data_6Q8O
# 
_entry.id   6Q8O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.332 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6Q8O         
WWPDB D_1200012673 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Submitted PDB 6I0D contains the same complex with decyl-ubiquinone bound' 6I0D unspecified 
PDB 'Submitted PDB 6I1P contains the same complex with NADH bound'             6I1P unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q8O 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.41 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q8O 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     95.140 
_cell.length_a_esd                 ? 
_cell.length_b                     336.590 
_cell.length_b_esd                 ? 
_cell.length_c                     262.790 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q8O 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'  48693.715 2  1.6.5.11 ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'  20309.162 2  1.6.5.11 ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'  86656.203 2  1.6.5.11 ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'  46428.027 2  1.6.5.11 ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'  23893.254 2  1.6.5.11 ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'  20262.564 2  1.6.5.11 ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'  20106.309 2  1.6.5.11 ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15' 14812.074 2  1.6.5.11 ? ? ? 
9  polymer     nat 'NADH-quinone oxidoreductase subunit 16' 14201.612 2  ?        ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'  13154.656 2  1.6.5.11 ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10' 18563.330 2  1.6.5.11 ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11' 10002.788 2  1.6.5.11 ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12' 65189.930 2  1.6.5.11 ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13' 49247.117 2  1.6.5.11 ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14' 44463.895 2  1.6.5.11 ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'  41034.523 2  1.6.5.11 ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                    351.640   14 ?        ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                  456.344   2  ?        ? ? ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'             175.820   4  ?        ? ? ? 
20 non-polymer syn 'Piericidin A'                           415.566   2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6Q8O 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6Q8O 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6Q8O 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6Q8O 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6Q8O 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6Q8O 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6Q8O 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6Q8O 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6Q8O W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6Q8O A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6Q8O J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6Q8O K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6Q8O L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6Q8O M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6Q8O N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6Q8O H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6Q8O B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6Q8O C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6Q8O D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6Q8O E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6Q8O F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6Q8O G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6Q8O O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6Q8O I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6Q8O X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6Q8O P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6Q8O R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6Q8O S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6Q8O T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6Q8O U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6Q8O V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6Q8O Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                          'C3 H7 N O2 S'    121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                          'Fe2 S2'          175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'      'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE                    ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                          'C6 H10 N3 O2 1'  156.162 
HQH non-polymer         . 'Piericidin A'               ?                          'C25 H37 N O4'    415.566 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                          'C3 H7 N O3'      105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                          'Fe4 S4'          351.640 
THR 'L-peptide linking' y THREONINE                    ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ?                          'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q8O 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.90 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 24% (w/v) PEG 4000, 100 mM KCl, 100 mM glutaric acid and 0.59 mM n-undecyl-beta-maltoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-09-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6Q8O 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.60 
_reflns.d_resolution_low                 49.164 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       182595 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.1 
_reflns.pdbx_Rmerge_I_obs                0.153 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.133 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.60 
_reflns_shell.d_res_low                   3.79 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           26923 
_reflns_shell.percent_possible_all        97.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.239 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             1.106 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               111.8 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;TLS refinement.

Twin refinement.
TWINNING INFORMATION:                                              
FRACTION: 0.490                                                   
OPERATOR: -h,-k,h+l 

Data cut anisotropically to limits (Angstrom) along a*, b* and c*:
3.6, 4.2, 3.7
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Q8O 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.605 
_refine.ls_d_res_low                             49.164 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     148790 
_refine.ls_number_reflns_R_free                  1595 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    79.80 
_refine.ls_percent_reflns_R_free                 1.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2194 
_refine.ls_R_factor_R_free                       0.2352 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2179 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HEA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.03 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         250 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74146 
_refine_hist.d_res_high                       3.605 
_refine_hist.d_res_low                        49.164 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005 ? 76250  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.804 ? 103990 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.821 ? 44658  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.044 ? 11644  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 13110  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.6190 3.7357  . . 41  3021  18.00 . . . 0.2817 . 0.2816 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7357 3.8690  . . 70  7842  47.00 . . . 0.2590 . 0.2643 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8690 4.0237  . . 111 11283 68.00 . . . 0.2798 . 0.2477 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0237 4.2065  . . 156 14174 85.00 . . . 0.2421 . 0.2363 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2065 4.4278  . . 171 15919 95.00 . . . 0.2566 . 0.2242 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4278 4.7045  . . 164 15960 95.00 . . . 0.2270 . 0.2241 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7045 5.0667  . . 192 15865 95.00 . . . 0.2201 . 0.2211 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0667 5.5745  . . 164 15846 94.00 . . . 0.2310 . 0.2248 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5745 6.3764  . . 166 16020 96.00 . . . 0.2726 . 0.2214 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3764 8.0159  . . 140 15860 95.00 . . . 0.2276 . 0.2023 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.0159 33.8131 . . 167 15273 90.00 . . . 0.2161 . 0.1961 . . . . . . . . . . 
# 
_struct.entry_id                     6Q8O 
_struct.title                        'Respiratory complex I from Thermus thermophilus with bound Piericidin A' 
_struct.pdbx_descriptor              
;NADH-quinone oxidoreductase subunit 1 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 2 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 3 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 4 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 5 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 6 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 9 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 15 (E.C.1.6.5.11), Uncharacterized protein, NADH-quinone oxidoreductase subunit 7 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 10 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 11 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 12 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 13 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 14 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 8 (E.C.1.6.5.11)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q8O 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 17 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 19 ? 
NA N N 20 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 19 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 19 ? 
YA N N 20 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P2   AA2 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P3   AA3 THR A  49  ? GLY A  61  ? THR 1 49  GLY 1 61  1 ? 13 
HELX_P HELX_P4   AA4 PRO A  71  ? PHE A  78  ? PRO 1 71  PHE 1 78  1 ? 8  
HELX_P HELX_P5   AA5 LYS A  102 ? VAL A  110 ? LYS 1 102 VAL 1 110 1 ? 9  
HELX_P HELX_P6   AA6 VAL A  110 ? ILE A  125 ? VAL 1 110 ILE 1 125 1 ? 16 
HELX_P HELX_P7   AA7 TYR A  138 ? ARG A  155 ? TYR 1 138 ARG 1 155 1 ? 18 
HELX_P HELX_P8   AA8 ASN A  161 ? THR A  165 ? ASN 1 161 THR 1 165 5 ? 5  
HELX_P HELX_P9   AA9 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P10  AB1 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P11  AB2 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P12  AB3 ASN A  220 ? ARG A  233 ? ASN 1 220 ARG 1 233 1 ? 14 
HELX_P HELX_P13  AB4 ALA A  235 ? GLN A  240 ? ALA 1 235 GLN 1 240 1 ? 6  
HELX_P HELX_P14  AB5 THR A  271 ? GLU A  278 ? THR 1 271 GLU 1 278 1 ? 8  
HELX_P HELX_P15  AB6 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P16  AB7 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P17  AB8 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P18  AB9 CYS A  356 ? GLY A  365 ? CYS 1 356 GLY 1 365 1 ? 10 
HELX_P HELX_P19  AC1 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P20  AC2 GLU A  380 ? GLY A  396 ? GLU 1 380 GLY 1 396 1 ? 17 
HELX_P HELX_P21  AC3 PRO A  401 ? HIS A  416 ? PRO 1 401 HIS 1 416 1 ? 16 
HELX_P HELX_P22  AC4 PHE A  417 ? GLU A  427 ? PHE 1 417 GLU 1 427 1 ? 11 
HELX_P HELX_P23  AC5 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P24  AC6 LYS B  17  ? TYR B  18  ? LYS 2 17  TYR 2 18  5 ? 2  
HELX_P HELX_P25  AC7 PRO B  19  ? ALA B  25  ? PRO 2 19  ALA 2 25  5 ? 7  
HELX_P HELX_P26  AC8 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P27  AC9 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P28  AD1 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P29  AD2 THR B  85  ? ALA B  91  ? THR 2 85  ALA 2 91  1 ? 7  
HELX_P HELX_P30  AD3 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P31  AD4 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P32  AD5 ARG B  162 ? ILE B  166 ? ARG 2 162 ILE 2 166 5 ? 5  
HELX_P HELX_P33  AD6 SER C  18  ? ALA C  26  ? SER 3 18  ALA 3 26  1 ? 9  
HELX_P HELX_P34  AD7 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P35  AD8 ASP C  118 ? CYS C  122 ? ASP 3 118 CYS 3 122 5 ? 5  
HELX_P HELX_P36  AD9 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P37  AE1 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P38  AE2 ARG C  205 ? THR C  209 ? ARG 3 205 THR 3 209 5 ? 5  
HELX_P HELX_P39  AE3 GLY C  224 ? CYS C  230 ? GLY 3 224 CYS 3 230 1 ? 7  
HELX_P HELX_P40  AE4 THR C  239 ? ARG C  241 ? THR 3 239 ARG 3 241 5 ? 3  
HELX_P HELX_P41  AE5 CYS C  291 ? GLY C  297 ? CYS 3 291 GLY 3 297 1 ? 7  
HELX_P HELX_P42  AE6 HIS C  298 ? GLN C  303 ? HIS 3 298 GLN 3 303 1 ? 6  
HELX_P HELX_P43  AE7 THR C  321 ? LYS C  334 ? THR 3 321 LYS 3 334 1 ? 14 
HELX_P HELX_P44  AE8 ARG C  337 ? GLU C  339 ? ARG 3 337 GLU 3 339 5 ? 3  
HELX_P HELX_P45  AE9 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P46  AF1 PRO C  378 ? PHE C  382 ? PRO 3 378 PHE 3 382 5 ? 5  
HELX_P HELX_P47  AF2 SER C  386 ? GLN C  392 ? SER 3 386 GLN 3 392 1 ? 7  
HELX_P HELX_P48  AF3 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P49  AF4 ALA C  406 ? ARG C  418 ? ALA 3 406 ARG 3 418 1 ? 13 
HELX_P HELX_P50  AF5 ALA C  456 ? ALA C  462 ? ALA 3 456 ALA 3 462 5 ? 7  
HELX_P HELX_P51  AF6 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P52  AF7 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P53  AF8 GLY C  508 ? ASP C  514 ? GLY 3 508 ASP 3 514 1 ? 7  
HELX_P HELX_P54  AF9 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P55  AG1 ASN C  540 ? MET C  547 ? ASN 3 540 MET 3 547 1 ? 8  
HELX_P HELX_P56  AG2 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P57  AG3 HIS C  591 ? ARG C  596 ? HIS 3 591 ARG 3 596 1 ? 6  
HELX_P HELX_P58  AG4 THR C  606 ? LYS C  610 ? THR 3 606 LYS 3 610 5 ? 5  
HELX_P HELX_P59  AG5 GLY C  636 ? LEU C  648 ? GLY 3 636 LEU 3 648 1 ? 13 
HELX_P HELX_P60  AG6 LEU C  656 ? ARG C  667 ? LEU 3 656 ARG 3 667 1 ? 12 
HELX_P HELX_P61  AG7 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P62  AG8 VAL C  705 ? GLN C  709 ? VAL 3 705 GLN 3 709 5 ? 5  
HELX_P HELX_P63  AG9 HIS C  719 ? ALA C  727 ? HIS 3 719 ALA 3 727 1 ? 9  
HELX_P HELX_P64  AH1 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P65  AH2 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P66  AH3 THR D  74  ? THR D  82  ? THR 4 74  THR 4 82  1 ? 9  
HELX_P HELX_P67  AH4 SER D  90  ? GLY D  106 ? SER 4 90  GLY 4 106 1 ? 17 
HELX_P HELX_P68  AH5 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P69  AH6 THR D  144 ? THR D  164 ? THR 4 144 THR 4 164 1 ? 21 
HELX_P HELX_P70  AH7 GLU D  185 ? ALA D  209 ? GLU 4 185 ALA 4 209 1 ? 25 
HELX_P HELX_P71  AH8 ILE D  213 ? ARG D  219 ? ILE 4 213 ARG 4 219 1 ? 7  
HELX_P HELX_P72  AH9 PRO D  225 ? LEU D  232 ? PRO 4 225 LEU 4 232 1 ? 8  
HELX_P HELX_P73  AI1 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P74  AI2 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P75  AI3 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P76  AI4 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P77  AI5 ARG D  314 ? THR D  319 ? ARG 4 314 THR 4 319 5 ? 6  
HELX_P HELX_P78  AI6 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P79  AI7 ALA D  372 ? LEU D  378 ? ALA 4 372 LEU 4 378 1 ? 7  
HELX_P HELX_P80  AI8 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P81  AI9 PRO D  391 ? ASP D  401 ? PRO 4 391 ASP 4 401 1 ? 11 
HELX_P HELX_P82  AJ1 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P83  AJ2 ARG E  2   ? LYS E  13  ? ARG 5 2   LYS 5 13  1 ? 12 
HELX_P HELX_P84  AJ3 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P85  AJ4 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P86  AJ5 ILE E  166 ? ARG E  171 ? ILE 5 166 ARG 5 171 1 ? 6  
HELX_P HELX_P87  AJ6 GLY E  186 ? GLY E  191 ? GLY 5 186 GLY 5 191 5 ? 6  
HELX_P HELX_P88  AJ7 PHE F  21  ? SER F  35  ? PHE 6 21  SER 6 35  1 ? 15 
HELX_P HELX_P89  AJ8 CYS F  45  ? ALA F  52  ? CYS 6 45  ALA 6 52  1 ? 8  
HELX_P HELX_P90  AJ9 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P91  AK1 SER F  85  ? LYS F  87  ? SER 6 85  LYS 6 87  5 ? 3  
HELX_P HELX_P92  AK2 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P93  AK3 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P94  AK4 ASN F  126 ? VAL F  130 ? ASN 6 126 VAL 6 130 5 ? 5  
HELX_P HELX_P95  AK5 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P96  AK6 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P97  AK7 SER G  57  ? CYS G  63  ? SER 9 57  CYS 9 63  1 ? 7  
HELX_P HELX_P98  AK8 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P99  AK9 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P100 AL1 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P101 AL2 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P102 AL3 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P103 AL4 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P104 AL5 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P105 AL6 THR H  111 ? LEU H  126 ? THR 7 111 LEU 7 126 1 ? 16 
HELX_P HELX_P106 AL7 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P107 AL8 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P108 AL9 SER I  95  ? LEU I  103 ? SER W 95  LEU W 103 1 ? 9  
HELX_P HELX_P109 AM1 PRO I  106 ? ILE I  117 ? PRO W 106 ILE W 117 1 ? 12 
HELX_P HELX_P110 AM2 ASP I  122 ? LEU I  127 ? ASP W 122 LEU W 127 5 ? 6  
HELX_P HELX_P111 AM3 PRO J  3   ? LEU J  31  ? PRO A 3   LEU A 31  1 ? 29 
HELX_P HELX_P112 AM4 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P113 AM5 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P114 AM6 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P115 AM7 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P116 AM8 ARG K  49  ? TYR K  59  ? ARG J 49  TYR J 59  1 ? 11 
HELX_P HELX_P117 AM9 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P118 AN1 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P119 AN2 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P120 AN3 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P121 AN4 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P122 AN5 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P123 AN6 LEU L  51  ? PHE L  79  ? LEU K 51  PHE K 79  1 ? 29 
HELX_P HELX_P124 AN7 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P125 AN8 MET M  1   ? LEU M  3   ? MET L 1   LEU L 3   5 ? 3  
HELX_P HELX_P126 AN9 LEU M  4   ? PHE M  20  ? LEU L 4   PHE L 20  1 ? 17 
HELX_P HELX_P127 AO1 GLU M  26  ? SER M  50  ? GLU L 26  SER L 50  1 ? 25 
HELX_P HELX_P128 AO2 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P129 AO3 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P130 AO4 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P131 AO5 PRO M  149 ? LEU M  179 ? PRO L 149 LEU L 179 1 ? 31 
HELX_P HELX_P132 AO6 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P133 AO7 ASN M  198 ? SER M  217 ? ASN L 198 SER L 217 1 ? 20 
HELX_P HELX_P134 AO8 PRO M  221 ? GLY M  232 ? PRO L 221 GLY L 232 5 ? 12 
HELX_P HELX_P135 AO9 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P136 AP1 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P137 AP2 SER M  256 ? VAL M  262 ? SER L 256 VAL L 262 1 ? 7  
HELX_P HELX_P138 AP3 LEU M  263 ? PHE M  286 ? LEU L 263 PHE L 286 1 ? 24 
HELX_P HELX_P139 AP4 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P140 AP5 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P141 AP6 GLY M  354 ? LEU M  359 ? GLY L 354 LEU L 359 1 ? 6  
HELX_P HELX_P142 AP7 GLN M  361 ? GLY M  375 ? GLN L 361 GLY L 375 1 ? 15 
HELX_P HELX_P143 AP8 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P144 AP9 GLY M  399 ? LEU M  426 ? GLY L 399 LEU L 426 1 ? 28 
HELX_P HELX_P145 AQ1 PRO M  439 ? GLY M  457 ? PRO L 439 GLY L 457 1 ? 19 
HELX_P HELX_P146 AQ2 TYR M  458 ? ALA M  460 ? TYR L 458 ALA L 460 5 ? 3  
HELX_P HELX_P147 AQ3 VAL M  468 ? LEU M  477 ? VAL L 468 LEU L 477 1 ? 10 
HELX_P HELX_P148 AQ4 GLY M  488 ? LYS M  515 ? GLY L 488 LYS L 515 1 ? 28 
HELX_P HELX_P149 AQ5 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P150 AQ6 ALA M  531 ? TYR M  533 ? ALA L 531 TYR L 533 5 ? 3  
HELX_P HELX_P151 AQ7 VAL M  534 ? ILE M  542 ? VAL L 534 ILE L 542 1 ? 9  
HELX_P HELX_P152 AQ8 ILE M  542 ? LEU M  581 ? ILE L 542 LEU L 581 1 ? 40 
HELX_P HELX_P153 AQ9 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P154 AR1 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P155 AR2 PRO N  21  ? LEU N  41  ? PRO M 21  LEU M 41  1 ? 21 
HELX_P HELX_P156 AR3 ASP N  68  ? VAL N  88  ? ASP M 68  VAL M 88  1 ? 21 
HELX_P HELX_P157 AR4 PHE N  95  ? ALA N  111 ? PHE M 95  ALA M 111 1 ? 17 
HELX_P HELX_P158 AR5 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P159 AR6 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P160 AR7 GLY N  140 ? LEU N  169 ? GLY M 140 LEU M 169 1 ? 30 
HELX_P HELX_P161 AR8 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P162 AR9 ALA N  189 ? LYS N  204 ? ALA M 189 LYS M 204 1 ? 16 
HELX_P HELX_P163 AS1 LEU N  207 ? ALA N  212 ? LEU M 207 ALA M 212 5 ? 6  
HELX_P HELX_P164 AS2 TRP N  213 ? ASN N  221 ? TRP M 213 ASN M 221 1 ? 9  
HELX_P HELX_P165 AS3 GLY N  225 ? LEU N  233 ? GLY M 225 LEU M 233 1 ? 9  
HELX_P HELX_P166 AS4 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P167 AS5 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P168 AS6 ALA N  249 ? ALA N  275 ? ALA M 249 ALA M 275 1 ? 27 
HELX_P HELX_P169 AS7 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P170 AS8 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P171 AS9 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P172 AT1 GLY N  353 ? GLY N  367 ? GLY M 353 GLY M 367 1 ? 15 
HELX_P HELX_P173 AT2 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P174 AT3 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P175 AT4 SER N  398 ? TRP N  415 ? SER M 398 TRP M 415 1 ? 18 
HELX_P HELX_P176 AT5 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P177 AT6 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P178 AT7 THR O  2   ? GLY O  17  ? THR N 2   GLY N 17  1 ? 16 
HELX_P HELX_P179 AT8 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P180 AT9 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P181 AU1 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P182 AU2 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P183 AU3 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P184 AU4 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P185 AU5 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P186 AU6 PRO O  204 ? VAL O  226 ? PRO N 204 VAL N 226 1 ? 23 
HELX_P HELX_P187 AU7 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P188 AU8 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P189 AU9 LEU O  271 ? GLY O  276 ? LEU N 271 GLY N 276 1 ? 6  
HELX_P HELX_P190 AV1 GLN O  279 ? SER O  303 ? GLN N 279 SER N 303 1 ? 25 
HELX_P HELX_P191 AV2 PRO O  308 ? ARG O  313 ? PRO N 308 ARG N 313 1 ? 6  
HELX_P HELX_P192 AV3 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P193 AV4 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P194 AV5 LEU O  339 ? GLY O  356 ? LEU N 339 GLY N 356 1 ? 18 
HELX_P HELX_P195 AV6 TRP O  358 ? LEU O  380 ? TRP N 358 LEU N 380 1 ? 23 
HELX_P HELX_P196 AV7 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P197 AV8 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P198 AV9 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P199 AW1 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P200 AW2 ARG P  79  ? LEU P  95  ? ARG H 79  LEU H 95  1 ? 17 
HELX_P HELX_P201 AW3 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P202 AW4 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P203 AW5 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P204 AW6 LEU P  195 ? GLU P  213 ? LEU H 195 GLU H 213 1 ? 19 
HELX_P HELX_P205 AW7 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P206 AW8 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P207 AW9 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P208 AX1 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P209 AX2 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P210 AX3 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P211 AX4 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P212 AX5 THR Q  49  ? GLY Q  61  ? THR B 49  GLY B 61  1 ? 13 
HELX_P HELX_P213 AX6 PRO Q  71  ? PHE Q  78  ? PRO B 71  PHE B 78  1 ? 8  
HELX_P HELX_P214 AX7 LYS Q  102 ? VAL Q  110 ? LYS B 102 VAL B 110 1 ? 9  
HELX_P HELX_P215 AX8 VAL Q  110 ? ILE Q  125 ? VAL B 110 ILE B 125 1 ? 16 
HELX_P HELX_P216 AX9 ARG Q  139 ? ARG Q  155 ? ARG B 139 ARG B 155 1 ? 17 
HELX_P HELX_P217 AY1 ASN Q  161 ? THR Q  165 ? ASN B 161 THR B 165 5 ? 5  
HELX_P HELX_P218 AY2 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P219 AY3 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P220 AY4 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P221 AY5 VAL Q  221 ? ARG Q  233 ? VAL B 221 ARG B 233 1 ? 13 
HELX_P HELX_P222 AY6 ALA Q  235 ? GLN Q  240 ? ALA B 235 GLN B 240 1 ? 6  
HELX_P HELX_P223 AY7 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P224 AY8 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P225 AY9 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P226 AZ1 SER Q  336 ? GLU Q  351 ? SER B 336 GLU B 351 1 ? 16 
HELX_P HELX_P227 AZ2 CYS Q  356 ? PHE Q  366 ? CYS B 356 PHE B 366 1 ? 11 
HELX_P HELX_P228 AZ3 PHE Q  366 ? GLY Q  375 ? PHE B 366 GLY B 375 1 ? 10 
HELX_P HELX_P229 AZ4 GLU Q  380 ? LEU Q  391 ? GLU B 380 LEU B 391 1 ? 12 
HELX_P HELX_P230 AZ5 LEU Q  391 ? GLY Q  396 ? LEU B 391 GLY B 396 1 ? 6  
HELX_P HELX_P231 AZ6 PRO Q  401 ? GLU Q  427 ? PRO B 401 GLU B 427 1 ? 27 
HELX_P HELX_P232 AZ7 LYS R  7   ? ALA R  16  ? LYS C 7   ALA C 16  1 ? 10 
HELX_P HELX_P233 AZ8 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P234 AZ9 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P235 BA1 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P236 BA2 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P237 BA3 THR R  85  ? ALA R  91  ? THR C 85  ALA C 91  1 ? 7  
HELX_P HELX_P238 BA4 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P239 BA5 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P240 BA6 SER S  18  ? ALA S  26  ? SER D 18  ALA D 26  1 ? 9  
HELX_P HELX_P241 BA7 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P242 BA8 ASP S  118 ? CYS S  122 ? ASP D 118 CYS D 122 5 ? 5  
HELX_P HELX_P243 BA9 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P244 BB1 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P245 BB2 ARG S  205 ? THR S  209 ? ARG D 205 THR D 209 5 ? 5  
HELX_P HELX_P246 BB3 PHE S  222 ? GLY S  224 ? PHE D 222 GLY D 224 5 ? 3  
HELX_P HELX_P247 BB4 ASN S  225 ? CYS S  230 ? ASN D 225 CYS D 230 1 ? 6  
HELX_P HELX_P248 BB5 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P249 BB6 CYS S  291 ? GLY S  297 ? CYS D 291 GLY D 297 1 ? 7  
HELX_P HELX_P250 BB7 HIS S  298 ? GLN S  303 ? HIS D 298 GLN D 303 1 ? 6  
HELX_P HELX_P251 BB8 THR S  321 ? LYS S  334 ? THR D 321 LYS D 334 1 ? 14 
HELX_P HELX_P252 BB9 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P253 BC1 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P254 BC2 SER S  386 ? GLN S  392 ? SER D 386 GLN D 392 1 ? 7  
HELX_P HELX_P255 BC3 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P256 BC4 ALA S  406 ? ARG S  418 ? ALA D 406 ARG D 418 1 ? 13 
HELX_P HELX_P257 BC5 ALA S  456 ? TRP S  461 ? ALA D 456 TRP D 461 5 ? 6  
HELX_P HELX_P258 BC6 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P259 BC7 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P260 BC8 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P261 BC9 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P262 BD1 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P263 BD2 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P264 BD3 HIS S  591 ? ARG S  596 ? HIS D 591 ARG D 596 1 ? 6  
HELX_P HELX_P265 BD4 THR S  606 ? LYS S  610 ? THR D 606 LYS D 610 5 ? 5  
HELX_P HELX_P266 BD5 GLY S  636 ? GLY S  649 ? GLY D 636 GLY D 649 1 ? 14 
HELX_P HELX_P267 BD6 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P268 BD7 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P269 BD8 VAL S  705 ? GLN S  709 ? VAL D 705 GLN D 709 5 ? 5  
HELX_P HELX_P270 BD9 HIS S  719 ? ALA S  727 ? HIS D 719 ALA D 727 1 ? 9  
HELX_P HELX_P271 BE1 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P272 BE2 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P273 BE3 GLN T  77  ? THR T  82  ? GLN E 77  THR E 82  1 ? 6  
HELX_P HELX_P274 BE4 SER T  90  ? GLY T  106 ? SER E 90  GLY E 106 1 ? 17 
HELX_P HELX_P275 BE5 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P276 BE6 THR T  144 ? THR T  164 ? THR E 144 THR E 164 1 ? 21 
HELX_P HELX_P277 BE7 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P278 BE8 PHE T  214 ? ARG T  219 ? PHE E 214 ARG E 219 1 ? 6  
HELX_P HELX_P279 BE9 PRO T  225 ? LEU T  232 ? PRO E 225 LEU E 232 1 ? 8  
HELX_P HELX_P280 BF1 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P281 BF2 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P282 BF3 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P283 BF4 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P284 BF5 ARG T  314 ? THR T  319 ? ARG E 314 THR E 319 5 ? 6  
HELX_P HELX_P285 BF6 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P286 BF7 ALA T  372 ? SER T  380 ? ALA E 372 SER E 380 1 ? 9  
HELX_P HELX_P287 BF8 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P288 BF9 GLN T  389 ? ASP T  401 ? GLN E 389 ASP E 401 1 ? 13 
HELX_P HELX_P289 BG1 VAL T  403 ? ASP T  408 ? VAL E 403 ASP E 408 1 ? 6  
HELX_P HELX_P290 BG2 ARG U  2   ? LYS U  13  ? ARG F 2   LYS F 13  1 ? 12 
HELX_P HELX_P291 BG3 PRO U  30  ? MET U  44  ? PRO F 30  MET F 44  1 ? 15 
HELX_P HELX_P292 BG4 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P293 BG5 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P294 BG6 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P295 BG7 PHE V  21  ? SER V  35  ? PHE G 21  SER G 35  1 ? 15 
HELX_P HELX_P296 BG8 CYS V  45  ? ALA V  52  ? CYS G 45  ALA G 52  1 ? 8  
HELX_P HELX_P297 BG9 SER V  71  ? ALA V  75  ? SER G 71  ALA G 75  5 ? 5  
HELX_P HELX_P298 BH1 SER V  85  ? LYS V  87  ? SER G 85  LYS G 87  5 ? 3  
HELX_P HELX_P299 BH2 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P300 BH3 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P301 BH4 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P302 BH5 ARG V  143 ? ARG V  159 ? ARG G 143 ARG G 159 1 ? 17 
HELX_P HELX_P303 BH6 LEU W  3   ? PHE W  18  ? LEU O 3   PHE O 18  1 ? 16 
HELX_P HELX_P304 BH7 SER W  57  ? CYS W  63  ? SER O 57  CYS O 63  1 ? 7  
HELX_P HELX_P305 BH8 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P306 BH9 GLU W  125 ? ASP W  128 ? GLU O 125 ASP O 128 5 ? 4  
HELX_P HELX_P307 BI1 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P308 BI2 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P309 BI3 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P310 BI4 SER X  5   ? GLY X  28  ? SER I 5   GLY I 28  1 ? 24 
HELX_P HELX_P311 BI5 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P312 BI6 THR X  111 ? LEU X  126 ? THR I 111 LEU I 126 1 ? 16 
HELX_P HELX_P313 BI7 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P314 BI8 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P315 BI9 GLY Y  97  ? LEU Y  102 ? GLY X 97  LEU X 102 1 ? 6  
HELX_P HELX_P316 BJ1 PRO Y  106 ? ILE Y  117 ? PRO X 106 ILE X 117 1 ? 12 
HELX_P HELX_P317 BJ2 ASP Y  122 ? TYR Y  126 ? ASP X 122 TYR X 126 5 ? 5  
HELX_P HELX_P318 BJ3 ILE Z  4   ? LEU Z  31  ? ILE P 4   LEU P 31  1 ? 28 
HELX_P HELX_P319 BJ4 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P320 BJ5 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P321 BJ6 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P322 BJ7 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P323 BJ8 ALA AA 48  ? TYR AA 59  ? ALA R 48  TYR R 59  1 ? 12 
HELX_P HELX_P324 BJ9 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P325 BK1 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P326 BK2 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P327 BK3 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P328 BK4 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P329 BK5 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P330 BK6 LEU BA 51  ? ARG BA 80  ? LEU S 51  ARG S 80  1 ? 30 
HELX_P HELX_P331 BK7 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P332 BK8 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P333 BK9 PRO CA 27  ? SER CA 50  ? PRO T 27  SER T 50  1 ? 24 
HELX_P HELX_P334 BL1 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P335 BL2 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P336 BL3 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P337 BL4 ALA CA 152 ? LEU CA 179 ? ALA T 152 LEU T 179 1 ? 28 
HELX_P HELX_P338 BL5 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P339 BL6 ASN CA 198 ? ALA CA 218 ? ASN T 198 ALA T 218 1 ? 21 
HELX_P HELX_P340 BL7 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P341 BL8 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P342 BL9 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P343 BM1 SER CA 256 ? VAL CA 262 ? SER T 256 VAL T 262 1 ? 7  
HELX_P HELX_P344 BM2 LEU CA 263 ? GLY CA 287 ? LEU T 263 GLY T 287 1 ? 25 
HELX_P HELX_P345 BM3 ASP CA 290 ? VAL CA 312 ? ASP T 290 VAL T 312 1 ? 23 
HELX_P HELX_P346 BM4 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P347 BM5 GLY CA 354 ? LEU CA 359 ? GLY T 354 LEU T 359 1 ? 6  
HELX_P HELX_P348 BM6 THR CA 362 ? GLY CA 375 ? THR T 362 GLY T 375 1 ? 14 
HELX_P HELX_P349 BM7 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P350 BM8 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P351 BM9 PRO CA 439 ? GLY CA 457 ? PRO T 439 GLY T 457 1 ? 19 
HELX_P HELX_P352 BN1 TYR CA 458 ? ALA CA 460 ? TYR T 458 ALA T 460 5 ? 3  
HELX_P HELX_P353 BN2 VAL CA 468 ? LYS CA 474 ? VAL T 468 LYS T 474 1 ? 7  
HELX_P HELX_P354 BN3 GLY CA 488 ? LYS CA 515 ? GLY T 488 LYS T 515 1 ? 28 
HELX_P HELX_P355 BN4 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P356 BN5 TYR CA 533 ? ILE CA 542 ? TYR T 533 ILE T 542 1 ? 10 
HELX_P HELX_P357 BN6 ILE CA 542 ? ARG CA 580 ? ILE T 542 ARG T 580 1 ? 39 
HELX_P HELX_P358 BN7 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P359 BN8 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P360 BN9 PRO DA 21  ? LEU DA 41  ? PRO U 21  LEU U 41  1 ? 21 
HELX_P HELX_P361 BO1 ASP DA 68  ? VAL DA 88  ? ASP U 68  VAL U 88  1 ? 21 
HELX_P HELX_P362 BO2 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P363 BO3 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P364 BO4 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P365 BO5 GLY DA 140 ? LEU DA 169 ? GLY U 140 LEU U 169 1 ? 30 
HELX_P HELX_P366 BO6 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P367 BO7 ALA DA 189 ? LYS DA 204 ? ALA U 189 LYS U 204 1 ? 16 
HELX_P HELX_P368 BO8 LEU DA 207 ? HIS DA 211 ? LEU U 207 HIS U 211 5 ? 5  
HELX_P HELX_P369 BO9 TRP DA 213 ? ASN DA 221 ? TRP U 213 ASN U 221 1 ? 9  
HELX_P HELX_P370 BP1 GLY DA 225 ? TYR DA 234 ? GLY U 225 TYR U 234 1 ? 10 
HELX_P HELX_P371 BP2 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P372 BP3 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P373 BP4 ALA DA 249 ? ALA DA 278 ? ALA U 249 ALA U 278 1 ? 30 
HELX_P HELX_P374 BP5 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P375 BP6 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P376 BP7 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P377 BP8 GLY DA 353 ? GLY DA 367 ? GLY U 353 GLY U 367 1 ? 15 
HELX_P HELX_P378 BP9 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P379 BQ1 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P380 BQ2 SER DA 398 ? PHE DA 414 ? SER U 398 PHE U 414 1 ? 17 
HELX_P HELX_P381 BQ3 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P382 BQ4 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P383 BQ5 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P384 BQ6 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P385 BQ7 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P386 BQ8 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P387 BQ9 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P388 BR1 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P389 BR2 GLY EA 169 ? ALA EA 187 ? GLY V 169 ALA V 187 1 ? 19 
HELX_P HELX_P390 BR3 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P391 BR4 PRO EA 204 ? VAL EA 226 ? PRO V 204 VAL V 226 1 ? 23 
HELX_P HELX_P392 BR5 PRO EA 229 ? GLN EA 251 ? PRO V 229 GLN V 251 1 ? 23 
HELX_P HELX_P393 BR6 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P394 BR7 LEU EA 271 ? THR EA 275 ? LEU V 271 THR V 275 5 ? 5  
HELX_P HELX_P395 BR8 GLN EA 279 ? SER EA 303 ? GLN V 279 SER V 303 1 ? 25 
HELX_P HELX_P396 BR9 PRO EA 308 ? ARG EA 313 ? PRO V 308 ARG V 313 1 ? 6  
HELX_P HELX_P397 BS1 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P398 BS2 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P399 BS3 LEU EA 339 ? GLY EA 356 ? LEU V 339 GLY V 356 1 ? 18 
HELX_P HELX_P400 BS4 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P401 BS5 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P402 BS6 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P403 BS7 VAL EA 419 ? LEU EA 423 ? VAL V 419 LEU V 423 5 ? 5  
HELX_P HELX_P404 BS8 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P405 BS9 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P406 BT1 PHE FA 80  ? LEU FA 95  ? PHE Q 80  LEU Q 95  1 ? 16 
HELX_P HELX_P407 BT2 LEU FA 120 ? SER FA 143 ? LEU Q 120 SER Q 143 1 ? 24 
HELX_P HELX_P408 BT3 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P409 BT4 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P410 BT5 LEU FA 195 ? GLU FA 213 ? LEU Q 195 GLU Q 213 1 ? 19 
HELX_P HELX_P411 BT6 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P412 BT7 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P413 BT8 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P414 BT9 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P415 BU1 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc4  metalc ? ? A CYS 400 SG  ? ? ? 1_555 GA SF4 .   FE3 ? ? 1 CYS 400 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc5  metalc ? ? B CYS 83  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc6  metalc ? ? B CYS 88  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc7  metalc ? ? B CYS 124 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc8  metalc ? ? B CYS 128 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc9  metalc ? ? C CYS 34  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 34  3 FES 804 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc10 metalc ? ? C CYS 45  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc11 metalc ? ? C CYS 48  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc12 metalc ? ? C CYS 83  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc13 metalc ? ? C CYS 119 SG  ? ? ? 1_555 JA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc14 metalc ? ? C CYS 122 SG  ? ? ? 1_555 JA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc15 metalc ? ? C CYS 128 SG  ? ? ? 1_555 JA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc16 metalc ? ? C CYS 181 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc17 metalc ? ? C CYS 184 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc18 metalc ? ? C CYS 187 SG  ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc19 metalc ? ? C CYS 230 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc20 metalc ? ? C CYS 256 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc21 metalc ? ? C CYS 259 SG  ? ? ? 1_555 LA SF4 .   FE4 ? ? 3 CYS 259 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc22 metalc ? ? C CYS 263 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc23 metalc ? ? C CYS 291 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc24 metalc ? ? F CYS 45  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc25 metalc ? ? F CYS 46  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc26 metalc ? ? F CYS 111 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc27 metalc ? ? F CYS 140 SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc28 metalc ? ? G CYS 53  SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc29 metalc ? ? G CYS 56  SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc30 metalc ? ? G CYS 59  SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc31 metalc ? ? G CYS 63  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc32 metalc ? ? G CYS 98  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc33 metalc ? ? G CYS 101 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc34 metalc ? ? G CYS 104 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc35 metalc ? ? G CYS 108 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc36 metalc ? ? Q CYS 353 SG  ? ? ? 1_555 RA SF4 .   FE4 ? ? B CYS 353 B SF4 501 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc37 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc38 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc39 metalc ? ? Q CYS 400 SG  ? ? ? 1_555 RA SF4 .   FE3 ? ? B CYS 400 B SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc40 metalc ? ? R CYS 83  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc41 metalc ? ? R CYS 88  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc42 metalc ? ? R CYS 124 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc43 metalc ? ? R CYS 128 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc44 metalc ? ? S CYS 34  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc45 metalc ? ? S CYS 45  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc46 metalc ? ? S CYS 48  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc47 metalc ? ? S CYS 83  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc48 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 UA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 1.744 ? ? 
metalc49 metalc ? ? S CYS 119 SG  ? ? ? 1_555 UA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc50 metalc ? ? S CYS 122 SG  ? ? ? 1_555 UA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc51 metalc ? ? S CYS 128 SG  ? ? ? 1_555 UA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc52 metalc ? ? S CYS 181 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc53 metalc ? ? S CYS 184 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc54 metalc ? ? S CYS 187 SG  ? ? ? 1_555 VA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc55 metalc ? ? S CYS 230 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc56 metalc ? ? S CYS 256 SG  ? ? ? 1_555 WA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc57 metalc ? ? S CYS 263 SG  ? ? ? 1_555 WA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc58 metalc ? ? S CYS 291 SG  ? ? ? 1_555 WA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc59 metalc ? ? V CYS 46  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc60 metalc ? ? V CYS 111 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc61 metalc ? ? V CYS 140 SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc62 metalc ? ? W CYS 53  SG  ? ? ? 1_555 BB SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc63 metalc ? ? W CYS 56  SG  ? ? ? 1_555 BB SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc64 metalc ? ? W CYS 59  SG  ? ? ? 1_555 BB SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc65 metalc ? ? W CYS 63  SG  ? ? ? 1_555 AB SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc66 metalc ? ? W CYS 98  SG  ? ? ? 1_555 AB SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc67 metalc ? ? W CYS 101 SG  ? ? ? 1_555 AB SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc68 metalc ? ? W CYS 104 SG  ? ? ? 1_555 AB SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc69 metalc ? ? W CYS 108 SG  ? ? ? 1_555 BB SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -3.26 
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 0.03  
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -8.19 
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 0.50  
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 -1.76 
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -6.79 
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 -3.81 
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 -1.09 
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 -4.24 
10 GLY 52  P  . ? GLY 52  H PRO 53  P  ? PRO 53  H 1 25.36 
11 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -8.89 
12 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -1.54 
13 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 3.22  
14 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -8.49 
15 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 -1.15 
16 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -1.05 
17 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -8.19 
18 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -2.90 
19 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 0.09  
20 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 -1.98 
21 GLY 52  FA . ? GLY 52  Q PRO 53  FA ? PRO 53  Q 1 27.94 
22 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -3.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 7 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 7 ? 
AC5 ? 6 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 3 ? 
AD2 ? 5 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 7 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 7 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 3 ? 
AE4 ? 5 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 3 ? 
AF2 ? 7 ? 
AF3 ? 6 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AC1 1 2 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC4 6 7 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? parallel      
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? parallel      
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? parallel      
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD6 5 6 ? parallel      
AD6 6 7 ? parallel      
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? parallel      
AD9 3 4 ? anti-parallel 
AD9 4 5 ? parallel      
AD9 5 6 ? anti-parallel 
AD9 6 7 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? parallel      
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE5 1 2 ? parallel      
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE8 1 2 ? parallel      
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? anti-parallel 
AF2 6 7 ? anti-parallel 
AF3 1 2 ? parallel      
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? parallel      
AF3 5 6 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A  170 ? ARG A  175 ? ASP 1 170 ARG 1 175 
AA1 2 VAL A  129 ? VAL A  134 ? VAL 1 129 VAL 1 134 
AA1 3 TYR A  88  ? CYS A  91  ? TYR 1 88  CYS 1 91  
AA1 4 THR A  216 ? ASN A  219 ? THR 1 216 ASN 1 219 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? SER C  171 ? HIS 3 168 SER 3 171 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  235 ? ASP C  237 ? LEU 3 235 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? ARG C  270 ? GLY 3 264 ARG 3 270 
AA7 3 GLU C  273 ? ALA C  279 ? GLU 3 273 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 HIS C  465 ? VAL C  467 ? HIS 3 465 VAL 3 467 
AA9 2 MET C  448 ? ALA C  452 ? MET 3 448 ALA 3 452 
AA9 3 ALA C  396 ? LEU C  399 ? ALA 3 396 LEU 3 399 
AA9 4 VAL C  504 ? LEU C  507 ? VAL 3 504 LEU 3 507 
AA9 5 LYS C  531 ? ALA C  534 ? LYS 3 531 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB2 2 PHE C  692 ? ARG C  695 ? PHE 3 692 ARG 3 695 
AB2 3 LEU C  758 ? SER C  761 ? LEU 3 758 SER 3 761 
AB2 4 GLU C  715 ? ALA C  718 ? GLU 3 715 ALA 3 718 
AB2 5 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 6 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 7 ARG C  774 ? LEU C  776 ? ARG 3 774 LEU 3 776 
AB3 1 LEU D  28  ? VAL D  30  ? LEU 4 28  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB4 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB4 3 THR D  346 ? SER D  348 ? THR 4 346 SER 4 348 
AB5 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB5 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB5 3 ARG D  367 ? ARG D  371 ? ARG 4 367 ARG 4 371 
AB6 1 ILE E  17  ? ASP E  19  ? ILE 5 17  ASP 5 19  
AB6 2 LEU E  25  ? VAL E  28  ? LEU 5 25  VAL 5 28  
AB6 3 PHE E  88  ? VAL E  94  ? PHE 5 88  VAL 5 94  
AB6 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB6 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB7 1 ARG E  100 ? PRO E  102 ? ARG 5 100 PRO 5 102 
AB7 2 VAL E  125 ? GLU E  127 ? VAL 5 125 GLU 5 127 
AB8 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB8 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB9 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB9 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB9 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB9 4 VAL F  135 ? VAL F  137 ? VAL 6 135 VAL 6 137 
AC1 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AC1 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC2 1 HIS G  41  ? LEU G  43  ? HIS 9 41  LEU 9 43  
AC2 2 ILE G  113 ? LEU G  115 ? ILE 9 113 LEU 9 115 
AC3 1 ILE G  68  ? GLU G  74  ? ILE 9 68  GLU 9 74  
AC3 2 ARG G  86  ? ASN G  94  ? ARG 9 86  ASN 9 94  
AC3 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC4 1 ARG H  30  ? ASP H  36  ? ARG 7 30  ASP 7 36  
AC4 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC4 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC4 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC4 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC4 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC4 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC5 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC5 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC5 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC5 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC5 5 PHE I  89  ? VAL I  93  ? PHE W 89  VAL W 93  
AC5 6 ASN I  119 ? PRO I  120 ? ASN W 119 PRO W 120 
AC6 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC6 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC7 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC7 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC8 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC8 2 VAL Q  129 ? VAL Q  134 ? VAL B 129 VAL B 134 
AC8 3 TYR Q  88  ? ALA Q  93  ? TYR B 88  ALA B 93  
AC8 4 THR Q  216 ? ASN Q  220 ? THR B 216 ASN B 220 
AC9 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AC9 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AC9 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AC9 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AC9 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AD1 1 SER R  118 ? VAL R  122 ? SER C 118 VAL C 122 
AD1 2 HIS R  79  ? CYS R  83  ? HIS C 79  CYS C 83  
AD1 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD2 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD2 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD2 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD2 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD2 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD3 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD3 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD3 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD4 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD4 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD5 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD5 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD5 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD6 1 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD6 2 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD6 3 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD6 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD6 5 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD6 6 LEU S  343 ? LEU S  345 ? LEU D 343 LEU D 345 
AD6 7 LEU S  369 ? PHE S  371 ? LEU D 369 PHE D 371 
AD7 1 ILE S  464 ? HIS S  465 ? ILE D 464 HIS D 465 
AD7 2 MET S  448 ? PHE S  451 ? MET D 448 PHE D 451 
AD7 3 ALA S  396 ? LEU S  399 ? ALA D 396 LEU D 399 
AD7 4 VAL S  504 ? LEU S  507 ? VAL D 504 LEU D 507 
AD7 5 VAL S  532 ? ALA S  534 ? VAL D 532 ALA D 534 
AD8 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD8 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AD9 1 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AD9 2 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AD9 3 LEU S  758 ? ALA S  762 ? LEU D 758 ALA D 762 
AD9 4 ALA S  714 ? ALA S  718 ? ALA D 714 ALA D 718 
AD9 5 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AD9 6 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AD9 7 ARG S  774 ? LEU S  776 ? ARG D 774 LEU D 776 
AE1 1 LEU T  28  ? VAL T  30  ? LEU E 28  VAL E 30  
AE1 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AE1 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE2 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE2 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE2 3 PRO T  345 ? SER T  348 ? PRO E 345 SER E 348 
AE3 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE3 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE3 3 ARG T  367 ? ARG T  371 ? ARG E 367 ARG E 371 
AE4 1 ILE U  17  ? ASP U  19  ? ILE F 17  ASP F 19  
AE4 2 LEU U  25  ? VAL U  28  ? LEU F 25  VAL F 28  
AE4 3 PHE U  88  ? VAL U  94  ? PHE F 88  VAL F 94  
AE4 4 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE4 5 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE5 1 ARG U  100 ? PRO U  102 ? ARG F 100 PRO F 102 
AE5 2 VAL U  125 ? GLU U  127 ? VAL F 125 GLU F 127 
AE6 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE6 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE7 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE7 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE7 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE7 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE8 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE8 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AE9 1 HIS W  41  ? LEU W  43  ? HIS O 41  LEU O 43  
AE9 2 ILE W  113 ? LEU W  115 ? ILE O 113 LEU O 115 
AF1 1 ILE W  68  ? GLU W  74  ? ILE O 68  GLU O 74  
AF1 2 ARG W  86  ? ASN W  94  ? ARG O 86  ASN O 94  
AF1 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AF2 1 PHE X  31  ? ASP X  36  ? PHE I 31  ASP I 36  
AF2 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AF2 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AF2 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AF2 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AF2 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AF2 7 ILE X  108 ? LEU X  110 ? ILE I 108 LEU I 110 
AF3 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF3 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF3 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF3 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF3 5 PHE Y  89  ? VAL Y  93  ? PHE X 89  VAL X 93  
AF3 6 ALA Y  118 ? PRO Y  120 ? ALA X 118 PRO X 120 
AF4 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF4 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF5 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF5 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  174 ? O HIS 1 174 N VAL A  134 ? N VAL 1 134 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N CYS A  91  ? N CYS 1 91  
AA1 3 4 N ILE A  90  ? N ILE 1 90  O THR A  217 ? O THR 1 217 
AA2 1 2 O LEU A  266 ? O LEU 1 266 N LYS A  250 ? N LYS 1 250 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N ALA A  289 ? N ALA 1 289 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O GLN B  120 ? O GLN 2 120 N VAL B  82  ? N VAL 2 82  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O VAL C  11  ? O VAL 3 11  N VAL C  4   ? N VAL 3 4   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O VAL C  92  ? O VAL 3 92  N GLY C  53  ? N GLY 3 53  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N GLU C  250 ? N GLU 3 250 O THR C  269 ? O THR 3 269 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O VAL C  600 ? O VAL 3 600 N MET C  585 ? N MET 3 585 
AA8 4 5 O HIS C  586 ? O HIS 3 586 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  567 ? O TYR 3 567 N GLY C  342 ? N GLY 3 342 
AA8 6 7 N LEU C  343 ? N LEU 3 343 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O GLU C  466 ? O GLU 3 466 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O ALA C  449 ? O ALA 3 449 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N LEU C  397 ? N LEU 3 397 O ILE C  506 ? O ILE 3 506 
AA9 4 5 N LEU C  505 ? N LEU 3 505 O LEU C  533 ? O LEU 3 533 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 O VAL C  771 ? O VAL 3 771 N PHE C  692 ? N PHE 3 692 
AB2 2 3 N TYR C  693 ? N TYR 3 693 O LEU C  760 ? O LEU 3 760 
AB2 3 4 O TYR C  759 ? O TYR 3 759 N TRP C  717 ? N TRP 3 717 
AB2 4 5 N LEU C  716 ? N LEU 3 716 O VAL C  748 ? O VAL 3 748 
AB2 5 6 O VAL C  743 ? O VAL 3 743 N VAL C  736 ? N VAL 3 736 
AB2 6 7 N GLU C  737 ? N GLU 3 737 O ARG C  774 ? O ARG 3 774 
AB3 1 2 N LEU D  28  ? N LEU 4 28  O VAL D  45  ? O VAL 4 45  
AB3 2 3 N THR D  46  ? N THR 4 46  O GLU D  54  ? O GLU 4 54  
AB4 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB4 2 3 O GLY D  351 ? O GLY 4 351 N SER D  348 ? N SER 4 348 
AB5 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB5 2 3 N GLY D  354 ? N GLY 4 354 O ARG D  371 ? O ARG 4 371 
AB6 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB6 2 3 N VAL E  27  ? N VAL 5 27  O PHE E  89  ? O PHE 5 89  
AB6 3 4 O VAL E  94  ? O VAL 5 94  N PHE E  68  ? N PHE 5 68  
AB6 4 5 O VAL E  75  ? O VAL 5 75  N PHE E  48  ? N PHE 5 48  
AB7 1 2 N LEU E  101 ? N LEU 5 101 O VAL E  125 ? O VAL 5 125 
AB8 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB9 1 2 N ALA F  39  ? N ALA 6 39  O VAL F  77  ? O VAL 6 77  
AB9 2 3 N MET F  78  ? N MET 6 78  O ILE F  106 ? O ILE 6 106 
AB9 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AC1 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC2 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC3 1 2 N GLU G  71  ? N GLU 9 71  O VAL G  90  ? O VAL 9 90  
AC3 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC4 1 2 N ARG H  30  ? N ARG 7 30  O SER H  60  ? O SER 7 60  
AC4 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC4 3 4 N LEU H  69  ? N LEU 7 69  O ARG H  85  ? O ARG 7 85  
AC4 4 5 N LEU H  84  ? N LEU 7 84  O LEU H  93  ? O LEU 7 93  
AC4 5 6 N GLU H  98  ? N GLU 7 98  O GLY H  102 ? O GLY 7 102 
AC4 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC5 1 2 N VAL I  2   ? N VAL W 2   O ASP I  56  ? O ASP W 56  
AC5 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC5 3 4 O HIS I  51  ? O HIS W 51  N LYS I  30  ? N LYS W 30  
AC5 4 5 N VAL I  31  ? N VAL W 31  O TYR I  90  ? O TYR W 90  
AC5 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC6 1 2 N ALA M  53  ? N ALA L 53  O LEU M  69  ? O LEU L 69  
AC7 1 2 N LEU N  55  ? N LEU M 55  O VAL N  61  ? O VAL M 61  
AC8 1 2 O HIS Q  174 ? O HIS B 174 N VAL Q  134 ? N VAL B 134 
AC8 2 3 O TYR Q  131 ? O TYR B 131 N LEU Q  89  ? N LEU B 89  
AC8 3 4 N ILE Q  90  ? N ILE B 90  O THR Q  217 ? O THR B 217 
AC9 1 2 O LEU Q  266 ? O LEU B 266 N LYS Q  250 ? N LYS B 250 
AC9 2 3 N GLN Q  253 ? N GLN B 253 O VAL Q  328 ? O VAL B 328 
AC9 3 4 O ILE Q  329 ? O ILE B 329 N ILE Q  291 ? N ILE B 291 
AC9 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AD1 1 2 O VAL R  122 ? O VAL C 122 N VAL R  82  ? N VAL C 82  
AD1 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD2 1 2 O VAL S  13  ? O VAL D 13  N VAL S  2   ? N VAL D 2   
AD2 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD2 3 4 O ASP S  94  ? O ASP D 94  N ARG S  51  ? N ARG D 51  
AD2 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD3 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD3 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD4 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD5 1 2 N THR S  252 ? N THR D 252 O ALA S  267 ? O ALA D 267 
AD5 2 3 N ASP S  268 ? N ASP D 268 O ARG S  276 ? O ARG D 276 
AD6 1 2 O VAL S  318 ? O VAL D 318 N VAL S  311 ? N VAL D 311 
AD6 2 3 N LEU S  310 ? N LEU D 310 O VAL S  601 ? O VAL D 601 
AD6 3 4 O VAL S  600 ? O VAL D 600 N MET S  585 ? N MET D 585 
AD6 4 5 O VAL S  584 ? O VAL D 584 N TYR S  568 ? N TYR D 568 
AD6 5 6 O TYR S  567 ? O TYR D 567 N TYR S  344 ? N TYR D 344 
AD6 6 7 N LEU S  345 ? N LEU D 345 O ASP S  370 ? O ASP D 370 
AD7 1 2 O ILE S  464 ? O ILE D 464 N LEU S  450 ? N LEU D 450 
AD7 2 3 O ALA S  449 ? O ALA D 449 N VAL S  398 ? N VAL D 398 
AD7 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD7 4 5 N LEU S  505 ? N LEU D 505 O LEU S  533 ? O LEU D 533 
AD8 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AD9 1 2 O VAL S  771 ? O VAL D 771 N PHE S  692 ? N PHE D 692 
AD9 2 3 N ARG S  695 ? N ARG D 695 O ALA S  762 ? O ALA D 762 
AD9 3 4 O TYR S  759 ? O TYR D 759 N TRP S  717 ? N TRP D 717 
AD9 4 5 N LEU S  716 ? N LEU D 716 O VAL S  748 ? O VAL D 748 
AD9 5 6 O VAL S  743 ? O VAL D 743 N VAL S  736 ? N VAL D 736 
AD9 6 7 N GLU S  737 ? N GLU D 737 O ARG S  774 ? O ARG D 774 
AE1 1 2 N LEU T  28  ? N LEU E 28  O VAL T  45  ? O VAL E 45  
AE1 2 3 N THR T  46  ? N THR E 46  O GLU T  54  ? O GLU E 54  
AE2 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE2 2 3 O GLY T  351 ? O GLY E 351 N SER T  348 ? N SER E 348 
AE3 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE3 2 3 N VAL T  358 ? N VAL E 358 O ARG T  367 ? O ARG E 367 
AE4 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE4 2 3 N LEU U  25  ? N LEU F 25  O PHE U  89  ? O PHE F 89  
AE4 3 4 O VAL U  92  ? O VAL F 92  N VAL U  70  ? N VAL F 70  
AE4 4 5 O VAL U  75  ? O VAL F 75  N PHE U  48  ? N PHE F 48  
AE5 1 2 N LEU U  101 ? N LEU F 101 O GLU U  127 ? O GLU F 127 
AE6 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE7 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE7 2 3 N MET V  78  ? N MET G 78  O ILE V  106 ? O ILE G 106 
AE7 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE8 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AE9 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AF1 1 2 N TYR W  69  ? N TYR O 69  O GLU W  92  ? O GLU O 92  
AF1 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AF2 1 2 N ALA X  35  ? N ALA I 35  O THR X  56  ? O THR I 56  
AF2 2 3 N LEU X  59  ? N LEU I 59  O PHE X  67  ? O PHE I 67  
AF2 3 4 N LEU X  69  ? N LEU I 69  O ARG X  85  ? O ARG I 85  
AF2 4 5 N LEU X  84  ? N LEU I 84  O LEU X  93  ? O LEU I 93  
AF2 5 6 N GLU X  98  ? N GLU I 98  O GLY X  102 ? O GLY I 102 
AF2 6 7 N LEU X  103 ? N LEU I 103 O LEU X  110 ? O LEU I 110 
AF3 1 2 N VAL Y  2   ? N VAL X 2   O ASP Y  56  ? O ASP X 56  
AF3 2 3 O LEU Y  57  ? O LEU X 57  N LEU Y  50  ? N LEU X 50  
AF3 3 4 O HIS Y  51  ? O HIS X 51  N LYS Y  30  ? N LYS X 30  
AF3 4 5 N LEU Y  33  ? N LEU X 33  O ALA Y  92  ? O ALA X 92  
AF3 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF4 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF5 1 2 N LEU DA 55  ? N LEU U 55  O VAL DA 61  ? O VAL U 61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 8  'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 13 'binding site for residue FMN 1 502' 
AC3 Software 2 FES 201 ? 9  'binding site for residue FES 2 201' 
AC4 Software 3 SF4 801 ? 8  'binding site for residue SF4 3 801' 
AC5 Software 3 SF4 802 ? 5  'binding site for residue SF4 3 802' 
AC6 Software 3 SF4 803 ? 9  'binding site for residue SF4 3 803' 
AC7 Software 3 FES 804 ? 7  'binding site for residue FES 3 804' 
AC8 Software 4 HQH 501 ? 17 'binding site for residue HQH 4 501' 
AC9 Software 6 SF4 201 ? 10 'binding site for residue SF4 6 201' 
AD1 Software 9 SF4 201 ? 10 'binding site for residue SF4 9 201' 
AD2 Software 9 SF4 202 ? 12 'binding site for residue SF4 9 202' 
AD3 Software B SF4 501 ? 10 'binding site for residue SF4 B 501' 
AD4 Software B FMN 502 ? 14 'binding site for residue FMN B 502' 
AD5 Software C FES 201 ? 7  'binding site for residue FES C 201' 
AD6 Software D SF4 801 ? 8  'binding site for residue SF4 D 801' 
AD7 Software D SF4 802 ? 4  'binding site for residue SF4 D 802' 
AD8 Software D SF4 803 ? 9  'binding site for residue SF4 D 803' 
AD9 Software D FES 804 ? 7  'binding site for residue FES D 804' 
AE1 Software E HQH 501 ? 15 'binding site for residue HQH E 501' 
AE2 Software G SF4 201 ? 11 'binding site for residue SF4 G 201' 
AE3 Software O SF4 201 ? 10 'binding site for residue SF4 O 201' 
AE4 Software O SF4 202 ? 11 'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  PRO A  199 ? PRO 1 199 . ? 1_555 ? 
