975  GLN A CA    1 
ATOM   7274  C  C     . GLN A 1 975  ? -33.80500 8.36100   -33.61600 1.000 91.48983  ? 975  GLN A C     1 
ATOM   7275  O  O     . GLN A 1 975  ? -34.96700 8.76200   -33.74400 1.000 94.53685  ? 975  GLN A O     1 
ATOM   7276  C  CB    . GLN A 1 975  ? -32.11500 9.80700   -34.77700 1.000 87.52518  ? 975  GLN A CB    1 
ATOM   7277  C  CG    . GLN A 1 975  ? -33.08200 10.63500  -35.60400 1.000 91.39767  ? 975  GLN A CG    1 
ATOM   7278  C  CD    . GLN A 1 975  ? -32.45400 11.16000  -36.88000 1.000 103.11529 ? 975  GLN A CD    1 
ATOM   7279  O  OE1   . GLN A 1 975  ? -31.27100 10.93800  -37.14000 1.000 111.31604 ? 975  GLN A OE1   1 
ATOM   7280  N  NE2   . GLN A 1 975  ? -33.24400 11.86400  -37.68200 1.000 92.05447  ? 975  GLN A NE2   1 
ATOM   7281  N  N     . CYS A 1 976  ? -33.49100 7.06400   -33.64000 1.000 91.73706  ? 976  CYS A N     1 
ATOM   7282  C  CA    . CYS A 1 976  ? -34.54200 6.05500   -33.71300 1.000 84.95096  ? 976  CYS A CA    1 
ATOM   7283  C  C     . CYS A 1 976  ? -35.37700 6.04100   -32.43900 1.000 83.34390  ? 976  CYS A C     1 
ATOM   7284  O  O     . CYS A 1 976  ? -36.60000 5.87100   -32.49200 1.000 80.64045  ? 976  CYS A O     1 
ATOM   7285  C  CB    . CYS A 1 976  ? -33.93400 4.67500   -33.96700 1.000 83.87677  ? 976  CYS A CB    1 
ATOM   7286  S  SG    . CYS A 1 976  ? -33.40500 4.38100   -35.66900 1.000 90.08599  ? 976  CYS A SG    1 
ATOM   7287  N  N     . TRP A 1 977  ? -34.73200 6.22600   -31.28500 1.000 88.70866  ? 977  TRP A N     1 
ATOM   7288  C  CA    . TRP A 1 977  ? -35.45100 6.19700   -30.01600 1.000 83.68601  ? 977  TRP A CA    1 
ATOM   7289  C  C     . TRP A 1 977  ? -36.37600 7.39900   -29.87200 1.000 81.96815  ? 977  TRP A C     1 
ATOM   7290  O  O     . TRP A 1 977  ? -37.48600 7.27300   -29.34300 1.000 82.95899  ? 977  TRP A O     1 
ATOM   7291  C  CB    . TRP A 1 977  ? -34.45500 6.14100   -28.85700 1.000 83.09160  ? 977  TRP A CB    1 
ATOM   7292  C  CG    . TRP A 1 977  ? -35.09200 6.16200   -27.50100 1.000 80.72167  ? 977  TRP A CG    1 
ATOM   7293  C  CD1   . TRP A 1 977  ? -35.39900 7.26400   -26.75600 1.000 83.38532  ? 977  TRP A CD1   1 
ATOM   7294  C  CD2   . TRP A 1 977  ? -35.49900 5.02800   -26.72700 1.000 84.31568  ? 977  TRP A CD2   1 
ATOM   7295  N  NE1   . TRP A 1 977  ? -35.97200 6.88600   -25.56600 1.000 83.14917  ? 977  TRP A NE1   1 
ATOM   7296  C  CE2   . TRP A 1 977  ? -36.04500 5.51800   -25.52300 1.000 84.96962  ? 977  TRP A CE2   1 
ATOM   7297  C  CE3   . TRP A 1 977  ? -35.45600 3.64600   -26.93400 1.000 84.94266  ? 977  TRP A CE3   1 
ATOM   7298  C  CZ2   . TRP A 1 977  ? -36.54300 4.67500   -24.53200 1.000 80.35709  ? 977  TRP A CZ2   1 
ATOM   7299  C  CZ3   . TRP A 1 977  ? -35.95200 2.81100   -25.94800 1.000 79.93313  ? 977  TRP A CZ3   1 
ATOM   7300  C  CH2   . TRP A 1 977  ? -36.48800 3.32800   -24.76300 1.000 76.78052  ? 977  TRP A CH2   1 
ATOM   7301  N  N     . ARG A 1 978  ? -35.94100 8.57200   -30.34000 1.000 82.82717  ? 978  ARG A N     1 
ATOM   7302  C  CA    . ARG A 1 978  ? -36.75400 9.77200   -30.17200 1.000 86.97202  ? 978  ARG A CA    1 
ATOM   7303  C  C     . ARG A 1 978  ? -37.93400 9.78800   -31.13600 1.000 88.92933  ? 978  ARG A C     1 
ATOM   7304  O  O     . ARG A 1 978  ? -39.04200 10.18800  -30.75800 1.000 84.75090  ? 978  ARG A O     1 
ATOM   7305  C  CB    . ARG A 1 978  ? -35.89400 11.02300  -30.34800 1.000 81.21375  ? 978  ARG A CB    1 
ATOM   7306  C  CG    . ARG A 1 978  ? -34.77700 11.14400  -29.32500 1.000 86.39918  ? 978  ARG A CG    1 
ATOM   7307  C  CD    . ARG A 1 978  ? -34.67800 12.55600  -28.76800 1.000 84.48456  ? 978  ARG A CD    1 
ATOM   7308  N  NE    . ARG A 1 978  ? -33.62600 12.67000  -27.76100 1.000 93.29950  ? 978  ARG A NE    1 
ATOM   7309  C  CZ    . ARG A 1 978  ? -33.75600 12.27900  -26.49700 1.000 88.49465  ? 978  ARG A CZ    1 
ATOM   7310  N  NH1   . ARG A 1 978  ? -34.89600 11.74700  -26.07600 1.000 75.60684  ? 978  ARG A NH1   1 
ATOM   7311  N  NH2   . ARG A 1 978  ? -32.74600 12.42100  -25.64900 1.000 80.67354  ? 978  ARG A NH2   1 
ATOM   7312  N  N     . GLU A 1 979  ? -37.72200 9.35800   -32.38200 1.000 89.59907  ? 979  GLU A N     1 
ATOM   7313  C  CA    . GLU A 1 979  ? -38.82000 9.36000   -33.34500 1.000 91.13612  ? 979  GLU A CA    1 
ATOM   7314  C  C     . GLU A 1 979  ? -39.84800 8.28600   -33.01200 1.000 87.50118  ? 979  GLU A C     1 
ATOM   7315  O  O     . GLU A 1 979  ? -41.05300 8.49900   -33.18700 1.000 90.41260  ? 979  GLU A O     1 
ATOM   7316  C  CB    . GLU A 1 979  ? -38.28700 9.17500   -34.76500 1.000 83.40336  ? 979  GLU A CB    1 
ATOM   7317  C  CG    . GLU A 1 979  ? -39.38100 9.17700   -35.82400 1.000 93.11805  ? 979  GLU A CG    1 
ATOM   7318  C  CD    . GLU A 1 979  ? -38.84200 9.05500   -37.23500 1.000 113.14782 ? 979  GLU A CD    1 
ATOM   7319  O  OE1   . GLU A 1 979  ? -37.61200 9.16400   -37.41800 1.000 118.24113 ? 979  GLU A OE1   1 
ATOM   7320  O  OE2   . GLU A 1 979  ? -39.65400 8.85400   -38.16300 1.000 115.84837 ? 979  GLU A OE2   1 
ATOM   7321  N  N     . CYS A 1 980  ? -39.39300 7.12700   -32.52700 1.000 82.99334  ? 980  CYS A N     1 
ATOM   7322  C  CA    . CYS A 1 980  ? -40.32800 6.08500   -32.11400 1.000 79.04139  ? 980  CYS A CA    1 
ATOM   7323  C  C     . CYS A 1 980  ? -41.20500 6.56100   -30.96300 1.000 82.63981  ? 980  CYS A C     1 
ATOM   7324  O  O     . CYS A 1 980  ? -42.38900 6.21400   -30.88900 1.000 79.98092  ? 980  CYS A O     1 
ATOM   7325  C  CB    . CYS A 1 980  ? -39.56600 4.82000   -31.72200 1.000 86.15669  ? 980  CYS A CB    1 
ATOM   7326  S  SG    . CYS A 1 980  ? -40.61000 3.36400   -31.47400 1.000 86.42388  ? 980  CYS A SG    1 
ATOM   7327  N  N     . MET A 1 981  ? -40.63700 7.36000   -30.05500 1.000 82.41858  ? 981  MET A N     1 
ATOM   7328  C  CA    . MET A 1 981  ? -41.42900 7.93900   -28.97400 1.000 81.86559  ? 981  MET A CA    1 
ATOM   7329  C  C     . MET A 1 981  ? -42.49300 8.88600   -29.51600 1.000 83.91225  ? 981  MET A C     1 
ATOM   7330  O  O     . MET A 1 981  ? -43.63400 8.88900   -29.04000 1.000 78.41145  ? 981  MET A O     1 
ATOM   7331  C  CB    . MET A 1 981  ? -40.51400 8.67200   -27.99200 1.000 79.34248  ? 981  MET A CB    1 
ATOM   7332  C  CG    . MET A 1 981  ? -39.77600 7.76800   -27.01900 1.000 76.20177  ? 981  MET A CG    1 
ATOM   7333  S  SD    . MET A 1 981  ? -40.73000 7.45500   -25.52300 1.000 80.87702  ? 981  MET A SD    1 
ATOM   7334  C  CE    . MET A 1 981  ? -39.56200 6.50500   -24.55700 1.000 78.15983  ? 981  MET A CE    1 
ATOM   7335  N  N     . ALA A 1 982  ? -42.13900 9.69700   -30.51600 1.000 85.23460  ? 982  ALA A N     1 
ATOM   7336  C  CA    . ALA A 1 982  ? -43.08700 10.65800  -31.06700 1.000 81.59698  ? 982  ALA A CA    1 
ATOM   7337  C  C     . ALA A 1 982  ? -44.04700 10.00400  -32.05400 1.000 87.89913  ? 982  ALA A C     1 
ATOM   7338  O  O     . ALA A 1 982  ? -45.22800 10.36400  -32.10500 1.000 88.63188  ? 982  ALA A O     1 
ATOM   7339  C  CB    . ALA A 1 982  ? -42.33800 11.81000  -31.73700 1.000 81.77952  ? 982  ALA A CB    1 
ATOM   7340  N  N     . MET A 1 983  ? -43.55800 9.04600   -32.84600 1.000 88.22374  ? 983  MET A N     1 
ATOM   7341  C  CA    . MET A 1 983  ? -44.42100 8.37500   -33.81400 1.000 82.43711  ? 983  MET A CA    1 
ATOM   7342  C  C     . MET A 1 983  ? -45.50000 7.55600   -33.12000 1.000 84.10224  ? 983  MET A C     1 
ATOM   7343  O  O     . MET A 1 983  ? -46.64200 7.49500   -33.59200 1.000 83.74302  ? 983  MET A O     1 
ATOM   7344  C  CB    . MET A 1 983  ? -43.58500 7.48600   -34.73400 1.000 88.90537  ? 983  MET A CB    1 
ATOM   7345  C  CG    . MET A 1 983  ? -44.35700 6.88700   -35.89700 1.000 105.79845 ? 983  MET A CG    1 
ATOM   7346  S  SD    . MET A 1 983  ? -43.40600 5.63600   -36.78000 1.000 100.53748 ? 983  MET A SD    1 
ATOM   7347  C  CE    . MET A 1 983  ? -43.37600 4.31800   -35.56900 1.000 76.65388  ? 983  MET A CE    1 
ATOM   7348  N  N     . SER A 1 984  ? -45.16100 6.92500   -31.99800 1.000 84.87838  ? 984  SER A N     1 
ATOM   7349  C  CA    . SER A 1 984  ? -46.10000 6.08900   -31.26500 1.000 82.22871  ? 984  SER A CA    1 
ATOM   7350  C  C     . SER A 1 984  ? -46.91100 6.85800   -30.23300 1.000 83.03751  ? 984  SER A C     1 
ATOM   7351  O  O     . SER A 1 984  ? -47.89800 6.31500   -29.72300 1.000 82.03121  ? 984  SER A O     1 
ATOM   7352  C  CB    . SER A 1 984  ? -45.35500 4.94800   -30.56500 1.000 80.75157  ? 984  SER A CB    1 
ATOM   7353  O  OG    . SER A 1 984  ? -44.47400 5.44500   -29.57400 1.000 75.99478  ? 984  SER A OG    1 
ATOM   7354  N  N     . SER A 1 985  ? -46.52900 8.09700   -29.92400 1.000 86.16586  ? 985  SER A N     1 
ATOM   7355  C  CA    . SER A 1 985  ? -47.14300 8.87900   -28.85100 1.000 85.42971  ? 985  SER A CA    1 
ATOM   7356  C  C     . SER A 1 985  ? -47.10300 8.09300   -27.54000 1.000 79.71209  ? 985  SER A C     1 
ATOM   7357  O  O     . SER A 1 985  ? -48.12600 7.70500   -26.97300 1.000 76.63621  ? 985  SER A O     1 
ATOM   7358  C  CB    . SER A 1 985  ? -48.57400 9.28700   -29.21600 1.000 84.17037  ? 985  SER A CB    1 
ATOM   7359  O  OG    . SER A 1 985  ? -48.60400 9.97400   -30.45500 1.000 86.11345  ? 985  SER A OG    1 
ATOM   7360  N  N     . TYR A 1 986  ? -45.87600 7.86500   -27.06700 1.000 78.90457  ? 986  TYR A N     1 
ATOM   7361  C  CA    . TYR A 1 986  ? -45.65300 6.93500   -25.96500 1.000 78.16751  ? 986  TYR A CA    1 
ATOM   7362  C  C     . TYR A 1 986  ? -46.23700 7.46100   -24.65800 1.000 86.30392  ? 986  TYR A C     1 
ATOM   7363  O  O     . TYR A 1 986  ? -47.07500 6.80300   -24.03100 1.000 81.79578  ? 986  TYR A O     1 
ATOM   7364  C  CB    . TYR A 1 986  ? -44.15700 6.65900   -25.81600 1.000 74.67448  ? 986  TYR A CB    1 
ATOM   7365  C  CG    . TYR A 1 986  ? -43.81900 5.72200   -24.68000 1.000 78.61035  ? 986  TYR A CG    1 
ATOM   7366  C  CD1   . TYR A 1 986  ? -43.87500 4.34600   -24.84900 1.000 80.84056  ? 986  TYR A CD1   1 
ATOM   7367  C  CD2   . TYR A 1 986  ? -43.44300 6.21400   -23.43600 1.000 83.74358  ? 986  TYR A CD2   1 
ATOM   7368  C  CE1   . TYR A 1 986  ? -43.56600 3.48600   -23.81400 1.000 81.42970  ? 986  TYR A CE1   1 
ATOM   7369  C  CE2   . TYR A 1 986  ? -43.13500 5.36300   -22.39500 1.000 85.02297  ? 986  TYR A CE2   1 
ATOM   7370  C  CZ    . TYR A 1 986  ? -43.19800 4.00000   -22.58900 1.000 87.82417  ? 986  TYR A CZ    1 
ATOM   7371  O  OH    . TYR A 1 986  ? -42.89300 3.14900   -21.55400 1.000 94.40706  ? 986  TYR A OH    1 
ATOM   7372  N  N     . SER A 1 987  ? -45.79400 8.64600   -24.22600 1.000 91.88024  ? 987  SER A N     1 
ATOM   7373  C  CA    . SER A 1 987  ? -46.20800 9.16500   -22.92500 1.000 80.83245  ? 987  SER A CA    1 
ATOM   7374  C  C     . SER A 1 987  ? -47.71900 9.33500   -22.83700 1.000 86.97637  ? 987  SER A C     1 
ATOM   7375  O  O     . SER A 1 987  ? -48.30300 9.13800   -21.76500 1.000 90.24292  ? 987  SER A O     1 
ATOM   7376  C  CB    . SER A 1 987  ? -45.50700 10.49300  -22.63900 1.000 81.88022  ? 987  SER A CB    1 
ATOM   7377  O  OG    . SER A 1 987  ? -44.10200 10.32400  -22.57700 1.000 86.94626  ? 987  SER A OG    1 
ATOM   7378  N  N     . LEU A 1 988  ? -48.36800 9.69700   -23.94700 1.000 80.21209  ? 988  LEU A N     1 
ATOM   7379  C  CA    . LEU A 1 988  ? -49.82400 9.79000   -23.94800 1.000 79.16171  ? 988  LEU A CA    1 
ATOM   7380  C  C     . LEU A 1 988  ? -50.47100 8.42700   -23.74200 1.000 87.13649  ? 988  LEU A C     1 
ATOM   7381  O  O     . LEU A 1 988  ? -51.55700 8.33800   -23.15700 1.000 88.20878  ? 988  LEU A O     1 
ATOM   7382  C  CB    . LEU A 1 988  ? -50.31000 10.41600  -25.25500 1.000 80.66175  ? 988  LEU A CB    1 
ATOM   7383  C  CG    . LEU A 1 988  ? -50.25000 11.94200  -25.34400 1.000 95.69894  ? 988  LEU A CG    1 
ATOM   7384  C  CD1   . LEU A 1 988  ? -50.40300 12.39800  -26.78700 1.000 91.54408  ? 988  LEU A CD1   1 
ATOM   7385  C  CD2   . LEU A 1 988  ? -51.32100 12.56900  -24.46400 1.000 78.67588  ? 988  LEU A CD2   1 
ATOM   7386  N  N     . ARG A 1 989  ? -49.82300 7.35900   -24.20700 1.000 84.00967  ? 989  ARG A N     1 
ATOM   7387  C  CA    . ARG A 1 989  ? -50.35200 6.01300   -24.04500 1.000 80.68230  ? 989  ARG A CA    1 
ATOM   7388  C  C     . ARG A 1 989  ? -49.87800 5.33600   -22.76800 1.000 82.45615  ? 989  ARG A C     1 
ATOM   7389  O  O     . ARG A 1 989  ? -50.51300 4.37300   -22.32400 1.000 86.86531  ? 989  ARG A O     1 
ATOM   7390  C  CB    . ARG A 1 989  ? -49.97500 5.14900   -25.25100 1.000 79.63345  ? 989  ARG A CB    1 
ATOM   7391  C  CG    . ARG A 1 989  ? -50.76300 5.47500   -26.50800 1.000 82.62154  ? 989  ARG A CG    1 
ATOM   7392  C  CD    . ARG A 1 989  ? -50.05600 4.97000   -27.75300 1.000 79.97081  ? 989  ARG A CD    1 
ATOM   7393  N  NE    . ARG A 1 989  ? -49.79800 3.53500   -27.70100 1.000 77.41964  ? 989  ARG A NE    1 
ATOM   7394  C  CZ    . ARG A 1 989  ? -49.07200 2.87800   -28.59900 1.000 87.88081  ? 989  ARG A CZ    1 
ATOM   7395  N  NH1   . ARG A 1 989  ? -48.52600 3.53000   -29.61800 1.000 92.01559  ? 989  ARG A NH1   1 
ATOM   7396  N  NH2   . ARG A 1 989  ? -48.88600 1.57100   -28.47800 1.000 82.60053  ? 989  ARG A NH2   1 
ATOM   7397  N  N     . LYS A 1 990  ? -48.78300 5.80900   -22.16800 1.000 86.54033  ? 990  LYS A N     1 
ATOM   7398  C  CA    . LYS A 1 990  ? -48.33500 5.22800   -20.90700 1.000 91.11409  ? 990  LYS A CA    1 
ATOM   7399  C  C     . LYS A 1 990  ? -49.27100 5.60600   -19.76600 1.000 96.13170  ? 990  LYS A C     1 
ATOM   7400  O  O     . LYS A 1 990  ? -49.62700 4.75700   -18.94000 1.000 95.09454  ? 990  LYS A O     1 
ATOM   7401  C  CB    . LYS A 1 990  ? -46.90500 5.67000   -20.59700 1.000 82.36553  ? 990  LYS A CB    1 
ATOM   7402  C  CG    . LYS A 1 990  ? -46.30300 4.97900   -19.38400 1.000 78.90999  ? 990  LYS A CG    1 
ATOM   7403  C  CD    . LYS A 1 990  ? -46.31500 3.46800   -19.56000 1.000 91.18090  ? 990  LYS A CD    1 
ATOM   7404  C  CE    . LYS A 1 990  ? -46.17100 2.75000   -18.22800 1.000 99.73542  ? 990  LYS A CE    1 
ATOM   7405  N  NZ    . LYS A 1 990  ? -46.29000 1.27200   -18.38300 1.000 82.25056  ? 990  LYS A NZ    1 
ATOM   7406  N  N     . VAL A 1 991  ? -49.68400 6.87500   -19.70600 1.000 94.22703  ? 991  VAL A N     1 
ATOM   7407  C  CA    . VAL A 1 991  ? -50.60800 7.30500   -18.66300 1.000 93.36226  ? 991  VAL A CA    1 
ATOM   7408  C  C     . VAL A 1 991  ? -51.97600 6.65800   -18.85100 1.000 92.77330  ? 991  VAL A C     1 
ATOM   7409  O  O     . VAL A 1 991  ? -52.66600 6.35100   -17.87000 1.000 91.17465  ? 991  VAL A O     1 
ATOM   7410  C  CB    . VAL A 1 991  ? -50.69900 8.84400   -18.63700 1.000 83.85310  ? 991  VAL A CB    1 
ATOM   7411  C  CG1   . VAL A 1 991  ? -51.13300 9.38500   -19.99300 1.000 79.06674  ? 991  VAL A CG1   1 
ATOM   7412  C  CG2   . VAL A 1 991  ? -51.64300 9.31300   -17.53600 1.000 84.06806  ? 991  VAL A CG2   1 
ATOM   7413  N  N     . ALA A 1 992  ? -52.38300 6.41900   -20.10000 1.000 92.73145  ? 992  ALA A N     1 
ATOM   7414  C  CA    . ALA A 1 992  ? -53.67700 5.79300   -20.34900 1.000 84.07294  ? 992  ALA A CA    1 
ATOM   7415  C  C     . ALA A 1 992  ? -53.68800 4.34200   -19.88600 1.000 85.09921  ? 992  ALA A C     1 
ATOM   7416  O  O     . ALA A 1 992  ? -54.70600 3.85300   -19.38300 1.000 91.08508  ? 992  ALA A O     1 
ATOM   7417  C  CB    . ALA A 1 992  ? -54.03000 5.88700   -21.83300 1.000 82.55698  ? 992  ALA A CB    1 
ATOM   7418  N  N     . VAL A 1 993  ? -52.56700 3.63800   -20.05000 1.000 83.43961  ? 993  VAL A N     1 
ATOM   7419  C  CA    . VAL A 1 993  ? -52.48700 2.25400   -19.59300 1.000 90.35279  ? 993  VAL A CA    1 
ATOM   7420  C  C     . VAL A 1 993  ? -52.53400 2.19200   -18.07100 1.000 95.46559  ? 993  VAL A C     1 
ATOM   7421  O  O     . VAL A 1 993  ? -53.19300 1.31900   -17.49200 1.000 84.61891  ? 993  VAL A O     1 
ATOM   7422  C  CB    . VAL A 1 993  ? -51.22200 1.58000   -20.15700 1.000 88.55107  ? 993  VAL A CB    1 
ATOM   7423  C  CG1   . VAL A 1 993  ? -50.92600 0.28500   -19.41600 1.000 79.45618  ? 993  VAL A CG1   1 
ATOM   7424  C  CG2   . VAL A 1 993  ? -51.38600 1.31500   -21.64600 1.000 85.69779  ? 993  VAL A CG2   1 
ATOM   7425  N  N     . GLU A 1 994  ? -51.84500 3.11900   -17.39800 1.000 94.45800  ? 994  GLU A N     1 
ATOM   7426  C  CA    . GLU A 1 994  ? -51.93500 3.19200   -15.94400 1.000 90.80339  ? 994  GLU A CA    1 
ATOM   7427  C  C     . GLU A 1 994  ? -53.35500 3.50000   -15.49000 1.000 83.67650  ? 994  GLU A C     1 
ATOM   7428  O  O     . GLU A 1 994  ? -53.77800 3.04400   -14.42100 1.000 84.89352  ? 994  GLU A O     1 
ATOM   7429  C  CB    . GLU A 1 994  ? -50.96500 4.24600   -15.40800 1.000 99.46925  ? 994  GLU A CB    1 
ATOM   7430  C  CG    . GLU A 1 994  ? -49.52000 4.03100   -15.82400 1.000 105.99040 ? 994  GLU A CG    1 
ATOM   7431  C  CD    . GLU A 1 994  ? -48.58900 5.09400   -15.27300 1.000 111.49545 ? 994  GLU A CD    1 
ATOM   7432  O  OE1   . GLU A 1 994  ? -48.68600 5.40500   -14.06700 1.000 118.34277 ? 994  GLU A OE1   1 
ATOM   7433  O  OE2   . GLU A 1 994  ? -47.76300 5.62200   -16.04700 1.000 106.88098 ? 994  GLU A OE2   1 
ATOM   7434  N  N     . LYS A 1 995  ? -54.10300 4.26900   -16.28500 1.000 82.00048  ? 995  LYS A N     1 
ATOM   7435  C  CA    . LYS A 1 995  ? -55.51000 4.50800   -15.97800 1.000 84.65794  ? 995  LYS A CA    1 
ATOM   7436  C  C     . LYS A 1 995  ? -56.32300 3.22500   -16.10000 1.000 86.23675  ? 995  LYS A C     1 
ATOM   7437  O  O     . LYS A 1 995  ? -57.22900 2.97800   -15.29600 1.000 87.73016  ? 995  LYS A O     1 
ATOM   7438  C  CB    . LYS A 1 995  ? -56.06800 5.59000   -16.90300 1.000 82.19448  ? 995  LYS A CB    1 
ATOM   7439  C  CG    . LYS A 1 995  ? -57.54800 5.88300   -16.71100 1.000 79.26539  ? 995  LYS A CG    1 
ATOM   7440  C  CD    . LYS A 1 995  ? -58.00200 7.01400   -17.62200 1.000 80.24749  ? 995  LYS A CD    1 
ATOM   7441  C  CE    . LYS A 1 995  ? -59.46800 7.35100   -17.40000 1.000 90.58883  ? 995  LYS A CE    1 
ATOM   7442  N  NZ    . LYS A 1 995  ? -60.36100 6.20800   -17.74300 1.000 87.40294  ? 995  LYS A NZ    1 
ATOM   7443  N  N     . PHE A 1 996  ? -56.00800 2.39500   -17.09700 1.000 86.60346  ? 996  PHE A N     1 
ATOM   7444  C  CA    . PHE A 1 996  ? -56.73500 1.14300   -17.28300 1.000 83.11731  ? 996  PHE A CA    1 
ATOM   7445  C  C     . PHE A 1 996  ? -56.44400 0.16000   -16.15500 1.000 83.87521  ? 996  PHE A C     1 
ATOM   7446  O  O     . PHE A 1 996  ? -57.35900 -0.50100  -15.65000 1.000 81.89807  ? 996  PHE A O     1 
ATOM   7447  C  CB    . PHE A 1 996  ? -56.37600 0.53200   -18.63800 1.000 86.39895  ? 996  PHE A CB    1 
ATOM   7448  C  CG    . PHE A 1 996  ? -57.17900 -0.69000  -18.99100 1.000 82.48830  ? 996  PHE A CG    1 
ATOM   7449  C  CD1   . PHE A 1 996  ? -58.39500 -0.57100  -19.64200 1.000 77.98399  ? 996  PHE A CD1   1 
ATOM   7450  C  CD2   . PHE A 1 996  ? -56.71100 -1.95700  -18.68200 1.000 82.16260  ? 996  PHE A CD2   1 
ATOM   7451  C  CE1   . PHE A 1 996  ? -59.13400 -1.69200  -19.97000 1.000 74.33846  ? 996  PHE A CE1   1 
ATOM   7452  C  CE2   . PHE A 1 996  ? -57.44500 -3.08200  -19.00800 1.000 81.75554  ? 996  PHE A CE2   1 
ATOM   7453  C  CZ    . PHE A 1 996  ? -58.65800 -2.94900  -19.65300 1.000 78.68917  ? 996  PHE A CZ    1 
ATOM   7454  N  N     . ASN A 1 997  ? -55.17600 0.05100   -15.74800 1.000 87.91058  ? 997  ASN A N     1 
ATOM   7455  C  CA    . ASN A 1 997  ? -54.81100 -0.90200  -14.70400 1.000 87.58206  ? 997  ASN A CA    1 
ATOM   7456  C  C     . ASN A 1 997  ? -55.44600 -0.54600  -13.36700 1.000 85.94845  ? 997  ASN A C     1 
ATOM   7457  O  O     . ASN A 1 997  ? -55.78000 -1.44100  -12.58200 1.000 88.36662  ? 997  ASN A O     1 
ATOM   7458  C  CB    . ASN A 1 997  ? -53.28900 -0.97000  -14.56600 1.000 90.25294  ? 997  ASN A CB    1 
ATOM   7459  C  CG    . ASN A 1 997  ? -52.61100 -1.45800  -15.83100 1.000 89.09641  ? 997  ASN A CG    1 
ATOM   7460  O  OD1   . ASN A 1 997  ? -53.17400 -2.25200  -16.58400 1.000 88.81582  ? 997  ASN A OD1   1 
ATOM   7461  N  ND2   . ASN A 1 997  ? -51.39400 -0.98200  -16.07100 1.000 88.36672  ? 997  ASN A ND2   1 
ATOM   7462  N  N     . ALA A 1 998  ? -55.62100 0.74600   -13.08700 1.000 83.12476  ? 998  ALA A N     1 
ATOM   7463  C  CA    . ALA A 1 998  ? -56.25100 1.16500   -11.84200 1.000 87.17601  ? 998  ALA A CA    1 
ATOM   7464  C  C     . ALA A 1 998  ? -57.76500 1.00500   -11.86700 1.000 92.15678  ? 998  ALA A C     1 
ATOM   7465  O  O     . ALA A 1 998  ? -58.38300 0.92200   -10.80000 1.000 89.50681  ? 998  ALA A O     1 
ATOM   7466  C  CB    . ALA A 1 998  ? -55.89300 2.62100   -11.53400 1.000 84.76312  ? 998  ALA A CB    1 
ATOM   7467  N  N     . GLU A 1 999  ? -58.37200 0.95600   -13.05200 1.000 89.45864  ? 999  GLU A N     1 
ATOM   7468  C  CA    . GLU A 1 999  ? -59.81700 0.81900   -13.17100 1.000 84.59762  ? 999  GLU A CA    1 
ATOM   7469  C  C     . GLU A 1 999  ? -60.27200 -0.62400  -13.33400 1.000 89.94118  ? 999  GLU A C     1 
ATOM   7470  O  O     . GLU A 1 999  ? -61.42400 -0.93500  -13.00900 1.000 93.47840  ? 999  GLU A O     1 
ATOM   7471  C  CB    . GLU A 1 999  ? -60.33100 1.64100   -14.35800 1.000 85.87347  ? 999  GLU A CB    1 
ATOM   7472  C  CG    . GLU A 1 999  ? -60.24800 3.14500   -14.16500 1.000 80.36806  ? 999  GLU A CG    1 
ATOM   7473  C  CD    . GLU A 1 999  ? -60.63700 3.91200   -15.41500 1.000 89.96763  ? 999  GLU A CD    1 
ATOM   7474  O  OE1   . GLU A 1 999  ? -60.43900 3.37800   -16.52700 1.000 91.55234  ? 999  GLU A OE1   1 
ATOM   7475  O  OE2   . GLU A 1 999  ? -61.13700 5.04900   -15.28800 1.000 93.55460  ? 999  GLU A OE2   1 
ATOM   7476  N  N     . ASN A 1 1000 ? -59.40600 -1.50700  -13.82600 1.000 85.62670  ? 1000 ASN A N     1 
ATOM   7477  C  CA    . ASN A 1 1000 ? -59.76700 -2.88800  -14.11000 1.000 81.52653  ? 1000 ASN A CA    1 
ATOM   7478  C  C     . ASN A 1 1000 ? -58.90500 -3.82800  -13.27900 1.000 81.94116  ? 1000 ASN A C     1 
ATOM   7479  O  O     . ASN A 1 1000 ? -57.70200 -3.60200  -13.11400 1.000 82.86907  ? 1000 ASN A O     1 
ATOM   7480  C  CB    . ASN A 1 1000 ? -59.60700 -3.19800  -15.60100 1.000 79.70857  ? 1000 ASN A CB    1 
ATOM   7481  C  CG    . ASN A 1 1000 ? -60.35800 -2.21600  -16.48200 1.000 84.10028  ? 1000 ASN A CG    1 
ATOM   7482  O  OD1   . ASN A 1 1000 ? -61.48200 -2.47800  -16.90800 1.000 86.95033  ? 1000 ASN A OD1   1 
ATOM   7483  N  ND2   . ASN A 1 1000 ? -59.73600 -1.07600  -16.76100 1.000 86.11858  ? 1000 ASN A ND2   1 
ATOM   7484  N  N     . TYR A 1 1001 ? -59.52800 -4.88700  -12.76200 1.000 82.33430  ? 1001 TYR A N     1 
ATOM   7485  C  CA    . TYR A 1 1001 ? -58.87500 -5.82800  -11.85900 1.000 92.19616  ? 1001 TYR A CA    1 
ATOM   7486  C  C     . TYR A 1 1001 ? -58.51500 -7.14800  -12.52600 1.000 88.87631  ? 1001 TYR A C     1 
ATOM   7487  O  O     . TYR A 1 1001 ? -57.45400 -7.71100  -12.23800 1.000 81.77595  ? 1001 TYR A O     1 
ATOM   7488  C  CB    . TYR A 1 1001 ? -59.77400 -6.09800  -10.64800 1.000 84.21905  ? 1001 TYR A CB    1 
ATOM   7489  C  CG    . TYR A 1 1001 ? -59.06900 -6.74400  -9.47600  1.000 84.10736  ? 1001 TYR A CG    1 
ATOM   7490  C  CD1   . TYR A 1 1001 ? -58.34400 -5.98000  -8.57000  1.000 91.51863  ? 1001 TYR A CD1   1 
ATOM   7491  C  CD2   . TYR A 1 1001 ? -59.13900 -8.11500  -9.26800  1.000 91.65633  ? 1001 TYR A CD2   1 
ATOM   7492  C  CE1   . TYR A 1 1001 ? -57.70200 -6.56500  -7.49500  1.000 93.68880  ? 1001 TYR A CE1   1 
ATOM   7493  C  CE2   . TYR A 1 1001 ? -58.50100 -8.70900  -8.19500  1.000 92.70116  ? 1001 TYR A CE2   1 
ATOM   7494  C  CZ    . TYR A 1 1001 ? -57.78400 -7.92900  -7.31200  1.000 93.30518  ? 1001 TYR A CZ    1 
ATOM   7495  O  OH    . TYR A 1 1001 ? -57.14800 -8.51600  -6.24200  1.000 88.77603  ? 1001 TYR A OH    1 
ATOM   7496  N  N     . TRP A 1 1002 ? -59.37000 -7.65900  -13.41000 1.000 85.78945  ? 1002 TRP A N     1 
ATOM   7497  C  CA    . TRP A 1 1002 ? -59.12800 -8.92700  -14.08500 1.000 91.18734  ? 1002 TRP A CA    1 
ATOM   7498  C  C     . TRP A 1 1002 ? -58.61800 -8.75400  -15.51000 1.000 89.86816  ? 1002 TRP A C     1 
ATOM   7499  O  O     . TRP A 1 1002 ? -58.42600 -9.75300  -16.21100 1.000 83.17206  ? 1002 TRP A O     1 
ATOM   7500  C  CB    . TRP A 1 1002 ? -60.40500 -9.77300  -14.09000 1.000 89.53611  ? 1002 TRP A CB    1 
ATOM   7501  C  CG    . TRP A 1 1002 ? -60.93500 -10.07000 -12.71800 1.000 85.89473  ? 1002 TRP A CG    1 
ATOM   7502  C  CD1   . TRP A 1 1002 ? -62.09200 -9.60100  -12.17000 1.000 88.77942  ? 1002 TRP A CD1   1 
ATOM   7503  C  CD2   . TRP A 1 1002 ? -60.32500 -10.89900 -11.71900 1.000 82.20422  ? 1002 TRP A CD2   1 
ATOM   7504  N  NE1   . TRP A 1 1002 ? -62.24300 -10.08700 -10.89400 1.000 86.46170  ? 1002 TRP A NE1   1 
ATOM   7505  C  CE2   . TRP A 1 1002 ? -61.17200 -10.88600 -10.59300 1.000 78.53295  ? 1002 TRP A CE2   1 
ATOM   7506  C  CE3   . TRP A 1 1002 ? -59.14700 -11.64900 -11.66800 1.000 88.83186  ? 1002 TRP A CE3   1 
ATOM   7507  C  CZ2   . TRP A 1 1002 ? -60.87900 -11.59500 -9.43000  1.000 81.04853  ? 1002 TRP A CZ2   1 
ATOM   7508  C  CZ3   . TRP A 1 1002 ? -58.85800 -12.35400 -10.51200 1.000 84.10002  ? 1002 TRP A CZ3   1 
ATOM   7509  C  CH2   . TRP A 1 1002 ? -59.72000 -12.32100 -9.41000  1.000 83.75226  ? 1002 TRP A CH2   1 
ATOM   7510  N  N     . LYS A 1 1003 ? -58.40700 -7.51900  -15.95700 1.000 87.07458  ? 1003 LYS A N     1 
ATOM   7511  C  CA    . LYS A 1 1003 ? -57.80100 -7.24500  -17.25300 1.000 77.74326  ? 1003 LYS A CA    1 
ATOM   7512  C  C     . LYS A 1 1003 ? -56.78200 -6.13100  -17.08300 1.000 86.80036  ? 1003 LYS A C     1 
ATOM   7513  O  O     . LYS A 1 1003 ? -57.09400 -5.08600  -16.50700 1.000 93.63522  ? 1003 LYS A O     1 
ATOM   7514  C  CB    . LYS A 1 1003 ? -58.84900 -6.84600  -18.29800 1.000 75.06177  ? 1003 LYS A CB    1 
ATOM   7515  C  CG    . LYS A 1 1003 ? -59.77900 -7.96900  -18.71400 1.000 82.04089  ? 1003 LYS A CG    1 
ATOM   7516  C  CD    . LYS A 1 1003 ? -59.60500 -8.30000  -20.18600 1.000 75.46344  ? 1003 LYS A CD    1 
ATOM   7517  C  CE    . LYS A 1 1003 ? -60.55600 -9.40000  -20.61000 1.000 77.10147  ? 1003 LYS A CE    1 
ATOM   7518  N  NZ    . LYS A 1 1003 ? -60.48200 -10.57200 -19.70100 1.000 79.21735  ? 1003 LYS A NZ    1 
ATOM   7519  N  N     . LYS A 1 1004 ? -55.56900 -6.35600  -17.58100 1.000 85.86041  ? 1004 LYS A N     1 
ATOM   7520  C  CA    . LYS A 1 1004 ? -54.49200 -5.38700  -17.45700 1.000 81.87750  ? 1004 LYS A CA    1 
ATOM   7521  C  C     . LYS A 1 1004 ? -53.88200 -5.11200  -18.82200 1.000 81.58464  ? 1004 LYS A C     1 
ATOM   7522  O  O     . LYS A 1 1004 ? -53.88100 -5.97100  -19.70800 1.000 84.26422  ? 1004 LYS A O     1 
ATOM   7523  C  CB    . LYS A 1 1004 ? -53.40100 -5.87600  -16.49500 1.000 76.21646  ? 1004 LYS A CB    1 
ATOM   7524  C  CG    . LYS A 1 1004 ? -53.87300 -6.04000  -15.06300 1.000 80.22575  ? 1004 LYS A CG    1 
ATOM   7525  C  CD    . LYS A 1 1004 ? -54.21200 -4.70400  -14.43200 1.000 89.92808  ? 1004 LYS A CD    1 
ATOM   7526  C  CE    . LYS A 1 1004 ? -54.47100 -4.85500  -12.94300 1.000 90.06086  ? 1004 LYS A CE    1 
ATOM   7527  N  NZ    . LYS A 1 1004 ? -54.48300 -3.54000  -12.24800 1.000 98.26418  ? 1004 LYS A NZ    1 
ATOM   7528  N  N     . LYS A 1 1005 ? -53.36400 -3.89900  -18.98000 1.000 79.05148  ? 1005 LYS A N     1 
ATOM   7529  C  CA    . LYS A 1 1005 ? -52.64500 -3.49400  -20.17700 1.000 73.01056  ? 1005 LYS A CA    1 
ATOM   7530  C  C     . LYS A 1 1005 ? -51.17800 -3.25600  -19.84700 1.000 77.58328  ? 1005 LYS A C     1 
ATOM   7531  O  O     . LYS A 1 1005 ? -50.80700 -2.99900  -18.69800 1.000 83.37263  ? 1005 LYS A O     1 
ATOM   7532  C  CB    . LYS A 1 1005 ? -53.25900 -2.23200  -20.79300 1.000 74.69384  ? 1005 LYS A CB    1 
ATOM   7533  C  CG    . LYS A 1 1005 ? -54.59300 -2.46300  -21.48300 1.000 75.46562  ? 1005 LYS A CG    1 
ATOM   7534  C  CD    . LYS A 1 1005 ? -54.98100 -1.27000  -22.34300 1.000 79.12832  ? 1005 LYS A CD    1 
ATOM   7535  C  CE    . LYS A 1 1005 ? -56.27100 -1.53200  -23.10300 1.000 80.57092  ? 1005 LYS A CE    1 
ATOM   7536  N  NZ    . LYS A 1 1005 ? -56.56100 -0.45600  -24.09100 1.000 77.76484  ? 1005 LYS A NZ    1 
ATOM   7537  N  N     . GLY A 1 1006 ? -50.34000 -3.35100  -20.87700 1.000 78.94032  ? 1006 GLY A N     1 
ATOM   7538  C  CA    . GLY A 1 1006 ? -48.91500 -3.16300  -20.70800 1.000 77.31403  ? 1006 GLY A CA    1 
ATOM   7539  C  C     . GLY A 1 1006 ? -48.32200 -2.43000  -21.89400 1.000 75.70408  ? 1006 GLY A C     1 
ATOM   7540  O  O     . GLY A 1 1006 ? -48.86200 -2.45000  -23.00300 1.000 73.27759  ? 1006 GLY A O     1 
ATOM   7541  N  N     . LEU A 1 1007 ? -47.19000 -1.77800  -21.63700 1.000 72.23630  ? 1007 LEU A N     1 
ATOM   7542  C  CA    . LEU A 1 1007 ? -46.50300 -1.00400  -22.66000 1.000 73.69913  ? 1007 LEU A CA    1 
ATOM   7543  C  C     . LEU A 1 1007 ? -45.00300 -1.10200  -22.42900 1.000 72.24749  ? 1007 LEU A C     1 
ATOM   7544  O  O     . LEU A 1 1007 ? -44.54000 -1.05600  -21.28600 1.000 74.11908  ? 1007 LEU A O     1 
ATOM   7545  C  CB    . LEU A 1 1007 ? -46.95400 0.46100   -22.64700 1.000 77.02963  ? 1007 LEU A CB    1 
ATOM   7546  C  CG    . LEU A 1 1007 ? -46.54600 1.31800   -23.84500 1.000 76.77939  ? 1007 LEU A CG    1 
ATOM   7547  C  CD1   . LEU A 1 1007 ? -47.11000 0.74000   -25.13100 1.000 73.80809  ? 1007 LEU A CD1   1 
ATOM   7548  C  CD2   . LEU A 1 1007 ? -47.01300 2.75200   -23.65500 1.000 78.66300  ? 1007 LEU A CD2   1 
ATOM   7549  N  N     . ALA A 1 1008 ? -44.25200 -1.23900  -23.52000 1.000 71.30568  ? 1008 ALA A N     1 
ATOM   7550  C  CA    . ALA A 1 1008 ? -42.80600 -1.37300  -23.43700 1.000 70.61069  ? 1008 ALA A CA    1 
ATOM   7551  C  C     . ALA A 1 1008 ? -42.17900 -0.86800  -24.72800 1.000 72.06894  ? 1008 ALA A C     1 
ATOM   7552  O  O     . ALA A 1 1008 ? -42.81500 -0.84500  -25.78500 1.000 71.51337  ? 1008 ALA A O     1 
ATOM   7553  C  CB    . ALA A 1 1008 ? -42.38900 -2.82400  -23.17100 1.000 62.90831  ? 1008 ALA A CB    1 
ATOM   7554  N  N     . MET A 1 1009 ? -40.91600 -0.45700  -24.62400 1.000 69.73078  ? 1009 MET A N     1 
ATOM   7555  C  CA    . MET A 1 1009 ? -40.14500 -0.02600  -25.78300 1.000 71.38084  ? 1009 MET A CA    1 
ATOM   7556  C  C     . MET A 1 1009 ? -38.69200 -0.42600  -25.58300 1.000 71.60332  ? 1009 MET A C     1 
ATOM   7557  O  O     . MET A 1 1009 ? -38.11700 -0.16700  -24.52100 1.000 68.15867  ? 1009 MET A O     1 
ATOM   7558  C  CB    . MET A 1 1009 ? -40.25600 1.48700   -26.00300 1.000 71.08019  ? 1009 MET A CB    1 
ATOM   7559  C  CG    . MET A 1 1009 ? -39.60600 1.96200   -27.29500 1.000 76.89296  ? 1009 MET A CG    1 
ATOM   7560  S  SD    . MET A 1 1009 ? -39.43600 3.75300   -27.40000 1.000 83.14041  ? 1009 MET A SD    1 
ATOM   7561  C  CE    . MET A 1 1009 ? -41.12900 4.26300   -27.12400 1.000 83.33766  ? 1009 MET A CE    1 
ATOM   7562  N  N     . VAL A 1 1010 ? -38.10700 -1.05500  -26.59800 1.000 65.28731  ? 1010 VAL A N     1 
ATOM   7563  C  CA    . VAL A 1 1010 ? -36.72500 -1.52400  -26.52500 1.000 69.60938  ? 1010 VAL A CA    1 
ATOM   7564  C  C     . VAL A 1 1010 ? -35.90900 -0.89300  -27.64800 1.000 71.35616  ? 1010 VAL A C     1 
ATOM   7565  O  O     . VAL A 1 1010 ? -36.45000 -0.61400  -28.72900 1.000 72.51972  ? 1010 VAL A O     1 
ATOM   7566  C  CB    . VAL A 1 1010 ? -36.65200 -3.06000  -26.58000 1.000 65.41455  ? 1010 VAL A CB    1 
ATOM   7567  C  CG1   . VAL A 1 1010 ? -37.53700 -3.67400  -25.50400 1.000 64.95807  ? 1010 VAL A CG1   1 
ATOM   7568  C  CG2   . VAL A 1 1010 ? -37.05200 -3.57300  -27.95600 1.000 73.67543  ? 1010 VAL A CG2   1 
ATOM   7569  N  N     . PRO A 1 1011 ? -34.62600 -0.62100  -27.43200 1.000 72.52113  ? 1011 PRO A N     1 
ATOM   7570  C  CA    . PRO A 1 1011 ? -33.76000 -0.15200  -28.51300 1.000 75.52778  ? 1011 PRO A CA    1 
ATOM   7571  C  C     . PRO A 1 1011 ? -33.07200 -1.32300  -29.20900 1.000 76.74391  ? 1011 PRO A C     1 
ATOM   7572  O  O     . PRO A 1 1011 ? -33.11100 -2.46600  -28.75000 1.000 67.26954  ? 1011 PRO A O     1 
ATOM   7573  C  CB    . PRO A 1 1011 ? -32.74200 0.72400   -27.77500 1.000 76.41289  ? 1011 PRO A CB    1 
ATOM   7574  C  CG    . PRO A 1 1011 ? -32.60000 0.04900   -26.45100 1.000 78.12800  ? 1011 PRO A CG    1 
ATOM   7575  C  CD    . PRO A 1 1011 ? -33.95500 -0.54900  -26.12200 1.000 70.39500  ? 1011 PRO A CD    1 
ATOM   7576  N  N     . LEU A 1 1012 ? -32.42900 -1.01100  -30.33300 1.000 74.41732  ? 1012 LEU A N     1 
ATOM   7577  C  CA    . LEU A 1 1012 ? -31.80000 -2.03100  -31.16400 1.000 73.00532  ? 1012 LEU A CA    1 
ATOM   7578  C  C     . LEU A 1 1012 ? -30.47400 -1.52100  -31.70400 1.000 77.86868  ? 1012 LEU A C     1 
ATOM   7579  O  O     . LEU A 1 1012 ? -30.42700 -0.46900  -32.34900 1.000 74.70473  ? 1012 LEU A O     1 
ATOM   7580  C  CB    . LEU A 1 1012 ? -32.71500 -2.43900  -32.32300 1.000 75.06795  ? 1012 LEU A CB    1 
ATOM   7581  C  CG    . LEU A 1 1012 ? -32.12200 -3.42700  -33.33100 1.000 74.33085  ? 1012 LEU A CG    1 
ATOM   7582  C  CD1   . LEU A 1 1012 ? -32.10800 -4.83700  -32.76700 1.000 64.06350  ? 1012 LEU A CD1   1 
ATOM   7583  C  CD2   . LEU A 1 1012 ? -32.88300 -3.38000  -34.64900 1.000 80.69649  ? 1012 LEU A CD2   1 
ATOM   7584  N  N     . LYS A 1 1013 ? -29.40300 -2.26600  -31.43500 1.000 71.53593  ? 1013 LYS A N     1 
ATOM   7585  C  CA    . LYS A 1 1013 ? -28.14200 -2.13600  -32.16000 1.000 72.13579  ? 1013 LYS A CA    1 
ATOM   7586  C  C     . LYS A 1 1013 ? -27.74100 -3.53400  -32.60700 1.000 76.13321  ? 1013 LYS A C     1 
ATOM   7587  O  O     . LYS A 1 1013 ? -27.30900 -4.35100  -31.78700 1.000 81.55287  ? 1013 LYS A O     1 
ATOM   7588  C  CB    . LYS A 1 1013 ? -27.04000 -1.50500  -31.30700 1.000 75.71221  ? 1013 LYS A CB    1 
ATOM   7589  C  CG    . LYS A 1 1013 ? -25.70500 -1.42300  -32.04900 1.000 81.52389  ? 1013 LYS A CG    1 
ATOM   7590  C  CD    . LYS A 1 1013 ? -24.67000 -0.56200  -31.33600 1.000 85.98487  ? 1013 LYS A CD    1 
ATOM   7591  C  CE    . LYS A 1 1013 ? -23.79200 -1.38200  -30.40500 1.000 82.04556  ? 1013 LYS A CE    1 
ATOM   7592  N  NZ    . LYS A 1 1013 ? -23.43200 -2.70300  -30.99000 1.000 83.56215  ? 1013 LYS A NZ    1 
ATOM   7593  N  N     . PHE A 1 1014 ? -27.89700 -3.81500  -33.89900 1.000 76.63118  ? 1014 PHE A N     1 
ATOM   7594  C  CA    . PHE A 1 1014 ? -27.57500 -5.12900  -34.44600 1.000 74.25192  ? 1014 PHE A CA    1 
ATOM   7595  C  C     . PHE A 1 1014 ? -26.28500 -5.05100  -35.25100 1.000 82.77173  ? 1014 PHE A C     1 
ATOM   7596  O  O     . PHE A 1 1014 ? -26.29700 -4.58100  -36.39900 1.000 84.09300  ? 1014 PHE A O     1 
ATOM   7597  C  CB    . PHE A 1 1014 ? -28.72000 -5.65000  -35.31900 1.000 80.45994  ? 1014 PHE A CB    1 
ATOM   7598  C  CG    . PHE A 1 1014 ? -28.49500 -7.03800  -35.84300 1.000 81.05965  ? 1014 PHE A CG    1 
ATOM   7599  C  CD1   . PHE A 1 1014 ? -28.59300 -8.13400  -35.00100 1.000 87.20183  ? 1014 PHE A CD1   1 
ATOM   7600  C  CD2   . PHE A 1 1014 ? -28.18300 -7.24800  -37.17500 1.000 82.85095  ? 1014 PHE A CD2   1 
ATOM   7601  C  CE1   . PHE A 1 1014 ? -28.38400 -9.41400  -35.47800 1.000 87.35119  ? 1014 PHE A CE1   1 
ATOM   7602  C  CE2   . PHE A 1 1014 ? -27.97400 -8.52600  -37.65900 1.000 84.89689  ? 1014 PHE A CE2   1 
ATOM   7603  C  CZ    . PHE A 1 1014 ? -28.07400 -9.61000  -36.80900 1.000 87.94074  ? 1014 PHE A CZ    1 
ATOM   7604  N  N     . PRO A 1 1015 ? -25.15300 -5.48400  -34.70000 1.000 81.23777  ? 1015 PRO A N     1 
ATOM   7605  C  CA    . PRO A 1 1015 ? -23.91000 -5.48500  -35.47900 1.000 75.06797  ? 1015 PRO A CA    1 
ATOM   7606  C  C     . PRO A 1 1015 ? -23.95800 -6.52200  -36.59000 1.000 76.92588  ? 1015 PRO A C     1 
ATOM   7607  O  O     . PRO A 1 1015 ? -24.47200 -7.62900  -36.41100 1.000 79.03581  ? 1015 PRO A O     1 
ATOM   7608  C  CB    . PRO A 1 1015 ? -22.83700 -5.82800  -34.43900 1.000 80.26326  ? 1015 PRO A CB    1 
ATOM   7609  C  CG    . PRO A 1 1015 ? -23.48300 -5.58400  -33.10500 1.000 78.41788  ? 1015 PRO A CG    1 
ATOM   7610  C  CD    . PRO A 1 1015 ? -24.93000 -5.88700  -33.30400 1.000 80.75165  ? 1015 PRO A CD    1 
ATOM   7611  N  N     . VAL A 1 1016 ? -23.41400 -6.15300  -37.74700 1.000 73.05751  ? 1016 VAL A N     1 
ATOM   7612  C  CA    . VAL A 1 1016 ? -23.40600 -7.00600  -38.92900 1.000 77.29478  ? 1016 VAL A CA    1 
ATOM   7613  C  C     . VAL A 1 1016 ? -21.96200 -7.26000  -39.33400 1.000 74.68323  ? 1016 VAL A C     1 
ATOM   7614  O  O     . VAL A 1 1016 ? -21.18300 -6.31400  -39.50200 1.000 73.87742  ? 1016 VAL A O     1 
ATOM   7615  C  CB    . VAL A 1 1016 ? -24.19800 -6.37800  -40.09000 1.000 73.65028  ? 1016 VAL A CB    1 
ATOM   7616  C  CG1   . VAL A 1 1016 ? -24.14800 -7.27900  -41.31100 1.000 72.36451  ? 1016 VAL A CG1   1 
ATOM   7617  C  CG2   . VAL A 1 1016 ? -25.63500 -6.11500  -39.67100 1.000 74.15187  ? 1016 VAL A CG2   1 
ATOM   7618  N  N     . GLY A 1 1017 ? -21.61000 -8.53300  -39.49400 1.000 72.72449  ? 1017 GLY A N     1 
ATOM   7619  C  CA    . GLY A 1 1017 ? -20.27000 -8.90500  -39.90100 1.000 73.66476  ? 1017 GLY A CA    1 
ATOM   7620  C  C     . GLY A 1 1017 ? -19.99700 -10.38800 -39.75600 1.000 79.61017  ? 1017 GLY A C     1 
ATOM   7621  O  O     . GLY A 1 1017 ? -20.63600 -11.06600 -38.94600 1.000 86.31949  ? 1017 GLY A O     1 
ATOM   7622  N  N     . LEU A 1 1018 ? -19.05400 -10.90400 -40.53600 1.000 71.61544  ? 1018 LEU A N     1 
ATOM   7623  C  CA    . LEU A 1 1018 ? -18.67300 -12.30300 -40.47500 1.000 71.00353  ? 1018 LEU A CA    1 
ATOM   7624  C  C     . LEU A 1 1018 ? -17.36800 -12.44600 -39.69300 1.000 78.45347  ? 1018 LEU A C     1 
ATOM   7625  O  O     . LEU A 1 1018 ? -16.89400 -11.50500 -39.04900 1.000 80.77032  ? 1018 LEU A O     1 
ATOM   7626  C  CB    . LEU A 1 1018 ? -18.56300 -12.88600 -41.88600 1.000 71.06151  ? 1018 LEU A CB    1 
ATOM   7627  C  CG    . LEU A 1 1018 ? -19.85200 -13.01200 -42.70800 1.000 74.19866  ? 1018 LEU A CG    1 
ATOM   7628  C  CD1   . LEU A 1 1018 ? -21.03000 -13.41100 -41.82500 1.000 70.78944  ? 1018 LEU A CD1   1 
ATOM   7629  C  CD2   . LEU A 1 1018 ? -20.15500 -11.73500 -43.48100 1.000 57.51595  ? 1018 LEU A CD2   1 
ATOM   7630  N  N     . GLY A 1 1019 ? -16.77500 -13.63600 -39.74900 1.000 79.51163  ? 1019 GLY A N     1 
ATOM   7631  C  CA    . GLY A 1 1019 ? -15.56500 -13.91400 -38.99900 1.000 81.98820  ? 1019 GLY A CA    1 
ATOM   7632  C  C     . GLY A 1 1019 ? -14.31600 -13.29600 -39.59100 1.000 87.32741  ? 1019 GLY A C     1 
ATOM   7633  O  O     . GLY A 1 1019 ? -13.52700 -12.67000 -38.87600 1.000 93.64070  ? 1019 GLY A O     1 
ATOM   7634  N  N     . SER A 1 1020 ? -14.12300 -13.46600 -40.89800 1.000 73.98186  ? 1020 SER A N     1 
ATOM   7635  C  CA    . SER A 1 1020 ? -12.95000 -12.95100 -41.59000 1.000 79.80545  ? 1020 SER A CA    1 
ATOM   7636  C  C     . SER A 1 1020 ? -13.39100 -12.33300 -42.91100 1.000 76.44529  ? 1020 SER A C     1 
ATOM   7637  O  O     . SER A 1 1020 ? -14.57900 -12.31900 -43.24900 1.000 68.25739  ? 1020 SER A O     1 
ATOM   7638  C  CB    . SER A 1 1020 ? -11.91200 -14.05700 -41.81600 1.000 84.10653  ? 1020 SER A CB    1 
ATOM   7639  O  OG    . SER A 1 1020 ? -12.45300 -15.11400 -42.59000 1.000 79.89820  ? 1020 SER A OG    1 
ATOM   7640  N  N     . ARG A 1 1021 ? -12.41900 -11.81200 -43.66500 1.000 78.35743  ? 1021 ARG A N     1 
ATOM   7641  C  CA    . ARG A 1 1021 ? -12.73100 -11.26000 -44.97900 1.000 73.97860  ? 1021 ARG A CA    1 
ATOM   7642  C  C     . ARG A 1 1021 ? -13.09800 -12.35600 -45.97100 1.000 74.94987  ? 1021 ARG A C     1 
ATOM   7643  O  O     . ARG A 1 1021 ? -13.94200 -12.14000 -46.84900 1.000 72.67553  ? 1021 ARG A O     1 
ATOM   7644  C  CB    . ARG A 1 1021 ? -11.55100 -10.43800 -45.50400 1.000 67.15360  ? 1021 ARG A CB    1 
ATOM   7645  C  CG    . ARG A 1 1021 ? -11.76600 -9.88700  -46.90700 1.000 70.24333  ? 1021 ARG A CG    1 
ATOM   7646  C  CD    . ARG A 1 1021 ? -10.80500 -8.75900  -47.24400 1.000 81.90217  ? 1021 ARG A CD    1 
ATOM   7647  N  NE    . ARG A 1 1021 ? -9.48700  -9.24700  -47.64100 1.000 89.22444  ? 1021 ARG A NE    1 
ATOM   7648  C  CZ    . ARG A 1 1021 ? -8.65300  -8.57600  -48.42900 1.000 94.55416  ? 1021 ARG A CZ    1 
ATOM   7649  N  NH1   . ARG A 1 1021 ? -9.00300  -7.39000  -48.90900 1.000 87.59959  ? 1021 ARG A NH1   1 
ATOM   7650  N  NH2   . ARG A 1 1021 ? -7.47200  -9.09000  -48.74300 1.000 90.53400  ? 1021 ARG A NH2   1 
ATOM   7651  N  N     . ALA A 1 1022 ? -12.49200 -13.53800 -45.83700 1.000 73.36025  ? 1022 ALA A N     1 
ATOM   7652  C  CA    . ALA A 1 1022 ? -12.76000 -14.63100 -46.76400 1.000 71.86878  ? 1022 ALA A CA    1 
ATOM   7653  C  C     . ALA A 1 1022 ? -14.17800 -15.17200 -46.64000 1.000 70.25784  ? 1022 ALA A C     1 
ATOM   7654  O  O     . ALA A 1 1022 ? -14.65400 -15.84100 -47.56400 1.000 73.77544  ? 1022 ALA A O     1 
ATOM   7655  C  CB    . ALA A 1 1022 ? -11.75300 -15.76100 -46.54900 1.000 73.89551  ? 1022 ALA A CB    1 
ATOM   7656  N  N     . ALA A 1 1023 ? -14.86300 -14.90500 -45.52600 1.000 67.33642  ? 1023 ALA A N     1 
ATOM   7657  C  CA    . ALA A 1 1023 ? -16.23000 -15.37800 -45.35100 1.000 60.69352  ? 1023 ALA A CA    1 
ATOM   7658  C  C     . ALA A 1 1023 ? -17.25800 -14.45900 -45.99900 1.000 59.50655  ? 1023 ALA A C     1 
ATOM   7659  O  O     . ALA A 1 1023 ? -18.38200 -14.89900 -46.26100 1.000 69.48339  ? 1023 ALA A O     1 
ATOM   7660  C  CB    . ALA A 1 1023 ? -16.54900 -15.53700 -43.86400 1.000 70.45449  ? 1023 ALA A CB    1 
ATOM   7661  N  N     . GLY A 1 1024 ? -16.90300 -13.20300 -46.25500 1.000 65.31928  ? 1024 GLY A N     1 
ATOM   7662  C  CA    . GLY A 1 1024 ? -17.80100 -12.28100 -46.92100 1.000 62.69685  ? 1024 GLY A CA    1 
ATOM   7663  C  C     . GLY A 1 1024 ? -17.51000 -12.16800 -48.40300 1.000 66.07008  ? 1024 GLY A C     1 
ATOM   7664  O  O     . GLY A 1 1024 ? -17.93700 -11.21800 -49.06600 1.000 63.01790  ? 1024 GLY A O     1 
ATOM   7665  N  N     . GLN A 1 1025 ? -16.78100 -13.14600 -48.93100 1.000 69.10059  ? 1025 GLN A N     1 
ATOM   7666  C  CA    . GLN A 1 1025 ? -16.37900 -13.14600 -50.33000 1.000 62.78181  ? 1025 GLN A CA    1 
ATOM   7667  C  C     . GLN A 1 1025 ? -17.51700 -13.65300 -51.20900 1.000 65.61707  ? 1025 GLN A C     1 
ATOM   7668  O  O     . GLN A 1 1025 ? -18.14400 -14.67300 -50.90400 1.000 72.49324  ? 1025 GLN A O     1 
ATOM   7669  C  CB    . GLN A 1 1025 ? -15.13100 -14.01100 -50.50300 1.000 60.32002  ? 1025 GLN A CB    1 
ATOM   7670  C  CG    . GLN A 1 1025 ? -14.94600 -14.62100 -51.87600 1.000 67.84093  ? 1025 GLN A CG    1 
ATOM   7671  C  CD    . GLN A 1 1025 ? -13.89300 -15.71000 -51.87000 1.000 68.82856  ? 1025 GLN A CD    1 
ATOM   7672  O  OE1   . GLN A 1 1025 ? -13.49600 -16.21500 -52.92000 1.000 66.89362  ? 1025 GLN A OE1   1 
ATOM   7673  N  NE2   . GLN A 1 1025 ? -13.42900 -16.07400 -50.68000 1.000 61.65154  ? 1025 GLN A NE2   1 
ATOM   7674  N  N     . ALA A 1 1026 ? -17.78400 -12.93700 -52.29900 1.000 56.92194  ? 1026 ALA A N     1 
ATOM   7675  C  CA    . ALA A 1 1026 ? -18.86700 -13.27400 -53.21100 1.000 54.89332  ? 1026 ALA A CA    1 
ATOM   7676  C  C     . ALA A 1 1026 ? -18.36800 -13.22700 -54.64800 1.000 56.73145  ? 1026 ALA A C     1 
ATOM   7677  O  O     . ALA A 1 1026 ? -17.39700 -12.53700 -54.97000 1.000 56.69235  ? 1026 ALA A O     1 
ATOM   7678  C  CB    . ALA A 1 1026 ? -20.06400 -12.32700 -53.03800 1.000 56.61766  ? 1026 ALA A CB    1 
ATOM   7679  N  N     . ALA A 1 1027 ? -19.05200 -13.97300 -55.51400 1.000 54.21413  ? 1027 ALA A N     1 
ATOM   7680  C  CA    . ALA A 1 1027 ? -18.69900 -14.04800 -56.92400 1.000 49.68210  ? 1027 ALA A CA    1 
ATOM   7681  C  C     . ALA A 1 1027 ? -19.96900 -14.07900 -57.76200 1.000 45.70519  ? 1027 ALA A C     1 
ATOM   7682  O  O     . ALA A 1 1027 ? -21.06200 -14.35300 -57.26200 1.000 48.12157  ? 1027 ALA A O     1 
ATOM   7683  C  CB    . ALA A 1 1027 ? -17.83300 -15.27800 -57.22700 1.000 60.72738  ? 1027 ALA A CB    1 
ATOM   7684  N  N     . ALA A 1 1028 ? -19.80900 -13.79600 -59.05300 1.000 48.04107  ? 1028 ALA A N     1 
ATOM   7685  C  CA    . ALA A 1 1028 ? -20.93100 -13.76600 -59.97900 1.000 49.32190  ? 1028 ALA A CA    1 
ATOM   7686  C  C     . ALA A 1 1028 ? -20.42700 -14.04400 -61.38800 1.000 53.01946  ? 1028 ALA A C     1 
ATOM   7687  O  O     . ALA A 1 1028 ? -19.22300 -14.02600 -61.65800 1.000 54.26828  ? 1028 ALA A O     1 
ATOM   7688  C  CB    . ALA A 1 1028 ? -21.67000 -12.42500 -59.92100 1.000 44.08655  ? 1028 ALA A CB    1 
ATOM   7689  N  N     . LEU A 1 1029 ? -21.37200 -14.30400 -62.29000 1.000 47.55095  ? 1029 LEU A N     1 
ATOM   7690  C  CA    . LEU A 1 1029 ? -21.07300 -14.58100 -63.68900 1.000 47.47420  ? 1029 LEU A CA    1 
ATOM   7691  C  C     . LEU A 1 1029 ? -22.16600 -13.96800 -64.55000 1.000 59.53285  ? 1029 LEU A C     1 
ATOM   7692  O  O     . LEU A 1 1029 ? -23.35300 -14.21400 -64.31600 1.000 57.13462  ? 1029 LEU A O     1 
ATOM   7693  C  CB    . LEU A 1 1029 ? -20.97200 -16.08900 -63.94500 1.000 43.58581  ? 1029 LEU A CB    1 
ATOM   7694  C  CG    . LEU A 1 1029 ? -20.52800 -16.52600 -65.34100 1.000 48.73151  ? 1029 LEU A CG    1 
ATOM   7695  C  CD1   . LEU A 1 1029 ? -19.11000 -16.06500 -65.62600 1.000 57.58023  ? 1029 LEU A CD1   1 
ATOM   7696  C  CD2   . LEU A 1 1029 ? -20.64500 -18.03400 -65.49100 1.000 47.98661  ? 1029 LEU A CD2   1 
ATOM   7697  N  N     . VAL A 1 1030 ? -21.76600 -13.17100 -65.54000 1.000 55.26264  ? 1030 VAL A N     1 
ATOM   7698  C  CA    . VAL A 1 1030 ? -22.69900 -12.41800 -66.37100 1.000 50.77251  ? 1030 VAL A CA    1 
ATOM   7699  C  C     . VAL A 1 1030 ? -22.39200 -12.69100 -67.83700 1.000 54.41812  ? 1030 VAL A C     1 
ATOM   7700  O  O     . VAL A 1 1030 ? -21.24400 -12.55400 -68.27300 1.000 57.14351  ? 1030 VAL A O     1 
ATOM   7701  C  CB    . VAL A 1 1030 ? -22.62900 -10.90600 -66.08000 1.000 52.00804  ? 1030 VAL A CB    1 
ATOM   7702  C  CG1   . VAL A 1 1030 ? -23.58100 -10.14700 -66.98600 1.000 55.30601  ? 1030 VAL A CG1   1 
ATOM   7703  C  CG2   . VAL A 1 1030 ? -22.95100 -10.63000 -64.62000 1.000 48.75012  ? 1030 VAL A CG2   1 
ATOM   7704  N  N     . HIS A 1 1031 ? -23.41900 -13.07400 -68.59300 1.000 55.74414  ? 1031 HIS A N     1 
ATOM   7705  C  CA    . HIS A 1 1031 ? -23.32900 -13.26500 -70.03200 1.000 53.84602  ? 1031 HIS A CA    1 
ATOM   7706  C  C     . HIS A 1 1031 ? -24.18300 -12.22600 -70.74600 1.000 57.14814  ? 1031 HIS A C     1 
ATOM   7707  O  O     . HIS A 1 1031 ? -25.22000 -11.79400 -70.23600 1.000 60.79088  ? 1031 HIS A O     1 
ATOM   7708  C  CB    . HIS A 1 1031 ? -23.79300 -14.66800 -70.44300 1.000 50.97469  ? 1031 HIS A CB    1 
ATOM   7709  C  CG    . HIS A 1 1031 ? -23.01100 -15.78000 -69.81600 1.000 49.16090  ? 1031 HIS A CG    1 
ATOM   7710  N  ND1   . HIS A 1 1031 ? -21.81900 -15.57800 -69.15500 1.000 54.64655  ? 1031 HIS A ND1   1 
ATOM   7711  C  CD2   . HIS A 1 1031 ? -23.25500 -17.11100 -69.75300 1.000 48.03375  ? 1031 HIS A CD2   1 
ATOM   7712  C  CE1   . HIS A 1 1031 ? -21.36200 -16.73600 -68.71100 1.000 56.73666  ? 1031 HIS A CE1   1 
ATOM   7713  N  NE2   . HIS A 1 1031 ? -22.21500 -17.68200 -69.06000 1.000 51.60274  ? 1031 HIS A NE2   1 
ATOM   7714  N  N     . ILE A 1 1032 ? -23.74000 -11.82700 -71.93600 1.000 50.80948  ? 1032 ILE A N     1 
ATOM   7715  C  CA    . ILE A 1 1032 ? -24.49200 -10.92500 -72.80200 1.000 53.18291  ? 1032 ILE A CA    1 
ATOM   7716  C  C     . ILE A 1 1032 ? -24.58400 -11.58400 -74.17000 1.000 60.44237  ? 1032 ILE A C     1 
ATOM   7717  O  O     . ILE A 1 1032 ? -23.56600 -11.74800 -74.85400 1.000 59.63260  ? 1032 ILE A O     1 
ATOM   7718  C  CB    . ILE A 1 1032 ? -23.85000 -9.53500  -72.90800 1.000 56.11881  ? 1032 ILE A CB    1 
ATOM   7719  C  CG1   . ILE A 1 1032 ? -23.86000 -8.83400  -71.54900 1.000 52.55394  ? 1032 ILE A CG1   1 