2   AC1 8  SER A  352 ? SER 1 352 . ? 1_555 ? 
3   AC1 8  CYS A  353 ? CYS 1 353 . ? 1_555 ? 
4   AC1 8  GLY A  354 ? GLY 1 354 . ? 1_555 ? 
5   AC1 8  LYS A  355 ? LYS 1 355 . ? 1_555 ? 
6   AC1 8  CYS A  356 ? CYS 1 356 . ? 1_555 ? 
7   AC1 8  CYS A  359 ? CYS 1 359 . ? 1_555 ? 
8   AC1 8  CYS A  400 ? CYS 1 400 . ? 1_555 ? 
9   AC2 13 GLY A  64  ? GLY 1 64  . ? 1_555 ? 
10  AC2 13 ARG A  65  ? ARG 1 65  . ? 1_555 ? 
11  AC2 13 GLY A  66  ? GLY 1 66  . ? 1_555 ? 
12  AC2 13 LYS A  75  ? LYS 1 75  . ? 1_555 ? 
13  AC2 13 ASN A  92  ? ASN 1 92  . ? 1_555 ? 
14  AC2 13 ASP A  94  ? ASP 1 94  . ? 1_555 ? 
15  AC2 13 SER A  96  ? SER 1 96  . ? 1_555 ? 
16  AC2 13 TYR A  180 ? TYR 1 180 . ? 1_555 ? 
17  AC2 13 GLY A  183 ? GLY 1 183 . ? 1_555 ? 
18  AC2 13 ILE A  218 ? ILE 1 218 . ? 1_555 ? 
19  AC2 13 ASN A  219 ? ASN 1 219 . ? 1_555 ? 
20  AC2 13 ASN A  220 ? ASN 1 220 . ? 1_555 ? 
21  AC2 13 THR A  223 ? THR 1 223 . ? 1_555 ? 
22  AC3 9  CYS B  83  ? CYS 2 83  . ? 1_555 ? 
23  AC3 9  THR B  85  ? THR 2 85  . ? 1_555 ? 
24  AC3 9  SER B  87  ? SER 2 87  . ? 1_555 ? 
25  AC3 9  CYS B  88  ? CYS 2 88  . ? 1_555 ? 
26  AC3 9  CYS B  124 ? CYS 2 124 . ? 1_555 ? 
27  AC3 9  LEU B  125 ? LEU 2 125 . ? 1_555 ? 
28  AC3 9  GLY B  126 ? GLY 2 126 . ? 1_555 ? 
29  AC3 9  SER B  127 ? SER 2 127 . ? 1_555 ? 
30  AC3 9  CYS B  128 ? CYS 2 128 . ? 1_555 ? 
31  AC4 8  HIS C  115 ? HIS 3 115 . ? 1_555 ? 
32  AC4 8  ASP C  118 ? ASP 3 118 . ? 1_555 ? 
33  AC4 8  CYS C  119 ? CYS 3 119 . ? 1_555 ? 
34  AC4 8  CYS C  122 ? CYS 3 122 . ? 1_555 ? 
35  AC4 8  CYS C  128 ? CYS 3 128 . ? 1_555 ? 
36  AC4 8  GLN C  131 ? GLN 3 131 . ? 1_555 ? 
37  AC4 8  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
38  AC4 8  GLY C  233 ? GLY 3 233 . ? 1_555 ? 
39  AC5 5  CYS C  181 ? CYS 3 181 . ? 1_555 ? 
40  AC5 5  CYS C  184 ? CYS 3 184 . ? 1_555 ? 
41  AC5 5  CYS C  187 ? CYS 3 187 . ? 1_555 ? 
42  AC5 5  CYS C  230 ? CYS 3 230 . ? 1_555 ? 
43  AC5 5  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
44  AC6 9  CYS C  256 ? CYS 3 256 . ? 1_555 ? 
45  AC6 9  LEU C  258 ? LEU 3 258 . ? 1_555 ? 
46  AC6 9  CYS C  259 ? CYS 3 259 . ? 1_555 ? 
47  AC6 9  VAL C  261 ? VAL 3 261 . ? 1_555 ? 
48  AC6 9  GLY C  262 ? GLY 3 262 . ? 1_555 ? 
49  AC6 9  CYS C  263 ? CYS 3 263 . ? 1_555 ? 
50  AC6 9  CYS C  291 ? CYS 3 291 . ? 1_555 ? 
51  AC6 9  GLY C  294 ? GLY 3 294 . ? 1_555 ? 
52  AC6 9  PRO C  407 ? PRO 3 407 . ? 1_555 ? 
53  AC7 7  CYS C  34  ? CYS 3 34  . ? 1_555 ? 
54  AC7 7  GLY C  43  ? GLY 3 43  . ? 1_555 ? 
55  AC7 7  CYS C  45  ? CYS 3 45  . ? 1_555 ? 
56  AC7 7  ARG C  46  ? ARG 3 46  . ? 1_555 ? 
57  AC7 7  MET C  47  ? MET 3 47  . ? 1_555 ? 
58  AC7 7  CYS C  48  ? CYS 3 48  . ? 1_555 ? 
59  AC7 7  CYS C  83  ? CYS 3 83  . ? 1_555 ? 
60  AC8 17 GLN D  33  ? GLN 4 33  . ? 1_555 ? 
61  AC8 17 HIS D  38  ? HIS 4 38  . ? 1_555 ? 
62  AC8 17 GLY D  39  ? GLY 4 39  . ? 1_555 ? 
63  AC8 17 VAL D  40  ? VAL 4 40  . ? 1_555 ? 
64  AC8 17 TYR D  87  ? TYR 4 87  . ? 1_555 ? 
65  AC8 17 THR D  135 ? THR 4 135 . ? 1_555 ? 
66  AC8 17 LEU D  138 ? LEU 4 138 . ? 1_555 ? 
67  AC8 17 LEU D  143 ? LEU 4 143 . ? 1_555 ? 
68  AC8 17 PRO D  402 ? PRO 4 402 . ? 1_555 ? 
69  AC8 17 VAL D  403 ? VAL 4 403 . ? 1_555 ? 
70  AC8 17 THR F  40  ? THR 6 40  . ? 1_555 ? 
71  AC8 17 GLY F  42  ? GLY 6 42  . ? 1_555 ? 
72  AC8 17 LEU F  43  ? LEU 6 43  . ? 1_555 ? 
73  AC8 17 MET F  51  ? MET 6 51  . ? 1_555 ? 
74  AC8 17 PHE F  68  ? PHE 6 68  . ? 1_555 ? 
75  AC8 17 GLU P  225 ? GLU H 225 . ? 1_555 ? 
76  AC8 17 GLN P  226 ? GLN H 226 . ? 1_555 ? 
77  AC9 10 ARG D  84  ? ARG 4 84  . ? 1_555 ? 
78  AC9 10 HIS D  169 ? HIS 4 169 . ? 1_555 ? 
79  AC9 10 CYS F  45  ? CYS 6 45  . ? 1_555 ? 
80  AC9 10 CYS F  46  ? CYS 6 46  . ? 1_555 ? 
81  AC9 10 ALA F  110 ? ALA 6 110 . ? 1_555 ? 
82  AC9 10 CYS F  111 ? CYS 6 111 . ? 1_555 ? 
83  AC9 10 PHE F  118 ? PHE 6 118 . ? 1_555 ? 
84  AC9 10 GLY F  139 ? GLY 6 139 . ? 1_555 ? 
85  AC9 10 CYS F  140 ? CYS 6 140 . ? 1_555 ? 
86  AC9 10 PRO F  141 ? PRO 6 141 . ? 1_555 ? 
87  AD1 10 HIS G  41  ? HIS 9 41  . ? 1_555 ? 
88  AD1 10 CYS G  63  ? CYS 9 63  . ? 1_555 ? 
89  AD1 10 ILE G  68  ? ILE 9 68  . ? 1_555 ? 
90  AD1 10 CYS G  98  ? CYS 9 98  . ? 1_555 ? 
91  AD1 10 ILE G  99  ? ILE 9 99  . ? 1_555 ? 
92  AD1 10 PHE G  100 ? PHE 9 100 . ? 1_555 ? 
93  AD1 10 CYS G  101 ? CYS 9 101 . ? 1_555 ? 
94  AD1 10 GLY G  102 ? GLY 9 102 . ? 1_555 ? 
95  AD1 10 LEU G  103 ? LEU 9 103 . ? 1_555 ? 
96  AD1 10 CYS G  104 ? CYS 9 104 . ? 1_555 ? 
97  AD2 12 CYS G  53  ? CYS 9 53  . ? 1_555 ? 
98  AD2 12 ILE G  54  ? ILE 9 54  . ? 1_555 ? 
99  AD2 12 GLY G  55  ? GLY 9 55  . ? 1_555 ? 
100 AD2 12 CYS G  56  ? CYS 9 56  . ? 1_555 ? 
101 AD2 12 SER G  57  ? SER 9 57  . ? 1_555 ? 
102 AD2 12 CYS G  59  ? CYS 9 59  . ? 1_555 ? 
103 AD2 12 TYR G  91  ? TYR 9 91  . ? 1_555 ? 
104 AD2 12 CYS G  108 ? CYS 9 108 . ? 1_555 ? 
105 AD2 12 PRO G  109 ? PRO 9 109 . ? 1_555 ? 
106 AD2 12 THR G  110 ? THR 9 110 . ? 1_555 ? 
107 AD2 12 ALA G  112 ? ALA 9 112 . ? 1_555 ? 
108 AD2 12 ILE G  113 ? ILE 9 113 . ? 1_555 ? 
109 AD3 10 PRO Q  199 ? PRO B 199 . ? 1_555 ? 
110 AD3 10 SER Q  352 ? SER B 352 . ? 1_555 ? 
111 AD3 10 CYS Q  353 ? CYS B 353 . ? 1_555 ? 
112 AD3 10 GLY Q  354 ? GLY B 354 . ? 1_555 ? 
113 AD3 10 LYS Q  355 ? LYS B 355 . ? 1_555 ? 
114 AD3 10 CYS Q  356 ? CYS B 356 . ? 1_555 ? 
115 AD3 10 CYS Q  359 ? CYS B 359 . ? 1_555 ? 
116 AD3 10 SER Q  398 ? SER B 398 . ? 1_555 ? 
117 AD3 10 PHE Q  399 ? PHE B 399 . ? 1_555 ? 
118 AD3 10 CYS Q  400 ? CYS B 400 . ? 1_555 ? 
119 AD4 14 GLY Q  64  ? GLY B 64  . ? 1_555 ? 
120 AD4 14 ARG Q  65  ? ARG B 65  . ? 1_555 ? 
121 AD4 14 GLY Q  66  ? GLY B 66  . ? 1_555 ? 
122 AD4 14 ALA Q  68  ? ALA B 68  . ? 1_555 ? 
123 AD4 14 LYS Q  75  ? LYS B 75  . ? 1_555 ? 
124 AD4 14 ASN Q  92  ? ASN B 92  . ? 1_555 ? 
125 AD4 14 ASP Q  94  ? ASP B 94  . ? 1_555 ? 
126 AD4 14 SER Q  96  ? SER B 96  . ? 1_555 ? 
127 AD4 14 GLY Q  183 ? GLY B 183 . ? 1_555 ? 
128 AD4 14 GLU Q  184 ? GLU B 184 . ? 1_555 ? 
129 AD4 14 ASN Q  219 ? ASN B 219 . ? 1_555 ? 
130 AD4 14 ASN Q  220 ? ASN B 220 . ? 1_555 ? 
131 AD4 14 THR Q  223 ? THR B 223 . ? 1_555 ? 
132 AD4 14 LEU Q  402 ? LEU B 402 . ? 1_555 ? 
133 AD5 7  CYS R  83  ? CYS C 83  . ? 1_555 ? 
134 AD5 7  CYS R  88  ? CYS C 88  . ? 1_555 ? 
135 AD5 7  CYS R  124 ? CYS C 124 . ? 1_555 ? 
136 AD5 7  LEU R  125 ? LEU C 125 . ? 1_555 ? 
137 AD5 7  GLY R  126 ? GLY C 126 . ? 1_555 ? 
138 AD5 7  SER R  127 ? SER C 127 . ? 1_555 ? 
139 AD5 7  CYS R  128 ? CYS C 128 . ? 1_555 ? 
140 AD6 8  HIS S  115 ? HIS D 115 . ? 1_555 ? 
141 AD6 8  ASP S  118 ? ASP D 118 . ? 1_555 ? 
142 AD6 8  CYS S  119 ? CYS D 119 . ? 1_555 ? 
143 AD6 8  CYS S  122 ? CYS D 122 . ? 1_555 ? 
144 AD6 8  GLY S  125 ? GLY D 125 . ? 1_555 ? 
145 AD6 8  CYS S  128 ? CYS D 128 . ? 1_555 ? 
146 AD6 8  GLN S  131 ? GLN D 131 . ? 1_555 ? 
147 AD6 8  ILE T  325 ? ILE E 325 . ? 1_555 ? 
148 AD7 4  CYS S  181 ? CYS D 181 . ? 1_555 ? 
149 AD7 4  CYS S  184 ? CYS D 184 . ? 1_555 ? 
150 AD7 4  CYS S  187 ? CYS D 187 . ? 1_555 ? 
151 AD7 4  CYS S  230 ? CYS D 230 . ? 1_555 ? 
152 AD8 9  CYS S  256 ? CYS D 256 . ? 1_555 ? 
153 AD8 9  LEU S  258 ? LEU D 258 . ? 1_555 ? 
154 AD8 9  CYS S  259 ? CYS D 259 . ? 1_555 ? 
155 AD8 9  VAL S  261 ? VAL D 261 . ? 1_555 ? 
156 AD8 9  GLY S  262 ? GLY D 262 . ? 1_555 ? 
157 AD8 9  CYS S  263 ? CYS D 263 . ? 1_555 ? 
158 AD8 9  ILE S  290 ? ILE D 290 . ? 1_555 ? 
159 AD8 9  CYS S  291 ? CYS D 291 . ? 1_555 ? 
160 AD8 9  ILE S  408 ? ILE D 408 . ? 1_555 ? 
161 AD9 7  LEU S  32  ? LEU D 32  . ? 1_555 ? 
162 AD9 7  CYS S  34  ? CYS D 34  . ? 1_555 ? 
163 AD9 7  CYS S  45  ? CYS D 45  . ? 1_555 ? 
164 AD9 7  ARG S  46  ? ARG D 46  . ? 1_555 ? 
165 AD9 7  MET S  47  ? MET D 47  . ? 1_555 ? 
166 AD9 7  CYS S  48  ? CYS D 48  . ? 1_555 ? 
167 AD9 7  CYS S  83  ? CYS D 83  . ? 1_555 ? 
168 AE1 15 GLN T  33  ? GLN E 33  . ? 1_555 ? 
169 AE1 15 HIS T  38  ? HIS E 38  . ? 1_555 ? 
170 AE1 15 GLY T  39  ? GLY E 39  . ? 1_555 ? 
171 AE1 15 TYR T  87  ? TYR E 87  . ? 1_555 ? 
172 AE1 15 LEU T  88  ? LEU E 88  . ? 1_555 ? 
173 AE1 15 THR T  135 ? THR E 135 . ? 1_555 ? 
174 AE1 15 LEU T  138 ? LEU E 138 . ? 1_555 ? 
175 AE1 15 ASP T  401 ? ASP E 401 . ? 1_555 ? 
176 AE1 15 PRO T  402 ? PRO E 402 . ? 1_555 ? 
177 AE1 15 GLY V  42  ? GLY G 42  . ? 1_555 ? 
178 AE1 15 LEU V  43  ? LEU G 43  . ? 1_555 ? 
179 AE1 15 MET V  51  ? MET G 51  . ? 1_555 ? 
180 AE1 15 PHE V  68  ? PHE G 68  . ? 1_555 ? 
181 AE1 15 GLU FA 225 ? GLU Q 225 . ? 1_555 ? 
182 AE1 15 GLN FA 226 ? GLN Q 226 . ? 1_555 ? 
183 AE2 11 ARG T  84  ? ARG E 84  . ? 1_555 ? 
184 AE2 11 CYS V  45  ? CYS G 45  . ? 1_555 ? 
185 AE2 11 CYS V  46  ? CYS G 46  . ? 1_555 ? 
186 AE2 11 GLY V  82  ? GLY G 82  . ? 1_555 ? 
187 AE2 11 ARG V  83  ? ARG G 83  . ? 1_555 ? 
188 AE2 11 ALA V  110 ? ALA G 110 . ? 1_555 ? 
189 AE2 11 CYS V  111 ? CYS G 111 . ? 1_555 ? 
190 AE2 11 PHE V  118 ? PHE G 118 . ? 1_555 ? 
191 AE2 11 GLY V  139 ? GLY G 139 . ? 1_555 ? 
192 AE2 11 CYS V  140 ? CYS G 140 . ? 1_555 ? 
193 AE2 11 PRO V  141 ? PRO G 141 . ? 1_555 ? 
194 AE3 10 HIS W  41  ? HIS O 41  . ? 1_555 ? 
195 AE3 10 CYS W  63  ? CYS O 63  . ? 1_555 ? 
196 AE3 10 ALA W  65  ? ALA O 65  . ? 1_555 ? 
197 AE3 10 ILE W  68  ? ILE O 68  . ? 1_555 ? 
198 AE3 10 CYS W  98  ? CYS O 98  . ? 1_555 ? 
199 AE3 10 ILE W  99  ? ILE O 99  . ? 1_555 ? 
200 AE3 10 PHE W  100 ? PHE O 100 . ? 1_555 ? 
201 AE3 10 CYS W  101 ? CYS O 101 . ? 1_555 ? 
202 AE3 10 GLY W  102 ? GLY O 102 . ? 1_555 ? 
203 AE3 10 CYS W  104 ? CYS O 104 . ? 1_555 ? 
204 AE4 11 CYS W  53  ? CYS O 53  . ? 1_555 ? 
205 AE4 11 ILE W  54  ? ILE O 54  . ? 1_555 ? 
206 AE4 11 GLY W  55  ? GLY O 55  . ? 1_555 ? 
207 AE4 11 CYS W  56  ? CYS O 56  . ? 1_555 ? 
208 AE4 11 SER W  57  ? SER O 57  . ? 1_555 ? 
209 AE4 11 CYS W  59  ? CYS O 59  . ? 1_555 ? 
210 AE4 11 VAL W  70  ? VAL O 70  . ? 1_555 ? 
211 AE4 11 TYR W  91  ? TYR O 91  . ? 1_555 ? 
212 AE4 11 CYS W  108 ? CYS O 108 . ? 1_555 ? 
213 AE4 11 PRO W  109 ? PRO O 109 . ? 1_555 ? 
214 AE4 11 ILE W  113 ? ILE O 113 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6Q8O 
_atom_sites.fract_transf_matrix[1][1]   0.010511 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001931 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002971 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003869 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? -30.581  -1.028  408.391 1.00 256.05 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? -30.780  -1.261  406.965 1.00 256.47 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? -29.703  -0.549  406.147 1.00 261.85 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? -29.229  0.521   406.532 1.00 263.82 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? -32.174  -0.782  406.507 1.00 252.00 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? -33.153  -1.140  407.491 1.00 250.37 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? -32.552  -1.418  405.177 1.00 250.36 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? -29.316  -1.154  405.024 1.00 264.58 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? -28.342  -0.574  404.130 1.00 266.89 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? -28.775  0.783   403.616 1.00 268.07 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? -29.957  1.016   403.340 1.00 269.57 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? -27.827  1.719   403.488 1.00 266.12 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? -28.213  3.099   403.163 1.00 262.07 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? -28.665  3.261   401.722 1.00 254.30 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? -27.833  3.417   400.824 1.00 253.75 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? -26.923  3.891   403.426 1.00 264.19 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? -26.113  3.012   404.344 1.00 265.93 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? -26.405  1.626   403.851 1.00 266.82 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? -29.984  3.288   401.515 1.00 246.64 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? -30.646  3.641   400.259 1.00 238.25 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? -32.089  3.994   400.595 1.00 229.67 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? -32.768  3.258   401.321 1.00 229.59 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? -30.593  2.506   399.212 1.00 239.00 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? -29.152  2.177   398.808 1.00 241.20 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? -31.405  2.871   397.975 1.00 238.25 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? -29.030  0.979   397.886 1.00 242.37 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? -32.567  5.122   400.080 1.00 221.58 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? -33.892  5.631   400.413 1.00 212.65 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? -34.872  5.212   399.324 1.00 198.28 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? -34.806  5.703   398.192 1.00 197.04 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? -33.836  7.144   400.600 1.00 217.07 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? -33.004  7.422   401.856 1.00 221.26 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? -32.718  8.892   402.075 1.00 222.81 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? -33.702  6.832   403.074 1.00 222.32 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? -35.773  4.288   399.669 1.00 185.15 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? -36.728  3.754   398.708 1.00 171.57 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? -38.132  3.608   399.284 1.00 159.91 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? -38.975  2.956   398.654 1.00 157.38 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? -36.246  2.400   398.173 1.00 170.23 ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? -34.922  2.490   397.675 1.00 168.21 ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? -38.416  4.181   400.451 1.00 152.29 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? -39.721  4.002   401.052 1.00 147.11 ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? -39.912  4.643   402.411 1.00 144.87 ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? -39.563  5.808   402.622 1.00 142.99 ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? -40.472  3.873   403.346 1.00 146.99 ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? -40.917  4.367   404.643 1.00 151.19 ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? -39.869  4.208   405.748 1.00 158.07 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? -40.229  4.126   406.930 1.00 160.65 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? -42.228  3.676   405.027 1.00 148.89 ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? -43.125  4.342   406.072 1.00 146.88 ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? -43.082  5.852   405.936 1.00 146.04 ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? -44.551  3.834   405.939 1.00 144.82 ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? -38.585  4.155   405.408 1.00 160.29 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? -37.566  4.089   406.447 1.00 158.77 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? -37.546  5.401   407.232 1.00 158.53 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? -37.605  6.483   406.639 1.00 159.79 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? -36.190  3.812   405.842 1.00 156.66 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? -35.284  3.035   406.783 1.00 154.50 ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? -35.745  2.020   407.343 1.00 153.05 ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? -34.117  3.436   406.971 1.00 154.89 ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? -37.464  5.339   408.566 1.00 155.71 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? -37.718  6.536   409.386 1.00 154.01 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? -36.665  7.627   409.275 1.00 154.72 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? -36.848  8.691   409.877 1.00 155.90 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? -37.768  5.972   410.813 1.00 153.94 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? -36.939  4.738   410.757 1.00 154.90 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? -37.134  4.161   409.386 1.00 155.41 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? -35.581  7.415   408.535 1.00 155.75 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? -34.564  8.446   408.369 1.00 158.58 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? -34.948  9.482   407.322 1.00 163.84 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? -34.151  10.385  407.043 1.00 167.30 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? -33.233  7.806   407.980 1.00 156.19 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? -33.403  6.541   407.170 1.00 154.21 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? -32.072  5.992   406.723 1.00 153.25 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? -32.242  4.946   405.724 1.00 153.20 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? -31.259  4.487   404.959 1.00 154.87 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? -30.038  4.985   405.089 1.00 156.35 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? -31.497  3.533   404.070 1.00 155.20 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? -36.139  9.371   406.741 1.00 163.51 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? -36.620  10.348  405.777 1.00 163.76 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? -37.131  11.598  406.483 1.00 159.46 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? -37.787  11.518  407.525 1.00 160.38 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? -37.727  9.736   404.917 1.00 168.05 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? -38.424  10.726  404.029 1.00 172.96 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? -37.738  11.354  403.001 1.00 175.73 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? -39.762  11.028  404.216 1.00 172.64 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? -38.371  12.266  402.180 1.00 175.14 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? -40.398  11.940  403.396 1.00 172.84 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? -39.702  12.559  402.378 1.00 174.12 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? -36.819  12.758  405.910 1.00 153.16 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? -37.233  14.048  406.446 1.00 146.86 ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? -38.351  14.624  405.589 1.00 146.58 ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? -38.150  14.890  404.400 1.00 143.98 ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? -36.070  15.040  406.498 1.00 142.87 ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? -35.161  14.915  407.701 1.00 141.88 ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? -34.185  16.075  407.802 1.00 143.32 ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? -33.308  16.200  406.922 1.00 144.26 ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? -34.303  16.870  408.756 1.00 143.67 ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? -39.522  14.819  406.191 1.00 148.58 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? -40.560  15.621  405.556 1.00 145.03 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? -40.103  17.073  405.564 1.00 143.74 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? -40.002  17.695  406.626 1.00 145.85 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? -41.894  15.453  406.277 1.00 140.79 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? -42.285  14.009  406.542 1.00 137.78 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? -42.981  13.436  405.320 1.00 137.01 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? -42.864  11.984  405.236 1.00 138.66 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? -43.724  11.203  404.591 1.00 139.43 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? -44.768  11.731  403.969 1.00 137.70 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? -43.536  9.891   404.562 1.00 140.66 ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? -39.825  17.619  404.381 1.00 139.25 ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? -39.285  18.968  404.263 1.00 138.68 ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? -40.218  19.915  403.529 1.00 137.52 ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? -40.456  21.032  404.001 1.00 141.13 ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? -37.925  18.921  403.543 1.00 140.28 ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? -37.082  17.944  404.165 1.00 140.55 ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? -37.247  20.276  403.603 1.00 142.98 ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? -40.763  19.493  402.390 1.00 131.46 ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? -41.544  20.387  401.543 1.00 124.12 ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? -42.977  20.503  402.053 1.00 118.03 ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? -43.433  21.592  402.418 1.00 118.21 ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? -41.502  19.884  400.097 1.00 121.04 ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? -40.070  19.675  399.593 1.00 117.24 ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? -40.026  19.359  398.107 1.00 115.93 ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? -39.197  20.883  399.909 1.00 116.38 ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? -43.697  19.385  402.090 1.00 112.25 ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? -45.086  19.338  402.530 1.00 111.21 ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? -45.227  19.205  404.041 1.00 112.24 ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? -46.335  18.943  404.521 1.00 110.96 ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? -45.825  18.189  401.836 1.00 113.64 ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? -46.781  18.650  400.757 1.00 120.42 ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? -46.314  19.218  399.584 1.00 122.17 ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? -48.154  18.522  400.916 1.00 124.20 ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? -47.188  19.645  398.600 1.00 121.80 ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? -49.035  18.951  399.936 1.00 123.55 ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? -48.544  19.512  398.781 1.00 120.44 ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? -49.407  19.935  397.798 1.00 116.47 ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? -44.136  19.360  404.794 1.00 116.11 ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? -44.191  19.204  406.245 1.00 118.66 ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? -45.213  20.149  406.868 1.00 122.24 ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? -46.120  19.716  407.587 1.00 124.16 ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? -42.803  19.433  406.845 1.00 116.64 ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? -45.085  21.448  406.603 1.00 122.22 ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? -45.968  22.434  407.216 1.00 121.94 ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? -47.333  22.510  406.540 1.00 125.24 ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? -48.140  23.374  406.898 1.00 127.08 ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? -45.313  23.817  407.179 1.00 120.25 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? -43.910  23.832  407.695 1.00 121.38 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? -42.896  24.526  407.069 1.00 122.53 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? -43.342  23.207  408.753 1.00 122.74 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? -41.769  24.348  407.733 1.00 123.37 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? -42.011  23.547  408.755 1.00 123.59 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? -47.607  21.626  405.583 1.00 125.26 ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? -48.862  21.670  404.843 1.00 124.42 ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? -50.010  21.184  405.719 1.00 124.76 ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? -49.894  20.178  406.433 1.00 127.73 ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? -48.735  20.846  403.551 1.00 122.52 ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? -50.097  20.529  402.973 1.00 122.29 ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? -47.896  21.610  402.535 1.00 120.13 ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? -51.128  21.911  405.677 1.00 122.21 ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? -52.332  21.578  406.398 1.00 122.28 ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? -52.488  22.302  407.718 1.00 124.07 ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? -53.619  22.505  408.174 1.00 124.17 ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? -51.382  22.693  408.340 1.00 126.37 ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? -51.452  23.408  409.604 1.00 130.96 ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? -52.112  24.762  409.392 1.00 134.81 ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? -51.736  25.508  408.483 1.00 134.87 ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? -50.051  23.592  410.182 1.00 131.88 ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? -49.260  22.307  410.332 1.00 132.50 ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? -49.987  21.296  411.191 1.00 131.10 ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? -49.027  20.230  411.691 1.00 129.15 ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? -49.522  19.570  412.929 1.00 127.71 ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? -53.122  25.070  410.197 1.00 136.39 ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? -53.683  26.409  410.153 1.00 131.70 ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? -52.627  27.396  410.629 1.00 125.92 ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? -51.859  27.111  411.551 1.00 126.66 ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? -54.950  26.503  411.001 1.00 132.19 ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? -55.693  27.813  410.822 1.00 132.95 ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? -56.760  28.024  411.868 1.00 136.09 ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? -56.667  27.403  412.947 1.00 140.22 ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? -57.696  28.809  411.612 1.00 141.01 ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? -52.584  28.559  409.992 1.00 120.78 ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? -51.526  29.501  410.281 1.00 117.67 ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? -50.168  29.087  409.764 1.00 116.71 ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? -49.166  29.706  410.133 1.00 114.84 ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? -50.102  28.044  408.929 1.00 116.60 ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? -48.851  27.666  408.282 1.00 114.06 ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? -48.410  28.696  407.257 1.00 119.94 ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? -47.240  28.698  406.863 1.00 125.20 ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? -48.976  26.303  407.605 1.00 105.62 ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? -50.203  26.192  406.906 1.00 102.51 ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? -49.319  29.569  406.820 1.00 121.14 ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? -48.972  30.656  405.918 1.00 124.43 ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? -48.525  31.906  406.655 1.00 123.55 ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? -48.094  32.867  406.008 1.00 120.41 ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? -50.155  31.016  405.007 1.00 127.86 ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? -51.402  31.434  405.739 1.00 126.51 ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? -51.701  32.685  406.198 1.00 120.99 ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? -52.533  30.611  406.057 1.00 125.91 ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? -52.934  32.685  406.802 1.00 119.48 ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? -53.467  31.425  406.727 1.00 122.82 ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? -52.842  29.264  405.849 1.00 122.85 ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? -54.686  30.938  407.190 1.00 121.13 ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? -54.055  28.782  406.310 1.00 119.00 ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? -54.961  29.617  406.971 1.00 118.92 ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? -48.614  31.926  407.982 1.00 126.15 ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? -48.025  33.025  408.725 1.00 126.77 ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? -46.517  32.941  408.560 1.00 126.14 ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? -45.923  31.876  408.757 1.00 123.94 ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? -48.403  32.960  410.207 1.00 127.81 ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? -48.013  31.695  410.753 1.00 127.82 ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? -49.899  33.132  410.395 1.00 129.41 ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? -45.899  34.054  408.161 1.00 127.11 ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? -44.450  34.062  408.012 1.00 127.97 ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? -43.775  33.605  409.294 1.00 127.76 ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? -42.747  32.922  409.251 1.00 124.23 ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? -43.974  35.460  407.615 1.00 130.52 ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? -42.457  35.628  407.575 1.00 134.82 ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? -41.859  34.652  406.586 1.00 136.25 ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? -42.076  37.055  407.221 1.00 136.17 ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? -44.376  33.932  410.439 1.00 132.89 ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? -43.836  33.530  411.731 1.00 138.96 ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? -43.807  32.015  411.877 1.00 138.24 ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? -42.908  31.473  412.529 1.00 140.16 ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? -44.657  34.167  412.851 1.00 143.84 ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? -44.682  35.680  412.760 1.00 146.36 ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? -45.309  36.207  411.816 1.00 146.36 ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? -44.070  36.344  413.624 1.00 147.32 ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? -44.800  31.322  411.316 1.00 133.53 ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? -44.793  29.864  411.340 1.00 128.75 ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? -43.555  29.326  410.635 1.00 121.95 ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? -42.801  28.525  411.200 1.00 118.58 ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? -46.072  29.325  410.699 1.00 131.08 ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? -46.227  27.828  410.784 1.00 133.37 ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? -45.574  26.987  409.898 1.00 133.20 ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? -47.015  27.254  411.768 1.00 134.46 ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? -45.711  25.623  409.985 1.00 133.36 ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? -47.155  25.887  411.862 1.00 134.74 ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? -46.501  25.077  410.966 1.00 133.96 ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? -46.631  23.714  411.053 1.00 134.55 ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? -43.345  29.745  409.385 1.00 122.29 ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? -42.145  29.355  408.651 1.00 128.36 ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? -40.882  29.757  409.401 1.00 129.78 ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? -39.848  29.090  409.282 1.00 129.58 ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? -42.168  29.968  407.248 1.00 130.85 ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? -41.045  29.501  406.348 1.00 126.43 ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? -40.941  28.172  405.969 1.00 124.33 ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? -40.108  30.395  405.855 1.00 120.44 ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? -39.916  27.744  405.147 1.00 121.00 ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? -39.087  29.977  405.023 1.00 117.36 ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? -38.994  28.649  404.677 1.00 119.01 ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? -37.978  28.218  403.856 1.00 119.20 ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? -40.951  30.839  410.177 1.00 129.06 ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? -39.811  31.264  410.982 1.00 125.80 ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? -39.512  30.250  412.079 1.00 119.96 ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? -38.360  29.843  412.265 1.00 121.82 ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? -40.087  32.641  411.585 1.00 127.24 ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? -40.139  33.814  410.605 1.00 128.25 ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? -40.309  35.141  411.337 1.00 127.90 ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? -38.904  33.827  409.717 1.00 129.18 ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? -40.541  29.838  412.822 1.00 112.48 ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? -40.341  28.936  413.951 1.00 111.75 ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? -39.791  27.581  413.528 1.00 119.33 ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? -39.290  26.837  414.380 1.00 125.66 ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? -41.647  28.730  414.720 1.00 108.21 ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? -41.874  29.728  415.844 1.00 109.89 ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? -43.334  30.134  415.940 1.00 118.31 ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? -44.194  28.964  416.102 1.00 127.23 ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? -45.520  28.988  416.015 1.00 131.65 ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? -46.154  30.126  415.774 1.00 134.77 ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? -46.214  27.870  416.177 1.00 130.94 ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? -39.868  27.237  412.245 1.00 117.89 ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? -39.443  25.929  411.771 1.00 115.61 ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? -38.095  25.968  411.065 1.00 114.73 ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? -37.707  24.979  410.437 1.00 116.26 ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? -40.500  25.355  410.829 1.00 114.55 ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? -41.744  24.900  411.525 1.00 117.22 ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? -42.741  25.771  411.910 1.00 118.19 ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? -42.152  23.667  411.906 1.00 116.88 ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? -43.707  25.093  412.503 1.00 118.02 ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? -43.376  23.815  412.511 1.00 116.70 ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? -37.374  27.078  411.155 1.00 112.66 ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? -36.046  27.175  410.592 1.00 110.96 ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? -35.987  27.786  409.212 1.00 106.33 ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? -35.002  27.567  408.500 1.00 106.50 ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? -37.009  28.532  408.811 1.00 106.10 ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? -37.025  29.108  407.487 1.00 109.87 ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? -36.059  30.263  407.322 1.00 110.77 ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? -35.603  30.882  408.283 1.00 110.93 ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? -35.741  30.539  406.057 1.00 111.55 ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? -34.972  31.688  405.584 1.00 113.26 ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? -33.507  31.652  405.990 1.00 116.54 ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? -32.748  32.541  405.587 1.00 107.24 ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? -35.592  33.017  406.031 1.00 113.77 ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? -36.749  33.415  405.155 1.00 118.10 ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? -36.540  33.826  403.849 1.00 117.19 ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? -38.051  33.345  405.618 1.00 123.82 ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? -37.595  34.180  403.036 1.00 118.87 ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? -39.111  33.695  404.810 1.00 125.45 ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? -38.878  34.113  403.520 1.00 123.13 ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? -39.930  34.465  402.708 1.00 123.94 ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? -33.078  30.660  406.770 1.00 100.82 ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? -31.676  30.575  407.158 1.00 98.03  ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? -30.802  30.243  405.957 1.00 94.57  ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? -29.652  30.699  405.872 1.00 92.61  ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? -31.511  29.529  408.257 1.00 97.11  ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? -31.298  30.114  409.637 1.00 96.32  ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? -30.889  29.068  410.641 1.00 101.13 ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? -31.361  27.919  410.524 1.00 104.11 ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? -30.116  29.398  411.561 1.00 103.92 ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? -31.339  29.443  405.032 1.00 95.56  ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? -30.572  28.979  403.883 1.00 102.83 ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? -30.129  30.144  403.007 1.00 108.34 ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? -28.987  30.180  402.538 1.00 106.78 ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? -31.410  27.990  403.072 1.00 107.04 ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? -32.074  27.086  403.963 1.00 109.55 ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? -30.538  27.194  402.130 1.00 107.32 ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? -31.027  31.096  402.755 1.00 111.93 ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? -30.637  32.274  401.990 1.00 108.74 ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? -29.543  33.054  402.711 1.00 106.87 ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? -28.558  33.472  402.092 1.00 105.55 ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? -31.852  33.162  401.727 1.00 105.50 ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? -29.697  33.252  404.023 1.00 107.13 ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? -28.713  34.022  404.781 1.00 107.17 ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? -27.328  33.395  404.695 1.00 102.15 ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? -26.329  34.104  404.529 1.00 96.54  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? -29.146  34.147  406.241 1.00 111.33 ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? -28.172  34.940  407.101 1.00 108.23 ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? -28.622  34.992  408.552 1.00 102.27 ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? -29.663  36.074  408.766 1.00 95.71  ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? -29.788  36.447  410.200 1.00 91.47  ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? -27.242  32.068  404.811 1.00 102.80 ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? -25.935  31.426  404.696 1.00 102.91 ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? -25.403  31.508  403.267 1.00 102.22 ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? -24.270  31.955  403.047 1.00 98.93  ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? -26.000  29.973  405.183 1.00 103.77 ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? -27.107  29.153  404.568 1.00 103.43 ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? -27.050  27.690  404.940 1.00 102.77 ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? -25.918  27.019  404.311 1.00 104.07 ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? -25.675  25.720  404.428 1.00 110.61 ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? -26.501  24.956  405.129 1.00 113.25 ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? -24.630  25.179  403.822 1.00 114.76 ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? -26.207  31.091  402.279 1.00 105.14 ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? -25.704  30.957  400.912 1.00 104.93 ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? -25.291  32.307  400.337 1.00 108.77 ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? -24.218  32.434  399.737 1.00 107.10 ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? -26.752  30.264  400.018 1.00 99.86  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? -26.255  30.181  398.582 1.00 96.63  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? -27.057  28.863  400.533 1.00 100.79 ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? -26.114  33.343  400.532 1.00 117.02 ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? -25.908  34.603  399.819 1.00 126.90 ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? -24.553  35.232  400.126 1.00 131.57 ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? -23.947  35.863  399.253 1.00 133.38 ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? -27.044  35.569  400.152 1.00 131.22 ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? -28.334  35.256  399.393 1.00 134.27 ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? -29.465  36.181  399.804 1.00 136.84 ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? -28.100  35.330  397.899 1.00 133.52 ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? -24.063  35.084  401.357 1.00 131.88 ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? -22.776  35.659  401.722 1.00 129.38 ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? -21.642  34.644  401.779 1.00 129.29 ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? -20.476  35.043  401.675 1.00 129.57 ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? -22.873  36.395  403.064 1.00 126.65 ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? -24.238  36.999  403.325 1.00 127.15 ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? -24.126  38.203  404.243 1.00 129.21 ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? -25.473  38.585  404.827 1.00 130.66 ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? -25.323  39.386  406.072 1.00 130.19 ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? -21.940  33.353  401.931 1.00 127.66 ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? -20.881  32.352  402.002 1.00 124.09 ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? -20.613  31.750  400.627 1.00 113.07 ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? -19.497  31.838  400.106 1.00 109.46 ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? -21.255  31.254  403.002 1.00 131.39 ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? -21.437  31.746  404.420 1.00 137.38 ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? -22.071  30.703  405.312 1.00 144.88 ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? -22.539  29.674  404.783 1.00 148.42 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? -22.108  30.915  406.541 1.00 147.44 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? -21.630  31.143  400.032 1.00 110.63 ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? -21.477  30.450  398.764 1.00 115.42 ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? -21.690  31.422  397.612 1.00 131.03 ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? -22.625  32.226  397.626 1.00 135.31 ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? -22.470  29.291  398.668 1.00 108.39 ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? -22.183  28.161  399.637 1.00 100.29 ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? -23.229  27.074  399.540 1.00 85.92  ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? -22.922  25.941  400.493 1.00 85.93  ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? -21.664  25.250  400.116 1.00 87.87  ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? -20.833  31.337  396.620 1.00 139.13 ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? -20.987  32.159  395.433 1.00 141.52 ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? -21.915  31.464  394.444 1.00 133.41 ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? -22.207  30.273  394.592 1.00 133.02 ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? -19.619  32.433  394.801 1.00 147.70 ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? -18.992  31.199  394.439 1.00 151.62 ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? -18.722  33.191  395.773 1.00 148.04 ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? -22.443  32.183  393.446 1.00 123.68 ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? -23.386  31.531  392.522 1.00 117.61 ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? -22.800  30.293  391.870 1.00 112.80 ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? -23.488  29.273  391.741 1.00 109.95 ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? -23.686  32.631  391.497 1.00 118.99 ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? -23.388  33.900  392.205 1.00 120.16 ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? -22.246  33.605  393.109 1.00 120.26 ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? -21.533  30.358  391.457 1.00 112.46 ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? -20.869  29.181  390.910 1.00 109.21 ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? -20.848  28.037  391.915 1.00 102.26 ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? -20.940  26.868  391.525 1.00 105.10 ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? -19.442  29.540  390.490 1.00 112.20 ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? -19.392  30.320  389.189 1.00 114.50 ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? -19.896  29.815  388.165 1.00 114.66 ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? -18.840  31.440  389.194 1.00 115.13 ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? -20.754  28.352  393.209 1.00 97.84  ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? -20.715  27.308  394.229 1.00 102.16 ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? -22.043  26.562  394.310 1.00 107.52 ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? -22.070  25.327  394.280 1.00 105.20 ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? -20.348  27.910  395.586 1.00 98.76  ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? -18.909  28.380  395.688 1.00 95.71  ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? -18.542  28.814  397.088 1.00 96.63  ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? -18.997  28.165  398.053 1.00 98.58  ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? -17.800  29.806  397.224 1.00 96.47  ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? -23.160  27.292  394.390 1.00 110.97 ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? -24.455  26.618  394.454 1.00 106.77 ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? -24.767  25.944  393.126 1.00 108.76 ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? -25.463  24.923  393.090 1.00 110.91 ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? -25.569  27.601  394.874 1.00 98.68  ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? -25.685  28.754  393.894 1.00 95.95  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? -26.911  26.879  395.024 1.00 95.13  ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? -24.222  26.461  392.023 1.00 108.87 ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? -24.448  25.837  390.721 1.00 108.58 ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? -23.744  24.487  390.652 1.00 116.56 ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? -24.334  23.483  390.238 1.00 119.52 ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? -23.999  26.775  389.587 1.00 101.74 ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? -25.018  27.899  389.395 1.00 92.41  ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? -23.817  26.001  388.287 1.00 104.86 ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? -24.621  28.920  388.355 1.00 88.67  ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? -22.466  24.445  391.045 1.00 120.17 ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? -21.772  23.167  391.172 1.00 125.07 ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? -22.469  22.258  392.172 1.00 125.44 ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? -22.504  21.036  391.985 1.00 123.07 ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? -20.317  23.388  391.592 1.00 128.23 ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? -19.309  23.392  390.454 1.00 132.10 ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? -19.129  22.015  389.840 1.00 134.99 ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? -19.735  21.748  388.783 1.00 136.80 ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? -18.388  21.193  390.416 1.00 134.15 ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? -23.049  22.834  393.226 1.00 128.58 ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? -23.744  22.027  394.224 1.00 129.64 ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? -24.968  21.348  393.622 1.00 118.95 ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? -25.205  20.160  393.861 1.00 117.64 ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? -24.130  22.886  395.426 1.00 136.20 ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? -24.420  22.061  396.664 1.00 139.76 ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? -23.153  21.674  397.397 1.00 140.60 ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? -22.203  22.485  397.405 1.00 140.88 ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? -23.088  20.556  397.942 1.00 141.07 ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? -25.773  22.091  392.856 1.00 109.58 ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? -26.949  21.484  392.241 1.00 101.65 ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? -26.530  20.525  391.130 1.00 105.69 ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? -27.203  19.515  390.891 1.00 109.29 ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? -27.932  22.556  391.729 1.00 92.63  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? -29.247  21.915  391.314 1.00 88.93  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? -28.204  23.590  392.807 1.00 88.26  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? -25.427  20.815  390.429 1.00 104.04 ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? -24.878  19.833  389.497 1.00 102.75 ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? -24.571  18.527  390.212 1.00 109.60 ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? -24.824  17.439  389.682 1.00 116.72 ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? -23.608  20.364  388.827 1.00 95.90  ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? -23.191  19.550  387.608 1.00 92.25  ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? -21.855  19.995  387.021 1.00 90.48  ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? -21.905  21.384  386.422 1.00 91.99  ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? -20.690  21.636  385.598 1.00 92.13  ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? -24.020  18.620  391.422 1.00 110.76 ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? -23.740  17.429  392.213 1.00 117.73 ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? -25.018  16.797  392.746 1.00 116.06 ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? -25.057  15.584  392.983 1.00 112.99 ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? -22.810  17.786  393.373 1.00 126.29 ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? -21.363  18.009  392.972 1.00 131.25 ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? -20.520  18.395  394.175 1.00 133.09 ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? -19.605  19.488  393.868 1.00 133.63 ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? -18.385  19.605  394.381 1.00 135.12 ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? -17.933  18.692  395.228 1.00 136.09 ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? -17.618  20.633  394.047 1.00 135.72 ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? -26.069  17.599  392.935 1.00 117.79 ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? -27.336  17.094  393.449 1.00 118.65 ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? -27.943  16.020  392.561 1.00 126.81 ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? -28.772  15.239  393.038 1.00 130.31 ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? -28.335  18.244  393.615 1.00 108.89 ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? -28.766  18.749  392.361 1.00 101.91 ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? -27.555  15.957  391.291 1.00 154.19 ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? -28.187  15.013  390.397 1.00 158.18 ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? -29.637  15.329  390.131 1.00 161.22 ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? -30.383  14.457  389.681 1.00 162.21 ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? -30.056  16.562  390.400 1.00 160.72 ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? -31.455  16.937  390.268 1.00 159.96 ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? -31.825  17.056  388.798 1.00 157.69 ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? -31.304  17.919  388.083 1.00 159.77 ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? -31.713  18.252  390.996 1.00 162.08 ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? -33.080  18.912  390.816 1.00 166.26 ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? -34.199  17.941  391.144 1.00 166.27 ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? -33.180  20.157  391.682 1.00 169.11 ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? -32.725  16.192  388.350 1.00 152.21 ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? -33.277  16.291  387.012 1.00 147.23 ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? -34.518  17.173  387.029 1.00 140.70 ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? -35.143  17.393  388.069 1.00 138.54 ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? -33.613  14.909  386.450 1.00 151.66 ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? -32.394  14.067  386.094 1.00 154.85 ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? -32.802  12.702  385.558 1.00 154.66 ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? -32.960  12.727  384.106 1.00 153.86 ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? -33.320  11.682  383.369 1.00 150.45 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? -33.547  10.510  383.942 1.00 149.44 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? -33.444  11.805  382.054 1.00 148.82 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? -34.852  17.701  385.857 1.00 139.35 ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? -35.996  18.577  385.715 1.00 140.48 ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? -37.286  18.006  386.263 1.00 140.37 ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? -37.748  16.952  385.814 1.00 137.81 ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? -37.875  18.697  387.237 1.00 143.91 ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? -39.109  18.254  387.872 1.00 147.97 ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? -40.353  18.675  387.107 1.00 148.99 ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? -41.460  18.300  387.504 1.00 151.68 ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? -39.196  18.790  389.306 1.00 151.97 ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? -38.176  18.218  390.275 1.00 157.88 ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? -38.454  16.743  390.522 1.00 165.17 ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? -37.235  15.966  390.704 1.00 172.11 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? -36.701  15.697  391.891 1.00 178.30 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? -37.282  16.149  392.995 1.00 181.30 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? -35.589  14.981  391.976 1.00 179.96 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? -40.206  19.441  386.028 1.00 147.77 ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? -41.352  19.767  385.208 1.00 149.69 ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? -41.825  18.645  384.316 1.00 154.31 ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? -42.879  18.770  383.686 1.00 154.21 ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? -41.076  17.549  384.258 1.00 160.62 ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? -41.362  16.431  383.379 1.00 166.10 ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? -40.289  16.163  382.348 1.00 170.19 ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? -40.243  15.058  381.787 1.00 171.70 ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? -39.418  17.136  382.078 1.00 171.80 ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? -38.344  16.929  381.114 1.00 172.52 ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? -37.287  15.985  381.673 1.00 167.27 ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? -37.003  14.931  381.093 1.00 164.73 ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? -37.724  18.273  380.726 1.00 175.87 ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? -36.697  16.348  382.805 1.00 164.41 ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? -35.631  15.574  383.396 1.00 161.52 ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? -34.228  16.032  383.074 1.00 157.99 ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? -33.276  15.311  383.390 1.00 161.37 ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? -34.063  17.176  382.433 1.00 151.73 ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? -32.689  17.588  382.185 1.00 151.63 ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? -32.098  18.169  383.471 1.00 149.59 ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? -32.781  18.900  384.192 1.00 151.30 ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? -32.620  18.602  381.043 1.00 158.37 ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? -31.378  18.474  380.195 1.00 163.05 ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? -30.227  19.183  380.497 1.00 163.85 ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? -31.360  17.615  379.106 1.00 162.76 ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? -29.089  19.047  379.718 1.00 161.44 ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? -30.227  17.476  378.326 1.00 160.75 ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? -29.091  18.192  378.632 1.00 159.76 ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? -30.843  17.854  383.785 1.00 145.58 ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? -30.244  18.337  385.041 1.00 140.80 ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? -30.145  19.855  385.101 1.00 130.63 ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? -29.457  20.484  384.294 1.00 127.49 ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? -28.858  17.681  385.039 1.00 145.11 ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? -29.024  16.472  384.168 1.00 147.37 ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? -29.952  16.916  383.081 1.00 147.25 ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? -30.856  20.441  386.073 1.00 126.71 ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? -30.916  21.894  386.214 1.00 122.86 ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? -29.540  22.509  386.431 1.00 121.44 ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? -29.347  23.695  386.138 1.00 112.66 ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? -31.837  22.283  387.375 1.00 120.17 ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? -31.095  22.274  388.600 1.00 114.32 ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? -33.002  21.311  387.497 1.00 113.04 ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? -28.582  21.731  386.928 1.00 112.57 ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? -27.234  22.216  387.131 1.00 112.46 ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? -26.585  22.567  385.810 1.00 112.34 ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? -26.139  23.701  385.608 1.00 112.32 ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? -26.512  21.594  384.900 1.00 114.00 ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? -25.981  21.873  383.570 1.00 115.12 ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? -26.839  22.902  382.842 1.00 114.75 ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? -26.327  23.675  382.022 1.00 116.22 ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? -25.882  20.576  382.766 1.00 121.56 ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? -25.282  20.660  381.364 1.00 130.76 ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? -23.785  20.890  381.454 1.00 131.63 ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? -25.582  19.399  380.569 1.00 136.80 ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? -28.144  22.925  383.129 1.00 116.70 ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? -29.014  23.975  382.609 1.00 117.73 ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? -28.485  25.356  382.968 1.00 118.31 ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? -28.347  26.230  382.104 1.00 115.36 ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? -30.431  23.806  383.156 1.00 112.63 ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? -31.425  24.794  382.580 1.00 112.74 ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? -32.768  24.705  383.285 1.00 114.48 ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? -33.877  25.296  382.433 1.00 113.00 ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? -35.172  25.331  383.161 1.00 113.17 ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? -28.190  25.574  384.250 1.00 122.49 ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? -27.621  26.851  384.665 1.00 126.32 ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? -26.236  27.053  384.070 1.00 123.35 ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? -25.843  28.188  383.780 1.00 116.48 ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? -27.568  26.941  386.191 1.00 132.15 ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? -28.916  26.897  386.841 1.00 136.18 ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? -30.120  26.806  386.213 1.00 137.01 ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? -29.200  26.955  388.245 1.00 137.50 ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? -31.136  26.795  387.134 1.00 137.32 ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? -30.597  26.887  388.389 1.00 135.44 ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? -28.410  27.055  389.392 1.00 138.56 ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? -31.221  26.917  389.632 1.00 131.67 ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? -29.032  27.084  390.626 1.00 135.00 ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? -30.422  27.017  390.735 1.00 131.27 ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? -25.485  25.967  383.881 1.00 128.70 ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? -24.193  26.085  383.221 1.00 132.21 ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? -24.336  26.482  381.759 1.00 132.29 ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? -23.341  26.874  381.141 1.00 130.59 ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? -23.414  24.772  383.328 1.00 134.31 ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? -23.691  23.923  382.229 1.00 136.76 ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? -25.544  26.388  381.194 1.00 134.26 ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? -25.794  26.955  379.875 1.00 135.47 ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? -26.078  28.449  379.922 1.00 136.76 ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? -26.004  29.109  378.880 1.00 138.41 ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? -26.983  26.282  379.181 1.00 135.31 ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? -26.702  24.900  378.677 1.00 134.95 ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? -25.426  24.535  378.292 1.00 137.86 ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? -27.728  23.984  378.532 1.00 132.23 ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? -25.171  23.267  377.810 1.00 137.58 ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? -27.478  22.717  378.049 1.00 133.99 ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? -26.198  22.360  377.687 1.00 136.21 ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? -26.398  28.998  381.090 1.00 138.20 ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? -26.777  30.395  381.157 1.00 144.24 ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? -25.571  31.297  380.909 1.00 137.03 ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? -24.425  30.878  381.080 1.00 138.85 ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? -27.409  30.702  382.509 1.00 158.78 ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? -28.798  30.131  382.655 1.00 171.86 ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? -29.981  31.262  381.902 1.00 181.84 ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? -29.594  32.782  382.768 1.00 180.48 ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? -25.809  32.547  380.497 1.00 129.52 ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? -24.675  33.418  380.149 1.00 133.53 ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? -23.714  33.641  381.301 1.00 135.22 ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? -22.497  33.699  381.085 1.00 140.59 ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? -25.368  34.717  379.714 1.00 132.72 ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? -26.696  34.256  379.207 1.00 127.34 ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? -27.096  33.192  380.181 1.00 124.03 ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? -24.243  33.808  382.516 1.00 127.87 ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? -23.476  33.894  383.755 1.00 122.91 ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? -22.738  35.227  383.846 1.00 121.37 ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? -22.221  35.580  384.910 1.00 118.02 ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? -22.499  32.716  383.859 1.00 122.61 ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? -21.971  32.427  385.251 1.00 123.74 ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? -21.305  31.059  385.298 1.00 123.12 ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? -22.255  29.985  385.809 1.00 112.16 ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? -23.404  29.741  384.890 1.00 112.21 ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? -22.701  35.973  382.739 1.00 126.80 ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? -22.263  37.365  382.707 1.00 131.27 ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? -22.638  38.032  381.389 1.00 137.83 ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? -22.159  37.623  380.327 1.00 137.98 ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? -20.752  37.477  382.926 1.00 127.08 ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? -20.351  38.813  383.527 1.00 118.92 ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? -20.730  39.860  382.963 1.00 114.59 ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? -19.656  38.820  384.564 1.00 117.35 ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? -23.499  39.049  381.444 1.00 141.59 ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? -23.808  39.861  380.268 1.00 139.46 ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? -23.860  41.357  380.530 1.00 127.15 ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? -23.671  42.130  379.586 1.00 118.17 ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? -25.143  39.428  379.651 1.00 145.76 ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? -26.308  39.591  380.607 1.00 150.98 ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? -26.077  39.868  381.802 1.00 153.93 ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? -27.464  39.448  380.166 1.00 152.31 ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? -24.088  41.802  381.764 1.00 127.35 ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? -24.444  43.172  382.049 1.00 130.79 ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? -25.915  43.488  381.906 1.00 135.94 ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? -26.388  44.453  382.516 1.00 138.73 ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? -26.660  42.705  381.131 1.00 138.14 ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? -28.094  42.917  381.023 1.00 138.65 ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? -28.824  42.297  382.209 1.00 135.67 ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? -28.322  41.399  382.892 1.00 136.11 ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? -28.664  42.340  379.726 1.00 138.97 ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? -28.279  43.069  378.456 1.00 136.75 ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? -29.051  42.489  377.279 1.00 134.10 ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? -29.509  43.578  376.326 1.00 132.44 ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? -29.912  43.029  375.003 1.00 130.77 ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? -30.027  42.805  382.450 1.00 129.80 ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? -30.867  42.286  383.517 1.00 123.28 ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? -31.312  40.867  383.181 1.00 119.82 ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? -31.518  40.526  382.015 1.00 117.40 ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? -32.074  43.205  383.718 1.00 121.19 ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? -33.270  42.565  384.385 1.00 113.60 ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? -33.087  42.446  385.877 1.00 118.64 ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? -32.223  41.711  386.352 1.00 123.44 ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? -33.896  43.180  386.632 1.00 113.80 ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? -31.430  40.027  384.203 1.00 92.53  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? -31.894  38.658  384.030 1.00 93.12  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? -33.250  38.471  384.696 1.00 92.90  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? -33.738  39.334  385.429 1.00 92.21  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? -30.885  37.655  384.600 1.00 93.55  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? -29.492  37.832  384.082 1.00 91.86  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? -28.386  37.334  384.738 1.00 91.96  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? -29.024  38.449  382.971 1.00 90.81  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? -27.298  37.636  384.054 1.00 90.79  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? -27.658  38.314  382.979 1.00 91.06  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? -33.860  37.319  384.424 1.00 95.03  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? -35.140  36.966  385.017 1.00 98.55  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? -35.127  35.508  385.444 1.00 105.23 ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? -34.596  34.646  384.737 1.00 98.25  ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? -36.312  37.188  384.046 1.00 97.09  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? -36.633  38.637  383.742 1.00 94.62  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? -37.365  39.407  384.630 1.00 95.27  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? -36.234  39.223  382.556 1.00 90.19  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? -37.668  40.731  384.351 1.00 91.79  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? -36.538  40.543  382.270 1.00 88.14  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? -37.253  41.292  383.171 1.00 90.08  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? -37.554  42.605  382.886 1.00 92.04  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? -35.709  35.246  386.607 1.00 121.33 ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? -35.969  33.895  387.084 1.00 133.45 ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? -37.478  33.717  387.149 1.00 148.93 ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? -38.165  34.474  387.841 1.00 151.65 ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? -35.344  33.662  388.456 1.00 127.16 ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? -35.661  32.286  389.030 1.00 118.93 ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? -35.297  31.175  388.058 1.00 117.95 ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? -34.962  32.110  390.341 1.00 115.64 ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? -37.993  32.711  386.455 1.00 160.09 ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? -39.430  32.566  386.263 1.00 171.21 ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? -39.900  31.312  386.984 1.00 175.93 ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? -39.375  30.217  386.749 1.00 177.97 ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? -39.790  32.518  384.772 1.00 176.54 ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? -39.448  33.853  384.105 1.00 180.14 ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? -41.261  32.174  384.586 1.00 177.80 ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? -39.952  33.984  382.683 1.00 183.01 ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? -40.871  31.478  387.876 1.00 179.32 ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? -41.506  30.355  388.548 1.00 184.01 ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? -42.724  29.933  387.738 1.00 179.11 ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? -43.638  30.736  387.521 1.00 176.56 ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? -41.908  30.733  389.971 1.00 195.25 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? -42.568  29.379  390.953 1.00 205.59 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? -42.736  28.679  387.290 1.00 177.65 ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? -43.795  28.179  386.414 1.00 177.09 ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? -44.935  27.652  387.282 1.00 172.75 ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? -45.114  26.449  387.479 1.00 170.48 ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? -43.246  27.120  385.465 1.00 178.76 ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? -44.289  26.611  384.483 1.00 179.58 ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? -45.381  27.166  384.369 1.00 178.56 ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? -43.938  25.565  383.741 1.00 180.92 ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? -45.728  28.587  387.806 1.00 169.41 ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? -46.828  28.264  388.701 1.00 161.38 ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? -48.134  28.036  387.954 1.00 153.55 ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? -49.212  28.185  388.540 1.00 152.32 ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? -47.004  29.368  389.745 1.00 161.27 ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? -48.058  27.683  386.675 1.00 149.75 ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? -49.221  27.226  385.921 1.00 150.42 ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? -49.253  25.715  386.059 1.00 145.12 ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? -48.472  25.004  385.426 1.00 147.90 ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? -49.136  27.651  384.459 1.00 154.79 ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? -50.342  27.206  383.644 1.00 154.76 ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? -51.341  27.955  383.592 1.00 153.27 ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? -50.297  26.105  383.059 1.00 154.22 ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? -50.137  25.222  386.917 1.00 138.12 ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? -50.314  23.788  387.118 1.00 139.22 ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? -51.580  23.399  386.364 1.00 139.05 ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? -52.688  23.463  386.896 1.00 142.57 ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? -50.390  23.450  388.601 1.00 142.85 ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? -50.744  22.004  388.889 1.00 142.84 ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? -50.837  21.701  390.369 1.00 138.17 ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? -51.599  22.392  391.077 1.00 136.12 ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? -50.140  20.773  390.827 1.00 136.01 ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? -51.410  22.973  385.112 1.00 136.37 ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? -52.544  22.732  384.236 1.00 138.66 ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? -52.721  21.282  383.822 1.00 140.25 ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? -53.844  20.895  383.484 1.00 143.06 ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? -52.427  23.586  382.962 1.00 141.15 ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? -52.315  24.963  383.273 1.00 144.07 ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? -51.676  20.472  383.850 1.00 139.84 ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? -51.809  19.105  383.374 1.00 140.41 ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? -52.580  18.283  384.401 1.00 138.48 ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? -52.252  18.323  385.593 1.00 137.32 ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? -50.443  18.486  383.097 1.00 142.38 ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? -50.536  17.091  382.513 1.00 144.06 ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? -49.434  16.796  381.525 1.00 145.33 ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? -48.562  17.668  381.327 1.00 145.39 ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? -49.456  15.704  380.925 1.00 146.64 ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? -53.616  17.554  383.990 1.00 136.15 ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? -54.392  16.751  384.942 1.00 136.83 ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? -53.523  15.748  385.686 1.00 134.39 ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? -52.436  15.369  385.243 1.00 134.58 ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? -55.423  16.048  384.054 1.00 136.26 ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? -55.551  16.943  382.864 1.00 133.80 ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? -54.190  17.516  382.636 1.00 133.58 ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? -54.018  15.323  386.845 1.00 130.94 ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? -53.221  14.508  387.732 1.00 132.42 ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? -52.140  15.255  388.476 1.00 138.06 ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? -51.397  14.631  389.239 1.00 140.23 ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? -52.020  16.563  388.276 1.00 142.91 ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? -51.055  17.399  388.985 1.00 146.27 ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? -51.837  18.381  389.852 1.00 145.14 ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? -52.399  19.357  389.347 1.00 143.72 ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? -50.133  18.124  388.008 1.00 147.41 ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? -49.393  19.143  388.658 1.00 148.75 ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? -51.900  18.096  391.154 1.00 141.73 ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? -52.537  18.975  392.128 1.00 137.07 ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? -51.641  19.188  393.342 1.00 132.08 ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? -52.134  19.451  394.443 1.00 133.19 ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? -53.897  18.429  392.568 1.00 137.83 ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? -53.938  16.937  392.727 1.00 140.16 ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? -53.626  16.351  393.941 1.00 140.51 ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? -54.317  16.122  391.675 1.00 143.71 ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? -53.670  14.979  394.096 1.00 142.17 ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? -54.362  14.747  391.826 1.00 145.53 ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? -54.038  14.177  393.038 1.00 144.51 ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? -50.323  19.086  393.163 1.00 124.48 ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? -49.420  19.151  394.306 1.00 115.06 ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? -49.029  20.580  394.666 1.00 114.98 ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? -48.980  20.924  395.852 1.00 117.79 ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? -48.159  18.319  394.037 1.00 105.99 ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? -47.323  18.756  392.836 1.00 100.04 ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? -45.882  18.282  392.997 1.00 98.63  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? -44.980  18.620  391.814 1.00 100.68 ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? -44.848  20.082  391.575 1.00 101.84 ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? -48.766  21.428  393.669 1.00 112.91 ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? -48.225  22.758  393.932 1.00 114.05 ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? -49.249  23.704  394.541 1.00 111.10 ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? -48.859  24.697  395.169 1.00 105.79 ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? -47.667  23.351  392.638 1.00 117.90 ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? -46.567  22.498  392.039 1.00 118.68 ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? -45.966  21.705  392.792 1.00 120.14 ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? -46.302  22.610  390.824 1.00 117.11 ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? -50.542  23.427  394.355 1.00 116.87 ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? -51.582  24.274  394.928 1.00 123.52 ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? -51.376  24.455  396.424 1.00 125.95 ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? -51.457  25.570  396.945 1.00 125.07 ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? -52.962  23.674  394.645 1.00 127.13 ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? -54.118  24.436  395.293 1.00 127.20 ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? -55.428  24.209  394.545 1.00 125.37 ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? -56.298  23.244  395.212 1.00 121.65 ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? -57.366  23.572  395.935 1.00 119.81 ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? -57.709  24.846  396.077 1.00 121.81 ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? -58.098  22.626  396.505 1.00 117.04 ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? -51.078  23.365  397.130 1.00 128.89 ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? -51.018  23.429  398.585 1.00 130.92 ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? -49.692  23.987  399.081 1.00 127.25 ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? -49.647  24.577  400.166 1.00 125.57 ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? -51.302  22.046  399.169 1.00 133.84 ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? -52.582  21.488  398.605 1.00 134.66 ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? -53.784  22.143  398.817 1.00 135.81 ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? -52.590  20.337  397.833 1.00 133.24 ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? -54.960  21.667  398.291 1.00 135.54 ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? -53.770  19.848  397.303 1.00 133.93 ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? -54.951  20.521  397.538 1.00 134.10 ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? -56.138  20.060  397.026 1.00 132.48 ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? -48.613  23.830  398.312 1.00 124.29 ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? -47.394  24.578  398.610 1.00 122.57 ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? -47.672  26.073  398.528 1.00 132.20 ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? -47.283  26.848  399.409 1.00 134.12 ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? -46.250  24.170  397.664 1.00 110.15 ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? -45.779  22.748  397.958 1.00 105.40 ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? -45.082  25.138  397.782 1.00 107.01 ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? -44.532  22.365  397.198 1.00 102.87 ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? -48.372  26.495  397.472 1.00 138.09 ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? -48.670  27.914  397.306 1.00 141.17 ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? -49.647  28.418  398.362 1.00 140.22 ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? -49.576  29.585  398.762 1.00 139.99 ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? -49.218  28.168  395.903 1.00 144.19 ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? -48.272  27.797  394.761 1.00 145.64 ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? -48.805  28.298  393.426 1.00 144.91 ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? -46.874  28.342  395.028 1.00 145.76 ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? -50.560  27.562  398.817 1.00 138.49 ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? -51.550  27.972  399.805 1.00 137.26 ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? -50.998  27.955  401.225 1.00 131.73 ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? -51.494  28.695  402.081 1.00 130.21 ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? -52.778  27.063  399.716 1.00 143.04 ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? -53.582  27.230  398.439 1.00 148.64 ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? -54.952  26.591  398.525 1.00 151.47 ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? -55.330  26.141  399.626 1.00 152.21 ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? -55.650  26.541  397.490 1.00 151.57 ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? -49.989  27.127  401.499 1.00 129.30 ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? -49.520  26.925  402.862 1.00 128.35 ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? -48.061  27.299  403.093 1.00 133.47 ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? -47.731  27.759  404.189 1.00 135.97 ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? -49.726  25.458  403.277 1.00 119.27 ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? -51.059  24.897  402.807 1.00 108.62 ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? -52.067  25.631  402.827 1.00 106.03 ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? -51.096  23.717  402.406 1.00 104.76 ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? -47.182  27.122  402.109 1.00 133.69 ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? -45.754  27.377  402.309 1.00 134.27 ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? -45.143  28.114  401.117 1.00 133.96 ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? -44.314  27.539  400.396 1.00 133.46 ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? -45.002  26.064  402.597 1.00 135.44 ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? -45.146  25.683  404.063 1.00 135.21 ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? -45.528  24.937  401.719 1.00 136.69 ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? -45.507  29.386  400.870 1.00 133.30 ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? -44.912  30.125  399.743 1.00 129.65 ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? -43.484  30.591  400.004 1.00 125.53 ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? -42.657  30.654  399.085 1.00 122.17 ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? -45.860  31.322  399.570 1.00 130.57 ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? -47.088  30.993  400.382 1.00 132.09 ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? -46.587  30.155  401.509 1.00 133.36 ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? -43.191  30.948  401.257 1.00 124.60 ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? -41.879  31.498  401.587 1.00 123.40 ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? -40.756  30.514  401.282 1.00 118.97 ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? -39.631  30.933  400.992 1.00 120.18 ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? -41.847  31.945  403.047 1.00 127.47 ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? -42.667  33.170  403.312 1.00 135.54 ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? -42.325  34.410  402.816 1.00 135.43 ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? -43.811  33.350  404.016 1.00 136.07 ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? -43.221  35.300  403.200 1.00 136.22 ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? -44.133  34.683  403.931 1.00 135.67 ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? -41.033  29.211  401.346 1.00 113.52 ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? -40.072  28.235  400.840 1.00 107.71 ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? -39.772  28.484  399.367 1.00 109.08 ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? -38.610  28.436  398.940 1.00 113.58 ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? -40.610  26.820  401.047 1.00 100.34 ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? -39.945  25.730  400.206 1.00 93.15  ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? -38.515  25.507  400.650 1.00 90.26  ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? -40.742  24.435  400.269 1.00 91.52  ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? -40.813  28.752  398.575 1.00 102.68 ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? -40.610  29.069  397.166 1.00 97.24  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? -39.801  30.346  396.996 1.00 91.48  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? -38.928  30.421  396.126 1.00 84.67  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? -41.953  29.190  396.450 1.00 93.52  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? -41.856  29.647  394.995 1.00 94.60  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? -41.101  28.625  394.165 1.00 95.52  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? -43.238  29.910  394.415 1.00 95.57  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? -40.080  31.367  397.812 1.00 97.39  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? -39.308  32.607  397.725 1.00 102.38 ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? -37.839  32.345  398.038 1.00 101.36 ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? -36.942  32.854  397.357 1.00 101.42 ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? -39.903  33.685  398.653 1.00 107.56 ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? -41.247  34.181  398.116 1.00 108.85 ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? -38.939  34.857  398.815 1.00 107.51 ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? -42.000  35.093  399.070 1.00 107.82 ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? -37.575  31.542  399.069 1.00 96.03  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? -36.205  31.197  399.433 1.00 91.59  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? -35.493  30.501  398.276 1.00 88.63  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? -34.372  30.873  397.896 1.00 84.68  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? -36.233  30.320  400.687 1.00 91.74  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? -34.912  30.137  401.409 1.00 92.35  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? -35.111  29.627  402.826 1.00 90.85  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? -36.278  29.430  403.222 1.00 91.84  ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? -34.114  29.429  403.546 1.00 94.36  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? -36.145  29.495  397.689 1.00 89.62  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? -35.532  28.773  396.584 1.00 92.33  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? -35.298  29.646  395.367 1.00 95.12  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? -34.276  29.521  394.684 1.00 88.89  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? -36.250  30.531  395.069 1.00 100.49 ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? -36.105  31.414  393.920 1.00 101.84 ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? -34.992  32.421  394.145 1.00 93.46  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? -34.272  32.771  393.210 1.00 84.85  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? -37.418  32.137  393.634 1.00 104.73 ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? -38.538  31.241  393.168 1.00 109.85 ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? -40.049  32.179  392.921 1.00 113.25 ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? -39.614  33.105  391.456 1.00 112.17 ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? -34.846  32.916  395.374 1.00 94.28  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? -33.725  33.798  395.676 1.00 99.44  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? -32.411  33.062  395.463 1.00 110.65 ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? -31.462  33.610  394.892 1.00 115.42 ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? -33.844  34.353  397.107 1.00 98.19  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? -35.042  35.296  397.216 1.00 99.72  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? -32.571  35.086  397.505 1.00 96.23  ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? -35.335  35.751  398.630 1.00 101.01 ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? -32.340  31.802  395.902 1.00 115.14 ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? -31.120  31.021  395.701 1.00 122.58 ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? -30.793  30.871  394.215 1.00 128.30 ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? -29.659  31.125  393.783 1.00 131.77 ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? -31.269  29.650  396.365 1.00 125.80 ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? -31.479  29.670  397.884 1.00 128.10 ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? -31.932  28.310  398.411 1.00 129.90 ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? -30.222  30.140  398.602 1.00 127.17 ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? -31.785  30.480  393.412 1.00 126.53 ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? -31.544  30.286  391.982 1.00 121.06 ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? -31.198  31.602  391.283 1.00 116.77 ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? -30.280  31.650  390.451 1.00 117.16 ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? -32.756  29.622  391.334 1.00 119.51 ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? -31.932  32.675  391.589 1.00 112.11 ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? -31.632  33.966  390.993 1.00 108.79 ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? -30.243  34.453  391.351 1.00 110.68 ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? -29.540  35.022  390.515 1.00 111.84 ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? -29.839  34.255  392.609 1.00 113.66 ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? -28.457  34.501  392.994 1.00 119.73 ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? -27.503  33.701  392.124 1.00 122.48 ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? -26.460  34.212  391.701 1.00 124.60 ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? -28.250  34.145  394.465 1.00 123.04 ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? -26.817  34.292  394.913 1.00 129.00 ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? -26.205  35.533  394.953 1.00 131.59 ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? -26.067  33.181  395.273 1.00 132.11 ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? -24.891  35.669  395.354 1.00 134.27 ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? -24.750  33.306  395.672 1.00 134.47 ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? -24.167  34.555  395.713 1.00 135.91 ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? -22.855  34.700  396.108 1.00 137.04 ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? -27.853  32.447  391.832 1.00 118.71 ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? -26.992  31.635  390.979 1.00 111.44 ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? -26.834  32.263  389.598 1.00 102.31 ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? -25.727  32.300  389.050 1.00 97.11  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? -27.540  30.214  390.869 1.00 112.88 ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? -27.924  32.761  389.019 1.00 101.14 ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? -27.888  33.294  387.658 1.00 99.15  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? -27.889  34.828  387.642 1.00 100.85 ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? -28.149  35.428  386.602 1.00 98.40  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? -29.032  32.734  386.797 1.00 94.93  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? -30.388  33.230  387.301 1.00 94.19  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? -28.988  31.212  386.773 1.00 91.55  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? -31.574  32.666  386.544 1.00 92.72  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? -27.596  35.470  388.776 1.00 108.46 ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? -27.500  36.934  388.855 1.00 117.11 ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? -28.771  37.614  388.348 1.00 119.08 ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? -28.725  38.678  387.726 1.00 115.34 ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? -26.283  37.481  388.101 1.00 122.83 ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? -24.903  37.214  388.694 1.00 128.04 ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? -24.243  35.954  388.165 1.00 133.96 ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? -22.808  35.991  388.442 1.00 138.26 ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? -22.006  34.932  388.445 1.00 140.50 ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? -22.486  33.726  388.189 1.00 143.02 ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? -20.715  35.086  388.706 1.00 138.96 ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? -29.919  37.009  388.625 1.00 124.18 ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? -31.196  37.570  388.208 1.00 126.24 ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? -31.727  38.471  389.317 1.00 124.97 ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? -32.025  37.998  390.419 1.00 128.42 ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? -32.195  36.461  387.884 1.00 126.00 ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? -31.848  39.767  389.021 1.00 115.18 ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? -32.267  40.733  390.026 1.00 104.42 ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? -33.776  40.778  390.208 1.00 101.28 ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? -34.242  41.250  391.247 1.00 106.28 ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? -31.765  42.138  389.678 1.00 102.74 ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? -32.660  42.747  388.743 1.00 106.32 ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? -30.373  42.078  389.065 1.00 100.47 ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? -34.554  40.330  389.225 1.00 94.34  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? -36.007  40.309  389.337 1.00 90.68  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? -36.514  38.999  388.752 1.00 90.08  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? -35.916  38.431  387.832 1.00 91.10  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? -36.669  41.522  388.626 1.00 87.13  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? -38.186  41.506  388.793 1.00 84.41  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? -36.109  42.838  389.154 1.00 89.49  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? -37.616  38.514  389.305 1.00 92.48  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? -38.242  37.304  388.812 1.00 95.13  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? -39.745  37.466  388.757 1.00 100.81 ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? -40.337  38.244  389.510 1.00 101.61 ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? -40.360  36.726  387.840 1.00 104.24 ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? -41.806  36.724  387.671 1.00 105.00 ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? -42.352  35.320  387.898 1.00 109.32 ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? -41.696  34.321  387.586 1.00 109.29 ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? -42.204  37.241  386.283 1.00 101.52 ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? -42.063  38.741  386.151 1.00 100.53 ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? -40.822  39.327  385.975 1.00 100.31 ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? -43.170  39.572  386.220 1.00 101.40 ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? -40.687  40.697  385.864 1.00 99.79  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? -43.042  40.946  386.109 1.00 102.04 ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? -41.797  41.500  385.931 1.00 100.97 ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? -41.650  42.863  385.819 1.00 102.31 ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? -43.560  35.253  388.449 1.00 112.38 ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? -44.240  33.993  388.723 1.00 114.53 ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? -45.560  33.997  387.971 1.00 115.03 ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? -46.411  34.866  388.201 1.00 114.81 ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? -44.475  33.781  390.225 1.00 114.46 ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? -43.155  33.859  390.991 1.00 116.09 ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? -45.155  32.445  390.467 1.00 113.23 ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? -43.276  33.458  392.440 1.00 117.32 ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? -45.733  33.028  387.080 1.00 117.41 ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? -46.945  32.894  386.279 1.00 121.33 ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? -47.842  31.849  386.928 1.00 123.17 ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? -47.622  30.646  386.774 1.00 123.65 ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? -46.592  32.512  384.847 1.00 125.41 ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? -47.774  32.387  383.910 1.00 129.27 ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? -48.492  31.203  383.821 1.00 132.21 ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? -48.170  33.451  383.117 1.00 131.14 ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? -49.570  31.083  382.969 1.00 135.83 ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? -49.250  33.340  382.263 1.00 133.92 ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? -49.945  32.156  382.192 1.00 137.83 ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? -51.020  32.046  381.339 1.00 142.22 ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? -48.871  32.313  387.632 1.00 124.43 ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? -49.849  31.444  388.275 1.00 126.09 ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? -51.075  31.351  387.377 1.00 111.95 ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? -51.444  32.324  386.705 1.00 108.74 ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? -50.210  31.955  389.685 1.00 139.93 ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? -48.949  32.339  390.451 1.00 144.66 ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? -51.166  33.140  389.625 1.00 143.61 ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? -51.685  30.171  387.328 1.00 102.81 ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? -52.831  29.968  386.457 1.00 97.79  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? -54.075  30.608  387.058 1.00 99.42  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? -54.199  30.753  388.277 1.00 100.06 ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? -53.091  28.482  386.220 1.00 93.95  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? -53.354  27.685  387.473 1.00 93.47  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? -53.784  26.284  387.102 1.00 89.59  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? -55.040  26.281  386.359 1.00 87.79  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? -55.608  25.190  385.859 1.00 86.67  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? -55.033  24.008  386.017 1.00 86.79  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? -56.748  25.281  385.193 1.00 86.82  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? -55.010  30.975  386.188 1.00 98.40  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? -56.176  31.734  386.597 1.00 93.28  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? -57.192  30.967  387.420 1.00 86.48  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? -58.280  31.480  387.700 1.00 85.92  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? -56.856  29.742  387.813 1.00 92.62  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? -57.720  28.945  388.670 1.00 104.39 ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? -57.271  28.927  390.125 1.00 112.10 ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? -58.022  28.444  390.981 1.00 110.34 ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? -57.795  27.506  388.147 1.00 107.78 ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? -58.830  27.304  387.067 1.00 111.05 ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? -58.359  27.809  385.726 1.00 117.33 ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? -57.130  27.865  385.516 1.00 120.46 ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? -59.213  28.156  384.886 1.00 120.13 ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? -56.078  29.431  390.429 1.00 121.43 ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? -55.590  29.490  391.806 1.00 132.73 ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? -55.718  30.939  392.261 1.00 142.73 ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? -54.791  31.736  392.114 1.00 145.13 ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? -54.146  29.002  391.905 1.00 133.97 ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? -53.945  27.522  391.642 1.00 133.03 ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? -54.986  26.731  391.194 1.00 130.70 ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? -52.710  26.919  391.839 1.00 132.33 ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? -54.811  25.388  390.946 1.00 129.51 ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? -52.526  25.567  391.593 1.00 130.52 ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? -53.584  24.809  391.147 1.00 130.68 ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? -53.430  23.466  390.897 1.00 134.28 ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? -56.874  31.283  392.830 1.00 146.62 ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? -57.012  32.606  393.423 1.00 146.15 ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? -56.714  32.596  394.911 1.00 146.65 ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? -56.219  33.594  395.442 1.00 149.25 ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? -58.410  33.186  393.194 1.00 142.49 ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? -58.454  34.664  393.565 1.00 138.62 ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? -59.830  35.277  393.501 1.00 137.00 ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? -59.775  36.723  393.694 1.00 135.24 ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? -59.644  37.318  394.876 1.00 134.05 ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? -59.548  36.595  395.983 1.00 132.23 ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? -59.606  38.642  394.948 1.00 135.02 ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? -57.018  31.496  395.599 1.00 143.93 ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? -56.563  31.354  396.975 1.00 141.35 ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? -55.049  31.480  397.041 1.00 136.46 ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? -54.511  32.286  397.809 1.00 136.19 ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? -57.018  30.011  397.547 1.00 145.26 ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? -56.417  29.673  398.895 1.00 146.99 ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? -57.343  28.750  399.659 1.00 144.82 ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? -58.519  29.459  400.148 1.00 141.16 ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? -59.635  28.859  400.548 1.00 136.17 ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? -59.729  27.538  400.510 1.00 132.62 ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? -60.658  29.582  400.978 1.00 136.70 ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? -54.348  30.702  396.213 1.00 133.67 ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? -52.895  30.798  396.134 1.00 133.60 ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? -52.444  32.182  395.684 1.00 136.92 ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? -51.406  32.672  396.138 1.00 139.20 ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? -52.356  29.725  395.189 1.00 130.85 ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? -53.210  32.830  394.803 1.00 134.42 ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? -52.839  34.162  394.331 1.00 129.63 ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? -52.876  35.182  395.465 1.00 124.93 ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? -51.952  35.991  395.618 1.00 121.77 ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? -53.764  34.590  393.192 1.00 130.11 ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? -53.951  35.170  396.257 1.00 126.27 ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? -54.044  36.071  397.401 1.00 129.59 ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? -52.982  35.748  398.443 1.00 133.27 ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? -52.385  36.661  399.027 1.00 132.87 ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? -55.443  36.005  398.015 1.00 130.14 ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? -56.495  36.667  397.145 1.00 129.90 ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? -56.124  37.493  396.285 1.00 130.31 ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? -57.693  36.367  397.325 1.00 128.94 ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? -52.730  34.457  398.689 1.00 137.88 ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? -51.664  34.079  399.614 1.00 140.74 ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? -50.327  34.637  399.153 1.00 143.28 ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? -49.552  35.165  399.958 1.00 147.08 ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? -51.573  32.557  399.740 1.00 138.55 ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? -52.838  31.872  400.211 1.00 133.69 ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? -52.866  31.653  401.705 1.00 127.09 ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? -53.633  30.458  402.031 1.00 122.10 ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? -54.921  30.469  402.353 1.00 120.91 ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? -55.587  31.616  402.391 1.00 118.32 ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? -55.544  29.334  402.634 1.00 122.94 ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? -50.051  34.542  397.852 1.00 140.74 ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? -48.769  34.986  397.324 1.00 140.53 ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? -48.641  36.501  397.377 1.00 141.29 ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? -47.586  37.024  397.753 1.00 143.13 ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? -48.603  34.481  395.893 1.00 141.73 ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? -47.987  33.089  395.796 1.00 146.67 ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? -47.770  32.686  394.347 1.00 147.85 ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? -46.682  33.060  396.566 1.00 150.26 ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? -49.695  37.222  396.989 1.00 139.57 ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? -49.656  38.678  397.077 1.00 136.00 ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? -49.462  39.139  398.517 1.00 131.58 ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? -48.652  40.037  398.787 1.00 129.46 ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? -50.933  39.273  396.487 1.00 136.34 ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? -50.790  40.717  396.054 1.00 138.30 ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? -50.194  40.850  394.669 1.00 141.68 ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? -49.016  41.251  394.563 1.00 143.10 ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? -50.902  40.555  393.684 1.00 142.94 ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? -50.174  38.515  399.461 1.00 128.83 ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? -50.012  38.877  400.863 1.00 124.10 ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? -48.602  38.577  401.349 1.00 113.63 ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? -47.988  39.403  402.030 1.00 111.62 ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? -51.043  38.149  401.725 1.00 129.19 ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? -51.033  38.591  403.181 1.00 134.00 ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? -52.152  37.973  403.995 1.00 140.22 ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? -52.987  37.236  403.469 1.00 144.75 ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? -52.178  38.275  405.287 1.00 140.09 ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? -48.068  37.404  401.002 1.00 106.58 ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? -46.734  37.030  401.456 1.00 102.16 ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? -45.672  37.963  400.891 1.00 102.19 ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? -44.729  38.339  401.596 1.00 104.62 ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? -46.435  35.583  401.068 1.00 100.50 ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? -45.804  38.344  399.618 1.00 100.44 ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? -44.811  39.221  399.006 1.00 98.38  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? -44.895  40.624  399.599 1.00 106.67 ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? -43.866  41.247  399.890 1.00 106.06 ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? -44.972  39.236  397.474 1.00 90.39  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? -44.677  37.852  396.892 1.00 85.63  ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? -44.052  40.266  396.852 1.00 88.95  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? -44.508  37.831  395.386 1.00 83.93  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? -46.113  41.139  399.807 1.00 112.82 ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? -46.248  42.434  400.471 1.00 114.61 ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? -45.659  42.393  401.874 1.00 120.18 ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? -44.977  43.333  402.297 1.00 119.06 ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? -47.715  42.862  400.529 1.00 110.01 ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? -48.319  43.303  399.207 1.00 106.69 ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? -49.608  44.075  399.457 1.00 106.23 ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? -50.286  44.480  398.163 1.00 105.50 ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? -51.245  43.440  397.713 1.00 105.57 ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? -45.919  41.310  402.610 1.00 124.62 ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? -45.380  41.152  403.957 1.00 126.35 ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? -43.857  41.165  403.948 1.00 124.76 ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? -43.226  41.912  404.705 1.00 125.34 ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? -45.907  39.853  404.568 1.00 130.34 ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? -47.373  39.900  404.977 1.00 134.02 ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? -47.857  38.581  405.546 1.00 136.41 ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? -47.873  38.434  406.785 1.00 136.98 ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? -48.218  37.690  404.750 1.00 136.88 ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? -43.248  40.322  403.110 1.00 122.07 ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? -41.793  40.232  403.078 1.00 119.19 ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? -41.171  41.550  402.637 1.00 117.33 ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? -40.102  41.934  403.126 1.00 116.36 ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? -41.358  39.094  402.156 1.00 118.02 ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? -41.827  42.260  401.715 1.00 115.65 ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? -41.309  43.550  401.274 1.00 111.58 ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? -41.407  44.589  402.386 1.00 110.07 ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? -40.491  45.398  402.570 1.00 110.01 ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? -42.046  44.013  400.017 1.00 106.10 ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? -41.238  43.796  398.742 1.00 100.25 ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? -41.938  44.331  397.506 1.00 97.99  ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? -42.425  43.271  396.630 1.00 98.84  ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? -42.875  43.480  395.397 1.00 104.34 ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? -42.900  44.709  394.901 1.00 106.82 ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? -43.297  42.465  394.657 1.00 105.10 ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? -42.517  44.591  403.128 1.00 108.94 ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? -42.676  45.533  404.231 1.00 112.37 ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? -41.647  45.269  405.323 1.00 116.30 ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? -41.012  46.200  405.831 1.00 113.27 ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? -44.097  45.450  404.789 1.00 113.58 ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? -41.468  44.004  405.700 1.00 126.95 ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? -40.497  43.665  406.733 1.00 139.83 ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? -39.062  43.720  406.230 1.00 147.62 ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? -38.140  43.457  407.010 1.00 149.07 ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? -40.761  42.265  407.295 1.00 146.24 ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? -42.010  42.116  408.143 1.00 149.51 ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? -42.015  40.750  408.818 1.00 149.96 ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? -43.239  40.498  409.568 1.00 151.37 ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? -43.512  39.354  410.185 1.00 152.22 ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? -42.640  38.356  410.153 1.00 153.12 ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? -44.652  39.210  410.848 1.00 152.03 ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? -38.850  44.052  404.960 1.00 136.53 ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? -37.506  44.236  404.455 1.00 140.58 ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? -36.787  42.976  404.034 1.00 140.69 ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? -35.552  42.966  404.014 1.00 141.64 ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? -37.513  41.905  403.703 1.00 138.01 ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? -36.869  40.675  403.255 1.00 135.16 ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? -36.686  40.621  401.744 1.00 131.92 ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? -35.857  39.841  401.262 1.00 127.49 ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? -37.666  39.456  403.736 1.00 134.74 ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? -37.573  39.245  405.235 1.00 133.06 ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? -36.541  38.502  405.790 1.00 131.19 ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? -38.512  39.796  406.095 1.00 130.60 ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? -36.447  38.314  407.161 1.00 129.09 ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? -38.426  39.611  407.467 1.00 128.17 ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? -37.392  38.869  407.992 1.00 127.49 ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? -37.306  38.686  409.354 1.00 126.60 ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? -37.428  41.437  400.998 1.00 134.68 ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? -37.238  41.638  399.563 1.00 137.95 ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? -37.139  43.143  399.343 1.00 147.72 ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? -38.145  43.852  399.441 1.00 152.03 ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? -38.385  41.037  398.749 1.00 131.02 ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? -38.723  39.557  398.933 1.00 125.48 ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? -39.726  39.111  397.885 1.00 124.75 ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? -37.469  38.711  398.848 1.00 123.98 ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? -35.945  43.632  399.045 1.00 148.42 ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? -35.709  45.055  399.090 1.00 147.82 ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? -34.537  45.511  398.256 1.00 147.42 ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? -34.064  44.796  397.371 1.00 139.96 ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? -34.086  46.734  398.555 1.00 154.50 ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? -33.034  47.389  397.784 1.00 154.89 ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? -31.793  46.512  397.690 1.00 156.32 ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? -31.401  46.072  396.605 1.00 158.84 ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? -32.682  48.723  398.447 1.00 148.98 ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? -33.879  49.567  398.844 1.00 143.64 ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? -34.641  50.083  397.644 1.00 141.91 ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? -35.847  50.892  398.085 1.00 142.41 ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? -35.450  52.092  398.870 1.00 144.77 ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? -31.160  46.255  398.828 1.00 152.37 ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? -29.997  45.384  398.910 1.00 146.60 ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? -30.259  44.392  400.028 1.00 143.20 ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? -30.519  44.793  401.167 1.00 140.77 ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? -28.714  46.181  399.159 1.00 145.25 ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? -28.317  47.036  397.967 1.00 144.22 ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? -27.404  46.691  397.217 1.00 143.50 ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? -29.007  48.156  397.785 1.00 144.13 ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? -30.192  43.105  399.710 1.00 143.73 ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? -30.638  42.071  400.631 1.00 142.52 ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? -29.502  41.720  401.579 1.00 140.33 ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? -28.433  41.279  401.142 1.00 140.84 ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? -31.109  40.836  399.863 1.00 140.50 ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? -32.293  41.084  398.928 1.00 139.98 ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? -32.812  39.784  398.336 1.00 138.01 ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? -33.390  41.810  399.677 1.00 141.99 ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? -29.733  41.943  402.873 1.00 136.26 ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? -28.846  41.488  403.940 1.00 130.06 ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? -27.477  42.160  403.864 1.00 128.22 ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? -26.479  41.618  404.341 1.00 130.57 ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? -28.716  39.963  403.910 1.00 125.14 ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? -30.021  39.261  403.647 1.00 123.86 ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? -31.156  39.586  404.368 1.00 123.55 ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? -30.124  38.312  402.646 1.00 125.41 ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? -32.363  38.957  404.116 1.00 124.17 ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? -31.331  37.681  402.391 1.00 126.51 ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? -32.448  38.005  403.126 1.00 125.74 ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? -27.419  43.349  403.263 1.00 121.69 ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? -26.195  44.110  403.176 1.00 116.45 ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? -25.379  43.879  401.922 1.00 113.69 ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? -24.613  44.765  401.529 1.00 117.37 ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? -25.522  42.722  401.279 1.00 110.30 ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? -24.729  42.423  400.098 1.00 112.85 ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? -25.213  43.244  398.904 1.00 115.55 ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? -26.296  43.838  398.914 1.00 111.31 ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? -24.782  40.928  399.775 1.00 115.35 ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? -23.651  40.572  398.971 1.00 115.53 ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? -26.057  40.577  399.025 1.00 117.48 ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? -24.389  43.257  397.855 1.00 123.41 ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? -24.630  44.068  396.668 1.00 128.17 ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? -25.672  43.464  395.742 1.00 117.98 ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? -25.815  43.929  394.606 1.00 119.53 ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? -23.325  44.255  395.893 1.00 136.83 ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? -22.732  42.937  395.435 1.00 142.05 ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? -22.841  41.944  396.185 1.00 142.66 ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? -22.170  42.888  394.322 1.00 143.91 ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? -26.389  42.441  396.191 1.00 105.95 ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? -27.395  41.803  395.362 1.00 98.71  ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? -28.731  42.493  395.595 1.00 93.97  ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? -28.968  43.087  396.650 1.00 95.20  ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? -27.492  40.306  395.680 1.00 99.05  ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? -28.422  39.542  394.772 1.00 97.02  ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? -27.995  39.112  393.528 1.00 93.92  ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? -29.714  39.238  395.166 1.00 98.75  ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? -28.838  38.406  392.691 1.00 92.47  ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? -30.560  38.529  394.328 1.00 97.34  ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? -30.120  38.117  393.092 1.00 94.44  ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? -29.603  42.415  394.599 1.00 89.98  ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? -30.938  42.973  394.713 1.00 91.42  ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? -31.927  41.974  394.141 1.00 91.56  ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? -31.614  41.242  393.199 1.00 93.39  ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? -31.061  44.319  393.988 1.00 100.52 ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? -30.222  45.293  394.584 1.00 108.12 ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? -33.131  41.960  394.702 1.00 94.08  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? -34.116  41.003  394.227 1.00 94.60  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? -35.510  41.440  394.638 1.00 103.57 ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? -35.711  42.025  395.705 1.00 111.43 ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? -33.837  39.588  394.745 1.00 83.97  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? -34.539  38.521  393.963 1.00 76.25  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? -34.036  38.098  392.749 1.00 64.63  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? -35.703  37.949  394.430 1.00 64.80  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? -34.679  37.123  392.017 1.00 64.61  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? -36.346  36.970  393.702 1.00 65.60  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? -35.834  36.560  392.494 1.00 64.69  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? -36.464  41.142  393.764 1.00 104.02 ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? -37.876  41.337  394.039 1.00 112.79 ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? -38.655  40.537  393.009 1.00 109.93 ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? -38.190  40.328  391.886 1.00 111.95 ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? -38.275  42.815  393.983 1.00 125.06 ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? -39.590  43.085  394.683 1.00 131.21 ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? -40.349  42.119  394.905 1.00 131.79 ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? -39.869  44.259  395.006 1.00 131.86 ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? -39.847  40.107  393.400 1.00 106.10 ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? -40.728  39.343  392.534 1.00 98.43  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? -41.971  40.157  392.216 1.00 99.75  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? -42.324  41.105  392.923 1.00 101.99 ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? -41.132  38.011  393.182 1.00 87.63  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? -40.029  36.983  393.426 1.00 72.32  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? -40.605  35.735  394.065 1.00 67.66  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? -39.356  36.639  392.117 1.00 65.03  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? -42.628  39.781  391.125 1.00 95.90  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? -43.895  40.389  390.754 1.00 96.20  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? -44.824  39.295  390.261 1.00 91.66  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? -44.413  38.422  389.490 1.00 83.73  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? -43.684  41.489  389.711 1.00 102.16 ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? -42.847  42.622  390.218 1.00 108.52 ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? -43.206  43.372  391.319 1.00 113.14 ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? -41.656  43.114  389.800 1.00 113.32 ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? -42.283  44.288  391.545 1.00 112.79 ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? -41.332  44.154  390.638 1.00 113.60 ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? -46.063  39.346  390.721 1.00 96.53  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? -47.042  38.284  390.536 1.00 102.55 ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? -47.783  38.505  389.227 1.00 113.80 ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? -47.954  39.638  388.767 1.00 116.01 ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? -48.008  38.237  391.741 1.00 101.14 ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? -48.817  36.947  391.744 1.00 106.34 ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? -47.239  38.406  393.046 1.00 96.86  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? -48.224  37.406  388.618 1.00 120.96 ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? -48.943  37.447  387.350 1.00 126.60 ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? -50.053  36.411  387.387 1.00 128.00 ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? -49.781  35.212  387.497 1.00 127.02 ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? -47.998  37.171  386.174 1.00 130.13 ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? -48.602  37.445  384.832 1.00 134.28 ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? -48.511  38.671  384.210 1.00 134.44 ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? -49.303  36.647  383.992 1.00 134.42 ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? -49.131  38.618  383.045 1.00 135.00 ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? -49.621  37.402  382.889 1.00 134.45 ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? -51.298  36.875  387.297 1.00 129.67 ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? -52.452  35.990  387.295 1.00 128.41 ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? -52.802  35.626  385.859 1.00 116.33 ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? -52.857  36.499  384.987 1.00 118.66 ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? -53.649  36.648  387.982 1.00 135.39 ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? -53.509  36.801  389.490 1.00 137.24 ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? -54.849  37.145  390.111 1.00 135.27 ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? -55.757  36.004  390.044 1.00 132.08 ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? -57.079  36.086  390.143 1.00 131.07 ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? -57.666  37.262  390.314 1.00 132.76 ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? -57.815  34.988  390.071 1.00 129.84 ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? -53.049  34.344  385.619 1.00 101.93 ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? -53.295  33.840  384.286 1.00 95.75  ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? -54.763  33.789  383.927 1.00 93.16  ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? -55.613  34.412  384.568 1.00 92.09  ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? -55.060  33.022  382.872 1.00 92.75  ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? -56.433  32.872  382.405 1.00 89.23  ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? -56.753  31.445  381.955 1.00 75.63  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? -57.692  31.247  381.171 1.00 67.19  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? -56.714  33.866  381.279 1.00 88.21  ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? -56.012  30.449  382.430 1.00 66.99  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? -56.377  29.069  382.185 1.00 66.88  ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? -56.181  28.571  380.767 1.00 66.84  ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? -57.156  28.355  380.041 1.00 66.99  ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? -54.926  28.397  380.353 1.00 66.62  ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? -54.605  27.781  379.068 1.00 75.28  ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? -53.446  26.818  379.274 1.00 84.95  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? -52.357  27.238  379.676 1.00 80.68  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? -54.251  28.832  378.013 1.00 66.53  ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? -53.693  25.530  379.006 1.00 93.87  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? -52.726  24.480  379.324 1.00 95.65  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? -51.367  24.744  378.688 1.00 93.78  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? -50.326  24.514  379.314 1.00 90.27  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? -53.272  23.119  378.884 1.00 103.01 ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? -52.296  21.966  379.013 1.00 117.40 ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? -51.462  21.849  380.115 1.00 125.87 ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? -52.206  20.999  378.025 1.00 124.81 ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? -50.566  20.801  380.226 1.00 131.58 ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? -51.313  19.946  378.130 1.00 129.67 ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? -50.496  19.853  379.231 1.00 131.24 ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? -49.608  18.808  379.335 1.00 129.48 ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? -51.354  25.241  377.449 1.00 99.97  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? -50.097  25.424  376.731 1.00 111.88 ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? -49.179  26.406  377.451 1.00 115.13 ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? -47.956  26.351  377.275 1.00 119.36 ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? -50.370  25.860  375.274 1.00 120.51 ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? -49.059  26.042  374.504 1.00 124.93 ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? -51.197  27.135  375.235 1.00 124.03 ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? -48.221  24.774  374.402 1.00 126.57 ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? -49.732  27.281  378.295 1.00 110.04 ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? -48.899  28.186  379.081 1.00 100.96 ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? -47.906  27.448  379.970 1.00 104.72 ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? -47.040  28.092  380.571 1.00 104.90 ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? -49.771  29.106  379.938 1.00 88.44  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? -50.941  30.113  379.008 1.00 78.43  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? -48.002  26.118  380.062 1.00 106.93 ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? -47.017  25.366  380.815 1.00 106.36 ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? -45.711  25.166  380.078 1.00 105.83 ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? -44.668  24.976  380.711 1.00 108.51 ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? -45.737  25.186  378.746 1.00 101.17 ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? -44.491  25.141  377.991 1.00 95.87  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? -43.739  26.448  378.202 1.00 105.46 ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? -44.320  27.531  378.086 1.00 108.26 ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? -44.754  24.904  376.503 1.00 84.57  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? -43.669  24.068  375.816 1.00 77.99  ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? -42.409  24.855  375.512 1.00 71.76  ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? -42.470  26.097  375.546 1.00 72.30  ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? -41.353  24.234  375.259 1.00 65.42  ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? -42.447  26.344  378.525 1.00 109.08 ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? -41.686  27.515  378.952 1.00 110.75 ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? -41.666  28.619  377.897 1.00 108.61 ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? -41.599  29.803  378.248 1.00 107.89 ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? -40.259  27.105  379.330 1.00 115.55 ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? -39.452  26.470  378.214 1.00 121.36 ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? -38.022  26.163  378.629 1.00 122.27 ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? -37.377  27.041  379.240 1.00 122.36 ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? -37.537  25.049  378.340 1.00 122.21 ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? -41.730  28.263  376.611 1.00 107.59 ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? -41.753  29.272  375.556 1.00 106.38 ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? -43.136  29.868  375.328 1.00 109.27 ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? -43.231  31.002  374.851 1.00 109.37 ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? -41.236  28.683  374.240 1.00 104.77 ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? -42.028  27.547  373.875 1.00 109.14 ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? -39.783  28.251  374.370 1.00 101.31 ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? -44.207  29.150  375.669 1.00 115.58 ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? -45.543  29.716  375.515 1.00 120.30 ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? -45.845  30.708  376.629 1.00 122.36 ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? -46.491  31.738  376.397 1.00 124.84 ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? -46.589  28.602  375.489 1.00 121.64 ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? -45.365  30.414  377.839 1.00 122.25 ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? -45.603  31.286  378.984 1.00 127.57 ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? -44.985  32.662  378.779 1.00 128.07 ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? -45.573  33.676  379.167 1.00 125.41 ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? -45.046  30.631  380.248 1.00 131.46 ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? -45.442  31.169  381.622 1.00 135.68 ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? -45.300  30.061  382.649 1.00 139.08 ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? -44.578  32.365  382.018 1.00 135.13 ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? -43.781  32.716  378.207 1.00 128.61 ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? -43.105  33.997  378.029 1.00 123.29 ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? -43.848  34.884  377.035 1.00 114.29 ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? -44.025  36.085  377.279 1.00 117.20 ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? -41.660  33.760  377.594 1.00 125.42 ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? -40.854  32.951  378.603 1.00 128.19 ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? -39.074  33.106  378.383 1.00 132.23 ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? -38.837  32.107  376.919 1.00 132.86 ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? -44.303  34.310  375.917 1.00 102.78 ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? -45.126  35.074  374.983 1.00 94.00  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? -46.435  35.503  375.632 1.00 89.74  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? -46.894  36.632  375.429 1.00 92.29  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? -45.388  34.268  373.709 1.00 86.77  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? -44.166  34.174  372.808 1.00 78.16  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? -43.242  34.979  372.909 1.00 71.29  ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? -44.170  33.204  371.905 1.00 80.19  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? -47.051  34.616  376.419 1.00 81.84  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? -48.289  34.972  377.105 1.00 79.15  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? -48.082  36.179  378.013 1.00 83.02  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? -48.824  37.165  377.938 1.00 85.68  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? -48.799  33.773  377.906 1.00 76.48  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? -50.054  34.041  378.510 1.00 76.94  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? -47.061  36.120  378.869 1.00 81.98  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? -46.819  37.193  379.832 1.00 79.87  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? -46.429  38.490  379.134 1.00 71.25  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? -46.841  39.573  379.556 1.00 65.98  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? -45.738  36.772  380.829 1.00 79.52  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? -45.449  37.740  381.980 1.00 80.10  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? -45.270  36.980  383.281 1.00 80.83  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? -44.220  38.598  381.696 1.00 81.23  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? -45.640  38.397  378.062 1.00 72.73  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? -45.208  39.580  377.324 1.00 78.06  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? -46.377  40.398  376.793 1.00 91.44  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? -46.197  41.573  376.454 1.00 96.09  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? -44.310  39.147  376.164 1.00 74.59  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? -43.212  40.114  375.786 1.00 72.04  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? -42.286  39.536  374.735 1.00 68.33  ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? -41.638  38.509  375.019 1.00 66.41  ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? -42.217  40.094  373.622 1.00 68.05  ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? -47.565  39.810  376.729 1.00 95.36  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? -48.710  40.416  376.087 1.00 97.77  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? -49.019  39.846  374.724 1.00 97.68  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? -49.849  40.415  374.005 1.00 94.48  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? -48.386  38.740  374.355 1.00 100.18 ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? -48.636  38.045  373.106 1.00 101.61 ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? -49.554  36.859  373.363 1.00 100.51 ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? -49.816  36.479  374.507 1.00 103.29 ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? -47.313  37.573  372.495 1.00 103.96 ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? -46.139  38.536  372.683 1.00 108.75 ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? -44.826  37.908  372.234 1.00 112.48 ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? -46.389  39.838  371.941 1.00 110.04 ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? -50.045  36.265  372.283 1.00 94.42  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? -50.688  34.974  372.426 1.00 90.17  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? -49.647  33.936  372.823 1.00 93.16  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? -48.480  34.012  372.430 1.00 92.29  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? -51.384  34.564  371.128 1.00 87.23  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? -52.672  35.316  370.842 1.00 87.35  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? -53.152  35.045  369.430 1.00 87.69  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? -54.366  34.238  369.433 1.00 86.27  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? -54.391  32.930  369.208 1.00 87.75  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? -53.264  32.274  368.968 1.00 85.86  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? -55.541  32.275  369.231 1.00 92.65  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? -50.076  32.961  373.624 1.00 97.03  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? -49.171  31.933  374.131 1.00 94.51  ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? -48.890  30.920  373.020 1.00 95.26  ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? -49.293  29.756  373.066 1.00 96.64  ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? -49.758  31.264  375.366 1.00 90.66  ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? -48.178  31.385  372.010 1.00 92.91  ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? -47.676  30.450  371.019 1.00 90.91  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? -46.221  30.165  371.327 1.00 98.22  ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? -45.435  31.111  371.483 1.00 105.31 ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? -47.815  31.012  369.603 1.00 84.95  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? -49.244  31.406  369.264 1.00 80.45  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? -50.180  31.062  369.982 1.00 73.67  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? -49.418  32.121  368.157 1.00 83.29  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? -45.832  28.899  371.452 1.00 99.08  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? -44.443  28.596  371.813 1.00 100.80 ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? -43.470  29.202  370.813 1.00 100.15 ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? -43.788  29.406  369.640 1.00 101.68 ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? -44.388  27.061  371.802 1.00 99.61  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? -45.706  26.593  371.276 1.00 96.56  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? -46.686  27.702  371.407 1.00 96.59  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? -42.272  29.495  371.299 1.00 97.28  ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? -41.260  30.156  370.498 1.00 97.95  ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? -40.398  29.126  369.783 1.00 95.52  ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? -40.554  27.915  369.949 1.00 99.21  ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? -40.394  31.062  371.370 1.00 101.67 ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? -41.172  32.056  372.196 1.00 106.29 ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? -40.245  33.054  372.856 1.00 109.73 ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? -40.935  34.298  373.167 1.00 114.60 ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? -40.398  35.294  373.861 1.00 122.15 ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? -39.162  35.187  374.328 1.00 124.32 ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? -41.098  36.395  374.091 1.00 126.45 ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? -39.476  29.618  368.967 1.00 88.90  ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? -38.497  28.753  368.333 1.00 82.24  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? -37.412  28.439  369.354 1.00 88.96  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? -36.759  29.351  369.874 1.00 87.34  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? -37.912  29.428  367.095 1.00 76.09  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? -37.183  28.527  366.100 1.00 79.63  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? -38.157  27.622  365.376 1.00 81.07  ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? -36.386  29.352  365.102 1.00 84.56  ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? -37.261  27.161  369.677 1.00 96.62  ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? -36.282  26.682  370.646 1.00 94.78  ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? -34.847  26.707  370.116 1.00 86.77  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? -33.919  26.851  370.922 1.00 85.96  ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? -36.658  25.280  371.134 1.00 93.30  ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? -36.775  25.195  372.653 1.00 87.59  ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? -37.790  24.149  373.075 1.00 83.86  ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? -37.964  24.124  374.583 1.00 76.80  ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? -39.040  23.180  374.990 1.00 70.33  ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? -34.604  26.511  368.815 1.00 78.18  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? -33.233  26.624  368.291 1.00 74.66  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? -32.519  27.875  368.781 1.00 79.04  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? -31.295  27.841  368.981 1.00 78.65  ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? -33.445  26.645  366.772 1.00 75.49  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? -34.644  25.773  366.572 1.00 77.41  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? -35.458  25.783  367.853 1.00 77.24  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? -33.227  29.017  368.977 1.00 86.97  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? -32.728  30.030  369.922 1.00 92.44  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? -33.121  29.661  371.345 1.00 104.13 ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? -34.303  29.681  371.702 1.00 107.60 ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? -33.418  31.322  369.452 1.00 82.03  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? -34.018  31.031  368.135 1.00 82.59  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? -34.277  29.568  368.102 1.00 86.38  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? -32.126  29.320  372.167 1.00 108.08 ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? -32.422  28.839  373.509 1.00 108.15 ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? -32.901  29.994  374.391 1.00 105.68 ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? -32.498  31.143  374.199 1.00 107.34 ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? -31.192  28.186  374.143 1.00 113.37 ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? -30.912  26.781  373.657 1.00 117.11 ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? -31.736  25.728  374.022 1.00 116.09 ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? -29.811  26.512  372.860 1.00 116.82 ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? -31.477  24.437  373.589 1.00 111.60 ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? -29.551  25.219  372.423 1.00 114.39 ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? -30.386  24.185  372.790 1.00 110.78 ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? -33.771  29.711  375.365 1.00 104.39 ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? -34.201  30.774  376.288 1.00 108.58 ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? -33.098  31.274  377.201 1.00 116.00 ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? -33.158  32.425  377.653 1.00 119.21 ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? -35.336  30.116  377.084 1.00 105.24 ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? -35.092  28.657  376.971 1.00 105.60 ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? -34.394  28.412  375.669 1.00 105.20 ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? -32.091  30.444  377.482 1.00 117.85 ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? -31.025  30.837  378.399 1.00 115.75 ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? -30.305  32.092  377.923 1.00 105.71 ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? -29.972  32.966  378.730 1.00 100.90 ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? -30.040  29.682  378.574 1.00 119.34 ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? -30.061  32.207  376.619 1.00 100.96 ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? -29.414  33.395  376.080 1.00 100.91 ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? -30.400  34.479  375.664 1.00 96.63  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? -29.990  35.633  375.500 1.00 105.59 ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? -28.534  33.030  374.877 1.00 109.52 ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? -27.658  31.806  375.085 1.00 120.33 ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? -28.178  30.590  374.344 1.00 129.84 ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? -28.824  30.711  373.304 1.00 135.77 ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? -27.904  29.407  374.883 1.00 129.75 ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? -31.683  34.148  375.491 1.00 82.01  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? -32.679  35.160  375.133 1.00 75.22  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? -34.058  34.664  375.569 1.00 70.19  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? -34.637  33.796  374.913 1.00 70.55  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? -32.645  35.459  373.642 1.00 74.74  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? -33.163  36.749  373.362 1.00 64.14  ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? -34.565  35.216  376.666 1.00 68.60  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? -35.896  34.881  377.134 1.00 64.37  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? -36.851  36.058  377.101 1.00 72.47  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? -36.986  36.726  376.072 1.00 75.96  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? -37.526  36.304  378.221 1.00 77.01  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? -38.431  37.439  378.376 1.00 82.04  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? -37.759  38.754  378.001 1.00 77.69  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? -36.723  39.115  378.566 1.00 73.13  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? -38.926  37.492  379.822 1.00 90.11  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? -40.402  37.798  380.050 1.00 97.95  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? -41.257  37.126  378.992 1.00 101.59 ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? -40.817  37.361  381.446 1.00 98.52  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? -38.375  39.477  377.062 1.00 79.89  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? -37.847  40.742  376.547 1.00 88.49  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? -36.355  40.642  376.246 1.00 92.51  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? -35.562  41.517  376.596 1.00 96.98  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? -38.134  41.898  377.505 1.00 96.24  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? -39.579  42.271  377.589 1.00 103.10 ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? -40.308  42.907  376.629 1.00 103.60 ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? -40.468  42.067  378.697 1.00 106.32 ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? -41.595  43.092  377.058 1.00 105.83 ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? -41.721  42.590  378.326 1.00 107.70 ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? -40.330  41.488  379.962 1.00 103.76 ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? -42.827  42.551  379.170 1.00 106.21 ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? -41.432  41.451  380.799 1.00 101.76 ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? -42.662  41.980  380.400 1.00 103.01 ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? -35.969  39.546  375.597 1.00 91.50  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? -34.589  39.334  375.233 1.00 91.26  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? -33.651  39.088  376.390 1.00 91.52  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? -32.480  38.768  376.154 1.00 94.72  ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? -34.115  39.219  377.633 1.00 87.78  ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? -33.211  39.025  378.751 1.00 91.69  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? -32.917  37.537  378.939 1.00 98.64  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? -33.735  36.685  378.586 1.00 102.35 ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? -33.814  39.601  380.030 1.00 94.32  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? -34.066  41.109  380.008 1.00 100.90 ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? -32.845  41.898  379.564 1.00 100.38 ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? -32.987  43.375  379.901 1.00 93.91  ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? -34.377  43.862  379.699 1.00 88.28  ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? -31.746  37.201  379.477 1.00 105.11 ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? -31.372  35.785  379.612 1.00 105.17 ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? -32.131  35.100  380.734 1.00 95.34  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? -31.626  34.988  381.854 1.00 87.18  ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? -29.866  35.845  379.902 1.00 114.81 ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? -29.437  37.209  379.445 1.00 116.57 ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? -30.604  38.095  379.726 1.00 111.29 ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? -33.344  34.640  380.452 1.00 97.81  ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? -34.226  34.139  381.495 1.00 105.98 ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? -34.063  32.639  381.686 1.00 115.92 ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? -33.674  31.911  380.770 1.00 119.70 ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? -35.688  34.451  381.171 1.00 106.47 ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? -36.111  33.667  380.050 1.00 105.28 ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? -35.851  35.913  380.843 1.00 110.63 ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? -34.371  32.185  382.899 1.00 121.91 ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? -34.338  30.774  383.251 1.00 125.21 ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? -35.578  30.460  384.072 1.00 121.57 ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? -35.989  31.255  384.921 1.00 120.74 ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? -33.066  30.415  384.035 1.00 129.63 ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? -31.928  30.560  383.182 1.00 133.29 ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? -33.115  28.980  384.542 1.00 128.96 ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? -36.178  29.305  383.800 1.00 116.98 ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? -37.414  28.878  384.438 1.00 110.29 ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? -37.167  27.536  385.105 1.00 108.18 ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? -36.442  26.691  384.570 1.00 107.02 ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? -38.572  28.781  383.422 1.00 105.43 ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? -38.686  30.082  382.628 1.00 103.58 ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? -39.885  28.468  384.121 1.00 104.22 ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? -39.285  29.929  381.252 1.00 104.38 ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? -37.762  27.344  386.277 1.00 110.98 ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? -37.704  26.065  386.961 1.00 116.91 ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? -39.065  25.777  387.574 1.00 117.08 ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? -39.857  26.685  387.836 1.00 118.02 ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? -36.610  26.039  388.037 1.00 122.65 ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? -35.263  25.603  387.491 1.00 126.13 ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? -34.257  26.292  387.658 1.00 124.75 ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? -35.237  24.448  386.837 1.00 128.48 ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? -39.325  24.494  387.808 1.00 115.30 ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? -40.592  24.088  388.396 1.00 112.38 ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? -40.641  24.466  389.872 1.00 109.77 ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? -39.609  24.574  390.541 1.00 109.61 ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? -40.791  22.582  388.225 1.00 110.07 ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? -42.187  22.134  388.585 1.00 107.64 ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? -42.386  21.405  389.555 1.00 105.96 ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? -43.168  22.581  387.814 1.00 108.06 ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? -41.864  24.678  390.371 1.00 104.82 ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? -42.046  25.120  391.752 1.00 96.43  ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? -41.405  24.128  392.706 1.00 80.43  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? -40.724  24.507  393.665 1.00 70.98  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? -43.543  25.304  392.066 1.00 101.99 ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? -43.740  25.710  393.523 1.00 101.86 ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? -44.178  26.309  391.120 1.00 105.07 ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? -41.612  22.839  392.450 1.00 77.91  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? -40.987  21.812  393.267 1.00 80.51  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? -39.469  21.915  393.206 1.00 77.27  ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? -38.790  21.736  394.220 1.00 72.73  ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? -41.451  20.437  392.803 1.00 85.41  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? -41.019  19.306  393.691 1.00 88.74  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? -40.934  18.020  392.925 1.00 91.89  ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? -41.759  17.831  392.008 1.00 93.35  ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? -40.034  17.213  393.223 1.00 93.70  ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? -38.922  22.219  392.025 1.00 78.24  ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? -37.473  22.329  391.868 1.00 78.42  ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? -36.918  23.490  392.686 1.00 76.57  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? -35.984  23.321  393.482 1.00 74.81  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? -37.128  22.505  390.386 1.00 80.90  ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? -37.985  21.681  389.588 1.00 83.11  ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? -35.684  22.126  390.107 1.00 82.83  ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? -37.490  24.681  392.496 1.00 79.91  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? -37.042  25.860  393.230 1.00 84.12  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? -37.194  25.666  394.732 1.00 78.66  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? -36.308  26.040  395.507 1.00 73.08  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? -37.826  27.084  392.758 1.00 90.56  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? -37.583  27.445  391.293 1.00 95.01  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? -38.468  28.597  390.854 1.00 97.69  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? -36.115  27.793  391.097 1.00 95.66  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? -38.306  25.069  395.159 1.00 76.50  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? -38.502  24.795  396.575 1.00 71.44  ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? -37.443  23.829  397.088 1.00 71.46  ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? -36.816  24.069  398.125 1.00 74.10  ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? -39.907  24.241  396.804 1.00 64.62  ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? -37.209  22.740  396.350 1.00 65.22  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? -36.254  21.720  396.756 1.00 65.26  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? -34.832  22.253  396.792 1.00 75.04  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? -33.970  21.639  397.427 1.00 73.77  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? -36.337  20.533  395.793 1.00 64.22  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? -37.586  19.874  395.896 1.00 64.33  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? -34.570  23.372  396.111 1.00 87.86  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? -33.256  24.005  396.217 1.00 94.76  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? -32.934  24.332  397.673 1.00 94.64  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? -31.787  24.192  398.114 1.00 97.73  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? -33.183  25.263  395.329 1.00 99.06  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? -31.861  25.989  395.534 1.00 99.64  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? -33.346  24.896  393.863 1.00 100.19 ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? -33.935  24.750  398.445 1.00 90.99  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? -33.690  25.235  399.805 1.00 89.10  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? -33.209  24.103  400.706 1.00 82.52  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? -32.187  24.279  401.376 1.00 80.40  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? -34.928  25.913  400.414 1.00 94.86  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? -34.618  26.409  401.821 1.00 96.97  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? -35.383  27.047  399.551 1.00 96.79  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? -33.895  22.953  400.798 1.00 78.95  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? -33.355  21.885  401.659 1.00 80.59  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? -31.968  21.440  401.244 1.00 70.97  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? -31.131  21.144  402.107 1.00 71.13  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? -34.378  20.748  401.516 1.00 85.27  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? -35.278  21.130  400.408 1.00 83.02  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? -35.231  22.605  400.284 1.00 80.25  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? -31.712  21.379  399.933 1.00 64.50  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? -30.401  20.981  399.427 1.00 72.54  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? -29.311  21.799  400.102 1.00 84.48  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? -28.365  21.256  400.683 1.00 89.97  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? -30.347  21.140  397.895 1.00 63.79  ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? -31.258  20.123  397.208 1.00 69.97  ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? -28.921  20.980  397.385 1.00 63.69  ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? -31.272  20.233  395.695 1.00 63.82  ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? -29.434  23.124  400.036 1.00 90.64  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? -28.421  23.998  400.604 1.00 89.69  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? -28.543  24.134  402.115 1.00 88.82  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? -27.557  24.467  402.773 1.00 83.32  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? -28.510  25.382  399.959 1.00 88.11  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? -28.505  25.363  398.448 1.00 92.49  ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? -27.291  24.227  397.767 1.00 102.68 ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? -25.770  24.937  398.382 1.00 105.69 ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? -29.720  23.858  402.675 1.00 95.33  ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? -29.966  24.099  404.093 1.00 105.48 ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? -29.248  23.080  404.964 1.00 117.11 ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? -28.354  23.429  405.743 1.00 122.75 ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? -31.472  24.081  404.365 1.00 105.70 ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? -31.853  24.258  405.825 1.00 104.81 ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? -33.354  24.203  406.038 1.00 101.53 ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? -34.003  23.301  405.473 1.00 97.39  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? -33.887  25.067  406.764 1.00 101.74 ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? -29.624  21.805  404.844 1.00 106.51 ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? -29.052  20.737  405.665 1.00 111.01 ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? -28.570  19.641  404.717 1.00 119.46 ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? -29.272  18.665  404.442 1.00 119.05 ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? -30.066  20.217  406.697 1.00 107.37 ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? -31.460  19.925  406.152 1.00 101.83 ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? -32.497  19.923  407.266 1.00 92.88  ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? -33.854  20.067  406.752 1.00 82.15  ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? -34.940  19.670  407.404 1.00 70.29  ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? -34.827  19.104  408.597 1.00 69.29  ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? -36.139  19.837  406.864 1.00 62.49  ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? -27.357  19.824  404.206 1.00 127.80 ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? -26.687  18.816  403.411 1.00 134.92 ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? -27.190  18.690  401.988 1.00 140.29 ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? -28.400  18.694  401.741 1.00 138.87 ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? -26.261  18.561  401.042 1.00 145.76 ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? -26.601  18.266  399.657 1.00 149.60 ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? -26.598  16.768  399.387 1.00 155.32 ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? -27.459  16.267  398.657 1.00 153.73 ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? -25.636  18.977  398.709 1.00 148.64 ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? -25.627  16.044  399.949 1.00 161.30 ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? -25.653  14.586  399.876 1.00 164.27 ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? -26.894  14.031  400.556 1.00 164.34 ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? -27.428  12.999  400.132 1.00 165.59 ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? -24.392  14.000  400.511 1.00 167.56 ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? -23.162  14.185  399.644 1.00 171.60 ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? -23.098  13.566  398.561 1.00 173.16 ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? -22.261  14.948  400.045 1.00 173.89 ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? -27.347  14.692  401.625 1.00 165.07 ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? -28.648  14.391  402.209 1.00 170.24 ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? -29.733  14.341  401.142 1.00 175.25 ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? -30.587  13.448  401.152 1.00 176.14 ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? -28.986  15.442  403.269 1.00 170.78 ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? -30.386  15.361  403.775 1.00 169.15 ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? -30.840  14.620  404.825 1.00 168.95 ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? -31.528  16.042  403.240 1.00 165.59 ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? -32.192  14.803  404.982 1.00 168.15 ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? -32.638  15.670  404.019 1.00 167.20 ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? -31.717  16.930  402.178 1.00 161.26 ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? -33.919  16.156  403.771 1.00 166.72 ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? -32.990  17.411  401.933 1.00 160.42 ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? -34.074  17.023  402.726 1.00 163.15 ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? -29.701  15.287  400.200 1.00 179.52 ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? -30.602  15.239  399.051 1.00 185.04 ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? -30.243  14.087  398.119 1.00 194.75 ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? -31.111  13.299  397.725 1.00 198.20 ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? -30.554  16.574  398.303 1.00 181.61 ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? -31.461  16.643  397.101 1.00 178.82 ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? -32.791  17.001  397.232 1.00 177.32 ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? -30.974  16.356  395.836 1.00 177.50 ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? -33.615  17.074  396.122 1.00 175.54 ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? -31.796  16.421  394.728 1.00 176.02 ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? -33.117  16.782  394.872 1.00 175.15 ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? -28.963  13.973  397.756 1.00 198.69 ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? -28.535  12.941  396.817 1.00 199.56 ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? -28.704  11.532  397.371 1.00 198.18 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? -28.713  10.573  396.592 1.00 195.69 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? -27.077  13.170  396.415 1.00 200.85 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? -28.840  11.382  398.690 1.00 199.08 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? -29.113  10.069  399.260 1.00 199.93 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? -30.557  9.637   399.022 1.00 196.04 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? -30.906  8.486   399.307 1.00 199.66 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? -28.772  10.078  400.757 1.00 203.88 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? -28.864  8.727   401.459 1.00 206.52 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? -28.481  8.802   402.923 1.00 207.52 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? -27.358  9.169   403.264 1.00 207.83 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? -29.414  8.443   403.798 1.00 207.90 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? -31.388  10.515  398.469 1.00 188.78 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? -32.774  10.205  398.145 1.00 183.41 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? -32.902  9.976   396.645 1.00 181.57 ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? -32.361  10.746  395.847 1.00 182.87 ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? -33.719  11.326  398.591 1.00 181.73 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? -34.135  11.258  400.050 1.00 180.83 ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? -35.049  12.686  400.669 1.00 178.20 ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? -33.709  13.736  401.211 1.00 177.23 ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? -33.598  8.909   396.272 1.00 178.97 ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? -33.886  8.608   394.885 1.00 175.83 ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? -32.942  7.571   394.295 1.00 172.80 ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? -31.953  7.151   394.902 1.00 173.96 ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? -33.265  7.169   393.066 1.00 169.01 ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? -32.582  6.074   392.388 1.00 166.42 ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? -31.316  6.607   391.708 1.00 164.08 ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? -30.903  7.750   391.921 1.00 166.02 ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? -33.544  5.395   391.411 1.00 166.32 ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? -34.851  5.349   391.995 1.00 166.78 ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? -33.119  3.954   391.138 1.00 166.68 ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? -30.684  5.778   390.872 1.00 160.16 ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? -29.371  6.097   390.321 1.00 158.33 ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? -29.392  7.284   389.367 1.00 148.89 ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? -28.346  7.909   389.161 1.00 147.08 ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? -28.797  4.874   389.601 1.00 165.82 ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? -27.280  4.852   389.514 1.00 172.61 ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? -26.772  3.918   388.433 1.00 177.50 ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? -27.290  2.786   388.329 1.00 178.99 ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? -25.855  4.316   387.685 1.00 179.38 ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? -30.542  7.607   388.774 1.00 143.12 ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? -30.655  8.776   387.914 1.00 138.97 ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? -31.679  9.797   388.384 1.00 137.63 ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? -31.659  10.931  387.894 1.00 135.66 ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? -31.008  8.360   386.478 1.00 134.11 ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? -29.818  7.992   385.615 1.00 127.69 ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? -30.090  8.209   384.142 1.00 121.57 ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? -30.955  7.559   383.556 1.00 120.33 ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? -29.351  9.128   383.534 1.00 118.42 ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? -32.550  9.448   389.325 1.00 137.93 ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? -33.598  10.338  389.816 1.00 138.84 ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? -33.290  10.632  391.279 1.00 140.73 ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? -33.792  9.953   392.176 1.00 141.67 ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? -34.985  9.710   389.643 1.00 138.48 ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? -35.320  9.574   388.272 1.00 138.89 ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? -32.476  11.654  391.518 1.00 141.85 ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? -31.988  11.947  392.856 1.00 143.89 ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? -32.978  12.836  393.601 1.00 144.55 ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? -33.776  13.561  393.003 1.00 145.08 ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? -30.620  12.630  392.796 1.00 144.55 ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? -29.557  11.858  392.026 1.00 146.13 ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? -29.220  10.532  392.691 1.00 148.05 ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? -28.130  9.801   391.920 1.00 147.42 ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? -27.890  8.427   392.437 1.00 146.33 ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? -32.919  12.767  394.926 1.00 144.04 ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? -33.761  13.600  395.759 1.00 140.58 ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? -35.135  13.013  395.999 1.00 138.58 ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? -35.436  11.860  395.680 1.00 138.97 ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? -35.986  13.844  396.585 1.00 139.06 ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? -37.368  13.491  396.865 1.00 146.06 ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? -38.282  14.089  395.805 1.00 149.98 ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? -37.862  14.878  394.957 1.00 150.62 ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? -37.776  13.995  398.249 1.00 152.33 ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? -37.845  15.506  398.323 1.00 157.53 ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? -36.227  16.233  398.008 1.00 162.67 ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? -36.527  17.965  398.350 1.00 163.60 ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? -39.555  13.707  395.871 1.00 153.21 ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? -40.552  14.125  394.902 1.00 152.36 ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? -41.899  14.175  395.606 1.00 150.19 ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? -42.165  13.395  396.524 1.00 148.88 ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? -40.605  13.163  393.704 1.00 150.26 ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? -41.720  13.440  392.706 1.00 146.09 ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? -41.496  14.749  391.977 1.00 143.01 ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? -42.534  14.978  390.888 1.00 142.14 ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? -43.910  15.038  391.455 1.00 143.30 ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? -42.748  15.094  395.167 1.00 150.27 ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? -44.125  15.154  395.645 1.00 151.91 ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? -44.964  14.277  394.726 1.00 153.21 ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? -45.344  14.693  393.630 1.00 157.34 ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? -44.630  16.590  395.681 1.00 150.24 ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? -44.276  17.512  396.849 1.00 148.32 ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? -42.837  17.367  397.300 1.00 149.25 ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? -44.550  18.939  396.432 1.00 146.28 ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? -45.230  