ATOM   7720  C  CG2   . ILE A 1 1032 ? -24.57800 -8.69300  -73.94700 1.000 53.98340  ? 1032 ILE A CG2   1 
ATOM   7721  C  CD1   . ILE A 1 1032 ? -23.35100 -7.40900  -71.59500 1.000 49.36367  ? 1032 ILE A CD1   1 
ATOM   7722  N  N     . TYR A 1 1033 ? -25.79300 -11.96100 -74.57000 1.000 57.77968  ? 1033 TYR A N     1 
ATOM   7723  C  CA    . TYR A 1 1033 ? -26.00400 -12.62000 -75.84800 1.000 56.76264  ? 1033 TYR A CA    1 
ATOM   7724  C  C     . TYR A 1 1033 ? -26.17100 -11.59100 -76.96300 1.000 57.41656  ? 1033 TYR A C     1 
ATOM   7725  O  O     . TYR A 1 1033 ? -26.41600 -10.40700 -76.72200 1.000 56.70418  ? 1033 TYR A O     1 
ATOM   7726  C  CB    . TYR A 1 1033 ? -27.21900 -13.54400 -75.78000 1.000 57.64044  ? 1033 TYR A CB    1 
ATOM   7727  C  CG    . TYR A 1 1033 ? -27.06400 -14.64700 -74.75700 1.000 54.83035  ? 1033 TYR A CG    1 
ATOM   7728  C  CD1   . TYR A 1 1033 ? -26.26600 -15.75300 -75.01900 1.000 54.00300  ? 1033 TYR A CD1   1 
ATOM   7729  C  CD2   . TYR A 1 1033 ? -27.70100 -14.57500 -73.52600 1.000 56.51859  ? 1033 TYR A CD2   1 
ATOM   7730  C  CE1   . TYR A 1 1033 ? -26.11400 -16.76000 -74.08700 1.000 57.86944  ? 1033 TYR A CE1   1 
ATOM   7731  C  CE2   . TYR A 1 1033 ? -27.55400 -15.57900 -72.58600 1.000 52.82416  ? 1033 TYR A CE2   1 
ATOM   7732  C  CZ    . TYR A 1 1033 ? -26.76000 -16.66800 -72.87200 1.000 55.47049  ? 1033 TYR A CZ    1 
ATOM   7733  O  OH    . TYR A 1 1033 ? -26.61000 -17.67100 -71.94200 1.000 61.30050  ? 1033 TYR A OH    1 
ATOM   7734  N  N     . LEU A 1 1034 ? -26.03300 -12.06900 -78.20200 1.000 59.56492  ? 1034 LEU A N     1 
ATOM   7735  C  CA    . LEU A 1 1034 ? -25.99700 -11.18500 -79.36200 1.000 61.23446  ? 1034 LEU A CA    1 
ATOM   7736  C  C     . LEU A 1 1034 ? -27.32800 -10.49900 -79.64000 1.000 59.17285  ? 1034 LEU A C     1 
ATOM   7737  O  O     . LEU A 1 1034 ? -27.36300 -9.57300  -80.45700 1.000 66.52352  ? 1034 LEU A O     1 
ATOM   7738  C  CB    . LEU A 1 1034 ? -25.54500 -11.96400 -80.59900 1.000 66.78693  ? 1034 LEU A CB    1 
ATOM   7739  C  CG    . LEU A 1 1034 ? -24.06500 -11.83600 -80.97400 1.000 61.70592  ? 1034 LEU A CG    1 
ATOM   7740  C  CD1   . LEU A 1 1034 ? -23.16300 -12.18200 -79.79800 1.000 49.56602  ? 1034 LEU A CD1   1 
ATOM   7741  C  CD2   . LEU A 1 1034 ? -23.73500 -12.70500 -82.17700 1.000 60.01241  ? 1034 LEU A CD2   1 
ATOM   7742  N  N     . ASP A 1 1035 ? -28.41300 -10.92200 -78.99800 1.000 67.12535  ? 1035 ASP A N     1 
ATOM   7743  C  CA    . ASP A 1 1035 ? -29.68700 -10.22700 -79.11700 1.000 59.52940  ? 1035 ASP A CA    1 
ATOM   7744  C  C     . ASP A 1 1035 ? -29.83000 -9.09100  -78.11400 1.000 59.87813  ? 1035 ASP A C     1 
ATOM   7745  O  O     . ASP A 1 1035 ? -30.83500 -8.37400  -78.14800 1.000 71.62343  ? 1035 ASP A O     1 
ATOM   7746  C  CB    . ASP A 1 1035 ? -30.85200 -11.21100 -78.95500 1.000 59.24309  ? 1035 ASP A CB    1 
ATOM   7747  C  CG    . ASP A 1 1035 ? -31.04200 -11.66500 -77.51800 1.000 65.87098  ? 1035 ASP A CG    1 
ATOM   7748  O  OD1   . ASP A 1 1035 ? -30.04600 -11.72300 -76.76600 1.000 66.87868  ? 1035 ASP A OD1   1 
ATOM   7749  O  OD2   . ASP A 1 1035 ? -32.19500 -11.96100 -77.13800 1.000 64.30233  ? 1035 ASP A OD2   1 
ATOM   7750  N  N     . GLY A 1 1036 ? -28.85200 -8.91000  -77.22700 1.000 55.46831  ? 1036 GLY A N     1 
ATOM   7751  C  CA    . GLY A 1 1036 ? -28.88600 -7.86700  -76.22700 1.000 58.34870  ? 1036 GLY A CA    1 
ATOM   7752  C  C     . GLY A 1 1036 ? -29.29200 -8.32400  -74.84300 1.000 54.39911  ? 1036 GLY A C     1 
ATOM   7753  O  O     . GLY A 1 1036 ? -29.10000 -7.56900  -73.88100 1.000 57.06340  ? 1036 GLY A O     1 
ATOM   7754  N  N     . SER A 1 1037 ? -29.84200 -9.52700  -74.71100 1.000 57.83803  ? 1037 SER A N     1 
ATOM   7755  C  CA    . SER A 1 1037 ? -30.28200 -10.01700 -73.41500 1.000 57.99484  ? 1037 SER A CA    1 
ATOM   7756  C  C     . SER A 1 1037 ? -29.08700 -10.43800 -72.56300 1.000 52.09497  ? 1037 SER A C     1 
ATOM   7757  O  O     . SER A 1 1037 ? -28.00400 -10.74800 -73.06700 1.000 57.88896  ? 1037 SER A O     1 
ATOM   7758  C  CB    . SER A 1 1037 ? -31.25400 -11.18600 -73.58200 1.000 55.19128  ? 1037 SER A CB    1 
ATOM   7759  O  OG    . SER A 1 1037 ? -30.63300 -12.27600 -74.23700 1.000 57.25242  ? 1037 SER A OG    1 
ATOM   7760  N  N     . VAL A 1 1038 ? -29.30200 -10.44900 -71.24900 1.000 49.39894  ? 1038 VAL A N     1 
ATOM   7761  C  CA    . VAL A 1 1038 ? -28.24600 -10.69200 -70.27400 1.000 59.33074  ? 1038 VAL A CA    1 
ATOM   7762  C  C     . VAL A 1 1038 ? -28.68700 -11.80800 -69.33800 1.000 60.10968  ? 1038 VAL A C     1 
ATOM   7763  O  O     . VAL A 1 1038 ? -29.82600 -11.80800 -68.85800 1.000 63.14994  ? 1038 VAL A O     1 
ATOM   7764  C  CB    . VAL A 1 1038 ? -27.91000 -9.41700  -69.47500 1.000 52.88151  ? 1038 VAL A CB    1 
ATOM   7765  C  CG1   . VAL A 1 1038 ? -26.94200 -9.72700  -68.34400 1.000 49.56202  ? 1038 VAL A CG1   1 
ATOM   7766  C  CG2   . VAL A 1 1038 ? -27.33600 -8.35200  -70.39500 1.000 49.99141  ? 1038 VAL A CG2   1 
ATOM   7767  N  N     . LEU A 1 1039 ? -27.78700 -12.75800 -69.08400 1.000 53.21400  ? 1039 LEU A N     1 
ATOM   7768  C  CA    . LEU A 1 1039 ? -28.00800 -13.82800 -68.11900 1.000 56.01420  ? 1039 LEU A CA    1 
ATOM   7769  C  C     . LEU A 1 1039 ? -26.98800 -13.68500 -66.99900 1.000 57.06437  ? 1039 LEU A C     1 
ATOM   7770  O  O     . LEU A 1 1039 ? -25.77800 -13.68700 -67.25400 1.000 63.99227  ? 1039 LEU A O     1 
ATOM   7771  C  CB    . LEU A 1 1039 ? -27.89600 -15.20400 -68.77700 1.000 52.90742  ? 1039 LEU A CB    1 
ATOM   7772  C  CG    . LEU A 1 1039 ? -28.29000 -16.38600 -67.88900 1.000 50.33712  ? 1039 LEU A CG    1 
ATOM   7773  C  CD1   . LEU A 1 1039 ? -29.78900 -16.38900 -67.63500 1.000 51.82754  ? 1039 LEU A CD1   1 
ATOM   7774  C  CD2   . LEU A 1 1039 ? -27.84200 -17.70200 -68.50500 1.000 54.73738  ? 1039 LEU A CD2   1 
ATOM   7775  N  N     . VAL A 1 1040 ? -27.47300 -13.56200 -65.76700 1.000 48.39840  ? 1040 VAL A N     1 
ATOM   7776  C  CA    . VAL A 1 1040 ? -26.62000 -13.36400 -64.60300 1.000 47.36636  ? 1040 VAL A CA    1 
ATOM   7777  C  C     . VAL A 1 1040 ? -26.85200 -14.50800 -63.62600 1.000 51.81248  ? 1040 VAL A C     1 
ATOM   7778  O  O     . VAL A 1 1040 ? -27.95900 -15.04500 -63.51600 1.000 51.50602  ? 1040 VAL A O     1 
ATOM   7779  C  CB    . VAL A 1 1040 ? -26.88900 -11.99500 -63.93300 1.000 49.36828  ? 1040 VAL A CB    1 
ATOM   7780  C  CG1   . VAL A 1 1040 ? -28.34800 -11.87500 -63.51900 1.000 42.78359  ? 1040 VAL A CG1   1 
ATOM   7781  C  CG2   . VAL A 1 1040 ? -25.96000 -11.76800 -62.74300 1.000 51.09863  ? 1040 VAL A CG2   1 
ATOM   7782  N  N     . THR A 1 1041 ? -25.78600 -14.89900 -62.93000 1.000 53.96909  ? 1041 THR A N     1 
ATOM   7783  C  CA    . THR A 1 1041 ? -25.87600 -15.88500 -61.86500 1.000 46.77042  ? 1041 THR A CA    1 
ATOM   7784  C  C     . THR A 1 1041 ? -24.85200 -15.53700 -60.79400 1.000 46.49056  ? 1041 THR A C     1 
ATOM   7785  O  O     . THR A 1 1041 ? -23.83300 -14.90000 -61.07400 1.000 47.37542  ? 1041 THR A O     1 
ATOM   7786  C  CB    . THR A 1 1041 ? -25.64900 -17.31200 -62.37800 1.000 48.18128  ? 1041 THR A CB    1 
ATOM   7787  O  OG1   . THR A 1 1041 ? -25.63800 -18.22400 -61.27200 1.000 59.36880  ? 1041 THR A OG1   1 
ATOM   7788  C  CG2   . THR A 1 1041 ? -24.32900 -17.41000 -63.12700 1.000 46.82095  ? 1041 THR A CG2   1 
ATOM   7789  N  N     . HIS A 1 1042 ? -25.13800 -15.95700 -59.56500 1.000 49.81753  ? 1042 HIS A N     1 
ATOM   7790  C  CA    . HIS A 1 1042 ? -24.28800 -15.64100 -58.42700 1.000 49.69065  ? 1042 HIS A CA    1 
ATOM   7791  C  C     . HIS A 1 1042 ? -24.45500 -16.72500 -57.37200 1.000 55.55958  ? 1042 HIS A C     1 
ATOM   7792  O  O     . HIS A 1 1042 ? -25.31700 -17.60100 -57.48100 1.000 62.41793  ? 1042 HIS A O     1 
ATOM   7793  C  CB    . HIS A 1 1042 ? -24.61900 -14.25700 -57.85800 1.000 49.05642  ? 1042 HIS A CB    1 
ATOM   7794  C  CG    . HIS A 1 1042 ? -26.05300 -14.10100 -57.45700 1.000 47.25555  ? 1042 HIS A CG    1 
ATOM   7795  N  ND1   . HIS A 1 1042 ? -26.53200 -14.50600 -56.23000 1.000 52.24510  ? 1042 HIS A ND1   1 
ATOM   7796  C  CD2   . HIS A 1 1042 ? -27.11500 -13.59800 -58.12800 1.000 45.02031  ? 1042 HIS A CD2   1 
ATOM   7797  C  CE1   . HIS A 1 1042 ? -27.82600 -14.25100 -56.15900 1.000 56.21794  ? 1042 HIS A CE1   1 
ATOM   7798  N  NE2   . HIS A 1 1042 ? -28.20500 -13.70200 -57.29900 1.000 53.18919  ? 1042 HIS A NE2   1 
ATOM   7799  N  N     . GLY A 1 1043 ? -23.61700 -16.65500 -56.34000 1.000 50.81260  ? 1043 GLY A N     1 
ATOM   7800  C  CA    . GLY A 1 1043 ? -23.59900 -17.65800 -55.29600 1.000 46.33959  ? 1043 GLY A CA    1 
ATOM   7801  C  C     . GLY A 1 1043 ? -24.69100 -17.56200 -54.25700 1.000 50.28518  ? 1043 GLY A C     1 
ATOM   7802  O  O     . GLY A 1 1043 ? -24.73000 -18.39000 -53.34200 1.000 60.27133  ? 1043 GLY A O     1 
ATOM   7803  N  N     . GLY A 1 1044 ? -25.58500 -16.58200 -54.36300 1.000 58.58910  ? 1044 GLY A N     1 
ATOM   7804  C  CA    . GLY A 1 1044 ? -26.63500 -16.43000 -53.37300 1.000 59.25980  ? 1044 GLY A CA    1 
ATOM   7805  C  C     . GLY A 1 1044 ? -27.81300 -17.35400 -53.62700 1.000 59.39787  ? 1044 GLY A C     1 
ATOM   7806  O  O     . GLY A 1 1044 ? -28.08900 -17.76200 -54.75400 1.000 63.79359  ? 1044 GLY A O     1 
ATOM   7807  N  N     . ILE A 1 1045 ? -28.51900 -17.68200 -52.54700 1.000 53.26492  ? 1045 ILE A N     1 
ATOM   7808  C  CA    . ILE A 1 1045 ? -29.67500 -18.57000 -52.58800 1.000 52.78977  ? 1045 ILE A CA    1 
ATOM   7809  C  C     . ILE A 1 1045 ? -30.92300 -17.75300 -52.29000 1.000 53.87632  ? 1045 ILE A C     1 
ATOM   7810  O  O     . ILE A 1 1045 ? -30.99200 -17.06600 -51.26300 1.000 56.19398  ? 1045 ILE A O     1 
ATOM   7811  C  CB    . ILE A 1 1045 ? -29.53200 -19.73100 -51.58900 1.000 50.62798  ? 1045 ILE A CB    1 
ATOM   7812  C  CG1   . ILE A 1 1045 ? -28.30900 -20.57900 -51.93300 1.000 50.68540  ? 1045 ILE A CG1   1 
ATOM   7813  C  CG2   . ILE A 1 1045 ? -30.78600 -20.58800 -51.58300 1.000 48.11334  ? 1045 ILE A CG2   1 
ATOM   7814  C  CD1   . ILE A 1 1045 ? -28.36100 -21.16500 -53.31600 1.000 53.90974  ? 1045 ILE A CD1   1 
ATOM   7815  N  N     . GLU A 1 1046 ? -31.90500 -17.82800 -53.18400 1.000 56.34286  ? 1046 GLU A N     1 
ATOM   7816  C  CA    . GLU A 1 1046 ? -33.18400 -17.15500 -52.98300 1.000 58.09398  ? 1046 GLU A CA    1 
ATOM   7817  C  C     . GLU A 1 1046 ? -34.00700 -17.95200 -51.97800 1.000 58.41626  ? 1046 GLU A C     1 
ATOM   7818  O  O     . GLU A 1 1046 ? -34.48600 -19.04900 -52.28700 1.000 54.64456  ? 1046 GLU A O     1 
ATOM   7819  C  CB    . GLU A 1 1046 ? -33.92500 -17.00300 -54.30700 1.000 47.22453  ? 1046 GLU A CB    1 
ATOM   7820  C  CG    . GLU A 1 1046 ? -35.35100 -16.49000 -54.16600 1.000 56.68347  ? 1046 GLU A CG    1 
ATOM   7821  C  CD    . GLU A 1 1046 ? -35.41400 -15.04900 -53.69800 1.000 60.82036  ? 1046 GLU A CD    1 
ATOM   7822  O  OE1   . GLU A 1 1046 ? -35.06200 -14.14900 -54.48900 1.000 64.71255  ? 1046 GLU A OE1   1 
ATOM   7823  O  OE2   . GLU A 1 1046 ? -35.81800 -14.81800 -52.53900 1.000 57.20884  ? 1046 GLU A OE2   1 
ATOM   7824  N  N     . MET A 1 1047 ? -34.16400 -17.40700 -50.77300 1.000 56.21420  ? 1047 MET A N     1 
ATOM   7825  C  CA    . MET A 1 1047 ? -34.97000 -18.02400 -49.72900 1.000 54.75486  ? 1047 MET A CA    1 
ATOM   7826  C  C     . MET A 1 1047 ? -36.19400 -17.18900 -49.37800 1.000 55.70201  ? 1047 MET A C     1 
ATOM   7827  O  O     . MET A 1 1047 ? -36.84800 -17.45900 -48.36500 1.000 59.64182  ? 1047 MET A O     1 
ATOM   7828  C  CB    . MET A 1 1047 ? -34.12800 -18.25600 -48.47300 1.000 58.20184  ? 1047 MET A CB    1 
ATOM   7829  C  CG    . MET A 1 1047 ? -32.69200 -18.66000 -48.74100 1.000 58.70471  ? 1047 MET A CG    1 
ATOM   7830  S  SD    . MET A 1 1047 ? -31.74600 -18.75800 -47.21100 1.000 73.14030  ? 1047 MET A SD    1 
ATOM   7831  C  CE    . MET A 1 1047 ? -32.06600 -17.13800 -46.51700 1.000 67.17429  ? 1047 MET A CE    1 
ATOM   7832  N  N     . GLY A 1 1048 ? -36.51400 -16.18100 -50.18400 1.000 51.59533  ? 1048 GLY A N     1 
ATOM   7833  C  CA    . GLY A 1 1048 ? -37.58900 -15.25800 -49.89100 1.000 55.42290  ? 1048 GLY A CA    1 
ATOM   7834  C  C     . GLY A 1 1048 ? -37.13400 -13.84200 -49.62300 1.000 60.38371  ? 1048 GLY A C     1 
ATOM   7835  O  O     . GLY A 1 1048 ? -37.97000 -12.92800 -49.63700 1.000 64.92618  ? 1048 GLY A O     1 
ATOM   7836  N  N     . GLN A 1 1049 ? -35.84300 -13.62500 -49.38000 1.000 58.21015  ? 1049 GLN A N     1 
ATOM   7837  C  CA    . GLN A 1 1049 ? -35.31500 -12.28600 -49.15900 1.000 59.35678  ? 1049 GLN A CA    1 
ATOM   7838  C  C     . GLN A 1 1049 ? -35.17200 -11.48500 -50.44700 1.000 54.68698  ? 1049 GLN A C     1 
ATOM   7839  O  O     . GLN A 1 1049 ? -34.70000 -10.34400 -50.39700 1.000 59.65410  ? 1049 GLN A O     1 
ATOM   7840  C  CB    . GLN A 1 1049 ? -33.96100 -12.36300 -48.44300 1.000 64.12609  ? 1049 GLN A CB    1 
ATOM   7841  C  CG    . GLN A 1 1049 ? -32.77800 -12.70200 -49.34300 1.000 63.95150  ? 1049 GLN A CG    1 
ATOM   7842  C  CD    . GLN A 1 1049 ? -32.67200 -14.18400 -49.65000 1.000 60.53236  ? 1049 GLN A CD    1 
ATOM   7843  O  OE1   . GLN A 1 1049 ? -33.61100 -14.79700 -50.15800 1.000 59.98081  ? 1049 GLN A OE1   1 
ATOM   7844  N  NE2   . GLN A 1 1049 ? -31.52000 -14.76800 -49.34000 1.000 65.28300  ? 1049 GLN A NE2   1 
ATOM   7845  N  N     . GLY A 1 1050 ? -35.56300 -12.04700 -51.58600 1.000 51.51755  ? 1050 GLY A N     1 
ATOM   7846  C  CA    . GLY A 1 1050 ? -35.49400 -11.32200 -52.84400 1.000 60.45053  ? 1050 GLY A CA    1 
ATOM   7847  C  C     . GLY A 1 1050 ? -34.09000 -10.95000 -53.26600 1.000 58.63166  ? 1050 GLY A C     1 
ATOM   7848  O  O     . GLY A 1 1050 ? -33.88200 -9.87000  -53.83500 1.000 62.70935  ? 1050 GLY A O     1 
ATOM   7849  N  N     . VAL A 1 1051 ? -33.11400 -11.82000 -52.99600 1.000 55.27254  ? 1051 VAL A N     1 
ATOM   7850  C  CA    . VAL A 1 1051 ? -31.74200 -11.54300 -53.41200 1.000 54.23920  ? 1051 VAL A CA    1 
ATOM   7851  C  C     . VAL A 1 1051 ? -31.65400 -11.47200 -54.93100 1.000 55.34441  ? 1051 VAL A C     1 
ATOM   7852  O  O     . VAL A 1 1051 ? -30.99000 -10.59000 -55.48800 1.000 63.02325  ? 1051 VAL A O     1 
ATOM   7853  C  CB    . VAL A 1 1051 ? -30.77900 -12.59500 -52.82800 1.000 56.64723  ? 1051 VAL A CB    1 
ATOM   7854  C  CG1   . VAL A 1 1051 ? -31.32632 -13.99812 -53.03334 1.000 56.01244  ? 1051 VAL A CG1   1 
ATOM   7855  C  CG2   . VAL A 1 1051 ? -29.39407 -12.46007 -53.44664 1.000 52.50231  ? 1051 VAL A CG2   1 
ATOM   7856  N  N     . HIS A 1 1052 ? -32.34100 -12.38300 -55.62600 1.000 57.97099  ? 1052 HIS A N     1 
ATOM   7857  C  CA    . HIS A 1 1052 ? -32.34100 -12.35500 -57.08500 1.000 57.18203  ? 1052 HIS A CA    1 
ATOM   7858  C  C     . HIS A 1 1052 ? -32.95800 -11.06700 -57.61200 1.000 55.75743  ? 1052 HIS A C     1 
ATOM   7859  O  O     . HIS A 1 1052 ? -32.45500 -10.47800 -58.57600 1.000 63.19015  ? 1052 HIS A O     1 
ATOM   7860  C  CB    . HIS A 1 1052 ? -33.08700 -13.57100 -57.63400 1.000 53.45604  ? 1052 HIS A CB    1 
ATOM   7861  C  CG    . HIS A 1 1052 ? -32.34000 -14.85900 -57.47600 1.000 60.23311  ? 1052 HIS A CG    1 
ATOM   7862  N  ND1   . HIS A 1 1052 ? -30.97900 -14.90900 -57.26600 1.000 59.35797  ? 1052 HIS A ND1   1 
ATOM   7863  C  CD2   . HIS A 1 1052 ? -32.76400 -16.14500 -57.49800 1.000 62.04787  ? 1052 HIS A CD2   1 
ATOM   7864  C  CE1   . HIS A 1 1052 ? -30.59600 -16.16900 -57.16500 1.000 59.94884  ? 1052 HIS A CE1   1 
ATOM   7865  N  NE2   . HIS A 1 1052 ? -31.66100 -16.94000 -57.30300 1.000 63.25963  ? 1052 HIS A NE2   1 
ATOM   7866  N  N     . THR A 1 1053 ? -34.04800 -10.61100 -56.98900 1.000 63.73578  ? 1053 THR A N     1 
ATOM   7867  C  CA    . THR A 1 1053 ? -34.68200 -9.36900  -57.42000 1.000 65.36502  ? 1053 THR A CA    1 
ATOM   7868  C  C     . THR A 1 1053 ? -33.73500 -8.18500  -57.27100 1.000 61.88261  ? 1053 THR A C     1 
ATOM   7869  O  O     . THR A 1 1053 ? -33.67200 -7.31600  -58.14900 1.000 62.55970  ? 1053 THR A O     1 
ATOM   7870  C  CB    . THR A 1 1053 ? -35.96600 -9.12700  -56.62400 1.000 55.44753  ? 1053 THR A CB    1 
ATOM   7871  O  OG1   . THR A 1 1053 ? -36.75400 -10.32400 -56.60600 1.000 61.23011  ? 1053 THR A OG1   1 
ATOM   7872  C  CG2   . THR A 1 1053 ? -36.77800 -8.00300  -57.24700 1.000 53.04557  ? 1053 THR A CG2   1 
ATOM   7873  N  N     . LYS A 1 1054 ? -32.98200 -8.13800  -56.16900 1.000 55.19257  ? 1054 LYS A N     1 
ATOM   7874  C  CA    . LYS A 1 1054 ? -32.04600 -7.03800  -55.96400 1.000 59.90540  ? 1054 LYS A CA    1 
ATOM   7875  C  C     . LYS A 1 1054 ? -30.87700 -7.10000  -56.94000 1.000 62.82726  ? 1054 LYS A C     1 
ATOM   7876  O  O     . LYS A 1 1054 ? -30.35200 -6.05400  -57.33700 1.000 60.35556  ? 1054 LYS A O     1 
ATOM   7877  C  CB    . LYS A 1 1054 ? -31.53300 -7.03900  -54.52400 1.000 58.27714  ? 1054 LYS A CB    1 
ATOM   7878  C  CG    . LYS A 1 1054 ? -32.52800 -6.50600  -53.50300 1.000 53.47100  ? 1054 LYS A CG    1 
ATOM   7879  C  CD    . LYS A 1 1054 ? -31.96800 -6.60000  -52.09200 1.000 64.54887  ? 1054 LYS A CD    1 
ATOM   7880  C  CE    . LYS A 1 1054 ? -32.94100 -6.04300  -51.06700 1.000 66.50065  ? 1054 LYS A CE    1 
ATOM   7881  N  NZ    . LYS A 1 1054 ? -32.41700 -6.17900  -49.67900 1.000 61.43484  ? 1054 LYS A NZ    1 
ATOM   7882  N  N     . MET A 1 1055 ? -30.45600 -8.30500  -57.33800 1.000 63.53390  ? 1055 MET A N     1 
ATOM   7883  C  CA    . MET A 1 1055 ? -29.34900 -8.41800  -58.28300 1.000 58.26540  ? 1055 MET A CA    1 
ATOM   7884  C  C     . MET A 1 1055 ? -29.74200 -7.89700  -59.65900 1.000 61.09344  ? 1055 MET A C     1 
ATOM   7885  O  O     . MET A 1 1055 ? -28.95500 -7.20500  -60.31400 1.000 58.65715  ? 1055 MET A O     1 
ATOM   7886  C  CB    . MET A 1 1055 ? -28.87400 -9.86700  -58.37700 1.000 52.12207  ? 1055 MET A CB    1 
ATOM   7887  C  CG    . MET A 1 1055 ? -28.35900 -10.44900 -57.07300 1.000 53.73991  ? 1055 MET A CG    1 
ATOM   7888  S  SD    . MET A 1 1055 ? -27.14800 -9.40500  -56.24600 1.000 64.15050  ? 1055 MET A SD    1 
ATOM   7889  C  CE    . MET A 1 1055 ? -28.12500 -8.76200  -54.88900 1.000 62.75921  ? 1055 MET A CE    1 
ATOM   7890  N  N     . ILE A 1 1056 ? -30.95500 -8.22200  -60.11500 1.000 58.13110  ? 1056 ILE A N     1 
ATOM   7891  C  CA    . ILE A 1 1056 ? -31.42900 -7.70200  -61.39400 1.000 58.97233  ? 1056 ILE A CA    1 
ATOM   7892  C  C     . ILE A 1 1056 ? -31.56000 -6.18700  -61.33800 1.000 62.19818  ? 1056 ILE A C     1 
ATOM   7893  O  O     . ILE A 1 1056 ? -31.36000 -5.50000  -62.34800 1.000 61.50000  ? 1056 ILE A O     1 
ATOM   7894  C  CB    . ILE A 1 1056 ? -32.75900 -8.37800  -61.78200 1.000 59.44661  ? 1056 ILE A CB    1 
ATOM   7895  C  CG1   . ILE A 1 1056 ? -32.62300 -9.89800  -61.69500 1.000 60.56096  ? 1056 ILE A CG1   1 
ATOM   7896  C  CG2   . ILE A 1 1056 ? -33.18100 -7.97200  -63.18300 1.000 57.00329  ? 1056 ILE A CG2   1 
ATOM   7897  C  CD1   . ILE A 1 1056 ? -31.64400 -10.48600 -62.67900 1.000 64.12862  ? 1056 ILE A CD1   1 
ATOM   7898  N  N     . GLN A 1 1057 ? -31.89100 -5.63900  -60.16500 1.000 63.66143  ? 1057 GLN A N     1 
ATOM   7899  C  CA    . GLN A 1 1057 ? -31.88300 -4.19000  -60.00000 1.000 57.26477  ? 1057 GLN A CA    1 
ATOM   7900  C  C     . GLN A 1 1057 ? -30.47600 -3.62400  -60.12700 1.000 61.99990  ? 1057 GLN A C     1 
ATOM   7901  O  O     . GLN A 1 1057 ? -30.30400 -2.49400  -60.59900 1.000 68.80259  ? 1057 GLN A O     1 
ATOM   7902  C  CB    . GLN A 1 1057 ? -32.48300 -3.80600  -58.64700 1.000 54.02184  ? 1057 GLN A CB    1 
ATOM   7903  C  CG    . GLN A 1 1057 ? -33.98600 -3.98700  -58.54800 1.000 54.17466  ? 1057 GLN A CG    1 
ATOM   7904  C  CD    . GLN A 1 1057 ? -34.50100 -3.77700  -57.13700 1.000 57.83402  ? 1057 GLN A CD    1 
ATOM   7905  O  OE1   . GLN A 1 1057 ? -34.16300 -4.52700  -56.22200 1.000 60.11386  ? 1057 GLN A OE1   1 
ATOM   7906  N  NE2   . GLN A 1 1057 ? -35.31900 -2.74800  -56.95300 1.000 72.90298  ? 1057 GLN A NE2   1 
ATOM   7907  N  N     . VAL A 1 1058 ? -29.46200 -4.38700  -59.71200 1.000 59.54771  ? 1058 VAL A N     1 
ATOM   7908  C  CA    . VAL A 1 1058 ? -28.08400 -3.92800  -59.84400 1.000 59.47621  ? 1058 VAL A CA    1 
ATOM   7909  C  C     . VAL A 1 1058 ? -27.63600 -3.99400  -61.30000 1.000 60.16889  ? 1058 VAL A C     1 
ATOM   7910  O  O     . VAL A 1 1058 ? -26.94400 -3.09400  -61.79200 1.000 62.46790  ? 1058 VAL A O     1 
ATOM   7911  C  CB    . VAL A 1 1058 ? -27.15900 -4.74500  -58.92300 1.000 52.38532  ? 1058 VAL A CB    1 
ATOM   7912  C  CG1   . VAL A 1 1058 ? -25.70400 -4.37600  -59.16100 1.000 52.90855  ? 1058 VAL A CG1   1 
ATOM   7913  C  CG2   . VAL A 1 1058 ? -27.53200 -4.52100  -57.46600 1.000 50.95620  ? 1058 VAL A CG2   1 
ATOM   7914  N  N     . VAL A 1 1059 ? -28.02600 -5.05400  -62.01400 1.000 58.01565  ? 1059 VAL A N     1 
ATOM   7915  C  CA    . VAL A 1 1059 ? -27.70200 -5.15000  -63.43600 1.000 55.23456  ? 1059 VAL A CA    1 
ATOM   7916  C  C     . VAL A 1 1059 ? -28.38900 -4.03500  -64.21100 1.000 59.29206  ? 1059 VAL A C     1 
ATOM   7917  O  O     . VAL A 1 1059 ? -27.82000 -3.46900  -65.15300 1.000 71.03631  ? 1059 VAL A O     1 
ATOM   7918  C  CB    . VAL A 1 1059 ? -28.09100 -6.53500  -63.98700 1.000 57.31072  ? 1059 VAL A CB    1 
ATOM   7919  C  CG1   . VAL A 1 1059 ? -27.66600 -6.66600  -65.44300 1.000 52.22827  ? 1059 VAL A CG1   1 
ATOM   7920  C  CG2   . VAL A 1 1059 ? -27.47700 -7.63900  -63.15100 1.000 55.11236  ? 1059 VAL A CG2   1 
ATOM   7921  N  N     . SER A 1 1060 ? -29.62200 -3.69800  -63.82600 1.000 50.07932  ? 1060 SER A N     1 
ATOM   7922  C  CA    . SER A 1 1060 ? -30.37600 -2.68400  -64.55300 1.000 54.25576  ? 1060 SER A CA    1 
ATOM   7923  C  C     . SER A 1 1060 ? -29.73800 -1.30500  -64.43400 1.000 66.49938  ? 1060 SER A C     1 
ATOM   7924  O  O     . SER A 1 1060 ? -29.79600 -0.51600  -65.38500 1.000 69.52275  ? 1060 SER A O     1 
ATOM   7925  C  CB    . SER A 1 1060 ? -31.82000 -2.64600  -64.05400 1.000 64.43434  ? 1060 SER A CB    1 
ATOM   7926  O  OG    . SER A 1 1060 ? -32.55600 -1.62000  -64.69700 1.000 72.27816  ? 1060 SER A OG    1 
ATOM   7927  N  N     . ARG A 1 1061 ? -29.12900 -0.99400  -63.28900 1.000 62.68291  ? 1061 ARG A N     1 
ATOM   7928  C  CA    . ARG A 1 1061 ? -28.50000 0.31200   -63.12700 1.000 64.58673  ? 1061 ARG A CA    1 
ATOM   7929  C  C     . ARG A 1 1061 ? -27.10400 0.34000   -63.73600 1.000 63.65922  ? 1061 ARG A C     1 
ATOM   7930  O  O     . ARG A 1 1061 ? -26.74700 1.28700   -64.44500 1.000 79.06270  ? 1061 ARG A O     1 
ATOM   7931  C  CB    . ARG A 1 1061 ? -28.43700 0.69800   -61.64800 1.000 70.52480  ? 1061 ARG A CB    1 
ATOM   7932  C  CG    . ARG A 1 1061 ? -27.88700 2.09900   -61.42300 1.000 78.13439  ? 1061 ARG A CG    1 
ATOM   7933  C  CD    . ARG A 1 1061 ? -26.83300 2.13700   -60.32900 1.000 80.52783  ? 1061 ARG A CD    1 
ATOM   7934  N  NE    . ARG A 1 1061 ? -27.41800 2.25300   -58.99600 1.000 86.52614  ? 1061 ARG A NE    1 
ATOM   7935  C  CZ    . ARG A 1 1061 ? -27.72700 3.41000   -58.41800 1.000 87.61318  ? 1061 ARG A CZ    1 
ATOM   7936  N  NH1   . ARG A 1 1061 ? -27.51100 4.55100   -59.05900 1.000 95.91258  ? 1061 ARG A NH1   1 
ATOM   7937  N  NH2   . ARG A 1 1061 ? -28.25300 3.42900   -57.20100 1.000 82.51461  ? 1061 ARG A NH2   1 
ATOM   7938  N  N     . GLU A 1 1062 ? -26.30000 -0.69300  -63.47200 1.000 65.49635  ? 1062 GLU A N     1 
ATOM   7939  C  CA    . GLU A 1 1062 ? -24.90900 -0.68100  -63.90700 1.000 63.03342  ? 1062 GLU A CA    1 
ATOM   7940  C  C     . GLU A 1 1062 ? -24.76000 -0.86600  -65.41100 1.000 61.76071  ? 1062 GLU A C     1 
ATOM   7941  O  O     . GLU A 1 1062 ? -23.70200 -0.53900  -65.95800 1.000 67.14000  ? 1062 GLU A O     1 
ATOM   7942  C  CB    . GLU A 1 1062 ? -24.12000 -1.76100  -63.16700 1.000 58.30528  ? 1062 GLU A CB    1 