13.048  395.160 1.00 147.61 ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? -46.102  12.163  394.409 1.00 141.48 ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? -47.551  12.535  394.685 1.00 135.69 ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? -47.885  13.075  395.743 1.00 134.55 ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? -45.867  10.704  394.808 1.00 145.82 ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? -44.565  10.098  394.322 1.00 152.29 ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? -43.356  10.439  394.907 1.00 155.97 ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? -44.553  9.161   393.299 1.00 156.24 ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? -42.167  9.880   394.472 1.00 158.58 ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? -43.370  8.595   392.859 1.00 159.10 ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? -42.181  8.959   393.448 1.00 159.85 ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? -41.003  8.398   393.010 1.00 160.95 ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? -48.417  12.264  393.716 1.00 133.79 ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? -49.839  12.480  393.927 1.00 135.03 ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? -50.613  11.426  393.157 1.00 132.88 ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? -50.177  10.959  392.103 1.00 132.72 ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? -50.286  13.887  393.504 1.00 140.53 ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? -50.090  14.213  392.032 1.00 145.91 ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? -48.667  14.600  391.691 1.00 150.41 ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? -47.784  14.562  392.542 1.00 153.02 ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? -48.437  14.979  390.440 1.00 151.09 ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? -51.766  11.054  393.699 1.00 131.04 ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? -52.601  10.024  393.098 1.00 129.12 ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? -54.052  10.483  393.146 1.00 132.12 ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? -54.477  11.176  394.077 1.00 131.23 ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? -52.416  8.650   393.783 1.00 125.52 ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? -53.138  7.557   392.994 1.00 124.80 ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? -52.905  8.691   395.222 1.00 124.73 ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? -53.084  6.197   393.641 1.00 127.52 ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? -54.809  10.089  392.123 1.00 136.51 ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? -56.214  10.441  392.003 1.00 137.28 ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? -57.005  9.253   391.471 1.00 138.17 ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? -56.480  8.399   390.744 1.00 138.76 ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? -56.410  11.655  391.085 1.00 135.80 ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? -55.560  11.585  389.954 1.00 135.87 ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? -58.280  9.216   391.849 1.00 136.59 ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? -59.181  8.146   391.494 1.00 135.88 ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? -60.051  7.741   392.668 1.00 135.43 ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? -60.068  8.399   393.713 1.00 134.02 ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? -60.800  6.645   392.514 1.00 135.15 ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? -61.673  6.142   393.600 1.00 135.67 ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? -60.917  5.315   394.635 1.00 137.95 ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? -61.127  4.110   394.804 1.00 137.19 ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? -62.712  5.312   392.830 1.00 132.22 ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? -62.484  5.605   391.358 1.00 130.04 ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? -61.043  5.936   391.250 1.00 131.63 ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? -60.017  5.967   395.368 1.00 138.69 ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? -59.240  5.304   396.407 1.00 136.66 ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? -59.595  5.945   397.743 1.00 135.15 ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? -60.142  7.049   397.804 1.00 134.74 ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? -57.719  5.371   396.132 1.00 135.88 ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? -57.151  6.703   396.554 1.00 136.59 ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? -56.989  4.228   396.814 1.00 135.76 ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? -59.288  5.227   398.827 1.00 134.92 ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? -59.753  5.650   400.145 1.00 135.61 ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? -59.135  6.982   400.551 1.00 136.65 ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? -59.835  7.874   401.039 1.00 134.56 ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? -59.463  4.579   401.197 1.00 134.51 ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? -59.900  5.010   402.592 1.00 133.25 ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? -59.961  3.856   403.572 1.00 132.01 ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? -60.372  4.347   404.951 1.00 131.10 ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? -61.496  5.318   404.876 1.00 130.14 ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? -57.820  7.130   400.389 1.00 139.13 ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? -57.129  8.385   400.691 1.00 140.68 ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? -56.224  8.777   399.527 1.00 142.09 ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? -55.015  8.511   399.536 1.00 143.07 ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? -56.364  8.285   402.016 1.00 140.15 ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? -55.406  7.105   402.163 1.00 139.02 ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? -54.840  7.050   403.578 1.00 139.26 ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? -55.710  6.315   404.492 1.00 141.38 ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? -55.586  5.019   404.764 1.00 145.88 ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? -54.618  4.312   404.201 1.00 147.86 ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? -56.426  4.431   405.606 1.00 147.11 ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? -56.783  9.415   398.501 1.00 142.35 ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? -55.964  9.947   397.409 1.00 144.49 ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? -55.258  11.226  397.837 1.00 150.72 ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? -55.489  11.761  398.921 1.00 155.31 ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? -56.988  10.232  396.306 1.00 142.55 ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? -58.243  10.525  397.052 1.00 141.47 ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? -58.220  9.660   398.286 1.00 141.93 ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? -54.377  11.714  396.966 1.00 151.74 ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? -53.801  13.015  397.242 1.00 152.29 ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? -52.309  13.183  397.051 1.00 152.31 ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? -51.705  12.533  396.193 1.00 152.35 ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? -51.714  14.060  397.863 1.00 149.80 ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? -50.313  14.452  397.753 1.00 141.99 ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? -49.517  13.799  398.875 1.00 131.97 ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? -50.000  13.689  400.008 1.00 131.56 ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? -50.170  15.986  397.811 1.00 141.04 ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? -48.753  16.411  397.459 1.00 140.80 ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? -51.202  16.667  396.915 1.00 138.98 ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? -48.286  13.386  398.564 1.00 122.86 ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? -47.393  12.769  399.540 1.00 120.78 ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? -45.955  13.074  399.144 1.00 114.44 ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? -45.537  12.759  398.026 1.00 110.81 ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? -47.624  11.256  399.628 1.00 130.69 ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? -49.035  10.883  400.032 1.00 140.23 ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? -49.422  10.885  401.365 1.00 143.08 ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? -49.984  10.538  399.079 1.00 143.09 ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? -50.716  10.554  401.738 1.00 143.00 ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? -51.277  10.205  399.443 1.00 143.31 ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? -51.638  10.214  400.773 1.00 142.59 ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? -52.924  9.879   401.129 1.00 140.97 ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? -45.205  13.687  400.055 1.00 118.21 ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? -43.799  14.025  399.836 1.00 124.23 ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? -42.951  12.799  400.149 1.00 125.82 ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? -42.730  12.469  401.317 1.00 124.14 ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? -43.398  15.204  400.714 1.00 127.86 ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? -42.008  15.749  400.458 1.00 126.75 ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? -41.609  16.779  401.490 1.00 122.74 ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? -42.512  17.336  402.147 1.00 121.68 ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? -40.398  17.041  401.643 1.00 120.07 ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? -42.468  12.111  399.115 1.00 130.36 ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? -41.792  10.836  399.302 1.00 137.14 ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? -40.542  10.756  398.438 1.00 145.49 ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? -40.445  11.438  397.412 1.00 145.50 ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? -42.723  9.661   398.959 1.00 134.70 ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? -44.091  9.697   399.642 1.00 134.76 ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? -45.079  8.737   398.985 1.00 134.06 ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? -43.946  9.422   401.127 1.00 136.79 ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? -39.566  9.942   398.833 1.00 153.69 ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? -38.398  9.717   397.975 1.00 156.47 ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? -38.762  8.938   396.718 1.00 155.33 ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? -39.797  8.273   396.635 1.00 155.56 ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? -37.442  8.921   398.872 1.00 160.85 ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? -38.316  8.316   399.920 1.00 161.82 ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? -39.407  9.314   400.155 1.00 158.72 ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? -37.880  9.037   395.727 1.00 155.03 ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? -38.095  8.413   394.426 1.00 154.10 ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? -37.690  6.941   394.442 1.00 148.31 ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? -36.607  6.594   394.922 1.00 150.00 ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? -37.295  9.163   393.360 1.00 157.30 ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? -37.925  9.176   391.982 1.00 158.13 ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? -39.092  10.541  391.829 1.00 156.66 ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? -37.989  11.884  391.396 1.00 154.46 ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? -38.556  6.078   393.910 1.00 139.77 ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? -38.215  4.673   393.784 1.00 133.38 ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? -39.189  3.670   394.372 1.00 132.10 ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? -39.013  2.463   394.180 1.00 132.72 ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? -40.209  4.140   395.087 1.00 132.98 ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? -41.194  3.232   395.666 1.00 134.28 ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? -41.956  2.493   394.573 1.00 139.55 ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? -42.249  3.049   393.513 1.00 140.85 ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? -42.185  3.996   396.550 1.00 129.54 ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? -43.080  4.750   395.725 1.00 124.80 ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? -41.450  4.943   397.487 1.00 129.47 ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? -42.279  1.230   394.836 1.00 140.38 ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? -43.064  0.463   393.883 1.00 138.48 ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? -44.520  0.918   393.923 1.00 141.72 ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? -44.991  1.501   394.903 1.00 143.11 ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? -42.974  -1.037  394.178 1.00 132.28 ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? -43.475  -1.298  395.494 1.00 130.13 ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? -41.534  -1.520  394.081 1.00 130.73 ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? -45.232  0.657   392.824 1.00 144.48 ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? -46.617  1.103   392.720 1.00 147.60 ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? -47.485  0.437   393.778 1.00 146.37 ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? -48.401  1.061   394.326 1.00 146.58 ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? -47.161  0.819   391.317 1.00 152.58 ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? -46.325  1.409   390.212 1.00 154.24 ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? -45.182  0.768   389.769 1.00 155.39 ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? -46.674  2.616   389.629 1.00 151.19 ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? -44.410  1.309   388.763 1.00 153.19 ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? -45.903  3.161   388.621 1.00 149.69 ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? -44.770  2.506   388.189 1.00 150.81 ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? -47.212  -0.835  394.072 1.00 144.95 ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? -47.972  -1.552  395.088 1.00 144.96 ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? -47.906  -0.827  396.425 1.00 140.46 ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? -48.933  -0.597  397.075 1.00 136.94 ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? -47.436  -2.977  395.220 1.00 150.01 ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? -48.190  -3.858  396.197 1.00 150.19 ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? -47.398  -5.123  396.485 1.00 148.42 ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? -46.978  -5.778  395.251 1.00 145.17 ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? -47.765  -6.554  394.515 1.00 142.90 ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? -49.016  -6.779  394.892 1.00 141.05 ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? -47.302  -7.107  393.404 1.00 143.78 ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? -46.694  -0.471  396.855 1.00 142.08 ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? -46.524  0.269   398.100 1.00 145.64 ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? -47.282  1.590   398.075 1.00 143.51 ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? -47.982  1.933   399.034 1.00 145.45 ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? -45.039  0.522   398.357 1.00 150.11 ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? -44.780  1.594   399.404 1.00 153.39 ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? -43.308  1.775   399.711 1.00 154.56 ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? -42.514  0.865   399.392 1.00 153.86 ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? -42.945  2.833   400.268 1.00 154.33 ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? -47.155  2.348   396.983 1.00 138.49 ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? -47.815  3.649   396.906 1.00 138.23 ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? -49.328  3.515   397.024 1.00 141.49 ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? -49.968  4.234   397.798 1.00 139.24 ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? -47.432  4.360   395.607 1.00 139.61 ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? -47.461  5.897   395.605 1.00 144.55 ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? -46.818  6.437   394.344 1.00 146.92 ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? -48.868  6.474   395.749 1.00 145.26 ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? -49.921  2.599   396.259 1.00 149.69 ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? -51.377  2.496   396.236 1.00 157.99 ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? -51.902  1.913   397.543 1.00 159.10 ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? -52.895  2.397   398.098 1.00 159.85 ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? -51.840  1.680   395.016 1.00 165.52 ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? -51.277  2.287   393.729 1.00 167.83 ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? -53.358  1.626   394.955 1.00 167.67 ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? -51.064  1.285   392.618 1.00 169.91 ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? -51.249  0.874   398.062 1.00 157.77 ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? -51.786  0.139   399.203 1.00 154.34 ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? -51.387  0.779   400.531 1.00 149.02 ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? -52.251  1.154   401.329 1.00 148.35 ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? -51.332  -1.324  399.136 1.00 156.35 ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? -52.093  -2.126  398.106 1.00 156.97 ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? -53.437  -2.424  398.282 1.00 157.10 ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? -51.472  -2.571  396.948 1.00 156.69 ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? -54.138  -3.149  397.336 1.00 157.24 ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? -52.165  -3.297  395.999 1.00 156.61 ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? -53.497  -3.582  396.197 1.00 156.95 ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? -54.191  -4.304  395.253 1.00 156.81 ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? -50.082  0.904   400.781 1.00 144.55 ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? -49.615  1.506   402.026 1.00 141.60 ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? -50.087  2.949   402.155 1.00 136.78 ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? -50.628  3.349   403.194 1.00 135.90 ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? -48.088  1.440   402.100 1.00 144.53 ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? -47.509  0.040   402.170 1.00 149.67 ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? -47.432  -0.485  403.589 1.00 154.85 ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? -48.470  -0.486  404.285 1.00 156.20 ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? -46.329  -0.887  404.014 1.00 156.67 ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? -49.899  3.744   401.103 1.00 133.73 ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? -50.124  5.186   401.162 1.00 131.80 ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? -51.566  5.552   400.819 1.00 128.54 ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? -52.270  6.151   401.636 1.00 129.24 ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? -49.136  5.888   400.227 1.00 134.44 ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? -47.718  5.556   400.551 1.00 140.23 ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? -46.942  4.605   399.960 1.00 141.96 ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? -46.905  6.173   401.551 1.00 143.02 ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? -45.694  4.589   400.531 1.00 143.03 ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? -45.646  5.544   401.511 1.00 144.24 ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? -47.118  7.196   402.477 1.00 143.07 ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? -44.607  5.906   402.361 1.00 144.76 ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? -46.086  7.552   403.319 1.00 143.21 ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? -44.848  6.909   403.256 1.00 143.91 ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? -52.022  5.193   399.619 1.00 127.33 ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? -53.373  5.558   399.211 1.00 129.40 ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? -54.439  4.710   399.889 1.00 130.94 ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? -55.630  4.996   399.726 1.00 129.19 ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? -53.511  5.453   397.692 1.00 130.43 ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? -54.047  3.681   400.636 1.00 134.43 ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? -54.992  2.870   401.371 1.00 137.37 ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? -55.640  1.761   400.581 1.00 140.13 ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? -56.584  1.138   401.081 1.00 140.89 ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? -55.168  1.493   399.368 1.00 141.10 ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? -55.695  0.420   398.562 1.00 138.83 ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? -56.991  0.807   397.880 1.00 132.67 ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? -57.746  1.656   398.363 1.00 133.78 ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? -57.282  0.174   396.748 1.00 126.10 ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? -58.471  0.547   395.974 1.00 126.57 ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? -59.763  0.240   396.715 1.00 129.20 ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? -59.803  -0.530  397.677 1.00 131.72 ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? -58.354  -0.307  394.706 1.00 127.39 ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? -56.910  -0.707  394.639 1.00 127.60 ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? -56.462  -0.835  396.057 1.00 125.65 ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? -60.837  0.870   396.241 1.00 130.31 ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? -62.189  0.527   396.660 1.00 132.76 ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? -62.919  -0.309  395.623 1.00 134.58 ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? -63.899  -0.980  395.965 1.00 132.47 ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? -63.010  1.795   396.932 1.00 133.21 ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? -62.377  2.906   397.768 1.00 132.22 ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? -63.076  4.227   397.495 1.00 129.79 ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? -62.454  2.562   399.246 1.00 133.16 ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? -62.459  -0.282  394.373 1.00 138.59 ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? -63.042  -1.041  393.276 1.00 142.05 ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? -61.903  -1.567  392.407 1.00 140.86 ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? -60.755  -1.134  392.577 1.00 133.73 ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? -64.012  -0.165  392.477 1.00 145.27 ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? -65.114  0.471   393.318 1.00 151.46 ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? -66.298  -0.449  393.540 1.00 158.42 ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? -66.702  -1.150  392.590 1.00 161.13 ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? -66.825  -0.475  394.673 1.00 159.87 ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? -62.157  -2.493  391.480 1.00 145.70 ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? -61.070  -2.977  390.614 1.00 144.33 ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? -60.602  -1.896  389.650 1.00 138.31 ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? -61.410  -1.200  389.032 1.00 134.95 ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? -61.702  -4.162  389.871 1.00 144.45 ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? -62.907  -4.531  390.678 1.00 144.90 ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? -63.400  -3.254  391.264 1.00 146.93 ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? -59.283  -1.758  389.531 1.00 135.25 ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? -58.657  -0.807  388.621 1.00 132.12 ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? -58.194  -1.575  387.392 1.00 134.91 ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? -57.577  -2.640  387.517 1.00 140.78 ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? -57.479  -0.081  389.299 1.00 130.29 ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? -57.935  1.237   389.930 1.00 135.44 ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? -56.346  0.182   388.315 1.00 124.60 ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? -58.897  1.079   391.088 1.00 139.04 ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? -58.506  -1.054  386.202 1.00 132.84 ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? -58.068  -1.715  384.979 1.00 134.17 ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? -56.725  -1.207  384.489 1.00 134.28 ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? -56.019  -1.941  383.789 1.00 135.95 ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? -59.084  -1.530  383.845 1.00 134.65 ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? -59.170  -0.114  383.302 1.00 133.18 ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? -60.219  0.035   382.220 1.00 129.54 ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? -60.459  -0.884  381.437 1.00 127.49 ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? -60.842  1.202   382.162 1.00 129.33 ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? -56.353  0.020   384.844 1.00 131.78 ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? -55.082  0.567   384.397 1.00 130.06 ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? -54.702  1.740   385.286 1.00 126.44 ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? -55.505  2.243   386.074 1.00 127.34 ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? -55.142  1.000   382.930 1.00 130.70 ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? -53.454  2.172   385.140 1.00 120.84 ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? -52.912  3.279   385.913 1.00 112.85 ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? -52.130  4.171   384.961 1.00 94.67  ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? -51.380  3.680   384.112 1.00 89.61  ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? -52.034  2.776   387.081 1.00 120.68 ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? -50.968  1.788   386.590 1.00 124.21 ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? -52.894  2.119   388.156 1.00 120.44 ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? -49.577  2.377   386.447 1.00 123.53 ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? -52.320  5.480   385.088 1.00 86.52  ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? -51.536  6.449   384.330 1.00 83.64  ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? -50.533  7.047   385.307 1.00 86.31  ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? -50.906  7.914   386.112 1.00 89.58  ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? -52.432  7.519   383.685 1.00 77.67  ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? -53.490  6.865   382.796 1.00 74.14  ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? -51.602  8.445   382.839 1.00 74.60  ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? -54.495  7.834   382.209 1.00 68.47  ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? -49.278  6.559   385.317 1.00 88.82  ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? -48.332  6.920   386.386 1.00 98.43  ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? -47.882  8.374   386.418 1.00 110.26 ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? -48.091  9.065   387.418 1.00 117.17 ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? -47.134  5.997   386.113 1.00 94.34  ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? -47.266  5.597   384.680 1.00 88.61  ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? -48.731  5.536   384.411 1.00 86.88  ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? -47.264  8.853   385.340 1.00 112.35 ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? -46.536  10.106  385.418 1.00 111.31 ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? -47.416  11.338  385.454 1.00 109.99 ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? -47.478  12.038  386.467 1.00 110.33 ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? -48.086  11.618  384.350 1.00 110.23 ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? -49.061  12.692  384.277 1.00 113.11 ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? -50.068  12.349  383.213 1.00 114.21 ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? -50.295  11.174  382.917 1.00 110.99 ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? -50.656  13.376  382.604 1.00 117.95 ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? -51.488  13.130  381.434 1.00 119.62 ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? -50.636  12.841  380.206 1.00 119.96 ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? -51.050  12.068  379.335 1.00 116.70 ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? -52.417  14.320  381.184 1.00 120.67 ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? -53.163  14.143  379.991 1.00 121.63 ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? -49.446  13.442  380.126 1.00 123.03 ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? -48.511  13.210  379.031 1.00 124.01 ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? -47.840  11.851  379.112 1.00 124.81 ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? -47.058  11.507  378.217 1.00 125.82 ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? -47.435  14.300  379.025 1.00 124.17 ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? -48.011  15.595  378.992 1.00 123.43 ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? -48.121  11.077  380.151 1.00 124.77 ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? -47.303  9.889   380.301 1.00 129.25 ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? -48.067  8.640   379.885 1.00 129.89 ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? -49.279  8.545   380.114 1.00 128.65 ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? -46.844  9.746   381.748 1.00 133.60 ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? -47.970  9.905   382.620 1.00 136.55 ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? -45.818  10.813  382.062 1.00 134.39 ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? -47.373  7.685   379.278 1.00 133.12 ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? -48.032  6.467   378.806 1.00 136.69 ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? -48.524  5.625   379.970 1.00 138.90 ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? -47.796  5.415   380.952 1.00 138.03 ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? -46.922  5.749   378.024 1.00 137.97 ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? -45.969  6.844   377.641 1.00 136.65 ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? -45.985  7.785   378.799 1.00 134.48 ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? -49.761  5.138   379.903 1.00 140.76 ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? -50.254  4.223   380.937 1.00 143.30 ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? -49.644  2.836   380.798 1.00 144.21 ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? -49.275  2.398   379.705 1.00 144.40 ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? -51.767  4.192   380.690 1.00 140.30 ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? -51.911  4.540   379.248 1.00 136.67 ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? -50.828  5.541   378.972 1.00 137.69 ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? -49.536  2.143   381.931 1.00 143.54 ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? -49.051  0.772   381.947 1.00 145.81 ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? -50.099  -0.155  382.551 1.00 149.20 ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? -50.941  0.286   383.340 1.00 148.49 ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? -47.736  0.653   382.728 1.00 147.38 ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? -46.580  1.429   382.099 1.00 148.37 ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? -45.324  1.296   382.943 1.00 150.91 ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? -46.342  0.965   380.669 1.00 146.79 ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? -50.082  -1.439  382.194 1.00 153.29 ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? -51.123  -2.355  382.675 1.00 156.09 ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? -51.058  -2.564  384.181 1.00 158.05 ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? -50.120  -2.158  384.870 1.00 160.70 ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? -50.827  -3.660  381.925 1.00 156.42 ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? -49.950  -3.261  380.782 1.00 154.84 ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? -49.145  -2.114  381.281 1.00 153.76 ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? -52.108  -3.208  384.691 1.00 156.86 ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? -52.202  -3.596  386.098 1.00 155.80 ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? -51.652  -5.007  386.279 1.00 159.28 ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? -52.374  -5.998  386.157 1.00 160.59 ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? -53.640  -3.497  386.590 1.00 151.45 ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? -53.750  -3.184  388.052 1.00 148.55 ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? -53.098  -2.086  388.586 1.00 147.99 ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? -54.482  -3.997  388.898 1.00 146.67 ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? -53.187  -1.796  389.933 1.00 147.15 ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? -54.572  -3.713  390.248 1.00 146.97 ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? -53.923  -2.610  390.764 1.00 147.27 ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? -50.359  -5.106  386.579 1.00 158.67 ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? -49.706  -6.392  386.787 1.00 157.52 ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? -48.957  -6.345  388.110 1.00 157.50 ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? -48.384  -5.313  388.469 1.00 160.55 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? -48.749  -6.735  385.637 1.00 155.50 ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? -49.445  -6.642  384.388 1.00 154.66 ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? -48.195  -8.143  385.792 1.00 156.11 ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? -48.970  -7.465  388.837 1.00 154.77 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? -48.261  -7.537  390.111 1.00 153.35 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? -46.775  -7.254  389.939 1.00 150.57 ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? -46.218  -6.374  390.603 1.00 148.78 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? -48.478  -8.909  390.748 1.00 157.93 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? -49.893  -9.131  391.235 1.00 162.97 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? -50.182  -8.361  392.505 1.00 168.76 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? -49.587  -8.696  393.550 1.00 171.85 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? -50.990  -7.410  392.456 1.00 169.60 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? -46.113  -7.989  389.043 1.00 152.09 ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? -44.711  -7.712  388.759 1.00 155.92 ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? -44.510  -6.313  388.190 1.00 161.23 ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? -43.408  -5.764  388.297 1.00 161.90 ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? -44.147  -8.769  387.809 1.00 153.44 ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? -42.637  -8.926  387.903 1.00 149.41 ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? -42.111  -10.037 387.022 1.00 145.67 ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? -41.935  -9.802  385.809 1.00 144.68 ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? -41.874  -11.146 387.543 1.00 144.39 ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? -45.549  -5.726  387.592 1.00 165.05 ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? -45.506  -4.320  387.202 1.00 168.71 ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? -45.837  -3.429  388.394 1.00 171.60 ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? -45.265  -2.347  388.553 1.00 169.71 ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? -46.442  -4.060  386.005 1.00 168.69 ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? -46.599  -2.567  385.751 1.00 168.72 ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? -45.908  -4.751  384.754 1.00 168.45 ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? -46.782  -3.848  389.238 1.00 175.76 ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? -46.998  -3.131  390.490 1.00 177.24 ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? -45.733  -3.121  391.334 1.00 176.20 ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? -45.465  -2.147  392.047 1.00 172.82 ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? -48.148  -3.763  391.274 1.00 181.12 ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? -49.560  -3.345  390.863 1.00 184.36 ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? -50.591  -4.302  391.442 1.00 187.11 ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? -49.841  -1.917  391.301 1.00 184.00 ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? -44.944  -4.192  391.257 1.00 178.47 ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? -43.669  -4.312  391.947 1.00 177.78 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? -42.519  -3.637  391.198 1.00 174.04 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? -41.352  -3.938  391.479 1.00 172.97 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? -43.349  -5.789  392.191 1.00 179.08 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? -44.246  -6.413  393.244 1.00 179.28 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? -44.164  -5.999  394.420 1.00 179.29 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? -45.034  -7.316  392.898 1.00 179.50 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? -42.817  -2.749  390.248 1.00 170.74 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? -41.860  -1.956  389.482 1.00 167.03 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? -41.548  -0.664  390.229 1.00 157.76 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? -42.456  -0.015  390.752 1.00 154.00 ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? -42.403  -1.620  388.092 1.00 170.28 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? -42.697  -2.829  387.379 1.00 173.07 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? -41.402  -0.796  387.288 1.00 169.71 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? -40.278  -0.277  390.325 1.00 154.87 ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? -39.952  1.012   390.947 1.00 154.89 ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? -40.237  2.159   389.987 1.00 152.98 ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? -39.811  2.142   388.831 1.00 151.92 ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? -38.452  0.897   391.253 1.00 157.09 ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? -38.081  -0.543  390.971 1.00 157.24 ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? -39.076  -1.054  389.992 1.00 155.24 ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? -40.983  3.145   390.472 1.00 151.45 ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? -41.268  4.345   389.697 1.00 148.61 ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? -39.999  5.173   389.542 1.00 147.53 ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? -39.443  5.655   390.534 1.00 143.65 ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? -42.358  5.164   390.379 1.00 148.10 ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? -43.465  4.332   390.978 1.00 150.45 ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? -44.598  5.348   391.931 1.00 153.98 ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? -45.574  6.088   390.626 1.00 154.36 ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? -39.534  5.333   388.307 1.00 151.12 ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? -38.329  6.110   388.061 1.00 152.92 ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? -38.329  6.591   386.618 1.00 150.29 ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? -39.150  6.174   385.797 1.00 149.79 ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? -37.066  5.296   388.351 1.00 156.24 ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? -36.848  4.340   387.330 1.00 158.47 ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? -37.378  7.479   386.322 1.00 146.53 ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? -37.202  8.019   384.980 1.00 142.38 ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? -36.692  6.983   383.992 1.00 140.04 ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? -36.704  7.243   382.785 1.00 139.94 ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? -36.227  9.193   385.023 1.00 141.12 ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? -36.784  10.448  385.651 1.00 140.32 ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? -38.098  10.512  386.082 1.00 140.61 ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? -35.986  11.566  385.828 1.00 139.61 ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? -38.603  11.658  386.664 1.00 141.09 ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? -36.481  12.715  386.408 1.00 139.37 ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? -37.790  12.757  386.822 1.00 140.11 ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? -38.283  13.904  387.400 1.00 139.70 ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? -36.245  5.830   384.472 1.00 137.20 ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? -35.594  4.815   383.657 1.00 134.04 ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? -36.329  3.487   383.674 1.00 134.21 ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? -36.450  2.839   382.632 1.00 132.15 ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? -34.157  4.618   384.144 1.00 132.85 ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? -34.032  4.711   385.652 1.00 134.34 ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? -32.667  5.171   386.100 1.00 137.58 ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? -31.686  4.936   385.365 1.00 139.77 ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? -32.575  5.752   387.199 1.00 138.71 ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? -36.800  3.048   384.843 1.00 139.21 ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? -37.577  1.816   384.911 1.00 147.63 ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? -38.873  1.955   384.125 1.00 148.08 ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? -39.319  1.006   383.469 1.00 148.95 ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? -37.839  1.444   386.369 1.00 152.79 ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? -36.588  1.281   387.176 1.00 153.24 ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? -35.830  2.353   387.597 1.00 152.35 ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? -35.950  0.172   387.620 1.00 153.04 ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? -34.786  1.913   388.275 1.00 152.75 ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? -34.835  0.593   388.303 1.00 153.37 ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? -39.489  3.137   384.173 1.00 147.20 ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? -40.640  3.396   383.320 1.00 149.85 ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? -40.212  3.552   381.868 1.00 157.46 ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? -40.981  3.220   380.959 1.00 158.50 ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? -41.389  4.636   383.809 1.00 145.66 ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? -42.328  4.394   384.994 1.00 141.22 ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? -42.388  5.594   385.912 1.00 139.10 ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? -43.720  4.055   384.496 1.00 138.33 ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? -38.992  4.045   381.638 1.00 163.35 ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? -38.467  4.189   380.282 1.00 166.82 ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? -38.511  2.861   379.532 1.00 168.23 ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? -39.023  2.785   378.411 1.00 168.18 ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? -37.039  4.742   380.335 1.00 168.05 ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? -36.137  4.333   379.179 1.00 169.86 ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? -36.380  5.147   377.926 1.00 173.20 ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? -36.835  6.288   377.990 1.00 174.50 ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? -36.076  4.560   376.773 1.00 174.15 ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? -37.978  1.796   380.140 1.00 169.01 ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? -37.865  0.513   379.454 1.00 168.64 ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? -39.209  -0.184  379.271 1.00 165.89 ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? -39.274  -1.182  378.546 1.00 167.90 ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? -36.906  -0.406  380.211 1.00 170.35 ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? -40.273  0.311   379.900 1.00 161.15 ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? -41.632  -0.131  379.621 1.00 158.86 ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? -42.345  0.806   378.654 1.00 160.62 ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? -43.570  0.727   378.508 1.00 159.21 ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? -42.425  -0.262  380.925 1.00 157.52 ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? -43.579  -1.262  380.879 1.00 158.40 ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? -43.119  -2.706  380.925 1.00 159.30 ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? -44.284  -3.648  380.646 1.00 156.89 ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? -43.847  -4.931  380.027 1.00 155.02 ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? -41.600  1.684   377.982 1.00 162.46 ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? -42.145  2.634   377.044 1.00 159.04 ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? -42.622  3.928   377.672 1.00 153.16 ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? -42.591  4.975   377.018 1.00 153.77 ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? -43.039  3.883   378.932 1.00 146.59 ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? -43.560  5.047   379.628 1.00 140.01 ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? -42.410  5.864   380.212 1.00 133.27 ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? -41.241  5.686   379.861 1.00 130.45 ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? -44.553  4.617   380.706 1.00 141.15 ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? -45.352  5.708   381.132 1.00 140.65 ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? -42.749  6.794   381.096 1.00 129.84 ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? -41.778  7.645   381.763 1.00 127.11 ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? -42.417  8.149   383.046 1.00 124.09 ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? -43.638  8.091   383.212 1.00 125.54 ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? -41.343  8.808   380.868 1.00 129.62 ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? -42.508  9.567   380.252 1.00 133.15 ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? -42.005  10.731  378.972 1.00 137.66 ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? -41.514  9.608   377.667 1.00 136.51 ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? -41.585  8.647   383.953 1.00 121.10 ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? -42.077  9.179   385.222 1.00 119.86 ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? -42.195  10.684  385.025 1.00 123.36 ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? -41.277  11.446  385.322 1.00 124.12 ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? -41.143  8.820   386.370 1.00 116.59 ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? -41.536  9.337   387.752 1.00 115.23 ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? -42.838  8.692   388.192 1.00 114.91 ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? -40.431  9.067   388.760 1.00 115.36 ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? -43.342  11.108  384.509 1.00 126.33 ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? -43.525  12.499  384.159 1.00 131.59 ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? -43.637  13.430  385.344 1.00 137.94 ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? -42.724  14.217  385.606 1.00 140.63 ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? -44.745  13.340  386.082 1.00 140.33 ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? -45.004  14.262  387.177 1.00 140.08 ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? -45.279  13.573  388.507 1.00 142.21 ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? -45.520  14.265  389.502 1.00 141.38 ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? -46.197  15.170  386.836 1.00 135.59 ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? -47.243  14.384  386.256 1.00 132.71 ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? -45.783  16.235  385.836 1.00 134.02 ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? -45.253  12.244  388.558 1.00 143.05 ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? -45.713  11.551  389.742 1.00 140.50 ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? -47.206  11.615  389.954 1.00 136.22 ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? -47.691  11.161  390.994 1.00 137.45 ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? -47.949  12.169  388.999 1.00 129.60 ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? -49.389  12.235  389.109 1.00 123.16 ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? -50.049  11.012  388.521 1.00 119.41 ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? -50.263  10.925  387.308 1.00 117.55 ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? -50.384  10.072  389.377 1.00 119.21 ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? -51.018  8.832   388.962 1.00 119.15 ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? -52.520  9.045   388.951 1.00 118.60 ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? -53.081  9.699   389.838 1.00 119.27 ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? -50.624  7.671   389.895 1.00 118.49 ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? -51.005  6.333   389.275 1.00 115.62 ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? -49.134  7.715   390.212 1.00 120.15 ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? -53.172  8.509   387.929 1.00 117.68 ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? -54.628  8.471   387.871 1.00 117.52 ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? -55.045  7.026   387.648 1.00 121.09 ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? -54.559  6.372   386.718 1.00 123.96 ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? -55.196  9.387   386.770 1.00 112.36 ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? -54.696  10.820  386.967 1.00 111.47 ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? -56.713  9.363   386.795 1.00 110.69 ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? -55.198  11.805  385.931 1.00 113.41 ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? -55.926  6.522   388.508 1.00 118.76 ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? -56.343  5.128   388.434 1.00 117.61 ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? -57.630  5.012   387.632 1.00 113.48 ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? -58.613  5.693   387.932 1.00 109.64 ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? -56.542  4.560   389.838 1.00 126.38 ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? -55.501  4.959   390.885 1.00 136.52 ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? -55.781  4.249   392.202 1.00 142.39 ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? -54.089  4.661   390.401 1.00 137.21 ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? -57.633  4.133   386.638 1.00 118.81 ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? -58.774  3.903   385.758 1.00 125.76 ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? -59.346  2.529   386.087 1.00 134.06 ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? -58.627  1.524   385.979 1.00 139.72 ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? -58.375  3.995   384.277 1.00 125.32 ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? -57.575  5.273   384.021 1.00 123.41 ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? -59.609  3.954   383.390 1.00 127.18 ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? -57.412  5.613   382.558 1.00 123.82 ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? -60.606  2.434   386.503 1.00 133.58 ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? -61.180  1.138   386.869 1.00 135.87 ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? -61.699  0.388   385.649 1.00 139.05 ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? -61.878  0.945   384.566 1.00 141.73 ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? -62.329  1.533   387.800 1.00 133.33 ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? -62.791  2.831   387.232 1.00 131.31 ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? -61.531  3.542   386.800 1.00 130.96 ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? -61.959  -0.906  385.858 1.00 136.38 ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? -62.529  -1.731  384.797 1.00 131.65 ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? -63.928  -1.275  384.412 1.00 130.98 ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? -64.360  -1.492  383.275 1.00 130.74 ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? -62.558  -3.197  385.228 1.00 129.06 ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? -61.190  -3.794  385.482 1.00 130.48 ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? -61.265  -5.123  386.191 1.00 136.44 ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? -62.254  -5.349  386.917 1.00 139.62 ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? -60.338  -5.942  386.022 1.00 139.56 ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? -64.649  -0.644  385.339 1.00 130.55 ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? -66.045  -0.307  385.097 1.00 129.40 ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? -66.214  0.713   383.978 1.00 130.49 ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? -67.307  0.813   383.411 1.00 129.27 ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? -66.693  0.201   386.384 1.00 126.98 ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? -68.192  -0.016  386.434 1.00 125.97 ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? -68.691  -0.113  387.860 1.00 127.12 ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? -68.245  1.006   388.679 1.00 129.68 ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? -69.006  2.049   388.989 1.00 130.22 ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? -70.252  2.120   388.543 1.00 129.46 ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? -68.521  3.022   389.747 1.00 129.77 ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? -65.162  1.449   383.630 1.00 132.12 ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? -65.176  2.364   382.495 1.00 131.40 ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? -64.097  1.914   381.523 1.00 130.29 ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? -62.951  1.685   381.924 1.00 130.91 ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? -64.944  3.824   382.927 1.00 129.67 ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? -64.903  4.736   381.710 1.00 126.76 ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? -66.026  4.275   383.892 1.00 130.81 ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? -64.463  1.790   380.252 1.00 125.94 ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? -63.546  1.260   379.255 1.00 120.00 ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? -62.470  2.286   378.918 1.00 111.99 ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? -62.685  3.498   379.009 1.00 102.08 ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? -64.303  0.860   377.989 1.00 119.21 ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? -63.437  0.286   377.026 1.00 119.32 ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? -61.293  1.775   378.545 1.00 115.08 ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? -60.176  2.634   378.160 1.00 114.78 ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? -60.578  3.683   377.132 1.00 113.18 ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? -60.100  4.822   377.185 1.00 114.89 ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? -59.026  1.789   377.614 1.00 116.16 ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? -57.930  1.522   378.616 1.00 117.30 ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? -57.135  3.084   379.037 1.00 116.26 ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? -56.170  2.617   380.465 1.00 118.97 ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? -61.427  3.312   376.172 1.00 110.47 ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? -61.780  4.239   375.101 1.00 108.92 ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? -62.401  5.509   375.667 1.00 108.84 ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? -62.120  6.606   375.187 1.00 108.78 ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? -62.700  3.557   374.071 1.00 111.46 ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? -63.267  4.582   373.097 1.00 104.70 ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? -61.932  2.488   373.315 1.00 119.25 ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? -63.237  5.390   376.701 1.00 110.13 ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? -63.846  6.580   377.299 1.00 107.77 ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? -62.799  7.474   377.967 1.00 102.22 ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? -62.831  8.707   377.827 1.00 97.35  ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? -64.921  6.146   378.297 1.00 105.83 ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? -65.695  7.308   378.873 1.00 100.47 ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? -66.334  8.047   378.098 1.00 96.66  ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? -65.684  7.465   380.108 1.00 98.95  ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? -61.840  6.866   378.668 1.00 98.95  ? 340 ALA 1 N     1 
ATOM   2635  C  CA    . ALA A  1  340 ? -60.787  7.638   379.321 1.00 92.40  ? 340 ALA 1 CA    1 
ATOM   2636  C  C     . ALA A  1  340 ? -59.926  8.371   378.299 1.00 84.96  ? 340 ALA 1 C     1 
ATOM   2637  O  O     . ALA A  1  340 ? -59.740  9.590   378.387 1.00 78.71  ? 340 ALA 1 O     1 
ATOM   2638  C  CB    . ALA A  1  340 ? -59.932  6.718   380.193 1.00 93.29  ? 340 ALA 1 CB    1 
ATOM   2639  N  N     . MET A  1  341 ? -59.387  7.636   377.320 1.00 86.66  ? 341 MET 1 N     1 
ATOM   2640  C  CA    . MET A  1  341 ? -58.578  8.263   376.278 1.00 87.20  ? 341 MET 1 CA    1 
ATOM   2641  C  C     . MET A  1  341 ? -59.408  9.224   375.444 1.00 92.42  ? 341 MET 1 C     1 
ATOM   2642  O  O     . MET A  1  341 ? -58.874  10.188  374.892 1.00 91.06  ? 341 MET 1 O     1 
ATOM   2643  C  CB    . MET A  1  341 ? -57.937  7.203   375.384 1.00 83.25  ? 341 MET 1 CB    1 
ATOM   2644  C  CG    . MET A  1  341 ? -57.431  5.989   376.124 1.00 82.79  ? 341 MET 1 CG    1 
ATOM   2645  S  SD    . MET A  1  341 ? -56.387  6.454   377.514 1.00 84.84  ? 341 MET 1 SD    1 
ATOM   2646  C  CE    . MET A  1  341 ? -54.906  7.012   376.677 1.00 82.20  ? 341 MET 1 CE    1 
ATOM   2647  N  N     . TRP A  1  342 ? -60.712  8.975   375.346 1.00 101.03 ? 342 TRP 1 N     1 
ATOM   2648  C  CA    . TRP A  1  342 ? -61.634  9.895   374.701 1.00 106.85 ? 342 TRP 1 CA    1 
ATOM   2649  C  C     . TRP A  1  342 ? -61.563  11.260  375.357 1.00 106.53 ? 342 TRP 1 C     1 
ATOM   2650  O  O     . TRP A  1  342 ? -61.308  12.277  374.698 1.00 100.32 ? 342 TRP 1 O     1 
ATOM   2651  C  CB    . TRP A  1  342 ? -63.052  9.336   374.814 1.00 109.21 ? 342 TRP 1 CB    1 
ATOM   2652  C  CG    . TRP A  1  342 ? -63.939  9.674   373.695 1.00 111.69 ? 342 TRP 1 CG    1 
ATOM   2653  C  CD1   . TRP A  1  342 ? -64.414  8.822   372.750 1.00 113.20 ? 342 TRP 1 CD1   1 
ATOM   2654  C  CD2   . TRP A  1  342 ? -64.433  10.972  373.355 1.00 112.75 ? 342 TRP 1 CD2   1 
ATOM   2655  N  NE1   . TRP A  1  342 ? -65.202  9.501   371.861 1.00 113.66 ? 342 TRP 1 NE1   1 
ATOM   2656  C  CE2   . TRP A  1  342 ? -65.223  10.826  372.205 1.00 112.08 ? 342 TRP 1 CE2   1 
ATOM   2657  C  CE3   . TRP A  1  342 ? -64.292  12.243  373.918 1.00 114.59 ? 342 TRP 1 CE3   1 
ATOM   2658  C  CZ2   . TRP A  1  342 ? -65.871  11.898  371.605 1.00 111.83 ? 342 TRP 1 CZ2   1 
ATOM   2659  C  CZ3   . TRP A  1  342 ? -64.933  13.305  373.319 1.00 116.10 ? 342 TRP 1 CZ3   1 
ATOM   2660  C  CH2   . TRP A  1  342 ? -65.714  13.128  372.175 1.00 115.56 ? 342 TRP 1 CH2   1 
ATOM   2661  N  N     . ASN A  1  343 ? -61.821  11.297  376.666 1.00 110.44 ? 343 ASN 1 N     1 
ATOM   2662  C  CA    . ASN A  1  343 ? -61.784  12.573  377.367 1.00 111.40 ? 343 ASN 1 CA    1 
ATOM   2663  C  C     . ASN A  1  343 ? -60.377  13.157  377.360 1.00 113.03 ? 343 ASN 1 C     1 
ATOM   2664  O  O     . ASN A  1  343 ? -60.215  14.380  377.295 1.00 115.91 ? 343 ASN 1 O     1 
ATOM   2665  C  CB    . ASN A  1  343 ? -62.306  12.423  378.796 1.00 109.61 ? 343 ASN 1 CB    1 
ATOM   2666  C  CG    . ASN A  1  343 ? -62.531  13.763  379.475 1.00 109.48 ? 343 ASN 1 CG    1 
ATOM   2667  O  OD1   . ASN A  1  343 ? -61.595  14.390  379.969 1.00 115.67 ? 343 ASN 1 OD1   1 
ATOM   2668  N  ND2   . ASN A  1  343 ? -63.777  14.216  379.481 1.00 103.85 ? 343 ASN 1 ND2   1 
ATOM   2669  N  N     . LEU A  1  344 ? -59.353  12.303  377.404 1.00 108.13 ? 344 LEU 1 N     1 
ATOM   2670  C  CA    . LEU A  1  344 ? -57.976  12.782  377.317 1.00 102.09 ? 344 LEU 1 CA    1 
ATOM   2671  C  C     . LEU A  1  344 ? -57.741  13.548  376.020 1.00 97.25  ? 344 LEU 1 C     1 
ATOM   2672  O  O     . LEU A  1  344 ? -57.241  14.680  376.030 1.00 97.23  ? 344 LEU 1 O     1 
ATOM   2673  C  CB    . LEU A  1  344 ? -57.008  11.601  377.418 1.00 102.94 ? 344 LEU 1 CB    1 
ATOM   2674  C  CG    . LEU A  1  344 ? -56.852  10.908  378.773 1.00 105.32 ? 344 LEU 1 CG    1 
ATOM   2675  C  CD1   . LEU A  1  344 ? -55.594  10.053  378.778 1.00 105.82 ? 344 LEU 1 CD1   1 
ATOM   2676  C  CD2   . LEU A  1  344 ? -56.817  11.931  379.896 1.00 106.47 ? 344 LEU 1 CD2   1 
ATOM   2677  N  N     . THR A  1  345 ? -58.104  12.940  374.888 1.00 95.74  ? 345 THR 1 N     1 
ATOM   2678  C  CA    . THR A  1  345 ? -57.865  13.561  373.592 1.00 99.20  ? 345 THR 1 CA    1 
ATOM   2679  C  C     . THR A  1  345 ? -58.733  14.796  373.409 1.00 105.31 ? 345 THR 1 C     1 
ATOM   2680  O  O     . THR A  1  345 ? -58.284  15.787  372.826 1.00 104.92 ? 345 THR 1 O     1 
ATOM   2681  C  CB    . THR A  1  345 ? -58.114  12.561  372.462 1.00 99.60  ? 345 THR 1 CB    1 
ATOM   2682  O  OG1   . THR A  1  345 ? -59.466  12.091  372.522 1.00 101.51 ? 345 THR 1 OG1   1 
ATOM   2683  C  CG2   . THR A  1  345 ? -57.154  11.381  372.550 1.00 99.51  ? 345 THR 1 CG2   1 
ATOM   2684  N  N     . ARG A  1  346 ? -59.975  14.765  373.901 1.00 114.98 ? 346 ARG 1 N     1 
ATOM   2685  C  CA    . ARG A  1  346 ? -60.813  15.955  373.788 1.00 126.02 ? 346 ARG 1 CA    1 
ATOM   2686  C  C     . ARG A  1  346 ? -60.265  17.088  374.645 1.00 126.09 ? 346 ARG 1 C     1 
ATOM   2687  O  O     . ARG A  1  346 ? -60.402  18.263  374.284 1.00 120.84 ? 346 ARG 1 O     1 
ATOM   2688  C  CB    . ARG A  1  346 ? -62.263  15.643  374.173 1.00 134.05 ? 346 ARG 1 CB    1 
ATOM   2689  C  CG    . ARG A  1  346 ? -62.538  15.613  375.669 1.00 139.49 ? 346 ARG 1 CG    1 
ATOM   2690  C  CD    . ARG A  1  346 ? -64.005  15.362  375.972 1.00 142.00 ? 346 ARG 1 CD    1 
ATOM   2691  N  NE    . ARG A  1  346 ? -64.871  16.129  375.084 1.00 141.20 ? 346 ARG 1 NE    1 
ATOM   2692  C  CZ    . ARG A  1  346 ? -65.265  17.377  375.316 1.00 138.05 ? 346 ARG 1 CZ    1 
ATOM   2693  N  NH1   . ARG A  1  346 ? -64.864  18.014  376.408 1.00 136.09 ? 346 ARG 1 NH1   1 
ATOM   2694  N  NH2   . ARG A  1  346 ? -66.053  17.992  374.445 1.00 136.56 ? 346 ARG 1 NH2   1 
ATOM   2695  N  N     . PHE A  1  347 ? -59.621  16.753  375.766 1.00 131.40 ? 347 PHE 1 N     1 
ATOM   2696  C  CA    . PHE A  1  347 ? -58.965  17.762  376.586 1.00 135.30 ? 347 PHE 1 CA    1 
ATOM   2697  C  C     . PHE A  1  347 ? -57.774  18.365  375.853 1.00 130.07 ? 347 PHE 1 C     1 
ATOM   2698  O  O     . PHE A  1  347 ? -57.632  19.592  375.783 1.00 131.62 ? 347 PHE 1 O     1 
ATOM   2699  C  CB    . PHE A  1  347 ? -58.527  17.144  377.918 1.00 139.81 ? 347 PHE 1 CB    1 
ATOM   2700  C  CG    . PHE A  1  347 ? -57.347  17.830  378.549 1.00 141.07 ? 347 PHE 1 CG    1 
ATOM   2701  C  CD1   . PHE A  1  347 ? -56.082  17.270  378.482 1.00 141.22 ? 347 PHE 1 CD1   1 
ATOM   2702  C  CD2   . PHE A  1  347 ? -57.503  19.035  379.206 1.00 140.92 ? 347 PHE 1 CD2   1 
ATOM   2703  C  CE1   . PHE A  1  347 ? -54.997  17.905  379.057 1.00 142.41 ? 347 PHE 1 CE1   1 
ATOM   2704  C  CE2   . PHE A  1  347 ? -56.423  19.673  379.782 1.00 141.86 ? 347 PHE 1 CE2   1 
ATOM   2705  C  CZ    . PHE A  1  347 ? -55.170  19.108  379.707 1.00 143.35 ? 347 PHE 1 CZ    1 
ATOM   2706  N  N     . TYR A  1  348 ? -56.899  17.512  375.308 1.00 120.81 ? 348 TYR 1 N     1 
ATOM   2707  C  CA    . TYR A  1  348 ? -55.755  18.013  374.547 1.00 113.98 ? 348 TYR 1 CA    1 
ATOM   2708  C  C     . TYR A  1  348 ? -56.203  18.863  373.366 1.00 113.00 ? 348 TYR 1 C     1 
ATOM   2709  O  O     . TYR A  1  348 ? -55.571  19.875  373.042 1.00 114.42 ? 348 TYR 1 O     1 
ATOM   2710  C  CB    . TYR A  1  348 ? -54.876  16.859  374.066 1.00 110.04 ? 348 TYR 1 CB    1 
ATOM   2711  C  CG    . TYR A  1  348 ? -54.033  16.251  375.157 1.00 109.32 ? 348 TYR 1 CG    1 
ATOM   2712  C  CD1   . TYR A  1  348 ? -52.934  16.923  375.659 1.00 110.97 ? 348 TYR 1 CD1   1 
ATOM   2713  C  CD2   . TYR A  1  348 ? -54.322  15.001  375.670 1.00 110.98 ? 348 TYR 1 CD2   1 
ATOM   2714  C  CE1   . TYR A  1  348 ? -52.160  16.378  376.654 1.00 114.07 ? 348 TYR 1 CE1   1 
ATOM   2715  C  CE2   . TYR A  1  348 ? -53.552  14.447  376.666 1.00 115.83 ? 348 TYR 1 CE2   1 
ATOM   2716  C  CZ    . TYR A  1  348 ? -52.472  15.140  377.153 1.00 118.82 ? 348 TYR 1 CZ    1 
ATOM   2717  O  OH    . TYR A  1  348 ? -51.695  14.595  378.144 1.00 124.54 ? 348 TYR 1 OH    1 
ATOM   2718  N  N     . ALA A  1  349 ? -57.299  18.472  372.719 1.00 110.30 ? 349 ALA 1 N     1 
ATOM   2719  C  CA    . ALA A  1  349 ? -57.806  19.230  371.585 1.00 105.84 ? 349 ALA 1 CA    1 
ATOM   2720  C  C     . ALA A  1  349 ? -58.378  20.562  372.046 1.00 99.33  ? 349 ALA 1 C     1 
ATOM   2721  O  O     . ALA A  1  349 ? -58.275  21.571  371.339 1.00 98.16  ? 349 ALA 1 O     1 
ATOM   2722  C  CB    . ALA A  1  349 ? -58.862  18.408  370.849 1.00 104.67 ? 349 ALA 1 CB    1 
ATOM   2723  N  N     . HIS A  1  350 ? -58.992  20.574  373.231 1.00 93.87  ? 350 HIS 1 N     1 
ATOM   2724  C  CA    . HIS A  1  350 ? -59.511  21.809  373.805 1.00 95.23  ? 350 HIS 1 CA    1 
ATOM   2725  C  C     . HIS A  1  350 ? -58.398  22.828  374.003 1.00 100.64 ? 350 HIS 1 C     1 
ATOM   2726  O  O     . HIS A  1  350 ? -58.657  24.035  374.037 1.00 104.80 ? 350 HIS 1 O     1 
ATOM   2727  C  CB    . HIS A  1  350 ? -60.210  21.510  375.135 1.00 93.78  ? 350 HIS 1 CB    1 
ATOM   2728  C  CG    . HIS A  1  350 ? -60.868  22.700  375.764 1.00 94.13  ? 350 HIS 1 CG    1 
ATOM   2729  N  ND1   . HIS A  1  350 ? -62.123  23.137  375.394 1.00 93.59  ? 350 HIS 1 ND1   1 
ATOM   2730  C  CD2   . HIS A  1  350 ? -60.449  23.540  376.740 1.00 94.56  ? 350 HIS 1 CD2   1 
ATOM   2731  C  CE1   . HIS A  1  350 ? -62.448  24.195  376.115 1.00 93.73  ? 350 HIS 1 CE1   1 
ATOM   2732  N  NE2   . HIS A  1  350 ? -61.449  24.461  376.938 1.00 94.11  ? 350 HIS 1 NE2   1 
ATOM   2733  N  N     . GLU A  1  351 ? -57.155  22.361  374.132 1.00 99.44  ? 351 GLU 1 N     1 
ATOM   2734  C  CA    . GLU A  1  351 ? -56.033  23.191  374.544 1.00 94.50  ? 351 GLU 1 CA    1 
ATOM   2735  C  C     . GLU A  1  351 ? -54.971  23.369  373.465 1.00 84.96  ? 351 GLU 1 C     1 
ATOM   2736  O  O     . GLU A  1  351 ? -53.885  23.874  373.765 1.00 92.93  ? 351 GLU 1 O     1 
ATOM   2737  C  CB    . GLU A  1  351 ? -55.389  22.589  375.794 1.00 97.62  ? 351 GLU 1 CB    1 
ATOM   2738  C  CG    . GLU A  1  351 ? -56.229  22.725  377.042 1.00 104.02 ? 351 GLU 1 CG    1 
ATOM   2739  C  CD    . GLU A  1  351 ? -56.273  24.143  377.552 1.00 113.23 ? 351 GLU 1 CD    1 
ATOM   2740  O  OE1   . GLU A  1  351 ? -55.385  24.936  377.179 1.00 117.07 ? 351 GLU 1 OE1   1 
ATOM   2741  O  OE2   . GLU A  1  351 ? -57.192  24.467  378.331 1.00 116.67 ? 351 GLU 1 OE2   1 
ATOM   2742  N  N     . SER A  1  352 ? -55.244  22.979  372.225 1.00 65.53  ? 352 SER 1 N     1 
ATOM   2743  C  CA    . SER A  1  352 ? -54.241  23.151  371.186 1.00 52.56  ? 352 SER 1 CA    1 
ATOM   2744  C  C     . SER A  1  352 ? -54.078  24.630  370.861 1.00 53.69  ? 352 SER 1 C     1 
ATOM   2745  O  O     . SER A  1  352 ? -55.059  25.368  370.738 1.00 50.81  ? 352 SER 1 O     1 
ATOM   2746  C  CB    . SER A  1  352 ? -54.630  22.367  369.932 1.00 42.04  ? 352 SER 1 CB    1 
ATOM   2747  O  OG    . SER A  1  352 ? -53.684  22.537  368.890 1.00 39.16  ? 352 SER 1 OG    1 
ATOM   2748  N  N     . CYS A  1  353 ? -52.826  25.064  370.730 1.00 55.04  ? 353 CYS 1 N     1 
ATOM   2749  C  CA    . CYS A  1  353 ? -52.551  26.463  370.434 1.00 51.06  ? 353 CYS 1 CA    1 
ATOM   2750  C  C     . CYS A  1  353 ? -52.727  26.790  368.960 1.00 53.82  ? 353 CYS 1 C     1 
ATOM   2751  O  O     . CYS A  1  353 ? -52.867  27.968  368.616 1.00 51.60  ? 353 CYS 1 O     1 
ATOM   2752  C  CB    . CYS A  1  353 ? -51.138  26.832  370.879 1.00 44.03  ? 353 CYS 1 CB    1 
ATOM   2753  S  SG    . CYS A  1  353 ? -49.926  26.706  369.578 1.00 38.28  ? 353 CYS 1 SG    1 
ATOM   2754  N  N     . GLY A  1  354 ? -52.703  25.784  368.089 1.00 64.99  ? 354 GLY 1 N     1 
ATOM   2755  C  CA    . GLY A  1  354 ? -53.052  25.955  366.696 1.00 83.28  ? 354 GLY 1 CA    1 
ATOM   2756  C  C     . GLY A  1  354 ? -51.885  26.149  365.752 1.00 103.57 ? 354 GLY 1 C     1 
ATOM   2757  O  O     . GLY A  1  354 ? -52.099  26.177  364.534 1.00 110.76 ? 354 GLY 1 O     1 
ATOM   2758  N  N     . LYS A  1  355 ? -50.662  26.294  366.270 1.00 108.24 ? 355 LYS 1 N     1 
ATOM   2759  C  CA    . LYS A  1  355 ? -49.534  26.622  365.402 1.00 102.75 ? 355 LYS 1 CA    1 
ATOM   2760  C  C     . LYS A  1  355 ? -49.237  25.501  364.413 1.00 90.83  ? 355 LYS 1 C     1 
ATOM   2761  O  O     . LYS A  1  355 ? -49.025  25.759  363.222 1.00 87.47  ? 355 LYS 1 O     1 
ATOM   2762  C  CB    . LYS A  1  355 ? -48.292  26.941  366.240 1.00 100.41 ? 355 LYS 1 CB    1 
ATOM   2763  C  CG    . LYS A  1  355 ? -47.654  28.290  365.906 1.00 94.15  ? 355 LYS 1 CG    1 
ATOM   2764  C  CD    . LYS A  1  355 ? -46.544  28.679  366.880 1.00 86.22  ? 355 LYS 1 CD    1 
ATOM   2765  C  CE    . LYS A  1  355 ? -45.169  28.521  366.243 1.00 79.82  ? 355 LYS 1 CE    1 
ATOM   2766  N  NZ    . LYS A  1  355 ? -44.108  29.228  367.013 1.00 73.93  ? 355 LYS 1 NZ    1 
ATOM   2767  N  N     . CYS A  1  356 ? -49.237  24.254  364.873 1.00 80.87  ? 356 CYS 1 N     1 
ATOM   2768  C  CA    . CYS A  1  356 ? -49.002  23.131  363.976 1.00 76.33  ? 356 CYS 1 CA    1 
ATOM   2769  C  C     . CYS A  1  356 ? -50.294  22.709  363.293 1.00 67.48  ? 356 CYS 1 C     1 
ATOM   2770  O  O     . CYS A  1  356 ? -51.328  22.543  363.946 1.00 53.47  ? 356 CYS 1 O     1 
ATOM   2771  C  CB    . CYS A  1  356 ? -48.411  21.944  364.729 1.00 86.57  ? 356 CYS 1 CB    1 
ATOM   2772  S  SG    . CYS A  1  356 ? -46.989  22.345  365.724 1.00 99.23  ? 356 CYS 1 SG    1 
ATOM   2773  N  N     . THR A  1  357 ? -50.229  22.558  361.973 1.00 79.01  ? 357 THR 1 N     1 
ATOM   2774  C  CA    . THR A  1  357 ? -51.279  21.850  361.242 1.00 89.33  ? 357 THR 1 CA    1 
ATOM   2775  C  C     . THR A  1  357 ? -51.492  20.423  361.741 1.00 93.35  ? 357 THR 1 C     1 
ATOM   2776  O  O     . THR A  1  357 ? -52.657  20.033  361.937 1.00 99.07  ? 357 THR 1 O     1 
ATOM   2777  C  CB    . THR A  1  357 ? -50.963  21.875  359.742 1.00 93.61  ? 357 THR 1 CB    1 
ATOM   2778  O  OG1   . THR A  1  357 ? -50.599  23.204  359.343 1.00 90.51  ? 357 THR 1 OG1   1 
ATOM   2779  C  CG2   . THR A  1  357 ? -52.153  21.396  358.927 1.00 99.59  ? 357 THR 1 CG2   1 
ATOM   2780  N  N     . PRO A  1  358 ? -50.457  19.596  361.951 1.00 87.15  ? 358 PRO 1 N     1 
ATOM   2781  C  CA    . PRO A  1  358 ? -50.728  18.210  362.384 1.00 82.89  ? 358 PRO 1 CA    1 
ATOM   2782  C  C     . PRO A  1  358 ? -51.508  18.123  363.682 1.00 76.97  ? 358 PRO 1 C     1 
ATOM   2783  O  O     . PRO A  1  358 ? -52.542  17.452  363.732 1.00 75.64  ? 358 PRO 1 O     1 
ATOM   2784  C  CB    . PRO A  1  358 ? -49.321  17.613  362.514 1.00 87.52  ? 358 PRO 1 CB    1 
ATOM   2785  C  CG    . PRO A  1  358 ? -48.427  18.788  362.706 1.00 87.80  ? 358 PRO 1 CG    1 
ATOM   2786  C  CD    . PRO A  1  358 ? -49.009  19.829  361.813 1.00 86.02  ? 358 PRO 1 CD    1 
ATOM   2787  N  N     . CYS A  1  359 ? -51.038  18.782  364.740 1.00 75.01  ? 359 CYS 1 N     1 
ATOM   2788  C  CA    . CYS A  1  359 ? -51.754  18.769  366.012 1.00 74.05  ? 359 CYS 1 CA    1 
ATOM   2789  C  C     . CYS A  1  359 ? -53.190  19.230  365.817 1.00 68.25  ? 359 CYS 1 C     1 
ATOM   2790  O  O     . CYS A  1  359 ? -54.132  18.466  366.040 1.00 67.38  ? 359 CYS 1 O     1 
ATOM   2791  C  CB    . CYS A  1  359 ? -51.014  19.642  367.024 1.00 81.08  ? 359 CYS 1 CB    1 
ATOM   2792  S  SG    . CYS A  1  359 ? -51.948  20.388  368.391 1.00 84.24  ? 359 CYS 1 SG    1 
ATOM   2793  N  N     . ARG A  1  360 ? -53.368  20.471  365.359 1.00 66.79  ? 360 ARG 1 N     1 
ATOM   2794  C  CA    . ARG A  1  360 ? -54.701  21.027  365.151 1.00 64.35  ? 360 ARG 1 CA    1 
ATOM   2795  C  C     . ARG A  1  360 ? -55.613  20.032  364.438 1.00 65.22  ? 360 ARG 1 C     1 
ATOM   2796  O  O     . ARG A  1  360 ? -56.563  19.503  365.030 1.00 66.46  ? 360 ARG 1 O     1 
ATOM   2797  C  CB    . ARG A  1  360 ? -54.574  22.335  364.357 1.00 60.49  ? 360 ARG 1 CB    1 
ATOM   2798  C  CG    . ARG A  1  360 ? -55.856  22.874  363.752 1.00 58.76  ? 360 ARG 1 CG    1 
ATOM   2799  C  CD    . ARG A  1  360 ? -55.624  24.194  363.025 1.00 54.03  ? 360 ARG 1 CD    1 
ATOM   2800  N  NE    . ARG A  1  360 ? -55.193  24.022  361.640 1.00 45.35  ? 360 ARG 1 NE    1 
ATOM   2801  C  CZ    . ARG A  1  360 ? -53.935  24.140  361.235 1.00 29.92  ? 360 ARG 1 CZ    1 
ATOM   2802  N  NH1   . ARG A  1  360 ? -52.981  24.426  362.107 1.00 33.79  ? 360 ARG 1 NH1   1 
ATOM   2803  N  NH2   . ARG A  1  360 ? -53.630  23.976  359.958 1.00 29.68  ? 360 ARG 1 NH2   1 
ATOM   2804  N  N     . GLU A  1  361 ? -55.271  19.685  363.197 1.00 66.79  ? 361 GLU 1 N     1 
ATOM   2805  C  CA    . GLU A  1  361 ? -56.161  18.858  362.386 1.00 71.25  ? 361 GLU 1 CA    1 
ATOM   2806  C  C     . GLU A  1  361 ? -56.316  17.461  362.974 1.00 73.70  ? 361 GLU 1 C     1 
ATOM   2807  O  O     . GLU A  1  361 ? -57.419  17.060  363.353 1.00 71.77  ? 361 GLU 1 O     1 
ATOM   2808  C  CB    . GLU A  1  361 ? -55.647  18.798  360.948 1.00 75.81  ? 361 GLU 1 CB    1 
ATOM   2809  C  CG    . GLU A  1  361 ? -55.392  20.165  360.341 1.00 85.76  ? 361 GLU 1 CG    1 
ATOM   2810  C  CD    . GLU A  1  361 ? -56.639  21.028  360.272 1.00 95.26  ? 361 GLU 1 CD    1 
ATOM   2811  O  OE1   . GLU A  1  361 ? -57.760  20.479  360.285 1.00 98.74  ? 361 GLU 1 OE1   1 
ATOM   2812  O  OE2   . GLU A  1  361 ? -56.499  22.266  360.220 1.00 98.44  ? 361 GLU 1 OE2   1 
ATOM   2813  N  N     . GLY A  1  362 ? -55.220  16.705  363.063 1.00 77.49  ? 362 GLY 1 N     1 
ATOM   2814  C  CA    . GLY A  1  362 ? -55.324  15.324  363.500 1.00 76.56  ? 362 GLY 1 CA    1 
ATOM   2815  C  C     . GLY A  1  362 ? -55.973  15.178  364.863 1.00 76.26  ? 362 GLY 1 C     1 
ATOM   2816  O  O     . GLY A  1  362 ? -56.916  14.403  365.030 1.00 79.72  ? 362 GLY 1 O     1 
ATOM   2817  N  N     . VAL A  1  363 ? -55.490  15.923  365.859 1.00 69.50  ? 363 VAL 1 N     1 
ATOM   2818  C  CA    . VAL A  1  363 ? -56.040  15.783  367.201 1.00 62.91  ? 363 VAL 1 CA    1 
ATOM   2819  C  C     . VAL A  1  363 ? -57.481  16.278  367.245 1.00 72.62  ? 363 VAL 1 C     1 
ATOM   2820  O  O     . VAL A  1  363 ? -58.407  15.495  367.469 1.00 80.07  ? 363 VAL 1 O     1 
ATOM   2821  C  CB    . VAL A  1  363 ? -55.159  16.516  368.227 1.00 53.35  ? 363 VAL 1 CB    1 
ATOM   2822  C  CG1   . VAL A  1  363 ? -55.725  16.348  369.629 1.00 32.54  ? 363 VAL 1 CG1   1 
ATOM   2823  C  CG2   . VAL A  1  363 ? -53.729  15.993  368.167 1.00 45.21  ? 363 VAL 1 CG2   1 
ATOM   2824  N  N     . ALA A  1  364 ? -57.702  17.576  367.000 1.00 76.31  ? 364 ALA 1 N     1 
ATOM   2825  C  CA    . ALA A  1  364 ? -59.010  18.139  367.315 1.00 82.08  ? 364 ALA 1 CA    1 
ATOM   2826  C  C     . ALA A  1  364 ? -60.084  17.791  366.292 1.00 83.70  ? 364 ALA 1 C     1 
ATOM   2827  O  O     . ALA A  1  364 ? -61.271  17.815  366.634 1.00 82.70  ? 364 ALA 1 O     1 
ATOM   2828  C  CB    . ALA A  1  364 ? -58.901  19.656  367.464 1.00 85.00  ? 364 ALA 1 CB    1 
ATOM   2829  N  N     . GLY A  1  365 ? -59.707  17.466  365.060 1.00 86.24  ? 365 GLY 1 N     1 
ATOM   2830  C  CA    . GLY A  1  365 ? -60.672  17.115  364.041 1.00 88.19  ? 365 GLY 1 CA    1 
ATOM   2831  C  C     . GLY A  1  365 ? -60.683  15.635  363.713 1.00 87.13  ? 365 GLY 1 C     1 
ATOM   2832  O  O     . GLY A  1  365 ? -61.743  15.066  363.444 1.00 90.46  ? 365 GLY 1 O     1 
ATOM   2833  N  N     . PHE A  1  366 ? -59.508  15.006  363.691 1.00 77.79  ? 366 PHE 1 N     1 
ATOM   2834  C  CA    . PHE A  1  366 ? -59.386  13.624  363.237 1.00 70.88  ? 366 PHE 1 CA    1 
ATOM   2835  C  C     . PHE A  1  366 ? -59.411  12.624  364.391 1.00 75.99  ? 366 PHE 1 C     1 
ATOM   2836  O  O     . PHE A  1  366 ? -60.316  11.790  364.471 1.00 84.53  ? 366 PHE 1 O     1 
ATOM   2837  C  CB    . PHE A  1  366 ? -58.093  13.462  362.421 1.00 66.61  ? 366 PHE 1 CB    1 
ATOM   2838  C  CG    . PHE A  1  366 ? -58.179  12.436  361.327 1.00 65.65  ? 366 PHE 1 CG    1 
ATOM   2839  C  CD1   . PHE A  1  366 ? -59.297  11.639  361.187 1.00 65.67  ? 366 PHE 1 CD1   1 
ATOM   2840  C  CD2   . PHE A  1  366 ? -57.127  12.258  360.447 1.00 64.75  ? 366 PHE 1 CD2   1 
ATOM   2841  C  CE1   . PHE A  1  366 ? -59.372  10.695  360.181 1.00 63.98  ? 366 PHE 1 CE1   1 
ATOM   2842  C  CE2   . PHE A  1  366 ? -57.198  11.311  359.443 1.00 66.21  ? 366 PHE 1 CE2   1 
ATOM   2843  C  CZ    . PHE A  1  366 ? -58.322  10.531  359.312 1.00 65.82  ? 366 PHE 1 CZ    1 
ATOM   2844  N  N     . MET A  1  367 ? -58.442  12.712  365.306 1.00 99.92  ? 367 MET 1 N     1 
ATOM   2845  C  CA    . MET A  1  367 ? -58.216  11.642  366.277 1.00 104.18 ? 367 MET 1 CA    1 
ATOM   2846  C  C     . MET A  1  367 ? -59.368  11.522  367.270 1.00 103.04 ? 367 MET 1 C     1 
ATOM   2847  O  O     . MET A  1  367 ? -59.955  10.444  367.432 1.00 106.13 ? 367 MET 1 O     1 
ATOM   2848  C  CB    . MET A  1  367 ? -56.888  11.866  367.000 1.00 110.91 ? 367 MET 1 CB    1 
ATOM   2849  C  CG    . MET A  1  367 ? -55.674  11.762  366.089 1.00 122.73 ? 367 MET 1 CG    1 
ATOM   2850  S  SD    . MET A  1  367 ? -54.111  11.777  366.981 1.00 134.64 ? 367 MET 1 SD    1 
ATOM   2851  C  CE    . MET A  1  367 ? -54.383  10.449  368.147 1.00 136.71 ? 367 MET 1 CE    1 
ATOM   2852  N  N     . VAL A  1  368 ? -59.683  12.612  367.976 1.00 100.14 ? 368 VAL 1 N     1 
ATOM   2853  C  CA    . VAL A  1  368 ? -60.793  12.565  368.924 1.00 103.20 ? 368 VAL 1 CA    1 
ATOM   2854  C  C     . VAL A  1  368 ? -62.080  12.193  368.201 1.00 99.66  ? 368 VAL 1 C     1 
ATOM   2855  O  O     . VAL A  1  368 ? -62.970  11.561  368.778 1.00 100.70 ? 368 VAL 1 O     1 
ATOM   2856  C  CB    . VAL A  1  368 ? -60.936  13.903  369.683 1.00 108.08 ? 368 VAL 1 CB    1 
ATOM   2857  C  CG1   . VAL A  1  368 ? -61.157  15.060  368.720 1.00 106.02 ? 368 VAL 1 CG1   1 
ATOM   2858  C  CG2   . VAL A  1  368 ? -62.056  13.828  370.720 1.00 112.30 ? 368 VAL 1 CG2   1 
ATOM   2859  N  N     . ASN A  1  369 ? -62.190  12.546  366.919 1.00 92.94  ? 369 ASN 1 N     1 
ATOM   2860  C  CA    . ASN A  1  369 ? -63.376  12.174  366.159 1.00 88.79  ? 369 ASN 1 CA    1 
ATOM   2861  C  C     . ASN A  1  369 ? -63.372  10.685  365.834 1.00 79.29  ? 369 ASN 1 C     1 
ATOM   2862  O  O     . ASN A  1  369 ? -64.433  10.052  365.792 1.00 78.66  ? 369 ASN 1 O     1 
ATOM   2863  C  CB    . ASN A  1  369 ? -63.467  13.023  364.894 1.00 93.43  ? 369 ASN 1 CB    1 
ATOM   2864  C  CG    . ASN A  1  369 ? -64.146  14.366  365.141 1.00 98.91  ? 369 ASN 1 CG    1 
ATOM   2865  O  OD1   . ASN A  1  369 ? -64.942  14.510  366.068 1.00 103.52 ? 369 ASN 1 OD1   1 
ATOM   2866  N  ND2   . ASN A  1  369 ? -63.823  15.354  364.316 1.00 99.46  ? 369 ASN 1 ND2   1 
ATOM   2867  N  N     . LEU A  1  370 ? -62.192  10.111  365.586 1.00 72.74  ? 370 LEU 1 N     1 
ATOM   2868  C  CA    . LEU A  1  370 ? -62.075  8.656   365.518 1.00 63.81  ? 370 LEU 1 CA    1 
ATOM   2869  C  C     . LEU A  1  370 ? -62.597  8.023   366.799 1.00 66.49  ? 370 LEU 1 C     1 
ATOM   2870  O  O     . LEU A  1  370 ? -63.366  7.052   366.766 1.00 71.43  ? 370 LEU 1 O     1 
ATOM   2871  C  CB    . LEU A  1  370 ? -60.620  8.246   365.281 1.00 55.68  ? 370 LEU 1 CB    1 
ATOM   2872  C  CG    . LEU A  1  370 ? -60.116  7.988   363.862 1.00 56.75  ? 370 LEU 1 CG    1 
ATOM   2873  C  CD1   . LEU A  1  370 ? -60.565  6.615   363.402 1.00 64.17  ? 370 LEU 1 CD1   1 
ATOM   2874  C  CD2   . LEU A  1  370 ? -60.604  9.043   362.911 1.00 55.55  ? 370 LEU 1 CD2   1 
ATOM   2875  N  N     . PHE A  1  371 ? -62.169  8.560   367.945 1.00 63.90  ? 371 PHE 1 N     1 
ATOM   2876  C  CA    . PHE A  1  371 ? -62.634  8.039   369.226 1.00 68.79  ? 371 PHE 1 CA    1 
ATOM   2877  C  C     . PHE A  1  371 ? -64.143  8.190   369.367 1.00 76.39  ? 371 PHE 1 C     1 
ATOM   2878  O  O     . PHE A  1  371 ? -64.808  7.324   369.937 1.00 78.49  ? 371 PHE 1 O     1 
ATOM   2879  C  CB    . PHE A  1  371 ? -61.918  8.750   370.374 1.00 67.99  ? 371 PHE 1 CB    1 
ATOM   2880  C  CG    . PHE A  1  371 ? -60.550  8.206   370.664 1.00 76.36  ? 371 PHE 1 CG    1 
ATOM   2881  C  CD1   . PHE A  1  371 ? -59.434  8.731   370.046 1.00 82.08  ? 371 PHE 1 CD1   1 
ATOM   2882  C  CD2   . PHE A  1  371 ? -60.383  7.150   371.541 1.00 81.39  ? 371 PHE 1 CD2   1 
ATOM   2883  C  CE1   . PHE A  1  371 ? -58.175  8.225   370.311 1.00 83.92  ? 371 PHE 1 CE1   1 
ATOM   2884  C  CE2   . PHE A  1  371 ? -59.126  6.639   371.803 1.00 81.39  ? 371 PHE 1 CE2   1 
ATOM   2885  C  CZ    . PHE A  1  371 ? -58.026  7.177   371.188 1.00 81.59  ? 371 PHE 1 CZ    1 
ATOM   2886  N  N     . ALA A  1  372 ? -64.699  9.289   368.859 1.00 80.22  ? 372 ALA 1 N     1 
ATOM   2887  C  CA    . ALA A  1  372 ? -66.144  9.482   368.909 1.00 83.45  ? 372 ALA 1 CA    1 
ATOM   2888  C  C     . ALA A  1  372 ? -66.858  8.422   368.087 1.00 87.43  ? 372 ALA 1 C     1 
ATOM   2889  O  O     . ALA A  1  372 ? -67.761  7.733   368.578 1.00 91.23  ? 372 ALA 1 O     1 
ATOM   2890  C  CB    . ALA A  1  372 ? -66.503  10.881  368.409 1.00 79.97  ? 372 ALA 1 CB    1 
ATOM   2891  N  N     . LYS A  1  373 ? -66.444  8.270   366.832 1.00 85.00  ? 373 LYS 1 N     1 
ATOM   2892  C  CA    . LYS A  1  373 ? -67.007  7.249   365.960 1.00 84.22  ? 373 LYS 1 CA    1 
ATOM   2893  C  C     . LYS A  1  373 ? -66.991  5.882   366.631 1.00 81.54  ? 373 LYS 1 C     1 
ATOM   2894  O  O     . LYS A  1  373 ? -68.003  5.172   366.643 1.00 79.43  ? 373 LYS 1 O     1 
ATOM   2895  C  CB    . LYS A  1  373 ? -66.223  7.223   364.648 1.00 86.48  ? 373 LYS 1 CB    1 
ATOM   2896  C  CG    . LYS A  1  373 ? -66.820  6.356   363.564 1.00 89.37  ? 373 LYS 1 CG    1 
ATOM   2897  C  CD    . LYS A  1  373 ? -65.844  6.229   362.411 1.00 92.15  ? 373 LYS 1 CD    1 
ATOM   2898  C  CE    . LYS A  1  373 ? -66.469  5.531   361.224 1.00 96.34  ? 373 LYS 1 CE    1 
ATOM   2899  N  NZ    . LYS A  1  373 ? -65.495  5.450   360.104 1.00 99.35  ? 373 LYS 1 NZ    1 
ATOM   2900  N  N     . ILE A  1  374 ? -65.847  5.498   367.205 1.00 84.00  ? 374 ILE 1 N     1 
ATOM   2901  C  CA    . ILE A  1  374 ? -65.736  4.176   367.822 1.00 88.90  ? 374 ILE 1 CA    1 
ATOM   2902  C  C     . ILE A  1  374 ? -66.595  4.091   369.081 1.00 99.56  ? 374 ILE 1 C     1 
ATOM   2903  O  O     . ILE A  1  374 ? -67.562  3.323   369.145 1.00 99.89  ? 374 ILE 1 O     1 
ATOM   2904  C  CB    . ILE A  1  374 ? -64.265  3.842   368.129 1.00 80.54  ? 374 ILE 1 CB    1 
ATOM   2905  C  CG1   . ILE A  1  374 ? -63.448  3.782   366.837 1.00 74.49  ? 374 ILE 1 CG1   1 
ATOM   2906  C  CG2   . ILE A  1  374 ? -64.169  2.517   368.875 1.00 79.25  ? 374 ILE 1 CG2   1 
ATOM   2907  C  CD1   . ILE A  1  374 ? -61.953  3.669   367.055 1.00 72.05  ? 374 ILE 1 CD1   1 
ATOM   2908  N  N     . GLY A  1  375 ? -66.266  4.895   370.096 1.00 105.37 ? 375 GLY 1 N     1 
ATOM   2909  C  CA    . GLY A  1  375 ? -66.909  4.863   371.395 1.00 109.01 ? 375 GLY 1 CA    1 
ATOM   2910  C  C     . GLY A  1  375 ? -68.339  5.346   371.427 1.00 109.72 ? 375 GLY 1 C     1 
ATOM   2911  O  O     . GLY A  1  375 ? -68.912  5.456   372.514 1.00 113.59 ? 375 GLY 1 O     1 
ATOM   2912  N  N     . THR A  1  376 ? -68.925  5.653   370.275 1.00 105.49 ? 376 THR 1 N     1 
ATOM   2913  C  CA    . THR A  1  376 ? -70.358  5.872   370.164 1.00 102.54 ? 376 THR 1 CA    1 
ATOM   2914  C  C     . THR A  1  376 ? -71.056  4.676   369.526 1.00 104.10 ? 376 THR 1 C     1 
ATOM   2915  O  O     . THR A  1  376 ? -72.251  4.747   369.226 1.00 105.17 ? 376 THR 1 O     1 
ATOM   2916  C  CB    . THR A  1  376 ? -70.634  7.150   369.367 1.00 96.69  ? 376 THR 1 CB    1 
ATOM   2917  O  OG1   . THR A  1  376 ? -69.609  8.109   369.645 1.00 94.59  ? 376 THR 1 OG1   1 
ATOM   2918  C  CG2   . THR A  1  376 ? -71.968  7.762   369.768 1.00 96.03  ? 376 THR 1 CG2   1 
ATOM   2919  N  N     . GLY A  1  377 ? -70.335  3.575   369.326 1.00 102.80 ? 377 GLY 1 N     1 
ATOM   2920  C  CA    . GLY A  1  377 ? -70.919  2.395   368.722 1.00 103.31 ? 377 GLY 1 CA    1 
ATOM   2921  C  C     . GLY A  1  377 ? -71.101  2.487   367.226 1.00 103.46 ? 377 GLY 1 C     1 
ATOM   2922  O  O     . GLY A  1  377 ? -71.993  1.834   366.676 1.00 104.90 ? 377 GLY 1 O     1 
ATOM   2923  N  N     . GLN A  1  378 ? -70.281  3.292   366.549 1.00 103.49 ? 378 GLN 1 N     1 
ATOM   2924  C  CA    . GLN A  1  378 ? -70.341  3.426   365.103 1.00 109.47 ? 378 GLN 1 CA    1 
ATOM   2925  C  C     . GLN A  1  378 ? -69.068  2.981   364.403 1.00 110.71 ? 378 GLN 1 C     1 
ATOM   2926  O  O     . GLN A  1  378 ? -69.044  2.938   363.167 1.00 111.41 ? 378 GLN 1 O     1 
ATOM   2927  C  CB    . GLN A  1  378 ? -70.621  4.886   364.715 1.00 118.31 ? 378 GLN 1 CB    1 
ATOM   2928  C  CG    . GLN A  1  378 ? -71.598  5.588   365.634 1.00 129.15 ? 378 GLN 1 CG    1 
ATOM   2929  C  CD    . GLN A  1  378 ? -73.015  5.525   365.124 1.00 138.62 ? 378 GLN 1 CD    1 
ATOM   2930  O  OE1   . GLN A  1  378 ? -73.414  4.546   364.494 1.00 139.21 ? 378 GLN 1 OE1   1 
ATOM   2931  N  NE2   . GLN A  1  378 ? -73.789  6.571   365.390 1.00 143.42 ? 378 GLN 1 NE2   1 
ATOM   2932  N  N     . GLY A  1  379 ? -68.019  2.654   365.145 1.00 109.22 ? 379 GLY 1 N     1 
ATOM   2933  C  CA    . GLY A  1  379 ? -66.736  2.405   364.536 1.00 102.32 ? 379 GLY 1 CA    1 
ATOM   2934  C  C     . GLY A  1  379 ? -66.634  1.061   363.846 1.00 96.41  ? 379 GLY 1 C     1 
ATOM   2935  O  O     . GLY A  1  379 ? -67.384  0.124   364.110 1.00 98.23  ? 379 GLY 1 O     1 
ATOM   2936  N  N     . GLU A  1  380 ? -65.673  0.991   362.931 1.00 93.28  ? 380 GLU 1 N     1 
ATOM   2937  C  CA    . GLU A  1  380 ? -65.268  -0.239  362.273 1.00 98.49  ? 380 GLU 1 CA    1 
ATOM   2938  C  C     . GLU A  1  380 ? -63.793  -0.464  362.571 1.00 103.11 ? 380 GLU 1 C     1 
ATOM   2939  O  O     . GLU A  1  380 ? -63.079  0.458   362.971 1.00 105.47 ? 380 GLU 1 O     1 
ATOM   2940  C  CB    . GLU A  1  380 ? -65.494  -0.184  360.753 1.00 100.93 ? 380 GLU 1 CB    1 
ATOM   2941  C  CG    . GLU A  1  380 ? -66.926  0.102   360.322 1.00 105.33 ? 380 GLU 1 CG    1 
ATOM   2942  C  CD    . GLU A  1  380 ? -66.998  0.972   359.078 1.00 107.37 ? 380 GLU 1 CD    1 
ATOM   2943  O  OE1   . GLU A  1  380 ? -66.225  0.724   358.129 1.00 106.95 ? 380 GLU 1 OE1   1 
ATOM   2944  O  OE2   . GLU A  1  380 ? -67.831  1.902   359.045 1.00 107.17 ? 380 GLU 1 OE2   1 
ATOM   2945  N  N     . GLU A  1  381 ? -63.338  -1.706  362.391 1.00 104.94 ? 381 GLU 1 N     1 
ATOM   2946  C  CA    . GLU A  1  381 ? -61.920  -1.994  362.586 1.00 106.42 ? 381 GLU 1 CA    1 
ATOM   2947  C  C     . GLU A  1  381 ? -61.046  -1.120  361.696 1.00 103.09 ? 381 GLU 1 C     1 
ATOM   2948  O  O     . GLU A  1  381 ? -59.905  -0.807  362.056 1.00 100.66 ? 381 GLU 1 O     1 
ATOM   2949  C  CB    . GLU A  1  381 ? -61.626  -3.471  362.326 1.00 111.48 ? 381 GLU 1 CB    1 
ATOM   2950  C  CG    . GLU A  1  381 ? -60.206  -3.858  362.706 1.00 118.52 ? 381 GLU 1 CG    1 
ATOM   2951  C  CD    . GLU A  1  381 ? -59.943  -5.342  362.592 1.00 126.87 ? 381 GLU 1 CD    1 
ATOM   2952  O  OE1   . GLU A  1  381 ? -60.837  -6.138  362.946 1.00 129.95 ? 381 GLU 1 OE1   1 
ATOM   2953  O  OE2   . GLU A  1  381 ? -58.835  -5.711  362.154 1.00 129.40 ? 381 GLU 1 OE2   1 
ATOM   2954  N  N     . LYS A  1  382 ? -61.554  -0.749  360.520 1.00 101.45 ? 382 LYS 1 N     1 
ATOM   2955  C  CA    . LYS A  1  382 ? -60.840  0.175   359.646 1.00 98.10  ? 382 LYS 1 CA    1 
ATOM   2956  C  C     . LYS A  1  382 ? -60.512  1.477   360.371 1.00 98.05  ? 382 LYS 1 C     1 
ATOM   2957  O  O     . LYS A  1  382 ? -59.445  2.065   360.158 1.00 100.99 ? 382 LYS 1 O     1 
ATOM   2958  C  CB    . LYS A  1  382 ? -61.683  0.440   358.399 1.00 95.20  ? 382 LYS 1 CB    1 
ATOM   2959  C  CG    . LYS A  1  382 ? -62.168  -0.839  357.721 1.00 91.95  ? 382 LYS 1 CG    1 
ATOM   2960  C  CD    . LYS A  1  382 ? -63.036  -0.556  356.506 1.00 85.21  ? 382 LYS 1 CD    1 
ATOM   2961  C  CE    . LYS A  1  382 ? -63.507  -1.850  355.857 1.00 75.61  ? 382 LYS 1 CE    1 
ATOM   2962  N  NZ    . LYS A  1  382 ? -64.516  -2.560  356.696 1.00 67.88  ? 382 LYS 1 NZ    1 
ATOM   2963  N  N     . ASP A  1  383 ? -61.425  1.946   361.226 1.00 94.79  ? 383 ASP 1 N     1 
ATOM   2964  C  CA    . ASP A  1  383 ? -61.145  3.121   362.047 1.00 91.67  ? 383 ASP 1 CA    1 
ATOM   2965  C  C     . ASP A  1  383 ? -59.987  2.855   362.998 1.00 89.00  ? 383 ASP 1 C     1 
ATOM   2966  O  O     . ASP A  1  383 ? -59.172  3.747   363.263 1.00 84.69  ? 383 ASP 1 O     1 
ATOM   2967  C  CB    . ASP A  1  383 ? -62.393  3.516   362.827 1.00 93.29  ? 383 ASP 1 CB    1 
ATOM   2968  C  CG    . ASP A  1  383 ? -63.624  3.564   361.957 1.00 98.34  ? 383 ASP 1 CG    1 
ATOM   2969  O  OD1   . ASP A  1  383 ? -63.492  3.832   360.746 1.00 99.78  ? 383 ASP 1 OD1   1 
ATOM   2970  O  OD2   . ASP A  1  383 ? -64.721  3.292   362.475 1.00 100.49 ? 383 ASP 1 OD2   1 
ATOM   2971  N  N     . VAL A  1  384 ? -59.902  1.631   363.524 1.00 94.57  ? 384 VAL 1 N     1 
ATOM   2972  C  CA    . VAL A  1  384 ? -58.787  1.267   364.394 1.00 102.56 ? 384 VAL 1 CA    1 
ATOM   2973  C  C     . VAL A  1  384 ? -57.482  1.307   363.612 1.00 107.30 ? 384 VAL 1 C     1 
ATOM   2974  O  O     . VAL A  1  384 ? -56.458  1.786   364.111 1.00 108.14 ? 384 VAL 1 O     1 
ATOM   2975  C  CB    . VAL A  1  384 ? -59.023  -0.115  365.033 1.00 102.95 ? 384 VAL 1 CB    1 
ATOM   2976  C  CG1   . VAL A  1  384 ? -57.920  -0.438  366.035 1.00 99.75  ? 384 VAL 1 CG1   1 
ATOM   2977  C  CG2   . VAL A  1  384 ? -60.390  -0.178  365.703 1.00 105.05 ? 384 VAL 1 CG2   1 
ATOM   2978  N  N     . GLU A  1  385 ? -57.494  0.795   362.379 1.00 108.38 ? 385 GLU 1 N     1 
ATOM   2979  C  CA    . GLU A  1  385 ? -56.292  0.849   361.550 1.00 108.90 ? 385 GLU 1 CA    1 
ATOM   2980  C  C     . GLU A  1  385 ? -55.882  2.291   361.278 1.00 107.24 ? 385 GLU 1 C     1 
ATOM   2981  O  O     . GLU A  1  385 ? -54.695  2.633   361.346 1.00 105.39 ? 385 GLU 1 O     1 