ATOM   7943  C  CG    . GLU A 1 1062 ? -23.91500 -1.47100  -61.68800 1.000 68.75837  ? 1062 GLU A CG    1 
ATOM   7944  C  CD    . GLU A 1 1062 ? -23.01400 -0.27300  -61.44200 1.000 82.51053  ? 1062 GLU A CD    1 
ATOM   7945  O  OE1   . GLU A 1 1062 ? -22.21100 0.06600   -62.33800 1.000 85.87362  ? 1062 GLU A OE1   1 
ATOM   7946  O  OE2   . GLU A 1 1062 ? -23.11300 0.33100   -60.35400 1.000 80.62976  ? 1062 GLU A OE2   1 
ATOM   7947  N  N     . LEU A 1 1063 ? -25.78500 -1.37900  -66.09100 1.000 62.52688  ? 1063 LEU A N     1 
ATOM   7948  C  CA    . LEU A 1 1063 ? -25.73400 -1.56100  -67.53400 1.000 64.19306  ? 1063 LEU A CA    1 
ATOM   7949  C  C     . LEU A 1 1063 ? -26.73900 -0.69900  -68.28400 1.000 64.43141  ? 1063 LEU A C     1 
ATOM   7950  O  O     . LEU A 1 1063 ? -26.74800 -0.72500  -69.52100 1.000 59.74678  ? 1063 LEU A O     1 
ATOM   7951  C  CB    . LEU A 1 1063 ? -25.94900 -3.03800  -67.89500 1.000 60.44232  ? 1063 LEU A CB    1 
ATOM   7952  C  CG    . LEU A 1 1063 ? -24.85000 -3.99600  -67.43000 1.000 66.66902  ? 1063 LEU A CG    1 
ATOM   7953  C  CD1   . LEU A 1 1063 ? -25.08100 -5.39500  -67.98500 1.000 61.74349  ? 1063 LEU A CD1   1 
ATOM   7954  C  CD2   . LEU A 1 1063 ? -23.47600 -3.47500  -67.82700 1.000 52.01741  ? 1063 LEU A CD2   1 
ATOM   7955  N  N     . ARG A 1 1064 ? -27.58100 0.05700   -67.57600 1.000 66.35847  ? 1064 ARG A N     1 
ATOM   7956  C  CA    . ARG A 1 1064 ? -28.53400 0.98700   -68.18100 1.000 69.42190  ? 1064 ARG A CA    1 
ATOM   7957  C  C     . ARG A 1 1064 ? -29.46500 0.26700   -69.16000 1.000 71.40331  ? 1064 ARG A C     1 
ATOM   7958  O  O     . ARG A 1 1064 ? -29.58400 0.62200   -70.33400 1.000 70.48801  ? 1064 ARG A O     1 
ATOM   7959  C  CB    . ARG A 1 1064 ? -27.80200 2.15100   -68.85800 1.000 76.68101  ? 1064 ARG A CB    1 
ATOM   7960  C  CG    . ARG A 1 1064 ? -26.89500 2.93000   -67.91900 1.000 85.23027  ? 1064 ARG A CG    1 
ATOM   7961  C  CD    . ARG A 1 1064 ? -25.74000 3.57400   -68.66600 1.000 99.08739  ? 1064 ARG A CD    1 
ATOM   7962  N  NE    . ARG A 1 1064 ? -24.60500 3.83500   -67.78500 1.000 104.99459 ? 1064 ARG A NE    1 
ATOM   7963  C  CZ    . ARG A 1 1064 ? -23.36600 4.06500   -68.20900 1.000 107.68790 ? 1064 ARG A CZ    1 
ATOM   7964  N  NH1   . ARG A 1 1064 ? -23.09700 4.06700   -69.50800 1.000 100.24106 ? 1064 ARG A NH1   1 
ATOM   7965  N  NH2   . ARG A 1 1064 ? -22.39500 4.29200   -67.33500 1.000 109.16001 ? 1064 ARG A NH2   1 
ATOM   7966  N  N     . MET A 1 1065 ? -30.12800 -0.76200  -68.64300 1.000 70.59833  ? 1065 MET A N     1 
ATOM   7967  C  CA    . MET A 1 1065 ? -31.09200 -1.55500  -69.38900 1.000 58.37554  ? 1065 MET A CA    1 
ATOM   7968  C  C     . MET A 1 1065 ? -32.23600 -1.92500  -68.46000 1.000 57.13782  ? 1065 MET A C     1 
ATOM   7969  O  O     . MET A 1 1065 ? -32.03100 -2.06900  -67.24900 1.000 61.34012  ? 1065 MET A O     1 
ATOM   7970  C  CB    . MET A 1 1065 ? -30.45800 -2.83300  -69.96200 1.000 53.54200  ? 1065 MET A CB    1 
ATOM   7971  C  CG    . MET A 1 1065 ? -29.85200 -3.74900  -68.90900 1.000 58.97549  ? 1065 MET A CG    1 
ATOM   7972  S  SD    . MET A 1 1065 ? -29.20400 -5.29100  -69.58400 1.000 58.32038  ? 1065 MET A SD    1 
ATOM   7973  C  CE    . MET A 1 1065 ? -27.87300 -4.68600  -70.61100 1.000 51.91462  ? 1065 MET A CE    1 
ATOM   7974  N  N     . PRO A 1 1066 ? -33.44700 -2.07700  -68.99000 1.000 49.00929  ? 1066 PRO A N     1 
ATOM   7975  C  CA    . PRO A 1 1066 ? -34.56500 -2.51200  -68.14800 1.000 52.77179  ? 1066 PRO A CA    1 
ATOM   7976  C  C     . PRO A 1 1066 ? -34.36200 -3.93500  -67.64900 1.000 59.84020  ? 1066 PRO A C     1 
ATOM   7977  O  O     . PRO A 1 1066 ? -33.64100 -4.73900  -68.24400 1.000 67.28953  ? 1066 PRO A O     1 
ATOM   7978  C  CB    . PRO A 1 1066 ? -35.77300 -2.41600  -69.08500 1.000 48.26240  ? 1066 PRO A CB    1 
ATOM   7979  C  CG    . PRO A 1 1066 ? -35.19500 -2.57000  -70.45100 1.000 42.21110  ? 1066 PRO A CG    1 
ATOM   7980  C  CD    . PRO A 1 1066 ? -33.85000 -1.90000  -70.39600 1.000 48.36432  ? 1066 PRO A CD    1 
ATOM   7981  N  N     . MET A 1 1067 ? -35.01700 -4.23900  -66.52400 1.000 52.38120  ? 1067 MET A N     1 
ATOM   7982  C  CA    . MET A 1 1067 ? -34.88900 -5.57200  -65.94500 1.000 55.56313  ? 1067 MET A CA    1 
ATOM   7983  C  C     . MET A 1 1067 ? -35.46100 -6.63800  -66.86600 1.000 57.93076  ? 1067 MET A C     1 
ATOM   7984  O  O     . MET A 1 1067 ? -35.05600 -7.80400  -66.79200 1.000 55.80121  ? 1067 MET A O     1 
ATOM   7985  C  CB    . MET A 1 1067 ? -35.59100 -5.64300  -64.59200 1.000 57.51816  ? 1067 MET A CB    1 
ATOM   7986  C  CG    . MET A 1 1067 ? -35.41700 -4.43700  -63.69900 1.000 61.14112  ? 1067 MET A CG    1 
ATOM   7987  S  SD    . MET A 1 1067 ? -36.11300 -4.80000  -62.07800 1.000 76.49570  ? 1067 MET A SD    1 
ATOM   7988  C  CE    . MET A 1 1067 ? -36.75900 -3.19600  -61.63800 1.000 74.67823  ? 1067 MET A CE    1 
ATOM   7989  N  N     . SER A 1 1068 ? -36.41000 -6.26300  -67.72900 1.000 59.45294  ? 1068 SER A N     1 
ATOM   7990  C  CA    . SER A 1 1068 ? -36.98600 -7.22000  -68.66800 1.000 61.55475  ? 1068 SER A CA    1 
ATOM   7991  C  C     . SER A 1 1068 ? -35.92200 -7.82200  -69.57500 1.000 61.27894  ? 1068 SER A C     1 
ATOM   7992  O  O     . SER A 1 1068 ? -36.09900 -8.93500  -70.08400 1.000 65.64759  ? 1068 SER A O     1 
ATOM   7993  C  CB    . SER A 1 1068 ? -38.07400 -6.54400  -69.50100 1.000 73.35785  ? 1068 SER A CB    1 
ATOM   7994  O  OG    . SER A 1 1068 ? -37.52600 -5.54200  -70.34200 1.000 67.78501  ? 1068 SER A OG    1 
ATOM   7995  N  N     . ASN A 1 1069 ? -34.81600 -7.10800  -69.78700 1.000 59.55003  ? 1069 ASN A N     1 
ATOM   7996  C  CA    . ASN A 1 1069 ? -33.72100 -7.62100  -70.59800 1.000 58.38564  ? 1069 ASN A CA    1 
ATOM   7997  C  C     . ASN A 1 1069 ? -32.83400 -8.59400  -69.83200 1.000 59.10907  ? 1069 ASN A C     1 
ATOM   7998  O  O     . ASN A 1 1069 ? -32.15700 -9.41800  -70.45700 1.000 69.43739  ? 1069 ASN A O     1 
ATOM   7999  C  CB    . ASN A 1 1069 ? -32.88100 -6.45700  -71.13000 1.000 49.70242  ? 1069 ASN A CB    1 
ATOM   8000  C  CG    . ASN A 1 1069 ? -31.85100 -6.89700  -72.14900 1.000 46.86592  ? 1069 ASN A CG    1 
ATOM   8001  O  OD1   . ASN A 1 1069 ? -32.17900 -7.16000  -73.30500 1.000 51.37209  ? 1069 ASN A OD1   1 
ATOM   8002  N  ND2   . ASN A 1 1069 ? -30.59500 -6.97500  -71.72600 1.000 53.61703  ? 1069 ASN A ND2   1 
ATOM   8003  N  N     . VAL A 1 1070 ? -32.82600 -8.52300  -68.50300 1.000 58.94839  ? 1070 VAL A N     1 
ATOM   8004  C  CA    . VAL A 1 1070 ? -31.98800 -9.37700  -67.67000 1.000 56.67463  ? 1070 VAL A CA    1 
ATOM   8005  C  C     . VAL A 1 1070 ? -32.80900 -10.56800 -67.20000 1.000 56.60380  ? 1070 VAL A C     1 
ATOM   8006  O  O     . VAL A 1 1070 ? -34.01900 -10.46500 -66.96700 1.000 70.38907  ? 1070 VAL A O     1 
ATOM   8007  C  CB    . VAL A 1 1070 ? -31.41000 -8.59300  -66.47100 1.000 53.95326  ? 1070 VAL A CB    1 
ATOM   8008  C  CG1   . VAL A 1 1070 ? -30.23500 -9.34100  -65.85700 1.000 54.94937  ? 1070 VAL A CG1   1 
ATOM   8009  C  CG2   . VAL A 1 1070 ? -31.00400 -7.19200  -66.89800 1.000 57.45337  ? 1070 VAL A CG2   1 
ATOM   8010  N  N     . HIS A 1 1071 ? -32.14900 -11.71600 -67.06100 1.000 51.74771  ? 1071 HIS A N     1 
ATOM   8011  C  CA    . HIS A 1 1071 ? -32.79700 -12.91600 -66.55400 1.000 57.95327  ? 1071 HIS A CA    1 
ATOM   8012  C  C     . HIS A 1 1071 ? -31.81800 -13.70700 -65.70100 1.000 55.70061  ? 1071 HIS A C     1 
ATOM   8013  O  O     . HIS A 1 1071 ? -30.60200 -13.65000 -65.90400 1.000 52.90689  ? 1071 HIS A O     1 
ATOM   8014  C  CB    . HIS A 1 1071 ? -33.33400 -13.80400 -67.68600 1.000 62.41078  ? 1071 HIS A CB    1 
ATOM   8015  C  CG    . HIS A 1 1071 ? -34.08600 -15.00400 -67.20100 1.000 63.66808  ? 1071 HIS A CG    1 
ATOM   8016  N  ND1   . HIS A 1 1071 ? -35.31200 -14.91300 -66.57800 1.000 65.61330  ? 1071 HIS A ND1   1 
ATOM   8017  C  CD2   . HIS A 1 1071 ? -33.78000 -16.32300 -67.23700 1.000 62.79184  ? 1071 HIS A CD2   1 
ATOM   8018  C  CE1   . HIS A 1 1071 ? -35.73100 -16.12300 -66.25600 1.000 61.56429  ? 1071 HIS A CE1   1 
ATOM   8019  N  NE2   . HIS A 1 1071 ? -34.82100 -16.99700 -66.64500 1.000 57.77152  ? 1071 HIS A NE2   1 
ATOM   8020  N  N     . LEU A 1 1072 ? -32.36700 -14.44800 -64.74100 1.000 53.63352  ? 1072 LEU A N     1 
ATOM   8021  C  CA    . LEU A 1 1072 ? -31.59400 -15.30400 -63.85500 1.000 51.29797  ? 1072 LEU A CA    1 
ATOM   8022  C  C     . LEU A 1 1072 ? -32.36100 -16.59900 -63.64600 1.000 57.10099  ? 1072 LEU A C     1 
ATOM   8023  O  O     . LEU A 1 1072 ? -33.57500 -16.57900 -63.42200 1.000 59.00483  ? 1072 LEU A O     1 
ATOM   8024  C  CB    . LEU A 1 1072 ? -31.32000 -14.61100 -62.50900 1.000 42.45623  ? 1072 LEU A CB    1 
ATOM   8025  C  CG    . LEU A 1 1072 ? -30.41900 -15.29500 -61.47600 1.000 51.00016  ? 1072 LEU A CG    1 
ATOM   8026  C  CD1   . LEU A 1 1072 ? -29.70200 -14.24800 -60.63700 1.000 51.37263  ? 1072 LEU A CD1   1 
ATOM   8027  C  CD2   . LEU A 1 1072 ? -31.20600 -16.23900 -60.57500 1.000 46.32788  ? 1072 LEU A CD2   1 
ATOM   8028  N  N     . ARG A 1 1073 ? -31.65100 -17.72400 -63.72000 1.000 59.13394  ? 1073 ARG A N     1 
ATOM   8029  C  CA    . ARG A 1 1073 ? -32.27200 -19.03700 -63.57400 1.000 49.59681  ? 1073 ARG A CA    1 
ATOM   8030  C  C     . ARG A 1 1073 ? -32.13900 -19.59800 -62.16500 1.000 47.40231  ? 1073 ARG A C     1 
ATOM   8031  O  O     . ARG A 1 1073 ? -33.12000 -20.08800 -61.60000 1.000 53.33436  ? 1073 ARG A O     1 
ATOM   8032  C  CB    . ARG A 1 1073 ? -31.67800 -20.02200 -64.58900 1.000 42.82213  ? 1073 ARG A CB    1 
ATOM   8033  C  CG    . ARG A 1 1073 ? -31.82800 -19.58100 -66.03400 1.000 53.07438  ? 1073 ARG A CG    1 
ATOM   8034  C  CD    . ARG A 1 1073 ? -31.48000 -20.70400 -66.99600 1.000 61.06817  ? 1073 ARG A CD    1 
ATOM   8035  N  NE    . ARG A 1 1073 ? -32.56500 -21.67500 -67.10900 1.000 66.34844  ? 1073 ARG A NE    1 
ATOM   8036  C  CZ    . ARG A 1 1073 ? -32.43100 -22.89100 -67.62800 1.000 64.07884  ? 1073 ARG A CZ    1 
ATOM   8037  N  NH1   . ARG A 1 1073 ? -31.25300 -23.29200 -68.08600 1.000 61.49994  ? 1073 ARG A NH1   1 
ATOM   8038  N  NH2   . ARG A 1 1073 ? -33.47400 -23.70800 -67.68900 1.000 65.53761  ? 1073 ARG A NH2   1 
ATOM   8039  N  N     . GLY A 1 1074 ? -30.94900 -19.53700 -61.58300 1.000 47.84469  ? 1074 GLY A N     1 
ATOM   8040  C  CA    . GLY A 1 1074 ? -30.77200 -20.04000 -60.23400 1.000 48.73699  ? 1074 GLY A CA    1 
ATOM   8041  C  C     . GLY A 1 1074 ? -29.32400 -19.98900 -59.80600 1.000 44.17580  ? 1074 GLY A C     1 
ATOM   8042  O  O     . GLY A 1 1074 ? -28.53900 -19.18200 -60.30700 1.000 46.21929  ? 1074 GLY A O     1 
ATOM   8043  N  N     . THR A 1 1075 ? -28.98300 -20.86200 -58.86100 1.000 40.54956  ? 1075 THR A N     1 
ATOM   8044  C  CA    . THR A 1 1075 ? -27.63400 -20.96500 -58.32200 1.000 46.50422  ? 1075 THR A CA    1 
ATOM   8045  C  C     . THR A 1 1075 ? -27.11500 -22.37500 -58.55700 1.000 50.74004  ? 1075 THR A C     1 
ATOM   8046  O  O     . THR A 1 1075 ? -27.83200 -23.35200 -58.31800 1.000 55.29650  ? 1075 THR A O     1 
ATOM   8047  C  CB    . THR A 1 1075 ? -27.61000 -20.63000 -56.82700 1.000 45.78137  ? 1075 THR A CB    1 
ATOM   8048  O  OG1   . THR A 1 1075 ? -28.23200 -19.35800 -56.61000 1.000 58.10095  ? 1075 THR A OG1   1 
ATOM   8049  C  CG2   . THR A 1 1075 ? -26.18000 -20.58400 -56.30600 1.000 57.20152  ? 1075 THR A CG2   1 
ATOM   8050  N  N     . SER A 1 1076 ? -25.87400 -22.47900 -59.02700 1.000 54.95775  ? 1076 SER A N     1 
ATOM   8051  C  CA    . SER A 1 1076 ? -25.29000 -23.77400 -59.33900 1.000 49.84012  ? 1076 SER A CA    1 
ATOM   8052  C  C     . SER A 1 1076 ? -23.78300 -23.71100 -59.14700 1.000 51.78469  ? 1076 SER A C     1 
ATOM   8053  O  O     . SER A 1 1076 ? -23.13800 -22.73800 -59.54700 1.000 61.91111  ? 1076 SER A O     1 
ATOM   8054  C  CB    . SER A 1 1076 ? -25.62200 -24.20400 -60.77300 1.000 52.70025  ? 1076 SER A CB    1 
ATOM   8055  O  OG    . SER A 1 1076 ? -25.00600 -25.43900 -61.08900 1.000 54.24608  ? 1076 SER A OG    1 
ATOM   8056  N  N     . THR A 1 1077 ? -23.22900 -24.75900 -58.53300 1.000 48.98649  ? 1077 THR A N     1 
ATOM   8057  C  CA    . THR A 1 1077 ? -21.78400 -24.86100 -58.37200 1.000 49.80980  ? 1077 THR A CA    1 
ATOM   8058  C  C     . THR A 1 1077 ? -21.06100 -25.06100 -59.69700 1.000 52.38969  ? 1077 THR A C     1 
ATOM   8059  O  O     . THR A 1 1077 ? -19.83300 -24.93100 -59.73900 1.000 52.16094  ? 1077 THR A O     1 
ATOM   8060  C  CB    . THR A 1 1077 ? -21.43500 -26.00500 -57.41700 1.000 46.61166  ? 1077 THR A CB    1 
ATOM   8061  O  OG1   . THR A 1 1077 ? -22.08500 -27.20700 -57.84900 1.000 55.08196  ? 1077 THR A OG1   1 
ATOM   8062  C  CG2   . THR A 1 1077 ? -21.88200 -25.67500 -56.00100 1.000 44.78225  ? 1077 THR A CG2   1 
ATOM   8063  N  N     . GLU A 1 1078 ? -21.78600 -25.37400 -60.77100 1.000 56.48427  ? 1078 GLU A N     1 
ATOM   8064  C  CA    . GLU A 1 1078 ? -21.19600 -25.49000 -62.09700 1.000 52.56140  ? 1078 GLU A CA    1 
ATOM   8065  C  C     . GLU A 1 1078 ? -20.93800 -24.13300 -62.74100 1.000 48.06479  ? 1078 GLU A C     1 
ATOM   8066  O  O     . GLU A 1 1078 ? -20.24300 -24.06900 -63.76100 1.000 52.19105  ? 1078 GLU A O     1 
ATOM   8067  C  CB    . GLU A 1 1078 ? -22.10700 -26.33500 -62.99600 1.000 48.77088  ? 1078 GLU A CB    1 
ATOM   8068  C  CG    . GLU A 1 1078 ? -21.44500 -26.86400 -64.26200 1.000 59.99646  ? 1078 GLU A CG    1 
ATOM   8069  C  CD    . GLU A 1 1078 ? -22.26000 -27.95100 -64.93900 1.000 62.07589  ? 1078 GLU A CD    1 
ATOM   8070  O  OE1   . GLU A 1 1078 ? -23.12200 -28.55700 -64.26800 1.000 62.71432  ? 1078 GLU A OE1   1 
ATOM   8071  O  OE2   . GLU A 1 1078 ? -22.03900 -28.19900 -66.14400 1.000 51.44804  ? 1078 GLU A OE2   1 
ATOM   8072  N  N     . THR A 1 1079 ? -21.46500 -23.05100 -62.16800 1.000 45.94380  ? 1079 THR A N     1 
ATOM   8073  C  CA    . THR A 1 1079 ? -21.27500 -21.70900 -62.70400 1.000 48.05391  ? 1079 THR A CA    1 
ATOM   8074  C  C     . THR A 1 1079 ? -20.48600 -20.80800 -61.76700 1.000 54.08102  ? 1079 THR A C     1 
ATOM   8075  O  O     . THR A 1 1079 ? -19.54000 -20.14300 -62.20800 1.000 56.84979  ? 1079 THR A O     1 
ATOM   8076  C  CB    . THR A 1 1079 ? -22.63700 -21.07000 -63.02300 1.000 46.08921  ? 1079 THR A CB    1 
ATOM   8077  O  OG1   . THR A 1 1079 ? -23.53600 -21.27700 -61.92600 1.000 54.21983  ? 1079 THR A OG1   1 
ATOM   8078  C  CG2   . THR A 1 1079 ? -23.23100 -21.68400 -64.28200 1.000 32.21369  ? 1079 THR A CG2   1 
ATOM   8079  N  N     . VAL A 1 1080 ? -20.84500 -20.75800 -60.49200 1.000 48.06209  ? 1080 VAL A N     1 
ATOM   8080  C  CA    . VAL A 1 1080 ? -20.15400 -19.94200 -59.50300 1.000 46.01475  ? 1080 VAL A CA    1 
ATOM   8081  C  C     . VAL A 1 1080 ? -19.56800 -20.86900 -58.44600 1.000 55.81219  ? 1080 VAL A C     1 
ATOM   8082  O  O     . VAL A 1 1080 ? -20.28400 -21.37300 -57.57900 1.000 56.26957  ? 1080 VAL A O     1 
ATOM   8083  C  CB    . VAL A 1 1080 ? -21.09600 -18.90300 -58.86800 1.000 55.43162  ? 1080 VAL A CB    1 
ATOM   8084  C  CG1   . VAL A 1 1080 ? -20.35700 -18.10000 -57.81100 1.000 48.76780  ? 1080 VAL A CG1   1 
ATOM   8085  C  CG2   . VAL A 1 1080 ? -21.66100 -17.98500 -59.93500 1.000 54.45789  ? 1080 VAL A CG2   1 
ATOM   8086  N  N     . PRO A 1 1081 ? -18.26500 -21.12000 -58.48500 1.000 58.92826  ? 1081 PRO A N     1 
ATOM   8087  C  CA    . PRO A 1 1081 ? -17.66500 -22.05400 -57.53200 1.000 53.54467  ? 1081 PRO A CA    1 
ATOM   8088  C  C     . PRO A 1 1081 ? -17.28600 -21.36900 -56.22800 1.000 54.99056  ? 1081 PRO A C     1 
ATOM   8089  O  O     . PRO A 1 1081 ? -17.10600 -20.15100 -56.15700 1.000 61.47906  ? 1081 PRO A O     1 
ATOM   8090  C  CB    . PRO A 1 1081 ? -16.42100 -22.55000 -58.27500 1.000 54.16883  ? 1081 PRO A CB    1 
ATOM   8091  C  CG    . PRO A 1 1081 ? -16.00700 -21.36700 -59.08300 1.000 55.40885  ? 1081 PRO A CG    1 
ATOM   8092  C  CD    . PRO A 1 1081 ? -17.28600 -20.65600 -59.48600 1.000 60.85134  ? 1081 PRO A CD    1 
ATOM   8093  N  N     . ASN A 1 1082 ? -17.18600 -22.19000 -55.18200 1.000 64.59098  ? 1082 ASN A N     1 
ATOM   8094  C  CA    . ASN A 1 1082 ? -16.69100 -21.76100 -53.87200 1.000 55.87320  ? 1082 ASN A CA    1 
ATOM   8095  C  C     . ASN A 1 1082 ? -17.55100 -20.64700 -53.27900 1.000 54.67342  ? 1082 ASN A C     1 
ATOM   8096  O  O     . ASN A 1 1082 ? -17.04500 -19.71400 -52.65200 1.000 61.80899  ? 1082 ASN A O     1 
ATOM   8097  C  CB    . ASN A 1 1082 ? -15.22600 -21.32900 -53.95900 1.000 52.74085  ? 1082 ASN A CB    1 
ATOM   8098  C  CG    . ASN A 1 1082 ? -14.41700 -22.20700 -54.89300 1.000 55.53836  ? 1082 ASN A CG    1 
ATOM   8099  O  OD1   . ASN A 1 1082 ? -14.58600 -23.42600 -54.92200 1.000 59.75609  ? 1082 ASN A OD1   1 
ATOM   8100  N  ND2   . ASN A 1 1082 ? -13.53200 -21.58900 -55.66600 1.000 59.03551  ? 1082 ASN A ND2   1 
ATOM   8101  N  N     . ALA A 1 1083 ? -18.86200 -20.74500 -53.47300 1.000 54.57027  ? 1083 ALA A N     1 
ATOM   8102  C  CA    . ALA A 1 1083 ? -19.77200 -19.75200 -52.92300 1.000 51.58132  ? 1083 ALA A CA    1 
ATOM   8103  C  C     . ALA A 1 1083 ? -19.90300 -19.92600 -51.41500 1.000 61.09001  ? 1083 ALA A C     1 
ATOM   8104  O  O     . ALA A 1 1083 ? -19.88300 -21.04600 -50.89800 1.000 63.99961  ? 1083 ALA A O     1 
ATOM   8105  C  CB    . ALA A 1 1083 ? -21.14400 -19.86100 -53.58500 1.000 61.05652  ? 1083 ALA A CB    1 
ATOM   8106  N  N     . ASN A 1 1084 ? -20.03300 -18.80700 -50.70900 1.000 60.21797  ? 1084 ASN A N     1 
ATOM   8107  C  CA    . ASN A 1 1084 ? -20.22000 -18.84400 -49.26900 1.000 57.57912  ? 1084 ASN A CA    1 
ATOM   8108  C  C     . ASN A 1 1084 ? -21.68200 -19.13200 -48.93300 1.000 60.77876  ? 1084 ASN A C     1 
ATOM   8109  O  O     . ASN A 1 1084 ? -22.56300 -19.12300 -49.79800 1.000 61.09818  ? 1084 ASN A O     1 
ATOM   8110  C  CB    . ASN A 1 1084 ? -19.76800 -17.52900 -48.63600 1.000 62.77870  ? 1084 ASN A CB    1 
ATOM   8111  C  CG    . ASN A 1 1084 ? -18.34000 -17.58900 -48.12900 1.000 64.91732  ? 1084 ASN A CG    1 
ATOM   8112  O  OD1   . ASN A 1 1084 ? -17.97100 -18.50000 -47.38800 1.000 65.17388  ? 1084 ASN A OD1   1 
ATOM   8113  N  ND2   . ASN A 1 1084 ? -17.52700 -16.61700 -48.53100 1.000 61.70875  ? 1084 ASN A ND2   1 
ATOM   8114  N  N     . ILE A 1 1085 ? -21.93500 -19.39500 -47.65000 1.000 55.84165  ? 1085 ILE A N     1 
ATOM   8115  C  CA    . ILE A 1 1085 ? -23.28100 -19.73400 -47.20700 1.000 58.07204  ? 1085 ILE A CA    1 
ATOM   8116  C  C     . ILE A 1 1085 ? -24.20500 -18.54000 -47.40800 1.000 56.33753  ? 1085 ILE A C     1 
ATOM   8117  O  O     . ILE A 1 1085 ? -23.83300 -17.38700 -47.15000 1.000 61.21622  ? 1085 ILE A O     1 
ATOM   8118  C  CB    . ILE A 1 1085 ? -23.26500 -20.19500 -45.73800 1.000 52.32653  ? 1085 ILE A CB    1 
ATOM   8119  C  CG1   . ILE A 1 1085 ? -24.68400 -20.50300 -45.25300 1.000 52.74564  ? 1085 ILE A CG1   1 
ATOM   8120  C  CG2   . ILE A 1 1085 ? -22.60000 -19.15200 -44.84900 1.000 57.54340  ? 1085 ILE A CG2   1 
ATOM   8121  C  CD1   . ILE A 1 1085 ? -24.75300 -20.95800 -43.81200 1.000 61.92069  ? 1085 ILE A CD1   1 
ATOM   8122  N  N     . SER A 1 1086 ? -25.41600 -18.81200 -47.89300 1.000 58.47182  ? 1086 SER A N     1 
ATOM   8123  C  CA    . SER A 1 1086 ? -26.41900 -17.76900 -48.10500 1.000 62.15277  ? 1086 SER A CA    1 
ATOM   8124  C  C     . SER A 1 1086 ? -27.33100 -17.68700 -46.88100 1.000 69.49057  ? 1086 SER A C     1 
ATOM   8125  O  O     . SER A 1 1086 ? -28.49300 -18.09800 -46.88300 1.000 75.32912  ? 1086 SER A O     1 
ATOM   8126  C  CB    . SER A 1 1086 ? -27.20500 -18.03600 -49.38200 1.000 62.31002  ? 1086 SER A CB    1 
ATOM   8127  O  OG    . SER A 1 1086 ? -26.34400 -18.08600 -50.50700 1.000 64.67685  ? 1086 SER A OG    1 
ATOM   8128  N  N     . GLY A 1 1087 ? -26.76200 -17.14400 -45.81100 1.000 68.06213  ? 1087 GLY A N     1 
ATOM   8129  C  CA    . GLY A 1 1087 ? -27.49100 -16.91100 -44.58300 1.000 71.36015  ? 1087 GLY A CA    1 
ATOM   8130  C  C     . GLY A 1 1087 ? -26.98900 -15.67200 -43.87300 1.000 89.58663  ? 1087 GLY A C     1 
ATOM   8131  O  O     . GLY A 1 1087 ? -25.77700 -15.47700 -43.73300 1.000 90.33337  ? 1087 GLY A O     1 
ATOM   8132  N  N     . GLY A 1 1088 ? -27.90400 -14.82300 -43.43300 1.000 92.85766  ? 1088 GLY A N     1 
ATOM   8133  C  CA    . GLY A 1 1088 ? -27.56300 -13.58300 -42.77000 1.000 92.22282  ? 1088 GLY A CA    1 
ATOM   8134  C  C     . GLY A 1 1088 ? -28.03000 -12.38300 -43.56600 1.000 97.09529  ? 1088 GLY A C     1 
ATOM   8135  O  O     . GLY A 1 1088 ? -28.77100 -12.49500 -44.54700 1.000 99.10394  ? 1088 GLY A O     1 
ATOM   8136  N  N     . SER A 1 1089 ? -27.56900 -11.21000 -43.13500 1.000 95.63802  ? 1089 SER A N     1 
ATOM   8137  C  CA    . SER A 1 1089 ? -28.04900 -9.95100  -43.68600 1.000 95.85390  ? 1089 SER A CA    1 
ATOM   8138  C  C     . SER A 1 1089 ? -27.26900 -9.47800  -44.90500 1.000 89.22913  ? 1089 SER A C     1 
ATOM   8139  O  O     . SER A 1 1089 ? -27.77700 -8.63900  -45.65800 1.000 91.08646  ? 1089 SER A O     1 
ATOM   8140  C  CB    . SER A 1 1089 ? -28.00200 -8.86100  -42.61100 1.000 94.53898  ? 1089 SER A CB    1 
ATOM   8141  O  OG    . SER A 1 1089 ? -28.79200 -9.21600  -41.48900 1.000 95.54347  ? 1089 SER A OG    1 
ATOM   8142  N  N     . VAL A 1 1090 ? -26.05900 -9.99300  -45.12700 1.000 85.39675  ? 1090 VAL A N     1 
ATOM   8143  C  CA    . VAL A 1 1090 ? -25.17400 -9.46400  -46.15900 1.000 90.53965  ? 1090 VAL A CA    1 
ATOM   8144  C  C     . VAL A 1 1090 ? -25.18800 -10.31000 -47.42800 1.000 80.21245  ? 1090 VAL A C     1 
ATOM   8145  O  O     . VAL A 1 1090 ? -24.35000 -10.10200 -48.30900 1.000 75.77593  ? 1090 VAL A O     1 
ATOM   8146  C  CB    . VAL A 1 1090 ? -23.74000 -9.31100  -45.62800 1.000 91.81446  ? 1090 VAL A CB    1 
ATOM   8147  C  CG1   . VAL A 1 1090 ? -23.60300 -8.02500  -44.83200 1.000 93.14966  ? 1090 VAL A CG1   1 
ATOM   8148  C  CG2   . VAL A 1 1090 ? -23.36300 -10.51200 -44.77400 1.000 80.24069  ? 1090 VAL A CG2   1 
ATOM   8149  N  N     . VAL A 1 1091 ? -26.12300 -11.25500 -47.55100 1.000 74.10633  ? 1091 VAL A N     1 
ATOM   8150  C  CA    . VAL A 1 1091 ? -26.15300 -12.11200 -48.73500 1.000 80.26960  ? 1091 VAL A CA    1 
ATOM   8151  C  C     . VAL A 1 1091 ? -26.38600 -11.27900 -49.99100 1.000 75.00727  ? 1091 VAL A C     1 
ATOM   8152  O  O     . VAL A 1 1091 ? -25.67800 -11.42300 -50.99500 1.000 69.46292  ? 1091 VAL A O     1 
ATOM   8153  C  CB    . VAL A 1 1091 ? -27.21800 -13.21200 -48.58000 1.000 84.97649  ? 1091 VAL A CB    1 
ATOM   8154  C  CG1   . VAL A 1 1091 ? -27.32100 -14.03400 -49.85500 1.000 69.17860  ? 1091 VAL A CG1   1 
ATOM   8155  C  CG2   . VAL A 1 1091 ? -26.89200 -14.10200 -47.39000 1.000 89.29724  ? 1091 VAL A CG2   1 
ATOM   8156  N  N     . ALA A 1 1092 ? -27.37900 -10.39000 -49.95000 1.000 76.73977  ? 1092 ALA A N     1 
ATOM   8157  C  CA    . ALA A 1 1092 ? -27.64900 -9.53500  -51.10200 1.000 70.13844  ? 1092 ALA A CA    1 
ATOM   8158  C  C     . ALA A 1 1092 ? -26.58400 -8.45600  -51.25100 1.000 64.01460  ? 1092 ALA A C     1 
ATOM   8159  O  O     . ALA A 1 1092 ? -26.22200 -8.08500  -52.37400 1.000 67.39082  ? 1092 ALA A O     1 
ATOM   8160  C  CB    . ALA A 1 1092 ? -29.03700 -8.90800  -50.97800 1.000 71.50931  ? 1092 ALA A CB    1 
ATOM   8161  N  N     . ASP A 1 1093 ? -26.07000 -7.94200  -50.13200 1.000 66.27037  ? 1093 ASP A N     1 
ATOM   8162  C  CA    . ASP A 1 1093 ? -25.05800 -6.89100  -50.19000 1.000 72.19162  ? 1093 ASP A CA    1 
ATOM   8163  C  C     . ASP A 1 1093 ? -23.78000 -7.39800  -50.84900 1.000 72.49754  ? 1093 ASP A C     1 
ATOM   8164  O  O     . ASP A 1 1093 ? -23.25600 -6.77200  -51.77800 1.000 65.69837  ? 1093 ASP A O     1 
ATOM   8165  C  CB    . ASP A 1 1093 ? -24.77200 -6.36900  -48.78000 1.000 82.94651  ? 1093 ASP A CB    1 
ATOM   8166  C  CG    . ASP A 1 1093 ? -24.03100 -5.04100  -48.78000 1.000 93.84372  ? 1093 ASP A CG    1 
ATOM   8167  O  OD1   . ASP A 1 1093 ? -23.12000 -4.85100  -49.61300 1.000 89.84365  ? 1093 ASP A OD1   1 
ATOM   8168  O  OD2   . ASP A 1 1093 ? -24.35900 -4.18200  -47.93500 1.000 105.72230 ? 1093 ASP A OD2   1 
ATOM   8169  N  N     . LEU A 1 1094 ? -23.26500 -8.53600  -50.38000 1.000 71.02760  ? 1094 LEU A N     1 
ATOM   8170  C  CA    . LEU A 1 1094 ? -22.00700 -9.05600  -50.90500 1.000 67.86595  ? 1094 LEU A CA    1 
ATOM   8171  C  C     . LEU A 1 1094 ? -22.15100 -9.49100  -52.35900 1.000 63.00016  ? 1094 LEU A C     1 
ATOM   8172  O  O     . LEU A 1 1094 ? -21.31100 -9.15500  -53.20200 1.000 65.19568  ? 1094 LEU A O     1 
ATOM   8173  C  CB    . LEU A 1 1094 ? -21.52300 -10.21600 -50.03600 1.000 67.30915  ? 1094 LEU A CB    1 
ATOM   8174  C  CG    . LEU A 1 1094 ? -21.27100 -9.85800  -48.57000 1.000 59.25803  ? 1094 LEU A CG    1 
ATOM   8175  C  CD1   . LEU A 1 1094 ? -21.04100 -11.11000 -47.74300 1.000 60.39371  ? 1094 LEU A CD1   1 
ATOM   8176  C  CD2   . LEU A 1 1094 ? -20.10100 -8.89500  -48.43800 1.000 66.55182  ? 1094 LEU A CD2   1 
ATOM   8177  N  N     . ASN A 1 1095 ? -23.20900 -10.24100 -52.67200 1.000 64.37434  ? 1095 ASN A N     1 
ATOM   8178  C  CA    . ASN A 1 1095 ? -23.43200 -10.65000 -54.05500 1.000 62.46957  ? 1095 ASN A CA    1 
ATOM   8179  C  C     . ASN A 1 1095 ? -23.79900 -9.46400  -54.93700 1.000 62.22511  ? 1095 ASN A C     1 
ATOM   8180  O  O     . ASN A 1 1095 ? -23.54700 -9.49400  -56.14700 1.000 57.70277  ? 1095 ASN A O     1 
ATOM   8181  C  CB    . ASN A 1 1095 ? -24.51700 -11.72400 -54.12000 1.000 54.22470  ? 1095 ASN A CB    1 
ATOM   8182  C  CG    . ASN A 1 1095 ? -24.04600 -13.05900 -53.57500 1.000 57.06916  ? 1095 ASN A CG    1 
ATOM   8183  O  OD1   . ASN A 1 1095 ? -23.47900 -13.87500 -54.30300 1.000 58.67980  ? 1095 ASN A OD1   1 
ATOM   8184  N  ND2   . ASN A 1 1095 ? -24.27600 -13.28700 -52.28800 1.000 63.29896  ? 1095 ASN A ND2   1 
ATOM   8185  N  N     . GLY A 1 1096 ? -24.39100 -8.41800  -54.35700 1.000 64.57034  ? 1096 GLY A N     1 
ATOM   8186  C  CA    . GLY A 1 1096 ? -24.66000 -7.21400  -55.12300 1.000 64.07580  ? 1096 GLY A CA    1 
ATOM   8187  C  C     . GLY A 1 1096 ? -23.40000 -6.50000  -55.56400 1.000 65.49494  ? 1096 GLY A C     1 
ATOM   8188  O  O     . GLY A 1 1096 ? -23.36800 -5.89800  -56.64100 1.000 59.77977  ? 1096 GLY A O     1 
ATOM   8189  N  N     . LEU A 1 1097 ? -22.34600 -6.55600  -54.74600 1.000 63.84857  ? 1097 LEU A N     1 
ATOM   8190  C  CA    . LEU A 1 1097 ? -21.07200 -5.96800  -55.14100 1.000 64.86732  ? 1097 LEU A CA    1 
ATOM   8191  C  C     . LEU A 1 1097 ? -20.37100 -6.81000  -56.19800 1.000 65.83115  ? 1097 LEU A C     1 
ATOM   8192  O  O     . LEU A 1 1097 ? -19.67100 -6.26500  -57.06000 1.000 64.57595  ? 1097 LEU A O     1 
ATOM   8193  C  CB    . LEU A 1 1097 ? -20.17400 -5.79200  -53.91700 1.000 63.48133  ? 1097 LEU A CB    1 
ATOM   8194  C  CG    . LEU A 1 1097 ? -20.54000 -4.63700  -52.98300 1.000 59.12236  ? 1097 LEU A CG    1 
ATOM   8195  C  CD1   . LEU A 1 1097 ? -19.83100 -4.77600  -51.64900 1.000 56.28865  ? 1097 LEU A CD1   1 
ATOM   8196  C  CD2   . LEU A 1 1097 ? -20.20900 -3.30300  -53.63100 1.000 64.14892  ? 1097 LEU A CD2   1 
ATOM   8197  N  N     . ALA A 1 1098 ? -20.54700 -8.13400  -56.15300 1.000 63.30828  ? 1098 ALA A N     1 
ATOM   8198  C  CA    . ALA A 1 1098 ? -19.92800 -8.99700  -57.15400 1.000 62.41140  ? 1098 ALA A CA    1 
ATOM   8199  C  C     . ALA A 1 1098 ? -20.60300 -8.84000  -58.51100 1.000 60.11237  ? 1098 ALA A C     1 
ATOM   8200  O  O     . ALA A 1 1098 ? -19.92600 -8.78500  -59.54400 1.000 57.50001  ? 1098 ALA A O     1 
ATOM   8201  C  CB    . ALA A 1 1098 ? -19.97200 -10.45300 -56.69400 1.000 55.94513  ? 1098 ALA A CB    1 
ATOM   8202  N  N     . VAL A 1 1099 ? -21.93600 -8.77200  -58.52900 1.000 57.44880  ? 1099 VAL A N     1 
ATOM   8203  C  CA    . VAL A 1 1099 ? -22.64800 -8.52800  -59.78000 1.000 55.86159  ? 1099 VAL A CA    1 
ATOM   8204  C  C     . VAL A 1 1099 ? -22.31000 -7.14300  -60.31700 1.000 60.68847  ? 1099 VAL A C     1 
ATOM   8205  O  O     . VAL A 1 1099 ? -22.18200 -6.94300  -61.53200 1.000 58.44759  ? 1099 VAL A O     1 
ATOM   8206  C  CB    . VAL A 1 1099 ? -24.16400 -8.70600  -59.57300 1.000 55.22426  ? 1099 VAL A CB    1 
ATOM   8207  C  CG1   . VAL A 1 1099 ? -24.91700 -8.34100  -60.83300 1.000 56.56309  ? 1099 VAL A CG1   1 
ATOM   8208  C  CG2   . VAL A 1 1099 ? -24.48100 -10.13600 -59.16500 1.000 57.27629  ? 1099 VAL A CG2   1 
ATOM   8209  N  N     . LYS A 1 1100 ? -22.15000 -6.16800  -59.42000 1.000 65.21379  ? 1100 LYS A N     1 
ATOM   8210  C  CA    . LYS A 1 1100 ? -21.73900 -4.83100  -59.83500 1.000 62.91710  ? 1100 LYS A CA    1 
ATOM   8211  C  C     . LYS A 1 1100 ? -20.33400 -4.83600  -60.42400 1.000 65.72030  ? 1100 LYS A C     1 
ATOM   8212  O  O     . LYS A 1 1100 ? -20.03000 -4.02700  -61.30800 1.000 68.70420  ? 1100 LYS A O     1 
ATOM   8213  C  CB    . LYS A 1 1100 ? -21.82800 -3.87400  -58.64400 1.000 64.37320  ? 1100 LYS A CB    1 
ATOM   8214  C  CG    . LYS A 1 1100 ? -21.32900 -2.46100  -58.90400 1.000 64.51881  ? 1100 LYS A CG    1 
ATOM   8215  C  CD    . LYS A 1 1100 ? -21.70700 -1.54100  -57.75100 1.000 68.65018  ? 1100 LYS A CD    1 
ATOM   8216  C  CE    . LYS A 1 1100 ? -20.95200 -0.22300  -57.80500 1.000 82.78432  ? 1100 LYS A CE    1 
ATOM   8217  N  NZ    . LYS A 1 1100 ? -19.50400 -0.39800  -57.50500 1.000 81.90294  ? 1100 LYS A NZ    1 
ATOM   8218  N  N     . ASP A 1 1101 ? -19.47100 -5.74400  -59.96000 1.000 62.09051  ? 1101 ASP A N     1 
ATOM   8219  C  CA    . ASP A 1 1101 ? -18.11300 -5.81300  -60.49100 1.000 62.26805  ? 1101 ASP A CA    1 
ATOM   8220  C  C     . ASP A 1 1101 ? -18.09600 -6.39700  -61.89800 1.000 62.37227  ? 1101 ASP A C     1 
ATOM   8221  O  O     . ASP A 1 1101 ? -17.31900 -5.95300  -62.75100 1.000 62.25632  ? 1101 ASP A O     1 
ATOM   8222  C  CB    . ASP A 1 1101 ? -17.22800 -6.63800  -59.55700 1.000 59.37671  ? 1101 ASP A CB    1 
ATOM   8223  C  CG    . ASP A 1 1101 ? -15.82400 -6.82500  -60.09900 1.000 65.75748  ? 1101 ASP A CG    1 
ATOM   8224  O  OD1   . ASP A 1 1101 ? -15.01000 -5.88400  -59.98000 1.000 67.21413  ? 1101 ASP A OD1   1 
ATOM   8225  O  OD2   . ASP A 1 1101 ? -15.53500 -7.91100  -60.64400 1.000 70.17581  ? 1101 ASP A OD2   1 
ATOM   8226  N  N     . ALA A 1 1102 ? -18.94200 -7.39600  -62.16100 1.000 64.97964  ? 1102 ALA A N     1 
ATOM   8227  C  CA    . ALA A 1 1102 ? -18.97700 -8.00200  -63.48800 1.000 59.45521  ? 1102 ALA A CA    1 
ATOM   8228  C  C     . ALA A 1 1102 ? -19.60300 -7.06200  -64.50900 1.000 59.79667  ? 1102 ALA A C     1 
ATOM   8229  O  O     . ALA A 1 1102 ? -19.18000 -7.02700  -65.67000 1.000 62.99965  ? 1102 ALA A O     1 
ATOM   8230  C  CB    . ALA A 1 1102 ? -19.73800 -9.32600  -63.44500 1.000 59.36547  ? 1102 ALA A CB    1 
ATOM   8231  N  N     . CYS A 1 1103 ? -20.61700 -6.29700  -64.09800 1.000 64.59007  ? 1103 CYS A N     1 
ATOM   8232  C  CA    . CYS A 1 1103 ? -21.24100 -5.34900  -65.01400 1.000 63.42790  ? 1103 CYS A CA    1 
ATOM   8233  C  C     . CYS A 1 1103 ? -20.28300 -4.22100  -65.37400 1.000 65.80153  ? 1103 CYS A C     1 
ATOM   8234  O  O     . CYS A 1 1103 ? -20.24800 -3.77400  -66.52700 1.000 66.10174  ? 1103 CYS A O     1 
ATOM   8235  C  CB    . CYS A 1 1103 ? -22.52400 -4.79300  -64.39900 1.000 61.67541  ? 1103 CYS A CB    1 
ATOM   8236  S  SG    . CYS A 1 1103 ? -23.85000 -6.00800  -64.21500 1.000 67.45781  ? 1103 CYS A SG    1 
ATOM   8237  N  N     . GLN A 1 1104 ? -19.49800 -3.74800  -64.40300 1.000 66.76325  ? 1104 GLN A N     1 
ATOM   8238  C  CA    . GLN A 1 1104 ? -18.50000 -2.72600  -64.69700 1.000 66.84923  ? 1104 GLN A CA    1 
ATOM   8239  C  C     . GLN A 1 1104 ? -17.40000 -3.27300  -65.59800 1.000 68.72648  ? 1104 GLN A C     1 
ATOM   8240  O  O     . GLN A 1 1104 ? -16.94000 -2.58100  -66.51200 1.000 73.51286  ? 1104 GLN A O     1 
ATOM   8241  C  CB    . GLN A 1 1104 ? -17.91100 -2.17300  -63.40000 1.000 66.00819  ? 1104 GLN A CB    1 
ATOM   8242  C  CG    . GLN A 1 1104 ? -18.82600 -1.20500  -62.67100 1.000 73.97305  ? 1104 GLN A CG    1 
ATOM   8243  C  CD    . GLN A 1 1104 ? -18.41200 -0.98500  -61.23000 1.000 77.68236  ? 1104 GLN A CD    1 
ATOM   8244  O  OE1   . GLN A 1 1104 ? -17.48700 -1.62700  -60.73200 1.000 72.94734  ? 1104 GLN A OE1   1 
ATOM   8245  N  NE2   . GLN A 1 1104 ? -19.09500 -0.07000  -60.55400 1.000 76.92537  ? 1104 GLN A NE2   1 
ATOM   8246  N  N     . THR A 1 1105 ? -16.96900 -4.51500  -65.35600 1.000 62.48224  ? 1105 THR A N     1 
ATOM   8247  C  CA    . THR A 1 1105 ? -15.98100 -5.13800  -66.23200 1.000 59.36143  ? 1105 THR A CA    1 
ATOM   8248  C  C     . THR A 1 1105 ? -16.48600 -5.20500  -67.66800 1.000 64.93712  ? 1105 THR A C     1 
ATOM   8249  O  O     . THR A 1 1105 ? -15.75000 -4.88800  -68.61000 1.000 70.67951  ? 1105 THR A O     1 
ATOM   8250  C  CB    . THR A 1 1105 ? -15.63100 -6.53600  -65.72200 1.000 59.54000  ? 1105 THR A CB    1 
ATOM   8251  O  OG1   . THR A 1 1105 ? -15.03800 -6.44200  -64.42000 1.000 67.48280  ? 1105 THR A OG1   1 
ATOM   8252  C  CG2   . THR A 1 1105 ? -14.66200 -7.22400  -66.67100 1.000 48.08750  ? 1105 THR A CG2   1 
ATOM   8253  N  N     . LEU A 1 1106 ? -17.74500 -5.60600  -67.85500 1.000 64.93889  ? 1106 LEU A N     1 
ATOM   8254  C  CA    . LEU A 1 1106 ? -18.31500 -5.65300  -69.19800 1.000 58.14074  ? 1106 LEU A CA    1 
ATOM   8255  C  C     . LEU A 1 1106 ? -18.49600 -4.25400  -69.77300 1.000 68.32952  ? 1106 LEU A C     1 
ATOM   8256  O  O     . LEU A 1 1106 ? -18.23500 -4.02600  -70.96000 1.000 74.45984  ? 1106 LEU A O     1 
ATOM   8257  C  CB    . LEU A 1 1106 ? -19.65000 -6.39500  -69.17800 1.000 50.32001  ? 1106 LEU A CB    1 
ATOM   8258  C  CG    . LEU A 1 1106 ? -19.58000 -7.91600  -69.06000 1.000 53.70669  ? 1106 LEU A CG    1 
ATOM   8259  C  CD1   . LEU A 1 1106 ? -20.97400 -8.50300  -68.94200 1.000 49.29610  ? 1106 LEU A CD1   1 
ATOM   8260  C  CD2   . LEU A 1 1106 ? -18.84500 -8.50700  -70.25400 1.000 51.67884  ? 1106 LEU A CD2   1 
ATOM   8261  N  N     . LEU A 1 1107 ? -18.94400 -3.30500  -68.94600 1.000 67.89020  ? 1107 LEU A N     1 
ATOM   8262  C  CA    . LEU A 1 1107 ? -19.20600 -1.95900  -69.44200 1.000 64.24941  ? 1107 LEU A CA    1 
ATOM   8263  C  C     . LEU A 1 1107 ? -17.92800 -1.26100  -69.88500 1.000 74.37033  ? 1107 LEU A C     1 
ATOM   8264  O  O     . LEU A 1 1107 ? -17.96900 -0.40900  -70.77900 1.000 80.59115  ? 1107 LEU A O     1 
ATOM   8265  C  CB    . LEU A 1 1107 ? -19.91700 -1.13300  -68.37200 1.000 63.64070  ? 1107 LEU A CB    1 
ATOM   8266  C  CG    . LEU A 1 1107 ? -20.68000 0.09300   -68.87600 1.000 66.38843  ? 1107 LEU A CG    1 
ATOM   8267  C  CD1   . LEU A 1 1107 ? -21.68000 -0.30800  -69.94700 1.000 60.61831  ? 1107 LEU A CD1   1 
ATOM   8268  C  CD2   . LEU A 1 1107 ? -21.37400 0.81300   -67.72800 1.000 77.82112  ? 1107 LEU A CD2   1 
ATOM   8269  N  N     . LYS A 1 1108 ? -16.78800 -1.60500  -69.28100 1.000 73.88027  ? 1108 LYS A N     1 
ATOM   8270  C  CA    . LYS A 1 1108 ? -15.53700 -0.96400  -69.67400 1.000 69.40015  ? 1108 LYS A CA    1 
ATOM   8271  C  C     . LYS A 1 1108 ? -15.04100 -1.51200  -71.00600 1.000 76.44186  ? 1108 LYS A C     1 
ATOM   8272  O  O     . LYS A 1 1108 ? -14.52600 -0.75800  -71.83900 1.000 86.91476  ? 1108 LYS A O     1 
ATOM   8273  C  CB    . LYS A 1 1108 ? -14.47300 -1.15000  -68.58500 1.000 66.24185  ? 1108 LYS A CB    1 
ATOM   8274  C  CG    . LYS A 1 1108 ? -14.71500 -0.47300  -67.20600 1.000 82.30566  ? 1108 LYS A CG    1 
ATOM   8275  C  CD    . LYS A 1 1108 ? -15.90500 0.49600   -67.09000 1.000 98.45096  ? 1108 LYS A CD    1 
ATOM   8276  C  CE    . LYS A 1 1108 ? -15.69900 1.81100   -67.83200 1.000 105.12416 ? 1108 LYS A CE    1 
ATOM   8277  N  NZ    . LYS A 1 1108 ? -16.94100 2.62900   -67.83200 1.000 93.82927  ? 1108 LYS A NZ    1 
ATOM   8278  N  N     . ARG A 1 1109 ? -15.18800 -2.82300  -71.22300 1.000 76.35215  ? 1109 ARG A N     1 
ATOM   8279  C  CA    . ARG A 1 1109 ? -14.82300 -3.40800  -72.50900 1.000 69.85378  ? 1109 ARG A CA    1 
ATOM   8280  C  C     . ARG A 1 1109 ? -15.65700 -2.82800  -73.64300 1.000 69.26031  ? 1109 ARG A C     1 
ATOM   8281  O  O     . ARG A 1 1109 ? -15.19300 -2.76500  -74.78700 1.000 72.65807  ? 1109 ARG A O     1 
ATOM   8282  C  CB    . ARG A 1 1109 ? -14.99400 -4.92800  -72.46700 1.000 63.88593  ? 1109 ARG A CB    1 
ATOM   8283  C  CG    . ARG A 1 1109 ? -14.24300 -5.62900  -71.34800 1.000 68.62712  ? 1109 ARG A CG    1 
ATOM   8284  C  CD    . ARG A 1 1109 ? -13.76600 -7.00200  -71.79400 1.000 70.93499  ? 1109 ARG A CD    1 
ATOM   8285  N  NE    . ARG A 1 1109 ? -13.70600 -7.95100  -70.68600 1.000 72.67943  ? 1109 ARG A NE    1 
ATOM   8286  C  CZ    . ARG A 1 1109 ? -14.52300 -8.99100  -70.55100 1.000 68.17728  ? 1109 ARG A CZ    1 
ATOM   8287  N  NH1   . ARG A 1 1109 ? -15.46300 -9.21800  -71.45700 1.000 58.70755  ? 1109 ARG A NH1   1 
ATOM   8288  N  NH2   . ARG A 1 1109 ? -14.39900 -9.80500  -69.51100 1.000 74.22471  ? 1109 ARG A NH2   1 
ATOM   8289  N  N     . LEU A 1 1110 ? -16.88000 -2.39500  -73.34500 1.000 69.62754  ? 1110 LEU A N     1 
ATOM   8290  C  CA    . LEU A 1 1110 ? -17.81300 -1.90400  -74.34800 1.000 78.44260  ? 1110 LEU A CA    1 
ATOM   8291  C  C     . LEU A 1 1110 ? -17.79600 -0.38800  -74.49500 1.000 86.42520  ? 1110 LEU A C     1 
ATOM   8292  O  O     . LEU A 1 1110 ? -18.53900 0.14400   -75.32500 1.000 88.85723  ? 1110 LEU A O     1 
ATOM   8293  C  CB    . LEU A 1 1110 ? -19.23400 -2.36700  -74.01000 1.000 76.34409  ? 1110 LEU A CB    1 
ATOM   8294  C  CG    . LEU A 1 1110 ? -19.53600 -3.85000  -74.22700 1.000 62.63533  ? 1110 LEU A CG    1 
ATOM   8295  C  CD1   . LEU A 1 1110 ? -20.74200 -4.27200  -73.40500 1.000 58.47439  ? 1110 LEU A CD1   1 
ATOM   8296  C  CD2   . LEU A 1 1110 ? -19.76600 -4.13700  -75.70100 1.000 58.80467  ? 1110 LEU A CD2   1 
ATOM   8297  N  N     . GLU A 1 1111 ? -16.97600 0.31700   -73.71600 1.000 85.42799  ? 1111 GLU A N     1 
ATOM   8298  C  CA    . GLU A 1 1111 ? -16.96000 1.77500   -73.80300 1.000 93.68905  ? 1111 GLU A CA    1 
ATOM   8299  C  C     . GLU A 1 1111 ? -16.56600 2.29800   -75.18200 1.000 91.32576  ? 1111 GLU A C     1 
ATOM   8300  O  O     . GLU A 1 1111 ? -17.18000 3.28400   -75.62800 1.000 91.77210  ? 1111 GLU A O     1 
ATOM   8301  C  CB    . GLU A 1 1111 ? -16.04500 2.35900   -72.71800 1.000 98.27113  ? 1111 GLU A CB    1 
ATOM   8302  C  CG    . GLU A 1 1111 ? -16.12800 3.87600   -72.61300 1.000 110.00192 ? 1111 GLU A CG    1 
ATOM   8303  C  CD    . GLU A 1 1111 ? -16.06800 4.37200   -71.18200 1.000 118.78785 ? 1111 GLU A CD    1 
ATOM   8304  O  OE1   . GLU A 1 1111 ? -15.41500 3.71000   -70.34800 1.000 116.10035 ? 1111 GLU A OE1   1 
ATOM   8305  O  OE2   . GLU A 1 1111 ? -16.68000 5.42100   -70.88900 1.000 116.61184 ? 1111 GLU A OE2   1 
ATOM   8306  N  N     . PRO A 1 1112 ? -15.58100 1.73000   -75.89300 1.000 82.37407  ? 1112 PRO A N     1 
ATOM   8307  C  CA    . PRO A 1 1112 ? -15.34400 2.19500   -77.27100 1.000 83.63125  ? 1112 PRO A CA    1 
ATOM   8308  C  C     . PRO A 1 1112 ? -16.55700 2.04800   -78.17200 1.000 93.16674  ? 1112 PRO A C     1 
ATOM   8309  O  O     . PRO A 1 1112 ? -16.80800 2.91700   -79.01600 1.000 99.37624  ? 1112 PRO A O     1 
ATOM   8310  C  CB    . PRO A 1 1112 ? -14.17900 1.31300   -77.74000 1.000 73.10633  ? 1112 PRO A CB    1 
ATOM   8311  C  CG    . PRO A 1 1112 ? -13.46100 0.95900   -76.49600 1.000 86.97190  ? 1112 PRO A CG    1 
ATOM   8312  C  CD    . PRO A 1 1112 ? -14.52300 0.80300   -75.44700 1.000 85.18362  ? 1112 PRO A CD    1 
ATOM   8313  N  N     . ILE A 1 1113 ? -17.32700 0.97200   -78.00600 1.000 91.60894  ? 1113 ILE A N     1 
ATOM   8314  C  CA    . ILE A 1 1113 ? -18.47300 0.73300   -78.87600 1.000 86.08842  ? 1113 ILE A CA    1 
ATOM   8315  C  C     . ILE A 1 1113 ? -19.64700 1.62400   -78.48700 1.000 86.00045  ? 1113 ILE A C     1 
ATOM   8316  O  O     . ILE A 1 1113 ? -20.39400 2.09800   -79.35100 1.000 80.30175  ? 1113 ILE A O     1 
ATOM   8317  C  CB    . ILE A 1 1113 ? -18.85000 -0.75900  -78.84400 1.000 79.86621  ? 1113 ILE A CB    1 
ATOM   8318  C  CG1   . ILE A 1 1113 ? -17.66000 -1.61100  -79.28800 1.000 76.97050  ? 1113 ILE A CG1   1 
ATOM   8319  C  CG2   . ILE A 1 1113 ? -20.05600 -1.02900  -79.73000 1.000 83.56075  ? 1113 ILE A CG2   1 
ATOM   8320  C  CD1   . ILE A 1 1113 ? -17.76600 -3.06200  -78.89100 1.000 71.84169  ? 1113 ILE A CD1   1 
ATOM   8321  N  N     . ILE A 1 1114 ? -19.82700 1.87300   -77.18900 1.000 90.45988  ? 1114 ILE A N     1 
ATOM   8322  C  CA    . ILE A 1 1114 ? -20.94600 2.70000   -76.74500 1.000 94.14942  ? 1114 ILE A CA    1 
ATOM   8323  C  C     . ILE A 1 1114 ? -20.70600 4.16300   -77.09900 1.000 96.42530  ? 1114 ILE A C     1 
ATOM   8324  O  O     . ILE A 1 1114 ? -21.63400 4.88000   -77.49300 1.000 95.09992  ? 1114 ILE A O     1 
ATOM   8325  C  CB    . ILE A 1 1114 ? -21.18600 2.50900   -75.23600 1.000 95.90644  ? 1114 ILE A CB    1 
ATOM   8326  C  CG1   . ILE A 1 1114 ? -21.56900 1.05700   -74.94000 1.000 90.44774  ? 1114 ILE A CG1   1 
ATOM   8327  C  CG2   . ILE A 1 1114 ? -22.27100 3.45300   -74.73800 1.000 93.79067  ? 1114 ILE A CG2   1 
ATOM   8328  C  CD1   . ILE A 1 1114 ? -21.88600 0.79100   -73.48600 1.000 86.81729  ? 1114 ILE A CD1   1 
ATOM   8329  N  N     . SER A 1 1115 ? -19.46100 4.63000   -76.97500 1.000 97.86778  ? 1115 SER A N     1 
ATOM   8330  C  CA    . SER A 1 1115 ? -19.16400 6.02100   -77.30200 1.000 93.95796  ? 1115 SER A CA    1 
ATOM   8331  C  C     . SER A 1 1115 ? -19.30100 6.27900   -78.79800 1.000 87.90083  ? 1115 SER A C     1 
ATOM   8332  O  O     . SER A 1 1115 ? -19.82200 7.32200   -79.20900 1.000 86.95765  ? 1115 SER A O     1 
ATOM   8333  C  CB    . SER A 1 1115 ? -17.75900 6.38600   -76.82400 1.000 94.16618  ? 1115 SER A CB    1 
ATOM   8334  O  OG    . SER A 1 1115 ? -16.77200 5.77600   -77.63700 1.000 93.04563  ? 1115 SER A OG    1 
ATOM   8335  N  N     . LYS A 1 1116 ? -18.84600 5.34000   -79.62600 1.000 88.66731  ? 1116 LYS A N     1 
ATOM   8336  C  CA    . LYS A 1 1116 ? -18.93200 5.50700   -81.07100 1.000 87.97290  ? 1116 LYS A CA    1 
ATOM   8337  C  C     . LYS A 1 1116 ? -20.35300 5.34700   -81.60200 1.000 86.04191  ? 1116 LYS A C     1 
ATOM   8338  O  O     . LYS A 1 1116 ? -20.58700 5.63100   -82.78100 1.000 88.53126  ? 1116 LYS A O     1 
ATOM   8339  C  CB    . LYS A 1 1116 ? -17.99500 4.51200   -81.76200 1.000 85.94533  ? 1116 LYS A CB    1 
ATOM   8340  C  CG    . LYS A 1 1116 ? -17.37700 5.02200   -83.05500 1.000 92.09609  ? 1116 LYS A CG    1 
ATOM   8341  C  CD    . LYS A 1 1116 ? -16.19900 4.15700   -83.48900 1.000 96.55574  ? 1116 LYS A CD    1 
ATOM   8342  C  CE    . LYS A 1 1116 ? -16.64100 2.74300   -83.82600 1.000 107.62720 ? 1116 LYS A CE    1 
ATOM   8343  N  NZ    . LYS A 1 1116 ? -15.53600 1.95000   -84.43100 1.000 102.95538 ? 1116 LYS A NZ    1 
ATOM   8344  N  N     . ASN A 1 1117 ? -21.29800 4.90600   -80.77000 1.000 89.48710  ? 1117 ASN A N     1 
ATOM   8345  C  CA    . ASN A 1 1117 ? -22.69600 4.75700   -81.17800 1.000 90.08644  ? 1117 ASN A CA    1 
ATOM   8346  C  C     . ASN A 1 1117 ? -23.56700 4.80500   -79.93200 1.000 94.06435  ? 1117 ASN A C     1 
ATOM   8347  O  O     . ASN A 1 1117 ? -24.10500 3.78600   -79.48300 1.000 92.70030  ? 1117 ASN A O     1 
ATOM   8348  C  CB    . ASN A 1 1117 ? -22.90200 3.45500   -81.95300 1.000 81.52189  ? 1117 ASN A CB    1 
ATOM   8349  C  CG    . ASN A 1 1117 ? -24.33500 3.27500   -82.42800 1.000 89.24716  ? 1117 ASN A CG    1 
ATOM   8350  O  OD1   . ASN A 1 1117 ? -25.11500 4.23000   -82.48600 1.000 96.67797  ? 1117 ASN A OD1   1 
ATOM   8351  N  ND2   . ASN A 1 1117 ? -24.69200 2.04000   -82.75900 1.000 83.66779  ? 1117 ASN A ND2   1 
ATOM   8352  N  N     . PRO A 1 1118 ? -23.72600 5.99000   -79.33700 1.000 93.26374  ? 1118 PRO A N     1 
ATOM   8353  C  CA    . PRO A 1 1118 ? -24.53200 6.10400   -78.11400 1.000 86.09602  ? 1118 PRO A CA    1 
ATOM   8354  C  C     . PRO A 1 1118 ? -26.02900 5.99400   -78.35200 1.000 85.44354  ? 1118 PRO A C     1 
ATOM   8355  O  O     . PRO A 1 1118 ? -26.78000 5.82400   -77.38100 1.000 79.03236  ? 1118 PRO A O     1 
ATOM   8356  C  CB    . PRO A 1 1118 ? -24.15500 7.49200   -77.58300 1.000 91.07908  ? 1118 PRO A CB    1 
ATOM   8357  C  CG    . PRO A 1 1118 ? -23.79500 8.26400   -78.81700 1.000 91.21218  ? 1118 PRO A CG    1 
ATOM   8358  C  CD    . PRO A 1 1118 ? -23.16700 7.28300   -79.76600 1.000 88.76468  ? 1118 PRO A CD    1 
ATOM   8359  N  N     . LYS A 1 1119 ? -26.48500 6.07600   -79.59900 1.000 92.39464  ? 1119 LYS A N     1 
ATOM   8360  C  CA    . LYS A 1 1119 ? -27.90600 5.96500   -79.90200 1.000 97.73480  ? 1119 LYS A CA    1 
ATOM   8361  C  C     . LYS A 1 1119 ? -28.35300 4.52200   -80.08800 1.000 101.89682 ? 1119 LYS A C     1 
ATOM   8362  O  O     . LYS A 1 1119 ? -29.52600 4.21000   -79.85200 1.000 104.53310 ? 1119 LYS A O     1 
ATOM   8363  C  CB    . LYS A 1 1119 ? -28.23800 6.77100   -81.16300 1.000 103.64825 ? 1119 LYS A CB    1 
ATOM   8364  C  CG    . LYS A 1 1119 ? -29.72300 6.84500   -81.49800 1.000 108.59972 ? 1119 LYS A CG    1 
ATOM   8365  C  CD    . LYS A 1 1119 ? -29.94600 6.93900   -83.00000 1.000 105.56984 ? 1119 LYS A CD    1 
ATOM   8366  C  CE    . LYS A 1 1119 ? -29.21400 8.13000   -83.59600 1.000 104.33135 ? 1119 LYS A CE    1 
ATOM   8367  N  NZ    . LYS A 1 1119 ? -29.32500 8.16000   -85.08100 1.000 87.47627  ? 1119 LYS A NZ    1 
ATOM   8368  N  N     . GLY A 1 1120 ? -27.44500 3.63500   -80.49200 1.000 99.16464  ? 1120 GLY A N     1 
ATOM   8369  C  CA    . GLY A 1 1120 ? -27.82200 2.26200   -80.76500 1.000 91.75821  ? 1120 GLY A CA    1 
ATOM   8370  C  C     . GLY A 1 1120 ? -28.29800 1.53000   -79.52500 1.000 87.85813  ? 1120 GLY A C     1 
ATOM   8371  O  O     . GLY A 1 1120 ? -28.00400 1.89900   -78.38700 1.000 87.11753  ? 1120 GLY A O     1 
ATOM   8372  N  N     . THR A 1 1121 ? -29.05400 0.46200   -79.76800 1.000 83.51660  ? 1121 THR A N     1 
ATOM   8373  C  CA    . THR A 1 1121 ? -29.61200 -0.35300  -78.70100 1.000 80.86996  ? 1121 THR A CA    1 
ATOM   8374  C  C     . THR A 1 1121 ? -28.53100 -1.24600  -78.09500 1.000 72.19278  ? 1121 THR A C     1 
ATOM   8375  O  O     . THR A 1 1121 ? -27.35300 -1.17900  -78.45400 1.000 80.01693  ? 1121 THR A O     1 
ATOM   8376  C  CB    . THR A 1 1121 ? -30.77400 -1.19100  -79.22900 1.000 84.04369  ? 1121 THR A CB    1 
ATOM   8377  O  OG1   . THR A 1 1121 ? -30.30500 -2.05500  -80.27300 1.000 73.40689  ? 1121 THR A OG1   1 
ATOM   8378  C  CG2   . THR A 1 1121 ? -31.87000 -0.29300  -79.78200 1.000 90.35976  ? 1121 THR A CG2   1 
ATOM   8379  N  N     . TRP A 1 1122 ? -28.93700 -2.09500  -77.15100 1.000 73.15387  ? 1122 TRP A N     1 
ATOM   8380  C  CA    . TRP A 1 1122 ? -28.01700 -3.07500  -76.59000 1.000 71.67066  ? 1122 TRP A CA    1 
ATOM   8381  C  C     . TRP A 1 1122 ? -27.79100 -4.25800  -77.52100 1.000 68.04248  ? 1122 TRP A C     1 
ATOM   8382  O  O     . TRP A 1 1122 ? -26.83800 -5.01800  -77.31600 1.000 57.50976  ? 1122 TRP A O     1 
ATOM   8383  C  CB    . TRP A 1 1122 ? -28.53000 -3.57700  -75.23800 1.000 67.18153  ? 1122 TRP A CB    1 
ATOM   8384  C  CG    . TRP A 1 1122 ? -27.85400 -2.93700  -74.06400 1.000 61.96623  ? 1122 TRP A CG    1 
ATOM   8385  C  CD1   . TRP A 1 1122 ? -28.38000 -1.99800  -73.22400 1.000 59.01444  ? 1122 TRP A CD1   1 
ATOM   8386  C  CD2   . TRP A 1 1122 ? -26.52200 -3.18800  -73.60200 1.000 63.26397  ? 1122 TRP A CD2   1 
ATOM   8387  N  NE1   . TRP A 1 1122 ? -27.45800 -1.65200  -72.26600 1.000 61.48097  ? 1122 TRP A NE1   1 
ATOM   8388  C  CE2   . TRP A 1 1122 ? -26.30800 -2.36600  -72.47800 1.000 66.66041  ? 1122 TRP A CE2   1 