ATOM   2982  C  CB    . GLU A  1  385 ? -56.520  0.113   360.231 1.00 113.80 ? 385 GLU 1 CB    1 
ATOM   2983  C  CG    . GLU A  1  385 ? -56.899  -1.347  360.367 1.00 122.48 ? 385 GLU 1 CG    1 
ATOM   2984  C  CD    . GLU A  1  385 ? -56.931  -2.052  359.026 1.00 132.24 ? 385 GLU 1 CD    1 
ATOM   2985  O  OE1   . GLU A  1  385 ? -55.968  -1.893  358.246 1.00 136.41 ? 385 GLU 1 OE1   1 
ATOM   2986  O  OE2   . GLU A  1  385 ? -57.920  -2.760  358.746 1.00 135.71 ? 385 GLU 1 OE2   1 
ATOM   2987  N  N     . ASN A  1  386 ? -56.856  3.149   360.960 1.00 107.26 ? 386 ASN 1 N     1 
ATOM   2988  C  CA    . ASN A  1  386 ? -56.568  4.563   360.730 1.00 103.36 ? 386 ASN 1 CA    1 
ATOM   2989  C  C     . ASN A  1  386 ? -55.937  5.204   361.958 1.00 97.42  ? 386 ASN 1 C     1 
ATOM   2990  O  O     . ASN A  1  386 ? -54.910  5.884   361.861 1.00 100.23 ? 386 ASN 1 O     1 
ATOM   2991  C  CB    . ASN A  1  386 ? -57.844  5.310   360.338 1.00 104.41 ? 386 ASN 1 CB    1 
ATOM   2992  C  CG    . ASN A  1  386 ? -58.251  5.062   358.901 1.00 107.61 ? 386 ASN 1 CG    1 
ATOM   2993  O  OD1   . ASN A  1  386 ? -57.517  5.399   357.975 1.00 111.52 ? 386 ASN 1 OD1   1 
ATOM   2994  N  ND2   . ASN A  1  386 ? -59.428  4.483   358.707 1.00 107.10 ? 386 ASN 1 ND2   1 
ATOM   2995  N  N     . LEU A  1  387 ? -56.565  5.028   363.121 1.00 89.35  ? 387 LEU 1 N     1 
ATOM   2996  C  CA    . LEU A  1  387 ? -56.036  5.631   364.338 1.00 87.27  ? 387 LEU 1 CA    1 
ATOM   2997  C  C     . LEU A  1  387 ? -54.642  5.099   364.653 1.00 86.32  ? 387 LEU 1 C     1 
ATOM   2998  O  O     . LEU A  1  387 ? -53.761  5.859   365.071 1.00 83.85  ? 387 LEU 1 O     1 
ATOM   2999  C  CB    . LEU A  1  387 ? -56.996  5.387   365.501 1.00 89.07  ? 387 LEU 1 CB    1 
ATOM   3000  C  CG    . LEU A  1  387 ? -56.558  5.959   366.847 1.00 90.30  ? 387 LEU 1 CG    1 
ATOM   3001  C  CD1   . LEU A  1  387 ? -56.159  7.419   366.709 1.00 87.90  ? 387 LEU 1 CD1   1 
ATOM   3002  C  CD2   . LEU A  1  387 ? -57.668  5.792   367.866 1.00 92.44  ? 387 LEU 1 CD2   1 
ATOM   3003  N  N     . GLU A  1  388 ? -54.425  3.796   364.458 1.00 89.53  ? 388 GLU 1 N     1 
ATOM   3004  C  CA    . GLU A  1  388 ? -53.110  3.214   364.702 1.00 91.36  ? 388 GLU 1 CA    1 
ATOM   3005  C  C     . GLU A  1  388 ? -52.059  3.814   363.778 1.00 84.09  ? 388 GLU 1 C     1 
ATOM   3006  O  O     . GLU A  1  388 ? -50.928  4.078   364.202 1.00 76.53  ? 388 GLU 1 O     1 
ATOM   3007  C  CB    . GLU A  1  388 ? -53.168  1.696   364.530 1.00 99.02  ? 388 GLU 1 CB    1 
ATOM   3008  C  CG    . GLU A  1  388 ? -51.806  1.044   364.387 1.00 105.61 ? 388 GLU 1 CG    1 
ATOM   3009  C  CD    . GLU A  1  388 ? -51.135  0.819   365.725 1.00 109.77 ? 388 GLU 1 CD    1 
ATOM   3010  O  OE1   . GLU A  1  388 ? -50.642  1.803   366.313 1.00 109.81 ? 388 GLU 1 OE1   1 
ATOM   3011  O  OE2   . GLU A  1  388 ? -51.094  -0.340  366.186 1.00 111.24 ? 388 GLU 1 OE2   1 
ATOM   3012  N  N     . ALA A  1  389 ? -52.412  4.033   362.509 1.00 86.75  ? 389 ALA 1 N     1 
ATOM   3013  C  CA    . ALA A  1  389 ? -51.472  4.602   361.550 1.00 88.11  ? 389 ALA 1 CA    1 
ATOM   3014  C  C     . ALA A  1  389 ? -51.261  6.098   361.746 1.00 86.13  ? 389 ALA 1 C     1 
ATOM   3015  O  O     . ALA A  1  389 ? -50.244  6.630   361.289 1.00 83.98  ? 389 ALA 1 O     1 
ATOM   3016  C  CB    . ALA A  1  389 ? -51.951  4.337   360.121 1.00 89.46  ? 389 ALA 1 CB    1 
ATOM   3017  N  N     . LEU A  1  390 ? -52.195  6.783   362.412 1.00 84.32  ? 390 LEU 1 N     1 
ATOM   3018  C  CA    . LEU A  1  390 ? -52.105  8.236   362.541 1.00 77.53  ? 390 LEU 1 CA    1 
ATOM   3019  C  C     . LEU A  1  390 ? -50.922  8.673   363.395 1.00 73.13  ? 390 LEU 1 C     1 
ATOM   3020  O  O     . LEU A  1  390 ? -50.342  9.735   363.143 1.00 66.50  ? 390 LEU 1 O     1 
ATOM   3021  C  CB    . LEU A  1  390 ? -53.397  8.797   363.136 1.00 76.31  ? 390 LEU 1 CB    1 
ATOM   3022  C  CG    . LEU A  1  390 ? -54.539  9.015   362.152 1.00 76.93  ? 390 LEU 1 CG    1 
ATOM   3023  C  CD1   . LEU A  1  390 ? -55.775  9.541   362.868 1.00 78.21  ? 390 LEU 1 CD1   1 
ATOM   3024  C  CD2   . LEU A  1  390 ? -54.087  9.962   361.052 1.00 78.10  ? 390 LEU 1 CD2   1 
ATOM   3025  N  N     . LEU A  1  391 ? -50.551  7.873   364.395 1.00 76.46  ? 391 LEU 1 N     1 
ATOM   3026  C  CA    . LEU A  1  391 ? -49.679  8.299   365.484 1.00 79.10  ? 391 LEU 1 CA    1 
ATOM   3027  C  C     . LEU A  1  391 ? -48.369  8.906   364.983 1.00 74.10  ? 391 LEU 1 C     1 
ATOM   3028  O  O     . LEU A  1  391 ? -48.082  10.060  365.316 1.00 56.16  ? 391 LEU 1 O     1 
ATOM   3029  C  CB    . LEU A  1  391 ? -49.404  7.127   366.434 1.00 83.38  ? 391 LEU 1 CB    1 
ATOM   3030  C  CG    . LEU A  1  391 ? -50.626  6.324   366.891 1.00 83.91  ? 391 LEU 1 CG    1 
ATOM   3031  C  CD1   . LEU A  1  391 ? -50.204  5.159   367.777 1.00 83.85  ? 391 LEU 1 CD1   1 
ATOM   3032  C  CD2   . LEU A  1  391 ? -51.641  7.215   367.598 1.00 80.05  ? 391 LEU 1 CD2   1 
ATOM   3033  N  N     . PRO A  1  392 ? -47.556  8.203   364.181 1.00 80.61  ? 392 PRO 1 N     1 
ATOM   3034  C  CA    . PRO A  1  392 ? -46.227  8.749   363.853 1.00 81.85  ? 392 PRO 1 CA    1 
ATOM   3035  C  C     . PRO A  1  392 ? -46.267  10.019  363.026 1.00 80.41  ? 392 PRO 1 C     1 
ATOM   3036  O  O     . PRO A  1  392 ? -45.299  10.792  363.063 1.00 76.47  ? 392 PRO 1 O     1 
ATOM   3037  C  CB    . PRO A  1  392 ? -45.561  7.606   363.077 1.00 82.34  ? 392 PRO 1 CB    1 
ATOM   3038  C  CG    . PRO A  1  392 ? -46.695  6.891   362.455 1.00 80.74  ? 392 PRO 1 CG    1 
ATOM   3039  C  CD    . PRO A  1  392 ? -47.792  6.927   363.477 1.00 80.99  ? 392 PRO 1 CD    1 
ATOM   3040  N  N     . LEU A  1  393 ? -47.351  10.266  362.289 1.00 82.50  ? 393 LEU 1 N     1 
ATOM   3041  C  CA    . LEU A  1  393 ? -47.474  11.508  361.536 1.00 83.11  ? 393 LEU 1 CA    1 
ATOM   3042  C  C     . LEU A  1  393 ? -47.515  12.717  362.455 1.00 83.77  ? 393 LEU 1 C     1 
ATOM   3043  O  O     . LEU A  1  393 ? -47.287  13.842  362.000 1.00 81.66  ? 393 LEU 1 O     1 
ATOM   3044  C  CB    . LEU A  1  393 ? -48.728  11.473  360.662 1.00 77.86  ? 393 LEU 1 CB    1 
ATOM   3045  C  CG    . LEU A  1  393 ? -48.747  10.427  359.549 1.00 71.30  ? 393 LEU 1 CG    1 
ATOM   3046  C  CD1   . LEU A  1  393 ? -50.179  10.027  359.201 1.00 67.87  ? 393 LEU 1 CD1   1 
ATOM   3047  C  CD2   . LEU A  1  393 ? -47.998  10.936  358.324 1.00 66.60  ? 393 LEU 1 CD2   1 
ATOM   3048  N  N     . ILE A  1  394 ? -47.808  12.502  363.735 1.00 82.83  ? 394 ILE 1 N     1 
ATOM   3049  C  CA    . ILE A  1  394 ? -47.821  13.566  364.716 1.00 80.52  ? 394 ILE 1 CA    1 
ATOM   3050  C  C     . ILE A  1  394 ? -46.709  13.414  365.751 1.00 83.02  ? 394 ILE 1 C     1 
ATOM   3051  O  O     . ILE A  1  394 ? -46.174  14.425  366.220 1.00 77.02  ? 394 ILE 1 O     1 
ATOM   3052  C  CB    . ILE A  1  394 ? -49.203  13.604  365.398 1.00 80.54  ? 394 ILE 1 CB    1 
ATOM   3053  C  CG1   . ILE A  1  394 ? -50.311  13.647  364.344 1.00 75.69  ? 394 ILE 1 CG1   1 
ATOM   3054  C  CG2   . ILE A  1  394 ? -49.335  14.806  366.289 1.00 86.84  ? 394 ILE 1 CG2   1 
ATOM   3055  C  CD1   . ILE A  1  394 ? -51.714  13.575  364.918 1.00 70.41  ? 394 ILE 1 CD1   1 
ATOM   3056  N  N     . GLU A  1  395 ? -46.336  12.183  366.106 1.00 96.34  ? 395 GLU 1 N     1 
ATOM   3057  C  CA    . GLU A  1  395 ? -45.401  11.902  367.190 1.00 106.17 ? 395 GLU 1 CA    1 
ATOM   3058  C  C     . GLU A  1  395 ? -44.040  12.552  366.976 1.00 114.84 ? 395 GLU 1 C     1 
ATOM   3059  O  O     . GLU A  1  395 ? -43.640  13.435  367.739 1.00 118.25 ? 395 GLU 1 O     1 
ATOM   3060  C  CB    . GLU A  1  395 ? -45.219  10.391  367.363 1.00 102.90 ? 395 GLU 1 CB    1 
ATOM   3061  C  CG    . GLU A  1  395 ? -44.111  10.021  368.341 1.00 101.60 ? 395 GLU 1 CG    1 
ATOM   3062  C  CD    . GLU A  1  395 ? -44.137  8.560   368.724 1.00 100.32 ? 395 GLU 1 CD    1 
ATOM   3063  O  OE1   . GLU A  1  395 ? -44.788  7.774   368.009 1.00 100.81 ? 395 GLU 1 OE1   1 
ATOM   3064  O  OE2   . GLU A  1  395 ? -43.510  8.200   369.740 1.00 101.09 ? 395 GLU 1 OE2   1 
ATOM   3065  N  N     . GLY A  1  396 ? -43.323  12.121  365.935 1.00 114.95 ? 396 GLY 1 N     1 
ATOM   3066  C  CA    . GLY A  1  396 ? -41.928  12.501  365.807 1.00 112.09 ? 396 GLY 1 CA    1 
ATOM   3067  C  C     . GLY A  1  396 ? -41.728  13.990  365.623 1.00 103.52 ? 396 GLY 1 C     1 
ATOM   3068  O  O     . GLY A  1  396 ? -40.727  14.548  366.081 1.00 102.14 ? 396 GLY 1 O     1 
ATOM   3069  N  N     . ARG A  1  397 ? -42.674  14.656  364.966 1.00 97.50  ? 397 ARG 1 N     1 
ATOM   3070  C  CA    . ARG A  1  397 ? -42.458  15.984  364.400 1.00 96.20  ? 397 ARG 1 CA    1 
ATOM   3071  C  C     . ARG A  1  397 ? -43.609  16.889  364.828 1.00 93.95  ? 397 ARG 1 C     1 
ATOM   3072  O  O     . ARG A  1  397 ? -44.649  16.956  364.167 1.00 93.59  ? 397 ARG 1 O     1 
ATOM   3073  C  CB    . ARG A  1  397 ? -42.325  15.910  362.873 1.00 98.30  ? 397 ARG 1 CB    1 
ATOM   3074  C  CG    . ARG A  1  397 ? -43.340  14.995  362.168 1.00 99.96  ? 397 ARG 1 CG    1 
ATOM   3075  C  CD    . ARG A  1  397 ? -42.961  13.518  362.245 1.00 99.55  ? 397 ARG 1 CD    1 
ATOM   3076  N  NE    . ARG A  1  397 ? -43.419  12.745  361.098 1.00 99.08  ? 397 ARG 1 NE    1 
ATOM   3077  C  CZ    . ARG A  1  397 ? -43.055  11.490  360.860 1.00 98.50  ? 397 ARG 1 CZ    1 
ATOM   3078  N  NH1   . ARG A  1  397 ? -42.221  10.874  361.688 1.00 99.02  ? 397 ARG 1 NH1   1 
ATOM   3079  N  NH2   . ARG A  1  397 ? -43.517  10.850  359.797 1.00 97.43  ? 397 ARG 1 NH2   1 
ATOM   3080  N  N     . SER A  1  398 ? -43.410  17.598  365.933 1.00 92.62  ? 398 SER 1 N     1 
ATOM   3081  C  CA    . SER A  1  398 ? -44.335  18.633  366.356 1.00 93.95  ? 398 SER 1 CA    1 
ATOM   3082  C  C     . SER A  1  398 ? -43.530  19.738  367.014 1.00 93.55  ? 398 SER 1 C     1 
ATOM   3083  O  O     . SER A  1  398 ? -42.444  19.501  367.549 1.00 88.20  ? 398 SER 1 O     1 
ATOM   3084  C  CB    . SER A  1  398 ? -45.404  18.096  367.315 1.00 99.79  ? 398 SER 1 CB    1 
ATOM   3085  O  OG    . SER A  1  398 ? -46.119  17.025  366.724 1.00 105.27 ? 398 SER 1 OG    1 
ATOM   3086  N  N     . PHE A  1  399 ? -44.079  20.951  366.978 1.00 101.06 ? 399 PHE 1 N     1 
ATOM   3087  C  CA    . PHE A  1  399 ? -43.329  22.096  367.474 1.00 109.30 ? 399 PHE 1 CA    1 
ATOM   3088  C  C     . PHE A  1  399 ? -43.233  22.095  368.995 1.00 119.15 ? 399 PHE 1 C     1 
ATOM   3089  O  O     . PHE A  1  399 ? -42.207  22.505  369.548 1.00 126.88 ? 399 PHE 1 O     1 
ATOM   3090  C  CB    . PHE A  1  399 ? -43.949  23.389  366.957 1.00 109.36 ? 399 PHE 1 CB    1 
ATOM   3091  C  CG    . PHE A  1  399 ? -42.976  24.514  366.858 1.00 116.37 ? 399 PHE 1 CG    1 
ATOM   3092  C  CD1   . PHE A  1  399 ? -41.845  24.390  366.074 1.00 121.75 ? 399 PHE 1 CD1   1 
ATOM   3093  C  CD2   . PHE A  1  399 ? -43.188  25.695  367.539 1.00 121.99 ? 399 PHE 1 CD2   1 
ATOM   3094  C  CE1   . PHE A  1  399 ? -40.941  25.422  365.978 1.00 128.30 ? 399 PHE 1 CE1   1 
ATOM   3095  C  CE2   . PHE A  1  399 ? -42.285  26.732  367.444 1.00 126.63 ? 399 PHE 1 CE2   1 
ATOM   3096  C  CZ    . PHE A  1  399 ? -41.164  26.595  366.663 1.00 129.78 ? 399 PHE 1 CZ    1 
ATOM   3097  N  N     . CYS A  1  400 ? -44.273  21.635  369.682 1.00 118.28 ? 400 CYS 1 N     1 
ATOM   3098  C  CA    . CYS A  1  400 ? -44.218  21.447  371.121 1.00 118.96 ? 400 CYS 1 CA    1 
ATOM   3099  C  C     . CYS A  1  400 ? -44.660  20.033  371.456 1.00 114.25 ? 400 CYS 1 C     1 
ATOM   3100  O  O     . CYS A  1  400 ? -45.496  19.457  370.754 1.00 110.13 ? 400 CYS 1 O     1 
ATOM   3101  C  CB    . CYS A  1  400 ? -45.096  22.464  371.869 1.00 127.37 ? 400 CYS 1 CB    1 
ATOM   3102  S  SG    . CYS A  1  400 ? -46.753  21.896  372.277 1.00 135.84 ? 400 CYS 1 SG    1 
ATOM   3103  N  N     . PRO A  1  401 ? -44.094  19.440  372.513 1.00 116.95 ? 401 PRO 1 N     1 
ATOM   3104  C  CA    . PRO A  1  401 ? -44.299  18.005  372.760 1.00 122.94 ? 401 PRO 1 CA    1 
ATOM   3105  C  C     . PRO A  1  401 ? -45.728  17.617  373.112 1.00 129.02 ? 401 PRO 1 C     1 
ATOM   3106  O  O     . PRO A  1  401 ? -45.989  16.420  373.294 1.00 127.45 ? 401 PRO 1 O     1 
ATOM   3107  C  CB    . PRO A  1  401 ? -43.357  17.723  373.942 1.00 120.55 ? 401 PRO 1 CB    1 
ATOM   3108  C  CG    . PRO A  1  401 ? -42.323  18.798  373.865 1.00 117.01 ? 401 PRO 1 CG    1 
ATOM   3109  C  CD    . PRO A  1  401 ? -43.069  20.009  373.403 1.00 115.88 ? 401 PRO 1 CD    1 
ATOM   3110  N  N     . LEU A  1  402 ? -46.660  18.574  373.195 1.00 134.04 ? 402 LEU 1 N     1 
ATOM   3111  C  CA    . LEU A  1  402 ? -48.043  18.250  373.540 1.00 136.02 ? 402 LEU 1 CA    1 
ATOM   3112  C  C     . LEU A  1  402 ? -48.604  17.193  372.604 1.00 140.33 ? 402 LEU 1 C     1 
ATOM   3113  O  O     . LEU A  1  402 ? -49.212  16.212  373.046 1.00 141.92 ? 402 LEU 1 O     1 
ATOM   3114  C  CB    . LEU A  1  402 ? -48.911  19.512  373.497 1.00 134.05 ? 402 LEU 1 CB    1 
ATOM   3115  C  CG    . LEU A  1  402 ? -50.315  19.456  374.106 1.00 135.81 ? 402 LEU 1 CG    1 
ATOM   3116  C  CD1   . LEU A  1  402 ? -50.706  20.818  374.649 1.00 136.93 ? 402 LEU 1 CD1   1 
ATOM   3117  C  CD2   . LEU A  1  402 ? -51.352  18.975  373.092 1.00 136.97 ? 402 LEU 1 CD2   1 
ATOM   3118  N  N     . ALA A  1  403 ? -48.405  17.382  371.299 1.00 141.48 ? 403 ALA 1 N     1 
ATOM   3119  C  CA    . ALA A  1  403 ? -48.841  16.381  370.336 1.00 139.47 ? 403 ALA 1 CA    1 
ATOM   3120  C  C     . ALA A  1  403 ? -48.222  15.027  370.652 1.00 134.53 ? 403 ALA 1 C     1 
ATOM   3121  O  O     . ALA A  1  403 ? -48.922  14.010  370.712 1.00 136.72 ? 403 ALA 1 O     1 
ATOM   3122  C  CB    . ALA A  1  403 ? -48.479  16.841  368.926 1.00 139.20 ? 403 ALA 1 CB    1 
ATOM   3123  N  N     . ASP A  1  404 ? -46.909  15.004  370.897 1.00 124.97 ? 404 ASP 1 N     1 
ATOM   3124  C  CA    . ASP A  1  404 ? -46.281  13.797  371.419 1.00 118.33 ? 404 ASP 1 CA    1 
ATOM   3125  C  C     . ASP A  1  404 ? -46.987  13.358  372.691 1.00 111.39 ? 404 ASP 1 C     1 
ATOM   3126  O  O     . ASP A  1  404 ? -47.469  12.223  372.799 1.00 108.71 ? 404 ASP 1 O     1 
ATOM   3127  C  CB    . ASP A  1  404 ? -44.795  14.052  371.679 1.00 121.79 ? 404 ASP 1 CB    1 
ATOM   3128  C  CG    . ASP A  1  404 ? -44.074  14.594  370.458 1.00 126.01 ? 404 ASP 1 CG    1 
ATOM   3129  O  OD1   . ASP A  1  404 ? -44.759  15.099  369.545 1.00 126.77 ? 404 ASP 1 OD1   1 
ATOM   3130  O  OD2   . ASP A  1  404 ? -42.827  14.519  370.407 1.00 127.81 ? 404 ASP 1 OD2   1 
ATOM   3131  N  N     . ALA A  1  405 ? -47.110  14.285  373.642 1.00 108.18 ? 405 ALA 1 N     1 
ATOM   3132  C  CA    . ALA A  1  405 ? -47.818  14.034  374.886 1.00 102.28 ? 405 ALA 1 CA    1 
ATOM   3133  C  C     . ALA A  1  405 ? -49.266  13.633  374.656 1.00 93.46  ? 405 ALA 1 C     1 
ATOM   3134  O  O     . ALA A  1  405 ? -49.876  13.030  375.543 1.00 91.76  ? 405 ALA 1 O     1 
ATOM   3135  C  CB    . ALA A  1  405 ? -47.756  15.281  375.766 1.00 102.15 ? 405 ALA 1 CB    1 
ATOM   3136  N  N     . ALA A  1  406 ? -49.840  13.982  373.505 1.00 86.30  ? 406 ALA 1 N     1 
ATOM   3137  C  CA    . ALA A  1  406 ? -51.192  13.546  373.188 1.00 78.70  ? 406 ALA 1 CA    1 
ATOM   3138  C  C     . ALA A  1  406 ? -51.213  12.180  372.524 1.00 74.93  ? 406 ALA 1 C     1 
ATOM   3139  O  O     . ALA A  1  406 ? -52.149  11.406  372.753 1.00 70.24  ? 406 ALA 1 O     1 
ATOM   3140  C  CB    . ALA A  1  406 ? -51.887  14.569  372.286 1.00 77.58  ? 406 ALA 1 CB    1 
ATOM   3141  N  N     . VAL A  1  407 ? -50.200  11.863  371.718 1.00 81.43  ? 407 VAL 1 N     1 
ATOM   3142  C  CA    . VAL A  1  407 ? -50.201  10.601  370.985 1.00 90.21  ? 407 VAL 1 CA    1 
ATOM   3143  C  C     . VAL A  1  407 ? -49.617  9.470   371.832 1.00 99.05  ? 407 VAL 1 C     1 
ATOM   3144  O  O     . VAL A  1  407 ? -49.995  8.308   371.651 1.00 97.16  ? 407 VAL 1 O     1 
ATOM   3145  C  CB    . VAL A  1  407 ? -49.464  10.733  369.637 1.00 85.84  ? 407 VAL 1 CB    1 
ATOM   3146  C  CG1   . VAL A  1  407 ? -50.094  11.829  368.784 1.00 85.23  ? 407 VAL 1 CG1   1 
ATOM   3147  C  CG2   . VAL A  1  407 ? -47.978  10.991  369.839 1.00 83.95  ? 407 VAL 1 CG2   1 
ATOM   3148  N  N     . TRP A  1  408 ? -48.698  9.787   372.744 1.00 106.92 ? 408 TRP 1 N     1 
ATOM   3149  C  CA    . TRP A  1  408 ? -48.076  8.757   373.574 1.00 112.36 ? 408 TRP 1 CA    1 
ATOM   3150  C  C     . TRP A  1  408 ? -49.093  7.975   374.399 1.00 115.65 ? 408 TRP 1 C     1 
ATOM   3151  O  O     . TRP A  1  408 ? -49.054  6.733   374.363 1.00 119.19 ? 408 TRP 1 O     1 
ATOM   3152  C  CB    . TRP A  1  408 ? -46.994  9.394   374.454 1.00 113.92 ? 408 TRP 1 CB    1 
ATOM   3153  C  CG    . TRP A  1  408 ? -45.690  9.547   373.737 1.00 118.96 ? 408 TRP 1 CG    1 
ATOM   3154  C  CD1   . TRP A  1  408 ? -45.184  8.718   372.783 1.00 120.59 ? 408 TRP 1 CD1   1 
ATOM   3155  C  CD2   . TRP A  1  408 ? -44.734  10.602  373.899 1.00 126.29 ? 408 TRP 1 CD2   1 
ATOM   3156  N  NE1   . TRP A  1  408 ? -43.971  9.185   372.341 1.00 122.99 ? 408 TRP 1 NE1   1 
ATOM   3157  C  CE2   . TRP A  1  408 ? -43.671  10.341  373.012 1.00 125.91 ? 408 TRP 1 CE2   1 
ATOM   3158  C  CE3   . TRP A  1  408 ? -44.670  11.739  374.709 1.00 132.23 ? 408 TRP 1 CE3   1 
ATOM   3159  C  CZ2   . TRP A  1  408 ? -42.559  11.174  372.913 1.00 127.55 ? 408 TRP 1 CZ2   1 
ATOM   3160  C  CZ3   . TRP A  1  408 ? -43.563  12.563  374.610 1.00 132.71 ? 408 TRP 1 CZ3   1 
ATOM   3161  C  CH2   . TRP A  1  408 ? -42.524  12.277  373.719 1.00 130.34 ? 408 TRP 1 CH2   1 
ATOM   3162  N  N     . PRO A  1  409 ? -50.002  8.602   375.163 1.00 110.47 ? 409 PRO 1 N     1 
ATOM   3163  C  CA    . PRO A  1  409 ? -50.915  7.792   375.988 1.00 107.20 ? 409 PRO 1 CA    1 
ATOM   3164  C  C     . PRO A  1  409 ? -51.787  6.880   375.150 1.00 98.98  ? 409 PRO 1 C     1 
ATOM   3165  O  O     . PRO A  1  409 ? -52.065  5.744   375.552 1.00 98.02  ? 409 PRO 1 O     1 
ATOM   3166  C  CB    . PRO A  1  409 ? -51.738  8.845   376.742 1.00 110.74 ? 409 PRO 1 CB    1 
ATOM   3167  C  CG    . PRO A  1  409 ? -51.639  10.068  375.915 1.00 110.39 ? 409 PRO 1 CG    1 
ATOM   3168  C  CD    . PRO A  1  409 ? -50.274  10.041  375.315 1.00 109.04 ? 409 PRO 1 CD    1 
ATOM   3169  N  N     . VAL A  1  410 ? -52.229  7.358   373.983 1.00 93.53  ? 410 VAL 1 N     1 
ATOM   3170  C  CA    . VAL A  1  410 ? -53.067  6.544   373.111 1.00 92.03  ? 410 VAL 1 CA    1 
ATOM   3171  C  C     . VAL A  1  410 ? -52.270  5.353   372.595 1.00 96.20  ? 410 VAL 1 C     1 
ATOM   3172  O  O     . VAL A  1  410 ? -52.807  4.249   372.436 1.00 98.33  ? 410 VAL 1 O     1 
ATOM   3173  C  CB    . VAL A  1  410 ? -53.643  7.393   371.962 1.00 88.55  ? 410 VAL 1 CB    1 
ATOM   3174  C  CG1   . VAL A  1  410 ? -54.566  6.558   371.086 1.00 89.14  ? 410 VAL 1 CG1   1 
ATOM   3175  C  CG2   . VAL A  1  410 ? -54.392  8.603   372.511 1.00 88.23  ? 410 VAL 1 CG2   1 
ATOM   3176  N  N     . LYS A  1  411 ? -50.978  5.560   372.330 1.00 95.90  ? 411 LYS 1 N     1 
ATOM   3177  C  CA    . LYS A  1  411 ? -50.124  4.496   371.812 1.00 94.11  ? 411 LYS 1 CA    1 
ATOM   3178  C  C     . LYS A  1  411 ? -50.159  3.283   372.732 1.00 93.00  ? 411 LYS 1 C     1 
ATOM   3179  O  O     . LYS A  1  411 ? -50.518  2.175   372.315 1.00 88.07  ? 411 LYS 1 O     1 
ATOM   3180  C  CB    . LYS A  1  411 ? -48.696  5.024   371.653 1.00 88.48  ? 411 LYS 1 CB    1 
ATOM   3181  C  CG    . LYS A  1  411 ? -47.711  4.046   371.044 1.00 83.10  ? 411 LYS 1 CG    1 
ATOM   3182  C  CD    . LYS A  1  411 ? -46.299  4.340   371.517 1.00 77.30  ? 411 LYS 1 CD    1 
ATOM   3183  C  CE    . LYS A  1  411 ? -45.345  3.240   371.105 1.00 72.25  ? 411 LYS 1 CE    1 
ATOM   3184  N  NZ    . LYS A  1  411 ? -44.963  3.380   369.675 1.00 66.94  ? 411 LYS 1 NZ    1 
ATOM   3185  N  N     . GLY A  1  412 ? -49.805  3.482   374.002 1.00 96.34  ? 412 GLY 1 N     1 
ATOM   3186  C  CA    . GLY A  1  412 ? -49.964  2.418   374.977 1.00 97.79  ? 412 GLY 1 CA    1 
ATOM   3187  C  C     . GLY A  1  412 ? -51.406  1.969   375.099 1.00 102.64 ? 412 GLY 1 C     1 
ATOM   3188  O  O     . GLY A  1  412 ? -51.683  0.778   375.266 1.00 101.90 ? 412 GLY 1 O     1 
ATOM   3189  N  N     . SER A  1  413 ? -52.347  2.916   374.986 1.00 110.00 ? 413 SER 1 N     1 
ATOM   3190  C  CA    . SER A  1  413 ? -53.762  2.563   375.001 1.00 115.66 ? 413 SER 1 CA    1 
ATOM   3191  C  C     . SER A  1  413 ? -54.093  1.596   373.879 1.00 121.83 ? 413 SER 1 C     1 
ATOM   3192  O  O     . SER A  1  413 ? -55.003  0.774   374.015 1.00 122.72 ? 413 SER 1 O     1 
ATOM   3193  C  CB    . SER A  1  413 ? -54.633  3.815   374.885 1.00 112.63 ? 413 SER 1 CB    1 
ATOM   3194  O  OG    . SER A  1  413 ? -54.961  4.085   373.531 1.00 109.64 ? 413 SER 1 OG    1 
ATOM   3195  N  N     . LEU A  1  414 ? -53.385  1.694   372.757 1.00 124.00 ? 414 LEU 1 N     1 
ATOM   3196  C  CA    . LEU A  1  414 ? -53.451  0.634   371.764 1.00 122.53 ? 414 LEU 1 CA    1 
ATOM   3197  C  C     . LEU A  1  414 ? -52.563  -0.534  372.171 1.00 125.11 ? 414 LEU 1 C     1 
ATOM   3198  O  O     . LEU A  1  414 ? -53.023  -1.681  372.246 1.00 126.00 ? 414 LEU 1 O     1 
ATOM   3199  C  CB    . LEU A  1  414 ? -53.048  1.177   370.391 1.00 116.74 ? 414 LEU 1 CB    1 
ATOM   3200  C  CG    . LEU A  1  414 ? -54.187  1.684   369.504 1.00 113.71 ? 414 LEU 1 CG    1 
ATOM   3201  C  CD1   . LEU A  1  414 ? -54.846  2.908   370.114 1.00 112.68 ? 414 LEU 1 CD1   1 
ATOM   3202  C  CD2   . LEU A  1  414 ? -53.683  1.985   368.104 1.00 113.23 ? 414 LEU 1 CD2   1 
ATOM   3203  N  N     . ARG A  1  415 ? -51.306  -0.231  372.519 1.00 123.63 ? 415 ARG 1 N     1 
ATOM   3204  C  CA    . ARG A  1  415 ? -50.289  -1.252  372.759 1.00 118.50 ? 415 ARG 1 CA    1 
ATOM   3205  C  C     . ARG A  1  415 ? -50.751  -2.326  373.734 1.00 112.79 ? 415 ARG 1 C     1 
ATOM   3206  O  O     . ARG A  1  415 ? -50.341  -3.486  373.617 1.00 110.88 ? 415 ARG 1 O     1 
ATOM   3207  C  CB    . ARG A  1  415 ? -49.014  -0.577  373.271 1.00 119.35 ? 415 ARG 1 CB    1 
ATOM   3208  C  CG    . ARG A  1  415 ? -47.823  -1.493  373.476 1.00 122.04 ? 415 ARG 1 CG    1 
ATOM   3209  C  CD    . ARG A  1  415 ? -47.016  -1.024  374.680 1.00 125.08 ? 415 ARG 1 CD    1 
ATOM   3210  N  NE    . ARG A  1  415 ? -45.980  -1.973  375.072 1.00 127.91 ? 415 ARG 1 NE    1 
ATOM   3211  C  CZ    . ARG A  1  415 ? -45.199  -1.822  376.136 1.00 127.44 ? 415 ARG 1 CZ    1 
ATOM   3212  N  NH1   . ARG A  1  415 ? -45.338  -0.758  376.916 1.00 126.47 ? 415 ARG 1 NH1   1 
ATOM   3213  N  NH2   . ARG A  1  415 ? -44.283  -2.737  376.426 1.00 126.68 ? 415 ARG 1 NH2   1 
ATOM   3214  N  N     . HIS A  1  416 ? -51.601  -1.967  374.696 1.00 110.04 ? 416 HIS 1 N     1 
ATOM   3215  C  CA    . HIS A  1  416 ? -52.139  -2.933  375.639 1.00 108.93 ? 416 HIS 1 CA    1 
ATOM   3216  C  C     . HIS A  1  416 ? -53.648  -3.129  375.561 1.00 106.63 ? 416 HIS 1 C     1 
ATOM   3217  O  O     . HIS A  1  416 ? -54.154  -4.067  376.189 1.00 105.73 ? 416 HIS 1 O     1 
ATOM   3218  C  CB    . HIS A  1  416 ? -51.750  -2.558  377.078 1.00 112.61 ? 416 HIS 1 CB    1 
ATOM   3219  C  CG    . HIS A  1  416 ? -50.283  -2.688  377.357 1.00 115.21 ? 416 HIS 1 CG    1 
ATOM   3220  N  ND1   . HIS A  1  416 ? -49.662  -3.910  377.511 1.00 116.35 ? 416 HIS 1 ND1   1 
ATOM   3221  C  CD2   . HIS A  1  416 ? -49.316  -1.753  377.516 1.00 118.57 ? 416 HIS 1 CD2   1 
ATOM   3222  C  CE1   . HIS A  1  416 ? -48.376  -3.722  377.746 1.00 115.71 ? 416 HIS 1 CE1   1 
ATOM   3223  N  NE2   . HIS A  1  416 ? -48.140  -2.422  377.755 1.00 117.60 ? 416 HIS 1 NE2   1 
ATOM   3224  N  N     . PHE A  1  417 ? -54.387  -2.296  374.815 1.00 106.22 ? 417 PHE 1 N     1 
ATOM   3225  C  CA    . PHE A  1  417 ? -55.846  -2.379  374.835 1.00 107.16 ? 417 PHE 1 CA    1 
ATOM   3226  C  C     . PHE A  1  417 ? -56.479  -2.309  373.450 1.00 98.76  ? 417 PHE 1 C     1 
ATOM   3227  O  O     . PHE A  1  417 ? -57.700  -2.123  373.356 1.00 96.98  ? 417 PHE 1 O     1 
ATOM   3228  C  CB    . PHE A  1  417 ? -56.453  -1.274  375.713 1.00 112.51 ? 417 PHE 1 CB    1 
ATOM   3229  C  CG    . PHE A  1  417 ? -55.773  -1.104  377.040 1.00 114.48 ? 417 PHE 1 CG    1 
ATOM   3230  C  CD1   . PHE A  1  417 ? -54.742  -0.194  377.188 1.00 114.80 ? 417 PHE 1 CD1   1 
ATOM   3231  C  CD2   . PHE A  1  417 ? -56.165  -1.847  378.139 1.00 114.95 ? 417 PHE 1 CD2   1 
ATOM   3232  C  CE1   . PHE A  1  417 ? -54.112  -0.028  378.404 1.00 115.67 ? 417 PHE 1 CE1   1 
ATOM   3233  C  CE2   . PHE A  1  417 ? -55.535  -1.684  379.360 1.00 115.46 ? 417 PHE 1 CE2   1 
ATOM   3234  C  CZ    . PHE A  1  417 ? -54.508  -0.773  379.490 1.00 116.07 ? 417 PHE 1 CZ    1 
ATOM   3235  N  N     . LYS A  1  418 ? -55.691  -2.449  372.380 1.00 93.16  ? 418 LYS 1 N     1 
ATOM   3236  C  CA    . LYS A  1  418 ? -56.246  -2.447  371.030 1.00 92.92  ? 418 LYS 1 CA    1 
ATOM   3237  C  C     . LYS A  1  418 ? -57.458  -3.364  370.926 1.00 96.14  ? 418 LYS 1 C     1 
ATOM   3238  O  O     . LYS A  1  418 ? -58.479  -2.996  370.329 1.00 97.85  ? 418 LYS 1 O     1 
ATOM   3239  C  CB    . LYS A  1  418 ? -55.169  -2.874  370.031 1.00 95.44  ? 418 LYS 1 CB    1 
ATOM   3240  C  CG    . LYS A  1  418 ? -55.643  -2.977  368.592 1.00 100.01 ? 418 LYS 1 CG    1 
ATOM   3241  C  CD    . LYS A  1  418 ? -54.518  -3.436  367.676 1.00 102.24 ? 418 LYS 1 CD    1 
ATOM   3242  C  CE    . LYS A  1  418 ? -54.829  -3.137  366.219 1.00 99.57  ? 418 LYS 1 CE    1 
ATOM   3243  N  NZ    . LYS A  1  418 ? -53.713  -2.414  365.556 1.00 93.70  ? 418 LYS 1 NZ    1 
ATOM   3244  N  N     . ASP A  1  419 ? -57.375  -4.539  371.554 1.00 100.67 ? 419 ASP 1 N     1 
ATOM   3245  C  CA    . ASP A  1  419 ? -58.467  -5.507  371.534 1.00 106.28 ? 419 ASP 1 CA    1 
ATOM   3246  C  C     . ASP A  1  419 ? -59.796  -4.853  371.885 1.00 105.10 ? 419 ASP 1 C     1 
ATOM   3247  O  O     . ASP A  1  419 ? -60.786  -5.000  371.157 1.00 103.85 ? 419 ASP 1 O     1 
ATOM   3248  C  CB    . ASP A  1  419 ? -58.160  -6.649  372.507 1.00 112.97 ? 419 ASP 1 CB    1 
ATOM   3249  C  CG    . ASP A  1  419 ? -56.772  -7.237  372.305 1.00 115.07 ? 419 ASP 1 CG    1 
ATOM   3250  O  OD1   . ASP A  1  419 ? -56.189  -7.036  371.220 1.00 116.41 ? 419 ASP 1 OD1   1 
ATOM   3251  O  OD2   . ASP A  1  419 ? -56.262  -7.897  373.236 1.00 114.86 ? 419 ASP 1 OD2   1 
ATOM   3252  N  N     . GLN A  1  420 ? -59.825  -4.102  372.990 1.00 106.70 ? 420 GLN 1 N     1 
ATOM   3253  C  CA    . GLN A  1  420 ? -61.051  -3.431  373.414 1.00 110.68 ? 420 GLN 1 CA    1 
ATOM   3254  C  C     . GLN A  1  420 ? -61.642  -2.598  372.284 1.00 105.92 ? 420 GLN 1 C     1 
ATOM   3255  O  O     . GLN A  1  420 ? -62.824  -2.741  371.946 1.00 101.86 ? 420 GLN 1 O     1 
ATOM   3256  C  CB    . GLN A  1  420 ? -60.771  -2.555  374.635 1.00 118.51 ? 420 GLN 1 CB    1 
ATOM   3257  C  CG    . GLN A  1  420 ? -61.921  -2.479  375.628 1.00 124.46 ? 420 GLN 1 CG    1 
ATOM   3258  C  CD    . GLN A  1  420 ? -61.475  -2.012  377.000 1.00 126.55 ? 420 GLN 1 CD    1 
ATOM   3259  O  OE1   . GLN A  1  420 ? -60.283  -1.841  377.252 1.00 128.56 ? 420 GLN 1 OE1   1 
ATOM   3260  N  NE2   . GLN A  1  420 ? -62.432  -1.813  377.898 1.00 124.06 ? 420 GLN 1 NE2   1 
ATOM   3261  N  N     . TYR A  1  421 ? -60.815  -1.746  371.667 1.00 104.97 ? 421 TYR 1 N     1 
ATOM   3262  C  CA    . TYR A  1  421 ? -61.253  -0.979  370.505 1.00 103.54 ? 421 TYR 1 CA    1 
ATOM   3263  C  C     . TYR A  1  421 ? -61.974  -1.876  369.511 1.00 104.55 ? 421 TYR 1 C     1 
ATOM   3264  O  O     . TYR A  1  421 ? -63.128  -1.621  369.143 1.00 105.73 ? 421 TYR 1 O     1 
ATOM   3265  C  CB    . TYR A  1  421 ? -60.055  -0.305  369.831 1.00 105.67 ? 421 TYR 1 CB    1 
ATOM   3266  C  CG    . TYR A  1  421 ? -59.327  0.726   370.669 1.00 112.69 ? 421 TYR 1 CG    1 
ATOM   3267  C  CD1   . TYR A  1  421 ? -58.304  0.353   371.527 1.00 116.35 ? 421 TYR 1 CD1   1 
ATOM   3268  C  CD2   . TYR A  1  421 ? -59.638  2.075   370.574 1.00 116.10 ? 421 TYR 1 CD2   1 
ATOM   3269  C  CE1   . TYR A  1  421 ? -57.626  1.290   372.285 1.00 118.99 ? 421 TYR 1 CE1   1 
ATOM   3270  C  CE2   . TYR A  1  421 ? -58.963  3.020   371.329 1.00 116.63 ? 421 TYR 1 CE2   1 
ATOM   3271  C  CZ    . TYR A  1  421 ? -57.959  2.622   372.182 1.00 116.77 ? 421 TYR 1 CZ    1 
ATOM   3272  O  OH    . TYR A  1  421 ? -57.288  3.559   372.933 1.00 112.44 ? 421 TYR 1 OH    1 
ATOM   3273  N  N     . LEU A  1  422 ? -61.304  -2.955  369.099 1.00 105.63 ? 422 LEU 1 N     1 
ATOM   3274  C  CA    . LEU A  1  422 ? -61.883  -3.913  368.166 1.00 105.19 ? 422 LEU 1 CA    1 
ATOM   3275  C  C     . LEU A  1  422 ? -63.285  -4.322  368.594 1.00 105.66 ? 422 LEU 1 C     1 
ATOM   3276  O  O     . LEU A  1  422 ? -64.244  -4.214  367.820 1.00 102.99 ? 422 LEU 1 O     1 
ATOM   3277  C  CB    . LEU A  1  422 ? -60.977  -5.144  368.070 1.00 103.70 ? 422 LEU 1 CB    1 
ATOM   3278  C  CG    . LEU A  1  422 ? -59.522  -4.940  367.638 1.00 104.66 ? 422 LEU 1 CG    1 
ATOM   3279  C  CD1   . LEU A  1  422 ? -58.704  -6.190  367.923 1.00 103.74 ? 422 LEU 1 CD1   1 
ATOM   3280  C  CD2   . LEU A  1  422 ? -59.446  -4.574  366.168 1.00 108.22 ? 422 LEU 1 CD2   1 
ATOM   3281  N  N     . ALA A  1  423 ? -63.423  -4.763  369.846 1.00 109.60 ? 423 ALA 1 N     1 
ATOM   3282  C  CA    . ALA A  1  423 ? -64.729  -5.164  370.352 1.00 113.02 ? 423 ALA 1 CA    1 
ATOM   3283  C  C     . ALA A  1  423 ? -65.743  -4.045  370.173 1.00 118.89 ? 423 ALA 1 C     1 
ATOM   3284  O  O     . ALA A  1  423 ? -66.816  -4.246  369.589 1.00 117.05 ? 423 ALA 1 O     1 
ATOM   3285  C  CB    . ALA A  1  423 ? -64.617  -5.573  371.820 1.00 112.94 ? 423 ALA 1 CB    1 
ATOM   3286  N  N     . LEU A  1  424 ? -65.391  -2.840  370.632 1.00 126.38 ? 424 LEU 1 N     1 
ATOM   3287  C  CA    . LEU A  1  424 ? -66.307  -1.707  370.556 1.00 130.60 ? 424 LEU 1 CA    1 
ATOM   3288  C  C     . LEU A  1  424 ? -66.786  -1.461  369.132 1.00 134.03 ? 424 LEU 1 C     1 
ATOM   3289  O  O     . LEU A  1  424 ? -67.877  -0.915  368.929 1.00 131.95 ? 424 LEU 1 O     1 
ATOM   3290  C  CB    . LEU A  1  424 ? -65.640  -0.454  371.119 1.00 128.51 ? 424 LEU 1 CB    1 
ATOM   3291  C  CG    . LEU A  1  424 ? -65.918  -0.149  372.592 1.00 126.70 ? 424 LEU 1 CG    1 
ATOM   3292  C  CD1   . LEU A  1  424 ? -65.590  -1.336  373.487 1.00 125.17 ? 424 LEU 1 CD1   1 
ATOM   3293  C  CD2   . LEU A  1  424 ? -65.152  1.077   373.025 1.00 127.12 ? 424 LEU 1 CD2   1 
ATOM   3294  N  N     . ALA A  1  425 ? -65.991  -1.854  368.138 1.00 138.07 ? 425 ALA 1 N     1 
ATOM   3295  C  CA    . ALA A  1  425 ? -66.453  -1.786  366.759 1.00 139.21 ? 425 ALA 1 CA    1 
ATOM   3296  C  C     . ALA A  1  425 ? -67.409  -2.932  366.445 1.00 137.68 ? 425 ALA 1 C     1 
ATOM   3297  O  O     . ALA A  1  425 ? -68.559  -2.704  366.054 1.00 137.56 ? 425 ALA 1 O     1 
ATOM   3298  C  CB    . ALA A  1  425 ? -65.257  -1.797  365.804 1.00 140.43 ? 425 ALA 1 CB    1 
ATOM   3299  N  N     . ARG A  1  426 ? -66.957  -4.175  366.636 1.00 137.01 ? 426 ARG 1 N     1 
ATOM   3300  C  CA    . ARG A  1  426 ? -67.715  -5.325  366.147 1.00 138.74 ? 426 ARG 1 CA    1 
ATOM   3301  C  C     . ARG A  1  426 ? -69.020  -5.547  366.900 1.00 140.59 ? 426 ARG 1 C     1 
ATOM   3302  O  O     . ARG A  1  426 ? -69.929  -6.183  366.356 1.00 141.08 ? 426 ARG 1 O     1 
ATOM   3303  C  CB    . ARG A  1  426 ? -66.861  -6.591  366.196 1.00 139.05 ? 426 ARG 1 CB    1 
ATOM   3304  C  CG    . ARG A  1  426 ? -65.809  -6.642  365.102 1.00 138.92 ? 426 ARG 1 CG    1 
ATOM   3305  C  CD    . ARG A  1  426 ? -64.783  -7.728  365.348 1.00 139.46 ? 426 ARG 1 CD    1 
ATOM   3306  N  NE    . ARG A  1  426 ? -63.821  -7.805  364.256 1.00 143.12 ? 426 ARG 1 NE    1 
ATOM   3307  C  CZ    . ARG A  1  426 ? -62.743  -8.580  364.264 1.00 148.52 ? 426 ARG 1 CZ    1 
ATOM   3308  N  NH1   . ARG A  1  426 ? -62.492  -9.356  365.310 1.00 150.41 ? 426 ARG 1 NH1   1 
ATOM   3309  N  NH2   . ARG A  1  426 ? -61.921  -8.586  363.224 1.00 150.03 ? 426 ARG 1 NH2   1 
ATOM   3310  N  N     . GLU A  1  427 ? -69.138  -5.051  368.127 1.00 139.55 ? 427 GLU 1 N     1 
ATOM   3311  C  CA    . GLU A  1  427 ? -70.385  -5.185  368.867 1.00 135.05 ? 427 GLU 1 CA    1 
ATOM   3312  C  C     . GLU A  1  427 ? -71.294  -3.973  368.720 1.00 130.91 ? 427 GLU 1 C     1 
ATOM   3313  O  O     . GLU A  1  427 ? -72.437  -4.022  369.187 1.00 138.08 ? 427 GLU 1 O     1 
ATOM   3314  C  CB    . GLU A  1  427 ? -70.101  -5.422  370.354 1.00 133.76 ? 427 GLU 1 CB    1 
ATOM   3315  C  CG    . GLU A  1  427 ? -69.097  -6.524  370.634 1.00 131.99 ? 427 GLU 1 CG    1 
ATOM   3316  C  CD    . GLU A  1  427 ? -68.535  -6.449  372.037 1.00 129.96 ? 427 GLU 1 CD    1 
ATOM   3317  O  OE1   . GLU A  1  427 ? -68.013  -5.379  372.412 1.00 129.60 ? 427 GLU 1 OE1   1 
ATOM   3318  O  OE2   . GLU A  1  427 ? -68.623  -7.455  372.768 1.00 128.23 ? 427 GLU 1 OE2   1 
ATOM   3319  N  N     . LYS A  1  428 ? -70.820  -2.903  368.079 1.00 116.30 ? 428 LYS 1 N     1 
ATOM   3320  C  CA    . LYS A  1  428 ? -71.592  -1.672  367.907 1.00 102.76 ? 428 LYS 1 CA    1 
ATOM   3321  C  C     . LYS A  1  428 ? -72.116  -1.179  369.251 1.00 92.83  ? 428 LYS 1 C     1 
ATOM   3322  O  O     . LYS A  1  428 ? -73.273  -0.778  369.390 1.00 87.07  ? 428 LYS 1 O     1 
ATOM   3323  C  CB    . LYS A  1  428 ? -72.731  -1.866  366.906 1.00 101.93 ? 428 LYS 1 CB    1 
ATOM   3324  C  CG    . LYS A  1  428 ? -72.325  -2.637  365.666 1.00 100.64 ? 428 LYS 1 CG    1 
ATOM   3325  C  CD    . LYS A  1  428 ? -71.483  -1.778  364.741 1.00 100.03 ? 428 LYS 1 CD    1 
ATOM   3326  C  CE    . LYS A  1  428 ? -70.766  -2.632  363.713 1.00 101.97 ? 428 LYS 1 CE    1 
ATOM   3327  N  NZ    . LYS A  1  428 ? -69.836  -3.587  364.368 1.00 105.00 ? 428 LYS 1 NZ    1 
ATOM   3328  N  N     . ARG A  1  429 ? -71.246  -1.214  370.249 1.00 93.81  ? 429 ARG 1 N     1 
ATOM   3329  C  CA    . ARG A  1  429 ? -71.567  -0.836  371.607 1.00 101.09 ? 429 ARG 1 CA    1 
ATOM   3330  C  C     . ARG A  1  429 ? -70.891  0.479   371.947 1.00 106.46 ? 429 ARG 1 C     1 
ATOM   3331  O  O     . ARG A  1  429 ? -69.679  0.614   371.734 1.00 113.67 ? 429 ARG 1 O     1 
ATOM   3332  C  CB    . ARG A  1  429 ? -71.107  -1.923  372.582 1.00 108.61 ? 429 ARG 1 CB    1 
ATOM   3333  C  CG    . ARG A  1  429 ? -72.124  -3.026  372.818 1.00 121.83 ? 429 ARG 1 CG    1 
ATOM   3334  C  CD    . ARG A  1  429 ? -71.577  -4.064  373.783 1.00 134.05 ? 429 ARG 1 CD    1 
ATOM   3335  N  NE    . ARG A  1  429 ? -70.860  -3.447  374.892 1.00 142.62 ? 429 ARG 1 NE    1 
ATOM   3336  C  CZ    . ARG A  1  429 ? -69.613  -3.753  375.236 1.00 148.07 ? 429 ARG 1 CZ    1 
ATOM   3337  N  NH1   . ARG A  1  429 ? -68.941  -4.671  374.557 1.00 151.24 ? 429 ARG 1 NH1   1 
ATOM   3338  N  NH2   . ARG A  1  429 ? -69.037  -3.139  376.261 1.00 148.31 ? 429 ARG 1 NH2   1 
ATOM   3339  N  N     . PRO A  1  430 ? -71.620  1.467   372.458 1.00 99.35  ? 430 PRO 1 N     1 
ATOM   3340  C  CA    . PRO A  1  430 ? -70.950  2.648   373.003 1.00 88.62  ? 430 PRO 1 CA    1 
ATOM   3341  C  C     . PRO A  1  430 ? -70.117  2.249   374.211 1.00 81.41  ? 430 PRO 1 C     1 
ATOM   3342  O  O     . PRO A  1  430 ? -70.270  1.162   374.771 1.00 87.71  ? 430 PRO 1 O     1 
ATOM   3343  C  CB    . PRO A  1  430 ? -72.110  3.569   373.395 1.00 87.82  ? 430 PRO 1 CB    1 
ATOM   3344  C  CG    . PRO A  1  430 ? -73.246  2.633   373.645 1.00 94.43  ? 430 PRO 1 CG    1 
ATOM   3345  C  CD    . PRO A  1  430 ? -73.080  1.533   372.633 1.00 99.31  ? 430 PRO 1 CD    1 
ATOM   3346  N  N     . VAL A  1  431 ? -69.217  3.140   374.607 1.00 72.39  ? 431 VAL 1 N     1 
ATOM   3347  C  CA    . VAL A  1  431 ? -68.377  2.886   375.773 1.00 71.12  ? 431 VAL 1 CA    1 
ATOM   3348  C  C     . VAL A  1  431 ? -69.300  2.734   376.975 1.00 72.35  ? 431 VAL 1 C     1 
ATOM   3349  O  O     . VAL A  1  431 ? -70.352  3.386   377.030 1.00 74.77  ? 431 VAL 1 O     1 
ATOM   3350  C  CB    . VAL A  1  431 ? -67.343  4.003   375.980 1.00 74.23  ? 431 VAL 1 CB    1 
ATOM   3351  C  CG1   . VAL A  1  431 ? -66.293  3.945   374.896 1.00 73.72  ? 431 VAL 1 CG1   1 
ATOM   3352  C  CG2   . VAL A  1  431 ? -68.022  5.366   375.983 1.00 77.06  ? 431 VAL 1 CG2   1 
ATOM   3353  N  N     . PRO A  1  432 ? -68.977  1.867   377.933 1.00 71.45  ? 432 PRO 1 N     1 
ATOM   3354  C  CA    . PRO A  1  432 ? -69.830  1.743   379.117 1.00 79.16  ? 432 PRO 1 CA    1 
ATOM   3355  C  C     . PRO A  1  432 ? -69.925  3.068   379.855 1.00 89.99  ? 432 PRO 1 C     1 
ATOM   3356  O  O     . PRO A  1  432 ? -68.941  3.797   379.992 1.00 90.92  ? 432 PRO 1 O     1 
ATOM   3357  C  CB    . PRO A  1  432 ? -69.122  0.674   379.960 1.00 77.52  ? 432 PRO 1 CB    1 
ATOM   3358  C  CG    . PRO A  1  432 ? -67.746  0.552   379.377 1.00 76.09  ? 432 PRO 1 CG    1 
ATOM   3359  C  CD    . PRO A  1  432 ? -67.878  0.891   377.934 1.00 73.67  ? 432 PRO 1 CD    1 
ATOM   3360  N  N     . ARG A  1  433 ? -71.130  3.378   380.332 1.00 99.44  ? 433 ARG 1 N     1 
ATOM   3361  C  CA    . ARG A  1  433 ? -71.407  4.617   381.053 1.00 104.06 ? 433 ARG 1 CA    1 
ATOM   3362  C  C     . ARG A  1  433 ? -71.985  4.272   382.421 1.00 103.99 ? 433 ARG 1 C     1 
ATOM   3363  O  O     . ARG A  1  433 ? -73.185  4.450   382.667 1.00 103.64 ? 433 ARG 1 O     1 
ATOM   3364  C  CB    . ARG A  1  433 ? -72.355  5.516   380.263 1.00 106.42 ? 433 ARG 1 CB    1 
ATOM   3365  C  CG    . ARG A  1  433 ? -71.621  6.413   379.301 1.00 108.40 ? 433 ARG 1 CG    1 
ATOM   3366  C  CD    . ARG A  1  433 ? -70.644  7.262   380.080 1.00 112.68 ? 433 ARG 1 CD    1 
ATOM   3367  N  NE    . ARG A  1  433 ? -70.088  8.352   379.296 1.00 118.02 ? 433 ARG 1 NE    1 
ATOM   3368  C  CZ    . ARG A  1  433 ? -69.063  9.094   379.694 1.00 122.09 ? 433 ARG 1 CZ    1 
ATOM   3369  N  NH1   . ARG A  1  433 ? -68.487  8.852   380.864 1.00 122.28 ? 433 ARG 1 NH1   1 
ATOM   3370  N  NH2   . ARG A  1  433 ? -68.611  10.070  378.921 1.00 124.35 ? 433 ARG 1 NH2   1 
ATOM   3371  N  N     . PRO A  1  434 ? -71.156  3.784   383.336 1.00 102.29 ? 434 PRO 1 N     1 
ATOM   3372  C  CA    . PRO A  1  434 ? -71.662  3.313   384.627 1.00 103.76 ? 434 PRO 1 CA    1 
ATOM   3373  C  C     . PRO A  1  434 ? -71.852  4.459   385.613 1.00 102.67 ? 434 PRO 1 C     1 
ATOM   3374  O  O     . PRO A  1  434 ? -71.419  5.592   385.395 1.00 97.73  ? 434 PRO 1 O     1 
ATOM   3375  C  CB    . PRO A  1  434 ? -70.565  2.356   385.096 1.00 102.75 ? 434 PRO 1 CB    1 
ATOM   3376  C  CG    . PRO A  1  434 ? -69.328  2.922   384.504 1.00 100.20 ? 434 PRO 1 CG    1 
ATOM   3377  C  CD    . PRO A  1  434 ? -69.709  3.544   383.193 1.00 99.61  ? 434 PRO 1 CD    1 
ATOM   3378  N  N     . SER A  1  435 ? -72.520  4.135   386.718 1.00 106.22 ? 435 SER 1 N     1 
ATOM   3379  C  CA    . SER A  1  435 ? -72.754  5.097   387.787 1.00 108.20 ? 435 SER 1 CA    1 
ATOM   3380  C  C     . SER A  1  435 ? -71.483  5.264   388.610 1.00 112.45 ? 435 SER 1 C     1 
ATOM   3381  O  O     . SER A  1  435 ? -70.988  4.299   389.202 1.00 109.97 ? 435 SER 1 O     1 
ATOM   3382  C  CB    . SER A  1  435 ? -73.908  4.634   388.674 1.00 104.86 ? 435 SER 1 CB    1 
ATOM   3383  O  OG    . SER A  1  435 ? -74.249  5.617   389.635 1.00 102.83 ? 435 SER 1 OG    1 
ATOM   3384  N  N     . LEU A  1  436 ? -70.962  6.489   388.653 1.00 117.28 ? 436 LEU 1 N     1 
ATOM   3385  C  CA    . LEU A  1  436 ? -69.717  6.789   389.343 1.00 118.47 ? 436 LEU 1 CA    1 
ATOM   3386  C  C     . LEU A  1  436 ? -69.855  7.848   390.424 1.00 114.94 ? 436 LEU 1 C     1 
ATOM   3387  O  O     . LEU A  1  436 ? -69.034  7.872   391.347 1.00 112.52 ? 436 LEU 1 O     1 
ATOM   3388  C  CB    . LEU A  1  436 ? -68.644  7.245   388.342 1.00 121.93 ? 436 LEU 1 CB    1 
ATOM   3389  C  CG    . LEU A  1  436 ? -67.710  6.193   387.727 1.00 122.65 ? 436 LEU 1 CG    1 
ATOM   3390  C  CD1   . LEU A  1  436 ? -68.467  5.001   387.200 1.00 122.96 ? 436 LEU 1 CD1   1 
ATOM   3391  C  CD2   . LEU A  1  436 ? -66.894  6.804   386.604 1.00 121.41 ? 436 LEU 1 CD2   1 
ATOM   3392  N  N     . TRP A  1  437 ? -70.861  8.711   390.343 1.00 116.53 ? 437 TRP 1 N     1 
ATOM   3393  C  CA    . TRP A  1  437 ? -70.991  9.870   391.211 1.00 123.29 ? 437 TRP 1 CA    1 
ATOM   3394  C  C     . TRP A  1  437 ? -72.142  9.681   392.191 1.00 124.42 ? 437 TRP 1 C     1 
ATOM   3395  O  O     . TRP A  1  437 ? -73.109  8.965   391.913 1.00 125.36 ? 437 TRP 1 O     1 
ATOM   3396  C  CB    . TRP A  1  437 ? -71.206  11.143  390.386 1.00 129.37 ? 437 TRP 1 CB    1 
ATOM   3397  C  CG    . TRP A  1  437 ? -72.629  11.456  390.088 1.00 132.35 ? 437 TRP 1 CG    1 
ATOM   3398  C  CD1   . TRP A  1  437 ? -73.551  10.633  389.510 1.00 133.88 ? 437 TRP 1 CD1   1 
ATOM   3399  C  CD2   . TRP A  1  437 ? -73.303  12.685  390.362 1.00 132.34 ? 437 TRP 1 CD2   1 
ATOM   3400  N  NE1   . TRP A  1  437 ? -74.759  11.277  389.409 1.00 134.83 ? 437 TRP 1 NE1   1 
ATOM   3401  C  CE2   . TRP A  1  437 ? -74.632  12.539  389.925 1.00 135.45 ? 437 TRP 1 CE2   1 
ATOM   3402  C  CE3   . TRP A  1  437 ? -72.911  13.898  390.936 1.00 131.39 ? 437 TRP 1 CE3   1 
ATOM   3403  C  CZ2   . TRP A  1  437 ? -75.571  13.560  390.042 1.00 137.93 ? 437 TRP 1 CZ2   1 
ATOM   3404  C  CZ3   . TRP A  1  437 ? -73.845  14.908  391.053 1.00 134.87 ? 437 TRP 1 CZ3   1 
ATOM   3405  C  CH2   . TRP A  1  437 ? -75.159  14.735  390.607 1.00 137.55 ? 437 TRP 1 CH2   1 
ATOM   3406  N  N     . ARG A  1  438 ? -72.019  10.321  393.350 1.00 122.52 ? 438 ARG 1 N     1 
ATOM   3407  C  CA    . ARG A  1  438 ? -73.110  10.375  394.315 1.00 119.05 ? 438 ARG 1 CA    1 
ATOM   3408  C  C     . ARG A  1  438 ? -73.536  11.813  394.576 1.00 112.78 ? 438 ARG 1 C     1 
ATOM   3409  O  O     . ARG A  1  438 ? -73.293  12.711  393.774 1.00 111.31 ? 438 ARG 1 O     1 
ATOM   3410  C  CB    . ARG A  1  438 ? -72.702  9.707   395.631 1.00 124.53 ? 438 ARG 1 CB    1 
ATOM   3411  C  CG    . ARG A  1  438 ? -71.995  8.367   395.461 1.00 130.71 ? 438 ARG 1 CG    1 
ATOM   3412  C  CD    . ARG A  1  438 ? -70.478  8.510   395.451 1.00 132.25 ? 438 ARG 1 CD    1 
ATOM   3413  N  NE    . ARG A  1  438 ? -69.808  7.217   395.545 1.00 130.58 ? 438 ARG 1 NE    1 
ATOM   3414  C  CZ    . ARG A  1  438 ? -68.490  7.051   395.502 1.00 124.88 ? 438 ARG 1 CZ    1 
ATOM   3415  N  NH1   . ARG A  1  438 ? -67.689  8.099   395.368 1.00 122.99 ? 438 ARG 1 NH1   1 
ATOM   3416  N  NH2   . ARG A  1  438 ? -67.973  5.835   395.593 1.00 125.10 ? 438 ARG 1 NH2   1 
ATOM   3417  O  OXT   . ARG A  1  438 ? -74.124  12.113  395.610 1.00 111.71 ? 438 ARG 1 OXT   1 
ATOM   3418  N  N     . PHE B  2  3   ? -63.957  53.927  382.299 1.00 106.13 ? 3   PHE 2 N     1 
ATOM   3419  C  CA    . PHE B  2  3   ? -63.893  52.725  383.120 1.00 110.70 ? 3   PHE 2 CA    1 
ATOM   3420  C  C     . PHE B  2  3   ? -62.687  52.752  384.048 1.00 117.99 ? 3   PHE 2 C     1 
ATOM   3421  O  O     . PHE B  2  3   ? -62.829  52.674  385.267 1.00 124.22 ? 3   PHE 2 O     1 
ATOM   3422  C  CB    . PHE B  2  3   ? -63.845  51.473  382.235 1.00 110.14 ? 3   PHE 2 CB    1 
ATOM   3423  C  CG    . PHE B  2  3   ? -63.628  50.191  382.999 1.00 110.47 ? 3   PHE 2 CG    1 
ATOM   3424  C  CD1   . PHE B  2  3   ? -64.698  49.475  383.504 1.00 112.82 ? 3   PHE 2 CD1   1 
ATOM   3425  C  CD2   . PHE B  2  3   ? -62.351  49.698  383.202 1.00 107.63 ? 3   PHE 2 CD2   1 
ATOM   3426  C  CE1   . PHE B  2  3   ? -64.494  48.296  384.205 1.00 113.26 ? 3   PHE 2 CE1   1 
ATOM   3427  C  CE2   . PHE B  2  3   ? -62.142  48.526  383.901 1.00 108.04 ? 3   PHE 2 CE2   1 
ATOM   3428  C  CZ    . PHE B  2  3   ? -63.214  47.824  384.401 1.00 111.36 ? 3   PHE 2 CZ    1 
ATOM   3429  N  N     . PHE B  2  4   ? -61.495  52.863  383.464 1.00 118.57 ? 4   PHE 2 N     1 
ATOM   3430  C  CA    . PHE B  2  4   ? -60.270  52.918  384.249 1.00 120.64 ? 4   PHE 2 CA    1 
ATOM   3431  C  C     . PHE B  2  4   ? -59.999  54.308  384.802 1.00 116.86 ? 4   PHE 2 C     1 
ATOM   3432  O  O     . PHE B  2  4   ? -59.008  54.494  385.517 1.00 111.74 ? 4   PHE 2 O     1 
ATOM   3433  C  CB    . PHE B  2  4   ? -59.081  52.425  383.417 1.00 126.21 ? 4   PHE 2 CB    1 
ATOM   3434  C  CG    . PHE B  2  4   ? -58.971  50.923  383.364 1.00 125.57 ? 4   PHE 2 CG    1 
ATOM   3435  C  CD1   . PHE B  2  4   ? -58.563  50.208  384.475 1.00 123.52 ? 4   PHE 2 CD1   1 
ATOM   3436  C  CD2   . PHE B  2  4   ? -59.265  50.228  382.203 1.00 121.69 ? 4   PHE 2 CD2   1 
ATOM   3437  C  CE1   . PHE B  2  4   ? -58.469  48.829  384.439 1.00 118.59 ? 4   PHE 2 CE1   1 
ATOM   3438  C  CE2   . PHE B  2  4   ? -59.168  48.846  382.164 1.00 117.94 ? 4   PHE 2 CE2   1 
ATOM   3439  C  CZ    . PHE B  2  4   ? -58.768  48.150  383.283 1.00 116.11 ? 4   PHE 2 CZ    1 
ATOM   3440  N  N     . ASP B  2  5   ? -60.843  55.287  384.463 1.00 122.17 ? 5   ASP 2 N     1 
ATOM   3441  C  CA    . ASP B  2  5   ? -60.797  56.587  385.122 1.00 128.69 ? 5   ASP 2 CA    1 
ATOM   3442  C  C     . ASP B  2  5   ? -60.822  56.432  386.638 1.00 132.21 ? 5   ASP 2 C     1 
ATOM   3443  O  O     . ASP B  2  5   ? -60.154  57.180  387.359 1.00 139.19 ? 5   ASP 2 O     1 
ATOM   3444  C  CB    . ASP B  2  5   ? -61.977  57.449  384.663 1.00 129.87 ? 5   ASP 2 CB    1 
ATOM   3445  C  CG    . ASP B  2  5   ? -62.015  57.643  383.160 1.00 131.12 ? 5   ASP 2 CG    1 
ATOM   3446  O  OD1   . ASP B  2  5   ? -60.986  57.401  382.497 1.00 131.68 ? 5   ASP 2 OD1   1 
ATOM   3447  O  OD2   . ASP B  2  5   ? -63.079  58.040  382.639 1.00 131.42 ? 5   ASP 2 OD2   1 
ATOM   3448  N  N     . ASP B  2  6   ? -61.603  55.468  387.136 1.00 122.64 ? 6   ASP 2 N     1 
ATOM   3449  C  CA    . ASP B  2  6   ? -61.694  55.212  388.571 1.00 109.86 ? 6   ASP 2 CA    1 
ATOM   3450  C  C     . ASP B  2  6   ? -60.325  54.965  389.194 1.00 102.01 ? 6   ASP 2 C     1 
ATOM   3451  O  O     . ASP B  2  6   ? -59.880  55.717  390.068 1.00 103.25 ? 6   ASP 2 O     1 
ATOM   3452  C  CB    . ASP B  2  6   ? -62.611  54.017  388.836 1.00 106.75 ? 6   ASP 2 CB    1 
ATOM   3453  C  CG    . ASP B  2  6   ? -63.241  54.063  390.214 1.00 109.04 ? 6   ASP 2 CG    1 
ATOM   3454  O  OD1   . ASP B  2  6   ? -62.619  54.640  391.130 1.00 110.38 ? 6   ASP 2 OD1   1 
ATOM   3455  O  OD2   . ASP B  2  6   ? -64.346  53.513  390.390 1.00 109.92 ? 6   ASP 2 OD2   1 
ATOM   3456  N  N     . LYS B  2  7   ? -59.636  53.921  388.751 1.00 97.30  ? 7   LYS 2 N     1 
ATOM   3457  C  CA    . LYS B  2  7   ? -58.464  53.419  389.462 1.00 98.05  ? 7   LYS 2 CA    1 
ATOM   3458  C  C     . LYS B  2  7   ? -57.197  53.802  388.696 1.00 104.57 ? 7   LYS 2 C     1 
ATOM   3459  O  O     . LYS B  2  7   ? -56.669  53.025  387.900 1.00 100.73 ? 7   LYS 2 O     1 
ATOM   3460  C  CB    . LYS B  2  7   ? -58.569  51.904  389.666 1.00 97.16  ? 7   LYS 2 CB    1 
ATOM   3461  C  CG    . LYS B  2  7   ? -58.858  51.084  388.413 1.00 96.13  ? 7   LYS 2 CG    1 
ATOM   3462  C  CD    . LYS B  2  7   ? -59.819  49.939  388.686 1.00 95.31  ? 7   LYS 2 CD    1 
ATOM   3463  C  CE    . LYS B  2  7   ? -61.106  50.418  389.321 1.00 94.25  ? 7   LYS 2 CE    1 
ATOM   3464  N  NZ    . LYS B  2  7   ? -62.178  49.397  389.191 1.00 91.17  ? 7   LYS 2 NZ    1 
ATOM   3465  N  N     . GLN B  2  8   ? -56.690  55.006  388.964 1.00 116.93 ? 8   GLN 2 N     1 
ATOM   3466  C  CA    . GLN B  2  8   ? -55.419  55.419  388.385 1.00 126.97 ? 8   GLN 2 CA    1 
ATOM   3467  C  C     . GLN B  2  8   ? -54.240  54.944  389.223 1.00 134.59 ? 8   GLN 2 C     1 
ATOM   3468  O  O     . GLN B  2  8   ? -53.176  54.636  388.672 1.00 135.54 ? 8   GLN 2 O     1 
ATOM   3469  C  CB    . GLN B  2  8   ? -55.367  56.943  388.231 1.00 128.20 ? 8   GLN 2 CB    1 
ATOM   3470  C  CG    . GLN B  2  8   ? -56.320  57.498  387.183 1.00 129.42 ? 8   GLN 2 CG    1 
ATOM   3471  C  CD    . GLN B  2  8   ? -55.646  57.725  385.844 1.00 131.61 ? 8   GLN 2 CD    1 
ATOM   3472  O  OE1   . GLN B  2  8   ? -54.439  57.526  385.702 1.00 131.34 ? 8   GLN 2 OE1   1 
ATOM   3473  N  NE2   . GLN B  2  8   ? -56.423  58.148  384.854 1.00 133.28 ? 8   GLN 2 NE2   1 
ATOM   3474  N  N     . ASP B  2  9   ? -54.412  54.870  390.547 1.00 138.65 ? 9   ASP 2 N     1 
ATOM   3475  C  CA    . ASP B  2  9   ? -53.382  54.277  391.390 1.00 136.89 ? 9   ASP 2 CA    1 
ATOM   3476  C  C     . ASP B  2  9   ? -53.264  52.784  391.110 1.00 127.17 ? 9   ASP 2 C     1 
ATOM   3477  O  O     . ASP B  2  9   ? -52.171  52.212  391.210 1.00 127.47 ? 9   ASP 2 O     1 
ATOM   3478  C  CB    . ASP B  2  9   ? -53.671  54.554  392.869 1.00 138.72 ? 9   ASP 2 CB    1 
ATOM   3479  C  CG    . ASP B  2  9   ? -55.143  54.443  393.213 1.00 137.82 ? 9   ASP 2 CG    1 
ATOM   3480  O  OD1   . ASP B  2  9   ? -55.989  54.661  392.322 1.00 138.45 ? 9   ASP 2 OD1   1 
ATOM   3481  O  OD2   . ASP B  2  9   ? -55.455  54.149  394.387 1.00 136.41 ? 9   ASP 2 OD2   1 
ATOM   3482  N  N     . PHE B  2  10  ? -54.381  52.139  390.766 1.00 114.79 ? 10  PHE 2 N     1 
ATOM   3483  C  CA    . PHE B  2  10  ? -54.321  50.759  390.302 1.00 105.37 ? 10  PHE 2 CA    1 
ATOM   3484  C  C     . PHE B  2  10  ? -53.535  50.670  389.002 1.00 103.41 ? 10  PHE 2 C     1 
ATOM   3485  O  O     . PHE B  2  10  ? -52.797  49.705  388.784 1.00 101.33 ? 10  PHE 2 O     1 
ATOM   3486  C  CB    . PHE B  2  10  ? -55.735  50.200  390.134 1.00 102.41 ? 10  PHE 2 CB    1 
ATOM   3487  C  CG    . PHE B  2  10  ? -55.785  48.799  389.587 1.00 97.21  ? 10  PHE 2 CG    1 
ATOM   3488  C  CD1   . PHE B  2  10  ? -55.455  47.716  390.379 1.00 89.64  ? 10  PHE 2 CD1   1 
ATOM   3489  C  CD2   . PHE B  2  10  ? -56.185  48.566  388.284 1.00 97.90  ? 10  PHE 2 CD2   1 
ATOM   3490  C  CE1   . PHE B  2  10  ? -55.507  46.428  389.875 1.00 88.56  ? 10  PHE 2 CE1   1 
ATOM   3491  C  CE2   . PHE B  2  10  ? -56.236  47.280  387.780 1.00 88.29  ? 10  PHE 2 CE2   1 
ATOM   3492  C  CZ    . PHE B  2  10  ? -55.896  46.214  388.577 1.00 88.36  ? 10  PHE 2 CZ    1 
ATOM   3493  N  N     . LEU B  2  11  ? -53.668  51.676  388.130 1.00 109.06 ? 11  LEU 2 N     1 
ATOM   3494  C  CA    . LEU B  2  11  ? -52.826  51.730  386.937 1.00 119.11 ? 11  LEU 2 CA    1 
ATOM   3495  C  C     . LEU B  2  11  ? -51.355  51.832  387.313 1.00 126.79 ? 11  LEU 2 C     1 
ATOM   3496  O  O     . LEU B  2  11  ? -50.504  51.170  386.707 1.00 128.48 ? 11  LEU 2 O     1 
ATOM   3497  C  CB    . LEU B  2  11  ? -53.218  52.910  386.046 1.00 117.93 ? 11  LEU 2 CB    1 
ATOM   3498  C  CG    . LEU B  2  11  ? -54.623  52.985  385.455 1.00 115.82 ? 11  LEU 2 CG    1 
ATOM   3499  C  CD1   . LEU B  2  11  ? -54.825  54.321  384.758 1.00 114.50 ? 11  LEU 2 CD1   1 
ATOM   3500  C  CD2   . LEU B  2  11  ? -54.839  51.836  384.485 1.00 113.81 ? 11  LEU 2 CD2   1 
ATOM   3501  N  N     . GLU B  2  12  ? -51.035  52.683  388.291 1.00 130.21 ? 12  GLU 2 N     1 
ATOM   3502  C  CA    . GLU B  2  12  ? -49.660  52.783  388.772 1.00 131.93 ? 12  GLU 2 CA    1 
ATOM   3503  C  C     . GLU B  2  12  ? -49.143  51.424  389.219 1.00 126.65 ? 12  GLU 2 C     1 
ATOM   3504  O  O     . GLU B  2  12  ? -48.086  50.964  388.770 1.00 121.81 ? 12  GLU 2 O     1 
ATOM   3505  C  CB    . GLU B  2  12  ? -49.582  53.777  389.933 1.00 139.22 ? 12  GLU 2 CB    1 
ATOM   3506  C  CG    . GLU B  2  12  ? -49.682  55.243  389.561 1.00 143.23 ? 12  GLU 2 CG    1 
ATOM   3507  C  CD    . GLU B  2  12  ? -48.971  56.131  390.567 1.00 145.06 ? 12  GLU 2 CD    1 
ATOM   3508  O  OE1   . GLU B  2  12  ? -47.998  55.659  391.194 1.00 144.50 ? 12  GLU 2 OE1   1 
ATOM   3509  O  OE2   . GLU B  2  12  ? -49.388  57.295  390.738 1.00 145.92 ? 12  GLU 2 OE2   1 
ATOM   3510  N  N     . GLU B  2  13  ? -49.899  50.761  390.096 1.00 128.24 ? 13  GLU 2 N     1 
ATOM   3511  C  CA    . GLU B  2  13  ? -49.463  49.486  390.655 1.00 128.72 ? 13  GLU 2 CA    1 
ATOM   3512  C  C     . GLU B  2  13  ? -49.321  48.422  389.572 1.00 121.75 ? 13  GLU 2 C     1 
ATOM   3513  O  O     . GLU B  2  13  ? -48.378  47.623  389.602 1.00 122.88 ? 13  GLU 2 O     1 
ATOM   3514  C  CB    . GLU B  2  13  ? -50.442  49.032  391.740 1.00 135.53 ? 13  GLU 2 CB    1 
ATOM   3515  C  CG    . GLU B  2  13  ? -50.187  47.631  392.278 1.00 140.69 ? 13  GLU 2 CG    1 
ATOM   3516  C  CD    . GLU B  2  13  ? -50.981  47.337  393.539 1.00 144.96 ? 13  GLU 2 CD    1 
ATOM   3517  O  OE1   . GLU B  2  13  ? -51.958  48.067  393.812 1.00 146.95 ? 13  GLU 2 OE1   1 
ATOM   3518  O  OE2   . GLU B  2  13  ? -50.629  46.379  394.257 1.00 145.79 ? 13  GLU 2 OE2   1 
ATOM   3519  N  N     . THR B  2  14  ? -50.239  48.404  388.599 1.00 111.06 ? 14  THR 2 N     1 
ATOM   3520  C  CA    . THR B  2  14  ? -50.205  47.373  387.566 1.00 104.67 ? 14  THR 2 CA    1 
ATOM   3521  C  C     . THR B  2  14  ? -49.063  47.597  386.583 1.00 104.15 ? 14  THR 2 C     1 
ATOM   3522  O  O     . THR B  2  14  ? -48.355  46.648  386.226 1.00 99.19  ? 14  THR 2 O     1 
ATOM   3523  C  CB    . THR B  2  14  ? -51.540  47.320  386.822 1.00 96.50  ? 14  THR 2 CB    1 
ATOM   3524  O  OG1   . THR B  2  14  ? -51.892  48.631  386.363 1.00 87.79  ? 14  THR 2 OG1   1 
ATOM   3525  C  CG2   . THR B  2  14  ? -52.637  46.784  387.717 1.00 94.94  ? 14  THR 2 CG2   1 
ATOM   3526  N  N     . PHE B  2  15  ? -48.863  48.839  386.131 1.00 110.70 ? 15  PHE 2 N     1 
ATOM   3527  C  CA    . PHE B  2  15  ? -47.807  49.090  385.156 1.00 111.62 ? 15  PHE 2 CA    1 
ATOM   3528  C  C     . PHE B  2  15  ? -46.425  49.046  385.791 1.00 114.43 ? 15  PHE 2 C     1 
ATOM   3529  O  O     . PHE B  2  15  ? -45.442  48.751  385.101 1.00 114.69 ? 15  PHE 2 O     1 
ATOM   3530  C  CB    . PHE B  2  15  ? -48.024  50.432  384.455 1.00 109.40 ? 15  PHE 2 CB    1 
ATOM   3531  C  CG    . PHE B  2  15  ? -48.930  50.350  383.259 1.00 107.28 ? 15  PHE 2 CG    1 
ATOM   3532  C  CD1   . PHE B  2  15  ? -48.540  49.654  382.128 1.00 106.33 ? 15  PHE 2 CD1   1 
ATOM   3533  C  CD2   . PHE B  2  15  ? -50.157  50.989  383.254 1.00 108.92 ? 15  PHE 2 CD2   1 
ATOM   3534  C  CE1   . PHE B  2  15  ? -49.367  49.577  381.024 1.00 107.82 ? 15  PHE 2 CE1   1 
ATOM   3535  C  CE2   . PHE B  2  15  ? -50.986  50.918  382.151 1.00 110.41 ? 15  PHE 2 CE2   1 
ATOM   3536  C  CZ    . PHE B  2  15  ? -50.589  50.212  381.036 1.00 109.97 ? 15  PHE 2 CZ    1 
ATOM   3537  N  N     . ALA B  2  16  ? -46.320  49.318  387.095 1.00 114.18 ? 16  ALA 2 N     1 
ATOM   3538  C  CA    . ALA B  2  16  ? -45.027  49.218  387.757 1.00 112.32 ? 16  ALA 2 CA    1 
ATOM   3539  C  C     . ALA B  2  16  ? -44.503  47.791  387.812 1.00 111.20 ? 16  ALA 2 C     1 
ATOM   3540  O  O     . ALA B  2  16  ? -43.310  47.598  388.070 1.00 113.25 ? 16  ALA 2 O     1 
ATOM   3541  C  CB    . ALA B  2  16  ? -45.118  49.792  389.173 1.00 110.07 ? 16  ALA 2 CB    1 
ATOM   3542  N  N     . LYS B  2  17  ? -45.353  46.794  387.560 1.00 105.38 ? 17  LYS 2 N     1 
ATOM   3543  C  CA    . LYS B  2  17  ? -44.908  45.409  387.582 1.00 98.21  ? 17  LYS 2 CA    1 
ATOM   3544  C  C     . LYS B  2  17  ? -44.100  45.031  386.350 1.00 97.74  ? 17  LYS 2 C     1 
ATOM   3545  O  O     . LYS B  2  17  ? -43.303  44.092  386.418 1.00 102.26 ? 17  LYS 2 O     1 
ATOM   3546  C  CB    . LYS B  2  17  ? -46.114  44.477  387.709 1.00 87.47  ? 17  LYS 2 CB    1 
ATOM   3547  C  CG    . LYS B  2  17  ? -47.021  44.794  388.884 1.00 88.10  ? 17  LYS 2 CG    1 
ATOM   3548  C  CD    . LYS B  2  17  ? -48.391  44.160  388.712 1.00 87.78  ? 17  LYS 2 CD    1 
ATOM   3549  C  CE    . LYS B  2  17  ? -49.359  44.644  389.778 1.00 94.21  ? 17  LYS 2 CE    1 
ATOM   3550  N  NZ    . LYS B  2  17  ? -50.749  44.191  389.505 1.00 88.08  ? 17  LYS 2 NZ    1 
ATOM   3551  N  N     . TYR B  2  18  ? -44.270  45.740  385.237 1.00 94.60  ? 18  TYR 2 N     1 
ATOM   3552  C  CA    . TYR B  2  18  ? -43.641  45.360  383.981 1.00 96.14  ? 18  TYR 2 CA    1 
ATOM   3553  C  C     . TYR B  2  18  ? -42.838  46.512  383.399 1.00 101.41 ? 18  TYR 2 C     1 
ATOM   3554  O  O     . TYR B  2  18  ? -43.188  47.683  383.586 1.00 103.88 ? 18  TYR 2 O     1 
ATOM   3555  C  CB    . TYR B  2  18  ? -44.676  44.884  382.950 1.00 93.35  ? 18  TYR 2 CB    1 
ATOM   3556  C  CG    . TYR B  2  18  ? -45.576  43.792  383.467 1.00 92.98  ? 18  TYR 2 CG    1 
ATOM   3557  C  CD1   . TYR B  2  18  ? -45.068  42.535  383.753 1.00 86.67  ? 18  TYR 2 CD1   1 
ATOM   3558  C  CD2   . TYR B  2  18  ? -46.929  44.008  383.662 1.00 90.95  ? 18  TYR 2 CD2   1 
ATOM   3559  C  CE1   . TYR B  2  18  ? -45.878  41.527  384.226 1.00 86.78  ? 18  TYR 2 CE1   1 
ATOM   3560  C  CE2   . TYR B  2  18  ? -47.747  43.004  384.135 1.00 88.96  ? 18  TYR 2 CE2   1 
ATOM   3561  C  CZ    . TYR B  2  18  ? -47.217  41.766  384.414 1.00 86.90  ? 18  TYR 2 CZ    1 
ATOM   3562  O  OH    . TYR B  2  18  ? -48.033  40.767  384.886 1.00 87.01  ? 18  TYR 2 OH    1 
ATOM   3563  N  N     . PRO B  2  19  ? -41.751  46.204  382.696 1.00 104.26 ? 19  PRO 2 N     1 
ATOM   3564  C  CA    . PRO B  2  19  ? -40.870  47.250  382.162 1.00 102.92 ? 19  PRO 2 CA    1 
ATOM   3565  C  C     . PRO B  2  19  ? -41.610  48.162  381.199 1.00 108.43 ? 19  PRO 2 C     1 
ATOM   3566  O  O     . PRO B  2  19  ? -42.674  47.800  380.675 1.00 110.66 ? 19  PRO 2 O     1 
ATOM   3567  C  CB    . PRO B  2  19  ? -39.778  46.448  381.442 1.00 99.24  ? 19  PRO 2 CB    1 
ATOM   3568  C  CG    . PRO B  2  19  ? -39.742  45.149  382.170 1.00 100.17 ? 19  PRO 2 CG    1 
ATOM   3569  C  CD    . PRO B  2  19  ? -41.168  44.860  382.535 1.00 103.18 ? 19  PRO 2 CD    1 
ATOM   3570  N  N     . PRO B  2  20  ? -41.076  49.359  380.943 1.00 113.32 ? 20  PRO 2 N     1 
ATOM   3571  C  CA    . PRO B  2  20  ? -41.782  50.320  380.075 1.00 120.61 ? 20  PRO 2 CA    1 
ATOM   3572  C  C     . PRO B  2  20  ? -41.986  49.856  378.642 1.00 117.83 ? 20  PRO 2 C     1 
ATOM   3573  O  O     . PRO B  2  20  ? -42.908  50.346  377.979 1.00 118.64 ? 20  PRO 2 O     1 
ATOM   3574  C  CB    . PRO B  2  20  ? -40.885  51.566  380.128 1.00 125.52 ? 20  PRO 2 CB    1 
ATOM   3575  C  CG    . PRO B  2  20  ? -39.551  51.066  380.601 1.00 122.98 ? 20  PRO 2 CG    1 
ATOM   3576  C  CD    . PRO B  2  20  ? -39.855  49.937  381.525 1.00 116.33 ? 20  PRO 2 CD    1 
ATOM   3577  N  N     . GLU B  2  21  ? -41.158  48.947  378.135 1.00 113.79 ? 21  GLU 2 N     1 
ATOM   3578  C  CA    . GLU B  2  21  ? -41.229  48.528  376.740 1.00 111.43 ? 21  GLU 2 CA    1 
ATOM   3579  C  C     . GLU B  2  21  ? -42.122  47.316  376.510 1.00 108.65 ? 21  GLU 2 C     1 
ATOM   3580  O  O     . GLU B  2  21  ? -42.379  46.969  375.353 1.00 111.87 ? 21  GLU 2 O     1 
ATOM   3581  C  CB    . GLU B  2  21  ? -39.821  48.243  376.207 1.00 114.06 ? 21  GLU 2 CB    1 
ATOM   3582  C  CG    . GLU B  2  21  ? -39.283  46.867  376.556 1.00 117.42 ? 21  GLU 2 CG    1 
ATOM   3583  C  CD    . GLU B  2  21  ? -38.619  46.835  377.919 1.00 119.76 ? 21  GLU 2 CD    1 
ATOM   3584  O  OE1   . GLU B  2  21  ? -38.807  47.791  378.697 1.00 120.41 ? 21  GLU 2 OE1   1 
ATOM   3585  O  OE2   . GLU B  2  21  ? -37.907  45.854  378.215 1.00 120.84 ? 21  GLU 2 OE2   1 
ATOM   3586  N  N     . GLY B  2  22  ? -42.604  46.673  377.568 1.00 102.63 ? 22  GLY 2 N     1 
ATOM   3587  C  CA    . GLY B  2  22  ? -43.478  45.525  377.426 1.00 97.79  ? 22  GLY 2 CA    1 
ATOM   3588  C  C     . GLY B  2  22  ? -44.869  45.805  377.946 1.00 95.33  ? 22  GLY 2 C     1 
ATOM   3589  O  O     . GLY B  2  22  ? -45.478  44.960  378.610 1.00 97.96  ? 22  GLY 2 O     1 
ATOM   3590  N  N     . ARG B  2  23  ? -45.371  47.005  377.646 1.00 138.41 ? 23  ARG 2 N     1 
ATOM   3591  C  CA    . ARG B  2  23  ? -46.643  47.464  378.196 1.00 138.99 ? 23  ARG 2 CA    1 
ATOM   3592  C  C     . ARG B  2  23  ? -47.785  46.498  377.914 1.00 140.14 ? 23  ARG 2 C     1 
ATOM   3593  O  O     . ARG B  2  23  ? -48.683  46.345  378.750 1.00 141.18 ? 23  ARG 2 O     1 
ATOM   3594  C  CB    . ARG B  2  23  ? -46.977  48.837  377.612 1.00 138.95 ? 23  ARG 2 CB    1 
ATOM   3595  C  CG    . ARG B  2  23  ? -45.759  49.621  377.157 1.00 131.81 ? 23  ARG 2 CG    1 
ATOM   3596  C  CD    . ARG B  2  23  ? -46.079  51.090  376.974 1.00 131.85 ? 23  ARG 2 CD    1 
ATOM   3597  N  NE    . ARG B  2  23  ? -46.839  51.625  378.096 1.00 131.95 ? 23  ARG 2 NE    1 
ATOM   3598  C  CZ    . ARG B  2  23  ? -48.008  52.241  377.972 1.00 132.02 ? 23  ARG 2 CZ    1 
ATOM   3599  N  NH1   . ARG B  2  23  ? -48.548  52.406  376.772 1.00 131.99 ? 23  ARG 2 NH1   1 
ATOM   3600  N  NH2   . ARG B  2  23  ? -48.636  52.699  379.046 1.00 132.12 ? 23  ARG 2 NH2   1 
ATOM   3601  N  N     . ARG B  2  24  ? -47.758  45.818  376.762 1.00 139.50 ? 24  ARG 2 N     1 
ATOM   3602  C  CA    . ARG B  2  24  ? -48.873  44.964  376.362 1.00 140.98 ? 24  ARG 2 CA    1 
ATOM   3603  C  C     . ARG B  2  24  ? -49.179  43.887  377.395 1.00 141.92 ? 24  ARG 2 C     1 
ATOM   3604  O  O     . ARG B  2  24  ? -50.316  43.401  377.449 1.00 145.34 ? 24  ARG 2 O     1 
ATOM   3605  C  CB    . ARG B  2  24  ? -48.588  44.340  374.991 1.00 146.00 ? 24  ARG 2 CB    1 
ATOM   3606  C  CG    . ARG B  2  24  ? -48.443  45.378  373.874 1.00 153.39 ? 24  ARG 2 CG    1 
ATOM   3607  C  CD    . ARG B  2  24  ? -48.336  44.758  372.482 1.00 159.38 ? 24  ARG 2 CD    1 
ATOM   3608  N  NE    . ARG B  2  24  ? -49.602  44.192  372.017 1.00 162.39 ? 24  ARG 2 NE    1 
ATOM   3609  C  CZ    . ARG B  2  24  ? -49.860  42.890  371.934 1.00 163.24 ? 24  ARG 2 CZ    1 
ATOM   3610  N  NH1   . ARG B  2  24  ? -48.944  42.002  372.290 1.00 163.32 ? 24  ARG 2 NH1   1 
ATOM   3611  N  NH2   . ARG B  2  24  ? -51.039  42.476  371.497 1.00 163.55 ? 24  ARG 2 NH2   1 
ATOM   3612  N  N     . ALA B  2  25  ? -48.199  43.528  378.230 1.00 138.93 ? 25  ALA 2 N     1 
ATOM   3613  C  CA    . ALA B  2  25  ? -48.433  42.585  379.319 1.00 134.93 ? 25  ALA 2 CA    1 
ATOM   3614  C  C     . ALA B  2  25  ? -49.675  42.954  380.121 1.00 132.04 ? 25  ALA 2 C     1 
ATOM   3615  O  O     . ALA B  2  25  ? -50.491  42.087  380.460 1.00 132.08 ? 25  ALA 2 O     1 
ATOM   3616  C  CB    . ALA B  2  25  ? -47.207  42.539  380.231 1.00 133.62 ? 25  ALA 2 CB    1 
ATOM   3617  N  N     . ALA B  2  26  ? -49.846  44.249  380.404 1.00 132.54 ? 26  ALA 2 N     1 
ATOM   3618  C  CA    . ALA B  2  26  ? -50.938  44.719  381.247 1.00 134.19 ? 26  ALA 2 CA    1 
ATOM   3619  C  C     . ALA B  2  26  ? -52.304  44.266  380.751 1.00 132.23 ? 26  ALA 2 C     1 
ATOM   3620  O  O     . ALA B  2  26  ? -53.274  44.328  381.512 1.00 133.10 ? 26  ALA 2 O     1 
ATOM   3621  C  CB    . ALA B  2  26  ? -50.903  46.244  381.344 1.00 132.22 ? 26  ALA 2 CB    1 
ATOM   3622  N  N     . ILE B  2  27  ? -52.411  43.828  379.494 1.00 132.16 ? 27  ILE 2 N     1 
ATOM   3623  C  CA    . ILE B  2  27  ? -53.706  43.391  378.979 1.00 132.19 ? 27  ILE 2 CA    1 
ATOM   3624  C  C     . ILE B  2  27  ? -54.210  42.178  379.755 1.00 132.24 ? 27  ILE 2 C     1 
ATOM   3625  O  O     . ILE B  2  27  ? -55.409  42.058  380.032 1.00 132.32 ? 27  ILE 2 O     1 
ATOM   3626  C  CB    . ILE B  2  27  ? -53.613  43.109  377.468 1.00 133.50 ? 27  ILE 2 CB    1 
ATOM   3627  C  CG1   . ILE B  2  27  ? -53.193  44.376  376.721 1.00 134.61 ? 27  ILE 2 CG1   1 
ATOM   3628  C  CG2   . ILE B  2  27  ? -54.939  42.601  376.924 1.00 134.38 ? 27  ILE 2 CG2   1 
ATOM   3629  C  CD1   . ILE B  2  27  ? -52.768  44.131  375.292 1.00 135.65 ? 27  ILE 2 CD1   1 
ATOM   3630  N  N     . MET B  2  28  ? -53.307  41.273  380.136 1.00 132.20 ? 28  MET 2 N     1 
ATOM   3631  C  CA    . MET B  2  28  ? -53.737  40.076  380.858 1.00 136.55 ? 28  MET 2 CA    1 
ATOM   3632  C  C     . MET B  2  28  ? -54.373  40.382  382.210 1.00 136.89 ? 28  MET 2 C     1 
ATOM   3633  O  O     . MET B  2  28  ? -55.461  39.846  382.486 1.00 132.43 ? 28  MET 2 O     1 
ATOM   3634  C  CB    . MET B  2  28  ? -52.566  39.096  380.991 1.00 137.33 ? 28  MET 2 CB    1 
ATOM   3635  C  CG    . MET B  2  28  ? -52.057  38.553  379.670 1.00 137.55 ? 28  MET 2 CG    1 
ATOM   3636  S  SD    . MET B  2  28  ? -51.734  36.783  379.765 1.00 138.95 ? 28  MET 2 SD    1 
ATOM   3637  C  CE    . MET B  2  28  ? -53.353  36.171  380.219 1.00 137.27 ? 28  MET 2 CE    1 
ATOM   3638  N  N     . PRO B  2  29  ? -53.787  41.206  383.088 1.00 137.93 ? 29  PRO 2 N     1 
ATOM   3639  C  CA    . PRO B  2  29  ? -54.476  41.476  384.362 1.00 139.34 ? 29  PRO 2 CA    1 
ATOM   3640  C  C     . PRO B  2  29  ? -55.666  42.408  384.221 1.00 140.37 ? 29  PRO 2 C     1 
ATOM   3641  O  O     . PRO B  2  29  ? -56.691  42.188  384.880 1.00 141.32 ? 29  PRO 2 O     1 
ATOM   3642  C  CB    . PRO B  2  29  ? -53.371  42.086  385.235 1.00 138.81 ? 29  PRO 2 CB    1 
ATOM   3643  C  CG    . PRO B  2  29  ? -52.405  42.663  384.273 1.00 138.05 ? 29  PRO 2 CG    1 
ATOM   3644  C  CD    . PRO B  2  29  ? -52.420  41.760  383.081 1.00 138.45 ? 29  PRO 2 CD    1 
ATOM   3645  N  N     . LEU B  2  30  ? -55.563  43.447  383.385 1.00 140.67 ? 30  LEU 2 N     1 
ATOM   3646  C  CA    . LEU B  2  30  ? -56.637  44.433  383.290 1.00 139.85 ? 30  LEU 2 CA    1 
ATOM   3647  C  C     . LEU B  2  30  ? -57.951  43.777  382.884 1.00 140.87 ? 30  LEU 2 C     1 
ATOM   3648  O  O     . LEU B  2  30  ? -58.983  43.973  383.538 1.00 140.53 ? 30  LEU 2 O     1 
ATOM   3649  C  CB    . LEU B  2  30  ? -56.254  45.533  382.301 1.00 132.55 ? 30  LEU 2 CB    1 
ATOM   3650  C  CG    . LEU B  2  30  ? -55.120  46.456  382.746 1.00 132.78 ? 30  LEU 2 CG    1 
ATOM   3651  C  CD1   . LEU B  2  30  ? -54.875  47.545  381.711 1.00 132.48 ? 30  LEU 2 CD1   1 
ATOM   3652  C  CD2   . LEU B  2  30  ? -55.418  47.053  384.113 1.00 134.26 ? 30  LEU 2 CD2   1 
ATOM   3653  N  N     . LEU B  2  31  ? -57.928  42.997  381.797 1.00 138.61 ? 31  LEU 2 N     1 
ATOM   3654  C  CA    . LEU B  2  31  ? -59.079  42.190  381.404 1.00 137.29 ? 31  LEU 2 CA    1 
ATOM   3655  C  C     . LEU B  2  31  ? -59.681  41.475  382.605 1.00 138.48 ? 31  LEU 2 C     1 
ATOM   3656  O  O     . LEU B  2  31  ? -60.895  41.517  382.834 1.00 135.78 ? 31  LEU 2 O     1 
ATOM   3657  C  CB    . LEU B  2  31  ? -58.657  41.172  380.339 1.00 132.50 ? 31  LEU 2 CB    1 
ATOM   3658  C  CG    . LEU B  2  31  ? -58.352  41.651  378.920 1.00 133.63 ? 31  LEU 2 CG    1 
ATOM   3659  C  CD1   . LEU B  2  31  ? -57.610  40.565  378.164 1.00 133.79 ? 31  LEU 2 CD1   1 
ATOM   3660  C  CD2   . LEU B  2  31  ? -59.632  42.024  378.197 1.00 135.35 ? 31  LEU 2 CD2   1 
ATOM   3661  N  N     . ARG B  2  32  ? -58.820  40.840  383.404 1.00 145.79 ? 32  ARG 2 N     1 
ATOM   3662  C  CA    . ARG B  2  32  ? -59.290  40.033  384.523 1.00 154.67 ? 32  ARG 2 CA    1 
ATOM   3663  C  C     . ARG B  2  32  ? -60.075  40.869  385.521 1.00 157.64 ? 32  ARG 2 C     1 
ATOM   3664  O  O     . ARG B  2  32  ? -61.050  40.387  386.112 1.00 160.68 ? 32  ARG 2 O     1 
ATOM   3665  C  CB    . ARG B  2  32  ? -58.108  39.353  385.209 1.00 159.80 ? 32  ARG 2 CB    1 
ATOM   3666  C  CG    . ARG B  2  32  ? -58.470  38.697  386.527 1.00 162.62 ? 32  ARG 2 CG    1 
ATOM   3667  C  CD    . ARG B  2  32  ? -57.333  37.860  387.059 1.00 163.14 ? 32  ARG 2 CD    1 
ATOM   3668  N  NE    . ARG B  2  32  ? -57.202  36.639  386.277 1.00 161.86 ? 32  ARG 2 NE    1 
ATOM   3669  C  CZ    . ARG B  2  32  ? -57.938  35.553  386.476 1.00 161.50 ? 32  ARG 2 CZ    1 
ATOM   3670  N  NH1   . ARG B  2  32  ? -58.853  35.538  387.437 1.00 161.87 ? 32  ARG 2 NH1   1 
ATOM   3671  N  NH2   . ARG B  2  32  ? -57.764  34.483  385.717 1.00 161.92 ? 32  ARG 2 NH2   1 
ATOM   3672  N  N     . ARG B  2  33  ? -59.678  42.127  385.716 1.00 158.36 ? 33  ARG 2 N     1 
ATOM   3673  C  CA    . ARG B  2  33  ? -60.436  42.972  386.629 1.00 163.54 ? 33  ARG 2 CA    1 
ATOM   3674  C  C     . ARG B  2  33  ? -61.864  43.152  386.141 1.00 166.00 ? 33  ARG 2 C     1 
ATOM   3675  O  O     . ARG B  2  33  ? -62.806  43.104  386.939 1.00 170.59 ? 33  ARG 2 O     1 
ATOM   3676  C  CB    . ARG B  2  33  ? -59.750  44.323  386.810 1.00 167.55 ? 33  ARG 2 CB    1 
ATOM   3677  C  CG    . ARG B  2  33  ? -58.886  44.394  388.054 1.00 170.11 ? 33  ARG 2 CG    1 
ATOM   3678  C  CD    . ARG B  2  33  ? -59.236  45.618  388.880 1.00 170.46 ? 33  ARG 2 CD    1 
ATOM   3679  N  NE    . ARG B  2  33  ? -60.628  45.593  389.317 1.00 170.90 ? 33  ARG 2 NE    1 
ATOM   3680  C  CZ    . ARG B  2  33  ? -61.149  46.443  390.194 1.00 174.83 ? 33  ARG 2 CZ    1 
ATOM   3681  N  NH1   . ARG B  2  33  ? -60.393  47.390  390.730 1.00 175.00 ? 33  ARG 2 NH1   1 
ATOM   3682  N  NH2   . ARG B  2  33  ? -62.426  46.349  390.535 1.00 178.36 ? 33  ARG 2 NH2   1 
ATOM   3683  N  N     . VAL B  2  34  ? -62.047  43.338  384.832 1.00 164.43 ? 34  VAL 2 N     1 
ATOM   3684  C  CA    . VAL B  2  34  ? -63.395  43.352  384.269 1.00 166.85 ? 34  VAL 2 CA    1 
ATOM   3685  C  C     . VAL B  2  34  ? -64.099  42.031  384.555 1.00 170.04 ? 34  VAL 2 C     1 
ATOM   3686  O  O     . VAL B  2  34  ? -65.288  42.006  384.900 1.00 172.64 ? 34  VAL 2 O     1 
ATOM   3687  C  CB    . VAL B  2  34  ? -63.345  43.657  382.759 1.00 166.66 ? 34  VAL 2 CB    1 
ATOM   3688  C  CG1   . VAL B  2  34  ? -64.753  43.843  382.202 1.00 167.51 ? 34  VAL 2 CG1   1 
ATOM   3689  C  CG2   . VAL B  2  34  ? -62.491  44.887  382.487 1.00 165.91 ? 34  VAL 2 CG2   1 
ATOM   3690  N  N     . GLN B  2  35  ? -63.369  40.918  384.428 1.00 167.57 ? 35  GLN 2 N     1 
ATOM   3691  C  CA    . GLN B  2  35  ? -63.942  39.583  384.591 1.00 161.47 ? 35  GLN 2 CA    1 
ATOM   3692  C  C     . GLN B  2  35  ? -64.780  39.469  385.859 1.00 161.76 ? 35  GLN 2 C     1 
ATOM   3693  O  O     . GLN B  2  35  ? -65.989  39.226  385.800 1.00 160.14 ? 35  GLN 2 O     1 
ATOM   3694  C  CB    . GLN B  2  35  ? -62.823  38.541  384.595 1.00 154.92 ? 35  GLN 2 CB    1 
ATOM   3695  C  CG    . GLN B  2  35  ? -63.236  37.174  384.076 1.00 151.62 ? 35  GLN 2 CG    1 
ATOM   3696  C  CD    . GLN B  2  35  ? -64.344  36.551  384.898 1.00 151.55 ? 35  GLN 2 CD    1 
ATOM   3697  O  OE1   . GLN B  2  35  ? -65.410  36.219  384.381 1.00 152.01 ? 35  GLN 2 OE1   1 
ATOM   3698  N  NE2   . GLN B  2  35  ? -64.104  36.409  386.195 1.00 152.33 ? 35  GLN 2 NE2   1 
ATOM   3699  N  N     . GLN B  2  36  ? -64.151  39.637  387.021 1.00 164.58 ? 36  GLN 2 N     1 
ATOM   3700  C  CA    . GLN B  2  36  ? -64.881  39.493  388.274 1.00 169.89 ? 36  GLN 2 CA    1 
ATOM   3701  C  C     . GLN B  2  36  ? -65.804  40.671  388.555 1.00 179.30 ? 36  GLN 2 C     1 
ATOM   3702  O  O     . GLN B  2  36  ? -66.638  40.575  389.462 1.00 181.66 ? 36  GLN 2 O     1 
ATOM   3703  C  CB    . GLN B  2  36  ? -63.907  39.298  389.438 1.00 168.35 ? 36  GLN 2 CB    1 
ATOM   3704  C  CG    . GLN B  2  36  ? -63.310  40.578  389.982 1.00 169.12 ? 36  GLN 2 CG    1 
ATOM   3705  C  CD    . GLN B  2  36  ? -61.994  40.339  390.692 1.00 171.00 ? 36  GLN 2 CD    1 
ATOM   3706  O  OE1   . GLN B  2  36  ? -61.451  39.233  390.666 1.00 169.41 ? 36  GLN 2 OE1   1 
ATOM   3707  N  NE2   . GLN B  2  36  ? -61.474  41.376  391.335 1.00 174.00 ? 36  GLN 2 NE2   1 
ATOM   3708  N  N     . GLU B  2  37  ? -65.680  41.771  387.808 1.00 185.17 ? 37  GLU 2 N     1 
ATOM   3709  C  CA    . GLU B  2  37  ? -66.498  42.949  388.081 1.00 188.72 ? 37  GLU 2 CA    1 
ATOM   3710  C  C     . GLU B  2  37  ? -67.865  42.844  387.414 1.00 192.05 ? 37  GLU 2 C     1 
ATOM   3711  O  O     . GLU B  2  37  ? -68.892  43.125  388.040 1.00 192.87 ? 37  GLU 2 O     1 
ATOM   3712  C  CB    . GLU B  2  37  ? -65.772  44.215  387.624 1.00 188.37 ? 37  GLU 2 CB    1 
ATOM   3713  C  CG    . GLU B  2  37  ? -64.719  44.713  388.600 1.00 188.56 ? 37  GLU 2 CG    1 
ATOM   3714  C  CD    . GLU B  2  37  ? -65.288  45.630  389.656 1.00 190.33 ? 37  GLU 2 CD    1 
ATOM   3715  O  OE1   . GLU B  2  37  ? -66.000  46.588  389.290 1.00 191.12 ? 37  GLU 2 OE1   1 
ATOM   3716  O  OE2   . GLU B  2  37  ? -65.024  45.394  390.854 1.00 191.13 ? 37  GLU 2 OE2   1 
ATOM   3717  N  N     . GLU B  2  38  ? -67.897  42.447  386.142 1.00 193.78 ? 38  GLU 2 N     1 
ATOM   3718  C  CA    . GLU B  2  38  ? -69.137  42.368  385.383 1.00 195.27 ? 38  GLU 2 CA    1 
ATOM   3719  C  C     . GLU B  2  38  ? -69.488  40.952  384.947 1.00 193.41 ? 38  GLU 2 C     1 
ATOM   3720  O  O     . GLU B  2  38  ? -70.559  40.751  384.362 1.00 193.52 ? 38  GLU 2 O     1 
ATOM   3721  C  CB    . GLU B  2  38  ? -69.068  43.276  384.148 1.00 198.69 ? 38  GLU 2 CB    1 
ATOM   3722  C  CG    . GLU B  2  38  ? -69.091  44.762  384.463 1.00 202.60 ? 38  GLU 2 CG    1 
ATOM   3723  C  CD    . GLU B  2  38  ? -69.242  45.617  383.220 1.00 205.69 ? 38  GLU 2 CD    1 
ATOM   3724  O  OE1   . GLU B  2  38  ? -68.731  45.216  382.153 1.00 206.69 ? 38  GLU 2 OE1   1 
ATOM   3725  O  OE2   . GLU B  2  38  ? -69.875  46.690  383.309 1.00 206.89 ? 38  GLU 2 OE2   1 
ATOM   3726  N  N     . GLY B  2  39  ? -68.625  39.969  385.208 1.00 119.70 ? 39  GLY 2 N     1 
ATOM   3727  C  CA    . GLY B  2  39  ? -68.864  38.603  384.800 1.00 122.89 ? 39  GLY 2 CA    1 
ATOM   3728  C  C     . GLY B  2  39  ? -68.469  38.294  383.376 1.00 126.25 ? 39  GLY 2 C     1 
ATOM   3729  O  O     . GLY B  2  39  ? -68.282  37.117  383.039 1.00 124.90 ? 39  GLY 2 O     1 
ATOM   3730  N  N     . TRP B  2  40  ? -68.351  39.308  382.524 1.00 127.77 ? 40  TRP 2 N     1 
ATOM   3731  C  CA    . TRP B  2  40  ? -67.975  39.121  381.131 1.00 123.51 ? 40  TRP 2 CA    1 
ATOM   3732  C  C     . TRP B  2  40  ? -67.384  40.424  380.613 1.00 127.52 ? 40  TRP 2 C     1 
ATOM   3733  O  O     . TRP B  2  40  ? -67.646  41.501  381.153 1.00 131.31 ? 40  TRP 2 O     1 
ATOM   3734  C  CB    . TRP B  2  40  ? -69.175  38.687  380.289 1.00 115.47 ? 40  TRP 2 CB    1 
ATOM   3735  C  CG    . TRP B  2  40  ? -70.226  39.743  380.150 1.00 111.70 ? 40  TRP 2 CG    1 
ATOM   3736  C  CD1   . TRP B  2  40  ? -71.063  40.197  381.125 1.00 112.90 ? 40  TRP 2 CD1   1 
ATOM   3737  C  CD2   . TRP B  2  40  ? -70.560  40.472  378.964 1.00 107.16 ? 40  TRP 2 CD2   1 
ATOM   3738  N  NE1   . TRP B  2  40  ? -71.896  41.166  380.621 1.00 111.05 ? 40  TRP 2 NE1   1 
ATOM   3739  C  CE2   . TRP B  2  40  ? -71.606  41.353  379.296 1.00 108.81 ? 40  TRP 2 CE2   1 
ATOM   3740  C  CE3   . TRP B  2  40  ? -70.073  40.469  377.658 1.00 102.61 ? 40  TRP 2 CE3   1 
ATOM   3741  C  CZ2   . TRP B  2  40  ? -72.172  42.222  378.368 1.00 107.74 ? 40  TRP 2 CZ2   1 
ATOM   3742  C  CZ3   . TRP B  2  40  ? -70.638  41.326  376.737 1.00 103.84 ? 40  TRP 2 CZ3   1 
ATOM   3743  C  CH2   . TRP B  2  40  ? -71.678  42.190  377.095 1.00 106.10 ? 40  TRP 2 CH2   1 
ATOM   3744  N  N     . ILE B  2  41  ? -66.595  40.314  379.548 1.00 126.38 ? 41  ILE 2 N     1 
ATOM   3745  C  CA    . ILE B  2  41  ? -65.852  41.444  378.999 1.00 126.21 ? 41  ILE 2 CA    1 
ATOM   3746  C  C     . ILE B  2  41  ? -66.543  41.921  377.731 1.00 130.95 ? 41  ILE 2 C     1 
ATOM   3747  O  O     . ILE B  2  41  ? -66.761  41.139  376.799 1.00 128.36 ? 41  ILE 2 O     1 
ATOM   3748  C  CB    . ILE B  2  41  ? -64.387  41.075  378.721 1.00 122.62 ? 41  ILE 2 CB    1 
ATOM   3749  C  CG1   . ILE B  2  41  ? -63.701  40.638  380.014 1.00 124.84 ? 41  ILE 2 CG1   1 
ATOM   3750  C  CG2   . ILE B  2  41  ? -63.652  42.245  378.093 1.00 120.94 ? 41  ILE 2 CG2   1 
ATOM   3751  C  CD1   . ILE B  2  41  ? -62.344  40.009  379.806 1.00 126.97 ? 41  ILE 2 CD1   1 
ATOM   3752  N  N     . ARG B  2  42  ? -66.881  43.202  377.697 1.00 140.36 ? 42  ARG 2 N     1 
ATOM   3753  C  CA    . ARG B  2  42  ? -67.501  43.827  376.544 1.00 147.10 ? 42  ARG 2 CA    1 
ATOM   3754  C  C     . ARG B  2  42  ? -66.435  44.316  375.574 1.00 149.80 ? 42  ARG 2 C     1 
ATOM   3755  O  O     . ARG B  2  42  ? -65.281  44.531  375.957 1.00 150.09 ? 42  ARG 2 O     1 
ATOM   3756  C  CB    . ARG B  2  42  ? -68.374  44.998  376.991 1.00 147.36 ? 42  ARG 2 CB    1 
ATOM   3757  C  CG    . ARG B  2  42  ? -69.445  44.647  378.008 1.00 145.13 ? 42  ARG 2 CG    1 
ATOM   3758  C  CD    . ARG B  2  42  ? -69.837  45.868  378.820 1.00 144.87 ? 42  ARG 2 CD    1 
ATOM   3759  N  NE    . ARG B  2  42  ? -70.390  45.513  380.122 1.00 146.16 ? 42  ARG 2 NE    1 
ATOM   3760  C  CZ    . ARG B  2  42  ? -71.682  45.313  380.352 1.00 146.15 ? 42  ARG 2 CZ    1 
ATOM   3761  N  NH1   . ARG B  2  42  ? -72.560  45.434  379.366 1.00 146.07 ? 42  ARG 2 NH1   1 
ATOM   3762  N  NH2   . ARG B  2  42  ? -72.098  44.996  381.570 1.00 145.52 ? 42  ARG 2 NH2   1 
ATOM   3763  N  N     . PRO B  2  43  ? -66.788  44.480  374.296 1.00 150.47 ? 43  PRO 2 N     1 
ATOM   3764  C  CA    . PRO B  2  43  ? -65.838  45.082  373.343 1.00 151.54 ? 43  PRO 2 CA    1 
ATOM   3765  C  C     . PRO B  2  43  ? -65.326  46.457  373.751 1.00 147.67 ? 43  PRO 2 C     1 
ATOM   3766  O  O     . PRO B  2  43  ? -64.173  46.793  373.441 1.00 152.13 ? 43  PRO 2 O     1 
ATOM   3767  C  CB    . PRO B  2  43  ? -66.642  45.141  372.033 1.00 152.68 ? 43  PRO 2 CB    1 
ATOM   3768  C  CG    . PRO B  2  43  ? -68.065  44.797  372.400 1.00 150.45 ? 43  PRO 2 CG    1 
ATOM   3769  C  CD    . PRO B  2  43  ? -67.989  43.958  373.625 1.00 148.74 ? 43  PRO 2 CD    1 
ATOM   3770  N  N     . GLU B  2  44  ? -66.151  47.272  374.418 1.00 136.00 ? 44  GLU 2 N     1 
ATOM   3771  C  CA    . GLU B  2  44  ? -65.700  48.592  374.850 1.00 126.51 ? 44  GLU 2 CA    1 
ATOM   3772  C  C     . GLU B  2  44  ? -64.481  48.484  375.756 1.00 123.19 ? 44  GLU 2 C     1 
ATOM   3773  O  O     . GLU B  2  44  ? -63.528  49.263  375.631 1.00 123.49 ? 44  GLU 2 O     1 
ATOM   3774  C  CB    . GLU B  2  44  ? -66.824  49.336  375.577 1.00 124.50 ? 44  GLU 2 CB    1 
ATOM   3775  C  CG    . GLU B  2  44  ? -68.055  49.679  374.744 1.00 124.88 ? 44  GLU 2 CG    1 
ATOM   3776  C  CD    . GLU B  2  44  ? -69.041  48.532  374.659 1.00 126.07 ? 44  GLU 2 CD    1 
ATOM   3777  O  OE1   . GLU B  2  44  ? -68.720  47.440  375.161 1.00 126.61 ? 44  GLU 2 OE1   1 
ATOM   3778  O  OE2   . GLU B  2  44  ? -70.138  48.723  374.095 1.00 126.64 ? 44  GLU 2 OE2   1 
ATOM   3779  N  N     . ARG B  2  45  ? -64.495  47.519  376.678 1.00 120.16 ? 45  ARG 2 N     1 
ATOM   3780  C  CA    . ARG B  2  45  ? -63.369  47.352  377.588 1.00 114.92 ? 45  ARG 2 CA    1 
ATOM   3781  C  C     . ARG B  2  45  ? -62.117  46.931  376.833 1.00 105.46 ? 45  ARG 2 C     1 
ATOM   3782  O  O     . ARG B  2  45  ? -61.011  47.362  377.170 1.00 105.78 ? 45  ARG 2 O     1 
ATOM   3783  C  CB    . ARG B  2  45  ? -63.705  46.324  378.669 1.00 116.62 ? 45  ARG 2 CB    1 
ATOM   3784  C  CG    . ARG B  2  45  ? -65.159  46.321  379.111 1.00 115.48 ? 45  ARG 2 CG    1 
ATOM   3785  C  CD    . ARG B  2  45  ? -65.518  47.560  379.907 1.00 112.82 ? 45  ARG 2 CD    1 
ATOM   3786  N  NE    . ARG B  2  45  ? -66.188  48.545  379.064 1.00 113.16 ? 45  ARG 2 NE    1 
ATOM   3787  C  CZ    . ARG B  2  45  ? -66.973  49.513  379.524 1.00 117.62 ? 45  ARG 2 CZ    1 
ATOM   3788  N  NH1   . ARG B  2  45  ? -67.194  49.630  380.826 1.00 121.35 ? 45  ARG 2 NH1   1 
ATOM   3789  N  NH2   . ARG B  2  45  ? -67.542  50.364  378.683 1.00 118.79 ? 45  ARG 2 NH2   1 
ATOM   3790  N  N     . ILE B  2  46  ? -62.271  46.093  375.806 1.00 98.10  ? 46  ILE 2 N     1 
ATOM   3791  C  CA    . ILE B  2  46  ? -61.124  45.675  375.002 1.00 94.11  ? 46  ILE 2 CA    1 
ATOM   3792  C  C     . ILE B  2  46  ? -60.525  46.870  374.270 1.00 99.77  ? 46  ILE 2 C     1 
ATOM   3793  O  O     . ILE B  2  46  ? -59.302  47.063  374.253 1.00 101.60 ? 46  ILE 2 O     1 
ATOM   3794  C  CB    . ILE B  2  46  ? -61.533  44.557  374.025 1.00 81.41  ? 46  ILE 2 CB    1 
ATOM   3795  C  CG1   . ILE B  2  46  ? -61.744  43.244  374.779 1.00 83.46  ? 46  ILE 2 CG1   1 
ATOM   3796  C  CG2   . ILE B  2  46  ? -60.503  44.393  372.921 1.00 73.86  ? 46  ILE 2 CG2   1 
ATOM   3797  C  CD1   . ILE B  2  46  ? -61.868  42.034  373.881 1.00 87.84  ? 46  ILE 2 CD1   1 
ATOM   3798  N  N     . GLU B  2  47  ? -61.380  47.699  373.664 1.00 100.45 ? 47  GLU 2 N     1 
ATOM   3799  C  CA    . GLU B  2  47  ? -60.876  48.885  372.980 1.00 101.52 ? 47  GLU 2 CA    1 
ATOM   3800  C  C     . GLU B  2  47  ? -60.179  49.826  373.954 1.00 111.81 ? 47  GLU 2 C     1 
ATOM   3801  O  O     . GLU B  2  47  ? -59.146  50.417  373.622 1.00 111.80 ? 47  GLU 2 O     1 
ATOM   3802  C  CB    . GLU B  2  47  ? -62.007  49.615  372.254 1.00 94.71  ? 47  GLU 2 CB    1 
ATOM   3803  C  CG    . GLU B  2  47  ? -62.729  48.797  371.199 1.00 86.28  ? 47  GLU 2 CG    1 
ATOM   3804  C  CD    . GLU B  2  47  ? -63.904  49.540  370.601 1.00 80.66  ? 47  GLU 2 CD    1 
ATOM   3805  O  OE1   . GLU B  2  47  ? -63.909  50.788  370.651 1.00 78.59  ? 47  GLU 2 OE1   1 
ATOM   3806  O  OE2   . GLU B  2  47  ? -64.818  48.879  370.073 1.00 79.60  ? 47  GLU 2 OE2   1 
ATOM   3807  N  N     . GLU B  2  48  ? -60.722  49.970  375.165 1.00 119.10 ? 48  GLU 2 N     1 
ATOM   3808  C  CA    . GLU B  2  48  ? -60.111  50.875  376.135 1.00 122.63 ? 48  GLU 2 CA    1 
ATOM   3809  C  C     . GLU B  2  48  ? -58.773  50.341  376.632 1.00 118.20 ? 48  GLU 2 C     1 
ATOM   3810  O  O     . GLU B  2  48  ? -57.816  51.109  376.791 1.00 118.88 ? 48  GLU 2 O     1 
ATOM   3811  C  CB    . GLU B  2  48  ? -61.056  51.119  377.309 1.00 130.55 ? 48  GLU 2 CB    1 
ATOM   3812  C  CG    . GLU B  2  48  ? -60.580  52.227  378.238 1.00 138.05 ? 48  GLU 2 CG    1 
ATOM   3813  C  CD    . GLU B  2  48  ? -61.570  52.534  379.341 1.00 145.99 ? 48  GLU 2 CD    1 
ATOM   3814  O  OE1   . GLU B  2  48  ? -62.730  52.085  379.240 1.00 149.00 ? 48  GLU 2 OE1   1 
ATOM   3815  O  OE2   . GLU B  2  48  ? -61.190  53.228  380.308 1.00 148.37 ? 48  GLU 2 OE2   1 
ATOM   3816  N  N     . ILE B  2  49  ? -58.696  49.036  376.912 1.00 112.95 ? 49  ILE 2 N     1 
ATOM   3817  C  CA    . ILE B  2  49  ? -57.424  48.429  377.298 1.00 107.60 ? 49  ILE 2 CA    1 
ATOM   3818  C  C     . ILE B  2  49  ? -56.395  48.621  376.196 1.00 103.28 ? 49  ILE 2 C     1 
ATOM   3819  O  O     . ILE B  2  49  ? -55.231  48.935  376.465 1.00 97.91  ? 49  ILE 2 O     1 
ATOM   3820  C  CB    . ILE B  2  49  ? -57.611  46.939  377.645 1.00 104.81 ? 49  ILE 2 CB    1 
ATOM   3821  C  CG1   . ILE B  2  49  ? -58.501  46.774  378.876 1.00 107.33 ? 49  ILE 2 CG1   1 
ATOM   3822  C  CG2   . ILE B  2  49  ? -56.266  46.270  377.886 1.00 103.65 ? 49  ILE 2 CG2   1 
ATOM   3823  C  CD1   . ILE B  2  49  ? -58.685  45.335  379.306 1.00 108.22 ? 49  ILE 2 CD1   1 
ATOM   3824  N  N     . ALA B  2  50  ? -56.808  48.446  374.939 1.00 104.24 ? 50  ALA 2 N     1 
ATOM   3825  C  CA    . ALA B  2  50  ? -55.904  48.696  373.821 1.00 104.75 ? 50  ALA 2 CA    1 
ATOM   3826  C  C     . ALA B  2  50  ? -55.416  50.140  373.822 1.00 105.26 ? 50  ALA 2 C     1 
ATOM   3827  O  O     . ALA B  2  50  ? -54.211  50.401  373.744 1.00 96.74  ? 50  ALA 2 O     1 
ATOM   3828  C  CB    . ALA B  2  50  ? -56.604  48.368  372.504 1.00 104.77 ? 50  ALA 2 CB    1 
ATOM   3829  N  N     . ARG B  2  51  ? -56.351  51.092  373.902 1.00 114.84 ? 51  ARG 2 N     1 
ATOM   3830  C  CA    . ARG B  2  51  ? -56.000  52.509  373.853 1.00 122.18 ? 51  ARG 2 CA    1 
ATOM   3831  C  C     . ARG B  2  51  ? -55.036  52.886  374.970 1.00 130.58 ? 51  ARG 2 C     1 
ATOM   3832  O  O     . ARG B  2  51  ? -54.115  53.686  374.765 1.00 135.01 ? 51  ARG 2 O     1 
ATOM   3833  C  CB    . ARG B  2  51  ? -57.267  53.361  373.948 1.00 118.37 ? 51  ARG 2 CB    1 
ATOM   3834  C  CG    . ARG B  2  51  ? -58.210  53.249  372.761 1.00 113.04 ? 51  ARG 2 CG    1 
ATOM   3835  C  CD    . ARG B  2  51  ? -59.248  54.356  372.795 1.00 111.06 ? 51  ARG 2 CD    1 
ATOM   3836  N  NE    . ARG B  2  51  ? -60.095  54.275  373.979 1.00 108.88 ? 51  ARG 2 NE    1 
ATOM   3837  C  CZ    . ARG B  2  51  ? -61.198  53.539  374.062 1.00 105.21 ? 51  ARG 2 CZ    1 
ATOM   3838  N  NH1   . ARG B  2  51  ? -61.597  52.815  373.027 1.00 105.19 ? 51  ARG 2 NH1   1 
ATOM   3839  N  NH2   . ARG B  2  51  ? -61.907  53.530  375.183 1.00 103.32 ? 51  ARG 2 NH2   1 
ATOM   3840  N  N     . LEU B  2  52  ? -55.239  52.328  376.165 1.00 129.65 ? 52  LEU 2 N     1 
ATOM   3841  C  CA    . LEU B  2  52  ? -54.345  52.625  377.278 1.00 125.54 ? 52  LEU 2 CA    1 
ATOM   3842  C  C     . LEU B  2  52  ? -52.989  51.958  377.083 1.00 116.26 ? 52  LEU 2 C     1 
ATOM   3843  O  O     . LEU B  2  52  ? -51.946  52.553  377.383 1.00 115.60 ? 52  LEU 2 O     1 
ATOM   3844  C  CB    . LEU B  2  52  ? -54.983  52.181  378.595 1.00 127.71 ? 52  LEU 2 CB    1 
ATOM   3845  C  CG    . LEU B  2  52  ? -56.241  52.943  379.015 1.00 129.70 ? 52  LEU 2 CG    1 
ATOM   3846  C  CD1   . LEU B  2  52  ? -56.997  52.182  380.096 1.00 126.87 ? 52  LEU 2 CD1   1 
ATOM   3847  C  CD2   . LEU B  2  52  ? -55.898  54.355  379.475 1.00 134.81 ? 52  LEU 2 CD2   1 
ATOM   3848  N  N     . VAL B  2  53  ? -52.987  50.724  376.567 1.00 105.42 ? 53  VAL 2 N     1 
ATOM   3849  C  CA    . VAL B  2  53  ? -51.784  49.900  376.527 1.00 96.12  ? 53  VAL 2 CA    1 
ATOM   3850  C  C     . VAL B  2  53  ? -50.975  50.107  375.255 1.00 92.80  ? 53  VAL 2 C     1 
ATOM   3851  O  O     . VAL B  2  53  ? -49.826  49.645  375.180 1.00 96.57  ? 53  VAL 2 O     1 
ATOM   3852  C  CB    . VAL B  2  53  ? -52.154  48.409  376.671 1.00 93.30  ? 53  VAL 2 CB    1 
ATOM   3853  C  CG1   . VAL B  2  53  ? -52.625  47.825  375.341 1.00 92.73  ? 53  VAL 2 CG1   1 
ATOM   3854  C  CG2   . VAL B  2  53  ? -51.008  47.624  377.254 1.00 93.12  ? 53  VAL 2 CG2   1 
ATOM   3855  N  N     . GLY B  2  54  ? -51.528  50.789  374.256 1.00 85.69  ? 54  GLY 2 N     1 
ATOM   3856  C  CA    . GLY B  2  54  ? -50.763  51.119  373.073 1.00 76.67  ? 54  GLY 2 CA    1 
ATOM   3857  C  C     . GLY B  2  54  ? -50.584  49.985  372.085 1.00 63.05  ? 54  GLY 2 C     1 
ATOM   3858  O  O     . GLY B  2  54  ? -49.455  49.563  371.816 1.00 59.11  ? 54  GLY 2 O     1 
ATOM   3859  N  N     . THR B  2  55  ? -51.685  49.467  371.556 1.00 58.59  ? 55  THR 2 N     1 
ATOM   3860  C  CA    . THR B  2  55  ? -51.637  48.446  370.519 1.00 64.85  ? 55  THR 2 CA    1 
ATOM   3861  C  C     . THR B  2  55  ? -52.938  48.524  369.730 1.00 68.91  ? 55  THR 2 C     1 
ATOM   3862  O  O     . THR B  2  55  ? -53.792  49.375  369.990 1.00 67.10  ? 55  THR 2 O     1 
ATOM   3863  C  CB    . THR B  2  55  ? -51.408  47.053  371.117 1.00 66.01  ? 55  THR 2 CB    1 
ATOM   3864  O  OG1   . THR B  2  55  ? -51.131  46.120  370.066 1.00 67.00  ? 55  THR 2 OG1   1 
ATOM   3865  C  CG2   . THR B  2  55  ? -52.617  46.592  371.889 1.00 63.11  ? 55  THR 2 CG2   1 
ATOM   3866  N  N     . THR B  2  56  ? -53.086  47.626  368.761 1.00 72.79  ? 56  THR 2 N     1 
ATOM   3867  C  CA    . THR B  2  56  ? -54.340  47.697  368.021 1.00 70.85  ? 56  THR 2 CA    1 
ATOM   3868  C  C     . THR B  2  56  ? -55.418  46.868  368.714 1.00 61.86  ? 56  THR 2 C     1 
ATOM   3869  O  O     . THR B  2  56  ? -55.139  45.766  369.198 1.00 61.04  ? 56  THR 2 O     1 
ATOM   3870  C  CB    . THR B  2  56  ? -54.161  47.207  366.588 1.00 66.83  ? 56  THR 2 CB    1 
ATOM   3871  O  OG1   . THR B  2  56  ? -53.998  45.784  366.577 1.00 53.88  ? 56  THR 2 OG1   1 
ATOM   3872  C  CG2   . THR B  2  56  ? -52.947  47.865  365.944 1.00 72.15  ? 56  THR 2 CG2   1 
ATOM   3873  N  N     . PRO B  2  57  ? -56.641  47.398  368.774 1.00 58.57  ? 57  PRO 2 N     1 
ATOM   3874  C  CA    . PRO B  2  57  ? -57.738  46.666  369.430 1.00 63.59  ? 57  PRO 2 CA    1 
ATOM   3875  C  C     . PRO B  2  57  ? -57.934  45.262  368.891 1.00 68.51  ? 57  PRO 2 C     1 
ATOM   3876  O  O     . PRO B  2  57  ? -58.364  44.374  369.637 1.00 68.40  ? 57  PRO 2 O     1 
ATOM   3877  C  CB    . PRO B  2  57  ? -58.958  47.553  369.150 1.00 60.17  ? 57  PRO 2 CB    1 
ATOM   3878  C  CG    . PRO B  2  57  ? -58.394  48.914  368.949 1.00 58.96  ? 57  PRO 2 CG    1 
ATOM   3879  C  CD    . PRO B  2  57  ? -57.072  48.714  368.277 1.00 58.51  ? 57  PRO 2 CD    1 
ATOM   3880  N  N     . THR B  2  58  ? -57.660  45.046  367.603 1.00 70.96  ? 58  THR 2 N     1 
ATOM   3881  C  CA    . THR B  2  58  ? -57.710  43.699  367.046 1.00 70.83  ? 58  THR 2 CA    1 
ATOM   3882  C  C     . THR B  2  58  ? -56.782  42.764  367.806 1.00 82.14  ? 58  THR 2 C     1 
ATOM   3883  O  O     . THR B  2  58  ? -57.159  41.633  368.139 1.00 94.85  ? 58  THR 2 O     1 
ATOM   3884  C  CB    . THR B  2  58  ? -57.316  43.723  365.566 1.00 56.47  ? 58  THR 2 CB    1 
ATOM   3885  O  OG1   . THR B  2  58  ? -58.325  44.389  364.797 1.00 53.43  ? 58  THR 2 OG1   1 
ATOM   3886  C  CG2   . THR B  2  58  ? -57.086  42.314  365.035 1.00 53.09  ? 58  THR 2 CG2   1 
ATOM   3887  N  N     . GLU B  2  59  ? -55.561  43.223  368.089 1.00 82.94  ? 59  GLU 2 N     1 
ATOM   3888  C  CA    . GLU B  2  59  ? -54.626  42.413  368.861 1.00 85.13  ? 59  GLU 2 CA    1 
ATOM   3889  C  C     . GLU B  2  59  ? -55.167  42.107  370.251 1.00 83.04  ? 59  GLU 2 C     1 
ATOM   3890  O  O     . GLU B  2  59  ? -55.021  40.982  370.741 1.00 86.87  ? 59  GLU 2 O     1 
ATOM   3891  C  CB    . GLU B  2  59  ? -53.271  43.110  368.954 1.00 90.00  ? 59  GLU 2 CB    1 
ATOM   3892  C  CG    . GLU B  2  59  ? -52.285  42.670  367.889 1.00 95.83  ? 59  GLU 2 CG    1 
ATOM   3893  C  CD    . GLU B  2  59  ? -52.064  41.172  367.883 1.00 98.71  ? 59  GLU 2 CD    1 
ATOM   3894  O  OE1   . GLU B  2  59  ? -51.987  40.568  368.972 1.00 100.98 ? 59  GLU 2 OE1   1 
ATOM   3895  O  OE2   . GLU B  2  59  ? -51.967  40.598  366.780 1.00 96.80  ? 59  GLU 2 OE2   1 
ATOM   3896  N  N     . VAL B  2  60  ? -55.790  43.090  370.905 1.00 74.06  ? 60  VAL 2 N     1 
ATOM   3897  C  CA    . VAL B  2  60  ? -56.298  42.860  372.255 1.00 69.31  ? 60  VAL 2 CA    1 
ATOM   3898  C  C     . VAL B  2  60  ? -57.448  41.863  372.227 1.00 70.32  ? 60  VAL 2 C     1 
ATOM   3899  O  O     . VAL B  2  60  ? -57.573  41.017  373.117 1.00 69.44  ? 60  VAL 2 O     1 
ATOM   3900  C  CB    . VAL B  2  60  ? -56.707  44.187  372.920 1.00 67.38  ? 60  VAL 2 CB    1 
ATOM   3901  C  CG1   . VAL B  2  60  ? -57.321  43.932  374.290 1.00 69.84  ? 60  VAL 2 CG1   1 
ATOM   3902  C  CG2   . VAL B  2  60  ? -55.512  45.084  373.059 1.00 65.25  ? 60  VAL 2 CG2   1 
ATOM   3903  N  N     . MET B  2  61  ? -58.306  41.946  371.209 1.00 73.30  ? 61  MET 2 N     1 
ATOM   3904  C  CA    . MET B  2  61  ? -59.400  40.988  371.088 1.00 76.56  ? 61  MET 2 CA    1 
ATOM   3905  C  C     . MET B  2  61  ? -58.870  39.582  370.836 1.00 76.12  ? 61  MET 2 C     1 
ATOM   3906  O  O     . MET B  2  61  ? -59.353  38.613  371.435 1.00 76.87  ? 61  MET 2 O     1 
ATOM   3907  C  CB    . MET B  2  61  ? -60.342  41.413  369.960 1.00 76.76  ? 61  MET 2 CB    1 
ATOM   3908  C  CG    . MET B  2  61  ? -61.428  40.407  369.632 1.00 75.36  ? 61  MET 2 CG    1 
ATOM   3909  S  SD    . MET B  2  61  ? -62.788  41.166  368.728 1.00 71.02  ? 61  MET 2 SD    1 
ATOM   3910  C  CE    . MET B  2  61  ? -62.104  41.196  367.076 1.00 68.75  ? 61  MET 2 CE    1 
ATOM   3911  N  N     . GLY B  2  62  ? -57.873  39.456  369.958 1.00 71.59  ? 62  GLY 2 N     1 
ATOM   3912  C  CA    . GLY B  2  62  ? -57.244  38.163  369.745 1.00 62.84  ? 62  GLY 2 CA    1 
ATOM   3913  C  C     . GLY B  2  62  ? -56.633  37.599  371.012 1.00 62.37  ? 62  GLY 2 C     1 
ATOM   3914  O  O     . GLY B  2  62  ? -56.771  36.408  371.302 1.00 59.89  ? 62  GLY 2 O     1 
ATOM   3915  N  N     . VAL B  2  63  ? -55.941  38.447  371.777 1.00 70.15  ? 63  VAL 2 N     1 
ATOM   3916  C  CA    . VAL B  2  63  ? -55.339  38.018  373.038 1.00 80.62  ? 63  VAL 2 CA    1 
ATOM   3917  C  C     . VAL B  2  63  ? -56.418  37.556  374.010 1.00 83.48  ? 63  VAL 2 C     1 
ATOM   3918  O  O     . VAL B  2  63  ? -56.326  36.475  374.603 1.00 82.93  ? 63  VAL 2 O     1 
ATOM   3919  C  CB    . VAL B  2  63  ? -54.490  39.155  373.638 1.00 84.08  ? 63  VAL 2 CB    1 
ATOM   3920  C  CG1   . VAL B  2  63  ? -54.133  38.860  375.090 1.00 88.97  ? 63  VAL 2 CG1   1 
ATOM   3921  C  CG2   . VAL B  2  63  ? -53.225  39.379  372.818 1.00 81.51  ? 63  VAL 2 CG2   1 
ATOM   3922  N  N     . ALA B  2  64  ? -57.458  38.372  374.185 1.00 84.57  ? 64  ALA 2 N     1 
ATOM   3923  C  CA    . ALA B  2  64  ? -58.485  38.076  375.175 1.00 86.46  ? 64  ALA 2 CA    1 
ATOM   3924  C  C     . ALA B  2  64  ? -59.259  36.815  374.815 1.00 93.58  ? 64  ALA 2 C     1 
ATOM   3925  O  O     . ALA B  2  64  ? -59.618  36.031  375.700 1.00 96.41  ? 64  ALA 2 O     1 
ATOM   3926  C  CB    . ALA B  2  64  ? -59.430  39.269  375.315 1.00 84.15  ? 64  ALA 2 CB    1 
ATOM   3927  N  N     . SER B  2  65  ? -59.518  36.594  373.525 1.00 97.22  ? 65  SER 2 N     1 
ATOM   3928  C  CA    . SER B  2  65  ? -60.270  35.424  373.086 1.00 98.67  ? 65  SER 2 CA    1 
ATOM   3929  C  C     . SER B  2  65  ? -59.425  34.159  373.057 1.00 96.30  ? 65  SER 2 C     1 
ATOM   3930  O  O     . SER B  2  65  ? -59.894  33.126  372.565 1.00 96.35  ? 65  SER 2 O     1 
ATOM   3931  C  CB    . SER B  2  65  ? -60.877  35.678  371.702 1.00 99.54  ? 65  SER 2 CB    1 
ATOM   3932  O  OG    . SER B  2  65  ? -59.958  36.352  370.858 1.00 100.33 ? 65  SER 2 OG    1 
ATOM   3933  N  N     . PHE B  2  66  ? -58.198  34.215  373.581 1.00 93.43  ? 66  PHE 2 N     1 
ATOM   3934  C  CA    . PHE B  2  66  ? -57.349  33.033  373.632 1.00 89.71  ? 66  PHE 2 CA    1 
ATOM   3935  C  C     . PHE B  2  66  ? -57.758  32.094  374.755 1.00 79.99  ? 66  PHE 2 C     1 
ATOM   3936  O  O     . PHE B  2  66  ? -57.608  30.875  374.624 1.00 76.08  ? 66  PHE 2 O     1 
ATOM   3937  C  CB    . PHE B  2  66  ? -55.884  33.444  373.807 1.00 95.45  ? 66  PHE 2 CB    1 
ATOM   3938  C  CG    . PHE B  2  66  ? -54.919  32.290  373.787 1.00 101.22 ? 66  PHE 2 CG    1 
ATOM   3939  C  CD1   . PHE B  2  66  ? -54.405  31.814  372.595 1.00 101.40 ? 66  PHE 2 CD1   1 
ATOM   3940  C  CD2   . PHE B  2  66  ? -54.534  31.673  374.964 1.00 103.93 ? 66  PHE 2 CD2   1 
ATOM   3941  C  CE1   . PHE B  2  66  ? -53.520  30.749  372.582 1.00 99.95  ? 66  PHE 2 CE1   1 
ATOM   3942  C  CE2   . PHE B  2  66  ? -53.654  30.608  374.953 1.00 104.18 ? 66  PHE 2 CE2   1 
ATOM   3943  C  CZ    . PHE B  2  66  ? -53.146  30.148  373.762 1.00 100.86 ? 66  PHE 2 CZ    1 
ATOM   3944  N  N     . TYR B  2  67  ? -58.288  32.631  375.846 1.00 135.41 ? 67  TYR 2 N     1 
ATOM   3945  C  CA    . TYR B  2  67  ? -58.508  31.879  377.070 1.00 129.23 ? 67  TYR 2 CA    1 
ATOM   3946  C  C     . TYR B  2  67  ? -59.995  31.645  377.309 1.00 124.08 ? 67  TYR 2 C     1 
ATOM   3947  O  O     . TYR B  2  67  ? -60.856  32.394  376.838 1.00 120.64 ? 67  TYR 2 O     1 
ATOM   3948  C  CB    . TYR B  2  67  ? -57.883  32.605  378.264 1.00 125.80 ? 67  TYR 2 CB    1 
ATOM   3949  C  CG    . TYR B  2  67  ? -56.445  33.020  378.026 1.00 124.06 ? 67  TYR 2 CG    1 
ATOM   3950  C  CD1   . TYR B  2  67  ? -55.399  32.174  378.357 1.00 122.22 ? 67  TYR 2 CD1   1 
ATOM   3951  C  CD2   . TYR B  2  67  ? -56.135  34.251  377.468 1.00 123.87 ? 67  TYR 2 CD2   1 
ATOM   3952  C  CE1   . TYR B  2  67  ? -54.083  32.540  378.143 1.00 118.43 ? 67  TYR 2 CE1   1 
ATOM   3953  C  CE2   . TYR B  2  67  ? -54.818  34.624  377.246 1.00 121.01 ? 67  TYR 2 CE2   1 
ATOM   3954  C  CZ    . TYR B  2  67  ? -53.798  33.764  377.586 1.00 118.18 ? 67  TYR 2 CZ    1 
ATOM   3955  O  OH    . TYR B  2  67  ? -52.488  34.126  377.371 1.00 115.79 ? 67  TYR 2 OH    1 
ATOM   3956  N  N     . SER B  2  68  ? -60.282  30.580  378.061 1.00 124.34 ? 68  SER 2 N     1 
ATOM   3957  C  CA    . SER B  2  68  ? -61.658  30.233  378.396 1.00 125.18 ? 68  SER 2 CA    1 
ATOM   3958  C  C     . SER B  2  68  ? -62.170  31.000  379.608 1.00 119.31 ? 68  SER 2 C     1 
ATOM   3959  O  O     . SER B  2  68  ? -63.384  31.181  379.754 1.00 118.28 ? 68  SER 2 O     1 
ATOM   3960  C  CB    . SER B  2  68  ? -61.765  28.726  378.648 1.00 129.47 ? 68  SER 2 CB    1 
ATOM   3961  O  OG    . SER B  2  68  ? -61.724  27.995  377.434 1.00 130.03 ? 68  SER 2 OG    1 
ATOM   3962  N  N     . TYR B  2  69  ? -61.270  31.446  380.487 1.00 115.10 ? 69  TYR 2 N     1 
ATOM   3963  C  CA    . TYR B  2  69  ? -61.693  32.123  381.708 1.00 120.41 ? 69  TYR 2 CA    1 
ATOM   3964  C  C     . TYR B  2  69  ? -62.387  33.446  381.390 1.00 120.60 ? 69  TYR 2 C     1 
ATOM   3965  O  O     . TYR B  2  69  ? -63.336  33.838  382.078 1.00 117.85 ? 69  TYR 2 O     1 
ATOM   3966  C  CB    . TYR B  2  69  ? -60.481  32.334  382.621 1.00 122.15 ? 69  TYR 2 CB    1 
ATOM   3967  C  CG    . TYR B  2  69  ? -60.814  32.838  384.007 1.00 120.86 ? 69  TYR 2 CG    1 
ATOM   3968  C  CD1   . TYR B  2  69  ? -61.141  31.948  385.019 1.00 118.76 ? 69  TYR 2 CD1   1 
ATOM   3969  C  CD2   . TYR B  2  69  ? -60.803  34.190  384.307 1.00 124.22 ? 69  TYR 2 CD2   1 
ATOM   3970  C  CE1   . TYR B  2  69  ? -61.445  32.383  386.289 1.00 120.91 ? 69  TYR 2 CE1   1 
ATOM   3971  C  CE2   . TYR B  2  69  ? -61.114  34.637  385.580 1.00 127.41 ? 69  TYR 2 CE2   1 
ATOM   3972  C  CZ    . TYR B  2  69  ? -61.431  33.730  386.567 1.00 126.25 ? 69  TYR 2 CZ    1 
ATOM   3973  O  OH    . TYR B  2  69  ? -61.738  34.167  387.837 1.00 127.44 ? 69  TYR 2 OH    1 
ATOM   3974  N  N     . TYR B  2  70  ? -61.934  34.139  380.345 1.00 122.26 ? 70  TYR 2 N     1 
ATOM   3975  C  CA    . TYR B  2  70  ? -62.511  35.413  379.932 1.00 122.31 ? 70  TYR 2 CA    1 
ATOM   3976  C  C     . TYR B  2  70  ? -63.818  35.176  379.180 1.00 126.62 ? 70  TYR 2 C     1 
ATOM   3977  O  O     . TYR B  2  70  ? -63.826  34.504  378.143 1.00 134.40 ? 70  TYR 2 O     1 
ATOM   3978  C  CB    . TYR B  2  70  ? -61.540  36.189  379.040 1.00 121.01 ? 70  TYR 2 CB    1 
ATOM   3979  C  CG    . TYR B  2  70  ? -60.327  36.765  379.740 1.00 122.99 ? 70  TYR 2 CG    1 
ATOM   3980  C  CD1   . TYR B  2  70  ? -60.417  37.275  381.024 1.00 128.38 ? 70  TYR 2 CD1   1 
ATOM   3981  C  CD2   . TYR B  2  70  ? -59.098  36.820  379.102 1.00 121.29 ? 70  TYR 2 CD2   1 
ATOM   3982  C  CE1   . TYR B  2  70  ? -59.310  37.811  381.659 1.00 130.19 ? 70  TYR 2 CE1   1 
ATOM   3983  C  CE2   . TYR B  2  70  ? -57.987  37.353  379.730 1.00 123.72 ? 70  TYR 2 CE2   1 
ATOM   3984  C  CZ    . TYR B  2  70  ? -58.099  37.846  381.007 1.00 128.62 ? 70  TYR 2 CZ    1 
ATOM   3985  O  OH    . TYR B  2  70  ? -56.993  38.378  381.632 1.00 131.29 ? 70  TYR 2 OH    1 
ATOM   3986  N  N     . GLN B  2  71  ? -64.917  35.726  379.689 1.00 122.88 ? 71  GLN 2 N     1 
ATOM   3987  C  CA    . GLN B  2  71  ? -66.202  35.645  379.008 1.00 124.37 ? 71  GLN 2 CA    1 
ATOM   3988  C  C     . GLN B  2  71  ? -66.490  36.927  378.241 1.00 127.72 ? 71  GLN 2 C     1 
ATOM   3989  O  O     . GLN B  2  71  ? -66.166  38.028  378.696 1.00 122.46 ? 71  GLN 2 O     1 
ATOM   3990  C  CB    . GLN B  2  71  ? -67.333  35.357  379.996 1.00 122.07 ? 71  GLN 2 CB    1 
ATOM   3991  C  CG    . GLN B  2  71  ? -67.222  33.990  380.627 1.00 118.10 ? 71  GLN 2 CG    1 
ATOM   3992  C  CD    . GLN B  2  71  ? -67.121  32.896  379.587 1.00 115.17 ? 71  GLN 2 CD    1 
ATOM   3993  O  OE1   . GLN B  2  71  ? -67.792  32.938  378.556 1.00 115.40 ? 71  GLN 2 OE1   1 
ATOM   3994  N  NE2   . GLN B  2  71  ? -66.254  31.925  379.835 1.00 115.17 ? 71  GLN 2 NE2   1 
ATOM   3995  N  N     . PHE B  2  72  ? -67.092  36.765  377.062 1.00 137.19 ? 72  PHE 2 N     1 
ATOM   3996  C  CA    . PHE B  2  72  ? -67.374  37.869  376.160 1.00 141.87 ? 72  PHE 2 CA    1 
ATOM   3997  C  C     . PHE B  2  72  ? -68.862  38.056  375.898 1.00 143.85 ? 72  PHE 2 C     1 
ATOM   3998  O  O     . PHE B  2  72  ? -69.234  38.953  375.132 1.00 139.49 ? 72  PHE 2 O     1 
ATOM   3999  C  CB    . PHE B  2  72  ? -66.632  37.654  374.835 1.00 140.01 ? 72  PHE 2 CB    1 
ATOM   4000  C  CG    . PHE B  2  72  ? -65.140  37.592  374.989 1.00 136.00 ? 72  PHE 2 CG    1 
ATOM   4001  C  CD1   . PHE B  2  72  ? -64.522  36.423  375.404 1.00 133.89 ? 72  PHE 2 CD1   1 
ATOM   4002  C  CD2   . PHE B  2  72  ? -64.358  38.706  374.750 1.00 135.04 ? 72  PHE 2 CD2   1 
ATOM   4003  C  CE1   . PHE B  2  72  ? -63.156  36.362  375.558 1.00 133.77 ? 72  PHE 2 CE1   1 
ATOM   4004  C  CE2   . PHE B  2  72  ? -62.989  38.648  374.905 1.00 135.63 ? 72  PHE 2 CE2   1 
ATOM   4005  C  CZ    . PHE B  2  72  ? -62.391  37.474  375.311 1.00 134.90 ? 72  PHE 2 CZ    1 
ATOM   4006  N  N     . VAL B  2  73  ? -69.717  37.237  376.503 1.00 148.52 ? 73  VAL 2 N     1 
ATOM   4007  C  CA    . VAL B  2  73  ? -71.169  37.380  376.418 1.00 150.97 ? 73  VAL 2 CA    1 
ATOM   4008  C  C     . VAL B  2  73  ? -71.702  37.483  377.842 1.00 149.91 ? 73  VAL 2 C     1 
ATOM   4009  O  O     . VAL B  2  73  ? -71.079  36.939  378.764 1.00 152.51 ? 73  VAL 2 O     1 
ATOM   4010  C  CB    . VAL B  2  73  ? -71.804  36.205  375.658 1.00 152.94 ? 73  VAL 2 CB    1 
ATOM   4011  C  CG1   . VAL B  2  73  ? -71.282  36.151  374.228 1.00 156.55 ? 73  VAL 2 CG1   1 
ATOM   4012  C  CG2   . VAL B  2  73  ? -71.535  34.895  376.382 1.00 151.08 ? 73  VAL 2 CG2   1 
ATOM   4013  N  N     . PRO B  2  74  ? -72.825  38.164  378.076 1.00 146.18 ? 74  PRO 2 N     1 
ATOM   4014  C  CA    . PRO B  2  74  ? -73.336  38.288  379.443 1.00 143.27 ? 74  PRO 2 CA    1 
ATOM   4015  C  C     . PRO B  2  74  ? -73.511  36.917  380.075 1.00 143.24 ? 74  PRO 2 C     1 
ATOM   4016  O  O     . PRO B  2  74  ? -73.967  35.970  379.432 1.00 140.90 ? 74  PRO 2 O     1 
ATOM   4017  C  CB    . PRO B  2  74  ? -74.681  38.994  379.255 1.00 141.43 ? 74  PRO 2 CB    1 
ATOM   4018  C  CG    . PRO B  2  74  ? -74.517  39.762  378.005 1.00 141.43 ? 74  PRO 2 CG    1 
ATOM   4019  C  CD    . PRO B  2  74  ? -73.676  38.885  377.120 1.00 143.23 ? 74  PRO 2 CD    1 
ATOM   4020  N  N     . THR B  2  75  ? -73.134  36.814  381.340 1.00 141.09 ? 75  THR 2 N     1 
ATOM   4021  C  CA    . THR B  2  75  ? -73.310  35.589  382.094 1.00 135.77 ? 75  THR 2 CA    1 
ATOM   4022  C  C     . THR B  2  75  ? -74.148  35.885  383.325 1.00 131.67 ? 75  THR 2 C     1 
ATOM   4023  O  O     . THR B  2  75  ? -74.201  37.022  383.804 1.00 129.47 ? 75  THR 2 O     1 
ATOM   4024  C  CB    . THR B  2  75  ? -71.962  34.971  382.507 1.00 130.60 ? 75  THR 2 CB    1 
ATOM   4025  O  OG1   . THR B  2  75  ? -72.181  33.650  383.017 1.00 132.68 ? 75  THR 2 OG1   1 
ATOM   4026  C  CG2   . THR B  2  75  ? -71.271  35.816  383.571 1.00 123.89 ? 75  THR 2 CG2   1 
ATOM   4027  N  N     . GLY B  2  76  ? -74.831  34.857  383.810 1.00 130.57 ? 76  GLY 2 N     1 
ATOM   4028  C  CA    . GLY B  2  76  ? -75.662  34.993  384.985 1.00 125.56 ? 76  GLY 2 CA    1 
ATOM   4029  C  C     . GLY B  2  76  ? -74.845  35.377  386.198 1.00 120.55 ? 76  GLY 2 C     1 
ATOM   4030  O  O     . GLY B  2  76  ? -73.618  35.486  386.118 1.00 119.87 ? 76  GLY 2 O     1 
ATOM   4031  N  N     . LYS B  2  77  ? -75.518  35.588  387.329 1.00 119.04 ? 77  LYS 2 N     1 
ATOM   4032  C  CA    . LYS B  2  77  ? -74.811  35.902  388.564 1.00 121.48 ? 77  LYS 2 CA    1 
ATOM   4033  C  C     . LYS B  2  77  ? -73.763  34.846  388.883 1.00 130.44 ? 77  LYS 2 C     1 
ATOM   4034  O  O     . LYS B  2  77  ? -72.725  35.159  389.479 1.00 131.56 ? 77  LYS 2 O     1 
ATOM   4035  C  CB    . LYS B  2  77  ? -75.817  36.025  389.712 1.00 116.60 ? 77  LYS 2 CB    1 
ATOM   4036  C  CG    . LYS B  2  77  ? -75.235  36.381  391.066 1.00 114.54 ? 77  LYS 2 CG    1 
ATOM   4037  C  CD    . LYS B  2  77  ? -76.220  37.226  391.867 1.00 119.51 ? 77  LYS 2 CD    1 
ATOM   4038  C  CE    . LYS B  2  77  ? -76.842  36.422  393.000 1.00 122.17 ? 77  LYS 2 CE    1 
ATOM   4039  N  NZ    . LYS B  2  77  ? -77.338  37.270  394.118 1.00 120.03 ? 77  LYS 2 NZ    1 
ATOM   4040  N  N     . TYR B  2  78  ? -74.010  33.598  388.488 1.00 108.43 ? 78  TYR 2 N     1 
ATOM   4041  C  CA    . TYR B  2  78  ? -73.113  32.482  388.775 1.00 107.43 ? 78  TYR 2 CA    1 
ATOM   4042  C  C     . TYR B  2  78  ? -72.743  31.773  387.478 1.00 109.32 ? 78  TYR 2 C     1 
ATOM   4043  O  O     . TYR B  2  78  ? -73.560  31.036  386.915 1.00 109.68 ? 78  TYR 2 O     1 
ATOM   4044  C  CB    . TYR B  2  78  ? -73.758  31.523  389.770 1.00 105.59 ? 78  TYR 2 CB    1 
ATOM   4045  C  CG    . TYR B  2  78  ? -74.148  32.234  391.042 1.00 101.77 ? 78  TYR 2 CG    1 
ATOM   4046  C  CD1   . TYR B  2  78  ? -73.182  32.658  391.939 1.00 97.62  ? 78  TYR 2 CD1   1 
ATOM   4047  C  CD2   . TYR B  2  78  ? -75.474  32.503  391.338 1.00 96.51  ? 78  TYR 2 CD2   1 
ATOM   4048  C  CE1   . TYR B  2  78  ? -73.523  33.323  393.100 1.00 91.80  ? 78  TYR 2 CE1   1 
ATOM   4049  C  CE2   . TYR B  2  78  ? -75.825  33.165  392.501 1.00 91.91  ? 78  TYR 2 CE2   1 
ATOM   4050  C  CZ    . TYR B  2  78  ? -74.844  33.573  393.378 1.00 89.56  ? 78  TYR 2 CZ    1 
ATOM   4051  O  OH    . TYR B  2  78  ? -75.176  34.232  394.539 1.00 86.50  ? 78  TYR 2 OH    1 
ATOM   4052  N  N     . HIS B  2  79  ? -71.513  31.990  387.012 1.00 109.98 ? 79  HIS 2 N     1 
ATOM   4053  C  CA    . HIS B  2  79  ? -71.023  31.378  385.776 1.00 112.43 ? 79  HIS 2 CA    1 
ATOM   4054  C  C     . HIS B  2  79  ? -70.316  30.089  386.172 1.00 113.07 ? 79  HIS 2 C     1 
ATOM   4055  O  O     . HIS B  2  79  ? -69.113  30.060  386.433 1.00 117.35 ? 79  HIS 2 O     1 
ATOM   4056  C  CB    . HIS B  2  79  ? -70.097  32.334  385.035 1.00 114.59 ? 79  HIS 2 CB    1 
ATOM   4057  C  CG    . HIS B  2  79  ? -69.768  31.905  383.640 1.00 116.49 ? 79  HIS 2 CG    1 
ATOM   4058  N  ND1   . HIS B  2  79  ? -70.730  31.736  382.666 1.00 118.50 ? 79  HIS 2 ND1   1 
ATOM   4059  C  CD2   . HIS B  2  79  ? -68.583  31.618  383.053 1.00 119.06 ? 79  HIS 2 CD2   1 
ATOM   4060  C  CE1   . HIS B  2  79  ? -70.151  31.358  381.541 1.00 117.40 ? 79  HIS 2 CE1   1 
ATOM   4061  N  NE2   . HIS B  2  79  ? -68.848  31.279  381.749 1.00 118.52 ? 79  HIS 2 NE2   1 
ATOM   4062  N  N     . LEU B  2  80  ? -71.073  29.000  386.185 1.00 104.71 ? 80  LEU 2 N     1 
ATOM   4063  C  CA    . LEU B  2  80  ? -70.627  27.755  386.796 1.00 96.18  ? 80  LEU 2 CA    1 
ATOM   4064  C  C     . LEU B  2  80  ? -69.649  27.021  385.886 1.00 96.20  ? 80  LEU 2 C     1 
ATOM   4065  O  O     . LEU B  2  80  ? -70.009  26.619  384.775 1.00 97.20  ? 80  LEU 2 O     1 
ATOM   4066  C  CB    . LEU B  2  80  ? -71.837  26.883  387.115 1.00 96.20  ? 80  LEU 2 CB    1 
ATOM   4067  C  CG    . LEU B  2  80  ? -72.920  27.646  387.883 1.00 97.13  ? 80  LEU 2 CG    1 
ATOM   4068  C  CD1   . LEU B  2  80  ? -74.192  26.825  388.021 1.00 101.15 ? 80  LEU 2 CD1   1 
ATOM   4069  C  CD2   . LEU B  2  80  ? -72.403  28.074  389.248 1.00 94.85  ? 80  LEU 2 CD2   1 
ATOM   4070  N  N     . GLN B  2  81  ? -68.418  26.845  386.359 1.00 98.79  ? 81  GLN 2 N     1 
ATOM   4071  C  CA    . GLN B  2  81  ? -67.375  26.146  385.627 1.00 102.55 ? 81  GLN 2 CA    1 
ATOM   4072  C  C     . GLN B  2  81  ? -67.336  24.713  386.133 1.00 98.49  ? 81  GLN 2 C     1 
ATOM   4073  O  O     . GLN B  2  81  ? -67.023  24.475  387.308 1.00 96.22  ? 81  GLN 2 O     1 
ATOM   4074  C  CB    . GLN B  2  81  ? -66.014  26.811  385.826 1.00 106.36 ? 81  GLN 2 CB    1 
ATOM   4075  C  CG    . GLN B  2  81  ? -66.004  28.320  385.707 1.00 106.61 ? 81  GLN 2 CG    1 
ATOM   4076  C  CD    . GLN B  2  81  ? -64.601  28.884  385.773 1.00 107.11 ? 81  GLN 2 CD    1 
ATOM   4077  O  OE1   . GLN B  2  81  ? -63.711  28.455  385.038 1.00 107.90 ? 81  GLN 2 OE1   1 
ATOM   4078  N  NE2   . GLN B  2  81  ? -64.393  29.843  386.663 1.00 106.88 ? 81  GLN 2 NE2   1 
ATOM   4079  N  N     . VAL B  2  82  ? -67.650  23.772  385.249 1.00 98.26  ? 82  VAL 2 N     1 
ATOM   4080  C  CA    . VAL B  2  82  ? -67.727  22.356  385.580 1.00 99.73  ? 82  VAL 2 CA    1 
ATOM   4081  C  C     . VAL B  2  82  ? -66.502  21.676  384.993 1.00 100.74 ? 82  VAL 2 C     1 
ATOM   4082  O  O     . VAL B  2  82  ? -66.247  21.770  383.785 1.00 98.34  ? 82  VAL 2 O     1 
ATOM   4083  C  CB    . VAL B  2  82  ? -69.018  21.722  385.041 1.00 99.46  ? 82  VAL 2 CB    1 
ATOM   4084  C  CG1   . VAL B  2  82  ? -69.094  20.250  385.426 1.00 100.38 ? 82  VAL 2 CG1   1 
ATOM   4085  C  CG2   . VAL B  2  82  ? -70.233  22.486  385.549 1.00 96.95  ? 82  VAL 2 CG2   1 
ATOM   4086  N  N     . CYS B  2  83  ? -65.735  21.005  385.844 1.00 103.22 ? 83  CYS 2 N     1 
ATOM   4087  C  CA    . CYS B  2  83  ? -64.633  20.201  385.345 1.00 104.99 ? 83  CYS 2 CA    1 
ATOM   4088  C  C     . CYS B  2  83  ? -65.182  18.955  384.668 1.00 108.15 ? 83  CYS 2 C     1 
ATOM   4089  O  O     . CYS B  2  83  ? -65.993  18.224  385.246 1.00 108.88 ? 83  CYS 2 O     1 
ATOM   4090  C  CB    . CYS B  2  83  ? -63.688  19.816  386.478 1.00 103.01 ? 83  CYS 2 CB    1 
ATOM   4091  S  SG    . CYS B  2  83  ? -62.229  18.925  385.914 1.00 102.03 ? 83  CYS 2 SG    1 
ATOM   4092  N  N     . ALA B  2  84  ? -64.738  18.719  383.438 1.00 108.38 ? 84  ALA 2 N     1 
ATOM   4093  C  CA    . ALA B  2  84  ? -65.140  17.558  382.657 1.00 107.42 ? 84  ALA 2 CA    1 
ATOM   4094  C  C     . ALA B  2  84  ? -63.948  16.664  382.355 1.00 98.48  ? 84  ALA 2 C     1 
ATOM   4095  O  O     . ALA B  2  84  ? -64.065  15.736  381.547 1.00 98.35  ? 84  ALA 2 O     1 
ATOM   4096  C  CB    . ALA B  2  84  ? -65.819  17.998  381.357 1.00 112.72 ? 84  ALA 2 CB    1 
ATOM   4097  N  N     . THR B  2  85  ? -62.810  16.923  382.991 1.00 92.39  ? 85  THR 2 N     1 
ATOM   4098  C  CA    . THR B  2  85  ? -61.565  16.227  382.717 1.00 93.60  ? 85  THR 2 CA    1 
ATOM   4099  C  C     . THR B  2  85  ? -61.664  14.763  383.155 1.00 95.03  ? 85  THR 2 C     1 
ATOM   4100  O  O     . THR B  2  85  ? -62.678  14.307  383.688 1.00 96.95  ? 85  THR 2 O     1 
ATOM   4101  C  CB    . THR B  2  85  ? -60.414  16.950  383.412 1.00 93.91  ? 85  THR 2 CB    1 
ATOM   4102  O  OG1   . THR B  2  85  ? -60.664  18.357  383.371 1.00 90.99  ? 85  THR 2 OG1   1 
ATOM   4103  C  CG2   . THR B  2  85  ? -59.101  16.699  382.692 1.00 96.44  ? 85  THR 2 CG2   1 
ATOM   4104  N  N     . LEU B  2  86  ? -60.579  14.022  382.914 1.00 96.49  ? 86  LEU 2 N     1 
ATOM   4105  C  CA    . LEU B  2  86  ? -60.536  12.583  383.155 1.00 101.25 ? 86  LEU 2 CA    1 
ATOM   4106  C  C     . LEU B  2  86  ? -60.973  12.209  384.568 1.00 105.35 ? 86  LEU 2 C     1 
ATOM   4107  O  O     . LEU B  2  86  ? -61.969  11.501  384.757 1.00 104.42 ? 86  LEU 2 O     1 
ATOM   4108  C  CB    . LEU B  2  86  ? -59.121  12.067  382.891 1.00 105.04 ? 86  LEU 2 CB    1 
ATOM   4109  C  CG    . LEU B  2  86  ? -58.915  10.588  383.207 1.00 112.55 ? 86  LEU 2 CG    1 
ATOM   4110  C  CD1   . LEU B  2  86  ? -59.605  9.718   382.173 1.00 119.03 ? 86  LEU 2 CD1   1 
ATOM   4111  C  CD2   . LEU B  2  86  ? -57.434  10.256  383.306 1.00 111.39 ? 86  LEU 2 CD2   1 
ATOM   4112  N  N     . SER B  2  87  ? -60.219  12.658  385.574 1.00 109.85 ? 87  SER 2 N     1 
ATOM   4113  C  CA    . SER B  2  87  ? -60.423  12.172  386.938 1.00 113.29 ? 87  SER 2 CA    1 
ATOM   4114  C  C     . SER B  2  87  ? -61.818  12.510  387.446 1.00 114.02 ? 87  SER 2 C     1 
ATOM   4115  O  O     . SER B  2  87  ? -62.502  11.661  388.028 1.00 111.51 ? 87  SER 2 O     1 
ATOM   4116  C  CB    . SER B  2  87  ? -59.351  12.746  387.862 1.00 114.11 ? 87  SER 2 CB    1 
ATOM   4117  O  OG    . SER B  2  87  ? -58.072  12.228  387.539 1.00 115.77 ? 87  SER 2 OG    1 
ATOM   4118  N  N     . CYS B  2  88  ? -62.250  13.757  387.253 1.00 118.93 ? 88  CYS 2 N     1 
ATOM   4119  C  CA    . CYS B  2  88  ? -63.582  14.154  387.698 1.00 123.92 ? 88  CYS 2 CA    1 
ATOM   4120  C  C     . CYS B  2  88  ? -64.662  13.347  386.989 1.00 123.13 ? 88  CYS 2 C     1 
ATOM   4121  O  O     . CYS B  2  88  ? -65.691  13.011  387.585 1.00 121.82 ? 88  CYS 2 O     1 
ATOM   4122  C  CB    . CYS B  2  88  ? -63.778  15.652  387.471 1.00 127.15 ? 88  CYS 2 CB    1 
ATOM   4123  S  SG    . CYS B  2  88  ? -63.082  16.682  388.776 1.00 129.34 ? 88  CYS 2 SG    1 
ATOM   4124  N  N     . LYS B  2  89  ? -64.447  13.036  385.710 1.00 119.76 ? 89  LYS 2 N     1 
ATOM   4125  C  CA    . LYS B  2  89  ? -65.337  12.118  385.009 1.00 110.11 ? 89  LYS 2 CA    1 
ATOM   4126  C  C     . LYS B  2  89  ? -65.374  10.764  385.700 1.00 101.89 ? 89  LYS 2 C     1 
ATOM   4127  O  O     . LYS B  2  89  ? -66.445  10.169  385.868 1.00 98.15  ? 89  LYS 2 O     1 
ATOM   4128  C  CB    . LYS B  2  89  ? -64.887  11.966  383.558 1.00 107.03 ? 89  LYS 2 CB    1 
ATOM   4129  C  CG    . LYS B  2  89  ? -65.535  10.821  382.818 1.00 106.74 ? 89  LYS 2 CG    1 
ATOM   4130  C  CD    . LYS B  2  89  ? -64.820  10.570  381.506 1.00 110.35 ? 89  LYS 2 CD    1 
ATOM   4131  C  CE    . LYS B  2  89  ? -65.794  10.536  380.352 1.00 115.15 ? 89  LYS 2 CE    1 
ATOM   4132  N  NZ    . LYS B  2  89  ? -65.210  11.045  379.089 1.00 117.62 ? 89  LYS 2 NZ    1 
ATOM   4133  N  N     . LEU B  2  90  ? -64.208  10.262  386.107 1.00 99.96  ? 90  LEU 2 N     1 
ATOM   4134  C  CA    . LEU B  2  90  ? -64.139  9.022   386.868 1.00 100.29 ? 90  LEU 2 CA    1 
ATOM   4135  C  C     . LEU B  2  90  ? -64.836  9.145   388.213 1.00 102.15 ? 90  LEU 2 C     1 
ATOM   4136  O  O     . LEU B  2  90  ? -65.092  8.125   388.862 1.00 98.24  ? 90  LEU 2 O     1 
ATOM   4137  C  CB    . LEU B  2  90  ? -62.679  8.612   387.050 1.00 100.87 ? 90  LEU 2 CB    1 
ATOM   4138  C  CG    . LEU B  2  90  ? -62.181  7.615   386.005 1.00 103.12 ? 90  LEU 2 CG    1 
ATOM   4139  C  CD1   . LEU B  2  90  ? -62.083  8.267   384.641 1.00 103.14 ? 90  LEU 2 CD1   1 
ATOM   4140  C  CD2   . LEU B  2  90  ? -60.842  7.069   386.417 1.00 104.84 ? 90  LEU 2 CD2   1 
ATOM   4141  N  N     . ALA B  2  91  ? -65.130  10.367  388.644 1.00 109.47 ? 91  ALA 2 N     1 
ATOM   4142  C  CA    . ALA B  2  91  ? -66.008  10.634  389.768 1.00 117.37 ? 91  ALA 2 CA    1 
ATOM   4143  C  C     . ALA B  2  91  ? -67.416  10.987  389.312 1.00 124.79 ? 91  ALA 2 C     1 
ATOM   4144  O  O     . ALA B  2  91  ? -68.218  11.453  390.125 1.00 127.22 ? 91  ALA 2 O     1 
ATOM   4145  C  CB    . ALA B  2  91  ? -65.442  11.761  390.632 1.00 115.60 ? 91  ALA 2 CB    1 
ATOM   4146  N  N     . GLY B  2  92  ? -67.720  10.810  388.030 1.00 126.28 ? 92  GLY 2 N     1 
ATOM   4147  C  CA    . GLY B  2  92  ? -69.055  11.031  387.521 1.00 123.92 ? 92  GLY 2 CA    1 
ATOM   4148  C  C     . GLY B  2  92  ? -69.327  12.397  386.930 1.00 119.53 ? 92  GLY 2 C     1 
ATOM   4149  O  O     . GLY B  2  92  ? -70.500  12.758  386.784 1.00 118.27 ? 92  GLY 2 O     1 
ATOM   4150  N  N     . ALA B  2  93  ? -68.288  13.167  386.593 1.00 116.50 ? 93  ALA 2 N     1 
ATOM   4151  C  CA    . ALA B  2  93  ? -68.496  14.529  386.107 1.00 119.93 ? 93  ALA 2 CA    1 
ATOM   4152  C  C     . ALA B  2  93  ? -69.389  14.573  384.875 1.00 121.73 ? 93  ALA 2 C     1 
ATOM   4153  O  O     . ALA B  2  93  ? -70.089  15.566  384.661 1.00 123.03 ? 93  ALA 2 O     1 
ATOM   4154  C  CB    . ALA B  2  93  ? -67.156  15.199  385.805 1.00 121.18 ? 93  ALA 2 CB    1 
ATOM   4155  N  N     . GLU B  2  94  ? -69.353  13.539  384.034 1.00 121.32 ? 94  GLU 2 N     1 
ATOM   4156  C  CA    . GLU B  2  94  ? -70.260  13.501  382.891 1.00 121.63 ? 94  GLU 2 CA    1 
ATOM   4157  C  C     . GLU B  2  94  ? -71.709  13.442  383.355 1.00 114.11 ? 94  GLU 2 C     1 
ATOM   4158  O  O     . GLU B  2  94  ? -72.562  14.196  382.871 1.00 117.85 ? 94  GLU 2 O     1 
ATOM   4159  C  CB    . GLU B  2  94  ? -69.920  12.318  381.987 1.00 129.82 ? 94  GLU 2 CB    1 
ATOM   4160  C  CG    . GLU B  2  94  ? -68.582  12.463  381.290 1.00 137.46 ? 94  GLU 2 CG    1 
ATOM   4161  C  CD    . GLU B  2  94  ? -68.438  13.793  380.577 1.00 141.92 ? 94  GLU 2 CD    1 
ATOM   4162  O  OE1   . GLU B  2  94  ? -69.383  14.205  379.872 1.00 143.84 ? 94  GLU 2 OE1   1 
ATOM   4163  O  OE2   . GLU B  2  94  ? -67.378  14.434  380.728 1.00 141.96 ? 94  GLU 2 OE2   1 
ATOM   4164  N  N     . GLU B  2  95  ? -72.008  12.529  384.283 1.00 103.28 ? 95  GLU 2 N     1 
ATOM   4165  C  CA    . GLU B  2  95  ? -73.347  12.457  384.855 1.00 96.18  ? 95  GLU 2 CA    1 
ATOM   4166  C  C     . GLU B  2  95  ? -73.695  13.756  385.565 1.00 94.38  ? 95  GLU 2 C     1 
ATOM   4167  O  O     . GLU B  2  95  ? -74.846  14.204  385.534 1.00 87.96  ? 95  GLU 2 O     1 
ATOM   4168  C  CB    . GLU B  2  95  ? -73.453  11.269  385.810 1.00 98.60  ? 95  GLU 2 CB    1 
ATOM   4169  C  CG    . GLU B  2  95  ? -73.273  9.918   385.134 1.00 100.51 ? 95  GLU 2 CG    1 
ATOM   4170  C  CD    . GLU B  2  95  ? -73.395  8.759   386.101 1.00 100.16 ? 95  GLU 2 CD    1 
ATOM   4171  O  OE1   . GLU B  2  95  ? -72.716  8.777   387.148 1.00 98.37  ? 95  GLU 2 OE1   1 
ATOM   4172  O  OE2   . GLU B  2  95  ? -74.173  7.826   385.814 1.00 100.43 ? 95  GLU 2 OE2   1 
ATOM   4173  N  N     . LEU B  2  96  ? -72.707  14.368  386.222 1.00 98.78  ? 96  LEU 2 N     1 
ATOM   4174  C  CA    . LEU B  2  96  ? -72.921  15.648  386.888 1.00 103.57 ? 96  LEU 2 CA    1 
ATOM   4175  C  C     . LEU B  2  96  ? -73.363  16.710  385.893 1.00 101.96 ? 96  LEU 2 C     1 
ATOM   4176  O  O     . LEU B  2  96  ? -74.333  17.437  386.129 1.00 100.64 ? 96  LEU 2 O     1 
ATOM   4177  C  CB    . LEU B  2  96  ? -71.632  16.078  387.592 1.00 106.08 ? 96  LEU 2 CB    1 
ATOM   4178  C  CG    . LEU B  2  96  ? -71.463  17.565  387.914 1.00 108.11 ? 96  LEU 2 CG    1 
ATOM   4179  C  CD1   . LEU B  2  96  ? -72.520  18.054  388.891 1.00 110.46 ? 96  LEU 2 CD1   1 
ATOM   4180  C  CD2   . LEU B  2  96  ? -70.057  17.852  388.434 1.00 109.31 ? 96  LEU 2 CD2   1 
ATOM   4181  N  N     . TRP B  2  97  ? -72.649  16.816  384.772 1.00 100.05 ? 97  TRP 2 N     1 
ATOM   4182  C  CA    . TRP B  2  97  ? -72.979  17.811  383.759 1.00 100.35 ? 97  TRP 2 CA    1 
ATOM   4183  C  C     . TRP B  2  97  ? -74.346  17.533  383.151 1.00 99.67  ? 97  TRP 2 C     1 
ATOM   4184  O  O     . TRP B  2  97  ? -75.150  18.454  382.967 1.00 99.17  ? 97  TRP 2 O     1 
ATOM   4185  C  CB    . TRP B  2  97  ? -71.895  17.830  382.681 1.00 103.67 ? 97  TRP 2 CB    1 
ATOM   4186  C  CG    . TRP B  2  97  ? -72.167  18.775  381.550 1.00 108.02 ? 97  TRP 2 CG    1 
ATOM   4187  C  CD1   . TRP B  2  97  ? -72.670  18.464  380.321 1.00 107.47 ? 97  TRP 2 CD1   1 
ATOM   4188  C  CD2   . TRP B  2  97  ? -71.943  20.190  381.545 1.00 111.74 ? 97  TRP 2 CD2   1 
ATOM   4189  N  NE1   . TRP B  2  97  ? -72.775  19.598  379.552 1.00 109.52 ? 97  TRP 2 NE1   1 
ATOM   4190  C  CE2   . TRP B  2  97  ? -72.336  20.671  380.283 1.00 111.88 ? 97  TRP 2 CE2   1 
ATOM   4191  C  CE3   . TRP B  2  97  ? -71.451  21.096  382.487 1.00 111.05 ? 97  TRP 2 CE3   1 
ATOM   4192  C  CZ2   . TRP B  2  97  ? -72.253  22.017  379.939 1.00 111.96 ? 97  TRP 2 CZ2   1 
ATOM   4193  C  CZ3   . TRP B  2  97  ? -71.369  22.431  382.144 1.00 109.55 ? 97  TRP 2 CZ3   1 
ATOM   4194  C  CH2   . TRP B  2  97  ? -71.767  22.879  380.883 1.00 110.41 ? 97  TRP 2 CH2   1 
ATOM   4195  N  N     . ASP B  2  98  ? -74.627  16.263  382.841 1.00 100.43 ? 98  ASP 2 N     1 
ATOM   4196  C  CA    . ASP B  2  98  ? -75.927  15.898  382.286 1.00 98.63  ? 98  ASP 2 CA    1 
ATOM   4197  C  C     . ASP B  2  98  ? -77.061  16.275  383.231 1.00 99.05  ? 98  ASP 2 C     1 
ATOM   4198  O  O     . ASP B  2  98  ? -78.032  16.918  382.819 1.00 95.52  ? 98  ASP 2 O     1 
ATOM   4199  C  CB    . ASP B  2  98  ? -75.972  14.400  381.977 1.00 96.60  ? 98  ASP 2 CB    1 
ATOM   4200  C  CG    . ASP B  2  98  ? -75.092  14.014  380.805 1.00 95.03  ? 98  ASP 2 CG    1 
ATOM   4201  O  OD1   . ASP B  2  98  ? -75.213  14.640  379.733 1.00 94.31  ? 98  ASP 2 OD1   1 
ATOM   4202  O  OD2   . ASP B  2  98  ? -74.284  13.075  380.949 1.00 96.02  ? 98  ASP 2 OD2   1 
ATOM   4203  N  N     . TYR B  2  99  ? -76.958  15.885  384.505 1.00 106.62 ? 99  TYR 2 N     1 
ATOM   4204  C  CA    . TYR B  2  99  ? -78.019  16.199  385.457 1.00 117.38 ? 99  TYR 2 CA    1 
ATOM   4205  C  C     . TYR B  2  99  ? -78.163  17.701  385.656 1.00 113.50 ? 99  TYR 2 C     1 
ATOM   4206  O  O     . TYR B  2  99  ? -79.282  18.224  385.713 1.00 114.89 ? 99  TYR 2 O     1 
ATOM   4207  C  CB    . TYR B  2  99  ? -77.777  15.533  386.809 1.00 131.14 ? 99  TYR 2 CB    1 
ATOM   4208  C  CG    . TYR B  2  99  ? -78.717  16.118  387.839 1.00 140.91 ? 99  TYR 2 CG    1 
ATOM   4209  C  CD1   . TYR B  2  99  ? -80.077  15.852  387.783 1.00 143.73 ? 99  TYR 2 CD1   1 
ATOM   4210  C  CD2   . TYR B  2  99  ? -78.263  16.992  388.817 1.00 143.76 ? 99  TYR 2 CD2   1 
ATOM   4211  C  CE1   . TYR B  2  99  ? -80.953  16.402  388.695 1.00 144.90 ? 99  TYR 2 CE1   1 
ATOM   4212  C  CE2   . TYR B  2  99  ? -79.136  17.552  389.734 1.00 145.21 ? 99  TYR 2 CE2   1 
ATOM   4213  C  CZ    . TYR B  2  99  ? -80.479  17.252  389.667 1.00 146.89 ? 99  TYR 2 CZ    1 
ATOM   4214  O  OH    . TYR B  2  99  ? -81.356  17.802  390.576 1.00 150.30 ? 99  TYR 2 OH    1 
ATOM   4215  N  N     . LEU B  2  100 ? -77.043  18.400  385.853 1.00 108.86 ? 100 LEU 2 N     1 
ATOM   4216  C  CA    . LEU B  2  100 ? -77.102  19.836  386.095 1.00 107.27 ? 100 LEU 2 CA    1 
ATOM   4217  C  C     . LEU B  2  100 ? -77.769  20.548  384.927 1.00 110.97 ? 100 LEU 2 C     1 
ATOM   4218  O  O     . LEU B  2  100 ? -78.661  21.383  385.120 1.00 107.80 ? 100 LEU 2 O     1 
ATOM   4219  C  CB    . LEU B  2  100 ? -75.700  20.386  386.343 1.00 101.31 ? 100 LEU 2 CB    1 
ATOM   4220  C  CG    . LEU B  2  100 ? -75.676  21.854  386.762 1.00 95.37  ? 100 LEU 2 CG    1 
ATOM   4221  C  CD1   . LEU B  2  100 ? -76.293  22.003  388.138 1.00 94.93  ? 100 LEU 2 CD1   1 
ATOM   4222  C  CD2   . LEU B  2  100 ? -74.260  22.403  386.741 1.00 91.87  ? 100 LEU 2 CD2   1 
ATOM   4223  N  N     . THR B  2  101 ? -77.350  20.221  383.702 1.00 115.61 ? 101 THR 2 N     1 
ATOM   4224  C  CA    . THR B  2  101 ? -77.966  20.826  382.528 1.00 115.53 ? 101 THR 2 CA    1 
ATOM   4225  C  C     . THR B  2  101 ? -79.442  20.453  382.440 1.00 113.47 ? 101 THR 2 C     1 
ATOM   4226  O  O     . THR B  2  101 ? -80.277  21.290  382.088 1.00 112.65 ? 101 THR 2 O     1 
ATOM   4227  C  CB    . THR B  2  101 ? -77.215  20.397  381.267 1.00 115.16 ? 101 THR 2 CB    1 
ATOM   4228  O  OG1   . THR B  2  101 ? -75.832  20.743  381.397 1.00 115.52 ? 101 THR 2 OG1   1 
ATOM   4229  C  CG2   . THR B  2  101 ? -77.769  21.107  380.049 1.00 114.23 ? 101 THR 2 CG2   1 
ATOM   4230  N  N     . GLU B  2  102 ? -79.787  19.206  382.780 1.00 111.08 ? 102 GLU 2 N     1 
ATOM   4231  C  CA    . GLU B  2  102 ? -81.168  18.755  382.646 1.00 107.10 ? 102 GLU 2 CA    1 
ATOM   4232  C  C     . GLU B  2  102 ? -82.084  19.462  383.633 1.00 104.73 ? 102 GLU 2 C     1 
ATOM   4233  O  O     . GLU B  2  102 ? -83.231  19.786  383.303 1.00 106.36 ? 102 GLU 2 O     1 
ATOM   4234  C  CB    . GLU B  2  102 ? -81.241  17.243  382.846 1.00 107.29 ? 102 GLU 2 CB    1 
ATOM   4235  C  CG    . GLU B  2  102 ? -82.488  16.602  382.279 1.00 109.86 ? 102 GLU 2 CG    1 
ATOM   4236  C  CD    . GLU B  2  102 ? -82.887  15.357  383.037 1.00 113.02 ? 102 GLU 2 CD    1 
ATOM   4237  O  OE1   . GLU B  2  102 ? -82.300  15.102  384.108 1.00 114.48 ? 102 GLU 2 OE1   1 
ATOM   4238  O  OE2   . GLU B  2  102 ? -83.791  14.638  382.566 1.00 114.64 ? 102 GLU 2 OE2   1 
ATOM   4239  N  N     . THR B  2  103 ? -81.595  19.706  384.847 1.00 100.19 ? 103 THR 2 N     1 
ATOM   4240  C  CA    . THR B  2  103 ? -82.346  20.505  385.809 1.00 95.69  ? 103 THR 2 CA    1 
ATOM   4241  C  C     . THR B  2  103 ? -82.453  21.949  385.341 1.00 91.58  ? 103 THR 2 C     1 
ATOM   4242  O  O     . THR B  2  103 ? -83.536  22.545  385.366 1.00 88.47  ? 103 THR 2 O     1 
ATOM   4243  C  CB    . THR B  2  103 ? -81.682  20.433  387.188 1.00 92.12  ? 103 THR 2 CB    1 
ATOM   4244  O  OG1   . THR B  2  103 ? -81.937  19.155  387.781 1.00 87.96  ? 103 THR 2 OG1   1 
ATOM   4245  C  CG2   . THR B  2  103 ? -82.210  21.527  388.107 1.00 93.48  ? 103 THR 2 CG2   1 
ATOM   4246  N  N     . LEU B  2  104 ? -81.335  22.520  384.895 1.00 89.66  ? 104 LEU 2 N     1 
ATOM   4247  C  CA    . LEU B  2  104 ? -81.316  23.915  384.477 1.00 87.51  ? 104 LEU 2 CA    1 
ATOM   4248  C  C     . LEU B  2  104 ? -81.856  24.105  383.063 1.00 88.09  ? 104 LEU 2 C     1 
ATOM   4249  O  O     . LEU B  2  104 ? -82.523  25.107  382.784 1.00 87.59  ? 104 LEU 2 O     1 
ATOM   4250  C  CB    . LEU B  2  104 ? -79.894  24.457  384.591 1.00 86.87  ? 104 LEU 2 CB    1 
ATOM   4251  C  CG    . LEU B  2  104 ? -79.242  24.324  385.967 1.00 90.61  ? 104 LEU 2 CG    1 
ATOM   4252  C  CD1   . LEU B  2  104 ? -77.790  24.771  385.925 1.00 86.99  ? 104 LEU 2 CD1   1 
ATOM   4253  C  CD2   . LEU B  2  104 ? -80.028  25.119  386.996 1.00 94.27  ? 104 LEU 2 CD2   1 
ATOM   4254  N  N     . GLY B  2  105 ? -81.582  23.166  382.161 1.00 88.80  ? 105 GLY 2 N     1 
ATOM   4255  C  CA    . GLY B  2  105 ? -82.026  23.298  380.784 1.00 85.88  ? 105 GLY 2 CA    1 
ATOM   4256  C  C     . GLY B  2  105 ? -81.326  24.397  380.021 1.00 85.74  ? 105 GLY 2 C     1 
ATOM   4257  O  O     . GLY B  2  105 ? -81.941  25.035  379.163 1.00 85.73  ? 105 GLY 2 O     1 
ATOM   4258  N  N     . ILE B  2  106 ? -80.046  24.627  380.301 1.00 97.23  ? 106 ILE 2 N     1 
ATOM   4259  C  CA    . ILE B  2  106 ? -79.292  25.732  379.724 1.00 98.91  ? 106 ILE 2 CA    1 
ATOM   4260  C  C     . ILE B  2  106 ? -78.090  25.176  378.976 1.00 99.74  ? 106 ILE 2 C     1 
ATOM   4261  O  O     . ILE B  2  106 ? -77.463  24.209  379.421 1.00 96.03  ? 106 ILE 2 O     1 
ATOM   4262  C  CB    . ILE B  2  106 ? -78.827  26.724  380.808 1.00 95.45  ? 106 ILE 2 CB    1 
ATOM   4263  C  CG1   . ILE B  2  106 ? -79.805  26.747  381.972 1.00 97.07  ? 106 ILE 2 CG1   1 
ATOM   4264  C  CG2   . ILE B  2  106 ? -78.718  28.123  380.244 1.00 89.94  ? 106 ILE 2 CG2   1 
ATOM   4265  C  CD1   . ILE B  2  106 ? -79.290  27.536  383.147 1.00 98.19  ? 106 ILE 2 CD1   1 
ATOM   4266  N  N     . GLY B  2  107 ? -77.751  25.807  377.855 1.00 100.30 ? 107 GLY 2 N     1 
ATOM   4267  C  CA    . GLY B  2  107 ? -76.528  25.505  377.153 1.00 95.96  ? 107 GLY 2 CA    1 
ATOM   4268  C  C     . GLY B  2  107 ? -75.378  26.310  377.720 1.00 94.65  ? 107 GLY 2 C     1 
ATOM   4269  O  O     . GLY B  2  107 ? -75.571  27.210  378.542 1.00 94.55  ? 107 GLY 2 O     1 
ATOM   4270  N  N     . PRO B  2  108 ? -74.153  26.001  377.288 1.00 96.33  ? 108 PRO 2 N     1 
ATOM   4271  C  CA    . PRO B  2  108 ? -72.980  26.696  377.853 1.00 94.14  ? 108 PRO 2 CA    1 
ATOM   4272  C  C     . PRO B  2  108 ? -72.998  28.201  377.646 1.00 91.10  ? 108 PRO 2 C     1 
ATOM   4273  O  O     . PRO B  2  108 ? -72.431  28.938  378.462 1.00 90.94  ? 108 PRO 2 O     1 
ATOM   4274  C  CB    . PRO B  2  108 ? -71.788  26.050  377.132 1.00 89.42  ? 108 PRO 2 CB    1 
ATOM   4275  C  CG    . PRO B  2  108 ? -72.316  24.873  376.398 1.00 84.33  ? 108 PRO 2 CG    1 
ATOM   4276  C  CD    . PRO B  2  108 ? -73.801  24.911  376.363 1.00 84.50  ? 108 PRO 2 CD    1 
ATOM   4277  N  N     . GLY B  2  109 ? -73.634  28.686  376.587 1.00 87.99  ? 109 GLY 2 N     1 
ATOM   4278  C  CA    . GLY B  2  109 ? -73.580  30.100  376.285 1.00 87.69  ? 109 GLY 2 CA    1 
ATOM   4279  C  C     . GLY B  2  109 ? -74.645  30.919  376.975 1.00 84.79  ? 109 GLY 2 C     1 
ATOM   4280  O  O     . GLY B  2  109 ? -74.451  32.111  377.226 1.00 84.82  ? 109 GLY 2 O     1 
ATOM   4281  N  N     . GLU B  2  110 ? -75.762  30.293  377.307 1.00 84.94  ? 110 GLU 2 N     1 
ATOM   4282  C  CA    . GLU B  2  110 ? -76.924  31.022  377.778 1.00 95.47  ? 110 GLU 2 CA    1 
ATOM   4283  C  C     . GLU B  2  110 ? -76.968  31.054  379.304 1.00 96.09  ? 110 GLU 2 C     1 
ATOM   4284  O  O     . GLU B  2  110 ? -76.035  30.629  379.995 1.00 88.66  ? 110 GLU 2 O     1 
ATOM   4285  C  CB    . GLU B  2  110 ? -78.199  30.421  377.189 1.00 96.70  ? 110 GLU 2 CB    1 
ATOM   4286  C  CG    . GLU B  2  110 ? -78.106  28.943  376.940 1.00 97.65  ? 110 GLU 2 CG    1 
ATOM   4287  C  CD    . GLU B  2  110 ? -79.429  28.348  376.536 1.00 97.67  ? 110 GLU 2 CD    1 
ATOM   4288  O  OE1   . GLU B  2  110 ? -80.421  29.100  376.433 1.00 98.41  ? 110 GLU 2 OE1   1 
ATOM   4289  O  OE2   . GLU B  2  110 ? -79.474  27.123  376.330 1.00 97.19  ? 110 GLU 2 OE2   1 
ATOM   4290  N  N     . VAL B  2  111 ? -78.079  31.560  379.834 1.00 102.38 ? 111 VAL 2 N     1 
ATOM   4291  C  CA    . VAL B  2  111 ? -78.263  31.839  381.250 1.00 102.96 ? 111 VAL 2 CA    1 
ATOM   4292  C  C     . VAL B  2  111 ? -79.635  31.314  381.647 1.00 114.05 ? 111 VAL 2 C     1 
ATOM   4293  O  O     . VAL B  2  111 ? -80.554  31.253  380.825 1.00 119.16 ? 111 VAL 2 O     1 
ATOM   4294  C  CB    . VAL B  2  111 ? -78.139  33.357  381.545 1.00 91.08  ? 111 VAL 2 CB    1 
ATOM   4295  C  CG1   . VAL B  2  111 ? -79.085  34.154  380.654 1.00 86.99  ? 111 VAL 2 CG1   1 
ATOM   4296  C  CG2   . VAL B  2  111 ? -78.383  33.670  383.015 1.00 86.43  ? 111 VAL 2 CG2   1 
ATOM   4297  N  N     . THR B  2  112 ? -79.758  30.894  382.907 1.00 118.91 ? 112 THR 2 N     1 
ATOM   4298  C  CA    . THR B  2  112 ? -81.048  30.489  383.447 1.00 124.02 ? 112 THR 2 CA    1 
ATOM   4299  C  C     . THR B  2  112 ? -82.052  31.613  383.221 1.00 117.85 ? 112 THR 2 C     1 
ATOM   4300  O  O     . THR B  2  112 ? -81.666  32.789  383.165 1.00 109.97 ? 112 THR 2 O     1 
ATOM   4301  C  CB    . THR B  2  112 ? -80.913  30.131  384.937 1.00 131.79 ? 112 THR 2 CB    1 
ATOM   4302  O  OG1   . THR B  2  112 ? -81.974  29.254  385.336 1.00 136.83 ? 112 THR 2 OG1   1 
ATOM   4303  C  CG2   . THR B  2  112 ? -80.929  31.368  385.816 1.00 131.49 ? 112 THR 2 CG2   1 
ATOM   4304  N  N     . PRO B  2  113 ? -83.340  31.301  383.052 1.00 120.87 ? 113 PRO 2 N     1 
ATOM   4305  C  CA    . PRO B  2  113 ? -84.331  32.381  382.940 1.00 123.76 ? 113 PRO 2 CA    1 
ATOM   4306  C  C     . PRO B  2  113 ? -84.472  33.176  384.221 1.00 129.60 ? 113 PRO 2 C     1 
ATOM   4307  O  O     . PRO B  2  113 ? -84.891  34.339  384.168 1.00 130.77 ? 113 PRO 2 O     1 
ATOM   4308  C  CB    . PRO B  2  113 ? -85.632  31.651  382.571 1.00 122.33 ? 113 PRO 2 CB    1 
ATOM   4309  C  CG    . PRO B  2  113 ? -85.308  30.187  382.517 1.00 121.20 ? 113 PRO 2 CG    1 
ATOM   4310  C  CD    . PRO B  2  113 ? -83.950  29.961  383.068 1.00 121.36 ? 113 PRO 2 CD    1 
ATOM   4311  N  N     . ASP B  2  114 ? -84.124  32.587  385.368 1.00 133.54 ? 114 ASP 2 N     1 
ATOM   4312  C  CA    . ASP B  2  114 ? -84.102  33.330  386.622 1.00 134.19 ? 114 ASP 2 CA    1 
ATOM   4313  C  C     . ASP B  2  114 ? -83.100  34.478  386.569 1.00 130.82 ? 114 ASP 2 C     1 
ATOM   4314  O  O     . ASP B  2  114 ? -83.269  35.485  387.266 1.00 130.16 ? 114 ASP 2 O     1 
ATOM   4315  C  CB    . ASP B  2  114 ? -83.778  32.381  387.776 1.00 136.89 ? 114 ASP 2 CB    1 
ATOM   4316  C  CG    . ASP B  2  114 ? -84.583  31.090  387.717 1.00 140.58 ? 114 ASP 2 CG    1 
ATOM   4317  O  OD1   . ASP B  2  114 ? -85.828  31.162  387.644 1.00 141.86 ? 114 ASP 2 OD1   1 
ATOM   4318  O  OD2   . ASP B  2  114 ? -83.971  30.002  387.742 1.00 141.94 ? 114 ASP 2 OD2   1 
ATOM   4319  N  N     . GLY B  2  115 ? -82.054  34.343  385.759 1.00 128.32 ? 115 GLY 2 N     1 
ATOM   4320  C  CA    . GLY B  2  115 ? -81.090  35.401  385.551 1.00 126.16 ? 115 GLY 2 CA    1 
ATOM   4321  C  C     . GLY B  2  115 ? -79.812  35.319  386.354 1.00 122.96 ? 115 GLY 2 C     1 
ATOM   4322  O  O     . GLY B  2  115 ? -79.046  36.290  386.353 1.00 125.48 ? 115 GLY 2 O     1 
ATOM   4323  N  N     . LEU B  2  116 ? -79.557  34.207  387.046 1.00 115.84 ? 116 LEU 2 N     1 
ATOM   4324  C  CA    . LEU B  2  116 ? -78.367  34.101  387.877 1.00 107.91 ? 116 LEU 2 CA    1 
ATOM   4325  C  C     . LEU B  2  116 ? -77.533  32.846  387.652 1.00 103.14 ? 116 LEU 2 C     1 
ATOM   4326  O  O     . LEU B  2  116 ? -76.547  32.651  388.370 1.00 98.58  ? 116 LEU 2 O     1 
ATOM   4327  C  CB    . LEU B  2  116 ? -78.751  34.177  389.364 1.00 103.42 ? 116 LEU 2 CB    1 
ATOM   4328  C  CG    . LEU B  2  116 ? -79.739  33.148  389.915 1.00 100.14 ? 116 LEU 2 CG    1 
ATOM   4329  C  CD1   . LEU B  2  116 ? -79.384  32.798  391.348 1.00 98.29  ? 116 LEU 2 CD1   1 
ATOM   4330  C  CD2   . LEU B  2  116 ? -81.161  33.671  389.834 1.00 99.55  ? 116 LEU 2 CD2   1 
ATOM   4331  N  N     . PHE B  2  117 ? -77.877  32.001  386.684 1.00 104.15 ? 117 PHE 2 N     1 
ATOM   4332  C  CA    . PHE B  2  117 ? -77.186  30.730  386.492 1.00 108.60 ? 117 PHE 2 CA    1 
ATOM   4333  C  C     . PHE B  2  117 ? -76.799  30.542  385.034 1.00 103.80 ? 117 PHE 2 C     1 
ATOM   4334  O  O     . PHE B  2  117 ? -77.668  30.493  384.157 1.00 100.42 ? 117 PHE 2 O     1 
ATOM   4335  C  CB    . PHE B  2  117 ? -78.047  29.562  386.974 1.00 119.73 ? 117 PHE 2 CB    1 
ATOM   4336  C  CG    . PHE B  2  117 ? -78.191  29.505  388.463 1.00 132.17 ? 117 PHE 2 CG    1 
ATOM   4337  C  CD1   . PHE B  2  117 ? -77.088  29.682  389.281 1.00 137.56 ? 117 PHE 2 CD1   1 
ATOM   4338  C  CD2   . PHE B  2  117 ? -79.426  29.298  389.050 1.00 137.51 ? 117 PHE 2 CD2   1 
ATOM   4339  C  CE1   . PHE B  2  117 ? -77.210  29.637  390.655 1.00 141.10 ? 117 PHE 2 CE1   1 
ATOM   4340  C  CE2   . PHE B  2  117 ? -79.554  29.255  390.425 1.00 142.07 ? 117 PHE 2 CE2   1 
ATOM   4341  C  CZ    . PHE B  2  117 ? -78.444  29.425  391.227 1.00 142.90 ? 117 PHE 2 CZ    1 
ATOM   4342  N  N     . SER B  2  118 ? -75.499  30.427  384.783 1.00 103.15 ? 118 SER 2 N     1 
ATOM   4343  C  CA    . SER B  2  118 ? -74.982  29.992  383.498 1.00 102.54 ? 118 SER 2 CA    1 
ATOM   4344  C  C     . SER B  2  118 ? -73.990  28.863  383.731 1.00 104.67 ? 118 SER 2 C     1 
ATOM   4345  O  O     . SER B  2  118 ? -73.453  28.695  384.829 1.00 104.32 ? 118 SER 2 O     1 
ATOM   4346  C  CB    . SER B  2  118 ? -74.320  31.140  382.727 1.00 101.44 ? 118 SER 2 CB    1 
ATOM   4347  O  OG    . SER B  2  118 ? -75.200  32.243  382.610 1.00 105.28 ? 118 SER 2 OG    1 
ATOM   4348  N  N     . VAL B  2  119 ? -73.746  28.090  382.678 1.00 104.94 ? 119 VAL 2 N     1 
ATOM   4349  C  CA    . VAL B  2  119 ? -72.935  26.885  382.767 1.00 101.99 ? 119 VAL 2 CA    1 
ATOM   4350  C  C     . VAL B  2  119 ? -71.773  27.018  381.797 1.00 100.62 ? 119 VAL 2 C     1 
ATOM   4351  O  O     . VAL B  2  119 ? -71.843  27.761  380.813 1.00 100.89 ? 119 VAL 2 O     1 
ATOM   4352  C  CB    . VAL B  2  119 ? -73.752  25.607  382.472 1.00 99.74  ? 119 VAL 2 CB    1 
ATOM   4353  C  CG1   . VAL B  2  119 ? -74.668  25.277  383.642 1.00 99.27  ? 119 VAL 2 CG1   1 
ATOM   4354  C  CG2   . VAL B  2  119 ? -74.553  25.765  381.190 1.00 98.82  ? 119 VAL 2 CG2   1 
ATOM   4355  N  N     . GLN B  2  120 ? -70.696  26.295  382.086 1.00 97.62  ? 120 GLN 2 N     1 
ATOM   4356  C  CA    . GLN B  2  120 ? -69.504  26.344  381.254 1.00 92.02  ? 120 GLN 2 CA    1 
ATOM   4357  C  C     . GLN B  2  120 ? -68.610  25.172  381.615 1.00 88.15  ? 120 GLN 2 C     1 
ATOM   4358  O  O     . GLN B  2  120 ? -68.402  24.891  382.797 1.00 89.67  ? 120 GLN 2 O     1 
ATOM   4359  C  CB    . GLN B  2  120 ? -68.750  27.663  381.457 1.00 92.87  ? 120 GLN 2 CB    1 
ATOM   4360  C  CG    . GLN B  2  120 ? -67.422  27.751  380.738 1.00 93.32  ? 120 GLN 2 CG    1 
ATOM   4361  C  CD    . GLN B  2  120 ? -66.699  29.043  381.039 1.00 94.17  ? 120 GLN 2 CD    1 
ATOM   4362  O  OE1   . GLN B  2  120 ? -67.185  30.123  380.715 1.00 98.80  ? 120 GLN 2 OE1   1 
ATOM   4363  N  NE2   . GLN B  2  120 ? -65.531  28.942  381.659 1.00 90.39  ? 120 GLN 2 NE2   1 
ATOM   4364  N  N     . LYS B  2  121 ? -68.086  24.494  380.602 1.00 84.19  ? 121 LYS 2 N     1 
ATOM   4365  C  CA    . LYS B  2  121 ? -67.155  23.412  380.860 1.00 89.53  ? 121 LYS 2 CA    1 
ATOM   4366  C  C     . LYS B  2  121 ? -65.732  23.948  380.901 1.00 91.53  ? 121 LYS 2 C     1 
ATOM   4367  O  O     . LYS B  2  121 ? -65.398  24.939  380.247 1.00 94.05  ? 121 LYS 2 O     1 
ATOM   4368  C  CB    . LYS B  2  121 ? -67.261  22.314  379.801 1.00 96.04  ? 121 LYS 2 CB    1 
ATOM   4369  C  CG    . LYS B  2  121 ? -67.949  21.055  380.303 1.00 103.12 ? 121 LYS 2 CG    1 
ATOM   4370  C  CD    . LYS B  2  121 ? -68.049  19.991  379.224 1.00 109.62 ? 121 LYS 2 CD    1 
ATOM   4371  C  CE    . LYS B  2  121 ? -68.943  20.415  378.082 1.00 117.69 ? 121 LYS 2 CE    1 
ATOM   4372  N  NZ    . LYS B  2  121 ? -69.134  19.291  377.124 1.00 123.17 ? 121 LYS 2 NZ    1 
ATOM   4373  N  N     . VAL B  2  122 ? -64.892  23.267  381.677 1.00 95.55  ? 122 VAL 2 N     1 
ATOM   4374  C  CA    . VAL B  2  122 ? -63.510  23.671  381.897 1.00 104.58 ? 122 VAL 2 CA    1 
ATOM   4375  C  C     . VAL B  2  122 ? -62.691  22.397  382.023 1.00 115.95 ? 122 VAL 2 C     1 
ATOM   4376  O  O     . VAL B  2  122 ? -63.212  21.339  382.387 1.00 117.36 ? 122 VAL 2 O     1 
ATOM   4377  C  CB    . VAL B  2  122 ? -63.375  24.573  383.157 1.00 106.67 ? 122 VAL 2 CB    1 
ATOM   4378  C  CG1   . VAL B  2  122 ? -61.919  24.823  383.533 1.00 105.94 ? 122 VAL 2 CG1   1 
ATOM   4379  C  CG2   . VAL B  2  122 ? -64.082  25.905  382.954 1.00 110.19 ? 122 VAL 2 CG2   1 
ATOM   4380  N  N     . GLU B  2  123 ? -61.409  22.490  381.696 1.00 125.87 ? 123 GLU 2 N     1 
ATOM   4381  C  CA    . GLU B  2  123 ? -60.499  21.369  381.872 1.00 137.43 ? 123 GLU 2 CA    1 
ATOM   4382  C  C     . GLU B  2  123 ? -60.056  21.295  383.331 1.00 142.06 ? 123 GLU 2 C     1 
ATOM   4383  O  O     . GLU B  2  123 ? -60.633  21.934  384.216 1.00 145.22 ? 123 GLU 2 O     1 
ATOM   4384  C  CB    . GLU B  2  123 ? -59.341  21.486  380.887 1.00 142.73 ? 123 GLU 2 CB    1 
ATOM   4385  C  CG    . GLU B  2  123 ? -59.826  21.523  379.457 1.00 147.54 ? 123 GLU 2 CG    1 
ATOM   4386  C  CD    . GLU B  2  123 ? -60.903  20.484  379.197 1.00 153.07 ? 123 GLU 2 CD    1 
ATOM   4387  O  OE1   . GLU B  2  123 ? -60.660  19.288  379.461 1.00 154.27 ? 123 GLU 2 OE1   1 
ATOM   4388  O  OE2   . GLU B  2  123 ? -62.003  20.863  378.751 1.00 155.62 ? 123 GLU 2 OE2   1 
ATOM   4389  N  N     . CYS B  2  124 ? -59.031  20.485  383.591 1.00 141.02 ? 124 CYS 2 N     1 
ATOM   4390  C  CA    . CYS B  2  124 ? -58.644  20.102  384.945 1.00 138.17 ? 124 CYS 2 CA    1 
ATOM   4391  C  C     . CYS B  2  124 ? -58.475  21.307  385.858 1.00 131.54 ? 124 CYS 2 C     1 
ATOM   4392  O  O     . CYS B  2  124 ? -57.636  22.176  385.609 1.00 131.33 ? 124 CYS 2 O     1 
ATOM   4393  C  CB    . CYS B  2  124 ? -57.352  19.288  384.898 1.00 142.50 ? 124 CYS 2 CB    1 
ATOM   4394  S  SG    . CYS B  2  124 ? -56.881  18.604  386.485 1.00 147.61 ? 124 CYS 2 SG    1 
ATOM   4395  N  N     . LEU B  2  125 ? -59.278  21.348  386.920 1.00 125.98 ? 125 LEU 2 N     1 
ATOM   4396  C  CA    . LEU B  2  125 ? -59.242  22.426  387.897 1.00 121.51 ? 125 LEU 2 CA    1 
ATOM   4397  C  C     . LEU B  2  125 ? -58.193  22.207  388.982 1.00 121.43 ? 125 LEU 2 C     1 
ATOM   4398  O  O     . LEU B  2  125 ? -58.215  22.908  389.999 1.00 124.09 ? 125 LEU 2 O     1 
ATOM   4399  C  CB    . LEU B  2  125 ? -60.625  22.604  388.531 1.00 117.02 ? 125 LEU 2 CB    1 
ATOM   4400  C  CG    . LEU B  2  125 ? -61.688  23.214  387.617 1.00 114.35 ? 125 LEU 2 CG    1 
ATOM   4401  C  CD1   . LEU B  2  125 ? -63.051  23.237  388.291 1.00 110.39 ? 125 LEU 2 CD1   1 
ATOM   4402  C  CD2   . LEU B  2  125 ? -61.275  24.615  387.201 1.00 118.11 ? 125 LEU 2 CD2   1 
ATOM   4403  N  N     . GLY B  2  126 ? -57.287  21.253  388.792 1.00 117.01 ? 126 GLY 2 N     1 
ATOM   4404  C  CA    . GLY B  2  126 ? -56.180  21.068  389.710 1.00 114.71 ? 126 GLY 2 CA    1 
ATOM   4405  C  C     . GLY B  2  126 ? -56.551  20.606  391.098 1.00 115.89 ? 126 GLY 2 C     1 
ATOM   4406  O  O     . GLY B  2  126 ? -55.782  20.827  392.036 1.00 115.28 ? 126 GLY 2 O     1 
ATOM   4407  N  N     . SER B  2  127 ? -57.722  19.991  391.267 1.00 118.89 ? 127 SER 2 N     1 
ATOM   4408  C  CA    . SER B  2  127 ? -58.097  19.333  392.522 1.00 121.24 ? 127 SER 2 CA    1 
ATOM   4409  C  C     . SER B  2  127 ? -58.825  18.046  392.139 1.00 121.15 ? 127 SER 2 C     1 
ATOM   4410  O  O     . SER B  2  127 ? -60.052  18.028  392.025 1.00 124.45 ? 127 SER 2 O     1 
ATOM   4411  C  CB    . SER B  2  127 ? -58.956  20.235  393.401 1.00 121.89 ? 127 SER 2 CB    1 
ATOM   4412  O  OG    . SER B  2  127 ? -60.159  20.604  392.751 1.00 121.55 ? 127 SER 2 OG    1 
ATOM   4413  N  N     . CYS B  2  128 ? -58.068  16.966  391.963 1.00 116.00 ? 128 CYS 2 N     1 
ATOM   4414  C  CA    . CYS B  2  128 ? -58.648  15.722  391.472 1.00 108.63 ? 128 CYS 2 CA    1 
ATOM   4415  C  C     . CYS B  2  128 ? -59.076  14.795  392.602 1.00 108.79 ? 128 CYS 2 C     1 
ATOM   4416  O  O     . CYS B  2  128 ? -60.089  14.098  392.483 1.00 101.68 ? 128 CYS 2 O     1 
ATOM   4417  C  CB    . CYS B  2  128 ? -57.653  15.002  390.558 1.00 100.86 ? 128 CYS 2 CB    1 
ATOM   4418  S  SG    . CYS B  2  128 ? -56.944  16.026  389.260 1.00 92.72  ? 128 CYS 2 SG    1 
ATOM   4419  N  N     . HIS B  2  129 ? -58.318  14.781  393.700 1.00 118.92 ? 129 HIS 2 N     1 
ATOM   4420  C  CA    . HIS B  2  129 ? -58.617  13.922  394.838 1.00 125.12 ? 129 HIS 2 CA    1 
ATOM   4421  C  C     . HIS B  2  129 ? -59.928  14.280  395.523 1.00 130.19 ? 129 HIS 2 C     1 
ATOM   4422  O  O     . HIS B  2  129 ? -60.495  13.436  396.224 1.00 135.01 ? 129 HIS 2 O     1 
ATOM   4423  C  CB    . HIS B  2  129 ? -57.476  14.001  395.851 1.00 125.12 ? 129 HIS 2 CB    1 
ATOM   4424  C  CG    . HIS B  2  129 ? -57.115  15.402  396.236 1.00 120.96 ? 129 HIS 2 CG    1 
ATOM   4425  N  ND1   . HIS B  2  129 ? -56.477  16.265  395.370 1.00 121.22 ? 129 HIS 2 ND1   1 
ATOM   4426  C  CD2   . HIS B  2  129 ? -57.323  16.099  397.378 1.00 122.81 ? 129 HIS 2 CD2   1 
ATOM   4427  C  CE1   . HIS B  2  129 ? -56.292  17.426  395.969 1.00 119.40 ? 129 HIS 2 CE1   1 
ATOM   4428  N  NE2   . HIS B  2  129 ? -56.799  17.354  397.187 1.00 121.34 ? 129 HIS 2 NE2   1 
ATOM   4429  N  N     . THR B  2  130 ? -60.425  15.500  395.334 1.00 126.10 ? 130 THR 2 N     1 
ATOM   4430  C  CA    . THR B  2  130 ? -61.708  15.921  395.881 1.00 122.63 ? 130 THR 2 CA    1 
ATOM   4431  C  C     . THR B  2  130 ? -62.764  16.062  394.788 1.00 120.61 ? 130 THR 2 C     1 
ATOM   4432  O  O     . THR B  2  130 ? -63.706  16.846  394.917 1.00 114.79 ? 130 THR 2 O     1 
ATOM   4433  C  CB    . THR B  2  130 ? -61.552  17.228  396.653 1.00 123.86 ? 130 THR 2 CB    1 
ATOM   4434  O  OG1   . THR B  2  130 ? -60.792  18.160  395.875 1.00 122.66 ? 130 THR 2 OG1   1 
ATOM   4435  C  CG2   . THR B  2  130 ? -60.839  16.992  397.979 1.00 126.55 ? 130 THR 2 CG2   1 
ATOM   4436  N  N     . ALA B  2  131 ? -62.603  15.309  393.703 1.00 128.55 ? 131 ALA 2 N     1 
ATOM   4437  C  CA    . ALA B  2  131 ? -63.535  15.356  392.588 1.00 138.11 ? 131 ALA 2 CA    1 
ATOM   4438  C  C     . ALA B  2  131 ? -64.938  14.949  393.041 1.00 146.11 ? 131 ALA 2 C     1 
ATOM   4439  O  O     . ALA B  2  131 ? -65.090  14.201  394.011 1.00 152.32 ? 131 ALA 2 O     1 
ATOM   4440  C  CB    . ALA B  2  131 ? -63.058  14.428  391.471 1.00 138.25 ? 131 ALA 2 CB    1 
ATOM   4441  N  N     . PRO B  2  132 ? -65.992  15.444  392.366 1.00 144.53 ? 132 PRO 2 N     1 
ATOM   4442  C  CA    . PRO B  2  132 ? -65.913  16.405  391.261 1.00 137.47 ? 132 PRO 2 CA    1 
ATOM   4443  C  C     . PRO B  2  132 ? -65.687  17.830  391.752 1.00 126.45 ? 132 PRO 2 C     1 
ATOM   4444  O  O     . PRO B  2  132 ? -65.713  18.072  392.958 1.00 132.30 ? 132 PRO 2 O     1 
ATOM   4445  C  CB    . PRO B  2  132 ? -67.273  16.262  390.575 1.00 140.92 ? 132 PRO 2 CB    1 
ATOM   4446  C  CG    . PRO B  2  132 ? -68.180  15.834  391.648 1.00 143.10 ? 132 PRO 2 CG    1 
ATOM   4447  C  CD    . PRO B  2  132 ? -67.372  14.974  392.580 1.00 145.20 ? 132 PRO 2 CD    1 
ATOM   4448  N  N     . VAL B  2  133 ? -65.461  18.757  390.827 1.00 99.44  ? 133 VAL 2 N     1 
ATOM   4449  C  CA    . VAL B  2  133 ? -65.104  20.125  391.170 1.00 85.49  ? 133 VAL 2 CA    1 
ATOM   4450  C  C     . VAL B  2  133 ? -66.008  21.084  390.409 1.00 80.47  ? 133 VAL 2 C     1 
ATOM   4451  O  O     . VAL B  2  133 ? -66.491  20.778  389.316 1.00 77.38  ? 133 VAL 2 O     1 
ATOM   4452  C  CB    . VAL B  2  133 ? -63.618  20.418  390.860 1.00 85.28  ? 133 VAL 2 CB    1 
ATOM   4453  C  CG1   . VAL B  2  133 ? -63.161  21.660  391.578 1.00 87.63  ? 133 VAL 2 CG1   1 
ATOM   4454  C  CG2   . VAL B  2  133 ? -62.752  19.243  391.253 1.00 84.33  ? 133 VAL 2 CG2   1 
ATOM   4455  N  N     . ILE B  2  134 ? -66.230  22.256  390.999 1.00 81.86  ? 134 ILE 2 N     1 
ATOM   4456  C  CA    . ILE B  2  134 ? -66.984  23.338  390.373 1.00 81.96  ? 134 ILE 2 CA    1 
ATOM   4457  C  C     . ILE B  2  134 ? -66.387  24.654  390.849 1.00 82.28  ? 134 ILE 2 C     1 
ATOM   4458  O  O     . ILE B  2  134 ? -66.073  24.816  392.030 1.00 82.46  ? 134 ILE 2 O     1 
ATOM   4459  C  CB    . ILE B  2  134 ? -68.496  23.252  390.688 1.00 77.86  ? 134 ILE 2 CB    1 
ATOM   4460  C  CG1   . ILE B  2  134 ? -69.192  22.309  389.706 1.00 77.34  ? 134 ILE 2 CG1   1 
ATOM   4461  C  CG2   . ILE B  2  134 ? -69.147  24.625  390.653 1.00 79.23  ? 134 ILE 2 CG2   1 
ATOM   4462  C  CD1   . ILE B  2  134 ? -70.687  22.198  389.907 1.00 77.31  ? 134 ILE 2 CD1   1 
ATOM   4463  N  N     . GLN B  2  135 ? -66.222  25.592  389.920 1.00 84.06  ? 135 GLN 2 N     1 
ATOM   4464  C  CA    . GLN B  2  135 ? -65.655  26.898  390.227 1.00 88.73  ? 135 GLN 2 CA    1 
ATOM   4465  C  C     . GLN B  2  135 ? -66.632  27.993  389.818 1.00 94.33  ? 135 GLN 2 C     1 
ATOM   4466  O  O     . GLN B  2  135 ? -67.278  27.896  388.771 1.00 95.03  ? 135 GLN 2 O     1 
ATOM   4467  C  CB    . GLN B  2  135 ? -64.314  27.074  389.505 1.00 87.39  ? 135 GLN 2 CB    1 
ATOM   4468  C  CG    . GLN B  2  135 ? -63.674  28.439  389.636 1.00 83.80  ? 135 GLN 2 CG    1 
ATOM   4469  C  CD    . GLN B  2  135 ? -62.360  28.520  388.887 1.00 84.98  ? 135 GLN 2 CD    1 
ATOM   4470  O  OE1   . GLN B  2  135 ? -62.304  28.286  387.680 1.00 87.37  ? 135 GLN 2 OE1   1 
ATOM   4471  N  NE2   . GLN B  2  135 ? -61.292  28.841  389.603 1.00 84.46  ? 135 GLN 2 NE2   1 
ATOM   4472  N  N     . VAL B  2  136 ? -66.772  29.024  390.646 1.00 98.20  ? 136 VAL 2 N     1 
ATOM   4473  C  CA    . VAL B  2  136 ? -67.646  30.150  390.316 1.00 102.47 ? 136 VAL 2 CA    1 
ATOM   4474  C  C     . VAL B  2  136 ? -66.797  31.417  390.314 1.00 111.12 ? 136 VAL 2 C     1 
ATOM   4475  O  O     . VAL B  2  136 ? -66.703  32.138  391.311 1.00 116.17 ? 136 VAL 2 O     1 
ATOM   4476  C  CB    . VAL B  2  136 ? -68.831  30.267  391.278 1.00 94.90  ? 136 VAL 2 CB    1 
ATOM   4477  C  CG1   . VAL B  2  136 ? -69.772  31.380  390.834 1.00 93.27  ? 136 VAL 2 CG1   1 
ATOM   4478  C  CG2   . VAL B  2  136 ? -69.573  28.941  391.376 1.00 90.55  ? 136 VAL 2 CG2   1 
ATOM   4479  N  N     . ASN B  2  137 ? -66.150  31.679  389.179 1.00 111.37 ? 137 ASN 2 N     1 
ATOM   4480  C  CA    . ASN B  2  137 ? -65.709  32.983  388.689 1.00 110.85 ? 137 ASN 2 CA    1 
ATOM   4481  C  C     . ASN B  2  137 ? -64.621  33.677  389.502 1.00 111.37 ? 137 ASN 2 C     1 
ATOM   4482  O  O     . ASN B  2  137 ? -63.866  34.483  388.950 1.00 106.38 ? 137 ASN 2 O     1 
ATOM   4483  C  CB    . ASN B  2  137 ? -66.911  33.932  388.626 1.00 110.38 ? 137 ASN 2 CB    1 
ATOM   4484  C  CG    . ASN B  2  137 ? -68.083  33.343  387.876 1.00 112.95 ? 137 ASN 2 CG    1 
ATOM   4485  O  OD1   . ASN B  2  137 ? -68.151  32.137  387.668 1.00 112.74 ? 137 ASN 2 OD1   1 
ATOM   4486  N  ND2   . ASN B  2  137 ? -69.032  34.191  387.494 1.00 116.57 ? 137 ASN 2 ND2   1 
ATOM   4487  N  N     . ASP B  2  138 ? -64.510  33.382  390.796 1.00 116.88 ? 138 ASP 2 N     1 
ATOM   4488  C  CA    . ASP B  2  138 ? -63.375  33.873  391.568 1.00 119.87 ? 138 ASP 2 CA    1 
ATOM   4489  C  C     . ASP B  2  138 ? -63.076  32.999  392.778 1.00 123.99 ? 138 ASP 2 C     1 
ATOM   4490  O  O     . ASP B  2  138 ? -62.128  33.270  393.521 1.00 126.79 ? 138 ASP 2 O     1 
ATOM   4491  C  CB    . ASP B  2  138 ? -63.630  35.313  392.018 1.00 119.59 ? 138 ASP 2 CB    1 
ATOM   4492  C  CG    . ASP B  2  138 ? -64.763  35.416  393.018 1.00 123.76 ? 138 ASP 2 CG    1 
ATOM   4493  O  OD1   . ASP B  2  138 ? -65.923  35.144  392.648 1.00 125.95 ? 138 ASP 2 OD1   1 
ATOM   4494  O  OD2   . ASP B  2  138 ? -64.490  35.774  394.181 1.00 126.47 ? 138 ASP 2 OD2   1 
ATOM   4495  N  N     . GLU B  2  139 ? -63.861  31.960  392.996 1.00 122.14 ? 139 GLU 2 N     1 
ATOM   4496  C  CA    . GLU B  2  139 ? -63.763  31.462  394.358 1.00 113.73 ? 139 GLU 2 CA    1 
ATOM   4497  C  C     . GLU B  2  139 ? -63.020  30.134  394.416 1.00 99.81  ? 139 GLU 2 C     1 
ATOM   4498  O  O     . GLU B  2  139 ? -62.982  29.389  393.432 1.00 95.73  ? 139 GLU 2 O     1 
ATOM   4499  C  CB    . GLU B  2  139 ? -65.144  31.301  395.008 1.00 117.25 ? 139 GLU 2 CB    1 
ATOM   4500  C  CG    . GLU B  2  139 ? -66.021  32.546  394.951 1.00 118.33 ? 139 GLU 2 CG    1 
ATOM   4501  C  CD    . GLU B  2  139 ? -65.697  33.536  396.061 1.00 116.71 ? 139 GLU 2 CD    1 
ATOM   4502  O  OE1   . GLU B  2  139 ? -64.925  33.178  396.974 1.00 116.80 ? 139 GLU 2 OE1   1 
ATOM   4503  O  OE2   . GLU B  2  139 ? -66.216  34.671  396.026 1.00 115.73 ? 139 GLU 2 OE2   1 
ATOM   4504  N  N     . PRO B  2  140 ? -62.391  29.836  395.553 1.00 95.26  ? 140 PRO 2 N     1 
ATOM   4505  C  CA    . PRO B  2  140 ? -61.804  28.509  395.754 1.00 97.45  ? 140 PRO 2 CA    1 
ATOM   4506  C  C     . PRO B  2  140 ? -62.802  27.416  395.404 1.00 94.54  ? 140 PRO 2 C     1 
ATOM   4507  O  O     . PRO B  2  140 ? -64.014  27.581  395.554 1.00 97.00  ? 140 PRO 2 O     1 
ATOM   4508  C  CB    . PRO B  2  140 ? -61.450  28.497  397.243 1.00 102.49 ? 140 PRO 2 CB    1 
ATOM   4509  C  CG    . PRO B  2  140 ? -61.258  29.929  397.596 1.00 102.08 ? 140 PRO 2 CG    1 
ATOM   4510  C  CD    . PRO B  2  140 ? -62.099  30.756  396.667 1.00 96.60  ? 140 PRO 2 CD    1 
ATOM   4511  N  N     . TYR B  2  141 ? -62.277  26.295  394.923 1.00 87.91  ? 141 TYR 2 N     1 
ATOM   4512  C  CA    . TYR B  2  141 ? -63.134  25.282  394.330 1.00 86.58  ? 141 TYR 2 CA    1 
ATOM   4513  C  C     . TYR B  2  141 ? -64.091  24.700  395.357 1.00 85.26  ? 141 TYR 2 C     1 
ATOM   4514  O  O     . TYR B  2  141 ? -63.731  24.469  396.515 1.00 82.38  ? 141 TYR 2 O     1 
ATOM   4515  C  CB    . TYR B  2  141 ? -62.290  24.158  393.734 1.00 92.25  ? 141 TYR 2 CB    1 
ATOM   4516  C  CG    . TYR B  2  141 ? -61.095  24.636  392.962 1.00 100.34 ? 141 TYR 2 CG    1 
ATOM   4517  C  CD1   . TYR B  2  141 ? -61.253  25.367  391.798 1.00 105.58 ? 141 TYR 2 CD1   1 
ATOM   4518  C  CD2   . TYR B  2  141 ? -59.809  24.359  393.395 1.00 104.71 ? 141 TYR 2 CD2   1 
ATOM   4519  C  CE1   . TYR B  2  141 ? -60.167  25.810  391.086 1.00 110.57 ? 141 TYR 2 CE1   1 
ATOM   4520  C  CE2   . TYR B  2  141 ? -58.715  24.800  392.688 1.00 110.12 ? 141 TYR 2 CE2   1 
ATOM   4521  C  CZ    . TYR B  2  141 ? -58.903  25.525  391.534 1.00 113.37 ? 141 TYR 2 CZ    1 
ATOM   4522  O  OH    . TYR B  2  141 ? -57.820  25.969  390.823 1.00 115.86 ? 141 TYR 2 OH    1 
ATOM   4523  N  N     . VAL B  2  142 ? -65.328  24.483  394.921 1.00 88.91  ? 142 VAL 2 N     1 
ATOM   4524  C  CA    . VAL B  2  142 ? -66.320  23.763  395.703 1.00 89.20  ? 142 VAL 2 CA    1 
ATOM   4525  C  C     . VAL B  2  142 ? -66.102  22.292  395.369 1.00 84.13  ? 142 VAL 2 C     1 
ATOM   4526  O  O     . VAL B  2  142 ? -66.580  21.792  394.352 1.00 80.15  ? 142 VAL 2 O     1 
ATOM   4527  C  CB    . VAL B  2  142 ? -67.741  24.230  395.384 1.00 91.35  ? 142 VAL 2 CB    1 
ATOM   4528  C  CG1   . VAL B  2  142 ? -68.771  23.365  396.087 1.00 96.06  ? 142 VAL 2 CG1   1 
ATOM   4529  C  CG2   . VAL B  2  142 ? -67.909  25.689  395.768 1.00 87.31  ? 142 VAL 2 CG2   1 
ATOM   4530  N  N     . GLU B  2  143 ? -65.330  21.612  396.205 1.00 83.37  ? 143 GLU 2 N     1 
ATOM   4531  C  CA    . GLU B  2  143 ? -64.865  20.273  395.901 1.00 85.62  ? 143 GLU 2 CA    1 
ATOM   4532  C  C     . GLU B  2  143 ? -65.804  19.244  396.530 1.00 93.85  ? 143 GLU 2 C     1 
ATOM   4533  O  O     . GLU B  2  143 ? -66.786  19.588  397.190 1.00 101.93 ? 143 GLU 2 O     1 
ATOM   4534  C  CB    . GLU B  2  143 ? -63.422  20.119  396.382 1.00 81.52  ? 143 GLU 2 CB    1 
ATOM   4535  C  CG    . GLU B  2  143 ? -62.455  21.096  395.721 1.00 80.45  ? 143 GLU 2 CG    1 
ATOM   4536  C  CD    . GLU B  2  143 ? -61.108  21.163  396.417 1.00 79.89  ? 143 GLU 2 CD    1 
ATOM   4537  O  OE1   . GLU B  2  143 ? -60.779  20.231  397.176 1.00 79.27  ? 143 GLU 2 OE1   1 
ATOM   4538  O  OE2   . GLU B  2  143 ? -60.378  22.154  396.207 1.00 79.25  ? 143 GLU 2 OE2   1 
ATOM   4539  N  N     . CYS B  2  144 ? -65.496  17.964  396.322 1.00 90.03  ? 144 CYS 2 N     1 
ATOM   4540  C  CA    . CYS B  2  144 ? -66.238  16.854  396.923 1.00 87.23  ? 144 CYS 2 CA    1 
ATOM   4541  C  C     . CYS B  2  144 ? -67.734  16.970  396.630 1.00 86.38  ? 144 CYS 2 C     1 
ATOM   4542  O  O     . CYS B  2  144 ? -68.580  16.799  397.509 1.00 84.76  ? 144 CYS 2 O     1 
ATOM   4543  C  CB    . CYS B  2  144 ? -65.980  16.775  398.430 1.00 94.68  ? 144 CYS 2 CB    1 
ATOM   4544  S  SG    . CYS B  2  144 ? -64.337  17.321  398.978 1.00 104.81 ? 144 CYS 2 SG    1 
ATOM   4545  N  N     . VAL B  2  145 ? -68.059  17.261  395.372 1.00 89.94  ? 145 VAL 2 N     1 
ATOM   4546  C  CA    . VAL B  2  145 ? -69.422  17.628  394.989 1.00 99.54  ? 145 VAL 2 CA    1 
ATOM   4547  C  C     . VAL B  2  145 ? -70.289  16.375  394.935 1.00 109.38 ? 145 VAL 2 C     1 
ATOM   4548  O  O     . VAL B  2  145 ? -70.145  15.542  394.038 1.00 111.06 ? 145 VAL 2 O     1 
ATOM   4549  C  CB    . VAL B  2  145 ? -69.457  18.376  393.652 1.00 93.55  ? 145 VAL 2 CB    1 
ATOM   4550  C  CG1   . VAL B  2  145 ? -70.890  18.760  393.299 1.00 92.08  ? 145 VAL 2 CG1   1 
ATOM   4551  C  CG2   . VAL B  2  145 ? -68.591  19.606  393.711 1.00 91.93  ? 145 VAL 2 CG2   1 
ATOM   4552  N  N     . THR B  2  146 ? -71.193  16.242  395.897 1.00 113.35 ? 146 THR 2 N     1 
ATOM   4553  C  CA    . THR B  2  146 ? -72.250  15.249  395.838 1.00 112.37 ? 146 THR 2 CA    1 
ATOM   4554  C  C     . THR B  2  146 ? -73.560  15.918  395.432 1.00 105.46 ? 146 THR 2 C     1 
ATOM   4555  O  O     . THR B  2  146 ? -73.643  17.139  395.271 1.00 96.68  ? 146 THR 2 O     1 
ATOM   4556  C  CB    . THR B  2  146 ? -72.404  14.538  397.186 1.00 120.30 ? 146 THR 2 CB    1 
ATOM   4557  O  OG1   . THR B  2  146 ? -73.401  13.515  397.082 1.00 127.06 ? 146 THR 2 OG1   1 
ATOM   4558  C  CG2   . THR B  2  146 ? -72.814  15.523  398.268 1.00 119.06 ? 146 THR 2 CG2   1 
ATOM   4559  N  N     . ARG B  2  147 ? -74.588  15.088  395.242 1.00 121.95 ? 147 ARG 2 N     1 
ATOM   4560  C  CA    . ARG B  2  147 ? -75.915  15.606  394.922 1.00 122.51 ? 147 ARG 2 CA    1 
ATOM   4561  C  C     . ARG B  2  147 ? -76.373  16.603  395.976 1.00 118.02 ? 147 ARG 2 C     1 
ATOM   4562  O  O     . ARG B  2  147 ? -76.920  17.664  395.650 1.00 113.58 ? 147 ARG 2 O     1 
ATOM   4563  C  CB    . ARG B  2  147 ? -76.911  14.448  394.832 1.00 126.96 ? 147 ARG 2 CB    1 
ATOM   4564  C  CG    . ARG B  2  147 ? -77.947  14.554  393.731 1.00 130.14 ? 147 ARG 2 CG    1 
ATOM   4565  C  CD    . ARG B  2  147 ? -78.529  13.178  393.446 1.00 132.79 ? 147 ARG 2 CD    1 
ATOM   4566  N  NE    . ARG B  2  147 ? -77.500  12.143  393.439 1.00 136.06 ? 147 ARG 2 NE    1 
ATOM   4567  C  CZ    . ARG B  2  147 ? -77.698  10.895  393.029 1.00 137.72 ? 147 ARG 2 CZ    1 
ATOM   4568  N  NH1   . ARG B  2  147 ? -78.892  10.519  392.593 1.00 140.93 ? 147 ARG 2 NH1   1 
ATOM   4569  N  NH2   . ARG B  2  147 ? -76.702  10.021  393.059 1.00 135.33 ? 147 ARG 2 NH2   1 
ATOM   4570  N  N     . ALA B  2  148 ? -76.136  16.280  397.248 1.00 121.72 ? 148 ALA 2 N     1 
ATOM   4571  C  CA    . ALA B  2  148 ? -76.560  17.145  398.341 1.00 126.59 ? 148 ALA 2 CA    1 
ATOM   4572  C  C     . ALA B  2  148 ? -75.771  18.447  398.351 1.00 131.59 ? 148 ALA 2 C     1 
ATOM   4573  O  O     . ALA B  2  148 ? -76.351  19.527  398.495 1.00 136.04 ? 148 ALA 2 O     1 
ATOM   4574  C  CB    . ALA B  2  148 ? -76.416  16.414  399.676 1.00 128.46 ? 148 ALA 2 CB    1 
ATOM   4575  N  N     . ARG B  2  149 ? -74.442  18.365  398.224 1.00 131.12 ? 149 ARG 2 N     1 
ATOM   4576  C  CA    . ARG B  2  149 ? -73.635  19.579  398.143 1.00 131.15 ? 149 ARG 2 CA    1 
ATOM   4577  C  C     . ARG B  2  149 ? -74.083  20.451  396.978 1.00 123.81 ? 149 ARG 2 C     1 
ATOM   4578  O  O     . ARG B  2  149 ? -74.243  21.668  397.126 1.00 120.58 ? 149 ARG 2 O     1 
ATOM   4579  C  CB    . ARG B  2  149 ? -72.154  19.222  397.993 1.00 138.72 ? 149 ARG 2 CB    1 
ATOM   4580  C  CG    . ARG B  2  149 ? -71.190  20.131  398.751 1.00 144.95 ? 149 ARG 2 CG    1 
ATOM   4581  C  CD    . ARG B  2  149 ? -69.823  19.472  398.877 1.00 147.63 ? 149 ARG 2 CD    1 
ATOM   4582  N  NE    . ARG B  2  149 ? -69.018  19.993  399.979 1.00 148.36 ? 149 ARG 2 NE    1 
ATOM   4583  C  CZ    . ARG B  2  149 ? -68.383  21.162  399.969 1.00 147.18 ? 149 ARG 2 CZ    1 
ATOM   4584  N  NH1   . ARG B  2  149 ? -68.458  21.960  398.916 1.00 145.02 ? 149 ARG 2 NH1   1 
ATOM   4585  N  NH2   . ARG B  2  149 ? -67.666  21.537  401.020 1.00 147.90 ? 149 ARG 2 NH2   1 
ATOM   4586  N  N     . LEU B  2  150 ? -74.313  19.832  395.818 1.00 121.32 ? 150 LEU 2 N     1 
ATOM   4587  C  CA    . LEU B  2  150 ? -74.785  20.555  394.641 1.00 119.12 ? 150 LEU 2 CA    1 
ATOM   4588  C  C     . LEU B  2  150 ? -76.078  21.305  394.936 1.00 119.78 ? 150 LEU 2 C     1 
ATOM   4589  O  O     . LEU B  2  150 ? -76.147  22.534  394.800 1.00 120.63 ? 150 LEU 2 O     1 
ATOM   4590  C  CB    . LEU B  2  150 ? -74.971  19.572  393.478 1.00 111.36 ? 150 LEU 2 CB    1 
ATOM   4591  C  CG    . LEU B  2  150 ? -75.457  20.028  392.096 1.00 101.39 ? 150 LEU 2 CG    1 
ATOM   4592  C  CD1   . LEU B  2  150 ? -76.982  19.995  392.003 1.00 99.74  ? 150 LEU 2 CD1   1 
ATOM   4593  C  CD2   . LEU B  2  150 ? -74.926  21.414  391.752 1.00 96.35  ? 150 LEU 2 CD2   1 
ATOM   4594  N  N     . GLU B  2  151 ? -77.120  20.575  395.338 1.00 115.89 ? 151 GLU 2 N     1 
ATOM   4595  C  CA    . GLU B  2  151 ? -78.434  21.188  395.505 1.00 109.68 ? 151 GLU 2 CA    1 
ATOM   4596  C  C     . GLU B  2  151 ? -78.458  22.179  396.663 1.00 102.90 ? 151 GLU 2 C     1 
ATOM   4597  O  O     . GLU B  2  151 ? -79.159  23.195  396.593 1.00 101.99 ? 151 GLU 2 O     1 
ATOM   4598  C  CB    . GLU B  2  151 ? -79.485  20.094  395.687 1.00 110.15 ? 151 GLU 2 CB    1 
ATOM   4599  C  CG    . GLU B  2  151 ? -79.752  19.307  394.408 1.00 108.12 ? 151 GLU 2 CG    1 
ATOM   4600  C  CD    . GLU B  2  151 ? -80.310  17.924  394.668 1.00 106.70 ? 151 GLU 2 CD    1 
ATOM   4601  O  OE1   . GLU B  2  151 ? -80.965  17.727  395.710 1.00 107.69 ? 151 GLU 2 OE1   1 
ATOM   4602  O  OE2   . GLU B  2  151 ? -80.086  17.029  393.829 1.00 106.57 ? 151 GLU 2 OE2   1 
ATOM   4603  N  N     . ALA B  2  152 ? -77.680  21.925  397.718 1.00 98.95  ? 152 ALA 2 N     1 
ATOM   4604  C  CA    . ALA B  2  152 ? -77.622  22.846  398.846 1.00 95.85  ? 152 ALA 2 CA    1 
ATOM   4605  C  C     . ALA B  2  152 ? -76.933  24.145  398.458 1.00 93.21  ? 152 ALA 2 C     1 
ATOM   4606  O  O     . ALA B  2  152 ? -77.402  25.233  398.807 1.00 92.55  ? 152 ALA 2 O     1 
ATOM   4607  C  CB    . ALA B  2  152 ? -76.907  22.186  400.026 1.00 97.46  ? 152 ALA 2 CB    1 
ATOM   4608  N  N     . LEU B  2  153 ? -75.799  24.053  397.756 1.00 93.08  ? 153 LEU 2 N     1 
ATOM   4609  C  CA    . LEU B  2  153 ? -75.148  25.258  397.254 1.00 95.01  ? 153 LEU 2 CA    1 
ATOM   4610  C  C     . LEU B  2  153 ? -76.069  26.012  396.303 1.00 94.10  ? 153 LEU 2 C     1 
ATOM   4611  O  O     . LEU B  2  153 ? -76.090  27.250  396.294 1.00 90.77  ? 153 LEU 2 O     1 
ATOM   4612  C  CB    . LEU B  2  153 ? -73.829  24.888  396.573 1.00 95.27  ? 153 LEU 2 CB    1 
ATOM   4613  C  CG    . LEU B  2  153 ? -72.893  26.003  396.097 1.00 90.79  ? 153 LEU 2 CG    1 
ATOM   4614  C  CD1   . LEU B  2  153 ? -73.191  26.402  394.657 1.00 90.66  ? 153 LEU 2 CD1   1 
ATOM   4615  C  CD2   . LEU B  2  153 ? -72.955  27.209  397.029 1.00 93.19  ? 153 LEU 2 CD2   1 
ATOM   4616  N  N     . LEU B  2  154 ? -76.842  25.279  395.499 1.00 90.88  ? 154 LEU 2 N     1 
ATOM   4617  C  CA    . LEU B  2  154 ? -77.773  25.924  394.580 1.00 90.79  ? 154 LEU 2 CA    1 
ATOM   4618  C  C     . LEU B  2  154 ? -78.833  26.708  395.344 1.00 90.81  ? 154 LEU 2 C     1 
ATOM   4619  O  O     . LEU B  2  154 ? -79.114  27.869  395.027 1.00 92.22  ? 154 LEU 2 O     1 
ATOM   4620  C  CB    . LEU B  2  154 ? -78.415  24.874  393.673 1.00 96.53  ? 154 LEU 2 CB    1 
ATOM   4621  C  CG    . LEU B  2  154 ? -77.652  24.573  392.380 1.00 96.39  ? 154 LEU 2 CG    1 
ATOM   4622  C  CD1   . LEU B  2  154 ? -78.489  23.709  391.449 1.00 94.44  ? 154 LEU 2 CD1   1 
ATOM   4623  C  CD2   . LEU B  2  154 ? -77.226  25.862  391.690 1.00 90.58  ? 154 LEU 2 CD2   1 
ATOM   4624  N  N     . ALA B  2  155 ? -79.434  26.082  396.358 1.00 90.95  ? 155 ALA 2 N     1 
ATOM   4625  C  CA    . ALA B  2  155 ? -80.434  26.767  397.169 1.00 90.98  ? 155 ALA 2 CA    1 
ATOM   4626  C  C     . ALA B  2  155 ? -79.830  27.940  397.932 1.00 90.93  ? 155 ALA 2 C     1 
ATOM   4627  O  O     . ALA B  2  155 ? -80.498  28.962  398.128 1.00 90.88  ? 155 ALA 2 O     1 
ATOM   4628  C  CB    . ALA B  2  155 ? -81.091  25.783  398.137 1.00 100.81 ? 155 ALA 2 CB    1 
ATOM   4629  N  N     . GLY B  2  156 ? -78.577  27.811  398.372 1.00 95.29  ? 156 GLY 2 N     1 
ATOM   4630  C  CA    . GLY B  2  156 ? -77.929  28.907  399.075 1.00 94.58  ? 156 GLY 2 CA    1 
ATOM   4631  C  C     . GLY B  2  156 ? -77.721  30.118  398.186 1.00 97.16  ? 156 GLY 2 C     1 
ATOM   4632  O  O     . GLY B  2  156 ? -78.061  31.244  398.560 1.00 100.85 ? 156 GLY 2 O     1 
ATOM   4633  N  N     . LEU B  2  157 ? -77.144  29.903  397.001 1.00 96.37  ? 157 LEU 2 N     1 
ATOM   4634  C  CA    . LEU B  2  157 ? -76.948  31.012  396.073 1.00 99.00  ? 157 LEU 2 CA    1 
ATOM   4635  C  C     . LEU B  2  157 ? -78.287  31.595  395.647 1.00 99.11  ? 157 LEU 2 C     1 
ATOM   4636  O  O     . LEU B  2  157 ? -78.421  32.813  395.480 1.00 104.05 ? 157 LEU 2 O     1 
ATOM   4637  C  CB    . LEU B  2  157 ? -76.144  30.558  394.858 1.00 105.74 ? 157 LEU 2 CB    1 
ATOM   4638  C  CG    . LEU B  2  157 ? -74.703  30.149  395.156 1.00 111.68 ? 157 LEU 2 CG    1 
ATOM   4639  C  CD1   . LEU B  2  157 ? -73.968  29.817  393.866 1.00 110.40 ? 157 LEU 2 CD1   1 
ATOM   4640  C  CD2   . LEU B  2  157 ? -73.991  31.257  395.924 1.00 115.49 ? 157 LEU 2 CD2   1 
ATOM   4641  N  N     . ARG B  2  158 ? -79.288  30.734  395.462 1.00 94.73  ? 158 ARG 2 N     1 
ATOM   4642  C  CA    . ARG B  2  158 ? -80.633  31.196  395.141 1.00 92.50  ? 158 ARG 2 CA    1 
ATOM   4643  C  C     . ARG B  2  158 ? -81.183  32.094  396.242 1.00 92.09  ? 158 ARG 2 C     1 
ATOM   4644  O  O     . ARG B  2  158 ? -82.067  32.920  395.990 1.00 90.49  ? 158 ARG 2 O     1 
ATOM   4645  C  CB    . ARG B  2  158 ? -81.540  29.980  394.947 1.00 90.61  ? 158 ARG 2 CB    1 
ATOM   4646  C  CG    . ARG B  2  158 ? -82.226  29.864  393.606 1.00 90.54  ? 158 ARG 2 CG    1 
ATOM   4647  C  CD    . ARG B  2  158 ? -82.764  28.450  393.477 1.00 90.65  ? 158 ARG 2 CD    1 
ATOM   4648  N  NE    . ARG B  2  158 ? -82.877  28.006  392.095 1.00 92.07  ? 158 ARG 2 NE    1 
ATOM   4649  C  CZ    . ARG B  2  158 ? -82.881  26.728  391.731 1.00 96.25  ? 158 ARG 2 CZ    1 
ATOM   4650  N  NH1   . ARG B  2  158 ? -82.771  25.777  392.649 1.00 100.33 ? 158 ARG 2 NH1   1 
ATOM   4651  N  NH2   . ARG B  2  158 ? -82.982  26.396  390.452 1.00 94.99  ? 158 ARG 2 NH2   1 
ATOM   4652  N  N     . ALA B  2  159 ? -80.681  31.937  397.466 1.00 111.08 ? 159 ALA 2 N     1 
ATOM   4653  C  CA    . ALA B  2  159 ? -81.038  32.792  398.588 1.00 114.07 ? 159 ALA 2 CA    1 
ATOM   4654  C  C     . ALA B  2  159 ? -80.065  33.949  398.788 1.00 115.84 ? 159 ALA 2 C     1 
ATOM   4655  O  O     . ALA B  2  159 ? -80.236  34.726  399.732 1.00 117.48 ? 159 ALA 2 O     1 
ATOM   4656  C  CB    . ALA B  2  159 ? -81.121  31.967  399.876 1.00 111.14 ? 159 ALA 2 CB    1 
ATOM   4657  N  N     . GLY B  2  160 ? -79.050  34.076  397.937 1.00 115.16 ? 160 GLY 2 N     1 
ATOM   4658  C  CA    . GLY B  2  160 ? -78.161  35.218  397.967 1.00 111.29 ? 160 GLY 2 CA    1 
ATOM   4659  C  C     . GLY B  2  160 ? -77.101  35.205  399.045 1.00 111.28 ? 160 GLY 2 C     1 
ATOM   4660  O  O     . GLY B  2  160 ? -76.438  36.228  399.246 1.00 111.35 ? 160 GLY 2 O     1 
ATOM   4661  N  N     . LYS B  2  161 ? -76.915  34.091  399.745 1.00 111.19 ? 161 LYS 2 N     1 
ATOM   4662  C  CA    . LYS B  2  161 ? -75.808  33.981  400.686 1.00 124.54 ? 161 LYS 2 CA    1 
ATOM   4663  C  C     . LYS B  2  161 ? -74.506  33.795  399.917 1.00 128.36 ? 161 LYS 2 C     1 
ATOM   4664  O  O     . LYS B  2  161 ? -74.437  32.985  398.988 1.00 130.90 ? 161 LYS 2 O     1 
ATOM   4665  C  CB    . LYS B  2  161 ? -76.038  32.818  401.651 1.00 120.72 ? 161 LYS 2 CB    1 
ATOM   4666  C  CG    . LYS B  2  161 ? -76.745  33.208  402.946 1.00 111.17 ? 161 LYS 2 CG    1 
ATOM   4667  C  CD    . LYS B  2  161 ? -76.983  32.002  403.848 1.00 111.09 ? 161 LYS 2 CD    1 
ATOM   4668  C  CE    . LYS B  2  161 ? -76.649  32.318  405.298 1.00 111.14 ? 161 LYS 2 CE    1 
ATOM   4669  N  NZ    . LYS B  2  161 ? -76.187  31.112  406.040 1.00 111.04 ? 161 LYS 2 NZ    1 
ATOM   4670  N  N     . ARG B  2  162 ? -73.472  34.544  400.294 1.00 126.58 ? 162 ARG 2 N     1 
ATOM   4671  C  CA    . ARG B  2  162 ? -72.188  34.407  399.619 1.00 126.77 ? 162 ARG 2 CA    1 
ATOM   4672  C  C     . ARG B  2  162 ? -71.576  33.039  399.890 1.00 123.80 ? 162 ARG 2 C     1 
ATOM   4673  O  O     . ARG B  2  162 ? -71.609  32.533  401.014 1.00 122.32 ? 162 ARG 2 O     1 
ATOM   4674  C  CB    . ARG B  2  162 ? -71.207  35.501  400.045 1.00 129.37 ? 162 ARG 2 CB    1 
ATOM   4675  C  CG    . ARG B  2  162 ? -71.558  36.906  399.569 1.00 129.86 ? 162 ARG 2 CG    1 
ATOM   4676  C  CD    . ARG B  2  162 ? -70.322  37.806  399.579 1.00 126.44 ? 162 ARG 2 CD    1 
ATOM   4677  N  NE    . ARG B  2  162 ? -69.755  38.001  400.909 1.00 123.36 ? 162 ARG 2 NE    1 
ATOM   4678  C  CZ    . ARG B  2  162 ? -70.111  38.974  401.741 1.00 120.47 ? 162 ARG 2 CZ    1 
ATOM   4679  N  NH1   . ARG B  2  162 ? -71.038  39.850  401.385 1.00 121.05 ? 162 ARG 2 NH1   1 
ATOM   4680  N  NH2   . ARG B  2  162 ? -69.532  39.072  402.930 1.00 121.87 ? 162 ARG 2 NH2   1 
ATOM   4681  N  N     . LEU B  2  163 ? -71.017  32.442  398.832 1.00 121.12 ? 163 LEU 2 N     1 
ATOM   4682  C  CA    . LEU B  2  163 ? -70.450  31.100  398.919 1.00 110.73 ? 163 LEU 2 CA    1 
ATOM   4683  C  C     . LEU B  2  163 ? -69.377  30.998  399.992 1.00 119.06 ? 163 LEU 2 C     1 
ATOM   4684  O  O     . LEU B  2  163 ? -69.199  29.928  400.585 1.00 118.45 ? 163 LEU 2 O     1 
ATOM   4685  C  CB    . LEU B  2  163 ? -69.872  30.697  397.561 1.00 110.65 ? 163 LEU 2 CB    1 
ATOM   4686  C  CG    . LEU B  2  163 ? -69.382  29.258  397.402 1.00 111.38 ? 163 LEU 2 CG    1 
ATOM   4687  C  CD1   . LEU B  2  163 ? -69.781  28.718  396.042 1.00 113.55 ? 163 LEU 2 CD1   1 
ATOM   4688  C  CD2   . LEU B  2  163 ? -67.870  29.171  397.590 1.00 110.98 ? 163 LEU 2 CD2   1 
ATOM   4689  N  N     . GLU B  2  164 ? -68.655  32.092  400.252 1.00 122.45 ? 164 GLU 2 N     1 
ATOM   4690  C  CA    . GLU B  2  164 ? -67.509  32.058  401.156 1.00 119.13 ? 164 GLU 2 CA    1 
ATOM   4691  C  C     . GLU B  2  164 ? -67.855  31.465  402.517 1.00 114.09 ? 164 GLU 2 C     1 
ATOM   4692  O  O     . GLU B  2  164 ? -67.010  30.811  403.140 1.00 110.68 ? 164 GLU 2 O     1 
ATOM   4693  C  CB    . GLU B  2  164 ? -66.945  33.471  401.314 1.00 121.75 ? 164 GLU 2 CB    1 
ATOM   4694  C  CG    . GLU B  2  164 ? -67.971  34.491  401.781 1.00 128.72 ? 164 GLU 2 CG    1 
ATOM   4695  C  CD    . GLU B  2  164 ? -67.570  35.914  401.450 1.00 137.65 ? 164 GLU 2 CD    1 
ATOM   4696  O  OE1   . GLU B  2  164 ? -66.944  36.124  400.391 1.00 141.70 ? 164 GLU 2 OE1   1 
ATOM   4697  O  OE2   . GLU B  2  164 ? -67.882  36.823  402.246 1.00 141.66 ? 164 GLU 2 OE2   1 
ATOM   4698  N  N     . GLU B  2  165 ? -69.083  31.669  402.993 1.00 114.08 ? 165 GLU 2 N     1 
ATOM   4699  C  CA    . GLU B  2  165 ? -69.544  31.093  404.258 1.00 119.75 ? 165 GLU 2 CA    1 
ATOM   4700  C  C     . GLU B  2  165 ? -70.929  30.494  404.021 1.00 121.87 ? 165 GLU 2 C     1 
ATOM   4701  O  O     . GLU B  2  165 ? -71.949  31.169  404.175 1.00 110.88 ? 165 GLU 2 O     1 
ATOM   4702  C  CB    . GLU B  2  165 ? -69.556  32.130  405.381 1.00 120.27 ? 165 GLU 2 CB    1 
ATOM   4703  C  CG    . GLU B  2  165 ? -70.043  33.508  404.980 1.00 121.95 ? 165 GLU 2 CG    1 
ATOM   4704  C  CD    . GLU B  2  165 ? -69.670  34.565  405.998 1.00 123.82 ? 165 GLU 2 CD    1 
ATOM   4705  O  OE1   . GLU B  2  165 ? -68.519  34.547  406.485 1.00 124.44 ? 165 GLU 2 OE1   1 
ATOM   4706  O  OE2   . GLU B  2  165 ? -70.530  35.411  406.319 1.00 124.73 ? 165 GLU 2 OE2   1 
ATOM   4707  N  N     . ILE B  2  166 ? -70.955  29.220  403.644 1.00 118.17 ? 166 ILE 2 N     1 
ATOM   4708  C  CA    . ILE B  2  166 ? -72.191  28.475  403.437 1.00 120.16 ? 166 ILE 2 CA    1 
ATOM   4709  C  C     . ILE B  2  166 ? -72.011  27.097  404.056 1.00 121.94 ? 166 ILE 2 C     1 
ATOM   4710  O  O     . ILE B  2  166 ? -70.926  26.511  403.984 1.00 120.82 ? 166 ILE 2 O     1 
ATOM   4711  C  CB    . ILE B  2  166 ? -72.560  28.374  401.939 1.00 124.92 ? 166 ILE 2 CB    1 
ATOM   4712  C  CG1   . ILE B  2  166 ? -72.919  29.752  401.382 1.00 126.51 ? 166 ILE 2 CG1   1 
ATOM   4713  C  CG2   . ILE B  2  166 ? -73.714  27.405  401.715 1.00 126.58 ? 166 ILE 2 CG2   1 
ATOM   4714  C  CD1   . ILE B  2  166 ? -73.623  29.719  400.036 1.00 127.80 ? 166 ILE 2 CD1   1 
ATOM   4715  N  N     . GLU B  2  167 ? -73.073  26.581  404.666 1.00 124.00 ? 167 GLU 2 N     1 
ATOM   4716  C  CA    . GLU B  2  167 ? -73.037  25.225  405.194 1.00 126.13 ? 167 GLU 2 CA    1 
ATOM   4717  C  C     . GLU B  2  167 ? -72.925  24.239  404.038 1.00 122.82 ? 167 GLU 2 C     1 
ATOM   4718  O  O     . GLU B  2  167 ? -73.796  24.190  403.163 1.00 122.45 ? 167 GLU 2 O     1 
ATOM   4719  C  CB    . GLU B  2  167 ? -74.282  24.941  406.034 1.00 129.30 ? 167 GLU 2 CB    1 
ATOM   4720  C  CG    . GLU B  2  167 ? -75.600  25.291  405.361 1.00 131.24 ? 167 GLU 2 CG    1 
ATOM   4721  C  CD    . GLU B  2  167 ? -76.791  24.703  406.087 1.00 134.09 ? 167 GLU 2 CD    1 
ATOM   4722  O  OE1   . GLU B  2  167 ? -76.701  24.498  407.316 1.00 134.44 ? 167 GLU 2 OE1   1 
ATOM   4723  O  OE2   . GLU B  2  167 ? -77.817  24.437  405.428 1.00 135.80 ? 167 GLU 2 OE2   1 
ATOM   4724  N  N     . LEU B  2  168 ? -71.841  23.476  404.020 1.00 118.99 ? 168 LEU 2 N     1 
ATOM   4725  C  CA    . LEU B  2  168 ? -71.556  22.554  402.924 1.00 116.80 ? 168 LEU 2 CA    1 
ATOM   4726  C  C     . LEU B  2  168 ? -71.480  21.136  403.469 1.00 117.16 ? 168 LEU 2 C     1 
ATOM   4727  O  O     . LEU B  2  168 ? -70.513  20.796  404.178 1.00 117.19 ? 168 LEU 2 O     1 
ATOM   4728  C  CB    . LEU B  2  168 ? -70.255  22.940  402.224 1.00 113.94 ? 168 LEU 2 CB    1 
ATOM   4729  C  CG    . LEU B  2  168 ? -70.186  24.340  401.610 1.00 106.98 ? 168 LEU 2 CG    1 
ATOM   4730  C  CD1   . LEU B  2  168 ? -68.749  24.720  401.279 1.00 105.05 ? 168 LEU 2 CD1   1 
ATOM   4731  C  CD2   . LEU B  2  168 ? -71.062  24.420  400.369 1.00 104.94 ? 168 LEU 2 CD2   1 
ATOM   4732  N  N     . PRO B  2  169 ? -72.468  20.289  403.186 1.00 115.86 ? 169 PRO 2 N     1 
ATOM   4733  C  CA    . PRO B  2  169 ? -72.427  18.906  403.677 1.00 117.34 ? 169 PRO 2 CA    1 
ATOM   4734  C  C     . PRO B  2  169 ? -71.215  18.152  403.150 1.00 122.71 ? 169 PRO 2 C     1 
ATOM   4735  O  O     . PRO B  2  169 ? -70.744  18.385  402.035 1.00 123.67 ? 169 PRO 2 O     1 
ATOM   4736  C  CB    . PRO B  2  169 ? -73.736  18.302  403.153 1.00 115.51 ? 169 PRO 2 CB    1 
ATOM   4737  C  CG    . PRO B  2  169 ? -74.214  19.247  402.088 1.00 114.26 ? 169 PRO 2 CG    1 
ATOM   4738  C  CD    . PRO B  2  169 ? -73.728  20.596  402.494 1.00 114.41 ? 169 PRO 2 CD    1 
ATOM   4739  N  N     . GLY B  2  170 ? -70.710  17.239  403.974 1.00 127.62 ? 170 GLY 2 N     1 
ATOM   4740  C  CA    . GLY B  2  170 ? -69.530  16.471  403.639 1.00 130.62 ? 170 GLY 2 CA    1 
ATOM   4741  C  C     . GLY B  2  170 ? -68.250  17.239  403.912 1.00 132.70 ? 170 GLY 2 C     1 
ATOM   4742  O  O     . GLY B  2  170 ? -68.242  18.445  404.164 1.00 130.40 ? 170 GLY 2 O     1 
ATOM   4743  N  N     . LYS B  2  171 ? -67.137  16.515  403.853 1.00 138.35 ? 171 LYS 2 N     1 
ATOM   4744  C  CA    . LYS B  2  171 ? -65.829  17.087  404.124 1.00 144.81 ? 171 LYS 2 CA    1 
ATOM   4745  C  C     . LYS B  2  171 ? -64.995  17.154  402.853 1.00 146.37 ? 171 LYS 2 C     1 
ATOM   4746  O  O     . LYS B  2  171 ? -65.168  16.354  401.928 1.00 146.66 ? 171 LYS 2 O     1 
ATOM   4747  C  CB    . LYS B  2  171 ? -65.080  16.280  405.191 1.00 147.38 ? 171 LYS 2 CB    1 
ATOM   4748  C  CG    . LYS B  2  171 ? -65.025  14.783  404.937 1.00 147.81 ? 171 LYS 2 CG    1 
ATOM   4749  C  CD    . LYS B  2  171 ? -63.808  14.166  405.605 1.00 147.40 ? 171 LYS 2 CD    1 
ATOM   4750  C  CE    . LYS B  2  171 ? -64.028  12.694  405.896 1.00 147.39 ? 171 LYS 2 CE    1 
ATOM   4751  N  NZ    . LYS B  2  171 ? -63.894  11.877  404.667 1.00 147.99 ? 171 LYS 2 NZ    1 
ATOM   4752  N  N     . CYS B  2  172 ? -64.088  18.128  402.822 1.00 145.58 ? 172 CYS 2 N     1 
ATOM   4753  C  CA    . CYS B  2  172 ? -63.132  18.297  401.734 1.00 141.23 ? 172 CYS 2 CA    1 
ATOM   4754  C  C     . CYS B  2  172 ? -61.755  18.416  402.368 1.00 138.38 ? 172 CYS 2 C     1 
ATOM   4755  O  O     . CYS B  2  172 ? -61.440  19.438  402.988 1.00 139.98 ? 172 CYS 2 O     1 
ATOM   4756  C  CB    . CYS B  2  172 ? -63.459  19.532  400.897 1.00 137.96 ? 172 CYS 2 CB    1 
ATOM   4757  S  SG    . CYS B  2  172 ? -64.633  19.244  399.565 1.00 136.88 ? 172 CYS 2 SG    1 
ATOM   4758  N  N     . GLY B  2  173 ? -60.938  17.385  402.208 1.00 132.09 ? 173 GLY 2 N     1 
ATOM   4759  C  CA    . GLY B  2  173 ? -59.627  17.367  402.816 1.00 123.51 ? 173 GLY 2 CA    1 
ATOM   4760  C  C     . GLY B  2  173 ? -58.685  18.396  402.228 1.00 116.42 ? 173 GLY 2 C     1 
ATOM   4761  O  O     . GLY B  2  173 ? -58.947  19.032  401.208 1.00 119.04 ? 173 GLY 2 O     1 
ATOM   4762  N  N     . HIS B  2  174 ? -57.548  18.557  402.905 1.00 110.43 ? 174 HIS 2 N     1 
ATOM   4763  C  CA    . HIS B  2  174 ? -56.526  19.492  402.438 1.00 112.37 ? 174 HIS 2 CA    1 
ATOM   4764  C  C     . HIS B  2  174 ? -55.714  18.876  401.303 1.00 118.64 ? 174 HIS 2 C     1 
ATOM   4765  O  O     . HIS B  2  174 ? -55.769  19.342  400.162 1.00 123.61 ? 174 HIS 2 O     1 
ATOM   4766  C  CB    . HIS B  2  174 ? -55.623  19.900  403.604 1.00 111.06 ? 174 HIS 2 CB    1 
ATOM   4767  C  CG    . HIS B  2  174 ? -54.685  21.018  403.277 1.00 111.18 ? 174 HIS 2 CG    1 
ATOM   4768  N  ND1   . HIS B  2  174 ? -55.118  22.275  402.912 1.00 112.49 ? 174 HIS 2 ND1   1 
ATOM   4769  C  CD2   . HIS B  2  174 ? -53.333  21.061  403.247 1.00 111.76 ? 174 HIS 2 CD2   1 
ATOM   4770  C  CE1   . HIS B  2  174 ? -54.071  23.047  402.680 1.00 112.02 ? 174 HIS 2 CE1   1 
ATOM   4771  N  NE2   . HIS B  2  174 ? -52.977  22.334  402.878 1.00 112.00 ? 174 HIS 2 NE2   1 
ATOM   4772  N  N     . HIS B  2  175 ? -54.960  17.815  401.598 1.00 117.98 ? 175 HIS 2 N     1 
ATOM   4773  C  CA    . HIS B  2  175 ? -54.254  17.060  400.574 1.00 117.21 ? 175 HIS 2 CA    1 
ATOM   4774  C  C     . HIS B  2  175 ? -54.674  15.599  400.515 1.00 116.53 ? 175 HIS 2 C     1 
ATOM   4775  O  O     . HIS B  2  175 ? -54.282  14.902  399.574 1.00 114.35 ? 175 HIS 2 O     1 
ATOM   4776  C  CB    . HIS B  2  175 ? -52.729  17.139  400.764 1.00 117.06 ? 175 HIS 2 CB    1 
ATOM   4777  C  CG    . HIS B  2  175 ? -52.241  16.637  402.089 1.00 117.47 ? 175 HIS 2 CG    1 
ATOM   4778  N  ND1   . HIS B  2  175 ? -52.764  17.058  403.292 1.00 117.58 ? 175 HIS 2 ND1   1 
ATOM   4779  C  CD2   . HIS B  2  175 ? -51.265  15.748  402.393 1.00 115.67 ? 175 HIS 2 CD2   1 
ATOM   4780  C  CE1   . HIS B  2  175 ? -52.136  16.447  404.281 1.00 117.96 ? 175 HIS 2 CE1   1 
ATOM   4781  N  NE2   . HIS B  2  175 ? -51.221  15.648  403.762 1.00 116.46 ? 175 HIS 2 NE2   1 
ATOM   4782  N  N     . VAL B  2  176 ? -55.448  15.115  401.487 1.00 121.08 ? 176 VAL 2 N     1 
ATOM   4783  C  CA    . VAL B  2  176 ? -56.014  13.773  401.468 1.00 126.35 ? 176 VAL 2 CA    1 
ATOM   4784  C  C     . VAL B  2  176 ? -57.515  13.876  401.694 1.00 131.08 ? 176 VAL 2 C     1 
ATOM   4785  O  O     . VAL B  2  176 ? -58.026  14.884  402.183 1.00 130.94 ? 176 VAL 2 O     1 
ATOM   4786  C  CB    . VAL B  2  176 ? -55.376  12.849  402.529 1.00 127.68 ? 176 VAL 2 CB    1 
ATOM   4787  C  CG1   . VAL B  2  176 ? -53.900  12.650  402.239 1.00 129.48 ? 176 VAL 2 CG1   1 
ATOM   4788  C  CG2   . VAL B  2  176 ? -55.586  13.408  403.933 1.00 126.50 ? 176 VAL 2 CG2   1 
ATOM   4789  N  N     . HIS B  2  177 ? -58.223  12.809  401.333 1.00 135.28 ? 177 HIS 2 N     1 
ATOM   4790  C  CA    . HIS B  2  177 ? -59.682  12.803  401.339 1.00 136.99 ? 177 HIS 2 CA    1 
ATOM   4791  C  C     . HIS B  2  177 ? -60.142  11.418  401.760 1.00 139.29 ? 177 HIS 2 C     1 
ATOM   4792  O  O     . HIS B  2  177 ? -59.915  10.447  401.036 1.00 136.39 ? 177 HIS 2 O     1 
ATOM   4793  C  CB    . HIS B  2  177 ? -60.226  13.168  399.951 1.00 134.65 ? 177 HIS 2 CB    1 
ATOM   4794  C  CG    . HIS B  2  177 ? -61.713  13.050  399.822 1.00 132.63 ? 177 HIS 2 CG    1 
ATOM   4795  N  ND1   . HIS B  2  177 ? -62.587  13.790  400.588 1.00 133.81 ? 177 HIS 2 ND1   1 
ATOM   4796  C  CD2   . HIS B  2  177 ? -62.479  12.290  399.004 1.00 133.56 ? 177 HIS 2 CD2   1 
ATOM   4797  C  CE1   . HIS B  2  177 ? -63.828  13.485  400.253 1.00 133.56 ? 177 HIS 2 CE1   1 
ATOM   4798  N  NE2   . HIS B  2  177 ? -63.790  12.576  399.295 1.00 133.65 ? 177 HIS 2 NE2   1 
ATOM   4799  N  N     . GLU B  2  178 ? -60.796  11.332  402.918 1.00 142.96 ? 178 GLU 2 N     1 
ATOM   4800  C  CA    . GLU B  2  178 ? -61.143  10.056  403.536 1.00 142.90 ? 178 GLU 2 CA    1 
ATOM   4801  C  C     . GLU B  2  178 ? -62.498  9.562   403.043 1.00 148.99 ? 178 GLU 2 C     1 
ATOM   4802  O  O     . GLU B  2  178 ? -63.497  10.284  403.123 1.00 151.65 ? 178 GLU 2 O     1 
ATOM   4803  C  CB    . GLU B  2  178 ? -61.149  10.175  405.062 1.00 133.66 ? 178 GLU 2 CB    1 
ATOM   4804  C  CG    . GLU B  2  178 ? -61.910  9.058   405.762 1.00 124.50 ? 178 GLU 2 CG    1 
ATOM   4805  C  CD    . GLU B  2  178 ? -60.995  8.040   406.411 1.00 119.00 ? 178 GLU 2 CD    1 
ATOM   4806  O  OE1   . GLU B  2  178 ? -59.810  8.362   406.637 1.00 116.76 ? 178 GLU 2 OE1   1 
ATOM   4807  O  OE2   . GLU B  2  178 ? -61.460  6.916   406.689 1.00 117.71 ? 178 GLU 2 OE2   1 
ATOM   4808  N  N     . VAL B  2  179 ? -62.525  8.333   402.531 1.00 149.94 ? 179 VAL 2 N     1 
ATOM   4809  C  CA    . VAL B  2  179 ? -63.732  7.726   401.982 1.00 150.32 ? 179 VAL 2 CA    1 
ATOM   4810  C  C     . VAL B  2  179 ? -64.276  6.721   402.989 1.00 153.90 ? 179 VAL 2 C     1 
ATOM   4811  O  O     . VAL B  2  179 ? -63.538  5.858   403.481 1.00 158.13 ? 179 VAL 2 O     1 
ATOM   4812  C  CB    . VAL B  2  179 ? -63.448  7.047   400.631 1.00 148.53 ? 179 VAL 2 CB    1 
ATOM   4813  C  CG1   . VAL B  2  179 ? -64.742  6.540   400.006 1.00 148.30 ? 179 VAL 2 CG1   1 
ATOM   4814  C  CG2   . VAL B  2  179 ? -62.738  8.008   399.688 1.00 147.73 ? 179 VAL 2 CG2   1 
ATOM   4815  N  N     . GLU B  2  180 ? -65.565  6.836   403.301 1.00 151.17 ? 180 GLU 2 N     1 
ATOM   4816  C  CA    . GLU B  2  180 ? -66.251  5.853   404.136 1.00 146.84 ? 180 GLU 2 CA    1 
ATOM   4817  C  C     . GLU B  2  180 ? -67.622  5.516   403.559 1.00 144.64 ? 180 GLU 2 C     1 
ATOM   4818  O  O     . GLU B  2  180 ? -68.494  6.379   403.463 1.00 142.83 ? 180 GLU 2 O     1 
ATOM   4819  C  CB    . GLU B  2  180 ? -66.403  6.365   405.571 1.00 143.97 ? 180 GLU 2 CB    1 
ATOM   4820  C  CG    . GLU B  2  180 ? -65.092  6.585   406.308 1.00 142.21 ? 180 GLU 2 CG    1 
ATOM   4821  C  CD    . GLU B  2  180 ? -65.284  6.704   407.806 1.00 141.69 ? 180 GLU 2 CD    1 
ATOM   4822  O  OE1   . GLU B  2  180 ? -65.561  5.672   408.452 1.00 141.74 ? 180 GLU 2 OE1   1 
ATOM   4823  O  OE2   . GLU B  2  180 ? -65.164  7.829   408.336 1.00 141.05 ? 180 GLU 2 OE2   1 
ATOM   4824  N  N     . MET C  3  1   ? -16.595  28.732  352.346 1.00 136.45 ? 1   MET 3 N     1 
ATOM   4825  C  CA    . MET C  3  1   ? -18.040  28.536  352.318 1.00 135.79 ? 1   MET 3 CA    1 
ATOM   4826  C  C     . MET C  3  1   ? -18.403  27.118  352.766 1.00 128.38 ? 1   MET 3 C     1 
ATOM   4827  O  O     . MET C  3  1   ? -17.551  26.229  352.787 1.00 127.87 ? 1   MET 3 O     1 
ATOM   4828  C  CB    . MET C  3  1   ? -18.579  28.829  350.918 1.00 142.36 ? 1   MET 3 CB    1 
ATOM   4829  C  CG    . MET C  3  1   ? -18.462  30.298  350.529 1.00 149.48 ? 1   MET 3 CG    1 
ATOM   4830  S  SD    . MET C  3  1   ? -19.540  30.780  349.168 1.00 155.61 ? 1   MET 3 SD    1 
ATOM   4831  C  CE    . MET C  3  1   ? -18.461  30.466  347.774 1.00 155.82 ? 1   MET 3 CE    1 
ATOM   4832  N  N     . VAL C  3  2   ? -19.673  26.909  353.108 1.00 119.37 ? 2   VAL 3 N     1 
ATOM   4833  C  CA    . VAL C  3  2   ? -20.119  25.679  353.755 1.00 108.82 ? 2   VAL 3 CA    1 
ATOM   4834  C  C     . VAL C  3  2   ? -20.522  24.659  352.700 1.00 104.93 ? 2   VAL 3 C     1 
ATOM   4835  O  O     . VAL C  3  2   ? -21.165  24.993  351.696 1.00 104.64 ? 2   VAL 3 O     1 
ATOM   4836  C  CB    . VAL C  3  2   ? -21.275  25.969  354.733 1.00 103.63 ? 2   VAL 3 CB    1 
ATOM   4837  C  CG1   . VAL C  3  2   ? -22.117  24.729  354.979 1.00 97.82  ? 2   VAL 3 CG1   1 
ATOM   4838  C  CG2   . VAL C  3  2   ? -20.730  26.503  356.048 1.00 106.59 ? 2   VAL 3 CG2   1 
ATOM   4839  N  N     . ARG C  3  3   ? -20.138  23.407  352.937 1.00 101.86 ? 3   ARG 3 N     1 
ATOM   4840  C  CA    . ARG C  3  3   ? -20.446  22.286  352.061 1.00 93.40  ? 3   ARG 3 CA    1 
ATOM   4841  C  C     . ARG C  3  3   ? -21.688  21.576  352.584 1.00 93.47  ? 3   ARG 3 C     1 
ATOM   4842  O  O     . ARG C  3  3   ? -21.701  21.113  353.729 1.00 93.04  ? 3   ARG 3 O     1 
ATOM   4843  C  CB    . ARG C  3  3   ? -19.263  21.319  352.009 1.00 82.43  ? 3   ARG 3 CB    1 
ATOM   4844  C  CG    . ARG C  3  3   ? -19.021  20.712  350.654 1.00 73.29  ? 3   ARG 3 CG    1 
ATOM   4845  C  CD    . ARG C  3  3   ? -17.891  21.403  349.927 1.00 69.51  ? 3   ARG 3 CD    1 
ATOM   4846  N  NE    . ARG C  3  3   ? -17.463  20.632  348.767 1.00 70.79  ? 3   ARG 3 NE    1 
ATOM   4847  C  CZ    . ARG C  3  3   ? -16.303  20.800  348.143 1.00 77.35  ? 3   ARG 3 CZ    1 
ATOM   4848  N  NH1   . ARG C  3  3   ? -15.443  21.716  348.564 1.00 85.35  ? 3   ARG 3 NH1   1 
ATOM   4849  N  NH2   . ARG C  3  3   ? -16.004  20.050  347.092 1.00 75.51  ? 3   ARG 3 NH2   1 
ATOM   4850  N  N     . VAL C  3  4   ? -22.730  21.485  351.752 1.00 96.15  ? 4   VAL 3 N     1 
ATOM   4851  C  CA    . VAL C  3  4   ? -23.963  20.805  352.136 1.00 105.24 ? 4   VAL 3 CA    1 
ATOM   4852  C  C     . VAL C  3  4   ? -24.318  19.798  351.045 1.00 109.59 ? 4   VAL 3 C     1 
ATOM   4853  O  O     . VAL C  3  4   ? -23.905  19.931  349.893 1.00 114.65 ? 4   VAL 3 O     1 
ATOM   4854  C  CB    . VAL C  3  4   ? -25.125  21.805  352.375 1.00 111.48 ? 4   VAL 3 CB    1 
ATOM   4855  C  CG1   . VAL C  3  4   ? -26.368  21.104  352.912 1.00 113.58 ? 4   VAL 3 CG1   1 
ATOM   4856  C  CG2   . VAL C  3  4   ? -24.696  22.900  353.338 1.00 114.50 ? 4   VAL 3 CG2   1 
ATOM   4857  N  N     . LYS C  3  5   ? -25.084  18.772  351.422 1.00 103.40 ? 5   LYS 3 N     1 
ATOM   4858  C  CA    . LYS C  3  5   ? -25.467  17.704  350.506 1.00 96.74  ? 5   LYS 3 CA    1 
ATOM   4859  C  C     . LYS C  3  5   ? -26.981  17.546  350.469 1.00 91.77  ? 5   LYS 3 C     1 
ATOM   4860  O  O     . LYS C  3  5   ? -27.619  17.377  351.513 1.00 86.66  ? 5   LYS 3 O     1 
ATOM   4861  C  CB    . LYS C  3  5   ? -24.833  16.367  350.902 1.00 101.31 ? 5   LYS 3 CB    1 
ATOM   4862  C  CG    . LYS C  3  5   ? -25.015  15.281  349.844 1.00 108.73 ? 5   LYS 3 CG    1 
ATOM   4863  C  CD    . LYS C  3  5   ? -24.342  13.968  350.219 1.00 111.35 ? 5   LYS 3 CD    1 
ATOM   4864  C  CE    . LYS C  3  5   ? -25.217  12.778  349.845 1.00 108.32 ? 5   LYS 3 CE    1 
ATOM   4865  N  NZ    . LYS C  3  5   ? -26.337  12.557  350.796 1.00 104.72 ? 5   LYS 3 NZ    1 
ATOM   4866  N  N     . VAL C  3  6   ? -27.544  17.605  349.261 1.00 98.70  ? 6   VAL 3 N     1 
ATOM   4867  C  CA    . VAL C  3  6   ? -28.950  17.295  349.025 1.00 104.74 ? 6   VAL 3 CA    1 
ATOM   4868  C  C     . VAL C  3  6   ? -29.050  15.998  348.228 1.00 100.88 ? 6   VAL 3 C     1 
ATOM   4869  O  O     . VAL C  3  6   ? -28.963  15.992  346.993 1.00 97.18  ? 6   VAL 3 O     1 
ATOM   4870  C  CB    . VAL C  3  6   ? -29.670  18.449  348.302 1.00 109.58 ? 6   VAL 3 CB    1 
ATOM   4871  C  CG1   . VAL C  3  6   ? -31.145  18.122  348.115 1.00 112.29 ? 6   VAL 3 CG1   1 
ATOM   4872  C  CG2   . VAL C  3  6   ? -29.505  19.748  349.080 1.00 106.59 ? 6   VAL 3 CG2   1 
ATOM   4873  N  N     . ASN C  3  7   ? -29.115  14.886  348.952 1.00 102.31 ? 7   ASN 3 N     1 
ATOM   4874  C  CA    . ASN C  3  7   ? -29.620  13.590  348.515 1.00 111.59 ? 7   ASN 3 CA    1 
ATOM   4875  C  C     . ASN C  3  7   ? -28.794  12.918  347.428 1.00 121.37 ? 7   ASN 3 C     1 
ATOM   4876  O  O     . ASN C  3  7   ? -28.783  11.686  347.336 1.00 124.62 ? 7   ASN 3 O     1 
ATOM   4877  C  CB    . ASN C  3  7   ? -31.042  13.767  347.982 1.00 113.72 ? 7   ASN 3 CB    1 
ATOM   4878  C  CG    . ASN C  3  7   ? -32.097  13.537  349.030 1.00 117.34 ? 7   ASN 3 CG    1 
ATOM   4879  O  OD1   . ASN C  3  7   ? -32.812  14.461  349.406 1.00 119.54 ? 7   ASN 3 OD1   1 
ATOM   4880  N  ND2   . ASN C  3  7   ? -32.223  12.299  349.489 1.00 117.91 ? 7   ASN 3 ND2   1 
ATOM   4881  N  N     . ASP C  3  8   ? -28.104  13.702  346.601 1.00 126.45 ? 8   ASP 3 N     1 
ATOM   4882  C  CA    . ASP C  3  8   ? -27.044  13.185  345.747 1.00 130.83 ? 8   ASP 3 CA    1 
ATOM   4883  C  C     . ASP C  3  8   ? -26.062  14.277  345.339 1.00 125.24 ? 8   ASP 3 C     1 
ATOM   4884  O  O     . ASP C  3  8   ? -25.091  14.000  344.628 1.00 124.48 ? 8   ASP 3 O     1 
ATOM   4885  C  CB    . ASP C  3  8   ? -27.640  12.500  344.514 1.00 139.35 ? 8   ASP 3 CB    1 
ATOM   4886  C  CG    . ASP C  3  8   ? -28.522  13.424  343.696 1.00 145.65 ? 8   ASP 3 CG    1 
ATOM   4887  O  OD1   . ASP C  3  8   ? -28.007  14.390  343.098 1.00 147.64 ? 8   ASP 3 OD1   1 
ATOM   4888  O  OD2   . ASP C  3  8   ? -29.744  13.181  343.654 1.00 144.94 ? 8   ASP 3 OD2   1 
ATOM   4889  N  N     . ARG C  3  9   ? -26.290  15.514  345.776 1.00 120.03 ? 9   ARG 3 N     1 
ATOM   4890  C  CA    . ARG C  3  9   ? -25.543  16.645  345.241 1.00 115.51 ? 9   ARG 3 CA    1 
ATOM   4891  C  C     . ARG C  3  9   ? -24.849  17.431  346.346 1.00 116.94 ? 9   ARG 3 C     1 
ATOM   4892  O  O     . ARG C  3  9   ? -25.325  17.491  347.479 1.00 120.06 ? 9   ARG 3 O     1 
ATOM   4893  C  CB    . ARG C  3  9   ? -26.464  17.574  344.439 1.00 110.35 ? 9   ARG 3 CB    1 
ATOM   4894  C  CG    . ARG C  3  9   ? -26.622  17.164  342.982 1.00 107.94 ? 9   ARG 3 CG    1 
ATOM   4895  C  CD    . ARG C  3  9   ? -27.476  18.145  342.196 1.00 106.78 ? 9   ARG 3 CD    1 
ATOM   4896  N  NE    . ARG C  3  9   ? -28.550  17.456  341.488 1.00 103.60 ? 9   ARG 3 NE    1 
ATOM   4897  C  CZ    . ARG C  3  9   ? -29.840  17.725  341.648 1.00 99.55  ? 9   ARG 3 CZ    1 
ATOM   4898  N  NH1   . ARG C  3  9   ? -30.219  18.670  342.495 1.00 96.08  ? 9   ARG 3 NH1   1 
ATOM   4899  N  NH2   . ARG C  3  9   ? -30.751  17.047  340.966 1.00 99.66  ? 9   ARG 3 NH2   1 
ATOM   4900  N  N     . ILE C  3  10  ? -23.721  18.044  345.995 1.00 114.35 ? 10  ILE 3 N     1 
ATOM   4901  C  CA    . ILE C  3  10  ? -22.932  18.850  346.918 1.00 114.84 ? 10  ILE 3 CA    1 
ATOM   4902  C  C     . ILE C  3  10  ? -22.991  20.300  346.464 1.00 124.96 ? 10  ILE 3 C     1 
ATOM   4903  O  O     . ILE C  3  10  ? -22.839  20.595  345.273 1.00 127.85 ? 10  ILE 3 O     1 
ATOM   4904  C  CB    . ILE C  3  10  ? -21.476  18.354  346.990 1.00 110.92 ? 10  ILE 3 CB    1 
ATOM   4905  C  CG1   . ILE C  3  10  ? -21.433  16.846  347.236 1.00 107.83 ? 10  ILE 3 CG1   1 
ATOM   4906  C  CG2   . ILE C  3  10  ? -20.727  19.075  348.082 1.00 113.83 ? 10  ILE 3 CG2   1 
ATOM   4907  C  CD1   . ILE C  3  10  ? -20.128  16.195  346.819 1.00 105.25 ? 10  ILE 3 CD1   1 
ATOM   4908  N  N     . VAL C  3  11  ? -23.214  21.206  347.415 1.00 130.70 ? 11  VAL 3 N     1 
ATOM   4909  C  CA    . VAL C  3  11  ? -23.422  22.619  347.120 1.00 129.84 ? 11  VAL 3 CA    1 
ATOM   4910  C  C     . VAL C  3  11  ? -22.618  23.467  348.097 1.00 128.62 ? 11  VAL 3 C     1 
ATOM   4911  O  O     . VAL C  3  11  ? -22.536  23.157  349.293 1.00 122.89 ? 11  VAL 3 O     1 
ATOM   4912  C  CB    . VAL C  3  11  ? -24.914  23.021  347.177 1.00 125.62 ? 11  VAL 3 CB    1 
ATOM   4913  C  CG1   . VAL C  3  11  ? -25.126  24.307  346.411 1.00 118.16 ? 11  VAL 3 CG1   1 
ATOM   4914  C  CG2   . VAL C  3  11  ? -25.811  21.923  346.618 1.00 130.14 ? 11  VAL 3 CG2   1 
ATOM   4915  N  N     . GLU C  3  12  ? -22.015  24.533  347.569 1.00 132.99 ? 12  GLU 3 N     1 
ATOM   4916  C  CA    . GLU C  3  12  ? -21.472  25.605  348.387 1.00 135.33 ? 12  GLU 3 CA    1 
ATOM   4917  C  C     . GLU C  3  12  ? -22.604  26.517  348.835 1.00 121.83 ? 12  GLU 3 C     1 
ATOM   4918  O  O     . GLU C  3  12  ? -23.532  26.792  348.070 1.00 123.39 ? 12  GLU 3 O     1 
ATOM   4919  C  CB    . GLU C  3  12  ? -20.453  26.424  347.590 1.00 149.00 ? 12  GLU 3 CB    1 
ATOM   4920  C  CG    . GLU C  3  12  ? -19.288  25.642  347.010 1.00 160.51 ? 12  GLU 3 CG    1 
ATOM   4921  C  CD    . GLU C  3  12  ? -18.422  25.001  348.071 1.00 168.32 ? 12  GLU 3 CD    1 
ATOM   4922  O  OE1   . GLU C  3  12  ? -18.193  25.637  349.121 1.00 171.13 ? 12  GLU 3 OE1   1 
ATOM   4923  O  OE2   . GLU C  3  12  ? -17.962  23.860  347.851 1.00 170.39 ? 12  GLU 3 OE2   1 
ATOM   4924  N  N     . VAL C  3  13  ? -22.523  26.996  350.073 1.00 107.18 ? 13  VAL 3 N     1 
ATOM   4925  C  CA    . VAL C  3  13  ? -23.555  27.895  350.585 1.00 94.38  ? 13  VAL 3 CA    1 
ATOM   4926  C  C     . VAL C  3  13  ? -23.021  28.665  351.791 1.00 104.47 ? 13  VAL 3 C     1 
ATOM   4927  O  O     . VAL C  3  13  ? -22.266  28.105  352.599 1.00 111.29 ? 13  VAL 3 O     1 
ATOM   4928  C  CB    . VAL C  3  13  ? -24.840  27.118  350.928 1.00 73.90  ? 13  VAL 3 CB    1 
ATOM   4929  C  CG1   . VAL C  3  13  ? -24.731  26.393  352.273 1.00 69.53  ? 13  VAL 3 CG1   1 
ATOM   4930  C  CG2   . VAL C  3  13  ? -26.046  28.021  350.873 1.00 65.14  ? 13  VAL 3 CG2   1 
ATOM   4931  N  N     . PRO C  3  14  ? -23.335  29.951  351.929 1.00 103.63 ? 14  PRO 3 N     1 
ATOM   4932  C  CA    . PRO C  3  14  ? -22.932  30.689  353.132 1.00 100.65 ? 14  PRO 3 CA    1 