ATOM   8389  C  CE3   . TRP A 1 1122 ? -25.49000 -4.02700  -74.03000 1.000 66.41228  ? 1122 TRP A CE3   1 
ATOM   8390  C  CZ2   . TRP A 1 1122 ? -25.10400 -2.36300  -71.77400 1.000 69.82454  ? 1122 TRP A CZ2   1 
ATOM   8391  C  CZ3   . TRP A 1 1122 ? -24.29700 -4.02200  -73.33300 1.000 59.18901  ? 1122 TRP A CZ3   1 
ATOM   8392  C  CH2   . TRP A 1 1122 ? -24.11300 -3.19500  -72.21800 1.000 65.89410  ? 1122 TRP A CH2   1 
ATOM   8393  N  N     . LYS A 1 1123 ? -28.64100 -4.42800  -78.53600 1.000 71.22398  ? 1123 LYS A N     1 
ATOM   8394  C  CA    . LYS A 1 1123 ? -28.48700 -5.54800  -79.45600 1.000 60.31193  ? 1123 LYS A CA    1 
ATOM   8395  C  C     . LYS A 1 1123 ? -27.33800 -5.31200  -80.42800 1.000 64.52654  ? 1123 LYS A C     1 
ATOM   8396  O  O     . LYS A 1 1123 ? -26.42800 -6.14200  -80.53500 1.000 73.73962  ? 1123 LYS A O     1 
ATOM   8397  C  CB    . LYS A 1 1123 ? -29.79300 -5.79100  -80.21300 1.000 54.27843  ? 1123 LYS A CB    1 
ATOM   8398  C  CG    . LYS A 1 1123 ? -29.76500 -7.02300  -81.09900 1.000 56.64394  ? 1123 LYS A CG    1 
ATOM   8399  C  CD    . LYS A 1 1123 ? -31.03700 -7.14800  -81.92100 1.000 64.55452  ? 1123 LYS A CD    1 
ATOM   8400  C  CE    . LYS A 1 1123 ? -30.97100 -8.34300  -82.86100 1.000 74.12952  ? 1123 LYS A CE    1 
ATOM   8401  N  NZ    . LYS A 1 1123 ? -32.16300 -8.41500  -83.75000 1.000 81.70082  ? 1123 LYS A NZ    1 
ATOM   8402  N  N     . ASP A 1 1124 ? -27.35800 -4.18500  -81.14500 1.000 66.79806  ? 1124 ASP A N     1 
ATOM   8403  C  CA    . ASP A 1 1124 ? -26.26900 -3.88700  -82.06800 1.000 71.79268  ? 1124 ASP A CA    1 
ATOM   8404  C  C     . ASP A 1 1124 ? -24.97600 -3.53800  -81.34100 1.000 69.08355  ? 1124 ASP A C     1 
ATOM   8405  O  O     . ASP A 1 1124 ? -23.91000 -3.54800  -81.96500 1.000 77.76604  ? 1124 ASP A O     1 
ATOM   8406  C  CB    . ASP A 1 1124 ? -26.66400 -2.75500  -83.02100 1.000 72.29358  ? 1124 ASP A CB    1 
ATOM   8407  C  CG    . ASP A 1 1124 ? -27.43800 -1.65000  -82.33300 1.000 85.20902  ? 1124 ASP A CG    1 
ATOM   8408  O  OD1   . ASP A 1 1124 ? -27.76600 -1.80200  -81.13900 1.000 86.11674  ? 1124 ASP A OD1   1 
ATOM   8409  O  OD2   . ASP A 1 1124 ? -27.71800 -0.62600  -82.99100 1.000 89.70462  ? 1124 ASP A OD2   1 
ATOM   8410  N  N     . TRP A 1 1125 ? -25.04500 -3.23100  -80.04400 1.000 64.18184  ? 1125 TRP A N     1 
ATOM   8411  C  CA    . TRP A 1 1125 ? -23.82600 -3.09400  -79.25500 1.000 70.23387  ? 1125 TRP A CA    1 
ATOM   8412  C  C     . TRP A 1 1125 ? -23.15600 -4.44700  -79.05600 1.000 68.65393  ? 1125 TRP A C     1 
ATOM   8413  O  O     . TRP A 1 1125 ? -21.94200 -4.58600  -79.24700 1.000 69.75954  ? 1125 TRP A O     1 
ATOM   8414  C  CB    . TRP A 1 1125 ? -24.13700 -2.45000  -77.90400 1.000 71.86430  ? 1125 TRP A CB    1 
ATOM   8415  C  CG    . TRP A 1 1125 ? -24.31200 -0.96700  -77.95600 1.000 81.09150  ? 1125 TRP A CG    1 
ATOM   8416  C  CD1   . TRP A 1 1125 ? -23.98400 -0.13600  -78.98700 1.000 82.95151  ? 1125 TRP A CD1   1 
ATOM   8417  C  CD2   . TRP A 1 1125 ? -24.85100 -0.13400  -76.92400 1.000 87.88448  ? 1125 TRP A CD2   1 
ATOM   8418  N  NE1   . TRP A 1 1125 ? -24.29000 1.16300   -78.66200 1.000 89.31674  ? 1125 TRP A NE1   1 
ATOM   8419  C  CE2   . TRP A 1 1125 ? -24.82400 1.19200   -77.40000 1.000 87.58557  ? 1125 TRP A CE2   1 
ATOM   8420  C  CE3   . TRP A 1 1125 ? -25.35700 -0.38000  -75.64400 1.000 83.62551  ? 1125 TRP A CE3   1 
ATOM   8421  C  CZ2   . TRP A 1 1125 ? -25.28200 2.26700   -76.64200 1.000 91.90933  ? 1125 TRP A CZ2   1 
ATOM   8422  C  CZ3   . TRP A 1 1125 ? -25.81200 0.68800   -74.89300 1.000 86.28620  ? 1125 TRP A CZ3   1 
ATOM   8423  C  CH2   . TRP A 1 1125 ? -25.77100 1.99500   -75.39400 1.000 93.01463  ? 1125 TRP A CH2   1 
ATOM   8424  N  N     . ALA A 1 1126 ? -23.93700 -5.45900  -78.67200 1.000 69.80201  ? 1126 ALA A N     1 
ATOM   8425  C  CA    . ALA A 1 1126 ? -23.38000 -6.79100  -78.47100 1.000 60.84702  ? 1126 ALA A CA    1 
ATOM   8426  C  C     . ALA A 1 1126 ? -23.00900 -7.45300  -79.79100 1.000 59.96571  ? 1126 ALA A C     1 
ATOM   8427  O  O     . ALA A 1 1126 ? -22.11300 -8.30300  -79.82600 1.000 62.80269  ? 1126 ALA A O     1 
ATOM   8428  C  CB    . ALA A 1 1126 ? -24.36900 -7.66300  -77.69900 1.000 60.42100  ? 1126 ALA A CB    1 
ATOM   8429  N  N     . GLN A 1 1127 ? -23.68200 -7.08300  -80.88300 1.000 67.55822  ? 1127 GLN A N     1 
ATOM   8430  C  CA    . GLN A 1 1127 ? -23.35300 -7.66200  -82.18200 1.000 70.55156  ? 1127 GLN A CA    1 
ATOM   8431  C  C     . GLN A 1 1127 ? -22.02500 -7.12500  -82.70000 1.000 70.31479  ? 1127 GLN A C     1 
ATOM   8432  O  O     . GLN A 1 1127 ? -21.16800 -7.89300  -83.15300 1.000 68.98435  ? 1127 GLN A O     1 
ATOM   8433  C  CB    . GLN A 1 1127 ? -24.47600 -7.38700  -83.18200 1.000 65.72316  ? 1127 GLN A CB    1 
ATOM   8434  C  CG    . GLN A 1 1127 ? -24.26300 -8.04300  -84.53600 1.000 72.80162  ? 1127 GLN A CG    1 
ATOM   8435  C  CD    . GLN A 1 1127 ? -24.22000 -9.55700  -84.44900 1.000 73.94782  ? 1127 GLN A CD    1 
ATOM   8436  O  OE1   . GLN A 1 1127 ? -25.12700 -10.18500 -83.90300 1.000 77.63414  ? 1127 GLN A OE1   1 
ATOM   8437  N  NE2   . GLN A 1 1127 ? -23.16000 -10.15100 -84.98700 1.000 70.22006  ? 1127 GLN A NE2   1 
ATOM   8438  N  N     . THR A 1 1128 ? -21.83500 -5.80400  -82.64400 1.000 64.72479  ? 1128 THR A N     1 
ATOM   8439  C  CA    . THR A 1 1128 ? -20.56000 -5.22900  -83.05900 1.000 70.23440  ? 1128 THR A CA    1 
ATOM   8440  C  C     . THR A 1 1128 ? -19.43500 -5.62300  -82.11200 1.000 69.35755  ? 1128 THR A C     1 
ATOM   8441  O  O     . THR A 1 1128 ? -18.27400 -5.69700  -82.53000 1.000 68.97462  ? 1128 THR A O     1 
ATOM   8442  C  CB    . THR A 1 1128 ? -20.66700 -3.70700  -83.15200 1.000 65.24943  ? 1128 THR A CB    1 
ATOM   8443  O  OG1   . THR A 1 1128 ? -21.19700 -3.18600  -81.92700 1.000 72.67620  ? 1128 THR A OG1   1 
ATOM   8444  C  CG2   . THR A 1 1128 ? -21.57300 -3.30800  -84.30500 1.000 64.09561  ? 1128 THR A CG2   1 
ATOM   8445  N  N     . ALA A 1 1129 ? -19.75600 -5.87600  -80.84100 1.000 64.84538  ? 1129 ALA A N     1 
ATOM   8446  C  CA    . ALA A 1 1129 ? -18.75500 -6.40800  -79.92200 1.000 62.69052  ? 1129 ALA A CA    1 
ATOM   8447  C  C     . ALA A 1 1129 ? -18.28500 -7.78400  -80.37100 1.000 61.50310  ? 1129 ALA A C     1 
ATOM   8448  O  O     . ALA A 1 1129 ? -17.08900 -8.09300  -80.30800 1.000 61.48035  ? 1129 ALA A O     1 
ATOM   8449  C  CB    . ALA A 1 1129 ? -19.32100 -6.46800  -78.50400 1.000 59.03810  ? 1129 ALA A CB    1 
ATOM   8450  N  N     . PHE A 1 1130 ? -19.21400 -8.62400  -80.83100 1.000 65.49724  ? 1130 PHE A N     1 
ATOM   8451  C  CA    . PHE A 1 1130 ? -18.83400 -9.91500  -81.39300 1.000 62.85407  ? 1130 PHE A CA    1 
ATOM   8452  C  C     . PHE A 1 1130 ? -18.05700 -9.73900  -82.69100 1.000 63.53745  ? 1130 PHE A C     1 
ATOM   8453  O  O     . PHE A 1 1130 ? -17.09400 -10.47100 -82.94900 1.000 65.59940  ? 1130 PHE A O     1 
ATOM   8454  C  CB    . PHE A 1 1130 ? -20.08100 -10.77000 -81.62000 1.000 63.54008  ? 1130 PHE A CB    1 
ATOM   8455  C  CG    . PHE A 1 1130 ? -19.78400 -12.17300 -82.06400 1.000 63.00098  ? 1130 PHE A CG    1 
ATOM   8456  C  CD1   . PHE A 1 1130 ? -19.39300 -13.13600 -81.14900 1.000 56.15515  ? 1130 PHE A CD1   1 
ATOM   8457  C  CD2   . PHE A 1 1130 ? -19.90300 -12.53200 -83.39700 1.000 54.88026  ? 1130 PHE A CD2   1 
ATOM   8458  C  CE1   . PHE A 1 1130 ? -19.12300 -14.42900 -81.55600 1.000 60.49863  ? 1130 PHE A CE1   1 
ATOM   8459  C  CE2   . PHE A 1 1130 ? -19.63400 -13.82200 -83.81000 1.000 54.72490  ? 1130 PHE A CE2   1 
ATOM   8460  C  CZ    . PHE A 1 1130 ? -19.24300 -14.77200 -82.88800 1.000 60.16120  ? 1130 PHE A CZ    1 
ATOM   8461  N  N     . ASP A 1 1131 ? -18.45800 -8.76900  -83.51800 1.000 64.95731  ? 1131 ASP A N     1 
ATOM   8462  C  CA    . ASP A 1 1131 ? -17.75300 -8.52500  -84.77200 1.000 63.82908  ? 1131 ASP A CA    1 
ATOM   8463  C  C     . ASP A 1 1131 ? -16.33500 -8.02700  -84.52300 1.000 65.24364  ? 1131 ASP A C     1 
ATOM   8464  O  O     . ASP A 1 1131 ? -15.40800 -8.38400  -85.25900 1.000 66.26157  ? 1131 ASP A O     1 
ATOM   8465  C  CB    . ASP A 1 1131 ? -18.53200 -7.52400  -85.62500 1.000 69.04034  ? 1131 ASP A CB    1 
ATOM   8466  C  CG    . ASP A 1 1131 ? -19.87400 -8.06400  -86.08200 1.000 70.27348  ? 1131 ASP A CG    1 
ATOM   8467  O  OD1   . ASP A 1 1131 ? -20.01400 -9.30100  -86.18700 1.000 65.14941  ? 1131 ASP A OD1   1 
ATOM   8468  O  OD2   . ASP A 1 1131 ? -20.78900 -7.25300  -86.33600 1.000 71.25563  ? 1131 ASP A OD2   1 
ATOM   8469  N  N     . GLU A 1 1132 ? -16.14500 -7.20300  -83.49500 1.000 62.35687  ? 1132 GLU A N     1 
ATOM   8470  C  CA    . GLU A 1 1132 ? -14.83200 -6.68400  -83.13800 1.000 60.21965  ? 1132 GLU A CA    1 
ATOM   8471  C  C     . GLU A 1 1132 ? -14.07700 -7.59300  -82.17800 1.000 60.29800  ? 1132 GLU A C     1 
ATOM   8472  O  O     . GLU A 1 1132 ? -13.04500 -7.18000  -81.63800 1.000 68.24023  ? 1132 GLU A O     1 
ATOM   8473  C  CB    . GLU A 1 1132 ? -14.96100 -5.28600  -82.52600 1.000 65.69528  ? 1132 GLU A CB    1 
ATOM   8474  C  CG    . GLU A 1 1132 ? -15.45600 -4.22200  -83.48900 1.000 76.66058  ? 1132 GLU A CG    1 
ATOM   8475  C  CD    . GLU A 1 1132 ? -15.51400 -2.84800  -82.85100 1.000 81.52666  ? 1132 GLU A CD    1 
ATOM   8476  O  OE1   . GLU A 1 1132 ? -15.12900 -2.72400  -81.66900 1.000 73.71603  ? 1132 GLU A OE1   1 
ATOM   8477  O  OE2   . GLU A 1 1132 ? -15.94200 -1.89100  -83.53100 1.000 85.84654  ? 1132 GLU A OE2   1 
ATOM   8478  N  N     . SER A 1 1133 ? -14.57000 -8.81200  -81.95200 1.000 58.33668  ? 1133 SER A N     1 
ATOM   8479  C  CA    . SER A 1 1133 ? -13.93300 -9.78800  -81.06700 1.000 56.65169  ? 1133 SER A CA    1 
ATOM   8480  C  C     . SER A 1 1133 ? -13.77800 -9.23200  -79.64900 1.000 53.79451  ? 1133 SER A C     1 
ATOM   8481  O  O     . SER A 1 1133 ? -12.68300 -9.17400  -79.08600 1.000 59.04989  ? 1133 SER A O     1 
ATOM   8482  C  CB    . SER A 1 1133 ? -12.58400 -10.24700 -81.63400 1.000 62.16080  ? 1133 SER A CB    1 
ATOM   8483  O  OG    . SER A 1 1133 ? -12.76300 -11.11900 -82.73600 1.000 67.91864  ? 1133 SER A OG    1 
ATOM   8484  N  N     . ILE A 1 1134 ? -14.90700 -8.82100  -79.07800 1.000 53.48219  ? 1134 ILE A N     1 
ATOM   8485  C  CA    . ILE A 1 1134 ? -14.98600 -8.38800  -77.68800 1.000 57.69430  ? 1134 ILE A CA    1 
ATOM   8486  C  C     . ILE A 1 1134 ? -15.68100 -9.48300  -76.89300 1.000 61.35346  ? 1134 ILE A C     1 
ATOM   8487  O  O     . ILE A 1 1134 ? -16.75200 -9.96000  -77.28600 1.000 64.59716  ? 1134 ILE A O     1 
ATOM   8488  C  CB    . ILE A 1 1134 ? -15.72800 -7.04800  -77.54500 1.000 63.83894  ? 1134 ILE A CB    1 
ATOM   8489  C  CG1   . ILE A 1 1134 ? -15.08300 -5.97900  -78.43000 1.000 60.80497  ? 1134 ILE A CG1   1 
ATOM   8490  C  CG2   . ILE A 1 1134 ? -15.74400 -6.59900  -76.09000 1.000 61.53007  ? 1134 ILE A CG2   1 
ATOM   8491  C  CD1   . ILE A 1 1134 ? -13.72000 -5.53100  -77.95200 1.000 52.61058  ? 1134 ILE A CD1   1 
ATOM   8492  N  N     . ASN A 1 1135 ? -15.07100 -9.88200  -75.78100 1.000 68.19319  ? 1135 ASN A N     1 
ATOM   8493  C  CA    . ASN A 1 1135 ? -15.62200 -10.93500 -74.93800 1.000 61.13588  ? 1135 ASN A CA    1 
ATOM   8494  C  C     . ASN A 1 1135 ? -16.80300 -10.38400 -74.14800 1.000 63.63182  ? 1135 ASN A C     1 
ATOM   8495  O  O     . ASN A 1 1135 ? -16.66400 -9.39200  -73.42400 1.000 66.66188  ? 1135 ASN A O     1 
ATOM   8496  C  CB    . ASN A 1 1135 ? -14.53900 -11.48000 -74.01000 1.000 63.30709  ? 1135 ASN A CB    1 
ATOM   8497  C  CG    . ASN A 1 1135 ? -15.06900 -12.50100 -73.02700 1.000 65.07071  ? 1135 ASN A CG    1 
ATOM   8498  O  OD1   . ASN A 1 1135 ? -14.76100 -12.44800 -71.83800 1.000 75.16321  ? 1135 ASN A OD1   1 
ATOM   8499  N  ND2   . ASN A 1 1135 ? -15.87200 -13.43700 -73.51800 1.000 66.12625  ? 1135 ASN A ND2   1 
ATOM   8500  N  N     . LEU A 1 1136 ? -17.96600 -11.01900 -74.29300 1.000 61.09240  ? 1136 LEU A N     1 
ATOM   8501  C  CA    . LEU A 1 1136 ? -19.19700 -10.55300 -73.67000 1.000 57.44765  ? 1136 LEU A CA    1 
ATOM   8502  C  C     . LEU A 1 1136 ? -19.55900 -11.33300 -72.41300 1.000 57.26539  ? 1136 LEU A C     1 
ATOM   8503  O  O     . LEU A 1 1136 ? -20.69500 -11.23200 -71.93800 1.000 54.53290  ? 1136 LEU A O     1 
ATOM   8504  C  CB    . LEU A 1 1136 ? -20.35000 -10.61500 -74.67400 1.000 56.63127  ? 1136 LEU A CB    1 
ATOM   8505  C  CG    . LEU A 1 1136 ? -20.33000 -9.54900  -75.77200 1.000 57.46551  ? 1136 LEU A CG    1 
ATOM   8506  C  CD1   . LEU A 1 1136 ? -21.36900 -9.85300  -76.84100 1.000 59.97757  ? 1136 LEU A CD1   1 
ATOM   8507  C  CD2   . LEU A 1 1136 ? -20.55300 -8.16700  -75.17900 1.000 49.00461  ? 1136 LEU A CD2   1 
ATOM   8508  N  N     . SER A 1 1137 ? -18.62600 -12.10700 -71.86600 1.000 56.86845  ? 1137 SER A N     1 
ATOM   8509  C  CA    . SER A 1 1137 ? -18.82300 -12.83200 -70.62000 1.000 55.86280  ? 1137 SER A CA    1 
ATOM   8510  C  C     . SER A 1 1137 ? -17.79100 -12.36100 -69.60600 1.000 54.02510  ? 1137 SER A C     1 
ATOM   8511  O  O     . SER A 1 1137 ? -16.64300 -12.08400 -69.96300 1.000 58.28611  ? 1137 SER A O     1 
ATOM   8512  C  CB    . SER A 1 1137 ? -18.70700 -14.34400 -70.83600 1.000 58.92939  ? 1137 SER A CB    1 
ATOM   8513  O  OG    . SER A 1 1137 ? -19.05100 -15.05600 -69.66100 1.000 60.08941  ? 1137 SER A OG    1 
ATOM   8514  N  N     . ALA A 1 1138 ? -18.19600 -12.26500 -68.34200 1.000 47.58057  ? 1138 ALA A N     1 
ATOM   8515  C  CA    . ALA A 1 1138 ? -17.30000 -11.74100 -67.32300 1.000 57.31215  ? 1138 ALA A CA    1 
ATOM   8516  C  C     . ALA A 1 1138 ? -17.63000 -12.35500 -65.97200 1.000 58.10895  ? 1138 ALA A C     1 
ATOM   8517  O  O     . ALA A 1 1138 ? -18.77100 -12.74100 -65.70700 1.000 58.88102  ? 1138 ALA A O     1 
ATOM   8518  C  CB    . ALA A 1 1138 ? -17.37900 -10.21300 -67.23800 1.000 59.75140  ? 1138 ALA A CB    1 
ATOM   8519  N  N     . VAL A 1 1139 ? -16.61100 -12.42900 -65.11900 1.000 53.43921  ? 1139 VAL A N     1 
ATOM   8520  C  CA    . VAL A 1 1139 ? -16.74500 -12.92800 -63.75600 1.000 51.77671  ? 1139 VAL A CA    1 
ATOM   8521  C  C     . VAL A 1 1139 ? -16.70000 -11.74500 -62.80200 1.000 61.80560  ? 1139 VAL A C     1 
ATOM   8522  O  O     . VAL A 1 1139 ? -15.78100 -10.91900 -62.86600 1.000 76.34123  ? 1139 VAL A O     1 
ATOM   8523  C  CB    . VAL A 1 1139 ? -15.63600 -13.94100 -63.42100 1.000 54.10234  ? 1139 VAL A CB    1 
ATOM   8524  C  CG1   . VAL A 1 1139 ? -15.60800 -14.22700 -61.92700 1.000 53.59545  ? 1139 VAL A CG1   1 
ATOM   8525  C  CG2   . VAL A 1 1139 ? -15.83100 -15.22600 -64.21000 1.000 56.04627  ? 1139 VAL A CG2   1 
ATOM   8526  N  N     . GLY A 1 1140 ? -17.69500 -11.65500 -61.92500 1.000 59.18945  ? 1140 GLY A N     1 
ATOM   8527  C  CA    . GLY A 1 1140 ? -17.67700 -10.67300 -60.86300 1.000 53.56422  ? 1140 GLY A CA    1 
ATOM   8528  C  C     . GLY A 1 1140 ? -17.09600 -11.25400 -59.58800 1.000 55.22827  ? 1140 GLY A C     1 
ATOM   8529  O  O     . GLY A 1 1140 ? -17.18800 -12.45100 -59.33200 1.000 56.16150  ? 1140 GLY A O     1 
ATOM   8530  N  N     . TYR A 1 1141 ? -16.48700 -10.38700 -58.78200 1.000 61.86686  ? 1141 TYR A N     1 
ATOM   8531  C  CA    . TYR A 1 1141 ? -15.81300 -10.84900 -57.57600 1.000 62.26486  ? 1141 TYR A CA    1 
ATOM   8532  C  C     . TYR A 1 1141 ? -15.67800 -9.69800  -56.59300 1.000 62.88403  ? 1141 TYR A C     1 
ATOM   8533  O  O     . TYR A 1 1141 ? -15.28900 -8.59200  -56.98000 1.000 66.76997  ? 1141 TYR A O     1 
ATOM   8534  C  CB    . TYR A 1 1141 ? -14.43600 -11.43000 -57.91300 1.000 57.72295  ? 1141 TYR A CB    1 
ATOM   8535  C  CG    . TYR A 1 1141 ? -13.79600 -12.18700 -56.77500 1.000 64.03801  ? 1141 TYR A CG    1 
ATOM   8536  C  CD1   . TYR A 1 1141 ? -14.26500 -13.43900 -56.39900 1.000 69.47690  ? 1141 TYR A CD1   1 
ATOM   8537  C  CD2   . TYR A 1 1141 ? -12.71900 -11.65500 -56.07900 1.000 60.95334  ? 1141 TYR A CD2   1 
ATOM   8538  C  CE1   . TYR A 1 1141 ? -13.68100 -14.13700 -55.36000 1.000 62.81733  ? 1141 TYR A CE1   1 
ATOM   8539  C  CE2   . TYR A 1 1141 ? -12.12900 -12.34500 -55.04000 1.000 57.96112  ? 1141 TYR A CE2   1 
ATOM   8540  C  CZ    . TYR A 1 1141 ? -12.61400 -13.58500 -54.68600 1.000 58.68253  ? 1141 TYR A CZ    1 
ATOM   8541  O  OH    . TYR A 1 1141 ? -12.02700 -14.27300 -53.65200 1.000 65.34258  ? 1141 TYR A OH    1 
ATOM   8542  N  N     . PHE A 1 1142 ? -16.00000 -9.96500  -55.32900 1.000 57.24237  ? 1142 PHE A N     1 
ATOM   8543  C  CA    . PHE A 1 1142 ? -15.78400 -9.02300  -54.23900 1.000 62.38762  ? 1142 PHE A CA    1 
ATOM   8544  C  C     . PHE A 1 1142 ? -15.10400 -9.76900  -53.10200 1.000 62.76816  ? 1142 PHE A C     1 
ATOM   8545  O  O     . PHE A 1 1142 ? -15.64400 -10.75900 -52.59700 1.000 64.39372  ? 1142 PHE A O     1 
ATOM   8546  C  CB    . PHE A 1 1142 ? -17.09800 -8.39400  -53.76900 1.000 65.15926  ? 1142 PHE A CB    1 
ATOM   8547  C  CG    . PHE A 1 1142 ? -16.92900 -7.42400  -52.63500 1.000 70.64933  ? 1142 PHE A CG    1 
ATOM   8548  C  CD1   . PHE A 1 1142 ? -16.33000 -6.19400  -52.84600 1.000 71.25876  ? 1142 PHE A CD1   1 
ATOM   8549  C  CD2   . PHE A 1 1142 ? -17.36900 -7.74000  -51.36100 1.000 66.07518  ? 1142 PHE A CD2   1 
ATOM   8550  C  CE1   . PHE A 1 1142 ? -16.17000 -5.29700  -51.80800 1.000 66.88430  ? 1142 PHE A CE1   1 
ATOM   8551  C  CE2   . PHE A 1 1142 ? -17.21400 -6.84500  -50.31900 1.000 67.18729  ? 1142 PHE A CE2   1 
ATOM   8552  C  CZ    . PHE A 1 1142 ? -16.61100 -5.62400  -50.54300 1.000 69.59719  ? 1142 PHE A CZ    1 
ATOM   8553  N  N     . ARG A 1 1143 ? -13.92300 -9.29200  -52.70100 1.000 61.85268  ? 1143 ARG A N     1 
ATOM   8554  C  CA    . ARG A 1 1143 ? -13.10600 -10.02100 -51.73600 1.000 62.19474  ? 1143 ARG A CA    1 
ATOM   8555  C  C     . ARG A 1 1143 ? -13.73400 -10.07500 -50.34900 1.000 64.73875  ? 1143 ARG A C     1 
ATOM   8556  O  O     . ARG A 1 1143 ? -13.39000 -10.96700 -49.56600 1.000 69.38214  ? 1143 ARG A O     1 
ATOM   8557  C  CB    . ARG A 1 1143 ? -11.71400 -9.39400  -51.65200 1.000 65.76427  ? 1143 ARG A CB    1 
ATOM   8558  C  CG    . ARG A 1 1143 ? -11.07400 -9.12800  -53.00500 1.000 63.62396  ? 1143 ARG A CG    1 
ATOM   8559  C  CD    . ARG A 1 1143 ? -9.65200  -8.62200  -52.84700 1.000 77.59838  ? 1143 ARG A CD    1 
ATOM   8560  N  NE    . ARG A 1 1143 ? -8.74000  -9.69000  -52.44600 1.000 85.12068  ? 1143 ARG A NE    1 
ATOM   8561  C  CZ    . ARG A 1 1143 ? -7.51300  -9.48900  -51.98000 1.000 82.80363  ? 1143 ARG A CZ    1 
ATOM   8562  N  NH1   . ARG A 1 1143 ? -7.04400  -8.25600  -51.85000 1.000 88.39514  ? 1143 ARG A NH1   1 
ATOM   8563  N  NH2   . ARG A 1 1143 ? -6.75400  -10.52200 -51.64000 1.000 77.77673  ? 1143 ARG A NH2   1 
ATOM   8564  N  N     . GLY A 1 1144 ? -14.63200 -9.15700  -50.02700 1.000 69.88618  ? 1144 GLY A N     1 
ATOM   8565  C  CA    . GLY A 1 1144 ? -15.29100 -9.15800  -48.74000 1.000 75.50640  ? 1144 GLY A CA    1 
ATOM   8566  C  C     . GLY A 1 1144 ? -14.81100 -8.02000  -47.85200 1.000 76.29293  ? 1144 GLY A C     1 
ATOM   8567  O  O     . GLY A 1 1144 ? -13.71600 -7.47300  -48.01700 1.000 79.64947  ? 1144 GLY A O     1 
ATOM   8568  N  N     . TYR A 1 1145 ? -15.66200 -7.65900  -46.89400 1.000 74.80603  ? 1145 TYR A N     1 
ATOM   8569  C  CA    . TYR A 1 1145 ? -15.30000 -6.64200  -45.91800 1.000 78.15313  ? 1145 TYR A CA    1 
ATOM   8570  C  C     . TYR A 1 1145 ? -14.19200 -7.15200  -45.00400 1.000 79.08075  ? 1145 TYR A C     1 
ATOM   8571  O  O     . TYR A 1 1145 ? -14.12600 -8.33800  -44.67200 1.000 75.40555  ? 1145 TYR A O     1 
ATOM   8572  C  CB    . TYR A 1 1145 ? -16.51000 -6.24200  -45.07200 1.000 86.47567  ? 1145 TYR A CB    1 
ATOM   8573  C  CG    . TYR A 1 1145 ? -17.71400 -5.77000  -45.85500 1.000 88.64423  ? 1145 TYR A CG    1 
ATOM   8574  C  CD1   . TYR A 1 1145 ? -17.58100 -4.86100  -46.89700 1.000 84.04155  ? 1145 TYR A CD1   1 
ATOM   8575  C  CD2   . TYR A 1 1145 ? -18.98900 -6.22400  -45.53900 1.000 86.51376  ? 1145 TYR A CD2   1 
ATOM   8576  C  CE1   . TYR A 1 1145 ? -18.68500 -4.42400  -47.60800 1.000 86.35213  ? 1145 TYR A CE1   1 
ATOM   8577  C  CE2   . TYR A 1 1145 ? -20.09700 -5.79400  -46.24300 1.000 89.60049  ? 1145 TYR A CE2   1 
ATOM   8578  C  CZ    . TYR A 1 1145 ? -19.94000 -4.89500  -47.27600 1.000 94.35009  ? 1145 TYR A CZ    1 
ATOM   8579  O  OH    . TYR A 1 1145 ? -21.04200 -4.46500  -47.97900 1.000 96.14349  ? 1145 TYR A OH    1 
ATOM   8580  N  N     . GLU A 1 1146 ? -13.31600 -6.23900  -44.59500 1.000 81.12091  ? 1146 GLU A N     1 
ATOM   8581  C  CA    . GLU A 1 1146 ? -12.28600 -6.58400  -43.62600 1.000 79.14833  ? 1146 GLU A CA    1 
ATOM   8582  C  C     . GLU A 1 1146 ? -12.91900 -6.87000  -42.27000 1.000 86.80076  ? 1146 GLU A C     1 
ATOM   8583  O  O     . GLU A 1 1146 ? -13.90000 -6.23300  -41.87700 1.000 96.53593  ? 1146 GLU A O     1 
ATOM   8584  C  CB    . GLU A 1 1146 ? -11.26300 -5.45500  -43.50500 1.000 81.29181  ? 1146 GLU A CB    1 
ATOM   8585  C  CG    . GLU A 1 1146 ? -10.58800 -5.07900  -44.81500 1.000 84.73320  ? 1146 GLU A CG    1 
ATOM   8586  C  CD    . GLU A 1 1146 ? -9.53900  -6.08900  -45.24200 1.000 94.73952  ? 1146 GLU A CD    1 
ATOM   8587  O  OE1   . GLU A 1 1146 ? -9.11600  -6.90600  -44.39500 1.000 98.75802  ? 1146 GLU A OE1   1 
ATOM   8588  O  OE2   . GLU A 1 1146 ? -9.13400  -6.06500  -46.42400 1.000 93.70905  ? 1146 GLU A OE2   1 
ATOM   8589  N  N     . SER A 1 1147 ? -12.35600 -7.84300  -41.55700 1.000 87.72623  ? 1147 SER A N     1 
ATOM   8590  C  CA    . SER A 1 1147 ? -12.89600 -8.24500  -40.26500 1.000 85.60351  ? 1147 SER A CA    1 
ATOM   8591  C  C     . SER A 1 1147 ? -11.81900 -8.98900  -39.49100 1.000 90.63849  ? 1147 SER A C     1 
ATOM   8592  O  O     . SER A 1 1147 ? -11.20200 -9.91700  -40.02200 1.000 96.73149  ? 1147 SER A O     1 
ATOM   8593  C  CB    . SER A 1 1147 ? -14.13900 -9.12600  -40.43600 1.000 88.07298  ? 1147 SER A CB    1 
ATOM   8594  O  OG    . SER A 1 1147 ? -14.57500 -9.64200  -39.19000 1.000 90.14304  ? 1147 SER A OG    1 
ATOM   8595  N  N     . ASP A 1 1148 ? -11.60000 -8.58000  -38.24400 1.000 89.86305  ? 1148 ASP A N     1 
ATOM   8596  C  CA    . ASP A 1 1148 ? -10.61500 -9.22000  -37.38700 1.000 93.22209  ? 1148 ASP A CA    1 
ATOM   8597  C  C     . ASP A 1 1148 ? -11.09700 -9.15500  -35.94600 1.000 90.16390  ? 1148 ASP A C     1 
ATOM   8598  O  O     . ASP A 1 1148 ? -11.80900 -8.22500  -35.55600 1.000 86.46940  ? 1148 ASP A O     1 
ATOM   8599  C  CB    . ASP A 1 1148 ? -9.23800  -8.55900  -37.51500 1.000 92.41854  ? 1148 ASP A CB    1 
ATOM   8600  C  CG    . ASP A 1 1148 ? -9.31700  -7.04600  -37.52800 1.000 94.60979  ? 1148 ASP A CG    1 
ATOM   8601  O  OD1   . ASP A 1 1148 ? -9.82400  -6.48500  -38.52200 1.000 92.22790  ? 1148 ASP A OD1   1 
ATOM   8602  O  OD2   . ASP A 1 1148 ? -8.87700  -6.41800  -36.54100 1.000 98.53303  ? 1148 ASP A OD2   1 
ATOM   8603  N  N     . MET A 1 1149 ? -10.70300 -10.15400 -35.15900 1.000 94.26314  ? 1149 MET A N     1 
ATOM   8604  C  CA    . MET A 1 1149 ? -11.08400 -10.19900 -33.74900 1.000 95.19686  ? 1149 MET A CA    1 
ATOM   8605  C  C     . MET A 1 1149 ? -10.09300 -11.09300 -33.01800 1.000 96.03358  ? 1149 MET A C     1 
ATOM   8606  O  O     . MET A 1 1149 ? -10.03300 -12.29700 -33.28400 1.000 99.77338  ? 1149 MET A O     1 
ATOM   8607  C  CB    . MET A 1 1149 ? -12.50900 -10.71300 -33.58600 1.000 96.38640  ? 1149 MET A CB    1 
ATOM   8608  C  CG    . MET A 1 1149 ? -13.46100 -9.69500  -32.98400 1.000 94.33965  ? 1149 MET A CG    1 
ATOM   8609  S  SD    . MET A 1 1149 ? -13.15700 -9.35200  -31.24100 1.000 91.76399  ? 1149 MET A SD    1 
ATOM   8610  C  CE    . MET A 1 1149 ? -13.70900 -10.87800 -30.49400 1.000 84.74075  ? 1149 MET A CE    1 