ATOM   4933  C  C     . PRO C  3  14  ? -23.637  30.138  354.359 1.00 113.27 ? 14  PRO 3 C     1 
ATOM   4934  O  O     . PRO C  3  14  ? -24.714  29.534  354.246 1.00 117.80 ? 14  PRO 3 O     1 
ATOM   4935  C  CB    . PRO C  3  14  ? -23.364  32.132  352.824 1.00 93.30  ? 14  PRO 3 CB    1 
ATOM   4936  C  CG    . PRO C  3  14  ? -24.371  32.012  351.722 1.00 96.53  ? 14  PRO 3 CG    1 
ATOM   4937  C  CD    . PRO C  3  14  ? -23.913  30.844  350.911 1.00 103.14 ? 14  PRO 3 CD    1 
ATOM   4938  N  N     . PRO C  3  15  ? -23.059  30.325  355.551 1.00 120.76 ? 15  PRO 3 N     1 
ATOM   4939  C  CA    . PRO C  3  15  ? -23.558  29.595  356.735 1.00 125.72 ? 15  PRO 3 CA    1 
ATOM   4940  C  C     . PRO C  3  15  ? -24.984  29.929  357.144 1.00 125.42 ? 15  PRO 3 C     1 
ATOM   4941  O  O     . PRO C  3  15  ? -25.714  29.034  357.589 1.00 124.34 ? 15  PRO 3 O     1 
ATOM   4942  C  CB    . PRO C  3  15  ? -22.551  29.987  357.827 1.00 127.47 ? 15  PRO 3 CB    1 
ATOM   4943  C  CG    . PRO C  3  15  ? -21.937  31.266  357.342 1.00 124.79 ? 15  PRO 3 CG    1 
ATOM   4944  C  CD    . PRO C  3  15  ? -21.856  31.116  355.860 1.00 121.69 ? 15  PRO 3 CD    1 
ATOM   4945  N  N     . GLY C  3  16  ? -25.411  31.182  357.007 1.00 122.82 ? 16  GLY 3 N     1 
ATOM   4946  C  CA    . GLY C  3  16  ? -26.713  31.591  357.505 1.00 117.88 ? 16  GLY 3 CA    1 
ATOM   4947  C  C     . GLY C  3  16  ? -27.897  31.078  356.707 1.00 109.95 ? 16  GLY 3 C     1 
ATOM   4948  O  O     . GLY C  3  16  ? -29.024  31.552  356.879 1.00 111.00 ? 16  GLY 3 O     1 
ATOM   4949  N  N     . THR C  3  17  ? -27.654  30.103  355.838 1.00 100.22 ? 17  THR 3 N     1 
ATOM   4950  C  CA    . THR C  3  17  ? -28.681  29.583  354.949 1.00 89.24  ? 17  THR 3 CA    1 
ATOM   4951  C  C     . THR C  3  17  ? -29.544  28.546  355.657 1.00 85.14  ? 17  THR 3 C     1 
ATOM   4952  O  O     . THR C  3  17  ? -29.047  27.731  356.437 1.00 88.79  ? 17  THR 3 O     1 
ATOM   4953  C  CB    . THR C  3  17  ? -28.024  28.963  353.717 1.00 81.75  ? 17  THR 3 CB    1 
ATOM   4954  O  OG1   . THR C  3  17  ? -27.318  29.979  352.997 1.00 74.11  ? 17  THR 3 OG1   1 
ATOM   4955  C  CG2   . THR C  3  17  ? -29.058  28.340  352.800 1.00 85.78  ? 17  THR 3 CG2   1 
ATOM   4956  N  N     . SER C  3  18  ? -30.846  28.582  355.386 1.00 74.70  ? 18  SER 3 N     1 
ATOM   4957  C  CA    . SER C  3  18  ? -31.742  27.538  355.859 1.00 68.20  ? 18  SER 3 CA    1 
ATOM   4958  C  C     . SER C  3  18  ? -31.596  26.279  355.010 1.00 55.62  ? 18  SER 3 C     1 
ATOM   4959  O  O     . SER C  3  18  ? -31.206  26.332  353.841 1.00 45.01  ? 18  SER 3 O     1 
ATOM   4960  C  CB    . SER C  3  18  ? -33.192  28.016  355.831 1.00 70.75  ? 18  SER 3 CB    1 
ATOM   4961  O  OG    . SER C  3  18  ? -34.097  26.932  355.941 1.00 78.18  ? 18  SER 3 OG    1 
ATOM   4962  N  N     . VAL C  3  19  ? -31.911  25.134  355.622 1.00 54.31  ? 19  VAL 3 N     1 
ATOM   4963  C  CA    . VAL C  3  19  ? -31.816  23.854  354.923 1.00 52.91  ? 19  VAL 3 CA    1 
ATOM   4964  C  C     . VAL C  3  19  ? -32.673  23.860  353.662 1.00 63.29  ? 19  VAL 3 C     1 
ATOM   4965  O  O     . VAL C  3  19  ? -32.246  23.389  352.604 1.00 65.55  ? 19  VAL 3 O     1 
ATOM   4966  C  CB    . VAL C  3  19  ? -32.220  22.703  355.865 1.00 43.50  ? 19  VAL 3 CB    1 
ATOM   4967  C  CG1   . VAL C  3  19  ? -32.326  21.399  355.096 1.00 43.31  ? 19  VAL 3 CG1   1 
ATOM   4968  C  CG2   . VAL C  3  19  ? -31.234  22.565  357.012 1.00 43.33  ? 19  VAL 3 CG2   1 
ATOM   4969  N  N     . MET C  3  20  ? -33.888  24.401  353.752 1.00 66.09  ? 20  MET 3 N     1 
ATOM   4970  C  CA    . MET C  3  20  ? -34.779  24.429  352.594 1.00 68.98  ? 20  MET 3 CA    1 
ATOM   4971  C  C     . MET C  3  20  ? -34.184  25.235  351.447 1.00 67.71  ? 20  MET 3 C     1 
ATOM   4972  O  O     . MET C  3  20  ? -34.267  24.830  350.278 1.00 66.95  ? 20  MET 3 O     1 
ATOM   4973  C  CB    . MET C  3  20  ? -36.133  25.002  352.997 1.00 69.75  ? 20  MET 3 CB    1 
ATOM   4974  C  CG    . MET C  3  20  ? -37.073  25.220  351.839 1.00 75.36  ? 20  MET 3 CG    1 
ATOM   4975  S  SD    . MET C  3  20  ? -38.772  25.267  352.406 1.00 82.78  ? 20  MET 3 SD    1 
ATOM   4976  C  CE    . MET C  3  20  ? -38.804  26.911  353.101 1.00 87.81  ? 20  MET 3 CE    1 
ATOM   4977  N  N     . ASP C  3  21  ? -33.615  26.399  351.758 1.00 64.68  ? 21  ASP 3 N     1 
ATOM   4978  C  CA    . ASP C  3  21  ? -33.040  27.237  350.713 1.00 61.99  ? 21  ASP 3 CA    1 
ATOM   4979  C  C     . ASP C  3  21  ? -31.860  26.546  350.048 1.00 59.81  ? 21  ASP 3 C     1 
ATOM   4980  O  O     . ASP C  3  21  ? -31.699  26.619  348.828 1.00 60.53  ? 21  ASP 3 O     1 
ATOM   4981  C  CB    . ASP C  3  21  ? -32.624  28.586  351.290 1.00 63.26  ? 21  ASP 3 CB    1 
ATOM   4982  C  CG    . ASP C  3  21  ? -33.806  29.479  351.569 1.00 60.62  ? 21  ASP 3 CG    1 
ATOM   4983  O  OD1   . ASP C  3  21  ? -34.537  29.805  350.613 1.00 61.12  ? 21  ASP 3 OD1   1 
ATOM   4984  O  OD2   . ASP C  3  21  ? -34.005  29.856  352.739 1.00 59.42  ? 21  ASP 3 OD2   1 
ATOM   4985  N  N     . ALA C  3  22  ? -31.038  25.847  350.831 1.00 57.80  ? 22  ALA 3 N     1 
ATOM   4986  C  CA    . ALA C  3  22  ? -29.941  25.088  350.244 1.00 60.03  ? 22  ALA 3 CA    1 
ATOM   4987  C  C     . ALA C  3  22  ? -30.469  23.950  349.376 1.00 75.25  ? 22  ALA 3 C     1 
ATOM   4988  O  O     . ALA C  3  22  ? -29.891  23.641  348.326 1.00 78.27  ? 22  ALA 3 O     1 
ATOM   4989  C  CB    . ALA C  3  22  ? -29.025  24.557  351.347 1.00 60.29  ? 22  ALA 3 CB    1 
ATOM   4990  N  N     . VAL C  3  23  ? -31.567  23.320  349.800 1.00 79.26  ? 23  VAL 3 N     1 
ATOM   4991  C  CA    . VAL C  3  23  ? -32.199  22.272  348.998 1.00 79.05  ? 23  VAL 3 CA    1 
ATOM   4992  C  C     . VAL C  3  23  ? -32.577  22.815  347.628 1.00 78.64  ? 23  VAL 3 C     1 
ATOM   4993  O  O     . VAL C  3  23  ? -32.190  22.266  346.590 1.00 83.03  ? 23  VAL 3 O     1 
ATOM   4994  C  CB    . VAL C  3  23  ? -33.427  21.699  349.727 1.00 74.81  ? 23  VAL 3 CB    1 
ATOM   4995  C  CG1   . VAL C  3  23  ? -34.265  20.850  348.776 1.00 76.28  ? 23  VAL 3 CG1   1 
ATOM   4996  C  CG2   . VAL C  3  23  ? -32.998  20.875  350.928 1.00 73.18  ? 23  VAL 3 CG2   1 
ATOM   4997  N  N     . PHE C  3  24  ? -33.353  23.900  347.608 1.00 70.84  ? 24  PHE 3 N     1 
ATOM   4998  C  CA    . PHE C  3  24  ? -33.758  24.478  346.327 1.00 64.82  ? 24  PHE 3 CA    1 
ATOM   4999  C  C     . PHE C  3  24  ? -32.555  24.969  345.537 1.00 54.75  ? 24  PHE 3 C     1 
ATOM   5000  O  O     . PHE C  3  24  ? -32.568  24.947  344.301 1.00 46.46  ? 24  PHE 3 O     1 
ATOM   5001  C  CB    . PHE C  3  24  ? -34.757  25.613  346.534 1.00 65.69  ? 24  PHE 3 CB    1 
ATOM   5002  C  CG    . PHE C  3  24  ? -36.155  25.138  346.771 1.00 58.42  ? 24  PHE 3 CG    1 
ATOM   5003  C  CD1   . PHE C  3  24  ? -36.972  24.810  345.708 1.00 51.59  ? 24  PHE 3 CD1   1 
ATOM   5004  C  CD2   . PHE C  3  24  ? -36.658  25.028  348.049 1.00 55.48  ? 24  PHE 3 CD2   1 
ATOM   5005  C  CE1   . PHE C  3  24  ? -38.251  24.369  345.920 1.00 45.50  ? 24  PHE 3 CE1   1 
ATOM   5006  C  CE2   . PHE C  3  24  ? -37.942  24.594  348.259 1.00 51.85  ? 24  PHE 3 CE2   1 
ATOM   5007  C  CZ    . PHE C  3  24  ? -38.736  24.263  347.195 1.00 45.20  ? 24  PHE 3 CZ    1 
ATOM   5008  N  N     . HIS C  3  25  ? -31.512  25.413  346.237 1.00 62.45  ? 25  HIS 3 N     1 
ATOM   5009  C  CA    . HIS C  3  25  ? -30.264  25.783  345.587 1.00 73.83  ? 25  HIS 3 CA    1 
ATOM   5010  C  C     . HIS C  3  25  ? -29.637  24.589  344.884 1.00 79.79  ? 25  HIS 3 C     1 
ATOM   5011  O  O     . HIS C  3  25  ? -28.965  24.752  343.859 1.00 75.06  ? 25  HIS 3 O     1 
ATOM   5012  C  CB    . HIS C  3  25  ? -29.318  26.370  346.637 1.00 72.36  ? 25  HIS 3 CB    1 
ATOM   5013  C  CG    . HIS C  3  25  ? -28.085  26.992  346.071 1.00 64.00  ? 25  HIS 3 CG    1 
ATOM   5014  N  ND1   . HIS C  3  25  ? -28.066  27.627  344.848 1.00 62.62  ? 25  HIS 3 ND1   1 
ATOM   5015  C  CD2   . HIS C  3  25  ? -26.832  27.092  346.570 1.00 62.71  ? 25  HIS 3 CD2   1 
ATOM   5016  C  CE1   . HIS C  3  25  ? -26.847  28.077  344.612 1.00 66.53  ? 25  HIS 3 CE1   1 
ATOM   5017  N  NE2   . HIS C  3  25  ? -26.079  27.765  345.641 1.00 65.90  ? 25  HIS 3 NE2   1 
ATOM   5018  N  N     . ALA C  3  26  ? -29.861  23.384  345.408 1.00 89.07  ? 26  ALA 3 N     1 
ATOM   5019  C  CA    . ALA C  3  26  ? -29.459  22.158  344.731 1.00 99.39  ? 26  ALA 3 CA    1 
ATOM   5020  C  C     . ALA C  3  26  ? -30.453  21.722  343.663 1.00 110.52 ? 26  ALA 3 C     1 
ATOM   5021  O  O     . ALA C  3  26  ? -30.124  20.851  342.852 1.00 115.22 ? 26  ALA 3 O     1 
ATOM   5022  C  CB    . ALA C  3  26  ? -29.274  21.028  345.742 1.00 95.74  ? 26  ALA 3 CB    1 
ATOM   5023  N  N     . GLY C  3  27  ? -31.650  22.300  343.640 1.00 113.03 ? 27  GLY 3 N     1 
ATOM   5024  C  CA    . GLY C  3  27  ? -32.643  21.976  342.642 1.00 112.82 ? 27  GLY 3 CA    1 
ATOM   5025  C  C     . GLY C  3  27  ? -33.650  20.926  343.049 1.00 112.28 ? 27  GLY 3 C     1 
ATOM   5026  O  O     . GLY C  3  27  ? -34.491  20.548  342.223 1.00 115.20 ? 27  GLY 3 O     1 
ATOM   5027  N  N     . TYR C  3  28  ? -33.605  20.451  344.289 1.00 109.07 ? 28  TYR 3 N     1 
ATOM   5028  C  CA    . TYR C  3  28  ? -34.612  19.528  344.779 1.00 108.36 ? 28  TYR 3 CA    1 
ATOM   5029  C  C     . TYR C  3  28  ? -35.814  20.323  345.280 1.00 101.27 ? 28  TYR 3 C     1 
ATOM   5030  O  O     . TYR C  3  28  ? -35.909  21.539  345.091 1.00 101.57 ? 28  TYR 3 O     1 
ATOM   5031  C  CB    . TYR C  3  28  ? -34.027  18.598  345.840 1.00 117.09 ? 28  TYR 3 CB    1 
ATOM   5032  C  CG    . TYR C  3  28  ? -33.385  17.367  345.239 1.00 127.27 ? 28  TYR 3 CG    1 
ATOM   5033  C  CD1   . TYR C  3  28  ? -32.072  17.388  344.790 1.00 131.99 ? 28  TYR 3 CD1   1 
ATOM   5034  C  CD2   . TYR C  3  28  ? -34.103  16.188  345.097 1.00 127.07 ? 28  TYR 3 CD2   1 
ATOM   5035  C  CE1   . TYR C  3  28  ? -31.492  16.263  344.229 1.00 131.48 ? 28  TYR 3 CE1   1 
ATOM   5036  C  CE2   . TYR C  3  28  ? -33.531  15.064  344.538 1.00 126.85 ? 28  TYR 3 CE2   1 
ATOM   5037  C  CZ    . TYR C  3  28  ? -32.227  15.108  344.106 1.00 130.41 ? 28  TYR 3 CZ    1 
ATOM   5038  O  OH    . TYR C  3  28  ? -31.661  13.989  343.548 1.00 136.36 ? 28  TYR 3 OH    1 
ATOM   5039  N  N     . ASP C  3  29  ? -36.751  19.638  345.924 1.00 97.74  ? 29  ASP 3 N     1 
ATOM   5040  C  CA    . ASP C  3  29  ? -38.042  20.233  346.215 1.00 98.20  ? 29  ASP 3 CA    1 
ATOM   5041  C  C     . ASP C  3  29  ? -38.579  19.702  347.534 1.00 84.22  ? 29  ASP 3 C     1 
ATOM   5042  O  O     . ASP C  3  29  ? -38.255  18.589  347.958 1.00 85.33  ? 29  ASP 3 O     1 
ATOM   5043  C  CB    . ASP C  3  29  ? -39.012  19.972  345.059 1.00 112.56 ? 29  ASP 3 CB    1 
ATOM   5044  C  CG    . ASP C  3  29  ? -38.909  18.561  344.523 1.00 126.09 ? 29  ASP 3 CG    1 
ATOM   5045  O  OD1   . ASP C  3  29  ? -37.802  17.987  344.572 1.00 130.28 ? 29  ASP 3 OD1   1 
ATOM   5046  O  OD2   . ASP C  3  29  ? -39.925  18.028  344.035 1.00 131.68 ? 29  ASP 3 OD2   1 
ATOM   5047  N  N     . VAL C  3  30  ? -39.423  20.513  348.163 1.00 68.94  ? 30  VAL 3 N     1 
ATOM   5048  C  CA    . VAL C  3  30  ? -39.917  20.293  349.519 1.00 57.13  ? 30  VAL 3 CA    1 
ATOM   5049  C  C     . VAL C  3  30  ? -41.131  21.198  349.705 1.00 60.43  ? 30  VAL 3 C     1 
ATOM   5050  O  O     . VAL C  3  30  ? -41.135  22.330  349.195 1.00 62.35  ? 30  VAL 3 O     1 
ATOM   5051  C  CB    . VAL C  3  30  ? -38.815  20.562  350.562 1.00 45.40  ? 30  VAL 3 CB    1 
ATOM   5052  C  CG1   . VAL C  3  30  ? -38.260  21.962  350.419 1.00 43.98  ? 30  VAL 3 CG1   1 
ATOM   5053  C  CG2   . VAL C  3  30  ? -39.325  20.351  351.974 1.00 44.75  ? 30  VAL 3 CG2   1 
ATOM   5054  N  N     . PRO C  3  31  ? -42.202  20.730  350.366 1.00 64.12  ? 31  PRO 3 N     1 
ATOM   5055  C  CA    . PRO C  3  31  ? -43.401  21.566  350.527 1.00 70.53  ? 31  PRO 3 CA    1 
ATOM   5056  C  C     . PRO C  3  31  ? -43.098  22.912  351.164 1.00 75.92  ? 31  PRO 3 C     1 
ATOM   5057  O  O     . PRO C  3  31  ? -42.051  23.081  351.800 1.00 76.21  ? 31  PRO 3 O     1 
ATOM   5058  C  CB    . PRO C  3  31  ? -44.302  20.713  351.426 1.00 67.40  ? 31  PRO 3 CB    1 
ATOM   5059  C  CG    . PRO C  3  31  ? -43.889  19.321  351.147 1.00 64.57  ? 31  PRO 3 CG    1 
ATOM   5060  C  CD    . PRO C  3  31  ? -42.422  19.354  350.845 1.00 63.22  ? 31  PRO 3 CD    1 
ATOM   5061  N  N     . LEU C  3  32  ? -43.998  23.880  350.998 1.00 77.67  ? 32  LEU 3 N     1 
ATOM   5062  C  CA    . LEU C  3  32  ? -43.742  25.232  351.486 1.00 83.57  ? 32  LEU 3 CA    1 
ATOM   5063  C  C     . LEU C  3  32  ? -45.079  25.921  351.751 1.00 86.92  ? 32  LEU 3 C     1 
ATOM   5064  O  O     . LEU C  3  32  ? -45.759  26.336  350.807 1.00 88.50  ? 32  LEU 3 O     1 
ATOM   5065  C  CB    . LEU C  3  32  ? -42.919  26.013  350.471 1.00 92.75  ? 32  LEU 3 CB    1 
ATOM   5066  C  CG    . LEU C  3  32  ? -42.787  27.509  350.749 1.00 104.94 ? 32  LEU 3 CG    1 
ATOM   5067  C  CD1   . LEU C  3  32  ? -42.111  27.748  352.084 1.00 107.45 ? 32  LEU 3 CD1   1 
ATOM   5068  C  CD2   . LEU C  3  32  ? -42.060  28.213  349.616 1.00 110.55 ? 32  LEU 3 CD2   1 
ATOM   5069  N  N     . PHE C  3  33  ? -45.455  26.022  353.025 1.00 87.29  ? 33  PHE 3 N     1 
ATOM   5070  C  CA    . PHE C  3  33  ? -46.587  26.847  353.436 1.00 81.69  ? 33  PHE 3 CA    1 
ATOM   5071  C  C     . PHE C  3  33  ? -46.211  27.892  354.473 1.00 73.74  ? 33  PHE 3 C     1 
ATOM   5072  O  O     . PHE C  3  33  ? -46.605  29.057  354.345 1.00 75.13  ? 33  PHE 3 O     1 
ATOM   5073  C  CB    . PHE C  3  33  ? -47.718  25.972  353.993 1.00 82.12  ? 33  PHE 3 CB    1 
ATOM   5074  C  CG    . PHE C  3  33  ? -48.487  25.242  352.948 1.00 77.99  ? 33  PHE 3 CG    1 
ATOM   5075  C  CD1   . PHE C  3  33  ? -48.614  25.762  351.677 1.00 74.11  ? 33  PHE 3 CD1   1 
ATOM   5076  C  CD2   . PHE C  3  33  ? -49.083  24.032  353.236 1.00 73.26  ? 33  PHE 3 CD2   1 
ATOM   5077  C  CE1   . PHE C  3  33  ? -49.317  25.090  350.714 1.00 68.55  ? 33  PHE 3 CE1   1 
ATOM   5078  C  CE2   . PHE C  3  33  ? -49.789  23.359  352.274 1.00 70.34  ? 33  PHE 3 CE2   1 
ATOM   5079  C  CZ    . PHE C  3  33  ? -49.902  23.890  351.014 1.00 67.65  ? 33  PHE 3 CZ    1 
ATOM   5080  N  N     . CYS C  3  34  ? -45.463  27.505  355.507 1.00 66.93  ? 34  CYS 3 N     1 
ATOM   5081  C  CA    . CYS C  3  34  ? -45.235  28.401  356.634 1.00 67.85  ? 34  CYS 3 CA    1 
ATOM   5082  C  C     . CYS C  3  34  ? -44.341  29.575  356.248 1.00 76.41  ? 34  CYS 3 C     1 
ATOM   5083  O  O     . CYS C  3  34  ? -44.654  30.733  356.550 1.00 77.62  ? 34  CYS 3 O     1 
ATOM   5084  C  CB    . CYS C  3  34  ? -44.621  27.628  357.793 1.00 62.77  ? 34  CYS 3 CB    1 
ATOM   5085  S  SG    . CYS C  3  34  ? -42.846  27.677  357.746 1.00 67.82  ? 34  CYS 3 SG    1 
ATOM   5086  N  N     . SER C  3  35  ? -43.221  29.298  355.591 1.00 81.43  ? 35  SER 3 N     1 
ATOM   5087  C  CA    . SER C  3  35  ? -42.211  30.313  355.339 1.00 86.91  ? 35  SER 3 CA    1 
ATOM   5088  C  C     . SER C  3  35  ? -42.461  31.055  354.027 1.00 82.07  ? 35  SER 3 C     1 
ATOM   5089  O  O     . SER C  3  35  ? -43.105  30.548  353.105 1.00 73.30  ? 35  SER 3 O     1 
ATOM   5090  C  CB    . SER C  3  35  ? -40.818  29.677  355.317 1.00 92.70  ? 35  SER 3 CB    1 
ATOM   5091  O  OG    . SER C  3  35  ? -40.655  28.778  356.402 1.00 92.26  ? 35  SER 3 OG    1 
ATOM   5092  N  N     . GLU C  3  36  ? -41.933  32.279  353.957 1.00 82.05  ? 36  GLU 3 N     1 
ATOM   5093  C  CA    . GLU C  3  36  ? -42.139  33.146  352.805 1.00 75.21  ? 36  GLU 3 CA    1 
ATOM   5094  C  C     . GLU C  3  36  ? -40.981  34.131  352.702 1.00 64.47  ? 36  GLU 3 C     1 
ATOM   5095  O  O     . GLU C  3  36  ? -40.317  34.441  353.696 1.00 52.98  ? 36  GLU 3 O     1 
ATOM   5096  C  CB    . GLU C  3  36  ? -43.479  33.891  352.900 1.00 74.42  ? 36  GLU 3 CB    1 
ATOM   5097  C  CG    . GLU C  3  36  ? -43.813  34.792  351.714 1.00 69.71  ? 36  GLU 3 CG    1 
ATOM   5098  C  CD    . GLU C  3  36  ? -44.041  34.018  350.430 1.00 65.99  ? 36  GLU 3 CD    1 
ATOM   5099  O  OE1   . GLU C  3  36  ? -43.050  33.575  349.814 1.00 66.22  ? 36  GLU 3 OE1   1 
ATOM   5100  O  OE2   . GLU C  3  36  ? -45.209  33.861  350.028 1.00 61.65  ? 36  GLU 3 OE2   1 
ATOM   5101  N  N     . LYS C  3  37  ? -40.743  34.606  351.479 1.00 69.60  ? 37  LYS 3 N     1 
ATOM   5102  C  CA    . LYS C  3  37  ? -39.680  35.566  351.209 1.00 72.42  ? 37  LYS 3 CA    1 
ATOM   5103  C  C     . LYS C  3  37  ? -39.814  36.815  352.069 1.00 68.46  ? 37  LYS 3 C     1 
ATOM   5104  O  O     . LYS C  3  37  ? -40.912  37.331  352.280 1.00 65.24  ? 37  LYS 3 O     1 
ATOM   5105  C  CB    . LYS C  3  37  ? -39.696  35.964  349.731 1.00 78.85  ? 37  LYS 3 CB    1 
ATOM   5106  C  CG    . LYS C  3  37  ? -39.483  34.818  348.756 1.00 82.64  ? 37  LYS 3 CG    1 
ATOM   5107  C  CD    . LYS C  3  37  ? -40.108  35.129  347.404 1.00 86.47  ? 37  LYS 3 CD    1 
ATOM   5108  C  CE    . LYS C  3  37  ? -39.996  33.941  346.467 1.00 91.02  ? 37  LYS 3 CE    1 
ATOM   5109  N  NZ    . LYS C  3  37  ? -40.265  34.312  345.052 1.00 93.69  ? 37  LYS 3 NZ    1 
ATOM   5110  N  N     . HIS C  3  38  ? -38.676  37.305  352.553 1.00 72.60  ? 38  HIS 3 N     1 
ATOM   5111  C  CA    . HIS C  3  38  ? -38.538  38.563  353.283 1.00 74.96  ? 38  HIS 3 CA    1 
ATOM   5112  C  C     . HIS C  3  38  ? -39.427  38.648  354.519 1.00 74.82  ? 38  HIS 3 C     1 
ATOM   5113  O  O     . HIS C  3  38  ? -39.601  39.740  355.076 1.00 67.68  ? 38  HIS 3 O     1 
ATOM   5114  C  CB    . HIS C  3  38  ? -38.802  39.757  352.365 1.00 75.27  ? 38  HIS 3 CB    1 
ATOM   5115  C  CG    . HIS C  3  38  ? -37.942  39.771  351.141 1.00 73.68  ? 38  HIS 3 CG    1 
ATOM   5116  N  ND1   . HIS C  3  38  ? -36.602  40.097  351.175 1.00 76.65  ? 38  HIS 3 ND1   1 
ATOM   5117  C  CD2   . HIS C  3  38  ? -38.232  39.495  349.847 1.00 75.17  ? 38  HIS 3 CD2   1 
ATOM   5118  C  CE1   . HIS C  3  38  ? -36.103  40.020  349.954 1.00 75.77  ? 38  HIS 3 CE1   1 
ATOM   5119  N  NE2   . HIS C  3  38  ? -37.073  39.663  349.129 1.00 74.96  ? 38  HIS 3 NE2   1 
ATOM   5120  N  N     . LEU C  3  39  ? -39.980  37.526  354.971 1.00 81.45  ? 39  LEU 3 N     1 
ATOM   5121  C  CA    . LEU C  3  39  ? -40.802  37.463  356.168 1.00 86.52  ? 39  LEU 3 CA    1 
ATOM   5122  C  C     . LEU C  3  39  ? -40.221  36.440  357.133 1.00 83.74  ? 39  LEU 3 C     1 
ATOM   5123  O  O     . LEU C  3  39  ? -39.603  35.454  356.720 1.00 87.40  ? 39  LEU 3 O     1 
ATOM   5124  C  CB    . LEU C  3  39  ? -42.253  37.115  355.829 1.00 93.72  ? 39  LEU 3 CB    1 
ATOM   5125  C  CG    . LEU C  3  39  ? -43.007  38.232  355.109 1.00 97.43  ? 39  LEU 3 CG    1 
ATOM   5126  C  CD1   . LEU C  3  39  ? -44.502  37.968  355.094 1.00 95.51  ? 39  LEU 3 CD1   1 
ATOM   5127  C  CD2   . LEU C  3  39  ? -42.716  39.550  355.791 1.00 99.45  ? 39  LEU 3 CD2   1 
ATOM   5128  N  N     . SER C  3  40  ? -40.418  36.691  358.421 1.00 76.67  ? 40  SER 3 N     1 
ATOM   5129  C  CA    . SER C  3  40  ? -39.881  35.827  359.460 1.00 76.07  ? 40  SER 3 CA    1 
ATOM   5130  C  C     . SER C  3  40  ? -40.468  34.427  359.339 1.00 85.22  ? 40  SER 3 C     1 
ATOM   5131  O  O     . SER C  3  40  ? -41.683  34.259  359.489 1.00 93.16  ? 40  SER 3 O     1 
ATOM   5132  C  CB    . SER C  3  40  ? -40.192  36.411  360.833 1.00 71.57  ? 40  SER 3 CB    1 
ATOM   5133  O  OG    . SER C  3  40  ? -41.585  36.594  361.010 1.00 69.78  ? 40  SER 3 OG    1 
ATOM   5134  N  N     . PRO C  3  41  ? -39.660  33.410  359.063 1.00 81.38  ? 41  PRO 3 N     1 
ATOM   5135  C  CA    . PRO C  3  41  ? -40.196  32.050  358.970 1.00 75.11  ? 41  PRO 3 CA    1 
ATOM   5136  C  C     . PRO C  3  41  ? -40.305  31.404  360.341 1.00 74.86  ? 41  PRO 3 C     1 
ATOM   5137  O  O     . PRO C  3  41  ? -39.427  31.561  361.192 1.00 75.14  ? 41  PRO 3 O     1 
ATOM   5138  C  CB    . PRO C  3  41  ? -39.162  31.333  358.098 1.00 73.65  ? 41  PRO 3 CB    1 
ATOM   5139  C  CG    . PRO C  3  41  ? -37.885  32.014  358.457 1.00 75.93  ? 41  PRO 3 CG    1 
ATOM   5140  C  CD    . PRO C  3  41  ? -38.237  33.462  358.683 1.00 80.21  ? 41  PRO 3 CD    1 
ATOM   5141  N  N     . ILE C  3  42  ? -41.399  30.680  360.556 1.00 76.34  ? 42  ILE 3 N     1 
ATOM   5142  C  CA    . ILE C  3  42  ? -41.562  29.848  361.744 1.00 78.46  ? 42  ILE 3 CA    1 
ATOM   5143  C  C     . ILE C  3  42  ? -42.262  28.558  361.343 1.00 78.99  ? 42  ILE 3 C     1 
ATOM   5144  O  O     . ILE C  3  42  ? -43.252  28.583  360.606 1.00 81.09  ? 42  ILE 3 O     1 
ATOM   5145  C  CB    . ILE C  3  42  ? -42.298  30.587  362.891 1.00 72.12  ? 42  ILE 3 CB    1 
ATOM   5146  C  CG1   . ILE C  3  42  ? -43.674  31.160  362.493 1.00 63.77  ? 42  ILE 3 CG1   1 
ATOM   5147  C  CG2   . ILE C  3  42  ? -41.419  31.694  363.472 1.00 74.15  ? 42  ILE 3 CG2   1 
ATOM   5148  C  CD1   . ILE C  3  42  ? -44.705  30.208  361.940 1.00 61.36  ? 42  ILE 3 CD1   1 
ATOM   5149  N  N     . GLY C  3  43  ? -41.709  27.424  361.761 1.00 77.37  ? 43  GLY 3 N     1 
ATOM   5150  C  CA    . GLY C  3  43  ? -42.275  26.162  361.337 1.00 84.51  ? 43  GLY 3 CA    1 
ATOM   5151  C  C     . GLY C  3  43  ? -43.633  25.935  361.959 1.00 97.13  ? 43  GLY 3 C     1 
ATOM   5152  O  O     . GLY C  3  43  ? -43.738  25.561  363.129 1.00 107.66 ? 43  GLY 3 O     1 
ATOM   5153  N  N     . ALA C  3  44  ? -44.681  26.142  361.169 1.00 96.95  ? 44  ALA 3 N     1 
ATOM   5154  C  CA    . ALA C  3  44  ? -46.057  25.964  361.611 1.00 96.72  ? 44  ALA 3 CA    1 
ATOM   5155  C  C     . ALA C  3  44  ? -46.796  24.942  360.767 1.00 92.95  ? 44  ALA 3 C     1 
ATOM   5156  O  O     . ALA C  3  44  ? -47.432  24.032  361.310 1.00 96.47  ? 44  ALA 3 O     1 
ATOM   5157  C  CB    . ALA C  3  44  ? -46.799  27.309  361.583 1.00 100.58 ? 44  ALA 3 CB    1 
ATOM   5158  N  N     . CYS C  3  45  ? -46.723  25.067  359.444 1.00 85.91  ? 45  CYS 3 N     1 
ATOM   5159  C  CA    . CYS C  3  45  ? -47.358  24.098  358.565 1.00 83.43  ? 45  CYS 3 CA    1 
ATOM   5160  C  C     . CYS C  3  45  ? -46.696  22.732  358.652 1.00 81.09  ? 45  CYS 3 C     1 
ATOM   5161  O  O     . CYS C  3  45  ? -47.314  21.734  358.269 1.00 80.89  ? 45  CYS 3 O     1 
ATOM   5162  C  CB    . CYS C  3  45  ? -47.326  24.611  357.130 1.00 86.79  ? 45  CYS 3 CB    1 
ATOM   5163  S  SG    . CYS C  3  45  ? -45.672  24.837  356.441 1.00 88.31  ? 45  CYS 3 SG    1 
ATOM   5164  N  N     . ARG C  3  46  ? -45.460  22.670  359.153 1.00 79.49  ? 46  ARG 3 N     1 
ATOM   5165  C  CA    . ARG C  3  46  ? -44.742  21.410  359.345 1.00 75.40  ? 46  ARG 3 CA    1 
ATOM   5166  C  C     . ARG C  3  46  ? -44.680  20.610  358.050 1.00 66.05  ? 46  ARG 3 C     1 
ATOM   5167  O  O     . ARG C  3  46  ? -44.709  19.378  358.056 1.00 61.52  ? 46  ARG 3 O     1 
ATOM   5168  C  CB    . ARG C  3  46  ? -45.367  20.601  360.482 1.00 77.41  ? 46  ARG 3 CB    1 
ATOM   5169  C  CG    . ARG C  3  46  ? -45.582  21.437  361.737 1.00 77.42  ? 46  ARG 3 CG    1 
ATOM   5170  C  CD    . ARG C  3  46  ? -44.886  20.844  362.945 1.00 75.80  ? 46  ARG 3 CD    1 
ATOM   5171  N  NE    . ARG C  3  46  ? -43.454  20.683  362.721 1.00 69.61  ? 46  ARG 3 NE    1 
ATOM   5172  C  CZ    . ARG C  3  46  ? -42.569  21.671  362.753 1.00 52.91  ? 46  ARG 3 CZ    1 
ATOM   5173  N  NH1   . ARG C  3  46  ? -42.952  22.918  362.982 1.00 42.10  ? 46  ARG 3 NH1   1 
ATOM   5174  N  NH2   . ARG C  3  46  ? -41.291  21.408  362.538 1.00 45.97  ? 46  ARG 3 NH2   1 
ATOM   5175  N  N     . MET C  3  47  ? -44.575  21.324  356.932 1.00 64.10  ? 47  MET 3 N     1 
ATOM   5176  C  CA    . MET C  3  47  ? -44.500  20.718  355.610 1.00 67.89  ? 47  MET 3 CA    1 
ATOM   5177  C  C     . MET C  3  47  ? -43.071  20.487  355.143 1.00 70.65  ? 47  MET 3 C     1 
ATOM   5178  O  O     . MET C  3  47  ? -42.821  19.575  354.347 1.00 73.09  ? 47  MET 3 O     1 
ATOM   5179  C  CB    . MET C  3  47  ? -45.207  21.620  354.597 1.00 67.25  ? 47  MET 3 CB    1 
ATOM   5180  C  CG    . MET C  3  47  ? -46.711  21.569  354.652 1.00 69.16  ? 47  MET 3 CG    1 
ATOM   5181  S  SD    . MET C  3  47  ? -47.328  19.957  354.169 1.00 79.56  ? 47  MET 3 SD    1 
ATOM   5182  C  CE    . MET C  3  47  ? -49.083  20.259  354.212 1.00 81.82  ? 47  MET 3 CE    1 
ATOM   5183  N  N     . CYS C  3  48  ? -42.133  21.285  355.633 1.00 66.44  ? 48  CYS 3 N     1 
ATOM   5184  C  CA    . CYS C  3  48  ? -40.773  21.313  355.125 1.00 64.47  ? 48  CYS 3 CA    1 
ATOM   5185  C  C     . CYS C  3  48  ? -39.921  20.148  355.609 1.00 57.73  ? 48  CYS 3 C     1 
ATOM   5186  O  O     . CYS C  3  48  ? -38.706  20.172  355.404 1.00 56.42  ? 48  CYS 3 O     1 
ATOM   5187  C  CB    . CYS C  3  48  ? -40.112  22.623  355.539 1.00 71.50  ? 48  CYS 3 CB    1 
ATOM   5188  S  SG    . CYS C  3  48  ? -39.592  22.575  357.248 1.00 76.06  ? 48  CYS 3 SG    1 
ATOM   5189  N  N     . LEU C  3  49  ? -40.520  19.129  356.216 1.00 53.96  ? 49  LEU 3 N     1 
ATOM   5190  C  CA    . LEU C  3  49  ? -39.745  18.124  356.932 1.00 56.39  ? 49  LEU 3 CA    1 
ATOM   5191  C  C     . LEU C  3  49  ? -38.830  17.341  355.995 1.00 71.23  ? 49  LEU 3 C     1 
ATOM   5192  O  O     . LEU C  3  49  ? -39.252  16.872  354.935 1.00 72.85  ? 49  LEU 3 O     1 
ATOM   5193  C  CB    . LEU C  3  49  ? -40.693  17.188  357.674 1.00 51.90  ? 49  LEU 3 CB    1 
ATOM   5194  C  CG    . LEU C  3  49  ? -41.576  17.967  358.643 1.00 48.14  ? 49  LEU 3 CG    1 
ATOM   5195  C  CD1   . LEU C  3  49  ? -42.380  17.034  359.504 1.00 55.29  ? 49  LEU 3 CD1   1 
ATOM   5196  C  CD2   . LEU C  3  49  ? -40.708  18.859  359.516 1.00 41.59  ? 49  LEU 3 CD2   1 
ATOM   5197  N  N     . VAL C  3  50  ? -37.562  17.227  356.392 1.00 80.76  ? 50  VAL 3 N     1 
ATOM   5198  C  CA    . VAL C  3  50  ? -36.572  16.399  355.719 1.00 85.86  ? 50  VAL 3 CA    1 
ATOM   5199  C  C     . VAL C  3  50  ? -35.826  15.580  356.767 1.00 96.00  ? 50  VAL 3 C     1 
ATOM   5200  O  O     . VAL C  3  50  ? -36.003  15.756  357.973 1.00 96.39  ? 50  VAL 3 O     1 
ATOM   5201  C  CB    . VAL C  3  50  ? -35.579  17.232  354.880 1.00 77.56  ? 50  VAL 3 CB    1 
ATOM   5202  C  CG1   . VAL C  3  50  ? -36.305  17.991  353.778 1.00 75.97  ? 50  VAL 3 CG1   1 
ATOM   5203  C  CG2   . VAL C  3  50  ? -34.787  18.179  355.768 1.00 73.63  ? 50  VAL 3 CG2   1 
ATOM   5204  N  N     . ARG C  3  51  ? -34.989  14.671  356.284 1.00 104.92 ? 51  ARG 3 N     1 
ATOM   5205  C  CA    . ARG C  3  51  ? -34.087  13.893  357.119 1.00 111.98 ? 51  ARG 3 CA    1 
ATOM   5206  C  C     . ARG C  3  51  ? -32.726  14.572  357.136 1.00 116.46 ? 51  ARG 3 C     1 
ATOM   5207  O  O     . ARG C  3  51  ? -32.290  15.114  356.120 1.00 117.97 ? 51  ARG 3 O     1 
ATOM   5208  C  CB    . ARG C  3  51  ? -33.950  12.468  356.583 1.00 115.27 ? 51  ARG 3 CB    1 
ATOM   5209  C  CG    . ARG C  3  51  ? -33.456  11.456  357.591 1.00 121.12 ? 51  ARG 3 CG    1 
ATOM   5210  C  CD    . ARG C  3  51  ? -33.288  10.103  356.933 1.00 131.81 ? 51  ARG 3 CD    1 
ATOM   5211  N  NE    . ARG C  3  51  ? -33.066  9.042   357.906 1.00 144.34 ? 51  ARG 3 NE    1 
ATOM   5212  C  CZ    . ARG C  3  51  ? -32.686  7.809   357.587 1.00 153.41 ? 51  ARG 3 CZ    1 
ATOM   5213  N  NH1   . ARG C  3  51  ? -32.474  7.485   356.319 1.00 155.53 ? 51  ARG 3 NH1   1 
ATOM   5214  N  NH2   . ARG C  3  51  ? -32.510  6.901   358.537 1.00 156.17 ? 51  ARG 3 NH2   1 
ATOM   5215  N  N     . ILE C  3  52  ? -32.060  14.563  358.290 1.00 117.98 ? 52  ILE 3 N     1 
ATOM   5216  C  CA    . ILE C  3  52  ? -30.794  15.272  358.449 1.00 123.05 ? 52  ILE 3 CA    1 
ATOM   5217  C  C     . ILE C  3  52  ? -29.759  14.329  359.049 1.00 132.24 ? 52  ILE 3 C     1 
ATOM   5218  O  O     . ILE C  3  52  ? -30.041  13.629  360.027 1.00 137.96 ? 52  ILE 3 O     1 
ATOM   5219  C  CB    . ILE C  3  52  ? -30.947  16.536  359.318 1.00 122.06 ? 52  ILE 3 CB    1 
ATOM   5220  C  CG1   . ILE C  3  52  ? -31.587  17.659  358.503 1.00 121.09 ? 52  ILE 3 CG1   1 
ATOM   5221  C  CG2   . ILE C  3  52  ? -29.601  16.998  359.850 1.00 124.43 ? 52  ILE 3 CG2   1 
ATOM   5222  C  CD1   . ILE C  3  52  ? -31.521  19.025  359.166 1.00 120.21 ? 52  ILE 3 CD1   1 
ATOM   5223  N  N     . GLY C  3  53  ? -28.581  14.291  358.442 1.00 135.10 ? 53  GLY 3 N     1 
ATOM   5224  C  CA    . GLY C  3  53  ? -27.444  13.558  358.981 1.00 137.79 ? 53  GLY 3 CA    1 
ATOM   5225  C  C     . GLY C  3  53  ? -26.319  14.511  359.336 1.00 139.38 ? 53  GLY 3 C     1 
ATOM   5226  O  O     . GLY C  3  53  ? -25.991  15.408  358.558 1.00 135.07 ? 53  GLY 3 O     1 
ATOM   5227  N  N     . LEU C  3  54  ? -25.736  14.317  360.516 1.00 146.99 ? 54  LEU 3 N     1 
ATOM   5228  C  CA    . LEU C  3  54  ? -24.643  15.162  361.003 1.00 153.33 ? 54  LEU 3 CA    1 
ATOM   5229  C  C     . LEU C  3  54  ? -23.628  14.302  361.744 1.00 159.22 ? 54  LEU 3 C     1 
ATOM   5230  O  O     . LEU C  3  54  ? -23.543  14.330  362.977 1.00 159.43 ? 54  LEU 3 O     1 
ATOM   5231  C  CB    . LEU C  3  54  ? -25.180  16.284  361.895 1.00 153.33 ? 54  LEU 3 CB    1 
ATOM   5232  C  CG    . LEU C  3  54  ? -24.305  17.534  362.014 1.00 152.92 ? 54  LEU 3 CG    1 
ATOM   5233  C  CD1   . LEU C  3  54  ? -23.679  17.889  360.675 1.00 154.58 ? 54  LEU 3 CD1   1 
ATOM   5234  C  CD2   . LEU C  3  54  ? -25.106  18.706  362.561 1.00 151.69 ? 54  LEU 3 CD2   1 
ATOM   5235  N  N     . PRO C  3  55  ? -22.822  13.518  361.009 1.00 162.21 ? 55  PRO 3 N     1 
ATOM   5236  C  CA    . PRO C  3  55  ? -21.870  12.597  361.630 1.00 162.31 ? 55  PRO 3 CA    1 
ATOM   5237  C  C     . PRO C  3  55  ? -20.504  13.224  361.899 1.00 160.98 ? 55  PRO 3 C     1 
ATOM   5238  O  O     . PRO C  3  55  ? -19.732  12.658  362.676 1.00 158.23 ? 55  PRO 3 O     1 
ATOM   5239  C  CB    . PRO C  3  55  ? -21.756  11.491  360.588 1.00 160.13 ? 55  PRO 3 CB    1 
ATOM   5240  C  CG    . PRO C  3  55  ? -21.891  12.225  359.272 1.00 159.59 ? 55  PRO 3 CG    1 
ATOM   5241  C  CD    . PRO C  3  55  ? -22.698  13.497  359.540 1.00 161.56 ? 55  PRO 3 CD    1 
ATOM   5242  N  N     . ILE C  3  73  ? -21.943  8.283   360.195 1.00 204.46 ? 73  ILE 3 N     1 
ATOM   5243  C  CA    . ILE C  3  73  ? -23.275  8.251   359.607 1.00 201.86 ? 73  ILE 3 CA    1 
ATOM   5244  C  C     . ILE C  3  73  ? -24.334  8.260   360.711 1.00 200.53 ? 73  ILE 3 C     1 
ATOM   5245  O  O     . ILE C  3  73  ? -24.725  7.213   361.227 1.00 203.56 ? 73  ILE 3 O     1 
ATOM   5246  C  CB    . ILE C  3  73  ? -23.423  7.031   358.665 1.00 198.23 ? 73  ILE 3 CB    1 
ATOM   5247  C  CG1   . ILE C  3  73  ? -22.892  5.758   359.333 1.00 193.10 ? 73  ILE 3 CG1   1 
ATOM   5248  C  CG2   . ILE C  3  73  ? -22.686  7.277   357.357 1.00 199.30 ? 73  ILE 3 CG2   1 
ATOM   5249  C  CD1   . ILE C  3  73  ? -23.150  4.494   358.543 1.00 190.11 ? 73  ILE 3 CD1   1 
ATOM   5250  N  N     . GLN C  3  74  ? -24.804  9.456   361.071 1.00 194.84 ? 74  GLN 3 N     1 
ATOM   5251  C  CA    . GLN C  3  74  ? -25.736  9.634   362.187 1.00 191.11 ? 74  GLN 3 CA    1 
ATOM   5252  C  C     . GLN C  3  74  ? -26.934  10.476  361.757 1.00 191.20 ? 74  GLN 3 C     1 
ATOM   5253  O  O     . GLN C  3  74  ? -26.887  11.708  361.804 1.00 189.40 ? 74  GLN 3 O     1 
ATOM   5254  C  CB    . GLN C  3  74  ? -25.021  10.262  363.381 1.00 189.55 ? 74  GLN 3 CB    1 
ATOM   5255  C  CG    . GLN C  3  74  ? -24.430  9.255   364.352 1.00 187.61 ? 74  GLN 3 CG    1 
ATOM   5256  C  CD    . GLN C  3  74  ? -23.838  9.914   365.581 1.00 185.03 ? 74  GLN 3 CD    1 
ATOM   5257  O  OE1   . GLN C  3  74  ? -24.386  10.884  366.104 1.00 184.18 ? 74  GLN 3 OE1   1 
ATOM   5258  N  NE2   . GLN C  3  74  ? -22.710  9.390   366.049 1.00 183.42 ? 74  GLN 3 NE2   1 
ATOM   5259  N  N     . TRP C  3  75  ? -28.008  9.808   361.344 1.00 194.92 ? 75  TRP 3 N     1 
ATOM   5260  C  CA    . TRP C  3  75  ? -29.260  10.498  361.059 1.00 199.26 ? 75  TRP 3 CA    1 
ATOM   5261  C  C     . TRP C  3  75  ? -29.860  11.042  362.351 1.00 191.05 ? 75  TRP 3 C     1 
ATOM   5262  O  O     . TRP C  3  75  ? -29.771  10.410  363.408 1.00 191.08 ? 75  TRP 3 O     1 
ATOM   5263  C  CB    . TRP C  3  75  ? -30.252  9.550   360.386 1.00 210.61 ? 75  TRP 3 CB    1 
ATOM   5264  C  CG    . TRP C  3  75  ? -29.856  9.091   359.009 1.00 221.19 ? 75  TRP 3 CG    1 
ATOM   5265  C  CD1   . TRP C  3  75  ? -29.607  7.810   358.614 1.00 225.14 ? 75  TRP 3 CD1   1 
ATOM   5266  C  CD2   . TRP C  3  75  ? -29.731  9.904   357.834 1.00 224.97 ? 75  TRP 3 CD2   1 
ATOM   5267  N  NE1   . TRP C  3  75  ? -29.301  7.778   357.275 1.00 226.70 ? 75  TRP 3 NE1   1 
ATOM   5268  C  CE2   . TRP C  3  75  ? -29.373  9.050   356.773 1.00 227.88 ? 75  TRP 3 CE2   1 
ATOM   5269  C  CE3   . TRP C  3  75  ? -29.871  11.271  357.580 1.00 228.38 ? 75  TRP 3 CE3   1 
ATOM   5270  C  CZ2   . TRP C  3  75  ? -29.153  9.518   355.480 1.00 230.83 ? 75  TRP 3 CZ2   1 
ATOM   5271  C  CZ3   . TRP C  3  75  ? -29.651  11.733  356.295 1.00 230.51 ? 75  TRP 3 CZ3   1 
ATOM   5272  C  CH2   . TRP C  3  75  ? -29.297  10.858  355.262 1.00 231.35 ? 75  TRP 3 CH2   1 
ATOM   5273  N  N     . GLN C  3  76  ? -30.461  12.228  362.272 1.00 184.88 ? 76  GLN 3 N     1 
ATOM   5274  C  CA    . GLN C  3  76  ? -31.191  12.752  363.418 1.00 177.37 ? 76  GLN 3 CA    1 
ATOM   5275  C  C     . GLN C  3  76  ? -32.348  11.817  363.769 1.00 174.43 ? 76  GLN 3 C     1 
ATOM   5276  O  O     . GLN C  3  76  ? -32.917  11.163  362.889 1.00 173.03 ? 76  GLN 3 O     1 
ATOM   5277  C  CB    . GLN C  3  76  ? -31.716  14.158  363.133 1.00 171.94 ? 76  GLN 3 CB    1 
ATOM   5278  C  CG    . GLN C  3  76  ? -30.658  15.138  362.664 1.00 165.94 ? 76  GLN 3 CG    1 
ATOM   5279  C  CD    . GLN C  3  76  ? -30.186  16.066  363.761 1.00 160.97 ? 76  GLN 3 CD    1 
ATOM   5280  O  OE1   . GLN C  3  76  ? -30.619  17.214  363.849 1.00 159.32 ? 76  GLN 3 OE1   1 
ATOM   5281  N  NE2   . GLN C  3  76  ? -29.292  15.571  364.608 1.00 159.97 ? 76  GLN 3 NE2   1 
ATOM   5282  N  N     . PRO C  3  77  ? -32.711  11.726  365.058 1.00 171.34 ? 77  PRO 3 N     1 
ATOM   5283  C  CA    . PRO C  3  77  ? -33.786  10.804  365.454 1.00 163.23 ? 77  PRO 3 CA    1 
ATOM   5284  C  C     . PRO C  3  77  ? -35.130  11.144  364.830 1.00 151.18 ? 77  PRO 3 C     1 
ATOM   5285  O  O     . PRO C  3  77  ? -35.743  10.299  364.171 1.00 152.40 ? 77  PRO 3 O     1 
ATOM   5286  C  CB    . PRO C  3  77  ? -33.830  10.954  366.983 1.00 166.28 ? 77  PRO 3 CB    1 
ATOM   5287  C  CG    . PRO C  3  77  ? -32.489  11.515  367.357 1.00 169.85 ? 77  PRO 3 CG    1 
ATOM   5288  C  CD    . PRO C  3  77  ? -32.112  12.409  366.217 1.00 172.37 ? 77  PRO 3 CD    1 
ATOM   5289  N  N     . LYS C  3  78  ? -35.587  12.376  365.018 1.00 135.51 ? 78  LYS 3 N     1 
ATOM   5290  C  CA    . LYS C  3  78  ? -36.850  12.841  364.468 1.00 117.31 ? 78  LYS 3 CA    1 
ATOM   5291  C  C     . LYS C  3  78  ? -36.602  13.892  363.395 1.00 111.99 ? 78  LYS 3 C     1 
ATOM   5292  O  O     . LYS C  3  78  ? -35.566  14.560  363.372 1.00 109.95 ? 78  LYS 3 O     1 
ATOM   5293  C  CB    . LYS C  3  78  ? -37.766  13.388  365.568 1.00 105.22 ? 78  LYS 3 CB    1 
ATOM   5294  C  CG    . LYS C  3  78  ? -37.086  14.266  366.602 1.00 95.51  ? 78  LYS 3 CG    1 
ATOM   5295  C  CD    . LYS C  3  78  ? -38.050  14.566  367.743 1.00 90.67  ? 78  LYS 3 CD    1 
ATOM   5296  C  CE    . LYS C  3  78  ? -37.412  15.419  368.822 1.00 91.40  ? 78  LYS 3 CE    1 
ATOM   5297  N  NZ    . LYS C  3  78  ? -38.443  16.024  369.707 1.00 92.45  ? 78  LYS 3 NZ    1 
ATOM   5298  N  N     . LEU C  3  79  ? -37.577  14.029  362.503 1.00 110.93 ? 79  LEU 3 N     1 
ATOM   5299  C  CA    . LEU C  3  79  ? -37.381  14.821  361.299 1.00 109.73 ? 79  LEU 3 CA    1 
ATOM   5300  C  C     . LEU C  3  79  ? -37.265  16.302  361.636 1.00 105.51 ? 79  LEU 3 C     1 
ATOM   5301  O  O     . LEU C  3  79  ? -37.958  16.817  362.518 1.00 108.40 ? 79  LEU 3 O     1 
ATOM   5302  C  CB    . LEU C  3  79  ? -38.532  14.576  360.328 1.00 111.71 ? 79  LEU 3 CB    1 
ATOM   5303  C  CG    . LEU C  3  79  ? -38.720  13.090  360.018 1.00 113.77 ? 79  LEU 3 CG    1 
ATOM   5304  C  CD1   . LEU C  3  79  ? -40.166  12.775  359.692 1.00 113.79 ? 79  LEU 3 CD1   1 
ATOM   5305  C  CD2   . LEU C  3  79  ? -37.801  12.656  358.886 1.00 116.46 ? 79  LEU 3 CD2   1 
ATOM   5306  N  N     . ALA C  3  80  ? -36.380  16.982  360.922 1.00 97.18  ? 80  ALA 3 N     1 
ATOM   5307  C  CA    . ALA C  3  80  ? -36.085  18.384  361.165 1.00 92.58  ? 80  ALA 3 CA    1 
ATOM   5308  C  C     . ALA C  3  80  ? -36.971  19.285  360.317 1.00 88.81  ? 80  ALA 3 C     1 
ATOM   5309  O  O     . ALA C  3  80  ? -37.418  18.906  359.231 1.00 86.52  ? 80  ALA 3 O     1 
ATOM   5310  C  CB    . ALA C  3  80  ? -34.614  18.682  360.869 1.00 94.16  ? 80  ALA 3 CB    1 
ATOM   5311  N  N     . ALA C  3  81  ? -37.236  20.482  360.836 1.00 85.20  ? 81  ALA 3 N     1 
ATOM   5312  C  CA    . ALA C  3  81  ? -38.005  21.486  360.107 1.00 71.62  ? 81  ALA 3 CA    1 
ATOM   5313  C  C     . ALA C  3  81  ? -37.055  22.242  359.190 1.00 63.16  ? 81  ALA 3 C     1 
ATOM   5314  O  O     . ALA C  3  81  ? -36.440  23.229  359.597 1.00 48.67  ? 81  ALA 3 O     1 
ATOM   5315  C  CB    . ALA C  3  81  ? -38.696  22.440  361.072 1.00 64.13  ? 81  ALA 3 CB    1 
ATOM   5316  N  N     . SER C  3  82  ? -36.992  21.828  357.921 1.00 69.67  ? 82  SER 3 N     1 
ATOM   5317  C  CA    . SER C  3  82  ? -36.027  22.401  356.989 1.00 66.79  ? 82  SER 3 CA    1 
ATOM   5318  C  C     . SER C  3  82  ? -36.327  23.847  356.641 1.00 65.96  ? 82  SER 3 C     1 
ATOM   5319  O  O     . SER C  3  82  ? -35.458  24.521  356.081 1.00 62.79  ? 82  SER 3 O     1 
ATOM   5320  C  CB    . SER C  3  82  ? -35.960  21.583  355.697 1.00 62.40  ? 82  SER 3 CB    1 
ATOM   5321  O  OG    . SER C  3  82  ? -37.184  21.630  354.983 1.00 58.37  ? 82  SER 3 OG    1 
ATOM   5322  N  N     . CYS C  3  83  ? -37.524  24.342  356.948 1.00 66.59  ? 83  CYS 3 N     1 
ATOM   5323  C  CA    . CYS C  3  83  ? -37.805  25.743  356.683 1.00 62.29  ? 83  CYS 3 CA    1 
ATOM   5324  C  C     . CYS C  3  83  ? -37.063  26.650  357.656 1.00 60.34  ? 83  CYS 3 C     1 
ATOM   5325  O  O     . CYS C  3  83  ? -36.663  27.754  357.282 1.00 58.73  ? 83  CYS 3 O     1 
ATOM   5326  C  CB    . CYS C  3  83  ? -39.307  26.005  356.758 1.00 62.08  ? 83  CYS 3 CB    1 
ATOM   5327  S  SG    . CYS C  3  83  ? -39.872  26.383  358.412 1.00 69.64  ? 83  CYS 3 SG    1 
ATOM   5328  N  N     . VAL C  3  84  ? -36.867  26.211  358.900 1.00 62.43  ? 84  VAL 3 N     1 
ATOM   5329  C  CA    . VAL C  3  84  ? -36.197  27.045  359.893 1.00 66.07  ? 84  VAL 3 CA    1 
ATOM   5330  C  C     . VAL C  3  84  ? -35.094  26.291  360.634 1.00 68.17  ? 84  VAL 3 C     1 
ATOM   5331  O  O     . VAL C  3  84  ? -34.750  26.651  361.764 1.00 73.48  ? 84  VAL 3 O     1 
ATOM   5332  C  CB    . VAL C  3  84  ? -37.204  27.635  360.901 1.00 71.80  ? 84  VAL 3 CB    1 
ATOM   5333  C  CG1   . VAL C  3  84  ? -38.032  28.733  360.252 1.00 71.99  ? 84  VAL 3 CG1   1 
ATOM   5334  C  CG2   . VAL C  3  84  ? -38.094  26.546  361.482 1.00 75.18  ? 84  VAL 3 CG2   1 
ATOM   5335  N  N     . THR C  3  85  ? -34.526  25.253  360.025 1.00 63.75  ? 85  THR 3 N     1 
ATOM   5336  C  CA    . THR C  3  85  ? -33.421  24.522  360.636 1.00 63.00  ? 85  THR 3 CA    1 
ATOM   5337  C  C     . THR C  3  85  ? -32.111  25.019  360.046 1.00 61.49  ? 85  THR 3 C     1 
ATOM   5338  O  O     . THR C  3  85  ? -31.958  25.087  358.823 1.00 62.05  ? 85  THR 3 O     1 
ATOM   5339  C  CB    . THR C  3  85  ? -33.546  23.008  360.443 1.00 61.74  ? 85  THR 3 CB    1 
ATOM   5340  O  OG1   . THR C  3  85  ? -34.796  22.562  360.979 1.00 42.36  ? 85  THR 3 OG1   1 
ATOM   5341  C  CG2   . THR C  3  85  ? -32.418  22.276  361.157 1.00 55.14  ? 85  THR 3 CG2   1 
ATOM   5342  N  N     . ALA C  3  86  ? -31.178  25.377  360.920 1.00 63.90  ? 86  ALA 3 N     1 
ATOM   5343  C  CA    . ALA C  3  86  ? -29.902  25.906  360.480 1.00 71.86  ? 86  ALA 3 CA    1 
ATOM   5344  C  C     . ALA C  3  86  ? -29.063  24.810  359.831 1.00 78.99  ? 86  ALA 3 C     1 
ATOM   5345  O  O     . ALA C  3  86  ? -29.341  23.614  359.955 1.00 79.06  ? 86  ALA 3 O     1 
ATOM   5346  C  CB    . ALA C  3  86  ? -29.148  26.522  361.660 1.00 74.89  ? 86  ALA 3 CB    1 
ATOM   5347  N  N     . VAL C  3  87  ? -28.023  25.243  359.127 1.00 86.56  ? 87  VAL 3 N     1 
ATOM   5348  C  CA    . VAL C  3  87  ? -27.087  24.350  358.460 1.00 91.12  ? 87  VAL 3 CA    1 
ATOM   5349  C  C     . VAL C  3  87  ? -25.729  24.501  359.128 1.00 107.80 ? 87  VAL 3 C     1 
ATOM   5350  O  O     . VAL C  3  87  ? -25.362  25.581  359.606 1.00 115.79 ? 87  VAL 3 O     1 
ATOM   5351  C  CB    . VAL C  3  87  ? -26.977  24.635  356.943 1.00 80.46  ? 87  VAL 3 CB    1 
ATOM   5352  C  CG1   . VAL C  3  87  ? -28.311  24.407  356.247 1.00 70.27  ? 87  VAL 3 CG1   1 
ATOM   5353  C  CG2   . VAL C  3  87  ? -26.452  26.036  356.684 1.00 84.81  ? 87  VAL 3 CG2   1 
ATOM   5354  N  N     . ALA C  3  88  ? -24.983  23.403  359.172 1.00 113.52 ? 88  ALA 3 N     1 
ATOM   5355  C  CA    . ALA C  3  88  ? -23.602  23.426  359.624 1.00 120.32 ? 88  ALA 3 CA    1 
ATOM   5356  C  C     . ALA C  3  88  ? -22.740  22.771  358.557 1.00 125.90 ? 88  ALA 3 C     1 
ATOM   5357  O  O     . ALA C  3  88  ? -23.238  22.045  357.694 1.00 126.22 ? 88  ALA 3 O     1 
ATOM   5358  C  CB    . ALA C  3  88  ? -23.429  22.710  360.971 1.00 118.59 ? 88  ALA 3 CB    1 
ATOM   5359  N  N     . ASP C  3  89  ? -21.440  23.056  358.613 1.00 128.05 ? 89  ASP 3 N     1 
ATOM   5360  C  CA    . ASP C  3  89  ? -20.524  22.543  357.603 1.00 129.20 ? 89  ASP 3 CA    1 
ATOM   5361  C  C     . ASP C  3  89  ? -20.569  21.020  357.568 1.00 131.53 ? 89  ASP 3 C     1 
ATOM   5362  O  O     . ASP C  3  89  ? -20.584  20.356  358.608 1.00 130.03 ? 89  ASP 3 O     1 
ATOM   5363  C  CB    . ASP C  3  89  ? -19.101  23.034  357.879 1.00 127.30 ? 89  ASP 3 CB    1 
ATOM   5364  C  CG    . ASP C  3  89  ? -18.273  23.168  356.613 1.00 125.48 ? 89  ASP 3 CG    1 
ATOM   5365  O  OD1   . ASP C  3  89  ? -18.396  22.302  355.723 1.00 126.07 ? 89  ASP 3 OD1   1 
ATOM   5366  O  OD2   . ASP C  3  89  ? -17.497  24.142  356.506 1.00 123.35 ? 89  ASP 3 OD2   1 
ATOM   5367  N  N     . GLY C  3  90  ? -20.586  20.469  356.356 1.00 134.05 ? 90  GLY 3 N     1 
ATOM   5368  C  CA    . GLY C  3  90  ? -20.634  19.034  356.164 1.00 135.11 ? 90  GLY 3 CA    1 
ATOM   5369  C  C     . GLY C  3  90  ? -21.850  18.375  356.783 1.00 137.22 ? 90  GLY 3 C     1 
ATOM   5370  O  O     . GLY C  3  90  ? -21.713  17.521  357.664 1.00 139.85 ? 90  GLY 3 O     1 
ATOM   5371  N  N     . MET C  3  91  ? -23.045  18.765  356.342 1.00 137.41 ? 91  MET 3 N     1 
ATOM   5372  C  CA    . MET C  3  91  ? -24.293  18.174  356.805 1.00 138.75 ? 91  MET 3 CA    1 
ATOM   5373  C  C     . MET C  3  91  ? -25.029  17.556  355.623 1.00 131.26 ? 91  MET 3 C     1 
ATOM   5374  O  O     . MET C  3  91  ? -24.979  18.085  354.508 1.00 129.26 ? 91  MET 3 O     1 
ATOM   5375  C  CB    . MET C  3  91  ? -25.185  19.218  357.497 1.00 146.42 ? 91  MET 3 CB    1 
ATOM   5376  C  CG    . MET C  3  91  ? -26.488  18.651  358.054 1.00 151.68 ? 91  MET 3 CG    1 
ATOM   5377  S  SD    . MET C  3  91  ? -27.583  19.886  358.780 1.00 153.80 ? 91  MET 3 SD    1 
ATOM   5378  C  CE    . MET C  3  91  ? -27.902  20.917  357.356 1.00 155.93 ? 91  MET 3 CE    1 
ATOM   5379  N  N     . VAL C  3  92  ? -25.713  16.440  355.867 1.00 125.61 ? 92  VAL 3 N     1 
ATOM   5380  C  CA    . VAL C  3  92  ? -26.410  15.684  354.833 1.00 122.03 ? 92  VAL 3 CA    1 
ATOM   5381  C  C     . VAL C  3  92  ? -27.907  15.918  354.985 1.00 120.37 ? 92  VAL 3 C     1 
ATOM   5382  O  O     . VAL C  3  92  ? -28.425  15.960  356.106 1.00 124.78 ? 92  VAL 3 O     1 
ATOM   5383  C  CB    . VAL C  3  92  ? -26.077  14.182  354.944 1.00 123.09 ? 92  VAL 3 CB    1 
ATOM   5384  C  CG1   . VAL C  3  92  ? -26.868  13.365  353.932 1.00 122.61 ? 92  VAL 3 CG1   1 
ATOM   5385  C  CG2   . VAL C  3  92  ? -24.581  13.949  354.774 1.00 126.92 ? 92  VAL 3 CG2   1 
ATOM   5386  N  N     . VAL C  3  93  ? -28.604  16.053  353.856 1.00 113.11 ? 93  VAL 3 N     1 
ATOM   5387  C  CA    . VAL C  3  93  ? -30.052  16.237  353.830 1.00 102.31 ? 93  VAL 3 CA    1 
ATOM   5388  C  C     . VAL C  3  93  ? -30.645  15.174  352.917 1.00 93.94  ? 93  VAL 3 C     1 
ATOM   5389  O  O     . VAL C  3  93  ? -30.186  14.998  351.783 1.00 87.63  ? 93  VAL 3 O     1 
ATOM   5390  C  CB    . VAL C  3  93  ? -30.455  17.645  353.353 1.00 99.90  ? 93  VAL 3 CB    1 
ATOM   5391  C  CG1   . VAL C  3  93  ? -31.968  17.799  353.385 1.00 97.52  ? 93  VAL 3 CG1   1 
ATOM   5392  C  CG2   . VAL C  3  93  ? -29.792  18.715  354.215 1.00 98.13  ? 93  VAL 3 CG2   1 
ATOM   5393  N  N     . ASP C  3  94  ? -31.656  14.464  353.412 1.00 99.81  ? 94  ASP 3 N     1 
ATOM   5394  C  CA    . ASP C  3  94  ? -32.358  13.435  352.653 1.00 112.94 ? 94  ASP 3 CA    1 
ATOM   5395  C  C     . ASP C  3  94  ? -33.811  13.866  352.503 1.00 121.59 ? 94  ASP 3 C     1 
ATOM   5396  O  O     . ASP C  3  94  ? -34.546  13.953  353.495 1.00 120.96 ? 94  ASP 3 O     1 
ATOM   5397  C  CB    . ASP C  3  94  ? -32.245  12.077  353.349 1.00 118.12 ? 94  ASP 3 CB    1 
ATOM   5398  C  CG    . ASP C  3  94  ? -32.923  10.956  352.578 1.00 124.60 ? 94  ASP 3 CG    1 
ATOM   5399  O  OD1   . ASP C  3  94  ? -33.454  11.205  351.475 1.00 127.25 ? 94  ASP 3 OD1   1 
ATOM   5400  O  OD2   . ASP C  3  94  ? -32.909  9.810   353.074 1.00 127.02 ? 94  ASP 3 OD2   1 
ATOM   5401  N  N     . THR C  3  95  ? -34.214  14.142  351.263 1.00 129.20 ? 95  THR 3 N     1 
ATOM   5402  C  CA    . THR C  3  95  ? -35.571  14.543  350.924 1.00 129.98 ? 95  THR 3 CA    1 
ATOM   5403  C  C     . THR C  3  95  ? -36.277  13.508  350.059 1.00 133.07 ? 95  THR 3 C     1 
ATOM   5404  O  O     . THR C  3  95  ? -37.403  13.756  349.613 1.00 136.84 ? 95  THR 3 O     1 
ATOM   5405  C  CB    . THR C  3  95  ? -35.566  15.900  350.201 1.00 123.72 ? 95  THR 3 CB    1 
ATOM   5406  O  OG1   . THR C  3  95  ? -35.266  15.706  348.814 1.00 124.66 ? 95  THR 3 OG1   1 
ATOM   5407  C  CG2   . THR C  3  95  ? -34.525  16.833  350.804 1.00 117.68 ? 95  THR 3 CG2   1 
ATOM   5408  N  N     . LEU C  3  96  ? -35.647  12.358  349.809 1.00 130.08 ? 96  LEU 3 N     1 
ATOM   5409  C  CA    . LEU C  3  96  ? -36.203  11.339  348.933 1.00 127.68 ? 96  LEU 3 CA    1 
ATOM   5410  C  C     . LEU C  3  96  ? -36.576  10.049  349.648 1.00 119.95 ? 96  LEU 3 C     1 
ATOM   5411  O  O     . LEU C  3  96  ? -37.261  9.212   349.051 1.00 115.00 ? 96  LEU 3 O     1 
ATOM   5412  C  CB    . LEU C  3  96  ? -35.214  11.003  347.808 1.00 133.99 ? 96  LEU 3 CB    1 
ATOM   5413  C  CG    . LEU C  3  96  ? -34.867  12.111  346.814 1.00 139.23 ? 96  LEU 3 CG    1 
ATOM   5414  C  CD1   . LEU C  3  96  ? -33.489  11.874  346.222 1.00 141.88 ? 96  LEU 3 CD1   1 
ATOM   5415  C  CD2   . LEU C  3  96  ? -35.920  12.198  345.723 1.00 140.82 ? 96  LEU 3 CD2   1 
ATOM   5416  N  N     . SER C  3  97  ? -36.147  9.861   350.894 1.00 120.72 ? 97  SER 3 N     1 
ATOM   5417  C  CA    . SER C  3  97  ? -36.425  8.614   351.592 1.00 124.83 ? 97  SER 3 CA    1 
ATOM   5418  C  C     . SER C  3  97  ? -37.927  8.395   351.702 1.00 134.05 ? 97  SER 3 C     1 
ATOM   5419  O  O     . SER C  3  97  ? -38.712  9.345   351.775 1.00 135.03 ? 97  SER 3 O     1 
ATOM   5420  C  CB    . SER C  3  97  ? -35.797  8.622   352.986 1.00 122.68 ? 97  SER 3 CB    1 
ATOM   5421  O  OG    . SER C  3  97  ? -34.436  8.236   352.940 1.00 124.92 ? 97  SER 3 OG    1 
ATOM   5422  N  N     . ASP C  3  98  ? -38.323  7.120   351.687 1.00 142.40 ? 98  ASP 3 N     1 
ATOM   5423  C  CA    . ASP C  3  98  ? -39.739  6.783   351.762 1.00 150.95 ? 98  ASP 3 CA    1 
ATOM   5424  C  C     . ASP C  3  98  ? -40.388  7.388   353.000 1.00 154.66 ? 98  ASP 3 C     1 
ATOM   5425  O  O     . ASP C  3  98  ? -41.555  7.792   352.956 1.00 154.12 ? 98  ASP 3 O     1 
ATOM   5426  C  CB    . ASP C  3  98  ? -39.908  5.264   351.740 1.00 155.79 ? 98  ASP 3 CB    1 
ATOM   5427  C  CG    . ASP C  3  98  ? -39.628  4.669   350.370 1.00 160.83 ? 98  ASP 3 CG    1 
ATOM   5428  O  OD1   . ASP C  3  98  ? -39.983  5.306   349.358 1.00 165.53 ? 98  ASP 3 OD1   1 
ATOM   5429  O  OD2   . ASP C  3  98  ? -39.047  3.566   350.304 1.00 163.63 ? 98  ASP 3 OD2   1 
ATOM   5430  N  N     . VAL C  3  99  ? -39.641  7.465   354.104 1.00 159.64 ? 99  VAL 3 N     1 
ATOM   5431  C  CA    . VAL C  3  99  ? -40.154  8.075   355.329 1.00 163.04 ? 99  VAL 3 CA    1 
ATOM   5432  C  C     . VAL C  3  99  ? -40.471  9.549   355.094 1.00 158.36 ? 99  VAL 3 C     1 
ATOM   5433  O  O     . VAL C  3  99  ? -41.517  10.054  355.519 1.00 157.83 ? 99  VAL 3 O     1 
ATOM   5434  C  CB    . VAL C  3  99  ? -39.153  7.887   356.484 1.00 167.70 ? 99  VAL 3 CB    1 
ATOM   5435  C  CG1   . VAL C  3  99  ? -39.732  8.425   357.786 1.00 168.95 ? 99  VAL 3 CG1   1 
ATOM   5436  C  CG2   . VAL C  3  99  ? -38.770  6.416   356.631 1.00 168.75 ? 99  VAL 3 CG2   1 
ATOM   5437  N  N     . VAL C  3  100 ? -39.554  10.265  354.435 1.00 154.58 ? 100 VAL 3 N     1 
ATOM   5438  C  CA    . VAL C  3  100 ? -39.754  11.690  354.169 1.00 152.53 ? 100 VAL 3 CA    1 
ATOM   5439  C  C     . VAL C  3  100 ? -41.003  11.896  353.321 1.00 147.02 ? 100 VAL 3 C     1 
ATOM   5440  O  O     . VAL C  3  100 ? -41.846  12.758  353.611 1.00 152.25 ? 100 VAL 3 O     1 
ATOM   5441  C  CB    . VAL C  3  100 ? -38.505  12.286  353.488 1.00 156.57 ? 100 VAL 3 CB    1 
ATOM   5442  C  CG1   . VAL C  3  100 ? -38.826  13.628  352.838 1.00 156.75 ? 100 VAL 3 CG1   1 
ATOM   5443  C  CG2   . VAL C  3  100 ? -37.360  12.432  354.485 1.00 159.10 ? 100 VAL 3 CG2   1 
ATOM   5444  N  N     . ARG C  3  101 ? -41.132  11.108  352.252 1.00 136.55 ? 101 ARG 3 N     1 
ATOM   5445  C  CA    . ARG C  3  101 ? -42.266  11.256  351.348 1.00 130.59 ? 101 ARG 3 CA    1 
ATOM   5446  C  C     . ARG C  3  101 ? -43.570  10.933  352.068 1.00 122.43 ? 101 ARG 3 C     1 
ATOM   5447  O  O     . ARG C  3  101 ? -44.590  11.607  351.865 1.00 120.65 ? 101 ARG 3 O     1 
ATOM   5448  C  CB    . ARG C  3  101 ? -42.050  10.371  350.118 1.00 134.50 ? 101 ARG 3 CB    1 
ATOM   5449  C  CG    . ARG C  3  101 ? -41.015  10.966  349.160 1.00 138.93 ? 101 ARG 3 CG    1 
ATOM   5450  C  CD    . ARG C  3  101 ? -40.852  10.229  347.829 1.00 145.22 ? 101 ARG 3 CD    1 
ATOM   5451  N  NE    . ARG C  3  101 ? -40.535  8.807   347.962 1.00 150.35 ? 101 ARG 3 NE    1 
ATOM   5452  C  CZ    . ARG C  3  101 ? -41.405  7.825   347.752 1.00 158.65 ? 101 ARG 3 CZ    1 
ATOM   5453  N  NH1   . ARG C  3  101 ? -42.647  8.104   347.387 1.00 159.56 ? 101 ARG 3 NH1   1 
ATOM   5454  N  NH2   . ARG C  3  101 ? -41.029  6.563   347.890 1.00 166.44 ? 101 ARG 3 NH2   1 
ATOM   5455  N  N     . GLU C  3  102 ? -43.539  9.930   352.951 1.00 117.46 ? 102 GLU 3 N     1 
ATOM   5456  C  CA    . GLU C  3  102 ? -44.724  9.570   353.723 1.00 111.41 ? 102 GLU 3 CA    1 
ATOM   5457  C  C     . GLU C  3  102 ? -45.125  10.689  354.674 1.00 96.25  ? 102 GLU 3 C     1 
ATOM   5458  O  O     . GLU C  3  102 ? -46.312  11.014  354.796 1.00 87.43  ? 102 GLU 3 O     1 
ATOM   5459  C  CB    . GLU C  3  102 ? -44.455  8.284   354.507 1.00 116.38 ? 102 GLU 3 CB    1 
ATOM   5460  C  CG    . GLU C  3  102 ? -45.632  7.771   355.320 1.00 117.63 ? 102 GLU 3 CG    1 
ATOM   5461  C  CD    . GLU C  3  102 ? -45.315  6.472   356.035 1.00 117.78 ? 102 GLU 3 CD    1 
ATOM   5462  O  OE1   . GLU C  3  102 ? -44.323  5.814   355.659 1.00 116.74 ? 102 GLU 3 OE1   1 
ATOM   5463  O  OE2   . GLU C  3  102 ? -46.053  6.111   356.976 1.00 118.53 ? 102 GLU 3 OE2   1 
ATOM   5464  N  N     . ALA C  3  103 ? -44.149  11.295  355.352 1.00 96.87  ? 103 ALA 3 N     1 
ATOM   5465  C  CA    . ALA C  3  103 ? -44.457  12.392  356.263 1.00 105.58 ? 103 ALA 3 CA    1 
ATOM   5466  C  C     . ALA C  3  103 ? -45.046  13.582  355.517 1.00 108.50 ? 103 ALA 3 C     1 
ATOM   5467  O  O     . ALA C  3  103 ? -46.020  14.196  355.975 1.00 114.50 ? 103 ALA 3 O     1 
ATOM   5468  C  CB    . ALA C  3  103 ? -43.200  12.805  357.029 1.00 109.49 ? 103 ALA 3 CB    1 
ATOM   5469  N  N     . GLN C  3  104 ? -44.473  13.915  354.357 1.00 102.06 ? 104 GLN 3 N     1 
ATOM   5470  C  CA    . GLN C  3  104 ? -44.985  15.038  353.575 1.00 92.44  ? 104 GLN 3 CA    1 
ATOM   5471  C  C     . GLN C  3  104 ? -46.418  14.779  353.115 1.00 90.48  ? 104 GLN 3 C     1 
ATOM   5472  O  O     . GLN C  3  104 ? -47.291  15.649  353.236 1.00 89.69  ? 104 GLN 3 O     1 
ATOM   5473  C  CB    . GLN C  3  104 ? -44.065  15.300  352.380 1.00 82.39  ? 104 GLN 3 CB    1 
ATOM   5474  C  CG    . GLN C  3  104 ? -42.725  15.936  352.744 1.00 74.35  ? 104 GLN 3 CG    1 
ATOM   5475  C  CD    . GLN C  3  104 ? -41.789  16.064  351.556 1.00 69.17  ? 104 GLN 3 CD    1 
ATOM   5476  O  OE1   . GLN C  3  104 ? -40.747  16.712  351.639 1.00 65.87  ? 104 GLN 3 OE1   1 
ATOM   5477  N  NE2   . GLN C  3  104 ? -42.154  15.439  350.447 1.00 68.15  ? 104 GLN 3 NE2   1 
ATOM   5478  N  N     . ALA C  3  105 ? -46.683  13.574  352.598 1.00 84.62  ? 105 ALA 3 N     1 
ATOM   5479  C  CA    . ALA C  3  105 ? -48.032  13.243  352.141 1.00 75.82  ? 105 ALA 3 CA    1 
ATOM   5480  C  C     . ALA C  3  105 ? -49.036  13.266  353.289 1.00 69.24  ? 105 ALA 3 C     1 
ATOM   5481  O  O     . ALA C  3  105 ? -50.161  13.765  353.136 1.00 63.90  ? 105 ALA 3 O     1 
ATOM   5482  C  CB    . ALA C  3  105 ? -48.027  11.879  351.454 1.00 74.97  ? 105 ALA 3 CB    1 
ATOM   5483  N  N     . GLY C  3  106 ? -48.660  12.713  354.443 1.00 71.53  ? 106 GLY 3 N     1 
ATOM   5484  C  CA    . GLY C  3  106 ? -49.561  12.731  355.582 1.00 77.30  ? 106 GLY 3 CA    1 
ATOM   5485  C  C     . GLY C  3  106 ? -49.887  14.134  356.053 1.00 82.45  ? 106 GLY 3 C     1 
ATOM   5486  O  O     . GLY C  3  106 ? -51.045  14.447  356.353 1.00 82.94  ? 106 GLY 3 O     1 
ATOM   5487  N  N     . MET C  3  107 ? -48.869  14.995  356.145 1.00 87.20  ? 107 MET 3 N     1 
ATOM   5488  C  CA    . MET C  3  107 ? -49.124  16.378  356.535 1.00 96.81  ? 107 MET 3 CA    1 
ATOM   5489  C  C     . MET C  3  107 ? -50.003  17.093  355.515 1.00 99.98  ? 107 MET 3 C     1 
ATOM   5490  O  O     . MET C  3  107 ? -50.835  17.930  355.889 1.00 93.58  ? 107 MET 3 O     1 
ATOM   5491  C  CB    . MET C  3  107 ? -47.800  17.118  356.721 1.00 106.50 ? 107 MET 3 CB    1 
ATOM   5492  C  CG    . MET C  3  107 ? -47.801  18.065  357.894 1.00 118.61 ? 107 MET 3 CG    1 
ATOM   5493  S  SD    . MET C  3  107 ? -47.906  17.112  359.415 1.00 129.69 ? 107 MET 3 SD    1 
ATOM   5494  C  CE    . MET C  3  107 ? -46.368  16.194  359.356 1.00 130.32 ? 107 MET 3 CE    1 
ATOM   5495  N  N     . VAL C  3  108 ? -49.845  16.768  354.228 1.00 108.05 ? 108 VAL 3 N     1 
ATOM   5496  C  CA    . VAL C  3  108 ? -50.719  17.338  353.203 1.00 108.19 ? 108 VAL 3 CA    1 
ATOM   5497  C  C     . VAL C  3  108 ? -52.165  16.915  353.437 1.00 94.13  ? 108 VAL 3 C     1 
ATOM   5498  O  O     . VAL C  3  108 ? -53.092  17.729  353.322 1.00 91.58  ? 108 VAL 3 O     1 
ATOM   5499  C  CB    . VAL C  3  108 ? -50.231  16.949  351.794 1.00 116.78 ? 108 VAL 3 CB    1 
ATOM   5500  C  CG1   . VAL C  3  108 ? -51.290  17.270  350.750 1.00 121.50 ? 108 VAL 3 CG1   1 
ATOM   5501  C  CG2   . VAL C  3  108 ? -48.938  17.680  351.461 1.00 115.91 ? 108 VAL 3 CG2   1 
ATOM   5502  N  N     . GLU C  3  109 ? -52.383  15.631  353.731 1.00 82.10  ? 109 GLU 3 N     1 
ATOM   5503  C  CA    . GLU C  3  109 ? -53.742  15.171  354.014 1.00 76.19  ? 109 GLU 3 CA    1 
ATOM   5504  C  C     . GLU C  3  109 ? -54.318  15.903  355.221 1.00 71.19  ? 109 GLU 3 C     1 
ATOM   5505  O  O     . GLU C  3  109 ? -55.488  16.311  355.216 1.00 61.61  ? 109 GLU 3 O     1 
ATOM   5506  C  CB    . GLU C  3  109 ? -53.762  13.657  354.244 1.00 79.81  ? 109 GLU 3 CB    1 
ATOM   5507  C  CG    . GLU C  3  109 ? -55.044  13.149  354.912 1.00 79.59  ? 109 GLU 3 CG    1 
ATOM   5508  C  CD    . GLU C  3  109 ? -55.113  11.634  355.018 1.00 69.20  ? 109 GLU 3 CD    1 
ATOM   5509  O  OE1   . GLU C  3  109 ? -54.048  10.986  355.066 1.00 64.71  ? 109 GLU 3 OE1   1 
ATOM   5510  O  OE2   . GLU C  3  109 ? -56.237  11.091  355.059 1.00 62.57  ? 109 GLU 3 OE2   1 
ATOM   5511  N  N     . PHE C  3  110 ? -53.501  16.089  356.260 1.00 77.64  ? 110 PHE 3 N     1 
ATOM   5512  C  CA    . PHE C  3  110 ? -53.945  16.844  357.429 1.00 82.52  ? 110 PHE 3 CA    1 
ATOM   5513  C  C     . PHE C  3  110 ? -54.356  18.259  357.046 1.00 79.03  ? 110 PHE 3 C     1 
ATOM   5514  O  O     . PHE C  3  110 ? -55.355  18.782  357.551 1.00 81.44  ? 110 PHE 3 O     1 
ATOM   5515  C  CB    . PHE C  3  110 ? -52.845  16.889  358.490 1.00 84.39  ? 110 PHE 3 CB    1 
ATOM   5516  C  CG    . PHE C  3  110 ? -52.557  15.564  359.126 1.00 82.17  ? 110 PHE 3 CG    1 
ATOM   5517  C  CD1   . PHE C  3  110 ? -53.577  14.670  359.375 1.00 79.12  ? 110 PHE 3 CD1   1 
ATOM   5518  C  CD2   . PHE C  3  110 ? -51.268  15.215  359.484 1.00 81.93  ? 110 PHE 3 CD2   1 
ATOM   5519  C  CE1   . PHE C  3  110 ? -53.321  13.453  359.966 1.00 77.51  ? 110 PHE 3 CE1   1 
ATOM   5520  C  CE2   . PHE C  3  110 ? -51.008  13.995  360.075 1.00 80.45  ? 110 PHE 3 CE2   1 
ATOM   5521  C  CZ    . PHE C  3  110 ? -52.036  13.115  360.314 1.00 78.87  ? 110 PHE 3 CZ    1 
ATOM   5522  N  N     . THR C  3  111 ? -53.587  18.902  356.166 1.00 68.90  ? 111 THR 3 N     1 
ATOM   5523  C  CA    . THR C  3  111 ? -53.898  20.282  355.803 1.00 62.94  ? 111 THR 3 CA    1 
ATOM   5524  C  C     . THR C  3  111 ? -55.173  20.358  354.973 1.00 60.63  ? 111 THR 3 C     1 
ATOM   5525  O  O     . THR C  3  111 ? -55.999  21.254  355.177 1.00 55.73  ? 111 THR 3 O     1 
ATOM   5526  C  CB    . THR C  3  111 ? -52.724  20.902  355.049 1.00 66.41  ? 111 THR 3 CB    1 
ATOM   5527  O  OG1   . THR C  3  111 ? -51.557  20.848  355.874 1.00 74.20  ? 111 THR 3 OG1   1 
ATOM   5528  C  CG2   . THR C  3  111 ? -53.012  22.354  354.709 1.00 66.75  ? 111 THR 3 CG2   1 
ATOM   5529  N  N     . LEU C  3  112 ? -55.353  19.418  354.042 1.00 66.95  ? 112 LEU 3 N     1 
ATOM   5530  C  CA    . LEU C  3  112 ? -56.560  19.366  353.223 1.00 65.77  ? 112 LEU 3 CA    1 
ATOM   5531  C  C     . LEU C  3  112 ? -57.775  18.861  353.982 1.00 61.01  ? 112 LEU 3 C     1 
ATOM   5532  O  O     . LEU C  3  112 ? -58.881  18.898  353.430 1.00 55.62  ? 112 LEU 3 O     1 
ATOM   5533  C  CB    . LEU C  3  112 ? -56.349  18.470  352.005 1.00 66.10  ? 112 LEU 3 CB    1 
ATOM   5534  C  CG    . LEU C  3  112 ? -55.336  18.929  350.970 1.00 66.99  ? 112 LEU 3 CG    1 
ATOM   5535  C  CD1   . LEU C  3  112 ? -55.347  17.944  349.831 1.00 66.78  ? 112 LEU 3 CD1   1 
ATOM   5536  C  CD2   . LEU C  3  112 ? -55.716  20.313  350.497 1.00 68.14  ? 112 LEU 3 CD2   1 
ATOM   5537  N  N     . LEU C  3  113 ? -57.587  18.382  355.212 1.00 63.24  ? 113 LEU 3 N     1 
ATOM   5538  C  CA    . LEU C  3  113 ? -58.684  17.868  356.028 1.00 67.66  ? 113 LEU 3 CA    1 
ATOM   5539  C  C     . LEU C  3  113 ? -59.964  18.692  355.932 1.00 74.95  ? 113 LEU 3 C     1 
ATOM   5540  O  O     . LEU C  3  113 ? -61.054  18.140  355.761 1.00 75.83  ? 113 LEU 3 O     1 
ATOM   5541  C  CB    . LEU C  3  113 ? -58.226  17.785  357.485 1.00 70.40  ? 113 LEU 3 CB    1 
ATOM   5542  C  CG    . LEU C  3  113 ? -58.784  16.631  358.307 1.00 77.56  ? 113 LEU 3 CG    1 
ATOM   5543  C  CD1   . LEU C  3  113 ? -58.073  15.349  357.931 1.00 80.21  ? 113 LEU 3 CD1   1 
ATOM   5544  C  CD2   . LEU C  3  113 ? -58.650  16.908  359.798 1.00 81.67  ? 113 LEU 3 CD2   1 
ATOM   5545  N  N     . ASN C  3  114 ? -59.861  20.014  356.052 1.00 80.22  ? 114 ASN 3 N     1 
ATOM   5546  C  CA    . ASN C  3  114 ? -61.038  20.863  356.193 1.00 83.25  ? 114 ASN 3 CA    1 
ATOM   5547  C  C     . ASN C  3  114 ? -61.148  21.918  355.092 1.00 90.54  ? 114 ASN 3 C     1 
ATOM   5548  O  O     . ASN C  3  114 ? -61.745  22.975  355.300 1.00 85.26  ? 114 ASN 3 O     1 
ATOM   5549  C  CB    . ASN C  3  114 ? -61.056  21.517  357.573 1.00 75.28  ? 114 ASN 3 CB    1 
ATOM   5550  C  CG    . ASN C  3  114 ? -61.475  20.552  358.663 1.00 66.24  ? 114 ASN 3 CG    1 
ATOM   5551  O  OD1   . ASN C  3  114 ? -62.452  19.820  358.515 1.00 68.23  ? 114 ASN 3 OD1   1 
ATOM   5552  N  ND2   . ASN C  3  114 ? -60.744  20.552  359.766 1.00 59.45  ? 114 ASN 3 ND2   1 
ATOM   5553  N  N     . HIS C  3  115 ? -60.579  21.651  353.923 1.00 101.99 ? 115 HIS 3 N     1 
ATOM   5554  C  CA    . HIS C  3  115 ? -60.742  22.581  352.820 1.00 111.79 ? 115 HIS 3 CA    1 
ATOM   5555  C  C     . HIS C  3  115 ? -62.210  22.622  352.393 1.00 112.13 ? 115 HIS 3 C     1 
ATOM   5556  O  O     . HIS C  3  115 ? -62.859  21.576  352.293 1.00 114.24 ? 115 HIS 3 O     1 
ATOM   5557  C  CB    . HIS C  3  115 ? -59.855  22.159  351.656 1.00 116.89 ? 115 HIS 3 CB    1 
ATOM   5558  C  CG    . HIS C  3  115 ? -59.330  23.303  350.853 1.00 124.68 ? 115 HIS 3 CG    1 
ATOM   5559  N  ND1   . HIS C  3  115 ? -58.375  24.176  351.332 1.00 123.74 ? 115 HIS 3 ND1   1 
ATOM   5560  C  CD2   . HIS C  3  115 ? -59.613  23.706  349.593 1.00 125.44 ? 115 HIS 3 CD2   1 
ATOM   5561  C  CE1   . HIS C  3  115 ? -58.108  25.079  350.407 1.00 125.24 ? 115 HIS 3 CE1   1 
ATOM   5562  N  NE2   . HIS C  3  115 ? -58.838  24.808  349.340 1.00 124.40 ? 115 HIS 3 NE2   1 
ATOM   5563  N  N     . PRO C  3  116 ? -62.762  23.808  352.134 1.00 108.86 ? 116 PRO 3 N     1 
ATOM   5564  C  CA    . PRO C  3  116 ? -64.219  23.952  352.014 1.00 111.32 ? 116 PRO 3 CA    1 
ATOM   5565  C  C     . PRO C  3  116 ? -64.809  23.629  350.650 1.00 114.58 ? 116 PRO 3 C     1 
ATOM   5566  O  O     . PRO C  3  116 ? -65.983  23.937  350.432 1.00 122.50 ? 116 PRO 3 O     1 
ATOM   5567  C  CB    . PRO C  3  116 ? -64.434  25.435  352.347 1.00 107.89 ? 116 PRO 3 CB    1 
ATOM   5568  C  CG    . PRO C  3  116 ? -63.180  26.066  351.978 1.00 104.61 ? 116 PRO 3 CG    1 
ATOM   5569  C  CD    . PRO C  3  116 ? -62.113  25.106  352.364 1.00 104.43 ? 116 PRO 3 CD    1 
ATOM   5570  N  N     . LEU C  3  117 ? -64.045  23.048  349.729 1.00 103.68 ? 117 LEU 3 N     1 
ATOM   5571  C  CA    . LEU C  3  117 ? -64.565  22.604  348.435 1.00 91.95  ? 117 LEU 3 CA    1 
ATOM   5572  C  C     . LEU C  3  117 ? -65.062  23.776  347.591 1.00 86.79  ? 117 LEU 3 C     1 
ATOM   5573  O  O     . LEU C  3  117 ? -66.186  23.781  347.086 1.00 89.92  ? 117 LEU 3 O     1 
ATOM   5574  C  CB    . LEU C  3  117 ? -65.656  21.549  348.625 1.00 86.34  ? 117 LEU 3 CB    1 
ATOM   5575  C  CG    . LEU C  3  117 ? -65.106  20.219  349.128 1.00 81.19  ? 117 LEU 3 CG    1 
ATOM   5576  C  CD1   . LEU C  3  117 ? -66.173  19.448  349.870 1.00 86.00  ? 117 LEU 3 CD1   1 
ATOM   5577  C  CD2   . LEU C  3  117 ? -64.581  19.411  347.970 1.00 76.68  ? 117 LEU 3 CD2   1 
ATOM   5578  N  N     . ASP C  3  118 ? -64.198  24.776  347.434 1.00 76.32  ? 118 ASP 3 N     1 
ATOM   5579  C  CA    . ASP C  3  118 ? -64.518  25.964  346.661 1.00 69.35  ? 118 ASP 3 CA    1 
ATOM   5580  C  C     . ASP C  3  118 ? -63.713  26.055  345.374 1.00 65.72  ? 118 ASP 3 C     1 
ATOM   5581  O  O     . ASP C  3  118 ? -63.930  26.985  344.592 1.00 52.89  ? 118 ASP 3 O     1 
ATOM   5582  C  CB    . ASP C  3  118 ? -64.287  27.216  347.515 1.00 65.32  ? 118 ASP 3 CB    1 
ATOM   5583  C  CG    . ASP C  3  118 ? -65.113  27.211  348.786 1.00 59.52  ? 118 ASP 3 CG    1 
ATOM   5584  O  OD1   . ASP C  3  118 ? -65.970  26.319  348.944 1.00 56.37  ? 118 ASP 3 OD1   1 
ATOM   5585  O  OD2   . ASP C  3  118 ? -64.889  28.087  349.644 1.00 61.23  ? 118 ASP 3 OD2   1 
ATOM   5586  N  N     . CYS C  3  119 ? -62.797  25.109  345.137 1.00 76.56  ? 119 CYS 3 N     1 
ATOM   5587  C  CA    . CYS C  3  119 ? -61.877  25.150  343.997 1.00 83.73  ? 119 CYS 3 CA    1 
ATOM   5588  C  C     . CYS C  3  119 ? -62.535  25.611  342.701 1.00 85.92  ? 119 CYS 3 C     1 
ATOM   5589  O  O     . CYS C  3  119 ? -62.023  26.556  342.087 1.00 91.53  ? 119 CYS 3 O     1 
ATOM   5590  C  CB    . CYS C  3  119 ? -61.229  23.769  343.809 1.00 86.00  ? 119 CYS 3 CB    1 
ATOM   5591  S  SG    . CYS C  3  119 ? -60.199  23.167  345.160 1.00 89.32  ? 119 CYS 3 SG    1 
ATOM   5592  N  N     . PRO C  3  120 ? -63.639  25.014  342.231 1.00 78.80  ? 120 PRO 3 N     1 
ATOM   5593  C  CA    . PRO C  3  120 ? -64.208  25.479  340.956 1.00 77.95  ? 120 PRO 3 CA    1 
ATOM   5594  C  C     . PRO C  3  120 ? -64.668  26.922  341.011 1.00 77.17  ? 120 PRO 3 C     1 
ATOM   5595  O  O     . PRO C  3  120 ? -64.460  27.671  340.048 1.00 76.28  ? 120 PRO 3 O     1 
ATOM   5596  C  CB    . PRO C  3  120 ? -65.379  24.520  340.701 1.00 78.44  ? 120 PRO 3 CB    1 
ATOM   5597  C  CG    . PRO C  3  120 ? -65.523  23.692  341.888 1.00 76.14  ? 120 PRO 3 CG    1 
ATOM   5598  C  CD    . PRO C  3  120 ? -64.391  23.888  342.811 1.00 76.18  ? 120 PRO 3 CD    1 
ATOM   5599  N  N     . THR C  3  121 ? -65.272  27.336  342.121 1.00 80.04  ? 121 THR 3 N     1 
ATOM   5600  C  CA    . THR C  3  121 ? -65.688  28.714  342.334 1.00 87.95  ? 121 THR 3 CA    1 
ATOM   5601  C  C     . THR C  3  121 ? -64.646  29.527  343.081 1.00 88.48  ? 121 THR 3 C     1 
ATOM   5602  O  O     . THR C  3  121 ? -64.940  30.646  343.515 1.00 85.85  ? 121 THR 3 O     1 
ATOM   5603  C  CB    . THR C  3  121 ? -67.013  28.768  343.101 1.00 91.57  ? 121 THR 3 CB    1 
ATOM   5604  O  OG1   . THR C  3  121 ? -67.380  30.135  343.318 1.00 93.86  ? 121 THR 3 OG1   1 
ATOM   5605  C  CG2   . THR C  3  121 ? -66.905  28.060  344.440 1.00 91.68  ? 121 THR 3 CG2   1 
ATOM   5606  N  N     . CYS C  3  122 ? -63.439  28.995  343.237 1.00 85.37  ? 122 CYS 3 N     1 
ATOM   5607  C  CA    . CYS C  3  122 ? -62.361  29.731  343.876 1.00 74.83  ? 122 CYS 3 CA    1 
ATOM   5608  C  C     . CYS C  3  122 ? -61.723  30.687  342.884 1.00 68.86  ? 122 CYS 3 C     1 
ATOM   5609  O  O     . CYS C  3  122 ? -61.129  30.255  341.890 1.00 68.11  ? 122 CYS 3 O     1 
ATOM   5610  C  CB    . CYS C  3  122 ? -61.314  28.774  344.412 1.00 70.22  ? 122 CYS 3 CB    1 
ATOM   5611  S  SG    . CYS C  3  122 ? -60.115  29.570  345.431 1.00 69.34  ? 122 CYS 3 SG    1 
ATOM   5612  N  N     . ASP C  3  123 ? -61.830  31.982  343.164 1.00 64.58  ? 123 ASP 3 N     1 
ATOM   5613  C  CA    . ASP C  3  123 ? -61.297  32.991  342.264 1.00 61.67  ? 123 ASP 3 CA    1 
ATOM   5614  C  C     . ASP C  3  123 ? -59.777  32.971  342.193 1.00 52.21  ? 123 ASP 3 C     1 
ATOM   5615  O  O     . ASP C  3  123 ? -59.206  33.673  341.351 1.00 50.10  ? 123 ASP 3 O     1 
ATOM   5616  C  CB    . ASP C  3  123 ? -61.790  34.370  342.685 1.00 68.36  ? 123 ASP 3 CB    1 
ATOM   5617  C  CG    . ASP C  3  123 ? -62.392  35.137  341.534 1.00 73.52  ? 123 ASP 3 CG    1 
ATOM   5618  O  OD1   . ASP C  3  123 ? -62.543  34.555  340.439 1.00 72.75  ? 123 ASP 3 OD1   1 
ATOM   5619  O  OD2   . ASP C  3  123 ? -62.719  36.321  341.721 1.00 76.13  ? 123 ASP 3 OD2   1 
ATOM   5620  N  N     . LYS C  3  124 ? -59.115  32.194  343.052 1.00 49.31  ? 124 LYS 3 N     1 
ATOM   5621  C  CA    . LYS C  3  124 ? -57.676  31.988  342.943 1.00 54.77  ? 124 LYS 3 CA    1 
ATOM   5622  C  C     . LYS C  3  124 ? -57.329  30.978  341.861 1.00 61.05  ? 124 LYS 3 C     1 
ATOM   5623  O  O     . LYS C  3  124 ? -56.205  31.002  341.352 1.00 61.56  ? 124 LYS 3 O     1 
ATOM   5624  C  CB    . LYS C  3  124 ? -57.101  31.521  344.284 1.00 58.04  ? 124 LYS 3 CB    1 
ATOM   5625  C  CG    . LYS C  3  124 ? -56.411  32.620  345.082 1.00 71.65  ? 124 LYS 3 CG    1 
ATOM   5626  C  CD    . LYS C  3  124 ? -54.984  32.857  344.626 1.00 82.61  ? 124 LYS 3 CD    1 
ATOM   5627  C  CE    . LYS C  3  124 ? -54.297  33.935  345.457 1.00 87.29  ? 124 LYS 3 CE    1 
ATOM   5628  N  NZ    . LYS C  3  124 ? -54.635  35.314  344.992 1.00 85.02  ? 124 LYS 3 NZ    1 
ATOM   5629  N  N     . GLY C  3  125 ? -58.272  30.106  341.503 1.00 63.88  ? 125 GLY 3 N     1 
ATOM   5630  C  CA    . GLY C  3  125 ? -58.133  29.187  340.390 1.00 60.54  ? 125 GLY 3 CA    1 
ATOM   5631  C  C     . GLY C  3  125 ? -56.792  28.499  340.275 1.00 57.51  ? 125 GLY 3 C     1 
ATOM   5632  O  O     . GLY C  3  125 ? -56.329  27.868  341.228 1.00 53.52  ? 125 GLY 3 O     1 
ATOM   5633  N  N     . GLY C  3  126 ? -56.156  28.630  339.110 1.00 59.09  ? 126 GLY 3 N     1 
ATOM   5634  C  CA    . GLY C  3  126 ? -54.910  27.941  338.824 1.00 60.73  ? 126 GLY 3 CA    1 
ATOM   5635  C  C     . GLY C  3  126 ? -53.762  28.290  339.747 1.00 57.07  ? 126 GLY 3 C     1 
ATOM   5636  O  O     . GLY C  3  126 ? -52.768  27.557  339.770 1.00 57.40  ? 126 GLY 3 O     1 
ATOM   5637  N  N     . ALA C  3  127 ? -53.874  29.367  340.513 1.00 61.90  ? 127 ALA 3 N     1 
ATOM   5638  C  CA    . ALA C  3  127 ? -52.814  29.812  341.418 1.00 78.83  ? 127 ALA 3 CA    1 
ATOM   5639  C  C     . ALA C  3  127 ? -53.231  29.469  342.844 1.00 87.06  ? 127 ALA 3 C     1 
ATOM   5640  O  O     . ALA C  3  127 ? -53.871  30.264  343.529 1.00 93.96  ? 127 ALA 3 O     1 
ATOM   5641  C  CB    . ALA C  3  127 ? -52.548  31.310  341.270 1.00 86.51  ? 127 ALA 3 CB    1 
ATOM   5642  N  N     . CYS C  3  128 ? -52.875  28.268  343.286 1.00 85.52  ? 128 CYS 3 N     1 
ATOM   5643  C  CA    . CYS C  3  128 ? -53.119  27.860  344.667 1.00 82.52  ? 128 CYS 3 CA    1 
ATOM   5644  C  C     . CYS C  3  128 ? -51.928  27.016  345.103 1.00 86.04  ? 128 CYS 3 C     1 
ATOM   5645  O  O     . CYS C  3  128 ? -51.790  25.863  344.683 1.00 89.31  ? 128 CYS 3 O     1 
ATOM   5646  C  CB    . CYS C  3  128 ? -54.422  27.089  344.800 1.00 72.97  ? 128 CYS 3 CB    1 
ATOM   5647  S  SG    . CYS C  3  128 ? -54.597  26.197  346.342 1.00 65.88  ? 128 CYS 3 SG    1 
ATOM   5648  N  N     . GLU C  3  129 ? -51.054  27.611  345.916 1.00 83.78  ? 129 GLU 3 N     1 
ATOM   5649  C  CA    . GLU C  3  129 ? -49.871  26.900  346.382 1.00 80.17  ? 129 GLU 3 CA    1 
ATOM   5650  C  C     . GLU C  3  129 ? -50.260  25.585  347.040 1.00 73.42  ? 129 GLU 3 C     1 
ATOM   5651  O  O     . GLU C  3  129 ? -49.563  24.576  346.896 1.00 71.79  ? 129 GLU 3 O     1 
ATOM   5652  C  CB    . GLU C  3  129 ? -49.082  27.804  347.327 1.00 86.08  ? 129 GLU 3 CB    1 
ATOM   5653  C  CG    . GLU C  3  129 ? -48.879  29.196  346.733 1.00 93.53  ? 129 GLU 3 CG    1 
ATOM   5654  C  CD    . GLU C  3  129 ? -47.872  30.036  347.484 1.00 98.97  ? 129 GLU 3 CD    1 
ATOM   5655  O  OE1   . GLU C  3  129 ? -47.032  29.465  348.207 1.00 100.82 ? 129 GLU 3 OE1   1 
ATOM   5656  O  OE2   . GLU C  3  129 ? -47.919  31.275  347.342 1.00 100.52 ? 129 GLU 3 OE2   1 
ATOM   5657  N  N     . LEU C  3  130 ? -51.396  25.575  347.740 1.00 70.48  ? 130 LEU 3 N     1 
ATOM   5658  C  CA    . LEU C  3  130 ? -51.916  24.332  348.297 1.00 65.62  ? 130 LEU 3 CA    1 
ATOM   5659  C  C     . LEU C  3  130 ? -52.232  23.323  347.200 1.00 57.41  ? 130 LEU 3 C     1 
ATOM   5660  O  O     . LEU C  3  130 ? -51.902  22.140  347.332 1.00 52.60  ? 130 LEU 3 O     1 
ATOM   5661  C  CB    . LEU C  3  130 ? -53.150  24.610  349.156 1.00 63.56  ? 130 LEU 3 CB    1 
ATOM   5662  C  CG    . LEU C  3  130 ? -53.863  23.394  349.748 1.00 57.37  ? 130 LEU 3 CG    1 
ATOM   5663  C  CD1   . LEU C  3  130 ? -52.901  22.457  350.445 1.00 55.89  ? 130 LEU 3 CD1   1 
ATOM   5664  C  CD2   . LEU C  3  130 ? -54.942  23.848  350.714 1.00 55.50  ? 130 LEU 3 CD2   1 
ATOM   5665  N  N     . GLN C  3  131 ? -52.859  23.771  346.108 1.00 54.10  ? 131 GLN 3 N     1 
ATOM   5666  C  CA    . GLN C  3  131 ? -53.136  22.877  344.986 1.00 55.25  ? 131 GLN 3 CA    1 
ATOM   5667  C  C     . GLN C  3  131 ? -51.864  22.185  344.524 1.00 56.14  ? 131 GLN 3 C     1 
ATOM   5668  O  O     . GLN C  3  131 ? -51.827  20.960  344.352 1.00 61.06  ? 131 GLN 3 O     1 
ATOM   5669  C  CB    . GLN C  3  131 ? -53.731  23.663  343.815 1.00 64.54  ? 131 GLN 3 CB    1 
ATOM   5670  C  CG    . GLN C  3  131 ? -55.237  23.617  343.651 1.00 73.06  ? 131 GLN 3 CG    1 
ATOM   5671  C  CD    . GLN C  3  131 ? -55.688  24.308  342.372 1.00 77.48  ? 131 GLN 3 CD    1 
ATOM   5672  O  OE1   . GLN C  3  131 ? -54.882  24.897  341.651 1.00 78.88  ? 131 GLN 3 OE1   1 
ATOM   5673  N  NE2   . GLN C  3  131 ? -56.982  24.249  342.094 1.00 75.93  ? 131 GLN 3 NE2   1 
ATOM   5674  N  N     . ASP C  3  132 ? -50.806  22.969  344.321 1.00 56.00  ? 132 ASP 3 N     1 
ATOM   5675  C  CA    . ASP C  3  132 ? -49.592  22.432  343.728 1.00 62.79  ? 132 ASP 3 CA    1 
ATOM   5676  C  C     . ASP C  3  132 ? -48.842  21.530  344.700 1.00 59.90  ? 132 ASP 3 C     1 
ATOM   5677  O  O     . ASP C  3  132 ? -48.415  20.441  344.315 1.00 70.50  ? 132 ASP 3 O     1 
ATOM   5678  C  CB    . ASP C  3  132 ? -48.711  23.566  343.214 1.00 73.55  ? 132 ASP 3 CB    1 
ATOM   5679  C  CG    . ASP C  3  132 ? -49.371  24.335  342.081 1.00 86.67  ? 132 ASP 3 CG    1 
ATOM   5680  O  OD1   . ASP C  3  132 ? -50.604  24.526  342.135 1.00 90.80  ? 132 ASP 3 OD1   1 
ATOM   5681  O  OD2   . ASP C  3  132 ? -48.665  24.749  341.137 1.00 91.64  ? 132 ASP 3 OD2   1 
ATOM   5682  N  N     . ARG C  3  133 ? -48.684  21.935  345.966 1.00 46.69  ? 133 ARG 3 N     1 
ATOM   5683  C  CA    . ARG C  3  133 ? -48.020  21.027  346.903 1.00 44.39  ? 133 ARG 3 CA    1 
ATOM   5684  C  C     . ARG C  3  133 ? -48.829  19.752  347.118 1.00 45.14  ? 133 ARG 3 C     1 
ATOM   5685  O  O     . ARG C  3  133 ? -48.248  18.671  347.290 1.00 45.84  ? 133 ARG 3 O     1 
ATOM   5686  C  CB    . ARG C  3  133 ? -47.754  21.709  348.244 1.00 52.79  ? 133 ARG 3 CB    1 
ATOM   5687  C  CG    . ARG C  3  133 ? -47.269  23.145  348.168 1.00 59.54  ? 133 ARG 3 CG    1 
ATOM   5688  C  CD    . ARG C  3  133 ? -45.806  23.247  347.775 1.00 65.51  ? 133 ARG 3 CD    1 
ATOM   5689  N  NE    . ARG C  3  133 ? -45.610  23.122  346.335 1.00 67.64  ? 133 ARG 3 NE    1 
ATOM   5690  C  CZ    . ARG C  3  133 ? -45.252  24.128  345.542 1.00 68.37  ? 133 ARG 3 CZ    1 
ATOM   5691  N  NH1   . ARG C  3  133 ? -45.055  25.335  346.051 1.00 61.28  ? 133 ARG 3 NH1   1 
ATOM   5692  N  NH2   . ARG C  3  133 ? -45.097  23.925  344.243 1.00 74.28  ? 133 ARG 3 NH2   1 
ATOM   5693  N  N     . THR C  3  134 ? -50.161  19.847  347.074 1.00 46.49  ? 134 THR 3 N     1 
ATOM   5694  C  CA    . THR C  3  134 ? -50.999  18.662  347.213 1.00 55.15  ? 134 THR 3 CA    1 
ATOM   5695  C  C     . THR C  3  134 ? -50.782  17.704  346.052 1.00 49.29  ? 134 THR 3 C     1 
ATOM   5696  O  O     . THR C  3  134 ? -50.508  16.516  346.254 1.00 53.05  ? 134 THR 3 O     1 
ATOM   5697  C  CB    . THR C  3  134 ? -52.470  19.070  347.302 1.00 63.70  ? 134 THR 3 CB    1 
ATOM   5698  O  OG1   . THR C  3  134 ? -52.761  19.560  348.618 1.00 67.40  ? 134 THR 3 OG1   1 
ATOM   5699  C  CG2   . THR C  3  134 ? -53.371  17.884  346.989 1.00 65.38  ? 134 THR 3 CG2   1 
ATOM   5700  N  N     . VAL C  3  135 ? -50.880  18.213  344.820 1.00 44.22  ? 135 VAL 3 N     1 
ATOM   5701  C  CA    . VAL C  3  135 ? -50.682  17.360  343.655 1.00 60.60  ? 135 VAL 3 CA    1 
ATOM   5702  C  C     . VAL C  3  135 ? -49.234  16.905  343.548 1.00 55.53  ? 135 VAL 3 C     1 
ATOM   5703  O  O     . VAL C  3  135 ? -48.946  15.923  342.860 1.00 67.18  ? 135 VAL 3 O     1 
ATOM   5704  C  CB    . VAL C  3  135 ? -51.131  18.076  342.365 1.00 44.63  ? 135 VAL 3 CB    1 
ATOM   5705  C  CG1   . VAL C  3  135 ? -50.074  19.062  341.889 1.00 50.52  ? 135 VAL 3 CG1   1 
ATOM   5706  C  CG2   . VAL C  3  135 ? -51.464  17.061  341.271 1.00 44.62  ? 135 VAL 3 CG2   1 
ATOM   5707  N  N     . GLU C  3  136 ? -48.314  17.589  344.227 1.00 52.19  ? 136 GLU 3 N     1 
ATOM   5708  C  CA    . GLU C  3  136 ? -46.903  17.225  344.180 1.00 43.94  ? 136 GLU 3 CA    1 
ATOM   5709  C  C     . GLU C  3  136 ? -46.583  16.059  345.108 1.00 43.53  ? 136 GLU 3 C     1 
ATOM   5710  O  O     . GLU C  3  136 ? -46.120  15.006  344.659 1.00 44.13  ? 136 GLU 3 O     1 
ATOM   5711  C  CB    . GLU C  3  136 ? -46.037  18.434  344.536 1.00 46.87  ? 136 GLU 3 CB    1 
ATOM   5712  C  CG    . GLU C  3  136 ? -45.800  19.366  343.370 1.00 51.15  ? 136 GLU 3 CG    1 
ATOM   5713  C  CD    . GLU C  3  136 ? -45.341  20.744  343.790 1.00 51.43  ? 136 GLU 3 CD    1 
ATOM   5714  O  OE1   . GLU C  3  136 ? -44.731  21.445  342.959 1.00 52.90  ? 136 GLU 3 OE1   1 
ATOM   5715  O  OE2   . GLU C  3  136 ? -45.573  21.126  344.953 1.00 44.69  ? 136 GLU 3 OE2   1 
ATOM   5716  N  N     . TYR C  3  137 ? -46.825  16.224  346.410 1.00 43.34  ? 137 TYR 3 N     1 
ATOM   5717  C  CA    . TYR C  3  137 ? -46.274  15.288  347.384 1.00 54.55  ? 137 TYR 3 CA    1 
ATOM   5718  C  C     . TYR C  3  137 ? -47.269  14.272  347.929 1.00 63.52  ? 137 TYR 3 C     1 
ATOM   5719  O  O     . TYR C  3  137 ? -46.838  13.251  348.474 1.00 65.70  ? 137 TYR 3 O     1 
ATOM   5720  C  CB    . TYR C  3  137 ? -45.661  16.053  348.562 1.00 53.11  ? 137 TYR 3 CB    1 
ATOM   5721  C  CG    . TYR C  3  137 ? -44.655  17.103  348.151 1.00 52.03  ? 137 TYR 3 CG    1 
ATOM   5722  C  CD1   . TYR C  3  137 ? -43.346  16.764  347.860 1.00 54.16  ? 137 TYR 3 CD1   1 
ATOM   5723  C  CD2   . TYR C  3  137 ? -45.015  18.436  348.058 1.00 48.23  ? 137 TYR 3 CD2   1 
ATOM   5724  C  CE1   . TYR C  3  137 ? -42.425  17.723  347.484 1.00 54.95  ? 137 TYR 3 CE1   1 
ATOM   5725  C  CE2   . TYR C  3  137 ? -44.100  19.400  347.686 1.00 48.59  ? 137 TYR 3 CE2   1 
ATOM   5726  C  CZ    . TYR C  3  137 ? -42.808  19.040  347.400 1.00 50.53  ? 137 TYR 3 CZ    1 
ATOM   5727  O  OH    . TYR C  3  137 ? -41.893  19.998  347.026 1.00 44.03  ? 137 TYR 3 OH    1 
ATOM   5728  N  N     . GLY C  3  138 ? -48.568  14.501  347.794 1.00 69.94  ? 138 GLY 3 N     1 
ATOM   5729  C  CA    . GLY C  3  138 ? -49.534  13.635  348.440 1.00 81.85  ? 138 GLY 3 CA    1 
ATOM   5730  C  C     . GLY C  3  138 ? -49.633  12.261  347.797 1.00 93.03  ? 138 GLY 3 C     1 
ATOM   5731  O  O     . GLY C  3  138 ? -49.151  12.012  346.692 1.00 89.75  ? 138 GLY 3 O     1 
ATOM   5732  N  N     . LEU C  3  139 ? -50.284  11.349  348.525 1.00 103.87 ? 139 LEU 3 N     1 
ATOM   5733  C  CA    . LEU C  3  139 ? -50.569  9.985   348.067 1.00 111.50 ? 139 LEU 3 CA    1 
ATOM   5734  C  C     . LEU C  3  139 ? -49.291  9.233   347.675 1.00 137.02 ? 139 LEU 3 C     1 
ATOM   5735  O  O     . LEU C  3  139 ? -49.032  8.942   346.506 1.00 137.65 ? 139 LEU 3 O     1 
ATOM   5736  C  CB    . LEU C  3  139 ? -51.589  9.986   346.923 1.00 93.52  ? 139 LEU 3 CB    1 
ATOM   5737  C  CG    . LEU C  3  139 ? -52.949  10.593  347.272 1.00 79.01  ? 139 LEU 3 CG    1 
ATOM   5738  C  CD1   . LEU C  3  139 ? -53.819  10.716  346.032 1.00 72.33  ? 139 LEU 3 CD1   1 
ATOM   5739  C  CD2   . LEU C  3  139 ? -53.642  9.768   348.348 1.00 75.14  ? 139 LEU 3 CD2   1 
ATOM   5740  N  N     . TYR C  3  140 ? -48.488  8.939   348.700 1.00 159.51 ? 140 TYR 3 N     1 
ATOM   5741  C  CA    . TYR C  3  140 ? -47.296  8.119   348.513 1.00 179.90 ? 140 TYR 3 CA    1 
ATOM   5742  C  C     . TYR C  3  140 ? -47.665  6.782   347.876 1.00 184.79 ? 140 TYR 3 C     1 
ATOM   5743  O  O     . TYR C  3  140 ? -48.783  6.282   348.025 1.00 187.25 ? 140 TYR 3 O     1 
ATOM   5744  C  CB    . TYR C  3  140 ? -46.585  7.881   349.854 1.00 195.45 ? 140 TYR 3 CB    1 
ATOM   5745  C  CG    . TYR C  3  140 ? -45.808  6.576   349.913 1.00 210.75 ? 140 TYR 3 CG    1 
ATOM   5746  C  CD1   . TYR C  3  140 ? -44.524  6.484   349.393 1.00 217.57 ? 140 TYR 3 CD1   1 
ATOM   5747  C  CD2   . TYR C  3  140 ? -46.361  5.438   350.490 1.00 218.26 ? 140 TYR 3 CD2   1 
ATOM   5748  C  CE1   . TYR C  3  140 ? -43.818  5.292   349.434 1.00 223.42 ? 140 TYR 3 CE1   1 
ATOM   5749  C  CE2   . TYR C  3  140 ? -45.660  4.245   350.540 1.00 226.32 ? 140 TYR 3 CE2   1 
ATOM   5750  C  CZ    . TYR C  3  140 ? -44.388  4.178   350.009 1.00 229.08 ? 140 TYR 3 CZ    1 
ATOM   5751  O  OH    . TYR C  3  140 ? -43.685  2.994   350.054 1.00 233.71 ? 140 TYR 3 OH    1 
ATOM   5752  N  N     . GLU C  3  141 ? -46.704  6.196   347.161 1.00 185.40 ? 141 GLU 3 N     1 
ATOM   5753  C  CA    . GLU C  3  141 ? -46.943  4.949   346.445 1.00 184.80 ? 141 GLU 3 CA    1 
ATOM   5754  C  C     . GLU C  3  141 ? -47.099  3.800   347.430 1.00 183.51 ? 141 GLU 3 C     1 
ATOM   5755  O  O     . GLU C  3  141 ? -46.127  3.121   347.770 1.00 182.66 ? 141 GLU 3 O     1 
ATOM   5756  C  CB    . GLU C  3  141 ? -45.787  4.668   345.486 1.00 183.81 ? 141 GLU 3 CB    1 
ATOM   5757  C  CG    . GLU C  3  141 ? -46.177  3.985   344.198 1.00 181.39 ? 141 GLU 3 CG    1 
ATOM   5758  C  CD    . GLU C  3  141 ? -45.065  4.049   343.179 1.00 177.25 ? 141 GLU 3 CD    1 
ATOM   5759  O  OE1   . GLU C  3  141 ? -44.829  5.149   342.640 1.00 175.38 ? 141 GLU 3 OE1   1 
ATOM   5760  O  OE2   . GLU C  3  141 ? -44.428  3.008   342.921 1.00 176.12 ? 141 GLU 3 OE2   1 
ATOM   5761  N  N     . LYS C  3  142 ? -48.336  3.555   347.849 1.00 182.20 ? 142 LYS 3 N     1 
ATOM   5762  C  CA    . LYS C  3  142 ? -48.628  2.560   348.868 1.00 179.52 ? 142 LYS 3 CA    1 
ATOM   5763  C  C     . LYS C  3  142 ? -48.594  1.157   348.277 1.00 180.02 ? 142 LYS 3 C     1 
ATOM   5764  O  O     . LYS C  3  142 ? -49.126  0.911   347.191 1.00 180.34 ? 142 LYS 3 O     1 
ATOM   5765  C  CB    . LYS C  3  142 ? -49.995  2.848   349.484 1.00 174.73 ? 142 LYS 3 CB    1 
ATOM   5766  C  CG    . LYS C  3  142 ? -50.063  4.183   350.211 1.00 168.11 ? 142 LYS 3 CG    1 
ATOM   5767  C  CD    . LYS C  3  142 ? -51.418  4.404   350.853 1.00 163.38 ? 142 LYS 3 CD    1 
ATOM   5768  C  CE    . LYS C  3  142 ? -52.490  4.490   349.780 1.00 159.62 ? 142 LYS 3 CE    1 
ATOM   5769  N  NZ    . LYS C  3  142 ? -52.251  5.622   348.843 1.00 156.83 ? 142 LYS 3 NZ    1 
ATOM   5770  N  N     . TYR C  3  143 ? -47.970  0.237   349.003 1.00 177.07 ? 143 TYR 3 N     1 
ATOM   5771  C  CA    . TYR C  3  143 ? -47.801  -1.127  348.522 1.00 170.34 ? 143 TYR 3 CA    1 
ATOM   5772  C  C     . TYR C  3  143 ? -48.100  -2.125  349.636 1.00 165.14 ? 143 TYR 3 C     1 
ATOM   5773  O  O     . TYR C  3  143 ? -47.898  -1.831  350.815 1.00 161.02 ? 143 TYR 3 O     1 
ATOM   5774  C  CB    . TYR C  3  143 ? -46.379  -1.332  347.993 1.00 168.18 ? 143 TYR 3 CB    1 
ATOM   5775  C  CG    . TYR C  3  143 ? -46.139  -0.714  346.634 1.00 166.83 ? 143 TYR 3 CG    1 
ATOM   5776  C  CD1   . TYR C  3  143 ? -47.086  -0.813  345.626 1.00 166.28 ? 143 TYR 3 CD1   1 
ATOM   5777  C  CD2   . TYR C  3  143 ? -44.969  -0.018  346.364 1.00 167.05 ? 143 TYR 3 CD2   1 
ATOM   5778  C  CE1   . TYR C  3  143 ? -46.872  -0.242  344.387 1.00 166.51 ? 143 TYR 3 CE1   1 
ATOM   5779  C  CE2   . TYR C  3  143 ? -44.747  0.556   345.126 1.00 167.87 ? 143 TYR 3 CE2   1 
ATOM   5780  C  CZ    . TYR C  3  143 ? -45.702  0.440   344.142 1.00 168.01 ? 143 TYR 3 CZ    1 
ATOM   5781  O  OH    . TYR C  3  143 ? -45.491  1.008   342.908 1.00 169.45 ? 143 TYR 3 OH    1 
ATOM   5782  N  N     . PRO C  3  148 ? -49.668  -3.881  341.294 1.00 169.95 ? 148 PRO 3 N     1 
ATOM   5783  C  CA    . PRO C  3  148 ? -50.674  -4.348  342.252 1.00 169.84 ? 148 PRO 3 CA    1 
ATOM   5784  C  C     . PRO C  3  148 ? -52.084  -3.886  341.899 1.00 171.14 ? 148 PRO 3 C     1 
ATOM   5785  O  O     . PRO C  3  148 ? -53.056  -4.567  342.225 1.00 170.05 ? 148 PRO 3 O     1 
ATOM   5786  C  CB    . PRO C  3  148 ? -50.210  -3.723  343.565 1.00 169.23 ? 148 PRO 3 CB    1 
ATOM   5787  C  CG    . PRO C  3  148 ? -49.546  -2.450  343.150 1.00 170.14 ? 148 PRO 3 CG    1 
ATOM   5788  C  CD    . PRO C  3  148 ? -48.981  -2.666  341.766 1.00 170.47 ? 148 PRO 3 CD    1 
ATOM   5789  N  N     . LEU C  3  149 ? -52.170  -2.735  341.231 1.00 174.05 ? 149 LEU 3 N     1 
ATOM   5790  C  CA    . LEU C  3  149 ? -53.442  -2.138  340.826 1.00 176.23 ? 149 LEU 3 CA    1 
ATOM   5791  C  C     . LEU C  3  149 ? -54.347  -1.974  342.046 1.00 179.28 ? 149 LEU 3 C     1 
ATOM   5792  O  O     . LEU C  3  149 ? -55.549  -2.242  342.007 1.00 178.31 ? 149 LEU 3 O     1 
ATOM   5793  C  CB    . LEU C  3  149 ? -54.117  -2.953  339.713 1.00 174.26 ? 149 LEU 3 CB    1 
ATOM   5794  C  CG    . LEU C  3  149 ? -55.137  -2.270  338.789 1.00 170.86 ? 149 LEU 3 CG    1 
ATOM   5795  C  CD1   . LEU C  3  149 ? -54.947  -2.779  337.373 1.00 171.59 ? 149 LEU 3 CD1   1 
ATOM   5796  C  CD2   . LEU C  3  149 ? -56.576  -2.516  339.217 1.00 168.69 ? 149 LEU 3 CD2   1 
ATOM   5797  N  N     . GLU C  3  150 ? -53.747  -1.556  343.156 1.00 181.68 ? 150 GLU 3 N     1 
ATOM   5798  C  CA    . GLU C  3  150 ? -54.524  -1.205  344.333 1.00 182.03 ? 150 GLU 3 CA    1 
ATOM   5799  C  C     . GLU C  3  150 ? -55.341  0.044   344.042 1.00 176.44 ? 150 GLU 3 C     1 
ATOM   5800  O  O     . GLU C  3  150 ? -54.846  1.004   343.445 1.00 179.77 ? 150 GLU 3 O     1 
ATOM   5801  C  CB    . GLU C  3  150 ? -53.599  -0.960  345.525 1.00 185.95 ? 150 GLU 3 CB    1 
ATOM   5802  C  CG    . GLU C  3  150 ? -54.318  -0.657  346.831 1.00 188.39 ? 150 GLU 3 CG    1 
ATOM   5803  C  CD    . GLU C  3  150 ? -53.364  -0.250  347.939 1.00 188.36 ? 150 GLU 3 CD    1 
ATOM   5804  O  OE1   . GLU C  3  150 ? -52.145  -0.173  347.676 1.00 187.75 ? 150 GLU 3 OE1   1 
ATOM   5805  O  OE2   . GLU C  3  150 ? -53.832  0.001   349.069 1.00 188.32 ? 150 GLU 3 OE2   1 
ATOM   5806  N  N     . LEU C  3  151 ? -56.606  0.027   344.450 1.00 165.44 ? 151 LEU 3 N     1 
ATOM   5807  C  CA    . LEU C  3  151 ? -57.460  1.192   344.281 1.00 152.83 ? 151 LEU 3 CA    1 
ATOM   5808  C  C     . LEU C  3  151 ? -57.293  2.086   345.499 1.00 144.84 ? 151 LEU 3 C     1 
ATOM   5809  O  O     . LEU C  3  151 ? -57.780  1.731   346.583 1.00 150.37 ? 151 LEU 3 O     1 
ATOM   5810  C  CB    . LEU C  3  151 ? -58.915  0.786   344.110 1.00 146.47 ? 151 LEU 3 CB    1 
ATOM   5811  C  CG    . LEU C  3  151 ? -59.897  1.955   344.039 1.00 139.53 ? 151 LEU 3 CG    1 
ATOM   5812  C  CD1   . LEU C  3  151 ? -59.564  2.853   342.865 1.00 136.79 ? 151 LEU 3 CD1   1 
ATOM   5813  C  CD2   . LEU C  3  151 ? -61.327  1.454   343.935 1.00 138.32 ? 151 LEU 3 CD2   1 
ATOM   5814  N  N     . PRO C  3  152 ? -56.630  3.232   345.386 1.00 128.78 ? 152 PRO 3 N     1 
ATOM   5815  C  CA    . PRO C  3  152 ? -56.507  4.115   346.544 1.00 114.23 ? 152 PRO 3 CA    1 
ATOM   5816  C  C     . PRO C  3  152 ? -57.692  5.059   346.641 1.00 103.97 ? 152 PRO 3 C     1 
ATOM   5817  O  O     . PRO C  3  152 ? -58.243  5.526   345.642 1.00 104.68 ? 152 PRO 3 O     1 
ATOM   5818  C  CB    . PRO C  3  152 ? -55.208  4.883   346.259 1.00 111.47 ? 152 PRO 3 CB    1 
ATOM   5819  C  CG    . PRO C  3  152 ? -54.993  4.772   344.759 1.00 115.41 ? 152 PRO 3 CG    1 
ATOM   5820  C  CD    . PRO C  3  152 ? -56.007  3.815   344.188 1.00 122.58 ? 152 PRO 3 CD    1 
ATOM   5821  N  N     . VAL C  3  153 ? -58.076  5.344   347.878 1.00 95.59  ? 153 VAL 3 N     1 
ATOM   5822  C  CA    . VAL C  3  153 ? -59.214  6.206   348.167 1.00 82.86  ? 153 VAL 3 CA    1 
ATOM   5823  C  C     . VAL C  3  153 ? -58.662  7.559   348.584 1.00 86.88  ? 153 VAL 3 C     1 
ATOM   5824  O  O     . VAL C  3  153 ? -57.651  7.643   349.295 1.00 84.35  ? 153 VAL 3 O     1 
ATOM   5825  C  CB    . VAL C  3  153 ? -60.147  5.598   349.237 1.00 62.63  ? 153 VAL 3 CB    1 
ATOM   5826  C  CG1   . VAL C  3  153 ? -59.504  5.607   350.618 1.00 62.01  ? 153 VAL 3 CG1   1 
ATOM   5827  C  CG2   . VAL C  3  153 ? -61.491  6.321   349.251 1.00 48.52  ? 153 VAL 3 CG2   1 
ATOM   5828  N  N     . TYR C  3  154 ? -59.302  8.626   348.106 1.00 91.34  ? 154 TYR 3 N     1 
ATOM   5829  C  CA    . TYR C  3  154 ? -58.741  9.964   348.267 1.00 89.41  ? 154 TYR 3 CA    1 
ATOM   5830  C  C     . TYR C  3  154 ? -58.747  10.395  349.727 1.00 82.89  ? 154 TYR 3 C     1 
ATOM   5831  O  O     . TYR C  3  154 ? -57.703  10.764  350.276 1.00 78.84  ? 154 TYR 3 O     1 
ATOM   5832  C  CB    . TYR C  3  154 ? -59.499  10.965  347.391 1.00 98.53  ? 154 TYR 3 CB    1 
ATOM   5833  C  CG    . TYR C  3  154 ? -59.180  10.811  345.919 1.00 111.30 ? 154 TYR 3 CG    1 
ATOM   5834  C  CD1   . TYR C  3  154 ? -58.115  11.492  345.348 1.00 115.32 ? 154 TYR 3 CD1   1 
ATOM   5835  C  CD2   . TYR C  3  154 ? -59.924  9.968   345.109 1.00 118.41 ? 154 TYR 3 CD2   1 
ATOM   5836  C  CE1   . TYR C  3  154 ? -57.806  11.348  344.008 1.00 116.74 ? 154 TYR 3 CE1   1 
ATOM   5837  C  CE2   . TYR C  3  154 ? -59.620  9.817   343.766 1.00 119.83 ? 154 TYR 3 CE2   1 
ATOM   5838  C  CZ    . TYR C  3  154 ? -58.560  10.510  343.223 1.00 118.07 ? 154 TYR 3 CZ    1 
ATOM   5839  O  OH    . TYR C  3  154 ? -58.252  10.366  341.890 1.00 116.99 ? 154 TYR 3 OH    1 
ATOM   5840  N  N     . THR C  3  155 ? -59.899  10.335  350.383 1.00 85.33  ? 155 THR 3 N     1 
ATOM   5841  C  CA    . THR C  3  155 ? -60.013  10.813  351.751 1.00 90.61  ? 155 THR 3 CA    1 
ATOM   5842  C  C     . THR C  3  155 ? -60.321  9.657   352.692 1.00 99.31  ? 155 THR 3 C     1 
ATOM   5843  O  O     . THR C  3  155 ? -61.099  8.754   352.363 1.00 108.88 ? 155 THR 3 O     1 
ATOM   5844  C  CB    . THR C  3  155 ? -61.095  11.904  351.875 1.00 90.07  ? 155 THR 3 CB    1 
ATOM   5845  O  OG1   . THR C  3  155 ? -61.087  12.443  353.204 1.00 92.79  ? 155 THR 3 OG1   1 
ATOM   5846  C  CG2   . THR C  3  155 ? -62.482  11.366  351.545 1.00 89.37  ? 155 THR 3 CG2   1 
ATOM   5847  N  N     . ARG C  3  156 ? -59.665  9.679   353.848 1.00 95.82  ? 156 ARG 3 N     1 
ATOM   5848  C  CA    . ARG C  3  156 ? -59.943  8.792   354.967 1.00 93.98  ? 156 ARG 3 CA    1 
ATOM   5849  C  C     . ARG C  3  156 ? -60.856  9.449   355.986 1.00 89.25  ? 156 ARG 3 C     1 
ATOM   5850  O  O     . ARG C  3  156 ? -61.708  8.784   356.583 1.00 87.75  ? 156 ARG 3 O     1 
ATOM   5851  C  CB    . ARG C  3  156 ? -58.627  8.370   355.629 1.00 95.30  ? 156 ARG 3 CB    1 
ATOM   5852  C  CG    . ARG C  3  156 ? -57.667  7.728   354.639 1.00 95.82  ? 156 ARG 3 CG    1 
ATOM   5853  C  CD    . ARG C  3  156 ? -57.381  6.283   354.969 1.00 94.84  ? 156 ARG 3 CD    1 
ATOM   5854  N  NE    . ARG C  3  156 ? -56.394  6.169   356.035 1.00 93.37  ? 156 ARG 3 NE    1 
ATOM   5855  C  CZ    . ARG C  3  156 ? -55.079  6.194   355.836 1.00 88.46  ? 156 ARG 3 CZ    1 
ATOM   5856  N  NH1   . ARG C  3  156 ? -54.594  6.317   354.608 1.00 83.26  ? 156 ARG 3 NH1   1 
ATOM   5857  N  NH2   . ARG C  3  156 ? -54.250  6.085   356.863 1.00 90.26  ? 156 ARG 3 NH2   1 
ATOM   5858  N  N     . PHE C  3  157 ? -60.676  10.752  356.190 1.00 88.24  ? 157 PHE 3 N     1 
ATOM   5859  C  CA    . PHE C  3  157 ? -61.560  11.570  357.004 1.00 92.05  ? 157 PHE 3 CA    1 
ATOM   5860  C  C     . PHE C  3  157 ? -62.970  11.511  356.431 1.00 91.97  ? 157 PHE 3 C     1 
ATOM   5861  O  O     . PHE C  3  157 ? -63.224  12.038  355.343 1.00 87.25  ? 157 PHE 3 O     1 
ATOM   5862  C  CB    . PHE C  3  157 ? -61.043  13.012  357.034 1.00 94.50  ? 157 PHE 3 CB    1 
ATOM   5863  C  CG    . PHE C  3  157 ? -61.860  13.942  357.883 1.00 96.42  ? 157 PHE 3 CG    1 
ATOM   5864  C  CD1   . PHE C  3  157 ? -61.672  14.004  359.251 1.00 96.24  ? 157 PHE 3 CD1   1 
ATOM   5865  C  CD2   . PHE C  3  157 ? -62.815  14.761  357.309 1.00 99.16  ? 157 PHE 3 CD2   1 
ATOM   5866  C  CE1   . PHE C  3  157 ? -62.422  14.867  360.028 1.00 97.65  ? 157 PHE 3 CE1   1 
ATOM   5867  C  CE2   . PHE C  3  157 ? -63.570  15.620  358.084 1.00 99.89  ? 157 PHE 3 CE2   1 
ATOM   5868  C  CZ    . PHE C  3  157 ? -63.369  15.675  359.442 1.00 99.04  ? 157 PHE 3 CZ    1 
ATOM   5869  N  N     . GLU C  3  158 ? -63.893  10.878  357.153 1.00 96.15  ? 158 GLU 3 N     1 
ATOM   5870  C  CA    . GLU C  3  158 ? -65.286  10.790  356.734 1.00 101.37 ? 158 GLU 3 CA    1 
ATOM   5871  C  C     . GLU C  3  158 ? -66.202  11.522  357.708 1.00 99.82  ? 158 GLU 3 C     1 
ATOM   5872  O  O     . GLU C  3  158 ? -67.391  11.209  357.812 1.00 101.51 ? 158 GLU 3 O     1 
ATOM   5873  C  CB    . GLU C  3  158 ? -65.717  9.332   356.588 1.00 105.32 ? 158 GLU 3 CB    1 
ATOM   5874  C  CG    . GLU C  3  158 ? -65.159  8.409   357.654 1.00 108.23 ? 158 GLU 3 CG    1 
ATOM   5875  C  CD    . GLU C  3  158 ? -65.485  6.957   357.381 1.00 112.94 ? 158 GLU 3 CD    1 
ATOM   5876  O  OE1   . GLU C  3  158 ? -64.938  6.394   356.411 1.00 114.61 ? 158 GLU 3 OE1   1 
ATOM   5877  O  OE2   . GLU C  3  158 ? -66.297  6.378   358.132 1.00 115.05 ? 158 GLU 3 OE2   1 
ATOM   5878  N  N     . PHE C  3  159 ? -65.660  12.502  358.424 1.00 93.21  ? 159 PHE 3 N     1 
ATOM   5879  C  CA    . PHE C  3  159 ? -66.406  13.224  359.438 1.00 86.81  ? 159 PHE 3 CA    1 
ATOM   5880  C  C     . PHE C  3  159 ? -66.881  14.558  358.869 1.00 79.75  ? 159 PHE 3 C     1 
ATOM   5881  O  O     . PHE C  3  159 ? -66.671  14.876  357.696 1.00 75.82  ? 159 PHE 3 O     1 
ATOM   5882  C  CB    . PHE C  3  159 ? -65.544  13.438  360.684 1.00 85.23  ? 159 PHE 3 CB    1 
ATOM   5883  C  CG    . PHE C  3  159 ? -64.991  12.171  361.269 1.00 82.52  ? 159 PHE 3 CG    1 
ATOM   5884  C  CD1   . PHE C  3  159 ? -63.848  11.594  360.748 1.00 80.53  ? 159 PHE 3 CD1   1 
ATOM   5885  C  CD2   . PHE C  3  159 ? -65.614  11.556  362.337 1.00 82.96  ? 159 PHE 3 CD2   1 
ATOM   5886  C  CE1   . PHE C  3  159 ? -63.338  10.431  361.282 1.00 80.94  ? 159 PHE 3 CE1   1 
ATOM   5887  C  CE2   . PHE C  3  159 ? -65.104  10.391  362.872 1.00 83.81  ? 159 PHE 3 CE2   1 
ATOM   5888  C  CZ    . PHE C  3  159 ? -63.966  9.831   362.345 1.00 83.75  ? 159 PHE 3 CZ    1 
ATOM   5889  N  N     . THR C  3  160 ? -67.530  15.350  359.717 1.00 79.67  ? 160 THR 3 N     1 
ATOM   5890  C  CA    . THR C  3  160 ? -68.001  16.667  359.316 1.00 85.37  ? 160 THR 3 CA    1 
ATOM   5891  C  C     . THR C  3  160 ? -66.854  17.670  359.387 1.00 92.09  ? 160 THR 3 C     1 
ATOM   5892  O  O     . THR C  3  160 ? -66.080  17.682  360.347 1.00 95.85  ? 160 THR 3 O     1 
ATOM   5893  C  CB    . THR C  3  160 ? -69.168  17.112  360.199 1.00 85.68  ? 160 THR 3 CB    1 
ATOM   5894  O  OG1   . THR C  3  160 ? -70.163  16.084  360.217 1.00 83.29  ? 160 THR 3 OG1   1 
ATOM   5895  C  CG2   . THR C  3  160 ? -69.801  18.377  359.654 1.00 89.74  ? 160 THR 3 CG2   1 
ATOM   5896  N  N     . ARG C  3  161 ? -66.747  18.505  358.361 1.00 90.22  ? 161 ARG 3 N     1 
ATOM   5897  C  CA    . ARG C  3  161 ? -65.639  19.434  358.209 1.00 85.26  ? 161 ARG 3 CA    1 
ATOM   5898  C  C     . ARG C  3  161 ? -65.925  20.769  358.896 1.00 79.09  ? 161 ARG 3 C     1 
ATOM   5899  O  O     . ARG C  3  161 ? -67.040  21.048  359.343 1.00 64.84  ? 161 ARG 3 O     1 
ATOM   5900  C  CB    . ARG C  3  161 ? -65.342  19.636  356.726 1.00 87.26  ? 161 ARG 3 CB    1 
ATOM   5901  C  CG    . ARG C  3  161 ? -64.797  18.382  356.071 1.00 90.95  ? 161 ARG 3 CG    1 
ATOM   5902  C  CD    . ARG C  3  161 ? -64.904  18.429  354.561 1.00 96.61  ? 161 ARG 3 CD    1 
ATOM   5903  N  NE    . ARG C  3  161 ? -64.392  17.206  353.957 1.00 98.63  ? 161 ARG 3 NE    1 
ATOM   5904  C  CZ    . ARG C  3  161 ? -63.114  17.004  353.657 1.00 99.00  ? 161 ARG 3 CZ    1 
ATOM   5905  N  NH1   . ARG C  3  161 ? -62.221  17.960  353.877 1.00 99.29  ? 161 ARG 3 NH1   1 
ATOM   5906  N  NH2   . ARG C  3  161 ? -62.732  15.858  353.113 1.00 98.49  ? 161 ARG 3 NH2   1 
ATOM   5907  N  N     . ARG C  3  162 ? -64.882  21.595  358.987 1.00 86.30  ? 162 ARG 3 N     1 