ATOM   8611  N  N     . ASN A 1 1150 ? -9.32200  -10.50500 -32.10600 1.000 96.35101  ? 1150 ASN A N     1 
ATOM   8612  C  CA    . ASN A 1 1150 ? -8.40900  -11.25900 -31.25100 1.000 103.60535 ? 1150 ASN A CA    1 
ATOM   8613  C  C     . ASN A 1 1150 ? -9.18200  -11.66400 -30.00300 1.000 96.42673  ? 1150 ASN A C     1 
ATOM   8614  O  O     . ASN A 1 1150 ? -9.32600  -10.87800 -29.06400 1.000 98.68430  ? 1150 ASN A O     1 
ATOM   8615  C  CB    . ASN A 1 1150 ? -7.17700  -10.42800 -30.90800 1.000 100.50027 ? 1150 ASN A CB    1 
ATOM   8616  C  CG    . ASN A 1 1150 ? -6.04600  -11.26600 -30.34400 1.000 102.07970 ? 1150 ASN A CG    1 
ATOM   8617  O  OD1   . ASN A 1 1150 ? -6.14200  -11.79600 -29.23800 1.000 102.25616 ? 1150 ASN A OD1   1 
ATOM   8618  N  ND2   . ASN A 1 1150 ? -4.96300  -11.38800 -31.10500 1.000 101.77850 ? 1150 ASN A ND2   1 
ATOM   8619  N  N     . TRP A 1 1151 ? -9.68900  -12.89900 -29.99400 1.000 90.83630  ? 1151 TRP A N     1 
ATOM   8620  C  CA    . TRP A 1 1151 ? -10.51800 -13.36000 -28.88600 1.000 94.96945  ? 1151 TRP A CA    1 
ATOM   8621  C  C     . TRP A 1 1151 ? -9.74400  -13.51900 -27.58500 1.000 98.49989  ? 1151 TRP A C     1 
ATOM   8622  O  O     . TRP A 1 1151 ? -10.36700 -13.72100 -26.53700 1.000 95.10539  ? 1151 TRP A O     1 
ATOM   8623  C  CB    . TRP A 1 1151 ? -11.19500 -14.68300 -29.24800 1.000 99.96578  ? 1151 TRP A CB    1 
ATOM   8624  C  CG    . TRP A 1 1151 ? -12.59000 -14.50900 -29.76600 1.000 99.15098  ? 1151 TRP A CG    1 
ATOM   8625  C  CD1   . TRP A 1 1151 ? -13.03300 -14.75700 -31.03200 1.000 102.71525 ? 1151 TRP A CD1   1 
ATOM   8626  C  CD2   . TRP A 1 1151 ? -13.72200 -14.03100 -29.03000 1.000 95.12717  ? 1151 TRP A CD2   1 
ATOM   8627  N  NE1   . TRP A 1 1151 ? -14.37400 -14.47100 -31.12800 1.000 104.24296 ? 1151 TRP A NE1   1 
ATOM   8628  C  CE2   . TRP A 1 1151 ? -14.82100 -14.02400 -29.91200 1.000 103.48725 ? 1151 TRP A CE2   1 
ATOM   8629  C  CE3   . TRP A 1 1151 ? -13.91500 -13.61200 -27.71000 1.000 93.47879  ? 1151 TRP A CE3   1 
ATOM   8630  C  CZ2   . TRP A 1 1151 ? -16.09200 -13.61100 -29.51800 1.000 101.27921 ? 1151 TRP A CZ2   1 
ATOM   8631  C  CZ3   . TRP A 1 1151 ? -15.17800 -13.20500 -27.32000 1.000 91.86203  ? 1151 TRP A CZ3   1 
ATOM   8632  C  CH2   . TRP A 1 1151 ? -16.25000 -13.20800 -28.22100 1.000 89.79905  ? 1151 TRP A CH2   1 
ATOM   8633  N  N     . GLU A 1 1152 ? -8.41300  -13.43600 -27.62100 1.000 107.50969 ? 1152 GLU A N     1 
ATOM   8634  C  CA    . GLU A 1 1152 ? -7.63700  -13.49600 -26.38800 1.000 105.45429 ? 1152 GLU A CA    1 
ATOM   8635  C  C     . GLU A 1 1152 ? -7.66500  -12.16000 -25.65600 1.000 103.72647 ? 1152 GLU A C     1 
ATOM   8636  O  O     . GLU A 1 1152 ? -8.01600  -12.09800 -24.47300 1.000 97.38390  ? 1152 GLU A O     1 
ATOM   8637  C  CB    . GLU A 1 1152 ? -6.19800  -13.91100 -26.69000 1.000 108.38037 ? 1152 GLU A CB    1 
ATOM   8638  C  CG    . GLU A 1 1152 ? -5.39800  -14.26500 -25.45200 1.000 111.81840 ? 1152 GLU A CG    1 
ATOM   8639  C  CD    . GLU A 1 1152 ? -5.90500  -15.52500 -24.78200 1.000 115.14967 ? 1152 GLU A CD    1 
ATOM   8640  O  OE1   . GLU A 1 1152 ? -6.22900  -16.49200 -25.50300 1.000 111.60909 ? 1152 GLU A OE1   1 
ATOM   8641  O  OE2   . GLU A 1 1152 ? -5.98200  -15.54900 -23.53500 1.000 121.19551 ? 1152 GLU A OE2   1 
ATOM   8642  N  N     . LYS A 1 1153 ? -7.29500  -11.08000 -26.34700 1.000 103.61686 ? 1153 LYS A N     1 
ATOM   8643  C  CA    . LYS A 1 1153 ? -7.32200  -9.76000  -25.72600 1.000 102.99745 ? 1153 LYS A CA    1 
ATOM   8644  C  C     . LYS A 1 1153 ? -8.75200  -9.29400  -25.48700 1.000 102.59545 ? 1153 LYS A C     1 
ATOM   8645  O  O     . LYS A 1 1153 ? -9.04400  -8.66600  -24.46300 1.000 110.36283 ? 1153 LYS A O     1 
ATOM   8646  C  CB    . LYS A 1 1153 ? -6.57100  -8.75500  -26.59900 1.000 99.55806  ? 1153 LYS A CB    1 
ATOM   8647  C  CG    . LYS A 1 1153 ? -5.30000  -9.30200  -27.22800 1.000 104.61449 ? 1153 LYS A CG    1 
ATOM   8648  C  CD    . LYS A 1 1153 ? -4.41100  -8.18000  -27.74000 1.000 101.25588 ? 1153 LYS A CD    1 
ATOM   8649  C  CE    . LYS A 1 1153 ? -3.27500  -8.71900  -28.59400 1.000 103.23987 ? 1153 LYS A CE    1 
ATOM   8650  N  NZ    . LYS A 1 1153 ? -2.56200  -9.84400  -27.92900 1.000 102.95211 ? 1153 LYS A NZ    1 
ATOM   8651  N  N     . GLY A 1 1154 ? -9.65500  -9.59600  -26.41400 1.000 106.51999 ? 1154 GLY A N     1 
ATOM   8652  C  CA    . GLY A 1 1154 ? -11.03200 -9.16300  -26.31900 1.000 103.18475 ? 1154 GLY A CA    1 
ATOM   8653  C  C     . GLY A 1 1154 ? -11.39000 -7.95700  -27.15600 1.000 97.21266  ? 1154 GLY A C     1 
ATOM   8654  O  O     . GLY A 1 1154 ? -12.52000 -7.46600  -27.04600 1.000 94.81443  ? 1154 GLY A O     1 
ATOM   8655  N  N     . GLU A 1 1155 ? -10.47300 -7.46400  -27.98300 1.000 95.68129  ? 1155 GLU A N     1 
ATOM   8656  C  CA    . GLU A 1 1155 ? -10.71300 -6.30900  -28.83100 1.000 98.08122  ? 1155 GLU A CA    1 
ATOM   8657  C  C     . GLU A 1 1155 ? -10.60100 -6.70900  -30.29700 1.000 94.14860  ? 1155 GLU A C     1 
ATOM   8658  O  O     . GLU A 1 1155 ? -9.96100  -7.70500  -30.64600 1.000 93.79495  ? 1155 GLU A O     1 
ATOM   8659  C  CB    . GLU A 1 1155 ? -9.73000  -5.17300  -28.51500 1.000 104.10141 ? 1155 GLU A CB    1 
ATOM   8660  C  CG    . GLU A 1 1155 ? -8.39000  -5.28800  -29.22500 1.000 106.39568 ? 1155 GLU A CG    1 
ATOM   8661  C  CD    . GLU A 1 1155 ? -7.41300  -4.20600  -28.80700 1.000 113.55049 ? 1155 GLU A CD    1 
ATOM   8662  O  OE1   . GLU A 1 1155 ? -6.84400  -3.54100  -29.69800 1.000 106.45974 ? 1155 GLU A OE1   1 
ATOM   8663  O  OE2   . GLU A 1 1155 ? -7.21500  -4.02200  -27.58700 1.000 114.75916 ? 1155 GLU A OE2   1 
ATOM   8664  N  N     . GLY A 1 1156 ? -11.23700 -5.91800  -31.15200 1.000 86.75688  ? 1156 GLY A N     1 
ATOM   8665  C  CA    . GLY A 1 1156 ? -11.21400 -6.18900  -32.57400 1.000 85.14420  ? 1156 GLY A CA    1 
ATOM   8666  C  C     . GLY A 1 1156 ? -12.24600 -5.35200  -33.29600 1.000 90.06154  ? 1156 GLY A C     1 
ATOM   8667  O  O     . GLY A 1 1156 ? -13.03900 -4.62900  -32.68500 1.000 87.83416  ? 1156 GLY A O     1 
ATOM   8668  N  N     . GLN A 1 1157 ? -12.21900 -5.46800  -34.62300 1.000 94.75022  ? 1157 GLN A N     1 
ATOM   8669  C  CA    . GLN A 1 1157 ? -13.12400 -4.73800  -35.51000 1.000 85.83059  ? 1157 GLN A CA    1 
ATOM   8670  C  C     . GLN A 1 1157 ? -13.81400 -5.74600  -36.42000 1.000 85.98673  ? 1157 GLN A C     1 
ATOM   8671  O  O     . GLN A 1 1157 ? -13.43900 -5.90500  -37.59000 1.000 81.43650  ? 1157 GLN A O     1 
ATOM   8672  C  CB    . GLN A 1 1157 ? -12.37000 -3.68200  -36.31800 1.000 89.53637  ? 1157 GLN A CB    1 
ATOM   8673  C  CG    . GLN A 1 1157 ? -11.75100 -2.58100  -35.47100 1.000 95.62786  ? 1157 GLN A CG    1 
ATOM   8674  C  CD    . GLN A 1 1157 ? -12.41300 -1.23500  -35.68700 1.000 103.51933 ? 1157 GLN A CD    1 
ATOM   8675  O  OE1   . GLN A 1 1157 ? -12.98700 -0.97400  -36.74500 1.000 96.73741  ? 1157 GLN A OE1   1 
ATOM   8676  N  NE2   . GLN A 1 1157 ? -12.33700 -0.37000  -34.68100 1.000 102.25967 ? 1157 GLN A NE2   1 
ATOM   8677  N  N     . PRO A 1 1158 ? -14.83000 -6.44600  -35.91700 1.000 85.15184  ? 1158 PRO A N     1 
ATOM   8678  C  CA    . PRO A 1 1158 ? -15.47900 -7.51600  -36.69300 1.000 84.23667  ? 1158 PRO A CA    1 
ATOM   8679  C  C     . PRO A 1 1158 ? -16.75300 -7.11900  -37.42900 1.000 72.65423  ? 1158 PRO A C     1 
ATOM   8680  O  O     . PRO A 1 1158 ? -17.34700 -7.98600  -38.07800 1.000 76.66316  ? 1158 PRO A O     1 
ATOM   8681  C  CB    . PRO A 1 1158 ? -15.80500 -8.53900  -35.60000 1.000 83.16236  ? 1158 PRO A CB    1 
ATOM   8682  C  CG    . PRO A 1 1158 ? -16.02100 -7.70400  -34.34500 1.000 80.63830  ? 1158 PRO A CG    1 
ATOM   8683  C  CD    . PRO A 1 1158 ? -15.39900 -6.34200  -34.56300 1.000 79.84060  ? 1158 PRO A CD    1 
ATOM   8684  N  N     . PHE A 1 1159 ? -17.18500 -5.86400  -37.35000 1.000 74.17223  ? 1159 PHE A N     1 
ATOM   8685  C  CA    . PHE A 1 1159 ? -18.46700 -5.44000  -37.89500 1.000 75.67253  ? 1159 PHE A CA    1 
ATOM   8686  C  C     . PHE A 1 1159 ? -18.26200 -4.30300  -38.88400 1.000 71.50758  ? 1159 PHE A C     1 
ATOM   8687  O  O     . PHE A 1 1159 ? -17.62000 -3.29800  -38.56000 1.000 71.50140  ? 1159 PHE A O     1 
ATOM   8688  C  CB    . PHE A 1 1159 ? -19.41400 -5.01400  -36.77100 1.000 76.57224  ? 1159 PHE A CB    1 
ATOM   8689  C  CG    . PHE A 1 1159 ? -19.62400 -6.07400  -35.72700 1.000 77.24938  ? 1159 PHE A CG    1 
ATOM   8690  C  CD1   . PHE A 1 1159 ? -20.04000 -7.34600  -36.08800 1.000 75.73681  ? 1159 PHE A CD1   1 
ATOM   8691  C  CD2   . PHE A 1 1159 ? -19.38600 -5.80700  -34.38900 1.000 76.77628  ? 1159 PHE A CD2   1 
ATOM   8692  C  CE1   . PHE A 1 1159 ? -20.23100 -8.32700  -35.13300 1.000 70.51183  ? 1159 PHE A CE1   1 
ATOM   8693  C  CE2   . PHE A 1 1159 ? -19.57500 -6.78500  -33.42900 1.000 77.53036  ? 1159 PHE A CE2   1 
ATOM   8694  C  CZ    . PHE A 1 1159 ? -19.99800 -8.04600  -33.80200 1.000 70.19272  ? 1159 PHE A CZ    1 
ATOM   8695  N  N     . GLU A 1 1160 ? -18.81200 -4.46700  -40.09000 1.000 71.07914  ? 1160 GLU A N     1 
ATOM   8696  C  CA    . GLU A 1 1160 ? -18.69700 -3.43000  -41.10900 1.000 71.79885  ? 1160 GLU A CA    1 
ATOM   8697  C  C     . GLU A 1 1160 ? -19.60900 -2.24800  -40.80200 1.000 79.52170  ? 1160 GLU A C     1 
ATOM   8698  O  O     . GLU A 1 1160 ? -19.20300 -1.08900  -40.94800 1.000 81.99482  ? 1160 GLU A O     1 
ATOM   8699  C  CB    . GLU A 1 1160 ? -19.01900 -4.01400  -42.48500 1.000 75.75885  ? 1160 GLU A CB    1 
ATOM   8700  C  CG    . GLU A 1 1160 ? -19.01700 -3.00200  -43.62400 1.000 84.74623  ? 1160 GLU A CG    1 
ATOM   8701  C  CD    . GLU A 1 1160 ? -17.62000 -2.60700  -44.06600 1.000 90.32929  ? 1160 GLU A CD    1 
ATOM   8702  O  OE1   . GLU A 1 1160 ? -16.64100 -3.21500  -43.58300 1.000 87.56640  ? 1160 GLU A OE1   1 
ATOM   8703  O  OE2   . GLU A 1 1160 ? -17.50100 -1.68800  -44.90400 1.000 92.52216  ? 1160 GLU A OE2   1 
ATOM   8704  N  N     . TYR A 1 1161 ? -20.84000 -2.52000  -40.37500 1.000 80.47600  ? 1161 TYR A N     1 
ATOM   8705  C  CA    . TYR A 1 1161 ? -21.79900 -1.46700  -40.07700 1.000 79.48336  ? 1161 TYR A CA    1 
ATOM   8706  C  C     . TYR A 1 1161 ? -22.72100 -1.94100  -38.96400 1.000 75.59903  ? 1161 TYR A C     1 
ATOM   8707  O  O     . TYR A 1 1161 ? -22.66200 -3.09200  -38.52400 1.000 70.44065  ? 1161 TYR A O     1 
ATOM   8708  C  CB    . TYR A 1 1161 ? -22.60100 -1.07300  -41.32300 1.000 77.50273  ? 1161 TYR A CB    1 
ATOM   8709  C  CG    . TYR A 1 1161 ? -23.31800 -2.22900  -41.98600 1.000 87.17303  ? 1161 TYR A CG    1 
ATOM   8710  C  CD1   . TYR A 1 1161 ? -22.69900 -2.97500  -42.98000 1.000 91.53015  ? 1161 TYR A CD1   1 
ATOM   8711  C  CD2   . TYR A 1 1161 ? -24.61800 -2.56500  -41.62800 1.000 88.48759  ? 1161 TYR A CD2   1 
ATOM   8712  C  CE1   . TYR A 1 1161 ? -23.34900 -4.02900  -43.59200 1.000 92.00594  ? 1161 TYR A CE1   1 
ATOM   8713  C  CE2   . TYR A 1 1161 ? -25.27700 -3.61700  -42.23500 1.000 84.40555  ? 1161 TYR A CE2   1 
ATOM   8714  C  CZ    . TYR A 1 1161 ? -24.63800 -4.34600  -43.21600 1.000 85.64435  ? 1161 TYR A CZ    1 
ATOM   8715  O  OH    . TYR A 1 1161 ? -25.28900 -5.39300  -43.82400 1.000 84.96343  ? 1161 TYR A OH    1 
ATOM   8716  N  N     . PHE A 1 1162 ? -23.58400 -1.03400  -38.51300 1.000 80.88102  ? 1162 PHE A N     1 
ATOM   8717  C  CA    . PHE A 1 1162 ? -24.54100 -1.31600  -37.45400 1.000 77.92087  ? 1162 PHE A CA    1 
ATOM   8718  C  C     . PHE A 1 1162 ? -25.93400 -0.90300  -37.90300 1.000 78.39867  ? 1162 PHE A C     1 
ATOM   8719  O  O     . PHE A 1 1162 ? -26.10000 0.10400   -38.59900 1.000 81.63735  ? 1162 PHE A O     1 
ATOM   8720  C  CB    . PHE A 1 1162 ? -24.17400 -0.58500  -36.15600 1.000 75.97402  ? 1162 PHE A CB    1 
ATOM   8721  C  CG    . PHE A 1 1162 ? -22.92200 -1.09600  -35.50400 1.000 74.10813  ? 1162 PHE A CG    1 
ATOM   8722  C  CD1   . PHE A 1 1162 ? -21.67700 -0.66700  -35.93100 1.000 67.71303  ? 1162 PHE A CD1   1 
ATOM   8723  C  CD2   . PHE A 1 1162 ? -22.99000 -2.00600  -34.46200 1.000 78.50922  ? 1162 PHE A CD2   1 
ATOM   8724  C  CE1   . PHE A 1 1162 ? -20.52300 -1.13600  -35.33300 1.000 73.85452  ? 1162 PHE A CE1   1 
ATOM   8725  C  CE2   . PHE A 1 1162 ? -21.84000 -2.47900  -33.85900 1.000 74.52980  ? 1162 PHE A CE2   1 
ATOM   8726  C  CZ    . PHE A 1 1162 ? -20.60500 -2.04400  -34.29500 1.000 72.89836  ? 1162 PHE A CZ    1 
ATOM   8727  N  N     . VAL A 1 1163 ? -26.93100 -1.68600  -37.50200 1.000 78.38501  ? 1163 VAL A N     1 
ATOM   8728  C  CA    . VAL A 1 1163 ? -28.33200 -1.40600  -37.79600 1.000 85.67993  ? 1163 VAL A CA    1 
ATOM   8729  C  C     . VAL A 1 1163 ? -29.00000 -0.97400  -36.49800 1.000 81.04363  ? 1163 VAL A C     1 
ATOM   8730  O  O     . VAL A 1 1163 ? -29.01300 -1.72800  -35.51700 1.000 78.28756  ? 1163 VAL A O     1 
ATOM   8731  C  CB    . VAL A 1 1163 ? -29.04000 -2.62300  -38.40700 1.000 81.95594  ? 1163 VAL A CB    1 
ATOM   8732  C  CG1   . VAL A 1 1163 ? -30.48500 -2.28500  -38.73600 1.000 76.67589  ? 1163 VAL A CG1   1 
ATOM   8733  C  CG2   . VAL A 1 1163 ? -28.30200 -3.09600  -39.65000 1.000 84.47675  ? 1163 VAL A CG2   1 
ATOM   8734  N  N     . TYR A 1 1164 ? -29.55000 0.23600   -36.49100 1.000 79.06802  ? 1164 TYR A N     1 
ATOM   8735  C  CA    . TYR A 1 1164 ? -30.16600 0.81400   -35.30900 1.000 74.82961  ? 1164 TYR A CA    1 
ATOM   8736  C  C     . TYR A 1 1164 ? -31.67900 0.87500   -35.47400 1.000 80.00823  ? 1164 TYR A C     1 
ATOM   8737  O  O     . TYR A 1 1164 ? -32.19800 0.93200   -36.59200 1.000 80.14455  ? 1164 TYR A O     1 
ATOM   8738  C  CB    . TYR A 1 1164 ? -29.61900 2.21800   -35.03700 1.000 80.14564  ? 1164 TYR A CB    1 
ATOM   8739  C  CG    . TYR A 1 1164 ? -28.12500 2.25500   -34.81600 1.000 76.24844  ? 1164 TYR A CG    1 
ATOM   8740  C  CD1   . TYR A 1 1164 ? -27.56100 1.70600   -33.67400 1.000 72.25962  ? 1164 TYR A CD1   1 
ATOM   8741  C  CD2   . TYR A 1 1164 ? -27.28000 2.83900   -35.75000 1.000 79.04382  ? 1164 TYR A CD2   1 
ATOM   8742  C  CE1   . TYR A 1 1164 ? -26.19700 1.73900   -33.46600 1.000 72.76483  ? 1164 TYR A CE1   1 
ATOM   8743  C  CE2   . TYR A 1 1164 ? -25.91300 2.87500   -35.55000 1.000 74.68792  ? 1164 TYR A CE2   1 
ATOM   8744  C  CZ    . TYR A 1 1164 ? -25.37800 2.32200   -34.40600 1.000 79.56554  ? 1164 TYR A CZ    1 
ATOM   8745  O  OH    . TYR A 1 1164 ? -24.01700 2.35400   -34.20000 1.000 90.94396  ? 1164 TYR A OH    1 
ATOM   8746  N  N     . GLY A 1 1165 ? -32.38100 0.86400   -34.34700 1.000 78.27393  ? 1165 GLY A N     1 
ATOM   8747  C  CA    . GLY A 1 1165 ? -33.82800 0.94100   -34.38300 1.000 78.51396  ? 1165 GLY A CA    1 
ATOM   8748  C  C     . GLY A 1 1165 ? -34.41100 0.83200   -32.99200 1.000 82.90549  ? 1165 GLY A C     1 
ATOM   8749  O  O     . GLY A 1 1165 ? -33.69800 0.63100   -32.00300 1.000 76.06314  ? 1165 GLY A O     1 
ATOM   8750  N  N     . ALA A 1 1166 ? -35.73400 0.97200   -32.93400 1.000 77.84861  ? 1166 ALA A N     1 
ATOM   8751  C  CA    . ALA A 1 1166 ? -36.47800 0.85000   -31.69100 1.000 68.58108  ? 1166 ALA A CA    1 
ATOM   8752  C  C     . ALA A 1 1166 ? -37.88400 0.36600   -32.00900 1.000 70.71359  ? 1166 ALA A C     1 
ATOM   8753  O  O     . ALA A 1 1166 ? -38.41600 0.63100   -33.09100 1.000 73.12178  ? 1166 ALA A O     1 
ATOM   8754  C  CB    . ALA A 1 1166 ? -36.52800 2.17800   -30.92600 1.000 78.19889  ? 1166 ALA A CB    1 
ATOM   8755  N  N     . ALA A 1 1167 ? -38.48100 -0.34900  -31.05800 1.000 72.27768  ? 1167 ALA A N     1 
ATOM   8756  C  CA    . ALA A 1 1167 ? -39.81100 -0.91300  -31.23300 1.000 70.83519  ? 1167 ALA A CA    1 
ATOM   8757  C  C     . ALA A 1 1167 ? -40.62300 -0.71200  -29.96300 1.000 74.95776  ? 1167 ALA A C     1 
ATOM   8758  O  O     . ALA A 1 1167 ? -40.10500 -0.87200  -28.85500 1.000 70.01834  ? 1167 ALA A O     1 
ATOM   8759  C  CB    . ALA A 1 1167 ? -39.74400 -2.40500  -31.58400 1.000 74.17372  ? 1167 ALA A CB    1 
ATOM   8760  N  N     . CYS A 1 1168 ? -41.89800 -0.36600  -30.13300 1.000 74.03217  ? 1168 CYS A N     1 
ATOM   8761  C  CA    . CYS A 1 1168 ? -42.80800 -0.11000  -29.02200 1.000 71.40321  ? 1168 CYS A CA    1 
ATOM   8762  C  C     . CYS A 1 1168 ? -44.07200 -0.93100  -29.22900 1.000 74.93920  ? 1168 CYS A C     1 
ATOM   8763  O  O     . CYS A 1 1168 ? -44.72400 -0.81100  -30.27100 1.000 75.72349  ? 1168 CYS A O     1 
ATOM   8764  C  CB    . CYS A 1 1168 ? -43.14300 1.38100   -28.91900 1.000 75.16094  ? 1168 CYS A CB    1 
ATOM   8765  S  SG    . CYS A 1 1168 ? -44.61100 1.75900   -27.93700 1.000 94.84609  ? 1168 CYS A SG    1 
ATOM   8766  N  N     . SER A 1 1169 ? -44.42100 -1.75300  -28.24000 1.000 69.88761  ? 1169 SER A N     1 
ATOM   8767  C  CA    . SER A 1 1169 ? -45.55200 -2.66300  -28.34600 1.000 71.07081  ? 1169 SER A CA    1 
ATOM   8768  C  C     . SER A 1 1169 ? -46.48700 -2.49100  -27.15600 1.000 72.38029  ? 1169 SER A C     1 
ATOM   8769  O  O     . SER A 1 1169 ? -46.05200 -2.20100  -26.03800 1.000 77.84748  ? 1169 SER A O     1 
ATOM   8770  C  CB    . SER A 1 1169 ? -45.08600 -4.12300  -28.43300 1.000 71.23430  ? 1169 SER A CB    1 
ATOM   8771  O  OG    . SER A 1 1169 ? -44.28800 -4.33600  -29.58500 1.000 74.49107  ? 1169 SER A OG    1 
ATOM   8772  N  N     . GLU A 1 1170 ? -47.78100 -2.68400  -27.41200 1.000 65.69472  ? 1170 GLU A N     1 
ATOM   8773  C  CA    . GLU A 1 1170 ? -48.82300 -2.56300  -26.40200 1.000 69.95010  ? 1170 GLU A CA    1 
ATOM   8774  C  C     . GLU A 1 1170 ? -49.63600 -3.84900  -26.36100 1.000 74.77729  ? 1170 GLU A C     1 
ATOM   8775  O  O     . GLU A 1 1170 ? -49.94900 -4.42700  -27.40600 1.000 76.74548  ? 1170 GLU A O     1 
ATOM   8776  C  CB    . GLU A 1 1170 ? -49.73800 -1.36600  -26.69100 1.000 76.59848  ? 1170 GLU A CB    1 
ATOM   8777  C  CG    . GLU A 1 1170 ? -50.84600 -1.15900  -25.67300 1.000 79.37488  ? 1170 GLU A CG    1 
ATOM   8778  C  CD    . GLU A 1 1170 ? -51.73600 0.01800   -26.01900 1.000 87.28504  ? 1170 GLU A CD    1 
ATOM   8779  O  OE1   . GLU A 1 1170 ? -51.42200 0.73500   -26.99300 1.000 89.06383  ? 1170 GLU A OE1   1 
ATOM   8780  O  OE2   . GLU A 1 1170 ? -52.74700 0.22900   -25.31600 1.000 95.02635  ? 1170 GLU A OE2   1 
ATOM   8781  N  N     . VAL A 1 1171 ? -49.97700 -4.29200  -25.15200 1.000 74.00283  ? 1171 VAL A N     1 
ATOM   8782  C  CA    . VAL A 1 1171 ? -50.63700 -5.57600  -24.94200 1.000 71.41717  ? 1171 VAL A CA    1 
ATOM   8783  C  C     . VAL A 1 1171 ? -51.70300 -5.42100  -23.86600 1.000 80.40119  ? 1171 VAL A C     1 
ATOM   8784  O  O     . VAL A 1 1171 ? -51.49300 -4.72800  -22.86500 1.000 86.60293  ? 1171 VAL A O     1 
ATOM   8785  C  CB    . VAL A 1 1171 ? -49.62200 -6.67200  -24.54300 1.000 65.84278  ? 1171 VAL A CB    1 
ATOM   8786  C  CG1   . VAL A 1 1171 ? -50.33500 -7.92800  -24.06300 1.000 72.82807  ? 1171 VAL A CG1   1 
ATOM   8787  C  CG2   . VAL A 1 1171 ? -48.70200 -6.99400  -25.70200 1.000 68.00844  ? 1171 VAL A CG2   1 
ATOM   8788  N  N     . GLU A 1 1172 ? -52.85200 -6.05800  -24.08100 1.000 73.65378  ? 1172 GLU A N     1 
ATOM   8789  C  CA    . GLU A 1 1172 ? -53.85800 -6.25700  -23.04700 1.000 73.51927  ? 1172 GLU A CA    1 
ATOM   8790  C  C     . GLU A 1 1172 ? -53.94400 -7.74500  -22.74200 1.000 73.80869  ? 1172 GLU A C     1 
ATOM   8791  O  O     . GLU A 1 1172 ? -54.17800 -8.55500  -23.64600 1.000 74.41985  ? 1172 GLU A O     1 
ATOM   8792  C  CB    . GLU A 1 1172 ? -55.22700 -5.73200  -23.48100 1.000 80.63181  ? 1172 GLU A CB    1 
ATOM   8793  C  CG    . GLU A 1 1172 ? -56.33000 -5.99500  -22.46200 1.000 78.67562  ? 1172 GLU A CG    1 
ATOM   8794  C  CD    . GLU A 1 1172 ? -57.70500 -5.60400  -22.96700 1.000 81.24156  ? 1172 GLU A CD    1 
ATOM   8795  O  OE1   . GLU A 1 1172 ? -57.80000 -5.04100  -24.07800 1.000 79.39308  ? 1172 GLU A OE1   1 
ATOM   8796  O  OE2   . GLU A 1 1172 ? -58.69400 -5.85600  -22.24600 1.000 74.39103  ? 1172 GLU A OE2   1 
ATOM   8797  N  N     . ILE A 1 1173 ? -53.75100 -8.10100  -21.47500 1.000 76.87100  ? 1173 ILE A N     1 
ATOM   8798  C  CA    . ILE A 1 1173 ? -53.77400 -9.48900  -21.03700 1.000 75.32621  ? 1173 ILE A CA    1 
ATOM   8799  C  C     . ILE A 1 1173 ? -55.07900 -9.75700  -20.30200 1.000 81.24373  ? 1173 ILE A C     1 
ATOM   8800  O  O     . ILE A 1 1173 ? -55.70400 -8.85200  -19.73700 1.000 82.63675  ? 1173 ILE A O     1 
ATOM   8801  C  CB    . ILE A 1 1173 ? -52.56700 -9.83900  -20.13800 1.000 72.20795  ? 1173 ILE A CB    1 
ATOM   8802  C  CG1   . ILE A 1 1173 ? -52.81000 -9.37300  -18.70100 1.000 69.87066  ? 1173 ILE A CG1   1 
ATOM   8803  C  CG2   . ILE A 1 1173 ? -51.30200 -9.19500  -20.67200 1.000 82.21962  ? 1173 ILE A CG2   1 
ATOM   8804  C  CD1   . ILE A 1 1173 ? -51.76000 -9.83600  -17.71500 1.000 74.44518  ? 1173 ILE A CD1   1 
ATOM   8805  N  N     . ASP A 1 1174 ? -55.49500 -11.02100 -20.33100 1.000 84.51509  ? 1174 ASP A N     1 
ATOM   8806  C  CA    . ASP A 1 1174 ? -56.63000 -11.51500 -19.55800 1.000 76.37721  ? 1174 ASP A CA    1 
ATOM   8807  C  C     . ASP A 1 1174 ? -56.05800 -12.14800 -18.29300 1.000 78.52759  ? 1174 ASP A C     1 
ATOM   8808  O  O     . ASP A 1 1174 ? -55.43700 -13.21500 -18.35400 1.000 79.58436  ? 1174 ASP A O     1 
ATOM   8809  C  CB    . ASP A 1 1174 ? -57.44000 -12.52900 -20.37200 1.000 81.15017  ? 1174 ASP A CB    1 
ATOM   8810  C  CG    . ASP A 1 1174 ? -58.68200 -13.03700 -19.63600 1.000 82.90050  ? 1174 ASP A CG    1 
ATOM   8811  O  OD1   . ASP A 1 1174 ? -58.53700 -13.66200 -18.56900 1.000 86.89240  ? 1174 ASP A OD1   1 
ATOM   8812  O  OD2   . ASP A 1 1174 ? -59.80900 -12.85600 -20.15000 1.000 80.39611  ? 1174 ASP A OD2   1 
ATOM   8813  N  N     . CYS A 1 1175 ? -56.33400 -11.58900 -17.13500 1.000 83.59751  ? 1175 CYS A N     1 
ATOM   8814  C  CA    . CYS A 1 1175 ? -55.78800 -12.14300 -15.91400 1.000 80.83030  ? 1175 CYS A CA    1 
ATOM   8815  C  C     . CYS A 1 1175 ? -56.32700 -13.47600 -15.49800 1.000 78.25510  ? 1175 CYS A C     1 
ATOM   8816  O  O     . CYS A 1 1175 ? -55.66800 -14.21400 -14.81300 1.000 83.47387  ? 1175 CYS A O     1 
ATOM   8817  C  CB    . CYS A 1 1175 ? -56.00400 -11.17400 -14.78800 1.000 86.40132  ? 1175 CYS A CB    1 
ATOM   8818  S  SG    . CYS A 1 1175 ? -55.13500 -9.64700  -15.07800 1.000 87.63189  ? 1175 CYS A SG    1 
ATOM   8819  N  N     . LEU A 1 1176 ? -57.53800 -13.79400 -15.88400 1.000 77.73580  ? 1176 LEU A N     1 
ATOM   8820  C  CA    . LEU A 1 1176 ? -58.08900 -15.05800 -15.48100 1.000 83.99261  ? 1176 LEU A CA    1 
ATOM   8821  C  C     . LEU A 1 1176 ? -57.58000 -16.23300 -16.29700 1.000 88.95999  ? 1176 LEU A C     1 
ATOM   8822  O  O     . LEU A 1 1176 ? -57.03400 -17.18200 -15.75500 1.000 86.72702  ? 1176 LEU A O     1 
ATOM   8823  C  CB    . LEU A 1 1176 ? -59.58800 -14.98900 -15.57200 1.000 80.04050  ? 1176 LEU A CB    1 
ATOM   8824  C  CG    . LEU A 1 1176 ? -60.19100 -14.08200 -14.53500 1.000 70.61548  ? 1176 LEU A CG    1 
ATOM   8825  C  CD1   . LEU A 1 1176 ? -61.60000 -13.78700 -14.95000 1.000 81.16910  ? 1176 LEU A CD1   1 
ATOM   8826  C  CD2   . LEU A 1 1176 ? -60.21400 -14.84000 -13.24300 1.000 75.40234  ? 1176 LEU A CD2   1 
ATOM   8827  N  N     . THR A 1 1177 ? -57.76700 -16.14800 -17.60400 1.000 83.62284  ? 1177 THR A N     1 
ATOM   8828  C  CA    . THR A 1 1177 ? -57.37300 -17.16300 -18.55700 1.000 79.10945  ? 1177 THR A CA    1 
ATOM   8829  C  C     . THR A 1 1177 ? -55.89500 -17.24000 -18.80300 1.000 78.95795  ? 1177 THR A C     1 
ATOM   8830  O  O     . THR A 1 1177 ? -55.28900 -18.26000 -18.60600 1.000 81.66183  ? 1177 THR A O     1 
ATOM   8831  C  CB    . THR A 1 1177 ? -57.95000 -16.80900 -19.90300 1.000 81.43550  ? 1177 THR A CB    1 
ATOM   8832  O  OG1   . THR A 1 1177 ? -57.69400 -15.42900 -20.13900 1.000 85.75323  ? 1177 THR A OG1   1 
ATOM   8833  C  CG2   . THR A 1 1177 ? -59.42400 -17.01800 -19.90400 1.000 86.84779  ? 1177 THR A CG2   1 
ATOM   8834  N  N     . GLY A 1 1178 ? -55.31600 -16.16400 -19.28800 1.000 78.39980  ? 1178 GLY A N     1 
ATOM   8835  C  CA    . GLY A 1 1178 ? -53.89600 -16.14100 -19.56400 1.000 75.20629  ? 1178 GLY A CA    1 
ATOM   8836  C  C     . GLY A 1 1178 ? -53.71800 -15.59700 -20.94500 1.000 70.78886  ? 1178 GLY A C     1 
ATOM   8837  O  O     . GLY A 1 1178 ? -52.64200 -15.39900 -21.44100 1.000 70.01094  ? 1178 GLY A O     1 
ATOM   8838  N  N     . ASP A 1 1179 ? -54.84200 -15.34300 -21.56100 1.000 73.25188  ? 1179 ASP A N     1 
ATOM   8839  C  CA    . ASP A 1 1179 ? -54.88800 -14.82700 -22.91900 1.000 78.42870  ? 1179 ASP A CA    1 
ATOM   8840  C  C     . ASP A 1 1179 ? -54.28100 -13.42800 -22.98000 1.000 75.24707  ? 1179 ASP A C     1 
ATOM   8841  O  O     . ASP A 1 1179 ? -54.15100 -12.72900 -21.97200 1.000 84.03364  ? 1179 ASP A O     1 
ATOM   8842  C  CB    . ASP A 1 1179 ? -56.32900 -14.79700 -23.43000 1.000 72.54693  ? 1179 ASP A CB    1 
ATOM   8843  C  CG    . ASP A 1 1179 ? -56.41300 -14.72100 -24.94100 1.000 85.10576  ? 1179 ASP A CG    1 
ATOM   8844  O  OD1   . ASP A 1 1179 ? -55.36500 -14.86100 -25.60600 1.000 89.22858  ? 1179 ASP A OD1   1 
ATOM   8845  O  OD2   . ASP A 1 1179 ? -57.52800 -14.51400 -25.46500 1.000 91.21732  ? 1179 ASP A OD2   1 
ATOM   8846  N  N     . HIS A 1 1180 ? -53.90000 -13.02300 -24.18900 1.000 72.02511  ? 1180 HIS A N     1 
ATOM   8847  C  CA    . HIS A 1 1180 ? -53.38300 -11.68200 -24.41200 1.000 70.33914  ? 1180 HIS A CA    1 
ATOM   8848  C  C     . HIS A 1 1180 ? -53.62100 -11.30100 -25.86400 1.000 74.88434  ? 1180 HIS A C     1 
ATOM   8849  O  O     . HIS A 1 1180 ? -53.79300 -12.15900 -26.73400 1.000 74.56128  ? 1180 HIS A O     1 
ATOM   8850  C  CB    . HIS A 1 1180 ? -51.89200 -11.57900 -24.06100 1.000 71.47642  ? 1180 HIS A CB    1 
ATOM   8851  C  CG    . HIS A 1 1180 ? -50.97600 -11.85600 -25.21200 1.000 67.67795  ? 1180 HIS A CG    1 
ATOM   8852  N  ND1   . HIS A 1 1180 ? -50.59200 -13.13000 -25.56900 1.000 71.68831  ? 1180 HIS A ND1   1 
ATOM   8853  C  CD2   . HIS A 1 1180 ? -50.35900 -11.02000 -26.08100 1.000 63.27199  ? 1180 HIS A CD2   1 
ATOM   8854  C  CE1   . HIS A 1 1180 ? -49.78200 -13.06800 -26.61100 1.000 76.16176  ? 1180 HIS A CE1   1 
ATOM   8855  N  NE2   . HIS A 1 1180 ? -49.62500 -11.79900 -26.94100 1.000 69.76177  ? 1180 HIS A NE2   1 
ATOM   8856  N  N     . LYS A 1 1181 ? -53.63400 -9.99400  -26.11500 1.000 77.94133  ? 1181 LYS A N     1 
ATOM   8857  C  CA    . LYS A 1 1181 ? -53.87300 -9.45000  -27.44400 1.000 73.34630  ? 1181 LYS A CA    1 
ATOM   8858  C  C     . LYS A 1 1181 ? -52.82500 -8.39100  -27.74300 1.000 67.79210  ? 1181 LYS A C     1 
ATOM   8859  O  O     . LYS A 1 1181 ? -52.63900 -7.45800  -26.95500 1.000 70.32970  ? 1181 LYS A O     1 
ATOM   8860  C  CB    . LYS A 1 1181 ? -55.28000 -8.85000  -27.55100 1.000 72.28697  ? 1181 LYS A CB    1 
ATOM   8861  C  CG    . LYS A 1 1181 ? -55.65100 -8.37000  -28.94300 1.000 78.36616  ? 1181 LYS A CG    1 
ATOM   8862  C  CD    . LYS A 1 1181 ? -55.99700 -9.53500  -29.85500 1.000 95.14111  ? 1181 LYS A CD    1 
ATOM   8863  C  CE    . LYS A 1 1181 ? -56.38000 -9.05300  -31.24400 1.000 98.20294  ? 1181 LYS A CE    1 
ATOM   8864  N  NZ    . LYS A 1 1181 ? -56.86700 -10.16600 -32.10300 1.000 99.32244  ? 1181 LYS A NZ    1 
ATOM   8865  N  N     . ASN A 1 1182 ? -52.13800 -8.54100  -28.87200 1.000 68.04853  ? 1182 ASN A N     1 
ATOM   8866  C  CA    . ASN A 1 1182 ? -51.17500 -7.54200  -29.32200 1.000 71.66300  ? 1182 ASN A CA    1 
ATOM   8867  C  C     . ASN A 1 1182 ? -51.94400 -6.36300  -29.90300 1.000 69.25824  ? 1182 ASN A C     1 
ATOM   8868  O  O     . ASN A 1 1182 ? -52.56400 -6.47700  -30.96500 1.000 70.22442  ? 1182 ASN A O     1 
ATOM   8869  C  CB    . ASN A 1 1182 ? -50.21400 -8.14500  -30.34300 1.000 69.83257  ? 1182 ASN A CB    1 
ATOM   8870  C  CG    . ASN A 1 1182 ? -49.40300 -9.29100  -29.77000 1.000 73.96483  ? 1182 ASN A CG    1 
ATOM   8871  O  OD1   . ASN A 1 1182 ? -49.28600 -9.43400  -28.55200 1.000 72.91781  ? 1182 ASN A OD1   1 
ATOM   8872  N  ND2   . ASN A 1 1182 ? -48.83600 -10.11300 -30.64500 1.000 79.95089  ? 1182 ASN A ND2   1 
ATOM   8873  N  N     . ILE A 1 1183 ? -51.90900 -5.23000  -29.20400 1.000 70.20831  ? 1183 ILE A N     1 
ATOM   8874  C  CA    . ILE A 1 1183 ? -52.74700 -4.09300  -29.57400 1.000 70.69649  ? 1183 ILE A CA    1 
ATOM   8875  C  C     . ILE A 1 1183 ? -52.08900 -3.26900  -30.67300 1.000 70.42080  ? 1183 ILE A C     1 
ATOM   8876  O  O     . ILE A 1 1183 ? -52.66200 -3.06500  -31.74900 1.000 72.74446  ? 1183 ILE A O     1 
ATOM   8877  C  CB    . ILE A 1 1183 ? -53.05800 -3.23200  -28.33700 1.000 63.75653  ? 1183 ILE A CB    1 
ATOM   8878  C  CG1   . ILE A 1 1183 ? -53.66300 -4.09600  -27.22900 1.000 61.97622  ? 1183 ILE A CG1   1 
ATOM   8879  C  CG2   . ILE A 1 1183 ? -53.99600 -2.09400  -28.70400 1.000 68.77074  ? 1183 ILE A CG2   1 
ATOM   8880  C  CD1   . ILE A 1 1183 ? -53.91500 -3.34700  -25.94200 1.000 68.06104  ? 1183 ILE A CD1   1 
ATOM   8881  N  N     . ARG A 1 1184 ? -50.87700 -2.78100  -30.41900 1.000 70.58452  ? 1184 ARG A N     1 
ATOM   8882  C  CA    . ARG A 1 1184 ? -50.21500 -1.88400  -31.35400 1.000 73.40068  ? 1184 ARG A CA    1 
ATOM   8883  C  C     . ARG A 1 1184 ? -48.70900 -2.06900  -31.25500 1.000 71.93208  ? 1184 ARG A C     1 
ATOM   8884  O  O     . ARG A 1 1184 ? -48.17500 -2.28600  -30.16400 1.000 77.82394  ? 1184 ARG A O     1 
ATOM   8885  C  CB    . ARG A 1 1184 ? -50.59700 -0.42500  -31.07600 1.000 76.33833  ? 1184 ARG A CB    1 
ATOM   8886  C  CG    . ARG A 1 1184 ? -49.88500 0.59500   -31.94600 1.000 76.29003  ? 1184 ARG A CG    1 
ATOM   8887  C  CD    . ARG A 1 1184 ? -50.48400 1.97800   -31.76000 1.000 82.72616  ? 1184 ARG A CD    1 
ATOM   8888  N  NE    . ARG A 1 1184 ? -49.76500 2.99400   -32.52200 1.000 85.96350  ? 1184 ARG A NE    1 
ATOM   8889  C  CZ    . ARG A 1 1184 ? -50.15600 4.25900   -32.63100 1.000 85.61287  ? 1184 ARG A CZ    1 
ATOM   8890  N  NH1   . ARG A 1 1184 ? -51.26300 4.66700   -32.02400 1.000 86.80907  ? 1184 ARG A NH1   1 
ATOM   8891  N  NH2   . ARG A 1 1184 ? -49.44200 5.11800   -33.34500 1.000 90.92552  ? 1184 ARG A NH2   1 
ATOM   8892  N  N     . THR A 1 1185 ? -48.03300 -1.98600  -32.40000 1.000 62.80087  ? 1185 THR A N     1 
ATOM   8893  C  CA    . THR A 1 1185 ? -46.58000 -2.07400  -32.45500 1.000 71.59600  ? 1185 THR A CA    1 
ATOM   8894  C  C     . THR A 1 1185 ? -46.04800 -0.99200  -33.38200 1.000 72.99971  ? 1185 THR A C     1 
ATOM   8895  O  O     . THR A 1 1185 ? -46.54300 -0.83100  -34.50100 1.000 75.78332  ? 1185 THR A O     1 
ATOM   8896  C  CB    . THR A 1 1185 ? -46.11400 -3.45400  -32.93300 1.000 74.09332  ? 1185 THR A CB    1 
ATOM   8897  O  OG1   . THR A 1 1185 ? -46.51000 -4.44900  -31.98100 1.000 69.22975  ? 1185 THR A OG1   1 
ATOM   8898  C  CG2   . THR A 1 1185 ? -44.60100 -3.47700  -33.08400 1.000 68.42692  ? 1185 THR A CG2   1 
ATOM   8899  N  N     . ASP A 1 1186 ? -45.04000 -0.25900  -32.91400 1.000 71.53752  ? 1186 ASP A N     1 
ATOM   8900  C  CA    . ASP A 1 1186 ? -44.44300 0.84600   -33.65400 1.000 77.01463  ? 1186 ASP A CA    1 
ATOM   8901  C  C     . ASP A 1 1186 ? -42.95400 0.57800   -33.81200 1.000 78.10059  ? 1186 ASP A C     1 
ATOM   8902  O  O     . ASP A 1 1186 ? -42.23300 0.46300   -32.81500 1.000 77.74741  ? 1186 ASP A O     1 
ATOM   8903  C  CB    . ASP A 1 1186 ? -44.68600 2.17100   -32.93100 1.000 79.21191  ? 1186 ASP A CB    1 
ATOM   8904  C  CG    . ASP A 1 1186 ? -46.16100 2.47700   -32.76400 1.000 80.85137  ? 1186 ASP A CG    1 
ATOM   8905  O  OD1   . ASP A 1 1186 ? -46.79800 2.89700   -33.75100 1.000 82.77164  ? 1186 ASP A OD1   1 
ATOM   8906  O  OD2   . ASP A 1 1186 ? -46.68800 2.28100   -31.64800 1.000 78.51199  ? 1186 ASP A OD2   1 
ATOM   8907  N  N     . ILE A 1 1187 ? -42.49600 0.48300   -35.05800 1.000 70.01238  ? 1187 ILE A N     1 
ATOM   8908  C  CA    . ILE A 1 1187 ? -41.12200 0.11300   -35.37400 1.000 68.77028  ? 1187 ILE A CA    1 
ATOM   8909  C  C     . ILE A 1 1187 ? -40.49300 1.21600   -36.21200 1.000 71.60486  ? 1187 ILE A C     1 
ATOM   8910  O  O     . ILE A 1 1187 ? -41.08700 1.67100   -37.19600 1.000 74.23880  ? 1187 ILE A O     1 
ATOM   8911  C  CB    . ILE A 1 1187 ? -41.05600 -1.23600  -36.11500 1.000 70.86418  ? 1187 ILE A CB    1 
ATOM   8912  C  CG1   . ILE A 1 1187 ? -41.61300 -2.35900  -35.23700 1.000 68.45698  ? 1187 ILE A CG1   1 
ATOM   8913  C  CG2   . ILE A 1 1187 ? -39.62900 -1.54800  -36.54300 1.000 64.15622  ? 1187 ILE A CG2   1 
ATOM   8914  C  CD1   . ILE A 1 1187 ? -41.61400 -3.71500  -35.91000 1.000 58.45393  ? 1187 ILE A CD1   1 
ATOM   8915  N  N     . VAL A 1 1188 ? -39.29700 1.64800   -35.81600 1.000 74.55437  ? 1188 VAL A N     1 
ATOM   8916  C  CA    . VAL A 1 1188 ? -38.47100 2.55300   -36.60600 1.000 75.30212  ? 1188 VAL A CA    1 
ATOM   8917  C  C     . VAL A 1 1188 ? -37.10400 1.90600   -36.77400 1.000 75.30696  ? 1188 VAL A C     1 
ATOM   8918  O  O     . VAL A 1 1188 ? -36.55800 1.33900   -35.82200 1.000 74.15925  ? 1188 VAL A O     1 
ATOM   8919  C  CB    . VAL A 1 1188 ? -38.34200 3.94500   -35.95000 1.000 72.08823  ? 1188 VAL A CB    1 
ATOM   8920  C  CG1   . VAL A 1 1188 ? -37.53200 4.87900   -36.83600 1.000 79.56457  ? 1188 VAL A CG1   1 
ATOM   8921  C  CG2   . VAL A 1 1188 ? -39.71600 4.53300   -35.67400 1.000 75.54231  ? 1188 VAL A CG2   1 
ATOM   8922  N  N     . MET A 1 1189 ? -36.55700 1.97800   -37.98600 1.000 72.71162  ? 1189 MET A N     1 
ATOM   8923  C  CA    . MET A 1 1189 ? -35.30300 1.31100   -38.30400 1.000 77.67238  ? 1189 MET A CA    1 
ATOM   8924  C  C     . MET A 1 1189 ? -34.39700 2.24600   -39.09000 1.000 83.65855  ? 1189 MET A C     1 
ATOM   8925  O  O     . MET A 1 1189 ? -34.86400 3.07300   -39.87700 1.000 90.72182  ? 1189 MET A O     1 
ATOM   8926  C  CB    . MET A 1 1189 ? -35.53700 0.02500   -39.11100 1.000 74.90436  ? 1189 MET A CB    1 
ATOM   8927  C  CG    . MET A 1 1189 ? -36.21300 -1.09000  -38.33300 1.000 76.41460  ? 1189 MET A CG    1 
ATOM   8928  S  SD    . MET A 1 1189 ? -35.02200 -2.17200  -37.52100 1.000 87.12883  ? 1189 MET A SD    1 
ATOM   8929  C  CE    . MET A 1 1189 ? -34.16900 -2.85300  -38.94000 1.000 68.53171  ? 1189 MET A CE    1 
ATOM   8930  N  N     . ASP A 1 1190 ? -33.09200 2.10000   -38.86900 1.000 81.06621  ? 1190 ASP A N     1 
ATOM   8931  C  CA    . ASP A 1 1190 ? -32.07300 2.80900   -39.63900 1.000 82.38931  ? 1190 ASP A CA    1 
ATOM   8932  C  C     . ASP A 1 1190 ? -31.49700 1.82800   -40.65400 1.000 89.13637  ? 1190 ASP A C     1 
ATOM   8933  O  O     . ASP A 1 1190 ? -30.61200 1.03100   -40.33200 1.000 94.46144  ? 1190 ASP A O     1 
ATOM   8934  C  CB    . ASP A 1 1190 ? -30.98800 3.37800   -38.73200 1.000 89.45792  ? 1190 ASP A CB    1 
ATOM   8935  C  CG    . ASP A 1 1190 ? -29.74700 3.79600   -39.50100 1.000 100.26763 ? 1190 ASP A CG    1 
ATOM   8936  O  OD1   . ASP A 1 1190 ? -29.88200 4.56400   -40.47900 1.000 94.61503  ? 1190 ASP A OD1   1 
ATOM   8937  O  OD2   . ASP A 1 1190 ? -28.63700 3.35600   -39.13100 1.000 96.23574  ? 1190 ASP A OD2   1 
ATOM   8938  N  N     . VAL A 1 1191 ? -32.01100 1.88300   -41.88400 1.000 92.16712  ? 1191 VAL A N     1 
ATOM   8939  C  CA    . VAL A 1 1191 ? -31.52500 1.02600   -42.96100 1.000 90.08793  ? 1191 VAL A CA    1 
ATOM   8940  C  C     . VAL A 1 1191 ? -30.59500 1.76700   -43.91200 1.000 94.47960  ? 1191 VAL A C     1 
ATOM   8941  O  O     . VAL A 1 1191 ? -29.90600 1.12100   -44.71800 1.000 92.79300  ? 1191 VAL A O     1 
ATOM   8942  C  CB    . VAL A 1 1191 ? -32.70400 0.40600   -43.74600 1.000 87.10661  ? 1191 VAL A CB    1 
ATOM   8943  C  CG1   . VAL A 1 1191 ? -33.34600 1.44400   -44.66100 1.000 90.79931  ? 1191 VAL A CG1   1 
ATOM   8944  C  CG2   . VAL A 1 1191 ? -32.26300 -0.82900  -44.52500 1.000 88.73743  ? 1191 VAL A CG2   1 
ATOM   8945  N  N     . GLY A 1 1192 ? -30.53400 3.09300   -43.83300 1.000 100.78372 ? 1192 GLY A N     1 
ATOM   8946  C  CA    . GLY A 1 1192 ? -29.76100 3.86700   -44.78100 1.000 98.54535  ? 1192 GLY A CA    1 
ATOM   8947  C  C     . GLY A 1 1192 ? -30.47700 3.97600   -46.11000 1.000 92.13203  ? 1192 GLY A C     1 
ATOM   8948  O  O     . GLY A 1 1192 ? -31.70300 4.11600   -46.14800 1.000 93.70525  ? 1192 GLY A O     1 
ATOM   8949  N  N     . CYS A 1 1193 ? -29.72900 3.90900   -47.20700 1.000 85.23488  ? 1193 CYS A N     1 
ATOM   8950  C  CA    . CYS A 1 1193 ? -30.32100 3.93900   -48.54200 1.000 92.46350  ? 1193 CYS A CA    1 
ATOM   8951  C  C     . CYS A 1 1193 ? -30.84600 2.54500   -48.86200 1.000 90.17156  ? 1193 CYS A C     1 
ATOM   8952  O  O     . CYS A 1 1193 ? -30.07900 1.63800   -49.18700 1.000 90.61742  ? 1193 CYS A O     1 
ATOM   8953  C  CB    . CYS A 1 1193 ? -29.30100 4.39900   -49.57600 1.000 93.07088  ? 1193 CYS A CB    1 
ATOM   8954  S  SG    . CYS A 1 1193 ? -29.86600 4.25200   -51.29000 1.000 119.31926 ? 1193 CYS A SG    1 
ATOM   8955  N  N     . SER A 1 1194 ? -32.16000 2.37000   -48.76900 1.000 83.92662  ? 1194 SER A N     1 
ATOM   8956  C  CA    . SER A 1 1194 ? -32.76500 1.06800   -49.02300 1.000 79.68228  ? 1194 SER A CA    1 
ATOM   8957  C  C     . SER A 1 1194 ? -32.76300 0.77700   -50.52000 1.000 77.06822  ? 1194 SER A C     1 
ATOM   8958  O  O     . SER A 1 1194 ? -33.30400 1.55500   -51.31200 1.000 78.30861  ? 1194 SER A O     1 
ATOM   8959  C  CB    . SER A 1 1194 ? -34.18500 1.02700   -48.46700 1.000 86.13382  ? 1194 SER A CB    1 
ATOM   8960  O  OG    . SER A 1 1194 ? -34.73800 -0.27100  -48.58900 1.000 80.89430  ? 1194 SER A OG    1 
ATOM   8961  N  N     . ILE A 1 1195 ? -32.15400 -0.34800  -50.90500 1.000 77.16614  ? 1195 ILE A N     1 
ATOM   8962  C  CA    . ILE A 1 1195 ? -32.08300 -0.71000  -52.31700 1.000 71.66150  ? 1195 ILE A CA    1 
ATOM   8963  C  C     . ILE A 1 1195 ? -33.44700 -1.16200  -52.82900 1.000 71.13576  ? 1195 ILE A C     1 
ATOM   8964  O  O     . ILE A 1 1195 ? -33.78600 -0.94000  -53.99900 1.000 72.40777  ? 1195 ILE A O     1 
ATOM   8965  C  CB    . ILE A 1 1195 ? -30.99500 -1.78200  -52.52700 1.000 67.09983  ? 1195 ILE A CB    1 
ATOM   8966  C  CG1   . ILE A 1 1195 ? -31.02800 -2.33300  -53.95600 1.000 68.33991  ? 1195 ILE A CG1   1 
ATOM   8967  C  CG2   . ILE A 1 1195 ? -31.13700 -2.90000  -51.50300 1.000 74.73697  ? 1195 ILE A CG2   1 
ATOM   8968  C  CD1   . ILE A 1 1195 ? -29.93200 -3.33400  -54.24700 1.000 74.09048  ? 1195 ILE A CD1   1 
ATOM   8969  N  N     . ASN A 1 1196 ? -34.25700 -1.78300  -51.97300 1.000 69.83994  ? 1196 ASN A N     1 
ATOM   8970  C  CA    . ASN A 1 1196 ? -35.62800 -2.15600  -52.31600 1.000 68.02875  ? 1196 ASN A CA    1 
ATOM   8971  C  C     . ASN A 1 1196 ? -36.47900 -1.98300  -51.06400 1.000 70.33293  ? 1196 ASN A C     1 
ATOM   8972  O  O     . ASN A 1 1196 ? -36.51800 -2.87700  -50.20300 1.000 68.18694  ? 1196 ASN A O     1 
ATOM   8973  C  CB    . ASN A 1 1196 ? -35.70600 -3.58500  -52.84900 1.000 72.79133  ? 1196 ASN A CB    1 
ATOM   8974  C  CG    . ASN A 1 1196 ? -37.06300 -3.91600  -53.45300 1.000 73.99681  ? 1196 ASN A CG    1 
ATOM   8975  O  OD1   . ASN A 1 1196 ? -38.10800 -3.60300  -52.88400 1.000 77.33994  ? 1196 ASN A OD1   1 
ATOM   8976  N  ND2   . ASN A 1 1196 ? -37.04700 -4.55200  -54.61900 1.000 66.07927  ? 1196 ASN A ND2   1 
ATOM   8977  N  N     . PRO A 1 1197 ? -37.17500 -0.85000  -50.92700 1.000 70.63288  ? 1197 PRO A N     1 
ATOM   8978  C  CA    . PRO A 1 1197 ? -37.94100 -0.61300  -49.69300 1.000 68.84567  ? 1197 PRO A CA    1 
ATOM   8979  C  C     . PRO A 1 1197 ? -39.09200 -1.58300  -49.49700 1.000 71.95696  ? 1197 PRO A C     1 
ATOM   8980  O  O     . PRO A 1 1197 ? -39.46300 -1.85500  -48.34900 1.000 75.22170  ? 1197 PRO A O     1 
ATOM   8981  C  CB    . PRO A 1 1197 ? -38.43900 0.83000   -49.86200 1.000 65.85964  ? 1197 PRO A CB    1 
ATOM   8982  C  CG    . PRO A 1 1197 ? -38.45700 1.04900   -51.33800 1.000 78.20102  ? 1197 PRO A CG    1 
ATOM   8983  C  CD    . PRO A 1 1197 ? -37.30200 0.26100   -51.88400 1.000 73.92467  ? 1197 PRO A CD    1 
ATOM   8984  N  N     . ALA A 1 1198 ? -39.67100 -2.11400  -50.57600 1.000 65.71195  ? 1198 ALA A N     1 
ATOM   8985  C  CA    . ALA A 1 1198 ? -40.73500 -3.10200  -50.42700 1.000 66.81995  ? 1198 ALA A CA    1 
ATOM   8986  C  C     . ALA A 1 1198 ? -40.20100 -4.38900  -49.81300 1.000 71.36346  ? 1198 ALA A C     1 
ATOM   8987  O  O     . ALA A 1 1198 ? -40.80800 -4.94900  -48.89100 1.000 71.06865  ? 1198 ALA A O     1 
ATOM   8988  C  CB    . ALA A 1 1198 ? -41.38600 -3.38300  -51.78100 1.000 68.36762  ? 1198 ALA A CB    1 
ATOM   8989  N  N     . ILE A 1 1199 ? -39.06100 -4.87100  -50.31000 1.000 72.78830  ? 1199 ILE A N     1 
ATOM   8990  C  CA    . ILE A 1 1199 ? -38.48200 -6.10500  -49.79000 1.000 63.75457  ? 1199 ILE A CA    1 
ATOM   8991  C  C     . ILE A 1 1199 ? -37.93100 -5.88900  -48.38600 1.000 72.14440  ? 1199 ILE A C     1 
ATOM   8992  O  O     . ILE A 1 1199 ? -38.06500 -6.75400  -47.51200 1.000 79.08621  ? 1199 ILE A O     1 
ATOM   8993  C  CB    . ILE A 1 1199 ? -37.40000 -6.62600  -50.75400 1.000 65.85987  ? 1199 ILE A CB    1 
ATOM   8994  C  CG1   . ILE A 1 1199 ? -38.03500 -7.08700  -52.06800 1.000 66.94828  ? 1199 ILE A CG1   1 
ATOM   8995  C  CG2   . ILE A 1 1199 ? -36.60900 -7.75600  -50.11800 1.000 65.84996  ? 1199 ILE A CG2   1 
ATOM   8996  C  CD1   . ILE A 1 1199 ? -37.05200 -7.70000  -53.04100 1.000 60.92830  ? 1199 ILE A CD1   1 
ATOM   8997  N  N     . ASP A 1 1200 ? -37.31700 -4.72800  -48.14100 1.000 70.03723  ? 1200 ASP A N     1 
ATOM   8998  C  CA    . ASP A 1 1200 ? -36.70200 -4.47900  -46.84100 1.000 70.87512  ? 1200 ASP A CA    1 
ATOM   8999  C  C     . ASP A 1 1200 ? -37.74100 -4.30500  -45.74000 1.000 70.20086  ? 1200 ASP A C     1 
ATOM   9000  O  O     . ASP A 1 1200 ? -37.49800 -4.70400  -44.59600 1.000 73.18710  ? 1200 ASP A O     1 
ATOM   9001  C  CB    . ASP A 1 1200 ? -35.79200 -3.25300  -46.91700 1.000 77.72954  ? 1200 ASP A CB    1 
ATOM   9002  C  CG    . ASP A 1 1200 ? -34.54200 -3.50700  -47.73800 1.000 86.60929  ? 1200 ASP A CG    1 
ATOM   9003  O  OD1   . ASP A 1 1200 ? -34.03900 -4.65000  -47.71800 1.000 87.73134  ? 1200 ASP A OD1   1 
ATOM   9004  O  OD2   . ASP A 1 1200 ? -34.06300 -2.56400  -48.40300 1.000 83.04621  ? 1200 ASP A OD2   1 
ATOM   9005  N  N     . ILE A 1 1201 ? -38.89600 -3.71400  -46.05600 1.000 64.28776  ? 1201 ILE A N     1 
ATOM   9006  C  CA    . ILE A 1 1201 ? -39.95100 -3.58400  -45.05500 1.000 66.62739  ? 1201 ILE A CA    1 
ATOM   9007  C  C     . ILE A 1 1201 ? -40.56300 -4.94500  -44.74800 1.000 72.42568  ? 1201 ILE A C     1 
ATOM   9008  O  O     . ILE A 1 1201 ? -40.89500 -5.24600  -43.59400 1.000 70.70421  ? 1201 ILE A O     1 
ATOM   9009  C  CB    . ILE A 1 1201 ? -41.01200 -2.56900  -45.52200 1.000 69.15827  ? 1201 ILE A CB    1 
ATOM   9010  C  CG1   . ILE A 1 1201 ? -40.46500 -1.14300  -45.42500 1.000 70.09960  ? 1201 ILE A CG1   1 
ATOM   9011  C  CG2   . ILE A 1 1201 ? -42.29100 -2.70000  -44.70700 1.000 67.68806  ? 1201 ILE A CG2   1 
ATOM   9012  C  CD1   . ILE A 1 1201 ? -41.45600 -0.07800  -45.84100 1.000 67.41011  ? 1201 ILE A CD1   1 
ATOM   9013  N  N     . GLY A 1 1202 ? -40.71200 -5.79400  -45.76800 1.000 69.09703  ? 1202 GLY A N     1 
ATOM   9014  C  CA    . GLY A 1 1202 ? -41.23300 -7.13000  -45.53300 1.000 67.11994  ? 1202 GLY A CA    1 
ATOM   9015  C  C     . GLY A 1 1202 ? -40.34000 -7.95500  -44.62700 1.000 71.96060  ? 1202 GLY A C     1 
ATOM   9016  O  O     . GLY A 1 1202 ? -40.82400 -8.73600  -43.80400 1.000 73.39394  ? 1202 GLY A O     1 
ATOM   9017  N  N     . GLN A 1 1203 ? -39.02100 -7.79200  -44.76300 1.000 67.67553  ? 1203 GLN A N     1 
ATOM   9018  C  CA    . GLN A 1 1203 ? -38.09800 -8.48300  -43.86900 1.000 65.46409  ? 1203 GLN A CA    1 
ATOM   9019  C  C     . GLN A 1 1203 ? -38.20500 -7.96300  -42.44100 1.000 69.04665  ? 1203 GLN A C     1 
ATOM   9020  O  O     . GLN A 1 1203 ? -38.00200 -8.72600  -41.49100 1.000 73.87573  ? 1203 GLN A O     1 
ATOM   9021  C  CB    . GLN A 1 1203 ? -36.66400 -8.34300  -44.38000 1.000 73.56779  ? 1203 GLN A CB    1 
ATOM   9022  C  CG    . GLN A 1 1203 ? -36.41000 -9.02600  -45.71300 1.000 73.47152  ? 1203 GLN A CG    1 
ATOM   9023  C  CD    . GLN A 1 1203 ? -36.65300 -10.52200 -45.65400 1.000 85.17091  ? 1203 GLN A CD    1 
ATOM   9024  O  OE1   . GLN A 1 1203 ? -36.00500 -11.23800 -44.89000 1.000 86.82995  ? 1203 GLN A OE1   1 
ATOM   9025  N  NE2   . GLN A 1 1203 ? -37.59300 -11.00200 -46.46200 1.000 82.62243  ? 1203 GLN A NE2   1 
ATOM   9026  N  N     . ILE A 1 1204 ? -38.51900 -6.67800  -42.27000 1.000 65.41731  ? 1204 ILE A N     1 
ATOM   9027  C  CA    . ILE A 1 1204 ? -38.70200 -6.12700  -40.93100 1.000 65.21294  ? 1204 ILE A CA    1 
ATOM   9028  C  C     . ILE A 1 1204 ? -39.94100 -6.72700  -40.27700 1.000 63.60587  ? 1204 ILE A C     1 
ATOM   9029  O  O     . ILE A 1 1204 ? -39.90600 -7.15400  -39.11600 1.000 63.11756  ? 1204 ILE A O     1 
ATOM   9030  C  CB    . ILE A 1 1204 ? -38.78500 -4.59100  -40.98900 1.000 66.00388  ? 1204 ILE A CB    1 
ATOM   9031  C  CG1   . ILE A 1 1204 ? -37.45800 -3.99800  -41.46200 1.000 66.24644  ? 1204 ILE A CG1   1 
ATOM   9032  C  CG2   . ILE A 1 1204 ? -39.16200 -4.02600  -39.62800 1.000 67.01995  ? 1204 ILE A CG2   1 
ATOM   9033  C  CD1   . ILE A 1 1204 ? -37.47000 -2.48900  -41.56800 1.000 65.23290  ? 1204 ILE A CD1   1 
ATOM   9034  N  N     . GLU A 1 1205 ? -41.05300 -6.76700  -41.01300 1.000 68.26439  ? 1205 GLU A N     1 
ATOM   9035  C  CA    . GLU A 1 1205 ? -42.28700 -7.33300  -40.47600 1.000 62.06988  ? 1205 GLU A CA    1 
ATOM   9036  C  C     . GLU A 1 1205 ? -42.12100 -8.81200  -40.15900 1.000 67.80625  ? 1205 GLU A C     1 
ATOM   9037  O  O     . GLU A 1 1205 ? -42.49400 -9.27400  -39.07500 1.000 68.64374  ? 1205 GLU A O     1 
ATOM   9038  C  CB    . GLU A 1 1205 ? -43.42900 -7.12600  -41.46800 1.000 63.18141  ? 1205 GLU A CB    1 
ATOM   9039  C  CG    . GLU A 1 1205 ? -44.03400 -5.74200  -41.43000 1.000 74.08426  ? 1205 GLU A CG    1 
ATOM   9040  C  CD    . GLU A 1 1205 ? -44.87300 -5.44200  -42.65200 1.000 91.14411  ? 1205 GLU A CD    1 
ATOM   9041  O  OE1   . GLU A 1 1205 ? -44.60900 -6.03800  -43.71900 1.000 87.42032  ? 1205 GLU A OE1   1 
ATOM   9042  O  OE2   . GLU A 1 1205 ? -45.79500 -4.60700  -42.55000 1.000 93.00081  ? 1205 GLU A OE2   1 
ATOM   9043  N  N     . GLY A 1 1206 ? -41.56200 -9.57400  -41.10100 1.000 62.21964  ? 1206 GLY A N     1 
ATOM   9044  C  CA    . GLY A 1 1206 ? -41.39800 -11.00100 -40.88100 1.000 58.39455  ? 1206 GLY A CA    1 
ATOM   9045  C  C     . GLY A 1 1206 ? -40.47200 -11.31500 -39.72400 1.000 67.65171  ? 1206 GLY A C     1 
ATOM   9046  O  O     . GLY A 1 1206 ? -40.72900 -12.23400 -38.94400 1.000 68.73436  ? 1206 GLY A O     1 
ATOM   9047  N  N     . ALA A 1 1207 ? -39.38200 -10.55500 -39.59500 1.000 65.63017  ? 1207 ALA A N     1 
ATOM   9048  C  CA    . ALA A 1 1207 ? -38.47200 -10.76500 -38.47500 1.000 60.71035  ? 1207 ALA A CA    1 
ATOM   9049  C  C     . ALA A 1 1207 ? -39.15100 -10.45100 -37.14900 1.000 60.63454  ? 1207 ALA A C     1 
ATOM   9050  O  O     . ALA A 1 1207 ? -38.94900 -11.16100 -36.15700 1.000 59.55276  ? 1207 ALA A O     1 
ATOM   9051  C  CB    . ALA A 1 1207 ? -37.21400 -9.91600  -38.65100 1.000 65.35770  ? 1207 ALA A CB    1 
ATOM   9052  N  N     . PHE A 1 1208 ? -39.97200 -9.39900  -37.11300 1.000 57.20909  ? 1208 PHE A N     1 
ATOM   9053  C  CA    . PHE A 1 1208 ? -40.65400 -9.04000  -35.87400 1.000 59.01748  ? 1208 PHE A CA    1 
ATOM   9054  C  C     . PHE A 1 1208 ? -41.66100 -10.11000 -35.47100 1.000 63.69304  ? 1208 PHE A C     1 
ATOM   9055  O  O     . PHE A 1 1208 ? -41.70600 -10.52600 -34.30700 1.000 62.82134  ? 1208 PHE A O     1 
ATOM   9056  C  CB    . PHE A 1 1208 ? -41.34600 -7.68400  -36.01800 1.000 62.74648  ? 1208 PHE A CB    1 
ATOM   9057  C  CG    . PHE A 1 1208