ATOM   5908  C  CA    . ARG C  3  162 ? -65.003  22.901  359.623 1.00 83.06  ? 162 ARG 3 CA    1 
ATOM   5909  C  C     . ARG C  3  162 ? -65.902  23.818  358.806 1.00 82.45  ? 162 ARG 3 C     1 
ATOM   5910  O  O     . ARG C  3  162 ? -65.735  23.947  357.589 1.00 80.84  ? 162 ARG 3 O     1 
ATOM   5911  C  CB    . ARG C  3  162 ? -63.630  23.550  359.793 1.00 78.31  ? 162 ARG 3 CB    1 
ATOM   5912  C  CG    . ARG C  3  162 ? -63.696  24.874  360.535 1.00 80.09  ? 162 ARG 3 CG    1 
ATOM   5913  C  CD    . ARG C  3  162 ? -62.523  25.793  360.225 1.00 79.74  ? 162 ARG 3 CD    1 
ATOM   5914  N  NE    . ARG C  3  162 ? -61.247  25.272  360.706 1.00 74.89  ? 162 ARG 3 NE    1 
ATOM   5915  C  CZ    . ARG C  3  162 ? -60.239  24.922  359.916 1.00 69.30  ? 162 ARG 3 CZ    1 
ATOM   5916  N  NH1   . ARG C  3  162 ? -60.344  25.051  358.600 1.00 70.35  ? 162 ARG 3 NH1   1 
ATOM   5917  N  NH2   . ARG C  3  162 ? -59.116  24.458  360.445 1.00 64.60  ? 162 ARG 3 NH2   1 
ATOM   5918  N  N     . HIS C  3  163 ? -66.851  24.464  359.482 1.00 82.46  ? 163 HIS 3 N     1 
ATOM   5919  C  CA    . HIS C  3  163 ? -67.810  25.353  358.840 1.00 79.79  ? 163 HIS 3 CA    1 
ATOM   5920  C  C     . HIS C  3  163 ? -67.898  26.637  359.651 1.00 82.70  ? 163 HIS 3 C     1 
ATOM   5921  O  O     . HIS C  3  163 ? -68.312  26.609  360.815 1.00 84.25  ? 163 HIS 3 O     1 
ATOM   5922  C  CB    . HIS C  3  163 ? -69.180  24.681  358.731 1.00 80.14  ? 163 HIS 3 CB    1 
ATOM   5923  C  CG    . HIS C  3  163 ? -69.162  23.407  357.946 1.00 80.84  ? 163 HIS 3 CG    1 
ATOM   5924  N  ND1   . HIS C  3  163 ? -69.647  22.217  358.446 1.00 83.70  ? 163 HIS 3 ND1   1 
ATOM   5925  C  CD2   . HIS C  3  163 ? -68.694  23.131  356.705 1.00 85.86  ? 163 HIS 3 CD2   1 
ATOM   5926  C  CE1   . HIS C  3  163 ? -69.493  21.267  357.543 1.00 82.57  ? 163 HIS 3 CE1   1 
ATOM   5927  N  NE2   . HIS C  3  163 ? -68.916  21.795  356.477 1.00 84.13  ? 163 HIS 3 NE2   1 
ATOM   5928  N  N     . VAL C  3  164 ? -67.510  27.755  359.039 1.00 83.85  ? 164 VAL 3 N     1 
ATOM   5929  C  CA    . VAL C  3  164 ? -67.573  29.078  359.648 1.00 84.87  ? 164 VAL 3 CA    1 
ATOM   5930  C  C     . VAL C  3  164 ? -68.101  30.063  358.610 1.00 82.80  ? 164 VAL 3 C     1 
ATOM   5931  O  O     . VAL C  3  164 ? -68.479  29.686  357.499 1.00 74.83  ? 164 VAL 3 O     1 
ATOM   5932  C  CB    . VAL C  3  164 ? -66.207  29.541  360.198 1.00 85.32  ? 164 VAL 3 CB    1 
ATOM   5933  C  CG1   . VAL C  3  164 ? -65.766  28.661  361.358 1.00 87.90  ? 164 VAL 3 CG1   1 
ATOM   5934  C  CG2   . VAL C  3  164 ? -65.156  29.551  359.103 1.00 83.48  ? 164 VAL 3 CG2   1 
ATOM   5935  N  N     . ASP C  3  165 ? -68.150  31.337  358.995 1.00 92.36  ? 165 ASP 3 N     1 
ATOM   5936  C  CA    . ASP C  3  165 ? -68.601  32.387  358.093 1.00 101.63 ? 165 ASP 3 CA    1 
ATOM   5937  C  C     . ASP C  3  165 ? -67.746  32.395  356.834 1.00 100.07 ? 165 ASP 3 C     1 
ATOM   5938  O  O     . ASP C  3  165 ? -66.567  32.031  356.854 1.00 103.57 ? 165 ASP 3 O     1 
ATOM   5939  C  CB    . ASP C  3  165 ? -68.527  33.751  358.781 1.00 106.89 ? 165 ASP 3 CB    1 
ATOM   5940  C  CG    . ASP C  3  165 ? -68.775  34.906  357.826 1.00 106.63 ? 165 ASP 3 CG    1 
ATOM   5941  O  OD1   . ASP C  3  165 ? -69.897  35.010  357.286 1.00 106.50 ? 165 ASP 3 OD1   1 
ATOM   5942  O  OD2   . ASP C  3  165 ? -67.849  35.713  357.617 1.00 104.55 ? 165 ASP 3 OD2   1 
ATOM   5943  N  N     . LYS C  3  166 ? -68.347  32.823  355.730 1.00 90.34  ? 166 LYS 3 N     1 
ATOM   5944  C  CA    . LYS C  3  166 ? -67.723  32.711  354.425 1.00 77.00  ? 166 LYS 3 CA    1 
ATOM   5945  C  C     . LYS C  3  166 ? -67.666  34.073  353.753 1.00 70.22  ? 166 LYS 3 C     1 
ATOM   5946  O  O     . LYS C  3  166 ? -68.514  34.936  353.991 1.00 70.82  ? 166 LYS 3 O     1 
ATOM   5947  C  CB    . LYS C  3  166 ? -68.497  31.730  353.541 1.00 69.63  ? 166 LYS 3 CB    1 
ATOM   5948  C  CG    . LYS C  3  166 ? -67.615  30.814  352.736 1.00 61.72  ? 166 LYS 3 CG    1 
ATOM   5949  C  CD    . LYS C  3  166 ? -68.360  29.592  352.263 1.00 55.68  ? 166 LYS 3 CD    1 
ATOM   5950  C  CE    . LYS C  3  166 ? -67.459  28.714  351.425 1.00 44.03  ? 166 LYS 3 CE    1 
ATOM   5951  N  NZ    . LYS C  3  166 ? -66.300  28.223  352.209 1.00 43.63  ? 166 LYS 3 NZ    1 
ATOM   5952  N  N     . HIS C  3  167 ? -66.645  34.249  352.920 1.00 66.36  ? 167 HIS 3 N     1 
ATOM   5953  C  CA    . HIS C  3  167 ? -66.455  35.416  352.054 1.00 68.46  ? 167 HIS 3 CA    1 
ATOM   5954  C  C     . HIS C  3  167 ? -66.786  36.723  352.778 1.00 66.36  ? 167 HIS 3 C     1 
ATOM   5955  O  O     . HIS C  3  167 ? -67.673  37.476  352.379 1.00 67.02  ? 167 HIS 3 O     1 
ATOM   5956  C  CB    . HIS C  3  167 ? -67.290  35.298  350.781 1.00 75.35  ? 167 HIS 3 CB    1 
ATOM   5957  C  CG    . HIS C  3  167 ? -68.747  35.081  351.036 1.00 80.01  ? 167 HIS 3 CG    1 
ATOM   5958  N  ND1   . HIS C  3  167 ? -69.590  36.107  351.410 1.00 82.63  ? 167 HIS 3 ND1   1 
ATOM   5959  C  CD2   . HIS C  3  167 ? -69.508  33.962  350.996 1.00 82.38  ? 167 HIS 3 CD2   1 
ATOM   5960  C  CE1   . HIS C  3  167 ? -70.811  35.633  351.575 1.00 82.99  ? 167 HIS 3 CE1   1 
ATOM   5961  N  NE2   . HIS C  3  167 ? -70.789  34.334  351.332 1.00 84.29  ? 167 HIS 3 NE2   1 
ATOM   5962  N  N     . HIS C  3  168 ? -66.053  36.999  353.856 1.00 65.08  ? 168 HIS 3 N     1 
ATOM   5963  C  CA    . HIS C  3  168 ? -66.324  38.224  354.592 1.00 67.32  ? 168 HIS 3 CA    1 
ATOM   5964  C  C     . HIS C  3  168 ? -65.395  39.319  354.104 1.00 66.04  ? 168 HIS 3 C     1 
ATOM   5965  O  O     . HIS C  3  168 ? -64.180  39.235  354.336 1.00 67.49  ? 168 HIS 3 O     1 
ATOM   5966  C  CB    . HIS C  3  168 ? -66.155  38.021  356.096 1.00 73.23  ? 168 HIS 3 CB    1 
ATOM   5967  C  CG    . HIS C  3  168 ? -66.428  39.257  356.898 1.00 80.39  ? 168 HIS 3 CG    1 
ATOM   5968  N  ND1   . HIS C  3  168 ? -67.654  39.887  356.891 1.00 83.30  ? 168 HIS 3 ND1   1 
ATOM   5969  C  CD2   . HIS C  3  168 ? -65.637  39.979  357.726 1.00 81.50  ? 168 HIS 3 CD2   1 
ATOM   5970  C  CE1   . HIS C  3  168 ? -67.605  40.948  357.676 1.00 83.61  ? 168 HIS 3 CE1   1 
ATOM   5971  N  NE2   . HIS C  3  168 ? -66.393  41.025  358.198 1.00 82.11  ? 168 HIS 3 NE2   1 
ATOM   5972  N  N     . PRO C  3  169 ? -65.902  40.355  353.438 1.00 68.59  ? 169 PRO 3 N     1 
ATOM   5973  C  CA    . PRO C  3  169 ? -65.037  41.471  353.030 1.00 75.15  ? 169 PRO 3 CA    1 
ATOM   5974  C  C     . PRO C  3  169 ? -64.548  42.239  354.249 1.00 84.59  ? 169 PRO 3 C     1 
ATOM   5975  O  O     . PRO C  3  169 ? -65.344  42.801  355.002 1.00 92.33  ? 169 PRO 3 O     1 
ATOM   5976  C  CB    . PRO C  3  169 ? -65.956  42.323  352.147 1.00 72.97  ? 169 PRO 3 CB    1 
ATOM   5977  C  CG    . PRO C  3  169 ? -67.339  41.987  352.629 1.00 71.88  ? 169 PRO 3 CG    1 
ATOM   5978  C  CD    . PRO C  3  169 ? -67.284  40.527  352.960 1.00 67.96  ? 169 PRO 3 CD    1 
ATOM   5979  N  N     . LEU C  3  170 ? -63.229  42.270  354.436 1.00 84.31  ? 170 LEU 3 N     1 
ATOM   5980  C  CA    . LEU C  3  170 ? -62.645  43.074  355.502 1.00 88.09  ? 170 LEU 3 CA    1 
ATOM   5981  C  C     . LEU C  3  170 ? -62.525  44.539  355.126 1.00 91.26  ? 170 LEU 3 C     1 
ATOM   5982  O  O     . LEU C  3  170 ? -62.352  45.379  356.013 1.00 96.09  ? 170 LEU 3 O     1 
ATOM   5983  C  CB    . LEU C  3  170 ? -61.269  42.531  355.885 1.00 89.75  ? 170 LEU 3 CB    1 
ATOM   5984  C  CG    . LEU C  3  170 ? -61.332  41.357  356.854 1.00 97.93  ? 170 LEU 3 CG    1 
ATOM   5985  C  CD1   . LEU C  3  170 ? -59.952  41.051  357.387 1.00 99.63  ? 170 LEU 3 CD1   1 
ATOM   5986  C  CD2   . LEU C  3  170 ? -62.296  41.676  357.988 1.00 104.90 ? 170 LEU 3 CD2   1 
ATOM   5987  N  N     . SER C  3  171 ? -62.650  44.856  353.847 1.00 85.01  ? 171 SER 3 N     1 
ATOM   5988  C  CA    . SER C  3  171 ? -62.576  46.213  353.331 1.00 74.51  ? 171 SER 3 CA    1 
ATOM   5989  C  C     . SER C  3  171 ? -63.074  46.184  351.890 1.00 74.82  ? 171 SER 3 C     1 
ATOM   5990  O  O     . SER C  3  171 ? -63.067  45.122  351.256 1.00 77.98  ? 171 SER 3 O     1 
ATOM   5991  C  CB    . SER C  3  171 ? -61.142  46.765  353.403 1.00 60.54  ? 171 SER 3 CB    1 
ATOM   5992  O  OG    . SER C  3  171 ? -60.455  46.581  352.178 1.00 50.03  ? 171 SER 3 OG    1 
ATOM   5993  N  N     . PRO C  3  172 ? -63.518  47.330  351.357 1.00 72.72  ? 172 PRO 3 N     1 
ATOM   5994  C  CA    . PRO C  3  172 ? -64.039  47.349  349.981 1.00 71.06  ? 172 PRO 3 CA    1 
ATOM   5995  C  C     . PRO C  3  172 ? -63.099  46.769  348.931 1.00 64.65  ? 172 PRO 3 C     1 
ATOM   5996  O  O     . PRO C  3  172 ? -63.509  46.584  347.780 1.00 57.66  ? 172 PRO 3 O     1 
ATOM   5997  C  CB    . PRO C  3  172 ? -64.302  48.842  349.725 1.00 75.98  ? 172 PRO 3 CB    1 
ATOM   5998  C  CG    . PRO C  3  172 ? -63.641  49.584  350.865 1.00 76.07  ? 172 PRO 3 CG    1 
ATOM   5999  C  CD    . PRO C  3  172 ? -63.661  48.639  352.016 1.00 73.97  ? 172 PRO 3 CD    1 
ATOM   6000  N  N     . PHE C  3  173 ? -61.848  46.468  349.302 1.00 67.02  ? 173 PHE 3 N     1 
ATOM   6001  C  CA    . PHE C  3  173 ? -60.880  45.901  348.373 1.00 67.15  ? 173 PHE 3 CA    1 
ATOM   6002  C  C     . PHE C  3  173 ? -60.476  44.463  348.676 1.00 57.58  ? 173 PHE 3 C     1 
ATOM   6003  O  O     . PHE C  3  173 ? -59.886  43.818  347.803 1.00 58.11  ? 173 PHE 3 O     1 
ATOM   6004  C  CB    . PHE C  3  173 ? -59.607  46.761  348.342 1.00 69.79  ? 173 PHE 3 CB    1 
ATOM   6005  C  CG    . PHE C  3  173 ? -59.867  48.225  348.146 1.00 72.60  ? 173 PHE 3 CG    1 
ATOM   6006  C  CD1   . PHE C  3  173 ? -60.691  48.665  347.129 1.00 78.29  ? 173 PHE 3 CD1   1 
ATOM   6007  C  CD2   . PHE C  3  173 ? -59.279  49.162  348.975 1.00 71.55  ? 173 PHE 3 CD2   1 
ATOM   6008  C  CE1   . PHE C  3  173 ? -60.931  50.010  346.949 1.00 79.87  ? 173 PHE 3 CE1   1 
ATOM   6009  C  CE2   . PHE C  3  173 ? -59.518  50.510  348.795 1.00 76.17  ? 173 PHE 3 CE2   1 
ATOM   6010  C  CZ    . PHE C  3  173 ? -60.345  50.932  347.780 1.00 78.97  ? 173 PHE 3 CZ    1 
ATOM   6011  N  N     . VAL C  3  174 ? -60.777  43.935  349.862 1.00 51.27  ? 174 VAL 3 N     1 
ATOM   6012  C  CA    . VAL C  3  174 ? -60.262  42.637  350.293 1.00 46.97  ? 174 VAL 3 CA    1 
ATOM   6013  C  C     . VAL C  3  174 ? -61.419  41.773  350.774 1.00 60.91  ? 174 VAL 3 C     1 
ATOM   6014  O  O     . VAL C  3  174 ? -62.299  42.251  351.499 1.00 61.49  ? 174 VAL 3 O     1 
ATOM   6015  C  CB    . VAL C  3  174 ? -59.194  42.792  351.401 1.00 42.28  ? 174 VAL 3 CB    1 
ATOM   6016  C  CG1   . VAL C  3  174 ? -58.831  41.443  352.004 1.00 42.02  ? 174 VAL 3 CG1   1 
ATOM   6017  C  CG2   . VAL C  3  174 ? -57.952  43.481  350.855 1.00 42.41  ? 174 VAL 3 CG2   1 
ATOM   6018  N  N     . ILE C  3  175 ? -61.417  40.499  350.377 1.00 66.00  ? 175 ILE 3 N     1 
ATOM   6019  C  CA    . ILE C  3  175 ? -62.428  39.539  350.806 1.00 68.48  ? 175 ILE 3 CA    1 
ATOM   6020  C  C     . ILE C  3  175 ? -61.730  38.454  351.616 1.00 60.98  ? 175 ILE 3 C     1 
ATOM   6021  O  O     . ILE C  3  175 ? -60.586  38.085  351.318 1.00 54.98  ? 175 ILE 3 O     1 
ATOM   6022  C  CB    . ILE C  3  175 ? -63.197  38.928  349.610 1.00 69.72  ? 175 ILE 3 CB    1 
ATOM   6023  C  CG1   . ILE C  3  175 ? -64.640  38.620  349.994 1.00 68.31  ? 175 ILE 3 CG1   1 
ATOM   6024  C  CG2   . ILE C  3  175 ? -62.578  37.624  349.152 1.00 71.19  ? 175 ILE 3 CG2   1 
ATOM   6025  C  CD1   . ILE C  3  175 ? -65.478  38.102  348.840 1.00 64.88  ? 175 ILE 3 CD1   1 
ATOM   6026  N  N     . LEU C  3  176 ? -62.422  37.950  352.639 1.00 59.92  ? 176 LEU 3 N     1 
ATOM   6027  C  CA    . LEU C  3  176 ? -61.882  36.963  353.566 1.00 61.04  ? 176 LEU 3 CA    1 
ATOM   6028  C  C     . LEU C  3  176 ? -62.861  35.805  353.676 1.00 71.19  ? 176 LEU 3 C     1 
ATOM   6029  O  O     . LEU C  3  176 ? -64.015  36.001  354.070 1.00 71.83  ? 176 LEU 3 O     1 
ATOM   6030  C  CB    . LEU C  3  176 ? -61.629  37.588  354.946 1.00 58.65  ? 176 LEU 3 CB    1 
ATOM   6031  C  CG    . LEU C  3  176 ? -61.332  36.666  356.130 1.00 53.98  ? 176 LEU 3 CG    1 
ATOM   6032  C  CD1   . LEU C  3  176 ? -60.138  35.774  355.855 1.00 54.22  ? 176 LEU 3 CD1   1 
ATOM   6033  C  CD2   . LEU C  3  176 ? -61.114  37.481  357.405 1.00 42.41  ? 176 LEU 3 CD2   1 
ATOM   6034  N  N     . ASP C  3  177 ? -62.395  34.601  353.345 1.00 78.87  ? 177 ASP 3 N     1 
ATOM   6035  C  CA    . ASP C  3  177 ? -63.170  33.365  353.461 1.00 81.33  ? 177 ASP 3 CA    1 
ATOM   6036  C  C     . ASP C  3  177 ? -62.472  32.499  354.506 1.00 80.79  ? 177 ASP 3 C     1 
ATOM   6037  O  O     . ASP C  3  177 ? -61.463  31.854  354.210 1.00 82.77  ? 177 ASP 3 O     1 
ATOM   6038  C  CB    . ASP C  3  177 ? -63.273  32.665  352.111 1.00 79.28  ? 177 ASP 3 CB    1 
ATOM   6039  C  CG    . ASP C  3  177 ? -64.354  31.609  352.080 1.00 75.16  ? 177 ASP 3 CG    1 
ATOM   6040  O  OD1   . ASP C  3  177 ? -64.449  30.812  353.035 1.00 75.34  ? 177 ASP 3 OD1   1 
ATOM   6041  O  OD2   . ASP C  3  177 ? -65.118  31.585  351.093 1.00 72.79  ? 177 ASP 3 OD2   1 
ATOM   6042  N  N     . ARG C  3  178 ? -63.012  32.461  355.722 1.00 79.30  ? 178 ARG 3 N     1 
ATOM   6043  C  CA    . ARG C  3  178 ? -62.283  31.882  356.846 1.00 85.95  ? 178 ARG 3 CA    1 
ATOM   6044  C  C     . ARG C  3  178 ? -62.166  30.359  356.800 1.00 87.90  ? 178 ARG 3 C     1 
ATOM   6045  O  O     . ARG C  3  178 ? -61.330  29.808  357.524 1.00 90.54  ? 178 ARG 3 O     1 
ATOM   6046  C  CB    . ARG C  3  178 ? -62.945  32.327  358.150 1.00 89.81  ? 178 ARG 3 CB    1 
ATOM   6047  C  CG    . ARG C  3  178 ? -62.870  33.830  358.345 1.00 91.96  ? 178 ARG 3 CG    1 
ATOM   6048  C  CD    . ARG C  3  178 ? -63.967  34.366  359.236 1.00 95.76  ? 178 ARG 3 CD    1 
ATOM   6049  N  NE    . ARG C  3  178 ? -63.884  35.819  359.328 1.00 101.44 ? 178 ARG 3 NE    1 
ATOM   6050  C  CZ    . ARG C  3  178 ? -64.518  36.555  360.234 1.00 105.79 ? 178 ARG 3 CZ    1 
ATOM   6051  N  NH1   . ARG C  3  178 ? -65.305  35.979  361.130 1.00 113.65 ? 178 ARG 3 NH1   1 
ATOM   6052  N  NH2   . ARG C  3  178 ? -64.376  37.874  360.230 1.00 100.44 ? 178 ARG 3 NH2   1 
ATOM   6053  N  N     . GLU C  3  179 ? -62.947  29.665  355.969 1.00 83.14  ? 179 GLU 3 N     1 
ATOM   6054  C  CA    . GLU C  3  179 ? -62.792  28.214  355.873 1.00 75.46  ? 179 GLU 3 CA    1 
ATOM   6055  C  C     . GLU C  3  179 ? -61.518  27.831  355.127 1.00 69.42  ? 179 GLU 3 C     1 
ATOM   6056  O  O     . GLU C  3  179 ? -60.799  26.918  355.549 1.00 65.58  ? 179 GLU 3 O     1 
ATOM   6057  C  CB    . GLU C  3  179 ? -64.009  27.586  355.197 1.00 75.80  ? 179 GLU 3 CB    1 
ATOM   6058  C  CG    . GLU C  3  179 ? -65.272  27.592  356.036 1.00 78.26  ? 179 GLU 3 CG    1 
ATOM   6059  C  CD    . GLU C  3  179 ? -66.465  27.052  355.283 1.00 79.80  ? 179 GLU 3 CD    1 
ATOM   6060  O  OE1   . GLU C  3  179 ? -66.412  27.008  354.040 1.00 78.82  ? 179 GLU 3 OE1   1 
ATOM   6061  O  OE2   . GLU C  3  179 ? -67.456  26.664  355.932 1.00 82.36  ? 179 GLU 3 OE2   1 
ATOM   6062  N  N     . ARG C  3  180 ? -61.216  28.523  354.026 1.00 73.22  ? 180 ARG 3 N     1 
ATOM   6063  C  CA    . ARG C  3  180 ? -60.113  28.125  353.154 1.00 79.52  ? 180 ARG 3 CA    1 
ATOM   6064  C  C     . ARG C  3  180 ? -58.764  28.259  353.839 1.00 92.74  ? 180 ARG 3 C     1 
ATOM   6065  O  O     . ARG C  3  180 ? -57.802  27.604  353.426 1.00 98.94  ? 180 ARG 3 O     1 
ATOM   6066  C  CB    . ARG C  3  180 ? -60.136  28.963  351.873 1.00 67.96  ? 180 ARG 3 CB    1 
ATOM   6067  C  CG    . ARG C  3  180 ? -61.305  28.640  350.968 1.00 54.20  ? 180 ARG 3 CG    1 
ATOM   6068  C  CD    . ARG C  3  180 ? -61.495  29.626  349.848 1.00 51.68  ? 180 ARG 3 CD    1 
ATOM   6069  N  NE    . ARG C  3  180 ? -62.838  29.510  349.295 1.00 49.91  ? 180 ARG 3 NE    1 
ATOM   6070  C  CZ    . ARG C  3  180 ? -63.512  30.523  348.763 1.00 67.75  ? 180 ARG 3 CZ    1 
ATOM   6071  N  NH1   . ARG C  3  180 ? -62.974  31.730  348.726 1.00 82.20  ? 180 ARG 3 NH1   1 
ATOM   6072  N  NH2   . ARG C  3  180 ? -64.732  30.334  348.284 1.00 71.79  ? 180 ARG 3 NH2   1 
ATOM   6073  N  N     . CYS C  3  181 ? -58.680  29.098  354.866 1.00 97.49  ? 181 CYS 3 N     1 
ATOM   6074  C  CA    . CYS C  3  181 ? -57.431  29.311  355.580 1.00 101.32 ? 181 CYS 3 CA    1 
ATOM   6075  C  C     . CYS C  3  181 ? -56.923  28.001  356.169 1.00 106.29 ? 181 CYS 3 C     1 
ATOM   6076  O  O     . CYS C  3  181 ? -57.688  27.217  356.738 1.00 107.55 ? 181 CYS 3 O     1 
ATOM   6077  C  CB    . CYS C  3  181 ? -57.649  30.338  356.692 1.00 100.88 ? 181 CYS 3 CB    1 
ATOM   6078  S  SG    . CYS C  3  181 ? -56.240  30.590  357.761 1.00 99.59  ? 181 CYS 3 SG    1 
ATOM   6079  N  N     . ILE C  3  182 ? -55.620  27.759  356.021 1.00 109.76 ? 182 ILE 3 N     1 
ATOM   6080  C  CA    . ILE C  3  182 ? -54.983  26.590  356.616 1.00 116.96 ? 182 ILE 3 CA    1 
ATOM   6081  C  C     . ILE C  3  182 ? -54.211  26.955  357.878 1.00 115.41 ? 182 ILE 3 C     1 
ATOM   6082  O  O     . ILE C  3  182 ? -53.443  26.135  358.391 1.00 122.46 ? 182 ILE 3 O     1 
ATOM   6083  C  CB    . ILE C  3  182 ? -54.057  25.882  355.611 1.00 121.19 ? 182 ILE 3 CB    1 
ATOM   6084  C  CG1   . ILE C  3  182 ? -52.846  26.753  355.284 1.00 121.10 ? 182 ILE 3 CG1   1 
ATOM   6085  C  CG2   . ILE C  3  182 ? -54.815  25.545  354.337 1.00 125.04 ? 182 ILE 3 CG2   1 
ATOM   6086  C  CD1   . ILE C  3  182 ? -51.797  26.056  354.432 1.00 120.95 ? 182 ILE 3 CD1   1 
ATOM   6087  N  N     . HIS C  3  183 ? -54.400  28.172  358.388 1.00 100.63 ? 183 HIS 3 N     1 
ATOM   6088  C  CA    . HIS C  3  183 ? -53.687  28.672  359.559 1.00 79.04  ? 183 HIS 3 CA    1 
ATOM   6089  C  C     . HIS C  3  183 ? -52.176  28.583  359.351 1.00 63.98  ? 183 HIS 3 C     1 
ATOM   6090  O  O     . HIS C  3  183 ? -51.443  27.936  360.103 1.00 50.71  ? 183 HIS 3 O     1 
ATOM   6091  C  CB    . HIS C  3  183 ? -54.125  27.944  360.830 1.00 77.14  ? 183 HIS 3 CB    1 
ATOM   6092  C  CG    . HIS C  3  183 ? -55.574  28.131  361.152 1.00 69.61  ? 183 HIS 3 CG    1 
ATOM   6093  N  ND1   . HIS C  3  183 ? -56.578  27.573  360.389 1.00 74.59  ? 183 HIS 3 ND1   1 
ATOM   6094  C  CD2   . HIS C  3  183 ? -56.188  28.820  362.143 1.00 75.36  ? 183 HIS 3 CD2   1 
ATOM   6095  C  CE1   . HIS C  3  183 ? -57.750  27.907  360.899 1.00 72.90  ? 183 HIS 3 CE1   1 
ATOM   6096  N  NE2   . HIS C  3  183 ? -57.541  28.663  361.963 1.00 75.55  ? 183 HIS 3 NE2   1 
ATOM   6097  N  N     . CYS C  3  184 ? -51.723  29.234  358.288 1.00 66.59  ? 184 CYS 3 N     1 
ATOM   6098  C  CA    . CYS C  3  184 ? -50.333  29.654  358.202 1.00 71.63  ? 184 CYS 3 CA    1 
ATOM   6099  C  C     . CYS C  3  184 ? -50.223  30.957  358.991 1.00 76.44  ? 184 CYS 3 C     1 
ATOM   6100  O  O     . CYS C  3  184 ? -51.114  31.307  359.769 1.00 85.59  ? 184 CYS 3 O     1 
ATOM   6101  C  CB    . CYS C  3  184 ? -49.889  29.763  356.744 1.00 67.24  ? 184 CYS 3 CB    1 
ATOM   6102  S  SG    . CYS C  3  184 ? -50.029  31.374  355.968 1.00 59.08  ? 184 CYS 3 SG    1 
ATOM   6103  N  N     . LYS C  3  185 ? -49.133  31.696  358.833 1.00 68.32  ? 185 LYS 3 N     1 
ATOM   6104  C  CA    . LYS C  3  185 ? -49.004  32.945  359.567 1.00 68.82  ? 185 LYS 3 CA    1 
ATOM   6105  C  C     . LYS C  3  185 ? -48.733  34.140  358.665 1.00 61.15  ? 185 LYS 3 C     1 
ATOM   6106  O  O     . LYS C  3  185 ? -48.475  35.233  359.176 1.00 60.00  ? 185 LYS 3 O     1 
ATOM   6107  C  CB    . LYS C  3  185 ? -47.901  32.823  360.624 1.00 79.66  ? 185 LYS 3 CB    1 
ATOM   6108  C  CG    . LYS C  3  185 ? -48.258  33.445  361.959 1.00 82.74  ? 185 LYS 3 CG    1 
ATOM   6109  C  CD    . LYS C  3  185 ? -47.183  33.170  362.989 1.00 82.54  ? 185 LYS 3 CD    1 
ATOM   6110  C  CE    . LYS C  3  185 ? -47.557  33.754  364.333 1.00 84.27  ? 185 LYS 3 CE    1 
ATOM   6111  N  NZ    . LYS C  3  185 ? -46.494  33.499  365.338 1.00 86.58  ? 185 LYS 3 NZ    1 
ATOM   6112  N  N     . ARG C  3  186 ? -48.834  33.974  357.346 1.00 55.98  ? 186 ARG 3 N     1 
ATOM   6113  C  CA    . ARG C  3  186 ? -48.289  34.958  356.414 1.00 55.33  ? 186 ARG 3 CA    1 
ATOM   6114  C  C     . ARG C  3  186 ? -48.922  36.337  356.599 1.00 56.50  ? 186 ARG 3 C     1 
ATOM   6115  O  O     . ARG C  3  186 ? -48.212  37.340  356.739 1.00 60.78  ? 186 ARG 3 O     1 
ATOM   6116  C  CB    . ARG C  3  186 ? -48.464  34.448  354.981 1.00 53.74  ? 186 ARG 3 CB    1 
ATOM   6117  C  CG    . ARG C  3  186 ? -47.524  33.287  354.637 1.00 52.02  ? 186 ARG 3 CG    1 
ATOM   6118  C  CD    . ARG C  3  186 ? -47.805  32.690  353.264 1.00 55.85  ? 186 ARG 3 CD    1 
ATOM   6119  N  NE    . ARG C  3  186 ? -47.004  31.493  353.019 1.00 60.63  ? 186 ARG 3 NE    1 
ATOM   6120  C  CZ    . ARG C  3  186 ? -46.906  30.880  351.844 1.00 53.27  ? 186 ARG 3 CZ    1 
ATOM   6121  N  NH1   . ARG C  3  186 ? -47.559  31.349  350.790 1.00 55.19  ? 186 ARG 3 NH1   1 
ATOM   6122  N  NH2   . ARG C  3  186 ? -46.160  29.791  351.725 1.00 40.53  ? 186 ARG 3 NH2   1 
ATOM   6123  N  N     . CYS C  3  187 ? -50.256  36.410  356.626 1.00 54.95  ? 187 CYS 3 N     1 
ATOM   6124  C  CA    . CYS C  3  187 ? -50.915  37.714  356.665 1.00 55.47  ? 187 CYS 3 CA    1 
ATOM   6125  C  C     . CYS C  3  187 ? -50.610  38.463  357.959 1.00 50.35  ? 187 CYS 3 C     1 
ATOM   6126  O  O     . CYS C  3  187 ? -50.213  39.634  357.927 1.00 51.56  ? 187 CYS 3 O     1 
ATOM   6127  C  CB    . CYS C  3  187 ? -52.427  37.555  356.454 1.00 60.23  ? 187 CYS 3 CB    1 
ATOM   6128  S  SG    . CYS C  3  187 ? -53.336  36.489  357.603 1.00 63.18  ? 187 CYS 3 SG    1 
ATOM   6129  N  N     . VAL C  3  188 ? -50.752  37.795  359.107 1.00 49.79  ? 188 VAL 3 N     1 
ATOM   6130  C  CA    . VAL C  3  188 ? -50.504  38.472  360.380 1.00 48.62  ? 188 VAL 3 CA    1 
ATOM   6131  C  C     . VAL C  3  188 ? -49.013  38.730  360.583 1.00 58.29  ? 188 VAL 3 C     1 
ATOM   6132  O  O     . VAL C  3  188 ? -48.629  39.762  361.146 1.00 59.17  ? 188 VAL 3 O     1 
ATOM   6133  C  CB    . VAL C  3  188 ? -51.116  37.670  361.552 1.00 39.41  ? 188 VAL 3 CB    1 
ATOM   6134  C  CG1   . VAL C  3  188 ? -52.505  37.159  361.189 1.00 39.59  ? 188 VAL 3 CG1   1 
ATOM   6135  C  CG2   . VAL C  3  188 ? -50.216  36.516  361.986 1.00 38.87  ? 188 VAL 3 CG2   1 
ATOM   6136  N  N     . ARG C  3  189 ? -48.153  37.825  360.104 1.00 61.00  ? 189 ARG 3 N     1 
ATOM   6137  C  CA    . ARG C  3  189 ? -46.708  38.018  360.212 1.00 54.92  ? 189 ARG 3 CA    1 
ATOM   6138  C  C     . ARG C  3  189 ? -46.278  39.275  359.471 1.00 45.28  ? 189 ARG 3 C     1 
ATOM   6139  O  O     . ARG C  3  189 ? -45.578  40.137  360.021 1.00 43.33  ? 189 ARG 3 O     1 
ATOM   6140  C  CB    . ARG C  3  189 ? -45.996  36.795  359.641 1.00 54.63  ? 189 ARG 3 CB    1 
ATOM   6141  C  CG    . ARG C  3  189 ? -44.694  36.422  360.281 1.00 58.50  ? 189 ARG 3 CG    1 
ATOM   6142  C  CD    . ARG C  3  189 ? -44.559  34.907  360.293 1.00 60.68  ? 189 ARG 3 CD    1 
ATOM   6143  N  NE    . ARG C  3  189 ? -43.893  34.408  359.092 1.00 62.15  ? 189 ARG 3 NE    1 
ATOM   6144  C  CZ    . ARG C  3  189 ? -44.507  33.754  358.111 1.00 61.23  ? 189 ARG 3 CZ    1 
ATOM   6145  N  NH1   . ARG C  3  189 ? -45.806  33.514  358.182 1.00 63.99  ? 189 ARG 3 NH1   1 
ATOM   6146  N  NH2   . ARG C  3  189 ? -43.819  33.339  357.057 1.00 55.73  ? 189 ARG 3 NH2   1 
ATOM   6147  N  N     . TYR C  3  190 ? -46.700  39.393  358.212 1.00 45.49  ? 190 TYR 3 N     1 
ATOM   6148  C  CA    . TYR C  3  190 ? -46.452  40.605  357.443 1.00 46.70  ? 190 TYR 3 CA    1 
ATOM   6149  C  C     . TYR C  3  190 ? -47.040  41.824  358.144 1.00 48.49  ? 190 TYR 3 C     1 
ATOM   6150  O  O     . TYR C  3  190 ? -46.327  42.794  358.414 1.00 53.29  ? 190 TYR 3 O     1 
ATOM   6151  C  CB    . TYR C  3  190 ? -47.011  40.424  356.030 1.00 50.86  ? 190 TYR 3 CB    1 
ATOM   6152  C  CG    . TYR C  3  190 ? -47.429  41.675  355.297 1.00 55.60  ? 190 TYR 3 CG    1 
ATOM   6153  C  CD1   . TYR C  3  190 ? -46.497  42.518  354.729 1.00 63.57  ? 190 TYR 3 CD1   1 
ATOM   6154  C  CD2   . TYR C  3  190 ? -48.760  41.983  355.135 1.00 57.56  ? 190 TYR 3 CD2   1 
ATOM   6155  C  CE1   . TYR C  3  190 ? -46.888  43.646  354.044 1.00 67.23  ? 190 TYR 3 CE1   1 
ATOM   6156  C  CE2   . TYR C  3  190 ? -49.159  43.103  354.449 1.00 63.35  ? 190 TYR 3 CE2   1 
ATOM   6157  C  CZ    . TYR C  3  190 ? -48.218  43.932  353.910 1.00 68.95  ? 190 TYR 3 CZ    1 
ATOM   6158  O  OH    . TYR C  3  190 ? -48.605  45.052  353.228 1.00 79.33  ? 190 TYR 3 OH    1 
ATOM   6159  N  N     . PHE C  3  191 ? -48.337  41.782  358.472 1.00 42.25  ? 191 PHE 3 N     1 
ATOM   6160  C  CA    . PHE C  3  191 ? -48.998  42.949  359.055 1.00 43.57  ? 191 PHE 3 CA    1 
ATOM   6161  C  C     . PHE C  3  191 ? -48.313  43.431  360.328 1.00 44.54  ? 191 PHE 3 C     1 
ATOM   6162  O  O     . PHE C  3  191 ? -48.314  44.635  360.607 1.00 48.53  ? 191 PHE 3 O     1 
ATOM   6163  C  CB    . PHE C  3  191 ? -50.474  42.646  359.323 1.00 41.72  ? 191 PHE 3 CB    1 
ATOM   6164  C  CG    . PHE C  3  191 ? -51.392  43.180  358.261 1.00 39.54  ? 191 PHE 3 CG    1 
ATOM   6165  C  CD1   . PHE C  3  191 ? -51.353  44.513  357.916 1.00 39.62  ? 191 PHE 3 CD1   1 
ATOM   6166  C  CD2   . PHE C  3  191 ? -52.275  42.354  357.595 1.00 39.79  ? 191 PHE 3 CD2   1 
ATOM   6167  C  CE1   . PHE C  3  191 ? -52.174  45.013  356.937 1.00 39.95  ? 191 PHE 3 CE1   1 
ATOM   6168  C  CE2   . PHE C  3  191 ? -53.102  42.861  356.612 1.00 40.11  ? 191 PHE 3 CE2   1 
ATOM   6169  C  CZ    . PHE C  3  191 ? -53.046  44.190  356.287 1.00 40.19  ? 191 PHE 3 CZ    1 
ATOM   6170  N  N     . GLU C  3  192 ? -47.714  42.529  361.106 1.00 46.26  ? 192 GLU 3 N     1 
ATOM   6171  C  CA    . GLU C  3  192 ? -46.957  42.998  362.263 1.00 60.00  ? 192 GLU 3 CA    1 
ATOM   6172  C  C     . GLU C  3  192 ? -45.590  43.523  361.862 1.00 70.55  ? 192 GLU 3 C     1 
ATOM   6173  O  O     . GLU C  3  192 ? -45.142  44.547  362.388 1.00 72.06  ? 192 GLU 3 O     1 
ATOM   6174  C  CB    . GLU C  3  192 ? -46.780  41.888  363.303 1.00 65.01  ? 192 GLU 3 CB    1 
ATOM   6175  C  CG    . GLU C  3  192 ? -46.246  42.387  364.661 1.00 63.63  ? 192 GLU 3 CG    1 
ATOM   6176  C  CD    . GLU C  3  192 ? -44.743  42.671  364.683 1.00 55.38  ? 192 GLU 3 CD    1 
ATOM   6177  O  OE1   . GLU C  3  192 ? -43.994  42.065  363.892 1.00 51.04  ? 192 GLU 3 OE1   1 
ATOM   6178  O  OE2   . GLU C  3  192 ? -44.310  43.530  365.475 1.00 49.20  ? 192 GLU 3 OE2   1 
ATOM   6179  N  N     . GLU C  3  193 ? -44.926  42.869  360.914 1.00 77.50  ? 193 GLU 3 N     1 
ATOM   6180  C  CA    . GLU C  3  193 ? -43.510  43.147  360.705 1.00 77.76  ? 193 GLU 3 CA    1 
ATOM   6181  C  C     . GLU C  3  193 ? -43.279  44.274  359.704 1.00 72.57  ? 193 GLU 3 C     1 
ATOM   6182  O  O     . GLU C  3  193 ? -42.702  45.306  360.051 1.00 72.45  ? 193 GLU 3 O     1 
ATOM   6183  C  CB    . GLU C  3  193 ? -42.789  41.874  360.248 1.00 86.10  ? 193 GLU 3 CB    1 
ATOM   6184  C  CG    . GLU C  3  193 ? -42.434  40.937  361.382 1.00 95.11  ? 193 GLU 3 CG    1 
ATOM   6185  C  CD    . GLU C  3  193 ? -42.248  39.514  360.915 1.00 105.44 ? 193 GLU 3 CD    1 
ATOM   6186  O  OE1   . GLU C  3  193 ? -41.608  39.309  359.864 1.00 109.40 ? 193 GLU 3 OE1   1 
ATOM   6187  O  OE2   . GLU C  3  193 ? -42.752  38.597  361.593 1.00 109.07 ? 193 GLU 3 OE2   1 
ATOM   6188  N  N     . VAL C  3  194 ? -43.736  44.104  358.470 1.00 66.30  ? 194 VAL 3 N     1 
ATOM   6189  C  CA    . VAL C  3  194 ? -43.257  44.958  357.387 1.00 61.21  ? 194 VAL 3 CA    1 
ATOM   6190  C  C     . VAL C  3  194 ? -43.907  46.342  357.442 1.00 63.54  ? 194 VAL 3 C     1 
ATOM   6191  O  O     . VAL C  3  194 ? -43.180  47.332  357.585 1.00 71.33  ? 194 VAL 3 O     1 
ATOM   6192  C  CB    . VAL C  3  194 ? -43.448  44.262  356.030 1.00 49.34  ? 194 VAL 3 CB    1 
ATOM   6193  C  CG1   . VAL C  3  194 ? -43.093  45.187  354.914 1.00 44.42  ? 194 VAL 3 CG1   1 
ATOM   6194  C  CG2   . VAL C  3  194 ? -42.590  43.025  355.965 1.00 39.07  ? 194 VAL 3 CG2   1 
ATOM   6195  N  N     . PRO C  3  195 ? -45.246  46.500  357.360 1.00 55.16  ? 195 PRO 3 N     1 
ATOM   6196  C  CA    . PRO C  3  195 ? -45.797  47.862  357.423 1.00 60.80  ? 195 PRO 3 CA    1 
ATOM   6197  C  C     . PRO C  3  195 ? -45.805  48.422  358.835 1.00 66.47  ? 195 PRO 3 C     1 
ATOM   6198  O  O     . PRO C  3  195 ? -45.752  49.640  359.033 1.00 75.07  ? 195 PRO 3 O     1 
ATOM   6199  C  CB    . PRO C  3  195 ? -47.217  47.688  356.879 1.00 60.59  ? 195 PRO 3 CB    1 
ATOM   6200  C  CG    . PRO C  3  195 ? -47.581  46.327  357.295 1.00 55.35  ? 195 PRO 3 CG    1 
ATOM   6201  C  CD    . PRO C  3  195 ? -46.324  45.507  357.185 1.00 49.31  ? 195 PRO 3 CD    1 
ATOM   6202  N  N     . GLY C  3  196 ? -45.861  47.537  359.824 1.00 60.00  ? 196 GLY 3 N     1 
ATOM   6203  C  CA    . GLY C  3  196 ? -45.936  47.971  361.202 1.00 57.43  ? 196 GLY 3 CA    1 
ATOM   6204  C  C     . GLY C  3  196 ? -47.323  48.359  361.648 1.00 59.74  ? 196 GLY 3 C     1 
ATOM   6205  O  O     . GLY C  3  196 ? -47.470  49.251  362.487 1.00 68.91  ? 196 GLY 3 O     1 
ATOM   6206  N  N     . ASP C  3  197 ? -48.353  47.710  361.109 1.00 55.17  ? 197 ASP 3 N     1 
ATOM   6207  C  CA    . ASP C  3  197 ? -49.746  47.958  361.482 1.00 58.76  ? 197 ASP 3 CA    1 
ATOM   6208  C  C     . ASP C  3  197 ? -50.377  46.624  361.862 1.00 56.13  ? 197 ASP 3 C     1 
ATOM   6209  O  O     . ASP C  3  197 ? -50.831  45.877  360.991 1.00 59.03  ? 197 ASP 3 O     1 
ATOM   6210  C  CB    . ASP C  3  197 ? -50.513  48.627  360.345 1.00 65.72  ? 197 ASP 3 CB    1 
ATOM   6211  C  CG    . ASP C  3  197 ? -50.124  50.081  360.146 1.00 77.13  ? 197 ASP 3 CG    1 
ATOM   6212  O  OD1   . ASP C  3  197 ? -49.939  50.796  361.152 1.00 81.46  ? 197 ASP 3 OD1   1 
ATOM   6213  O  OD2   . ASP C  3  197 ? -50.000  50.510  358.981 1.00 81.73  ? 197 ASP 3 OD2   1 
ATOM   6214  N  N     . GLU C  3  198 ? -50.412  46.329  363.161 1.00 41.75  ? 198 GLU 3 N     1 
ATOM   6215  C  CA    . GLU C  3  198 ? -50.945  45.059  363.637 1.00 52.81  ? 198 GLU 3 CA    1 
ATOM   6216  C  C     . GLU C  3  198 ? -52.461  45.053  363.520 1.00 48.94  ? 198 GLU 3 C     1 
ATOM   6217  O  O     . GLU C  3  198 ? -53.161  45.084  364.535 1.00 49.46  ? 198 GLU 3 O     1 
ATOM   6218  C  CB    . GLU C  3  198 ? -50.549  44.812  365.094 1.00 56.50  ? 198 GLU 3 CB    1 
ATOM   6219  C  CG    . GLU C  3  198 ? -49.134  44.332  365.310 1.00 59.51  ? 198 GLU 3 CG    1 
ATOM   6220  C  CD    . GLU C  3  198 ? -48.571  44.817  366.627 1.00 67.26  ? 198 GLU 3 CD    1 
ATOM   6221  O  OE1   . GLU C  3  198 ? -48.663  46.030  366.907 1.00 71.38  ? 198 GLU 3 OE1   1 
ATOM   6222  O  OE2   . GLU C  3  198 ? -48.041  43.983  367.385 1.00 70.33  ? 198 GLU 3 OE2   1 
ATOM   6223  N  N     . VAL C  3  199 ? -52.981  44.988  362.297 1.00 45.30  ? 199 VAL 3 N     1 
ATOM   6224  C  CA    . VAL C  3  199 ? -54.417  45.143  362.098 1.00 43.31  ? 199 VAL 3 CA    1 
ATOM   6225  C  C     . VAL C  3  199 ? -55.069  43.827  361.697 1.00 45.34  ? 199 VAL 3 C     1 
ATOM   6226  O  O     . VAL C  3  199 ? -56.127  43.825  361.060 1.00 48.13  ? 199 VAL 3 O     1 
ATOM   6227  C  CB    . VAL C  3  199 ? -54.702  46.241  361.056 1.00 42.15  ? 199 VAL 3 CB    1 
ATOM   6228  C  CG1   . VAL C  3  199 ? -54.241  47.585  361.584 1.00 42.16  ? 199 VAL 3 CG1   1 
ATOM   6229  C  CG2   . VAL C  3  199 ? -54.025  45.920  359.745 1.00 41.75  ? 199 VAL 3 CG2   1 
ATOM   6230  N  N     . LEU C  3  200 ? -54.470  42.701  362.084 1.00 42.36  ? 200 LEU 3 N     1 
ATOM   6231  C  CA    . LEU C  3  200 ? -55.072  41.407  361.785 1.00 44.31  ? 200 LEU 3 CA    1 
ATOM   6232  C  C     . LEU C  3  200 ? -54.431  40.319  362.638 1.00 53.40  ? 200 LEU 3 C     1 
ATOM   6233  O  O     . LEU C  3  200 ? -53.202  40.263  362.742 1.00 53.68  ? 200 LEU 3 O     1 
ATOM   6234  C  CB    . LEU C  3  200 ? -54.923  41.088  360.295 1.00 42.09  ? 200 LEU 3 CB    1 
ATOM   6235  C  CG    . LEU C  3  200 ? -56.133  40.423  359.643 1.00 54.89  ? 200 LEU 3 CG    1 
ATOM   6236  C  CD1   . LEU C  3  200 ? -57.366  41.265  359.844 1.00 56.52  ? 200 LEU 3 CD1   1 
ATOM   6237  C  CD2   . LEU C  3  200 ? -55.877  40.210  358.164 1.00 41.87  ? 200 LEU 3 CD2   1 
ATOM   6238  N  N     . ASP C  3  201 ? -55.260  39.473  363.253 1.00 60.65  ? 201 ASP 3 N     1 
ATOM   6239  C  CA    . ASP C  3  201 ? -54.806  38.300  363.997 1.00 67.53  ? 201 ASP 3 CA    1 
ATOM   6240  C  C     . ASP C  3  201 ? -56.006  37.399  364.274 1.00 74.71  ? 201 ASP 3 C     1 
ATOM   6241  O  O     . ASP C  3  201 ? -57.158  37.777  364.047 1.00 79.27  ? 201 ASP 3 O     1 
ATOM   6242  C  CB    . ASP C  3  201 ? -54.099  38.668  365.303 1.00 69.57  ? 201 ASP 3 CB    1 
ATOM   6243  C  CG    . ASP C  3  201 ? -53.126  37.588  365.755 1.00 73.74  ? 201 ASP 3 CG    1 
ATOM   6244  O  OD1   . ASP C  3  201 ? -53.355  36.406  365.424 1.00 71.08  ? 201 ASP 3 OD1   1 
ATOM   6245  O  OD2   . ASP C  3  201 ? -52.136  37.913  366.439 1.00 77.11  ? 201 ASP 3 OD2   1 
ATOM   6246  N  N     . PHE C  3  202 ? -55.712  36.197  364.782 1.00 75.75  ? 202 PHE 3 N     1 
ATOM   6247  C  CA    . PHE C  3  202 ? -56.716  35.180  365.077 1.00 76.06  ? 202 PHE 3 CA    1 
ATOM   6248  C  C     . PHE C  3  202 ? -57.670  35.629  366.182 1.00 85.09  ? 202 PHE 3 C     1 
ATOM   6249  O  O     . PHE C  3  202 ? -57.515  36.687  366.795 1.00 93.10  ? 202 PHE 3 O     1 
ATOM   6250  C  CB    . PHE C  3  202 ? -56.057  33.872  365.510 1.00 72.37  ? 202 PHE 3 CB    1 
ATOM   6251  C  CG    . PHE C  3  202 ? -55.084  33.314  364.519 1.00 77.98  ? 202 PHE 3 CG    1 
ATOM   6252  C  CD1   . PHE C  3  202 ? -55.508  32.905  363.270 1.00 79.45  ? 202 PHE 3 CD1   1 
ATOM   6253  C  CD2   . PHE C  3  202 ? -53.748  33.174  364.844 1.00 83.70  ? 202 PHE 3 CD2   1 
ATOM   6254  C  CE1   . PHE C  3  202 ? -54.616  32.376  362.358 1.00 81.67  ? 202 PHE 3 CE1   1 
ATOM   6255  C  CE2   . PHE C  3  202 ? -52.852  32.646  363.933 1.00 86.68  ? 202 PHE 3 CE2   1 
ATOM   6256  C  CZ    . PHE C  3  202 ? -53.288  32.250  362.689 1.00 84.20  ? 202 PHE 3 CZ    1 
ATOM   6257  N  N     . ILE C  3  203 ? -58.673  34.786  366.435 1.00 84.37  ? 203 ILE 3 N     1 
ATOM   6258  C  CA    . ILE C  3  203 ? -59.614  35.029  367.522 1.00 89.92  ? 203 ILE 3 CA    1 
ATOM   6259  C  C     . ILE C  3  203 ? -59.420  33.988  368.617 1.00 97.27  ? 203 ILE 3 C     1 
ATOM   6260  O  O     . ILE C  3  203 ? -58.964  34.310  369.719 1.00 107.21 ? 203 ILE 3 O     1 
ATOM   6261  C  CB    . ILE C  3  203 ? -61.065  35.010  367.005 1.00 85.36  ? 203 ILE 3 CB    1 
ATOM   6262  C  CG1   . ILE C  3  203 ? -61.299  36.160  366.027 1.00 83.56  ? 203 ILE 3 CG1   1 
ATOM   6263  C  CG2   . ILE C  3  203 ? -62.053  35.084  368.152 1.00 85.51  ? 203 ILE 3 CG2   1 
ATOM   6264  C  CD1   . ILE C  3  203 ? -60.896  37.516  366.563 1.00 84.45  ? 203 ILE 3 CD1   1 
ATOM   6265  N  N     . GLU C  3  204 ? -59.722  32.730  368.314 1.00 88.31  ? 204 GLU 3 N     1 
ATOM   6266  C  CA    . GLU C  3  204 ? -59.696  31.664  369.302 1.00 81.05  ? 204 GLU 3 CA    1 
ATOM   6267  C  C     . GLU C  3  204 ? -58.469  30.780  369.088 1.00 81.37  ? 204 GLU 3 C     1 
ATOM   6268  O  O     . GLU C  3  204 ? -57.580  31.094  368.289 1.00 84.45  ? 204 GLU 3 O     1 
ATOM   6269  C  CB    . GLU C  3  204 ? -61.003  30.873  369.244 1.00 78.64  ? 204 GLU 3 CB    1 
ATOM   6270  C  CG    . GLU C  3  204 ? -62.216  31.677  369.694 1.00 80.78  ? 204 GLU 3 CG    1 
ATOM   6271  C  CD    . GLU C  3  204 ? -63.473  30.842  369.801 1.00 84.87  ? 204 GLU 3 CD    1 
ATOM   6272  O  OE1   . GLU C  3  204 ? -63.361  29.634  370.084 1.00 87.43  ? 204 GLU 3 OE1   1 
ATOM   6273  O  OE2   . GLU C  3  204 ? -64.573  31.397  369.611 1.00 84.92  ? 204 GLU 3 OE2   1 
ATOM   6274  N  N     . ARG C  3  205 ? -58.419  29.664  369.813 1.00 78.01  ? 205 ARG 3 N     1 
ATOM   6275  C  CA    . ARG C  3  205 ? -57.352  28.682  369.668 1.00 64.64  ? 205 ARG 3 CA    1 
ATOM   6276  C  C     . ARG C  3  205 ? -57.969  27.317  369.390 1.00 50.41  ? 205 ARG 3 C     1 
ATOM   6277  O  O     . ARG C  3  205 ? -59.192  27.152  369.374 1.00 45.53  ? 205 ARG 3 O     1 
ATOM   6278  C  CB    . ARG C  3  205 ? -56.441  28.650  370.902 1.00 67.84  ? 205 ARG 3 CB    1 
ATOM   6279  C  CG    . ARG C  3  205 ? -57.144  28.473  372.237 1.00 71.93  ? 205 ARG 3 CG    1 
ATOM   6280  C  CD    . ARG C  3  205 ? -56.110  28.345  373.352 1.00 71.19  ? 205 ARG 3 CD    1 
ATOM   6281  N  NE    . ARG C  3  205 ? -56.625  28.723  374.665 1.00 70.21  ? 205 ARG 3 NE    1 
ATOM   6282  C  CZ    . ARG C  3  205 ? -57.468  27.988  375.384 1.00 73.01  ? 205 ARG 3 CZ    1 
ATOM   6283  N  NH1   . ARG C  3  205 ? -57.891  26.817  374.931 1.00 71.58  ? 205 ARG 3 NH1   1 
ATOM   6284  N  NH2   . ARG C  3  205 ? -57.876  28.421  376.567 1.00 77.12  ? 205 ARG 3 NH2   1 
ATOM   6285  N  N     . GLY C  3  206 ? -57.109  26.329  369.178 1.00 53.03  ? 206 GLY 3 N     1 
ATOM   6286  C  CA    . GLY C  3  206 ? -57.568  25.060  368.658 1.00 61.29  ? 206 GLY 3 CA    1 
ATOM   6287  C  C     . GLY C  3  206 ? -58.073  25.200  367.228 1.00 65.56  ? 206 GLY 3 C     1 
ATOM   6288  O  O     . GLY C  3  206 ? -57.722  26.133  366.498 1.00 65.91  ? 206 GLY 3 O     1 
ATOM   6289  N  N     . VAL C  3  207 ? -58.941  24.261  366.840 1.00 65.82  ? 207 VAL 3 N     1 
ATOM   6290  C  CA    . VAL C  3  207 ? -59.410  24.209  365.457 1.00 61.33  ? 207 VAL 3 CA    1 
ATOM   6291  C  C     . VAL C  3  207 ? -60.429  25.289  365.127 1.00 56.65  ? 207 VAL 3 C     1 
ATOM   6292  O  O     . VAL C  3  207 ? -60.582  25.639  363.951 1.00 54.89  ? 207 VAL 3 O     1 
ATOM   6293  C  CB    . VAL C  3  207 ? -60.034  22.844  365.129 1.00 56.70  ? 207 VAL 3 CB    1 
ATOM   6294  C  CG1   . VAL C  3  207 ? -58.957  21.822  364.821 1.00 55.53  ? 207 VAL 3 CG1   1 
ATOM   6295  C  CG2   . VAL C  3  207 ? -60.915  22.379  366.280 1.00 51.76  ? 207 VAL 3 CG2   1 
ATOM   6296  N  N     . HIS C  3  208 ? -61.120  25.842  366.121 1.00 56.33  ? 208 HIS 3 N     1 
ATOM   6297  C  CA    . HIS C  3  208 ? -62.061  26.916  365.836 1.00 58.74  ? 208 HIS 3 CA    1 
ATOM   6298  C  C     . HIS C  3  208 ? -61.360  28.218  365.487 1.00 63.08  ? 208 HIS 3 C     1 
ATOM   6299  O  O     . HIS C  3  208 ? -62.039  29.219  365.233 1.00 67.22  ? 208 HIS 3 O     1 
ATOM   6300  C  CB    . HIS C  3  208 ? -62.994  27.130  367.028 1.00 58.44  ? 208 HIS 3 CB    1 
ATOM   6301  C  CG    . HIS C  3  208 ? -63.905  25.974  367.291 1.00 59.56  ? 208 HIS 3 CG    1 
ATOM   6302  N  ND1   . HIS C  3  208 ? -64.697  25.416  366.310 1.00 62.58  ? 208 HIS 3 ND1   1 
ATOM   6303  C  CD2   . HIS C  3  208 ? -64.153  25.272  368.422 1.00 63.85  ? 208 HIS 3 CD2   1 
ATOM   6304  C  CE1   . HIS C  3  208 ? -65.390  24.417  366.825 1.00 63.89  ? 208 HIS 3 CE1   1 
ATOM   6305  N  NE2   . HIS C  3  208 ? -65.081  24.310  368.105 1.00 65.73  ? 208 HIS 3 NE2   1 
ATOM   6306  N  N     . THR C  3  209 ? -60.029  28.214  365.464 1.00 62.58  ? 209 THR 3 N     1 
ATOM   6307  C  CA    . THR C  3  209 ? -59.261  29.416  365.185 1.00 65.10  ? 209 THR 3 CA    1 
ATOM   6308  C  C     . THR C  3  209 ? -59.597  29.960  363.804 1.00 67.36  ? 209 THR 3 C     1 
ATOM   6309  O  O     . THR C  3  209 ? -59.687  29.213  362.828 1.00 58.78  ? 209 THR 3 O     1 
ATOM   6310  C  CB    . THR C  3  209 ? -57.765  29.108  365.277 1.00 59.73  ? 209 THR 3 CB    1 
ATOM   6311  O  OG1   . THR C  3  209 ? -57.490  28.420  366.502 1.00 57.37  ? 209 THR 3 OG1   1 
ATOM   6312  C  CG2   . THR C  3  209 ? -56.948  30.380  365.232 1.00 59.05  ? 209 THR 3 CG2   1 
ATOM   6313  N  N     . PHE C  3  210 ? -59.781  31.275  363.727 1.00 72.37  ? 210 PHE 3 N     1 
ATOM   6314  C  CA    . PHE C  3  210 ? -60.027  31.955  362.463 1.00 68.04  ? 210 PHE 3 CA    1 
ATOM   6315  C  C     . PHE C  3  210 ? -59.531  33.388  362.579 1.00 55.72  ? 210 PHE 3 C     1 
ATOM   6316  O  O     . PHE C  3  210 ? -59.264  33.886  363.675 1.00 48.70  ? 210 PHE 3 O     1 
ATOM   6317  C  CB    . PHE C  3  210 ? -61.510  31.917  362.057 1.00 79.40  ? 210 PHE 3 CB    1 
ATOM   6318  C  CG    . PHE C  3  210 ? -62.407  32.758  362.921 1.00 93.01  ? 210 PHE 3 CG    1 
ATOM   6319  C  CD1   . PHE C  3  210 ? -62.675  34.076  362.591 1.00 97.35  ? 210 PHE 3 CD1   1 
ATOM   6320  C  CD2   . PHE C  3  210 ? -63.006  32.226  364.047 1.00 99.26  ? 210 PHE 3 CD2   1 
ATOM   6321  C  CE1   . PHE C  3  210 ? -63.502  34.851  363.382 1.00 101.36 ? 210 PHE 3 CE1   1 
ATOM   6322  C  CE2   . PHE C  3  210 ? -63.837  33.000  364.837 1.00 103.54 ? 210 PHE 3 CE2   1 
ATOM   6323  C  CZ    . PHE C  3  210 ? -64.085  34.312  364.502 1.00 104.43 ? 210 PHE 3 CZ    1 
ATOM   6324  N  N     . ILE C  3  211 ? -59.406  34.040  361.428 1.00 61.15  ? 211 ILE 3 N     1 
ATOM   6325  C  CA    . ILE C  3  211 ? -58.874  35.396  361.325 1.00 71.56  ? 211 ILE 3 CA    1 
ATOM   6326  C  C     . ILE C  3  211 ? -60.002  36.405  361.507 1.00 75.89  ? 211 ILE 3 C     1 
ATOM   6327  O  O     . ILE C  3  211 ? -61.113  36.221  360.993 1.00 78.60  ? 211 ILE 3 O     1 
ATOM   6328  C  CB    . ILE C  3  211 ? -58.171  35.587  359.966 1.00 73.23  ? 211 ILE 3 CB    1 
ATOM   6329  C  CG1   . ILE C  3  211 ? -56.913  34.723  359.884 1.00 76.51  ? 211 ILE 3 CG1   1 
ATOM   6330  C  CG2   . ILE C  3  211 ? -57.808  37.040  359.729 1.00 67.42  ? 211 ILE 3 CG2   1 
ATOM   6331  C  CD1   . ILE C  3  211 ? -55.784  35.213  360.749 1.00 77.43  ? 211 ILE 3 CD1   1 
ATOM   6332  N  N     . GLY C  3  212 ? -59.713  37.483  362.236 1.00 66.80  ? 212 GLY 3 N     1 
ATOM   6333  C  CA    . GLY C  3  212 ? -60.671  38.539  362.489 1.00 53.55  ? 212 GLY 3 CA    1 
ATOM   6334  C  C     . GLY C  3  212 ? -59.943  39.833  362.778 1.00 44.91  ? 212 GLY 3 C     1 
ATOM   6335  O  O     . GLY C  3  212 ? -58.712  39.877  362.801 1.00 43.49  ? 212 GLY 3 O     1 
ATOM   6336  N  N     . THR C  3  213 ? -60.716  40.895  363.004 1.00 53.89  ? 213 THR 3 N     1 
ATOM   6337  C  CA    . THR C  3  213 ? -60.117  42.170  363.370 1.00 61.06  ? 213 THR 3 CA    1 
ATOM   6338  C  C     . THR C  3  213 ? -61.135  43.040  364.096 1.00 61.11  ? 213 THR 3 C     1 
ATOM   6339  O  O     . THR C  3  213 ? -62.346  42.915  363.894 1.00 50.44  ? 213 THR 3 O     1 
ATOM   6340  C  CB    . THR C  3  213 ? -59.569  42.922  362.148 1.00 51.02  ? 213 THR 3 CB    1 
ATOM   6341  O  OG1   . THR C  3  213 ? -59.013  44.174  362.569 1.00 43.45  ? 213 THR 3 OG1   1 
ATOM   6342  C  CG2   . THR C  3  213 ? -60.673  43.188  361.136 1.00 52.02  ? 213 THR 3 CG2   1 
ATOM   6343  N  N     . MET C  3  214 ? -60.615  43.907  364.969 1.00 68.85  ? 214 MET 3 N     1 
ATOM   6344  C  CA    . MET C  3  214 ? -61.346  45.063  365.469 1.00 70.91  ? 214 MET 3 CA    1 
ATOM   6345  C  C     . MET C  3  214 ? -60.947  46.358  364.771 1.00 83.74  ? 214 MET 3 C     1 
ATOM   6346  O  O     . MET C  3  214 ? -61.581  47.392  365.009 1.00 91.66  ? 214 MET 3 O     1 
ATOM   6347  C  CB    . MET C  3  214 ? -61.142  45.218  366.982 1.00 62.54  ? 214 MET 3 CB    1 
ATOM   6348  C  CG    . MET C  3  214 ? -62.327  44.763  367.807 1.00 60.01  ? 214 MET 3 CG    1 
ATOM   6349  S  SD    . MET C  3  214 ? -62.426  45.670  369.360 1.00 45.89  ? 214 MET 3 SD    1 
ATOM   6350  C  CE    . MET C  3  214 ? -62.998  44.401  370.477 1.00 46.34  ? 214 MET 3 CE    1 
ATOM   6351  N  N     . ASP C  3  215 ? -59.911  46.332  363.936 1.00 84.17  ? 215 ASP 3 N     1 
ATOM   6352  C  CA    . ASP C  3  215 ? -59.578  47.444  363.047 1.00 85.28  ? 215 ASP 3 CA    1 
ATOM   6353  C  C     . ASP C  3  215 ? -60.048  47.037  361.654 1.00 90.34  ? 215 ASP 3 C     1 
ATOM   6354  O  O     . ASP C  3  215 ? -59.368  46.289  360.947 1.00 94.78  ? 215 ASP 3 O     1 
ATOM   6355  C  CB    . ASP C  3  215 ? -58.091  47.765  363.103 1.00 79.25  ? 215 ASP 3 CB    1 
ATOM   6356  C  CG    . ASP C  3  215 ? -57.658  48.265  364.472 1.00 72.56  ? 215 ASP 3 CG    1 
ATOM   6357  O  OD1   . ASP C  3  215 ? -57.820  49.472  364.743 1.00 71.15  ? 215 ASP 3 OD1   1 
ATOM   6358  O  OD2   . ASP C  3  215 ? -57.166  47.455  365.281 1.00 70.65  ? 215 ASP 3 OD2   1 
ATOM   6359  N  N     . PHE C  3  216 ? -61.220  47.540  361.265 1.00 91.00  ? 216 PHE 3 N     1 
ATOM   6360  C  CA    . PHE C  3  216 ? -61.965  47.016  360.128 1.00 93.11  ? 216 PHE 3 CA    1 
ATOM   6361  C  C     . PHE C  3  216 ? -61.581  47.690  358.821 1.00 94.26  ? 216 PHE 3 C     1 
ATOM   6362  O  O     . PHE C  3  216 ? -61.378  47.013  357.810 1.00 94.59  ? 216 PHE 3 O     1 
ATOM   6363  C  CB    . PHE C  3  216 ? -63.463  47.196  360.388 1.00 97.35  ? 216 PHE 3 CB    1 
ATOM   6364  C  CG    . PHE C  3  216 ? -63.853  46.958  361.820 1.00 97.87  ? 216 PHE 3 CG    1 
ATOM   6365  C  CD1   . PHE C  3  216 ? -63.982  45.674  362.319 1.00 96.58  ? 216 PHE 3 CD1   1 
ATOM   6366  C  CD2   . PHE C  3  216 ? -64.071  48.025  362.673 1.00 93.22  ? 216 PHE 3 CD2   1 
ATOM   6367  C  CE1   . PHE C  3  216 ? -64.331  45.466  363.640 1.00 90.69  ? 216 PHE 3 CE1   1 
ATOM   6368  C  CE2   . PHE C  3  216 ? -64.420  47.819  363.989 1.00 88.35  ? 216 PHE 3 CE2   1 
ATOM   6369  C  CZ    . PHE C  3  216 ? -64.549  46.540  364.472 1.00 87.41  ? 216 PHE 3 CZ    1 
ATOM   6370  N  N     . GLY C  3  217 ? -61.462  49.017  358.823 1.00 94.71  ? 217 GLY 3 N     1 
ATOM   6371  C  CA    . GLY C  3  217 ? -61.037  49.730  357.634 1.00 90.98  ? 217 GLY 3 CA    1 
ATOM   6372  C  C     . GLY C  3  217 ? -59.686  49.303  357.101 1.00 81.99  ? 217 GLY 3 C     1 
ATOM   6373  O  O     . GLY C  3  217 ? -59.325  49.712  355.990 1.00 81.00  ? 217 GLY 3 O     1 
ATOM   6374  N  N     . LEU C  3  218 ? -58.939  48.489  357.855 1.00 78.13  ? 218 LEU 3 N     1 
ATOM   6375  C  CA    . LEU C  3  218 ? -57.599  48.053  357.482 1.00 84.32  ? 218 LEU 3 CA    1 
ATOM   6376  C  C     . LEU C  3  218 ? -56.725  49.283  357.270 1.00 94.66  ? 218 LEU 3 C     1 
ATOM   6377  O  O     . LEU C  3  218 ? -56.393  49.629  356.129 1.00 99.61  ? 218 LEU 3 O     1 
ATOM   6378  C  CB    . LEU C  3  218 ? -57.629  47.156  356.242 1.00 81.46  ? 218 LEU 3 CB    1 
ATOM   6379  C  CG    . LEU C  3  218 ? -57.699  45.648  356.515 1.00 78.54  ? 218 LEU 3 CG    1 
ATOM   6380  C  CD1   . LEU C  3  218 ? -56.321  45.138  356.879 1.00 78.85  ? 218 LEU 3 CD1   1 
ATOM   6381  C  CD2   . LEU C  3  218 ? -58.695  45.297  357.612 1.00 75.36  ? 218 LEU 3 CD2   1 
ATOM   6382  N  N     . PRO C  3  219 ? -56.348  49.971  358.351 1.00 97.21  ? 219 PRO 3 N     1 
ATOM   6383  C  CA    . PRO C  3  219 ? -55.695  51.280  358.200 1.00 97.42  ? 219 PRO 3 CA    1 
ATOM   6384  C  C     . PRO C  3  219 ? -54.427  51.243  357.370 1.00 91.81  ? 219 PRO 3 C     1 
ATOM   6385  O  O     . PRO C  3  219 ? -54.137  52.221  356.669 1.00 97.43  ? 219 PRO 3 O     1 
ATOM   6386  C  CB    . PRO C  3  219 ? -55.403  51.684  359.653 1.00 100.62 ? 219 PRO 3 CB    1 
ATOM   6387  C  CG    . PRO C  3  219 ? -56.420  50.932  360.457 1.00 102.42 ? 219 PRO 3 CG    1 
ATOM   6388  C  CD    . PRO C  3  219 ? -56.521  49.606  359.768 1.00 99.20  ? 219 PRO 3 CD    1 
ATOM   6389  N  N     . SER C  3  220 ? -53.655  50.158  357.442 1.00 77.21  ? 220 SER 3 N     1 
ATOM   6390  C  CA    . SER C  3  220 ? -52.380  50.093  356.739 1.00 67.89  ? 220 SER 3 CA    1 
ATOM   6391  C  C     . SER C  3  220 ? -52.575  50.349  355.253 1.00 54.56  ? 220 SER 3 C     1 
ATOM   6392  O  O     . SER C  3  220 ? -53.451  49.757  354.616 1.00 41.68  ? 220 SER 3 O     1 
ATOM   6393  C  CB    . SER C  3  220 ? -51.725  48.728  356.947 1.00 71.01  ? 220 SER 3 CB    1 
ATOM   6394  O  OG    . SER C  3  220 ? -52.013  47.860  355.867 1.00 77.93  ? 220 SER 3 OG    1 
ATOM   6395  N  N     . GLY C  3  221 ? -51.742  51.222  354.701 1.00 65.25  ? 221 GLY 3 N     1 
ATOM   6396  C  CA    . GLY C  3  221 ? -51.771  51.508  353.287 1.00 73.30  ? 221 GLY 3 CA    1 
ATOM   6397  C  C     . GLY C  3  221 ? -51.179  50.427  352.420 1.00 79.56  ? 221 GLY 3 C     1 
ATOM   6398  O  O     . GLY C  3  221 ? -50.920  50.668  351.238 1.00 92.11  ? 221 GLY 3 O     1 
ATOM   6399  N  N     . PHE C  3  222 ? -50.972  49.226  352.975 1.00 70.17  ? 222 PHE 3 N     1 
ATOM   6400  C  CA    . PHE C  3  222 ? -50.350  48.120  352.259 1.00 66.30  ? 222 PHE 3 CA    1 
ATOM   6401  C  C     . PHE C  3  222 ? -51.108  46.815  352.504 1.00 76.09  ? 222 PHE 3 C     1 
ATOM   6402  O  O     . PHE C  3  222 ? -50.510  45.734  352.510 1.00 82.85  ? 222 PHE 3 O     1 
ATOM   6403  C  CB    . PHE C  3  222 ? -48.882  47.958  352.674 1.00 59.69  ? 222 PHE 3 CB    1 
ATOM   6404  C  CG    . PHE C  3  222 ? -48.071  49.221  352.569 1.00 57.05  ? 222 PHE 3 CG    1 
ATOM   6405  C  CD1   . PHE C  3  222 ? -47.428  49.567  351.394 1.00 46.44  ? 222 PHE 3 CD1   1 
ATOM   6406  C  CD2   . PHE C  3  222 ? -47.924  50.046  353.667 1.00 59.32  ? 222 PHE 3 CD2   1 
ATOM   6407  C  CE1   . PHE C  3  222 ? -46.682  50.731  351.317 1.00 38.89  ? 222 PHE 3 CE1   1 
ATOM   6408  C  CE2   . PHE C  3  222 ? -47.178  51.200  353.592 1.00 60.39  ? 222 PHE 3 CE2   1 
ATOM   6409  C  CZ    . PHE C  3  222 ? -46.557  51.542  352.420 1.00 39.06  ? 222 PHE 3 CZ    1 
ATOM   6410  N  N     . SER C  3  223 ? -52.428  46.902  352.698 1.00 73.57  ? 223 SER 3 N     1 
ATOM   6411  C  CA    . SER C  3  223 ? -53.238  45.728  353.013 1.00 63.96  ? 223 SER 3 CA    1 
ATOM   6412  C  C     . SER C  3  223 ? -53.296  44.734  351.859 1.00 50.48  ? 223 SER 3 C     1 
ATOM   6413  O  O     . SER C  3  223 ? -53.430  43.529  352.092 1.00 40.20  ? 223 SER 3 O     1 
ATOM   6414  C  CB    . SER C  3  223 ? -54.652  46.171  353.399 1.00 62.48  ? 223 SER 3 CB    1 
ATOM   6415  O  OG    . SER C  3  223 ? -55.378  46.617  352.264 1.00 59.32  ? 223 SER 3 OG    1 
ATOM   6416  N  N     . GLY C  3  224 ? -53.161  45.203  350.619 1.00 47.44  ? 224 GLY 3 N     1 
ATOM   6417  C  CA    . GLY C  3  224 ? -53.417  44.353  349.469 1.00 39.76  ? 224 GLY 3 CA    1 
ATOM   6418  C  C     . GLY C  3  224 ? -52.397  43.257  349.243 1.00 39.54  ? 224 GLY 3 C     1 
ATOM   6419  O  O     . GLY C  3  224 ? -52.703  42.280  348.552 1.00 65.44  ? 224 GLY 3 O     1 
ATOM   6420  N  N     . ASN C  3  225 ? -51.198  43.383  349.815 1.00 39.40  ? 225 ASN 3 N     1 
ATOM   6421  C  CA    . ASN C  3  225 ? -50.133  42.439  349.487 1.00 39.16  ? 225 ASN 3 CA    1 
ATOM   6422  C  C     . ASN C  3  225 ? -50.385  41.041  350.038 1.00 51.47  ? 225 ASN 3 C     1 
ATOM   6423  O  O     . ASN C  3  225 ? -49.953  40.064  349.421 1.00 39.14  ? 225 ASN 3 O     1 
ATOM   6424  C  CB    . ASN C  3  225 ? -48.789  42.977  349.968 1.00 39.01  ? 225 ASN 3 CB    1 
ATOM   6425  C  CG    . ASN C  3  225 ? -48.255  44.059  349.066 1.00 38.77  ? 225 ASN 3 CG    1 
ATOM   6426  O  OD1   . ASN C  3  225 ? -48.615  44.128  347.892 1.00 38.65  ? 225 ASN 3 OD1   1 
ATOM   6427  N  ND2   . ASN C  3  225 ? -47.402  44.917  349.604 1.00 38.71  ? 225 ASN 3 ND2   1 
ATOM   6428  N  N     . ILE C  3  226 ? -51.100  40.908  351.160 1.00 46.95  ? 226 ILE 3 N     1 
ATOM   6429  C  CA    . ILE C  3  226 ? -51.451  39.566  351.629 1.00 52.94  ? 226 ILE 3 CA    1 
ATOM   6430  C  C     . ILE C  3  226 ? -52.286  38.859  350.575 1.00 51.88  ? 226 ILE 3 C     1 
ATOM   6431  O  O     . ILE C  3  226 ? -52.282  37.624  350.486 1.00 52.29  ? 226 ILE 3 O     1 
ATOM   6432  C  CB    . ILE C  3  226 ? -52.200  39.602  352.979 1.00 57.87  ? 226 ILE 3 CB    1 
ATOM   6433  C  CG1   . ILE C  3  226 ? -53.529  40.346  352.842 1.00 59.00  ? 226 ILE 3 CG1   1 
ATOM   6434  C  CG2   . ILE C  3  226 ? -51.352  40.229  354.052 1.00 59.63  ? 226 ILE 3 CG2   1 
ATOM   6435  C  CD1   . ILE C  3  226 ? -54.289  40.513  354.140 1.00 40.76  ? 226 ILE 3 CD1   1 
ATOM   6436  N  N     . THR C  3  227 ? -53.017  39.634  349.767 1.00 47.90  ? 227 THR 3 N     1 
ATOM   6437  C  CA    . THR C  3  227 ? -53.795  39.073  348.670 1.00 50.58  ? 227 THR 3 CA    1 
ATOM   6438  C  C     . THR C  3  227 ? -52.911  38.247  347.744 1.00 62.26  ? 227 THR 3 C     1 
ATOM   6439  O  O     . THR C  3  227 ? -53.314  37.172  347.283 1.00 67.38  ? 227 THR 3 O     1 
ATOM   6440  C  CB    . THR C  3  227 ? -54.490  40.209  347.910 1.00 46.11  ? 227 THR 3 CB    1 
ATOM   6441  O  OG1   . THR C  3  227 ? -55.605  40.683  348.673 1.00 40.09  ? 227 THR 3 OG1   1 
ATOM   6442  C  CG2   . THR C  3  227 ? -54.985  39.759  346.547 1.00 49.86  ? 227 THR 3 CG2   1 
ATOM   6443  N  N     . ASP C  3  228 ? -51.688  38.716  347.487 1.00 66.42  ? 228 ASP 3 N     1 
ATOM   6444  C  CA    . ASP C  3  228 ? -50.760  37.954  346.659 1.00 65.57  ? 228 ASP 3 CA    1 
ATOM   6445  C  C     . ASP C  3  228 ? -50.153  36.778  347.412 1.00 66.92  ? 228 ASP 3 C     1 
ATOM   6446  O  O     . ASP C  3  228 ? -49.772  35.781  346.790 1.00 61.59  ? 228 ASP 3 O     1 
ATOM   6447  C  CB    . ASP C  3  228 ? -49.643  38.863  346.140 1.00 60.99  ? 228 ASP 3 CB    1 
ATOM   6448  C  CG    . ASP C  3  228 ? -50.168  40.070  345.386 1.00 55.85  ? 228 ASP 3 CG    1 
ATOM   6449  O  OD1   . ASP C  3  228 ? -51.375  40.103  345.069 1.00 52.21  ? 228 ASP 3 OD1   1 
ATOM   6450  O  OD2   . ASP C  3  228 ? -49.372  40.984  345.094 1.00 53.57  ? 228 ASP 3 OD2   1 
ATOM   6451  N  N     . ILE C  3  229 ? -50.057  36.876  348.737 1.00 67.83  ? 229 ILE 3 N     1 
ATOM   6452  C  CA    . ILE C  3  229 ? -49.271  35.937  349.537 1.00 65.09  ? 229 ILE 3 CA    1 
ATOM   6453  C  C     . ILE C  3  229 ? -50.085  34.717  349.955 1.00 51.33  ? 229 ILE 3 C     1 
ATOM   6454  O  O     . ILE C  3  229 ? -49.575  33.596  349.913 1.00 49.53  ? 229 ILE 3 O     1 
ATOM   6455  C  CB    . ILE C  3  229 ? -48.670  36.654  350.759 1.00 73.72  ? 229 ILE 3 CB    1 
ATOM   6456  C  CG1   . ILE C  3  229 ? -47.993  37.958  350.331 1.00 75.16  ? 229 ILE 3 CG1   1 
ATOM   6457  C  CG2   . ILE C  3  229 ? -47.675  35.750  351.467 1.00 80.16  ? 229 ILE 3 CG2   1 
ATOM   6458  C  CD1   . ILE C  3  229 ? -47.409  38.751  351.474 1.00 76.67  ? 229 ILE 3 CD1   1 
ATOM   6459  N  N     . CYS C  3  230 ? -51.338  34.917  350.388 1.00 47.02  ? 230 CYS 3 N     1 
ATOM   6460  C  CA    . CYS C  3  230 ? -52.207  33.861  350.905 1.00 44.46  ? 230 CYS 3 CA    1 
ATOM   6461  C  C     . CYS C  3  230 ? -52.193  32.650  349.979 1.00 46.41  ? 230 CYS 3 C     1 
ATOM   6462  O  O     . CYS C  3  230 ? -52.730  32.710  348.863 1.00 39.65  ? 230 CYS 3 O     1 
ATOM   6463  C  CB    . CYS C  3  230 ? -53.634  34.397  351.067 1.00 51.37  ? 230 CYS 3 CB    1 
ATOM   6464  S  SG    . CYS C  3  230 ? -54.813  33.383  352.013 1.00 40.58  ? 230 CYS 3 SG    1 
ATOM   6465  N  N     . PRO C  3  231 ? -51.576  31.539  350.400 1.00 56.07  ? 231 PRO 3 N     1 
ATOM   6466  C  CA    . PRO C  3  231 ? -51.476  30.367  349.516 1.00 56.21  ? 231 PRO 3 CA    1 
ATOM   6467  C  C     . PRO C  3  231 ? -52.812  29.724  349.223 1.00 61.06  ? 231 PRO 3 C     1 
ATOM   6468  O  O     . PRO C  3  231 ? -52.869  28.785  348.415 1.00 61.42  ? 231 PRO 3 O     1 
ATOM   6469  C  CB    . PRO C  3  231 ? -50.562  29.413  350.295 1.00 47.73  ? 231 PRO 3 CB    1 
ATOM   6470  C  CG    . PRO C  3  231 ? -50.658  29.859  351.711 1.00 57.95  ? 231 PRO 3 CG    1 
ATOM   6471  C  CD    . PRO C  3  231 ? -50.874  31.334  351.677 1.00 56.91  ? 231 PRO 3 CD    1 
ATOM   6472  N  N     . VAL C  3  232 ? -53.881  30.194  349.862 1.00 63.30  ? 232 VAL 3 N     1 
ATOM   6473  C  CA    . VAL C  3  232 ? -55.220  29.689  349.610 1.00 57.48  ? 232 VAL 3 CA    1 
ATOM   6474  C  C     . VAL C  3  232 ? -56.074  30.841  349.097 1.00 48.30  ? 232 VAL 3 C     1 
ATOM   6475  O  O     . VAL C  3  232 ? -55.609  31.982  349.009 1.00 44.73  ? 232 VAL 3 O     1 
ATOM   6476  C  CB    . VAL C  3  232 ? -55.826  29.042  350.872 1.00 55.08  ? 232 VAL 3 CB    1 
ATOM   6477  C  CG1   . VAL C  3  232 ? -55.066  27.769  351.235 1.00 40.61  ? 232 VAL 3 CG1   1 
ATOM   6478  C  CG2   . VAL C  3  232 ? -55.851  30.020  352.043 1.00 57.40  ? 232 VAL 3 CG2   1 
ATOM   6479  N  N     . GLY C  3  233 ? -57.326  30.555  348.756 1.00 46.63  ? 233 GLY 3 N     1 
ATOM   6480  C  CA    . GLY C  3  233 ? -58.211  31.568  348.216 1.00 45.99  ? 233 GLY 3 CA    1 
ATOM   6481  C  C     . GLY C  3  233 ? -59.034  32.301  349.252 1.00 47.07  ? 233 GLY 3 C     1 
ATOM   6482  O  O     . GLY C  3  233 ? -60.013  32.973  348.913 1.00 48.70  ? 233 GLY 3 O     1 
ATOM   6483  N  N     . ALA C  3  234 ? -58.632  32.195  350.519 1.00 44.95  ? 234 ALA 3 N     1 
ATOM   6484  C  CA    . ALA C  3  234 ? -59.357  32.864  351.594 1.00 47.26  ? 234 ALA 3 CA    1 
ATOM   6485  C  C     . ALA C  3  234 ? -59.394  34.371  351.380 1.00 57.28  ? 234 ALA 3 C     1 
ATOM   6486  O  O     . ALA C  3  234 ? -60.470  34.981  351.337 1.00 56.78  ? 234 ALA 3 O     1 
ATOM   6487  C  CB    . ALA C  3  234 ? -58.712  32.529  352.940 1.00 41.61  ? 234 ALA 3 CB    1 
ATOM   6488  N  N     . LEU C  3  235 ? -58.225  34.982  351.217 1.00 63.70  ? 235 LEU 3 N     1 
ATOM   6489  C  CA    . LEU C  3  235 ? -58.101  36.418  351.000 1.00 59.09  ? 235 LEU 3 CA    1 
ATOM   6490  C  C     . LEU C  3  235 ? -57.967  36.687  349.507 1.00 56.72  ? 235 LEU 3 C     1 
ATOM   6491  O  O     . LEU C  3  235 ? -56.962  36.326  348.888 1.00 40.45  ? 235 LEU 3 O     1 
ATOM   6492  C  CB    . LEU C  3  235 ? -56.912  36.973  351.776 1.00 40.93  ? 235 LEU 3 CB    1 
ATOM   6493  C  CG    . LEU C  3  235 ? -57.162  36.956  353.280 1.00 41.25  ? 235 LEU 3 CG    1 
ATOM   6494  C  CD1   . LEU C  3  235 ? -55.885  37.191  354.057 1.00 48.28  ? 235 LEU 3 CD1   1 
ATOM   6495  C  CD2   . LEU C  3  235 ? -58.206  38.009  353.621 1.00 41.53  ? 235 LEU 3 CD2   1 
ATOM   6496  N  N     . LEU C  3  236 ? -58.981  37.328  348.940 1.00 62.20  ? 236 LEU 3 N     1 
ATOM   6497  C  CA    . LEU C  3  236 ? -59.005  37.673  347.527 1.00 61.62  ? 236 LEU 3 CA    1 
ATOM   6498  C  C     . LEU C  3  236 ? -59.116  39.180  347.350 1.00 52.01  ? 236 LEU 3 C     1 
ATOM   6499  O  O     . LEU C  3  236 ? -59.518  39.914  348.256 1.00 40.88  ? 236 LEU 3 O     1 
ATOM   6500  C  CB    . LEU C  3  236 ? -60.170  36.994  346.787 1.00 61.92  ? 236 LEU 3 CB    1 
ATOM   6501  C  CG    . LEU C  3  236 ? -60.230  35.475  346.636 1.00 53.32  ? 236 LEU 3 CG    1 
ATOM   6502  C  CD1   . LEU C  3  236 ? -61.645  35.036  346.296 1.00 41.11  ? 236 LEU 3 CD1   1 
ATOM   6503  C  CD2   . LEU C  3  236 ? -59.268  35.045  345.549 1.00 40.45  ? 236 LEU 3 CD2   1 
ATOM   6504  N  N     . ASP C  3  237 ? -58.758  39.627  346.154 1.00 45.98  ? 237 ASP 3 N     1 
ATOM   6505  C  CA    . ASP C  3  237 ? -58.794  41.037  345.794 1.00 51.60  ? 237 ASP 3 CA    1 
ATOM   6506  C  C     . ASP C  3  237 ? -60.201  41.356  345.298 1.00 55.54  ? 237 ASP 3 C     1 
ATOM   6507  O  O     . ASP C  3  237 ? -60.590  40.935  344.205 1.00 55.23  ? 237 ASP 3 O     1 
ATOM   6508  C  CB    . ASP C  3  237 ? -57.732  41.340  344.740 1.00 58.30  ? 237 ASP 3 CB    1 
ATOM   6509  C  CG    . ASP C  3  237 ? -57.708  42.801  344.335 1.00 73.02  ? 237 ASP 3 CG    1 
ATOM   6510  O  OD1   . ASP C  3  237 ? -58.417  43.605  344.970 1.00 78.59  ? 237 ASP 3 OD1   1 
ATOM   6511  O  OD2   . ASP C  3  237 ? -56.970  43.152  343.391 1.00 77.62  ? 237 ASP 3 OD2   1 
ATOM   6512  N  N     . LEU C  3  238 ? -60.966  42.084  346.116 1.00 52.71  ? 238 LEU 3 N     1 
ATOM   6513  C  CA    . LEU C  3  238 ? -62.358  42.375  345.787 1.00 48.34  ? 238 LEU 3 CA    1 
ATOM   6514  C  C     . LEU C  3  238 ? -62.476  43.123  344.466 1.00 43.43  ? 238 LEU 3 C     1 
ATOM   6515  O  O     . LEU C  3  238 ? -63.422  42.899  343.703 1.00 43.58  ? 238 LEU 3 O     1 
ATOM   6516  C  CB    . LEU C  3  238 ? -63.020  43.167  346.915 1.00 53.64  ? 238 LEU 3 CB    1 
ATOM   6517  C  CG    . LEU C  3  238 ? -64.551  43.259  346.881 1.00 58.48  ? 238 LEU 3 CG    1 
ATOM   6518  C  CD1   . LEU C  3  238 ? -65.184  41.983  346.344 1.00 41.92  ? 238 LEU 3 CD1   1 
ATOM   6519  C  CD2   . LEU C  3  238 ? -65.115  43.610  348.254 1.00 42.20  ? 238 LEU 3 CD2   1 
ATOM   6520  N  N     . THR C  3  239 ? -61.540  44.028  344.180 1.00 46.01  ? 239 THR 3 N     1 
ATOM   6521  C  CA    . THR C  3  239 ? -61.595  44.736  342.907 1.00 53.39  ? 239 THR 3 CA    1 
ATOM   6522  C  C     . THR C  3  239 ? -61.436  43.781  341.733 1.00 40.34  ? 239 THR 3 C     1 
ATOM   6523  O  O     . THR C  3  239 ? -61.855  44.108  340.619 1.00 40.29  ? 239 THR 3 O     1 
ATOM   6524  C  CB    . THR C  3  239 ? -60.519  45.834  342.855 1.00 68.52  ? 239 THR 3 CB    1 
ATOM   6525  O  OG1   . THR C  3  239 ? -60.863  46.810  341.863 1.00 75.06  ? 239 THR 3 OG1   1 
ATOM   6526  C  CG2   . THR C  3  239 ? -59.172  45.257  342.498 1.00 64.47  ? 239 THR 3 CG2   1 
ATOM   6527  N  N     . ALA C  3  240 ? -60.884  42.591  341.970 1.00 40.24  ? 240 ALA 3 N     1 
ATOM   6528  C  CA    . ALA C  3  240 ? -60.736  41.576  340.936 1.00 50.22  ? 240 ALA 3 CA    1 
ATOM   6529  C  C     . ALA C  3  240 ? -61.526  40.311  341.248 1.00 52.16  ? 240 ALA 3 C     1 
ATOM   6530  O  O     . ALA C  3  240 ? -61.222  39.246  340.703 1.00 46.59  ? 240 ALA 3 O     1 
ATOM   6531  C  CB    . ALA C  3  240 ? -59.260  41.236  340.730 1.00 47.98  ? 240 ALA 3 CB    1 
ATOM   6532  N  N     . ARG C  3  241 ? -62.532  40.396  342.112 1.00 55.95  ? 241 ARG 3 N     1 
ATOM   6533  C  CA    . ARG C  3  241 ? -63.350  39.225  342.400 1.00 54.01  ? 241 ARG 3 CA    1 
ATOM   6534  C  C     . ARG C  3  241 ? -64.270  38.927  341.221 1.00 55.24  ? 241 ARG 3 C     1 
ATOM   6535  O  O     . ARG C  3  241 ? -64.935  39.824  340.694 1.00 56.30  ? 241 ARG 3 O     1 
ATOM   6536  C  CB    . ARG C  3  241 ? -64.167  39.429  343.675 1.00 54.18  ? 241 ARG 3 CB    1 
ATOM   6537  C  CG    . ARG C  3  241 ? -65.540  38.776  343.626 1.00 56.66  ? 241 ARG 3 CG    1 
ATOM   6538  C  CD    . ARG C  3  241 ? -66.119  38.568  345.012 1.00 63.04  ? 241 ARG 3 CD    1 
ATOM   6539  N  NE    . ARG C  3  241 ? -65.648  37.305  345.574 1.00 68.39  ? 241 ARG 3 NE    1 
ATOM   6540  C  CZ    . ARG C  3  241 ? -66.407  36.229  345.752 1.00 70.54  ? 241 ARG 3 CZ    1 
ATOM   6541  N  NH1   . ARG C  3  241 ? -67.687  36.247  345.407 1.00 67.67  ? 241 ARG 3 NH1   1 
ATOM   6542  N  NH2   . ARG C  3  241 ? -65.881  35.126  346.269 1.00 72.51  ? 241 ARG 3 NH2   1 
ATOM   6543  N  N     . PHE C  3  242 ? -64.298  37.659  340.809 1.00 59.80  ? 242 PHE 3 N     1 
ATOM   6544  C  CA    . PHE C  3  242 ? -65.225  37.152  339.796 1.00 62.29  ? 242 PHE 3 CA    1 
ATOM   6545  C  C     . PHE C  3  242 ? -65.106  37.932  338.486 1.00 64.69  ? 242 PHE 3 C     1 
ATOM   6546  O  O     . PHE C  3  242 ? -66.069  38.510  337.982 1.00 68.14  ? 242 PHE 3 O     1 
ATOM   6547  C  CB    . PHE C  3  242 ? -66.670  37.161  340.304 1.00 57.46  ? 242 PHE 3 CB    1 
ATOM   6548  C  CG    . PHE C  3  242 ? -67.005  36.024  341.224 1.00 51.30  ? 242 PHE 3 CG    1 
ATOM   6549  C  CD1   . PHE C  3  242 ? -66.018  35.320  341.882 1.00 41.52  ? 242 PHE 3 CD1   1 
ATOM   6550  C  CD2   . PHE C  3  242 ? -68.320  35.669  341.437 1.00 42.06  ? 242 PHE 3 CD2   1 
ATOM   6551  C  CE1   . PHE C  3  242 ? -66.336  34.284  342.732 1.00 74.03  ? 242 PHE 3 CE1   1 
ATOM   6552  C  CE2   . PHE C  3  242 ? -68.638  34.638  342.282 1.00 65.31  ? 242 PHE 3 CE2   1 
ATOM   6553  C  CZ    . PHE C  3  242 ? -67.647  33.945  342.930 1.00 58.87  ? 242 PHE 3 CZ    1 
ATOM   6554  N  N     . ARG C  3  243 ? -63.902  37.938  337.942 1.00 61.60  ? 243 ARG 3 N     1 
ATOM   6555  C  CA    . ARG C  3  243 ? -63.699  38.504  336.619 1.00 55.65  ? 243 ARG 3 CA    1 
ATOM   6556  C  C     . ARG C  3  243 ? -63.075  37.517  335.650 1.00 49.22  ? 243 ARG 3 C     1 
ATOM   6557  O  O     . ARG C  3  243 ? -63.447  37.493  334.473 1.00 45.06  ? 243 ARG 3 O     1 
ATOM   6558  C  CB    . ARG C  3  243 ? -62.840  39.771  336.716 1.00 57.37  ? 243 ARG 3 CB    1 
ATOM   6559  C  CG    . ARG C  3  243 ? -63.627  40.958  337.227 1.00 64.80  ? 243 ARG 3 CG    1 
ATOM   6560  C  CD    . ARG C  3  243 ? -64.454  41.549  336.103 1.00 81.40  ? 243 ARG 3 CD    1 
ATOM   6561  N  NE    . ARG C  3  243 ? -65.061  42.828  336.457 1.00 100.36 ? 243 ARG 3 NE    1 
ATOM   6562  C  CZ    . ARG C  3  243 ? -64.476  44.009  336.290 1.00 108.43 ? 243 ARG 3 CZ    1 
ATOM   6563  N  NH1   . ARG C  3  243 ? -63.259  44.082  335.773 1.00 108.22 ? 243 ARG 3 NH1   1 
ATOM   6564  N  NH2   . ARG C  3  243 ? -65.113  45.120  336.637 1.00 110.63 ? 243 ARG 3 NH2   1 
ATOM   6565  N  N     . ALA C  3  244 ? -62.161  36.680  336.123 1.00 39.84  ? 244 ALA 3 N     1 
ATOM   6566  C  CA    . ALA C  3  244 ? -61.534  35.654  335.304 1.00 46.55  ? 244 ALA 3 CA    1 
ATOM   6567  C  C     . ALA C  3  244 ? -60.764  34.719  336.224 1.00 48.71  ? 244 ALA 3 C     1 
ATOM   6568  O  O     . ALA C  3  244 ? -60.536  35.020  337.399 1.00 61.66  ? 244 ALA 3 O     1 
ATOM   6569  C  CB    . ALA C  3  244 ? -60.603  36.255  334.252 1.00 39.28  ? 244 ALA 3 CB    1 
ATOM   6570  N  N     . ARG C  3  245 ? -60.372  33.576  335.674 1.00 43.76  ? 245 ARG 3 N     1 
ATOM   6571  C  CA    . ARG C  3  245 ? -59.514  32.642  336.379 1.00 39.30  ? 245 ARG 3 CA    1 
ATOM   6572  C  C     . ARG C  3  245 ? -58.060  32.985  336.099 1.00 38.95  ? 245 ARG 3 C     1 
ATOM   6573  O  O     . ARG C  3  245 ? -57.718  33.456  335.012 1.00 38.76  ? 245 ARG 3 O     1 
ATOM   6574  C  CB    . ARG C  3  245 ? -59.822  31.205  335.963 1.00 39.34  ? 245 ARG 3 CB    1 
ATOM   6575  C  CG    . ARG C  3  245 ? -61.303  30.897  335.955 1.00 46.30  ? 245 ARG 3 CG    1 
ATOM   6576  C  CD    . ARG C  3  245 ? -61.919  31.157  337.317 1.00 47.07  ? 245 ARG 3 CD    1 
ATOM   6577  N  NE    . ARG C  3  245 ? -61.355  30.310  338.360 1.00 55.61  ? 245 ARG 3 NE    1 
ATOM   6578  C  CZ    . ARG C  3  245 ? -61.811  29.100  338.659 1.00 62.38  ? 245 ARG 3 CZ    1 
ATOM   6579  N  NH1   . ARG C  3  245 ? -62.844  28.594  337.998 1.00 69.74  ? 245 ARG 3 NH1   1 
ATOM   6580  N  NH2   . ARG C  3  245 ? -61.242  28.395  339.625 1.00 58.85  ? 245 ARG 3 NH2   1 
ATOM   6581  N  N     . ASN C  3  246 ? -57.205  32.741  337.095 1.00 38.89  ? 246 ASN 3 N     1 
ATOM   6582  C  CA    . ASN C  3  246 ? -55.837  33.254  337.059 1.00 44.85  ? 246 ASN 3 CA    1 
ATOM   6583  C  C     . ASN C  3  246 ? -55.099  32.864  335.785 1.00 58.34  ? 246 ASN 3 C     1 
ATOM   6584  O  O     . ASN C  3  246 ? -54.400  33.693  335.195 1.00 65.78  ? 246 ASN 3 O     1 
ATOM   6585  C  CB    . ASN C  3  246 ? -55.066  32.779  338.291 1.00 43.91  ? 246 ASN 3 CB    1 
ATOM   6586  C  CG    . ASN C  3  246 ? -55.565  33.412  339.570 1.00 38.85  ? 246 ASN 3 CG    1 
ATOM   6587  O  OD1   . ASN C  3  246 ? -56.717  33.233  339.960 1.00 39.14  ? 246 ASN 3 OD1   1 
ATOM   6588  N  ND2   . ASN C  3  246 ? -54.689  34.144  340.244 1.00 38.75  ? 246 ASN 3 ND2   1 
ATOM   6589  N  N     . TRP C  3  247 ? -55.238  31.615  335.334 1.00 56.75  ? 247 TRP 3 N     1 
ATOM   6590  C  CA    . TRP C  3  247 ? -54.503  31.224  334.134 1.00 55.79  ? 247 TRP 3 CA    1 
ATOM   6591  C  C     . TRP C  3  247 ? -55.077  31.893  332.891 1.00 50.72  ? 247 TRP 3 C     1 
ATOM   6592  O  O     . TRP C  3  247 ? -54.331  32.204  331.958 1.00 47.52  ? 247 TRP 3 O     1 
ATOM   6593  C  CB    . TRP C  3  247 ? -54.486  29.700  333.955 1.00 58.52  ? 247 TRP 3 CB    1 
ATOM   6594  C  CG    . TRP C  3  247 ? -55.793  29.083  333.537 1.00 38.26  ? 247 TRP 3 CG    1 
ATOM   6595  C  CD1   . TRP C  3  247 ? -56.200  28.834  332.263 1.00 38.22  ? 247 TRP 3 CD1   1 
ATOM   6596  C  CD2   . TRP C  3  247 ? -56.825  28.571  334.391 1.00 38.57  ? 247 TRP 3 CD2   1 
ATOM   6597  N  NE1   . TRP C  3  247 ? -57.435  28.243  332.265 1.00 38.48  ? 247 TRP 3 NE1   1 
ATOM   6598  C  CE2   . TRP C  3  247 ? -57.838  28.064  333.560 1.00 38.70  ? 247 TRP 3 CE2   1 
ATOM   6599  C  CE3   . TRP C  3  247 ? -56.999  28.508  335.775 1.00 38.76  ? 247 TRP 3 CE3   1 
ATOM   6600  C  CZ2   . TRP C  3  247 ? -59.005  27.507  334.062 1.00 39.01  ? 247 TRP 3 CZ2   1 
ATOM   6601  C  CZ3   . TRP C  3  247 ? -58.161  27.949  336.270 1.00 39.06  ? 247 TRP 3 CZ3   1 
ATOM   6602  C  CH2   . TRP C  3  247 ? -59.147  27.458  335.417 1.00 39.19  ? 247 TRP 3 CH2   1 
ATOM   6603  N  N     . GLU C  3  248 ? -56.392  32.124  332.858 1.00 49.92  ? 248 GLU 3 N     1 
ATOM   6604  C  CA    . GLU C  3  248 ? -57.003  32.741  331.687 1.00 46.18  ? 248 GLU 3 CA    1 
ATOM   6605  C  C     . GLU C  3  248 ? -56.577  34.189  331.508 1.00 43.97  ? 248 GLU 3 C     1 
ATOM   6606  O  O     . GLU C  3  248 ? -56.621  34.696  330.384 1.00 44.11  ? 248 GLU 3 O     1 
ATOM   6607  C  CB    . GLU C  3  248 ? -58.528  32.661  331.762 1.00 46.31  ? 248 GLU 3 CB    1 
ATOM   6608  C  CG    . GLU C  3  248 ? -59.118  31.473  331.021 1.00 52.14  ? 248 GLU 3 CG    1 
ATOM   6609  C  CD    . GLU C  3  248 ? -60.625  31.387  331.148 1.00 55.26  ? 248 GLU 3 CD    1 
ATOM   6610  O  OE1   . GLU C  3  248 ? -61.132  31.466  332.283 1.00 55.43  ? 248 GLU 3 OE1   1 
ATOM   6611  O  OE2   . GLU C  3  248 ? -61.304  31.247  330.111 1.00 52.78  ? 248 GLU 3 OE2   1 
ATOM   6612  N  N     . MET C  3  249 ? -56.164  34.860  332.578 1.00 44.82  ? 249 MET 3 N     1 
ATOM   6613  C  CA    . MET C  3  249 ? -55.770  36.257  332.479 1.00 43.00  ? 249 MET 3 CA    1 
ATOM   6614  C  C     . MET C  3  249 ? -54.445  36.391  331.740 1.00 58.14  ? 249 MET 3 C     1 
ATOM   6615  O  O     . MET C  3  249 ? -53.521  35.595  331.924 1.00 60.50  ? 249 MET 3 O     1 
ATOM   6616  C  CB    . MET C  3  249 ? -55.663  36.890  333.864 1.00 38.19  ? 249 MET 3 CB    1 
ATOM   6617  C  CG    . MET C  3  249 ? -56.870  36.664  334.759 1.00 38.53  ? 249 MET 3 CG    1 
ATOM   6618  S  SD    . MET C  3  249 ? -57.147  38.089  335.827 1.00 38.69  ? 249 MET 3 SD    1 
ATOM   6619  C  CE    . MET C  3  249 ? -58.251  37.447  337.077 1.00 39.07  ? 249 MET 3 CE    1 
ATOM   6620  N  N     . GLU C  3  250 ? -54.363  37.417  330.899 1.00 72.10  ? 250 GLU 3 N     1 
ATOM   6621  C  CA    . GLU C  3  250 ? -53.160  37.724  330.139 1.00 84.31  ? 250 GLU 3 CA    1 
ATOM   6622  C  C     . GLU C  3  250 ? -52.221  38.561  330.997 1.00 77.70  ? 250 GLU 3 C     1 
ATOM   6623  O  O     . GLU C  3  250 ? -52.612  39.618  331.506 1.00 73.64  ? 250 GLU 3 O     1 
ATOM   6624  C  CB    . GLU C  3  250 ? -53.518  38.473  328.858 1.00 97.90  ? 250 GLU 3 CB    1 
ATOM   6625  C  CG    . GLU C  3  250 ? -52.371  38.592  327.874 1.00 109.99 ? 250 GLU 3 CG    1 
ATOM   6626  C  CD    . GLU C  3  250 ? -52.773  39.313  326.609 1.00 118.42 ? 250 GLU 3 CD    1 
ATOM   6627  O  OE1   . GLU C  3  250 ? -53.984  39.560  326.429 1.00 121.48 ? 250 GLU 3 OE1   1 
ATOM   6628  O  OE2   . GLU C  3  250 ? -51.881  39.642  325.799 1.00 120.54 ? 250 GLU 3 OE2   1 
ATOM   6629  N  N     . GLU C  3  251 ? -50.988  38.096  331.152 1.00 70.12  ? 251 GLU 3 N     1 
ATOM   6630  C  CA    . GLU C  3  251 ? -50.019  38.752  332.015 1.00 62.22  ? 251 GLU 3 CA    1 
ATOM   6631  C  C     . GLU C  3  251 ? -49.206  39.745  331.194 1.00 44.56  ? 251 GLU 3 C     1 
ATOM   6632  O  O     . GLU C  3  251 ? -48.593  39.373  330.189 1.00 36.84  ? 251 GLU 3 O     1 
ATOM   6633  C  CB    . GLU C  3  251 ? -49.103  37.714  332.664 1.00 79.27  ? 251 GLU 3 CB    1 
ATOM   6634  C  CG    . GLU C  3  251 ? -49.843  36.537  333.291 1.00 95.60  ? 251 GLU 3 CG    1 
ATOM   6635  C  CD    . GLU C  3  251 ? -48.907  35.538  333.949 1.00 105.69 ? 251 GLU 3 CD    1 
ATOM   6636  O  OE1   . GLU C  3  251 ? -47.898  35.158  333.320 1.00 108.57 ? 251 GLU 3 OE1   1 
ATOM   6637  O  OE2   . GLU C  3  251 ? -49.179  35.135  335.098 1.00 108.33 ? 251 GLU 3 OE2   1 
ATOM   6638  N  N     . THR C  3  252 ? -49.220  41.009  331.612 1.00 44.68  ? 252 THR 3 N     1 
ATOM   6639  C  CA    . THR C  3  252 ? -48.333  42.039  331.070 1.00 46.17  ? 252 THR 3 CA    1 
ATOM   6640  C  C     . THR C  3  252 ? -47.470  42.589  332.192 1.00 43.38  ? 252 THR 3 C     1 
ATOM   6641  O  O     . THR C  3  252 ? -47.945  43.403  333.000 1.00 36.74  ? 252 THR 3 O     1 
ATOM   6642  C  CB    . THR C  3  252 ? -49.131  43.161  330.414 1.00 50.53  ? 252 THR 3 CB    1 
ATOM   6643  O  OG1   . THR C  3  252 ? -49.890  42.639  329.316 1.00 52.17  ? 252 THR 3 OG1   1 
ATOM   6644  C  CG2   . THR C  3  252 ? -48.207  44.261  329.937 1.00 50.79  ? 252 THR 3 CG2   1 
ATOM   6645  N  N     . PRO C  3  253 ? -46.218  42.157  332.319 1.00 40.12  ? 253 PRO 3 N     1 
ATOM   6646  C  CA    . PRO C  3  253 ? -45.347  42.716  333.359 1.00 37.56  ? 253 PRO 3 CA    1 
ATOM   6647  C  C     . PRO C  3  253 ? -44.835  44.086  332.936 1.00 38.31  ? 253 PRO 3 C     1 
ATOM   6648  O  O     . PRO C  3  253 ? -44.281  44.244  331.846 1.00 47.69  ? 253 PRO 3 O     1 
ATOM   6649  C  CB    . PRO C  3  253 ? -44.212  41.692  333.460 1.00 36.23  ? 253 PRO 3 CB    1 
ATOM   6650  C  CG    . PRO C  3  253 ? -44.177  41.048  332.126 1.00 39.48  ? 253 PRO 3 CG    1 
ATOM   6651  C  CD    . PRO C  3  253 ? -45.586  41.031  331.611 1.00 44.18  ? 253 PRO 3 CD    1 
ATOM   6652  N  N     . THR C  3  254 ? -45.030  45.078  333.795 1.00 36.39  ? 254 THR 3 N     1 
ATOM   6653  C  CA    . THR C  3  254 ? -44.682  46.453  333.451 1.00 36.32  ? 254 THR 3 CA    1 
ATOM   6654  C  C     . THR C  3  254 ? -44.338  47.189  334.744 1.00 49.38  ? 254 THR 3 C     1 
ATOM   6655  O  O     . THR C  3  254 ? -44.077  46.561  335.775 1.00 44.96  ? 254 THR 3 O     1 
ATOM   6656  C  CB    . THR C  3  254 ? -45.821  47.102  332.639 1.00 40.48  ? 254 THR 3 CB    1 
ATOM   6657  O  OG1   . THR C  3  254 ? -45.379  48.356  332.112 1.00 36.31  ? 254 THR 3 OG1   1 
ATOM   6658  C  CG2   . THR C  3  254 ? -47.058  47.320  333.488 1.00 36.67  ? 254 THR 3 CG2   1 
ATOM   6659  N  N     . THR C  3  255 ? -44.309  48.518  334.697 1.00 49.88  ? 255 THR 3 N     1 
ATOM   6660  C  CA    . THR C  3  255 ? -43.931  49.314  335.855 1.00 41.78  ? 255 THR 3 CA    1 
ATOM   6661  C  C     . THR C  3  255 ? -45.001  50.362  336.127 1.00 42.28  ? 255 THR 3 C     1 
ATOM   6662  O  O     . THR C  3  255 ? -45.589  50.917  335.196 1.00 36.66  ? 255 THR 3 O     1 
ATOM   6663  C  CB    . THR C  3  255 ? -42.567  49.972  335.640 1.00 36.28  ? 255 THR 3 CB    1 
ATOM   6664  O  OG1   . THR C  3  255 ? -41.625  48.974  335.233 1.00 36.11  ? 255 THR 3 OG1   1 
ATOM   6665  C  CG2   . THR C  3  255 ? -42.077  50.604  336.920 1.00 36.35  ? 255 THR 3 CG2   1 
ATOM   6666  N  N     . CYS C  3  256 ? -45.262  50.617  337.404 1.00 36.83  ? 256 CYS 3 N     1 
ATOM   6667  C  CA    . CYS C  3  256 ? -46.288  51.563  337.824 1.00 37.03  ? 256 CYS 3 CA    1 
ATOM   6668  C  C     . CYS C  3  256 ? -45.675  52.951  337.952 1.00 41.08  ? 256 CYS 3 C     1 
ATOM   6669  O  O     . CYS C  3  256 ? -44.704  53.142  338.690 1.00 36.92  ? 256 CYS 3 O     1 
ATOM   6670  C  CB    . CYS C  3  256 ? -46.904  51.116  339.148 1.00 37.27  ? 256 CYS 3 CB    1 
ATOM   6671  S  SG    . CYS C  3  256 ? -47.878  52.333  340.056 1.00 37.54  ? 256 CYS 3 SG    1 
ATOM   6672  N  N     . ALA C  3  257 ? -46.253  53.916  337.242 1.00 45.58  ? 257 ALA 3 N     1 
ATOM   6673  C  CA    . ALA C  3  257 ? -45.746  55.279  337.181 1.00 41.84  ? 257 ALA 3 CA    1 
ATOM   6674  C  C     . ALA C  3  257 ? -46.606  56.246  337.986 1.00 38.75  ? 257 ALA 3 C     1 
ATOM   6675  O  O     . ALA C  3  257 ? -46.763  57.408  337.605 1.00 38.90  ? 257 ALA 3 O     1 
ATOM   6676  C  CB    . ALA C  3  257 ? -45.647  55.745  335.731 1.00 36.80  ? 257 ALA 3 CB    1 
ATOM   6677  N  N     . LEU C  3  258 ? -47.197  55.773  339.083 1.00 45.30  ? 258 LEU 3 N     1 
ATOM   6678  C  CA    . LEU C  3  258 ? -47.964  56.656  339.951 1.00 59.89  ? 258 LEU 3 CA    1 
ATOM   6679  C  C     . LEU C  3  258 ? -47.068  57.481  340.867 1.00 74.62  ? 258 LEU 3 C     1 
ATOM   6680  O  O     . LEU C  3  258 ? -47.380  58.646  341.144 1.00 81.45  ? 258 LEU 3 O     1 
ATOM   6681  C  CB    . LEU C  3  258 ? -48.957  55.849  340.786 1.00 64.75  ? 258 LEU 3 CB    1 
ATOM   6682  C  CG    . LEU C  3  258 ? -50.302  55.535  340.138 1.00 73.08  ? 258 LEU 3 CG    1 
ATOM   6683  C  CD1   . LEU C  3  258 ? -50.858  54.228  340.682 1.00 74.64  ? 258 LEU 3 CD1   1 
ATOM   6684  C  CD2   . LEU C  3  258 ? -51.274  56.684  340.348 1.00 77.18  ? 258 LEU 3 CD2   1 
ATOM   6685  N  N     . CYS C  3  259 ? -45.960  56.913  341.330 1.00 76.76  ? 259 CYS 3 N     1 
ATOM   6686  C  CA    . CYS C  3  259 ? -45.068  57.583  342.266 1.00 77.84  ? 259 CYS 3 CA    1 
ATOM   6687  C  C     . CYS C  3  259 ? -43.647  57.154  341.932 1.00 72.03  ? 259 CYS 3 C     1 
ATOM   6688  O  O     . CYS C  3  259 ? -43.450  56.121  341.281 1.00 70.89  ? 259 CYS 3 O     1 
ATOM   6689  C  CB    . CYS C  3  259 ? -45.429  57.245  343.720 1.00 78.05  ? 259 CYS 3 CB    1 
ATOM   6690  S  SG    . CYS C  3  259 ? -44.491  55.887  344.404 1.00 78.38  ? 259 CYS 3 SG    1 
ATOM   6691  N  N     . PRO C  3  260 ? -42.631  57.911  342.370 1.00 64.67  ? 260 PRO 3 N     1 
ATOM   6692  C  CA    . PRO C  3  260 ? -41.300  57.774  341.750 1.00 57.06  ? 260 PRO 3 CA    1 
ATOM   6693  C  C     . PRO C  3  260 ? -40.581  56.470  342.050 1.00 62.89  ? 260 PRO 3 C     1 
ATOM   6694  O  O     . PRO C  3  260 ? -39.552  56.206  341.414 1.00 67.27  ? 260 PRO 3 O     1 
ATOM   6695  C  CB    . PRO C  3  260 ? -40.517  58.967  342.317 1.00 45.97  ? 260 PRO 3 CB    1 
ATOM   6696  C  CG    . PRO C  3  260 ? -41.411  59.628  343.307 1.00 37.16  ? 260 PRO 3 CG    1 
ATOM   6697  C  CD    . PRO C  3  260 ? -42.582  58.779  343.556 1.00 58.38  ? 260 PRO 3 CD    1 
ATOM   6698  N  N     . VAL C  3  261 ? -41.081  55.636  342.965 1.00 58.27  ? 261 VAL 3 N     1 
ATOM   6699  C  CA    . VAL C  3  261 ? -40.382  54.390  343.252 1.00 51.34  ? 261 VAL 3 CA    1 
ATOM   6700  C  C     . VAL C  3  261 ? -40.604  53.375  342.141 1.00 55.00  ? 261 VAL 3 C     1 
ATOM   6701  O  O     . VAL C  3  261 ? -39.777  52.472  341.967 1.00 64.32  ? 261 VAL 3 O     1 
ATOM   6702  C  CB    . VAL C  3  261 ? -40.792  53.796  344.614 1.00 48.85  ? 261 VAL 3 CB    1 
ATOM   6703  C  CG1   . VAL C  3  261 ? -40.787  54.868  345.694 1.00 56.04  ? 261 VAL 3 CG1   1 
ATOM   6704  C  CG2   . VAL C  3  261 ? -42.153  53.123  344.539 1.00 37.28  ? 261 VAL 3 CG2   1 
ATOM   6705  N  N     . GLY C  3  262 ? -41.693  53.505  341.386 1.00 53.17  ? 262 GLY 3 N     1 
ATOM   6706  C  CA    . GLY C  3  262 ? -41.961  52.644  340.252 1.00 48.19  ? 262 GLY 3 CA    1 
ATOM   6707  C  C     . GLY C  3  262 ? -41.797  51.170  340.543 1.00 36.72  ? 262 GLY 3 C     1 
ATOM   6708  O  O     . GLY C  3  262 ? -40.900  50.533  339.993 1.00 36.54  ? 262 GLY 3 O     1 
ATOM   6709  N  N     . CYS C  3  263 ? -42.611  50.617  341.431 1.00 36.92  ? 263 CYS 3 N     1 
ATOM   6710  C  CA    . CYS C  3  263 ? -42.526  49.188  341.684 1.00 42.40  ? 263 CYS 3 CA    1 
ATOM   6711  C  C     . CYS C  3  263 ? -42.728  48.402  340.398 1.00 40.07  ? 263 CYS 3 C     1 
ATOM   6712  O  O     . CYS C  3  263 ? -43.400  48.850  339.464 1.00 36.78  ? 263 CYS 3 O     1 
ATOM   6713  C  CB    . CYS C  3  263 ? -43.574  48.744  342.694 1.00 45.32  ? 263 CYS 3 CB    1 
ATOM   6714  S  SG    . CYS C  3  263 ? -43.544  49.641  344.207 1.00 37.38  ? 263 CYS 3 SG    1 
ATOM   6715  N  N     . GLY C  3  264 ? -42.143  47.211  340.357 1.00 36.70  ? 264 GLY 3 N     1 
ATOM   6716  C  CA    . GLY C  3  264 ? -42.473  46.288  339.293 1.00 37.76  ? 264 GLY 3 CA    1 
ATOM   6717  C  C     . GLY C  3  264 ? -43.863  45.744  339.537 1.00 43.15  ? 264 GLY 3 C     1 
ATOM   6718  O  O     . GLY C  3  264 ? -44.203  45.359  340.662 1.00 40.73  ? 264 GLY 3 O     1 
ATOM   6719  N  N     . ILE C  3  265 ? -44.692  45.738  338.496 1.00 51.92  ? 265 ILE 3 N     1 
ATOM   6720  C  CA    . ILE C  3  265 ? -46.054  45.250  338.609 1.00 54.29  ? 265 ILE 3 CA    1 
ATOM   6721  C  C     . ILE C  3  265 ? -46.261  44.234  337.499 1.00 45.25  ? 265 ILE 3 C     1 
ATOM   6722  O  O     . ILE C  3  265 ? -45.520  44.193  336.516 1.00 39.92  ? 265 ILE 3 O     1 
ATOM   6723  C  CB    . ILE C  3  265 ? -47.106  46.379  338.500 1.00 56.79  ? 265 ILE 3 CB    1 
ATOM   6724  C  CG1   . ILE C  3  265 ? -47.022  47.067  337.140 1.00 65.39  ? 265 ILE 3 CG1   1 
ATOM   6725  C  CG2   . ILE C  3  265 ? -46.914  47.407  339.606 1.00 71.16  ? 265 ILE 3 CG2   1 
ATOM   6726  C  CD1   . ILE C  3  265 ? -48.003  48.214  336.973 1.00 37.17  ? 265 ILE 3 CD1   1 
ATOM   6727  N  N     . THR C  3  266 ? -47.296  43.421  337.659 1.00 45.40  ? 266 THR 3 N     1 
ATOM   6728  C  CA    . THR C  3  266 ? -47.725  42.479  336.634 1.00 46.62  ? 266 THR 3 CA    1 
ATOM   6729  C  C     . THR C  3  266 ? -49.222  42.677  336.474 1.00 45.31  ? 266 THR 3 C     1 
ATOM   6730  O  O     . THR C  3  266 ? -49.983  42.438  337.417 1.00 49.44  ? 266 THR 3 O     1 
ATOM   6731  C  CB    . THR C  3  266 ? -47.388  41.040  337.029 1.00 68.05  ? 266 THR 3 CB    1 
ATOM   6732  O  OG1   . THR C  3  266 ? -45.969  40.896  337.155 1.00 81.11  ? 266 THR 3 OG1   1 
ATOM   6733  C  CG2   . THR C  3  266 ? -47.886  40.052  335.989 1.00 70.71  ? 266 THR 3 CG2   1 
ATOM   6734  N  N     . ALA C  3  267 ? -49.645  43.149  335.306 1.00 43.70  ? 267 ALA 3 N     1 
ATOM   6735  C  CA    . ALA C  3  267 ? -51.038  43.491  335.073 1.00 37.45  ? 267 ALA 3 CA    1 
ATOM   6736  C  C     . ALA C  3  267 ? -51.744  42.303  334.432 1.00 37.50  ? 267 ALA 3 C     1 
ATOM   6737  O  O     . ALA C  3  267 ? -51.398  41.891  333.319 1.00 37.33  ? 267 ALA 3 O     1 
ATOM   6738  C  CB    . ALA C  3  267 ? -51.147  44.729  334.183 1.00 37.38  ? 267 ALA 3 CB    1 
ATOM   6739  N  N     . ASP C  3  268 ? -52.707  41.737  335.151 1.00 93.47  ? 268 ASP 3 N     1 
ATOM   6740  C  CA    . ASP C  3  268 ? -53.574  40.699  334.623 1.00 71.06  ? 268 ASP 3 CA    1 
ATOM   6741  C  C     . ASP C  3  268 ? -54.733  41.378  333.908 1.00 88.51  ? 268 ASP 3 C     1 
ATOM   6742  O  O     . ASP C  3  268 ? -55.512  42.114  334.528 1.00 38.22  ? 268 ASP 3 O     1 
ATOM   6743  C  CB    . ASP C  3  268 ? -54.070  39.789  335.742 1.00 87.89  ? 268 ASP 3 CB    1 
ATOM   6744  C  CG    . ASP C  3  268 ? -52.937  39.134  336.506 1.00 93.43  ? 268 ASP 3 CG    1 
ATOM   6745  O  OD1   . ASP C  3  268 ? -51.843  38.948  335.931 1.00 96.47  ? 268 ASP 3 OD1   1 
ATOM   6746  O  OD2   . ASP C  3  268 ? -53.137  38.800  337.689 1.00 93.96  ? 268 ASP 3 OD2   1 
ATOM   6747  N  N     . THR C  3  269 ? -54.860  41.089  332.620 1.00 37.90  ? 269 THR 3 N     1 
ATOM   6748  C  CA    . THR C  3  269 ? -55.747  41.778  331.698 1.00 72.16  ? 269 THR 3 CA    1 
ATOM   6749  C  C     . THR C  3  269 ? -56.546  40.750  330.915 1.00 64.12  ? 269 THR 3 C     1 
ATOM   6750  O  O     . THR C  3  269 ? -56.024  39.686  330.582 1.00 55.75  ? 269 THR 3 O     1 
ATOM   6751  C  CB    . THR C  3  269 ? -54.925  42.607  330.716 1.00 70.59  ? 269 THR 3 CB    1 
ATOM   6752  O  OG1   . THR C  3  269 ? -53.853  41.792  330.232 1.00 65.96  ? 269 THR 3 OG1   1 
ATOM   6753  C  CG2   . THR C  3  269 ? -54.322  43.814  331.378 1.00 73.87  ? 269 THR 3 CG2   1 
ATOM   6754  N  N     . ARG C  3  270 ? -57.800  41.057  330.597 1.00 63.62  ? 270 ARG 3 N     1 
ATOM   6755  C  CA    . ARG C  3  270 ? -58.562  40.114  329.788 1.00 60.98  ? 270 ARG 3 CA    1 
ATOM   6756  C  C     . ARG C  3  270 ? -59.617  40.839  328.967 1.00 60.09  ? 270 ARG 3 C     1 
ATOM   6757  O  O     . ARG C  3  270 ? -60.323  41.709  329.484 1.00 58.12  ? 270 ARG 3 O     1 
ATOM   6758  C  CB    . ARG C  3  270 ? -59.215  39.045  330.667 1.00 61.21  ? 270 ARG 3 CB    1 
ATOM   6759  C  CG    . ARG C  3  270 ? -60.028  38.004  329.911 1.00 64.05  ? 270 ARG 3 CG    1 
ATOM   6760  C  CD    . ARG C  3  270 ? -60.749  37.111  330.906 1.00 63.14  ? 270 ARG 3 CD    1 
ATOM   6761  N  NE    . ARG C  3  270 ? -61.776  36.254  330.327 1.00 57.78  ? 270 ARG 3 NE    1 
ATOM   6762  C  CZ    . ARG C  3  270 ? -61.536  35.030  329.872 1.00 53.98  ? 270 ARG 3 CZ    1 
ATOM   6763  N  NH1   . ARG C  3  270 ? -60.308  34.541  329.922 1.00 57.76  ? 270 ARG 3 NH1   1 
ATOM   6764  N  NH2   . ARG C  3  270 ? -62.515  34.293  329.374 1.00 49.00  ? 270 ARG 3 NH2   1 
ATOM   6765  N  N     . SER C  3  271 ? -59.713  40.466  327.690 1.00 61.65  ? 271 SER 3 N     1 
ATOM   6766  C  CA    . SER C  3  271 ? -60.765  40.935  326.791 1.00 61.89  ? 271 SER 3 CA    1 
ATOM   6767  C  C     . SER C  3  271 ? -60.757  42.454  326.648 1.00 70.89  ? 271 SER 3 C     1 
ATOM   6768  O  O     . SER C  3  271 ? -61.807  43.095  326.585 1.00 76.64  ? 271 SER 3 O     1 
ATOM   6769  C  CB    . SER C  3  271 ? -62.136  40.436  327.243 1.00 56.47  ? 271 SER 3 CB    1 
ATOM   6770  O  OG    . SER C  3  271 ? -62.351  39.105  326.816 1.00 59.59  ? 271 SER 3 OG    1 
ATOM   6771  N  N     . GLY C  3  272 ? -59.564  43.035  326.597 1.00 66.25  ? 272 GLY 3 N     1 
ATOM   6772  C  CA    . GLY C  3  272 ? -59.424  44.446  326.326 1.00 52.41  ? 272 GLY 3 CA    1 
ATOM   6773  C  C     . GLY C  3  272 ? -59.604  45.370  327.510 1.00 38.66  ? 272 GLY 3 C     1 
ATOM   6774  O  O     . GLY C  3  272 ? -59.517  46.591  327.332 1.00 38.44  ? 272 GLY 3 O     1 
ATOM   6775  N  N     . GLU C  3  273 ? -59.877  44.845  328.703 1.00 38.75  ? 273 GLU 3 N     1 
ATOM   6776  C  CA    . GLU C  3  273 ? -60.008  45.672  329.895 1.00 40.47  ? 273 GLU 3 CA    1 
ATOM   6777  C  C     . GLU C  3  273 ? -59.140  45.125  331.020 1.00 44.26  ? 273 GLU 3 C     1 
ATOM   6778  O  O     . GLU C  3  273 ? -58.932  43.916  331.138 1.00 46.20  ? 273 GLU 3 O     1 
ATOM   6779  C  CB    . GLU C  3  273 ? -61.469  45.795  330.361 1.00 39.11  ? 273 GLU 3 CB    1 
ATOM   6780  C  CG    . GLU C  3  273 ? -62.268  44.515  330.414 1.00 53.01  ? 273 GLU 3 CG    1 
ATOM   6781  C  CD    . GLU C  3  273 ? -63.696  44.776  330.845 1.00 52.36  ? 273 GLU 3 CD    1 
ATOM   6782  O  OE1   . GLU C  3  273 ? -64.201  45.888  330.584 1.00 50.16  ? 273 GLU 3 OE1   1 
ATOM   6783  O  OE2   . GLU C  3  273 ? -64.314  43.874  331.444 1.00 54.22  ? 273 GLU 3 OE2   1 
ATOM   6784  N  N     . LEU C  3  274 ? -58.629  46.038  331.840 1.00 48.17  ? 274 LEU 3 N     1 
ATOM   6785  C  CA    . LEU C  3  274 ? -57.709  45.705  332.922 1.00 51.33  ? 274 LEU 3 CA    1 
ATOM   6786  C  C     . LEU C  3  274 ? -58.485  45.151  334.108 1.00 44.58  ? 274 LEU 3 C     1 
ATOM   6787  O  O     . LEU C  3  274 ? -59.388  45.814  334.634 1.00 39.05  ? 274 LEU 3 O     1 
ATOM   6788  C  CB    . LEU C  3  274 ? -56.908  46.939  333.331 1.00 53.87  ? 274 LEU 3 CB    1 
ATOM   6789  C  CG    . LEU C  3  274 ? -55.849  46.829  334.428 1.00 49.00  ? 274 LEU 3 CG    1 
ATOM   6790  C  CD1   . LEU C  3  274 ? -54.884  45.709  334.179 1.00 38.07  ? 274 LEU 3 CD1   1 
ATOM   6791  C  CD2   . LEU C  3  274 ? -55.096  48.135  334.544 1.00 61.06  ? 274 LEU 3 CD2   1 
ATOM   6792  N  N     . LEU C  3  275 ? -58.133  43.938  334.530 1.00 50.40  ? 275 LEU 3 N     1 
ATOM   6793  C  CA    . LEU C  3  275 ? -58.811  43.255  335.624 1.00 48.83  ? 275 LEU 3 CA    1 
ATOM   6794  C  C     . LEU C  3  275 ? -58.088  43.411  336.952 1.00 44.60  ? 275 LEU 3 C     1 
ATOM   6795  O  O     . LEU C  3  275 ? -58.693  43.844  337.935 1.00 48.44  ? 275 LEU 3 O     1 
ATOM   6796  C  CB    . LEU C  3  275 ? -58.978  41.764  335.321 1.00 46.21  ? 275 LEU 3 CB    1 
ATOM   6797  C  CG    . LEU C  3  275 ? -59.822  41.403  334.108 1.00 39.08  ? 275 LEU 3 CG    1 
ATOM   6798  C  CD1   . LEU C  3  275 ? -59.899  39.902  333.985 1.00 39.08  ? 275 LEU 3 CD1   1 
ATOM   6799  C  CD2   . LEU C  3  275 ? -61.200  42.003  334.251 1.00 39.40  ? 275 LEU 3 CD2   1 
ATOM   6800  N  N     . ARG C  3  276 ? -56.811  43.054  337.018 1.00 38.75  ? 276 ARG 3 N     1 
ATOM   6801  C  CA    . ARG C  3  276 ? -56.167  42.968  338.317 1.00 38.76  ? 276 ARG 3 CA    1 
ATOM   6802  C  C     . ARG C  3  276 ? -54.711  43.368  338.174 1.00 53.79  ? 276 ARG 3 C     1 
ATOM   6803  O  O     . ARG C  3  276 ? -54.117  43.223  337.106 1.00 59.24  ? 276 ARG 3 O     1 
ATOM   6804  C  CB    . ARG C  3  276 ? -56.289  41.558  338.897 1.00 57.49  ? 276 ARG 3 CB    1 
ATOM   6805  C  CG    . ARG C  3  276 ? -55.435  41.290  340.118 1.00 62.14  ? 276 ARG 3 CG    1 
ATOM   6806  C  CD    . ARG C  3  276 ? -55.595  39.857  340.568 1.00 62.57  ? 276 ARG 3 CD    1 
ATOM   6807  N  NE    . ARG C  3  276 ? -54.906  38.934  339.679 1.00 53.96  ? 276 ARG 3 NE    1 
ATOM   6808  C  CZ    . ARG C  3  276 ? -54.876  37.620  339.858 1.00 51.84  ? 276 ARG 3 CZ    1 
ATOM   6809  N  NH1   . ARG C  3  276 ? -55.494  37.075  340.896 1.00 54.08  ? 276 ARG 3 NH1   1 
ATOM   6810  N  NH2   . ARG C  3  276 ? -54.226  36.856  338.997 1.00 52.34  ? 276 ARG 3 NH2   1 
ATOM   6811  N  N     . ILE C  3  277 ? -54.155  43.914  339.246 1.00 52.37  ? 277 ILE 3 N     1 
ATOM   6812  C  CA    . ILE C  3  277 ? -52.745  44.261  339.313 1.00 48.64  ? 277 ILE 3 CA    1 
ATOM   6813  C  C     . ILE C  3  277 ? -52.129  43.387  340.393 1.00 46.19  ? 277 ILE 3 C     1 
ATOM   6814  O  O     . ILE C  3  277 ? -52.750  43.151  341.434 1.00 48.01  ? 277 ILE 3 O     1 
ATOM   6815  C  CB    . ILE C  3  277 ? -52.558  45.760  339.625 1.00 47.39  ? 277 ILE 3 CB    1 
ATOM   6816  C  CG1   . ILE C  3  277 ? -53.318  46.610  338.605 1.00 40.31  ? 277 ILE 3 CG1   1 
ATOM   6817  C  CG2   . ILE C  3  277 ? -51.091  46.142  339.625 1.00 48.47  ? 277 ILE 3 CG2   1 
ATOM   6818  C  CD1   . ILE C  3  277 ? -52.839  46.461  337.179 1.00 38.00  ? 277 ILE 3 CD1   1 
ATOM   6819  N  N     . ARG C  3  278 ? -50.926  42.879  340.142 1.00 49.25  ? 278 ARG 3 N     1 
ATOM   6820  C  CA    . ARG C  3  278 ? -50.238  42.073  341.133 1.00 60.14  ? 278 ARG 3 CA    1 
ATOM   6821  C  C     . ARG C  3  278 ? -48.770  42.448  341.175 1.00 53.52  ? 278 ARG 3 C     1 
ATOM   6822  O  O     . ARG C  3  278 ? -48.270  43.226  340.362 1.00 46.23  ? 278 ARG 3 O     1 
ATOM   6823  C  CB    . ARG C  3  278 ? -50.365  40.568  340.868 1.00 67.97  ? 278 ARG 3 CB    1 
ATOM   6824  C  CG    . ARG C  3  278 ? -51.727  40.073  340.442 1.00 65.65  ? 278 ARG 3 CG    1 
ATOM   6825  C  CD    . ARG C  3  278 ? -51.713  38.562  340.416 1.00 38.18  ? 278 ARG 3 CD    1 
ATOM   6826  N  NE    . ARG C  3  278 ? -50.376  38.051  340.153 1.00 37.91  ? 278 ARG 3 NE    1 
ATOM   6827  C  CZ    . ARG C  3  278 ? -49.948  37.646  338.963 1.00 49.92  ? 278 ARG 3 CZ    1 
ATOM   6828  N  NH1   . ARG C  3  278 ? -50.750  37.688  337.908 1.00 49.02  ? 278 ARG 3 NH1   1 
ATOM   6829  N  NH2   . ARG C  3  278 ? -48.711  37.196  338.829 1.00 54.05  ? 278 ARG 3 NH2   1 
ATOM   6830  N  N     . ALA C  3  279 ? -48.081  41.865  342.144 1.00 58.76  ? 279 ALA 3 N     1 
ATOM   6831  C  CA    . ALA C  3  279 ? -46.682  42.169  342.370 1.00 62.91  ? 279 ALA 3 CA    1 
ATOM   6832  C  C     . ALA C  3  279 ? -45.784  41.402  341.410 1.00 60.51  ? 279 ALA 3 C     1 
ATOM   6833  O  O     . ALA C  3  279 ? -45.968  40.200  341.195 1.00 63.54  ? 279 ALA 3 O     1 
ATOM   6834  C  CB    . ALA C  3  279 ? -46.311  41.827  343.807 1.00 67.58  ? 279 ALA 3 CB    1 
ATOM   6835  N  N     . ARG C  3  280 ? -44.812  42.104  340.842 1.00 53.18  ? 280 ARG 3 N     1 
ATOM   6836  C  CA    . ARG C  3  280 ? -43.716  41.507  340.096 1.00 49.60  ? 280 ARG 3 CA    1 
ATOM   6837  C  C     . ARG C  3  280 ? -42.469  41.620  340.954 1.00 49.20  ? 280 ARG 3 C     1 
ATOM   6838  O  O     . ARG C  3  280 ? -42.101  42.723  341.370 1.00 58.11  ? 280 ARG 3 O     1 
ATOM   6839  C  CB    . ARG C  3  280 ? -43.498  42.201  338.752 1.00 46.69  ? 280 ARG 3 CB    1 
ATOM   6840  C  CG    . ARG C  3  280 ? -42.436  41.529  337.895 1.00 36.44  ? 280 ARG 3 CG    1 
ATOM   6841  C  CD    . ARG C  3  280 ? -42.521  41.947  336.449 1.00 36.30  ? 280 ARG 3 CD    1 
ATOM   6842  N  NE    . ARG C  3  280 ? -42.744  43.377  336.307 1.00 43.20  ? 280 ARG 3 NE    1 
ATOM   6843  C  CZ    . ARG C  3  280 ? -41.766  44.270  336.194 1.00 62.70  ? 280 ARG 3 CZ    1 
ATOM   6844  N  NH1   . ARG C  3  280 ? -40.502  43.875  336.206 1.00 74.37  ? 280 ARG 3 NH1   1 
ATOM   6845  N  NH2   . ARG C  3  280 ? -42.052  45.557  336.067 1.00 65.63  ? 280 ARG 3 NH2   1 
ATOM   6846  N  N     . GLU C  3  281 ? -41.829  40.491  341.229 1.00 44.01  ? 281 GLU 3 N     1 
ATOM   6847  C  CA    . GLU C  3  281 ? -40.696  40.516  342.137 1.00 46.29  ? 281 GLU 3 CA    1 
ATOM   6848  C  C     . GLU C  3  281 ? -39.504  41.162  341.447 1.00 37.92  ? 281 GLU 3 C     1 
ATOM   6849  O  O     . GLU C  3  281 ? -39.101  40.754  340.353 1.00 36.32  ? 281 GLU 3 O     1 
ATOM   6850  C  CB    . GLU C  3  281 ? -40.337  39.107  342.611 1.00 62.99  ? 281 GLU 3 CB    1 
ATOM   6851  C  CG    . GLU C  3  281 ? -38.890  38.981  343.080 1.00 72.89  ? 281 GLU 3 CG    1 
ATOM   6852  C  CD    . GLU C  3  281 ? -38.555  37.613  343.649 1.00 74.80  ? 281 GLU 3 CD    1 
ATOM   6853  O  OE1   . GLU C  3  281 ? -38.907  36.592  343.021 1.00 73.05  ? 281 GLU 3 OE1   1 
ATOM   6854  O  OE2   . GLU C  3  281 ? -37.929  37.562  344.728 1.00 76.71  ? 281 GLU 3 OE2   1 
ATOM   6855  N  N     . VAL C  3  282 ? -38.952  42.181  342.093 1.00 42.16  ? 282 VAL 3 N     1 
ATOM   6856  C  CA    . VAL C  3  282 ? -37.731  42.849  341.657 1.00 49.97  ? 282 VAL 3 CA    1 
ATOM   6857  C  C     . VAL C  3  282 ? -36.988  43.282  342.918 1.00 55.24  ? 282 VAL 3 C     1 
ATOM   6858  O  O     . VAL C  3  282 ? -37.123  44.428  343.373 1.00 36.48  ? 282 VAL 3 O     1 
ATOM   6859  C  CB    . VAL C  3  282 ? -38.033  44.009  340.685 1.00 41.22  ? 282 VAL 3 CB    1 
ATOM   6860  C  CG1   . VAL C  3  282 ? -39.136  44.926  341.201 1.00 36.43  ? 282 VAL 3 CG1   1 
ATOM   6861  C  CG2   . VAL C  3  282 ? -36.778  44.800  340.371 1.00 42.65  ? 282 VAL 3 CG2   1 
ATOM   6862  N  N     . PRO C  3  283 ? -36.199  42.376  343.525 1.00 57.92  ? 283 PRO 3 N     1 
ATOM   6863  C  CA    . PRO C  3  283 ? -35.624  42.637  344.855 1.00 56.89  ? 283 PRO 3 CA    1 
ATOM   6864  C  C     . PRO C  3  283 ? -34.823  43.927  344.948 1.00 54.61  ? 283 PRO 3 C     1 
ATOM   6865  O  O     . PRO C  3  283 ? -34.508  44.384  346.049 1.00 53.01  ? 283 PRO 3 O     1 
ATOM   6866  C  CB    . PRO C  3  283 ? -34.727  41.414  345.107 1.00 59.13  ? 283 PRO 3 CB    1 
ATOM   6867  C  CG    . PRO C  3  283 ? -34.723  40.616  343.836 1.00 55.84  ? 283 PRO 3 CG    1 
ATOM   6868  C  CD    . PRO C  3  283 ? -35.909  41.018  343.041 1.00 53.39  ? 283 PRO 3 CD    1 
ATOM   6869  N  N     . GLU C  3  284 ? -34.495  44.520  343.800 1.00 54.40  ? 284 GLU 3 N     1 
ATOM   6870  C  CA    . GLU C  3  284 ? -33.713  45.751  343.797 1.00 60.00  ? 284 GLU 3 CA    1 
ATOM   6871  C  C     . GLU C  3  284 ? -34.449  46.877  344.513 1.00 66.65  ? 284 GLU 3 C     1 
ATOM   6872  O  O     . GLU C  3  284 ? -33.867  47.575  345.350 1.00 75.55  ? 284 GLU 3 O     1 
ATOM   6873  C  CB    . GLU C  3  284 ? -33.378  46.162  342.361 1.00 62.28  ? 284 GLU 3 CB    1 
ATOM   6874  C  CG    . GLU C  3  284 ? -33.151  45.013  341.396 1.00 62.89  ? 284 GLU 3 CG    1 
ATOM   6875  C  CD    . GLU C  3  284 ? -31.817  44.329  341.596 1.00 60.03  ? 284 GLU 3 CD    1 
ATOM   6876  O  OE1   . GLU C  3  284 ? -30.908  44.941  342.188 1.00 57.58  ? 284 GLU 3 OE1   1 
ATOM   6877  O  OE2   . GLU C  3  284 ? -31.676  43.172  341.160 1.00 61.25  ? 284 GLU 3 OE2   1 
ATOM   6878  N  N     . VAL C  3  285 ? -35.736  47.065  344.210 1.00 66.30  ? 285 VAL 3 N     1 
ATOM   6879  C  CA    . VAL C  3  285 ? -36.484  48.190  344.767 1.00 71.04  ? 285 VAL 3 CA    1 
ATOM   6880  C  C     . VAL C  3  285 ? -37.627  47.724  345.670 1.00 81.27  ? 285 VAL 3 C     1 
ATOM   6881  O  O     . VAL C  3  285 ? -37.600  47.967  346.883 1.00 87.37  ? 285 VAL 3 O     1 
ATOM   6882  C  CB    . VAL C  3  285 ? -36.990  49.123  343.645 1.00 62.13  ? 285 VAL 3 CB    1 
ATOM   6883  C  CG1   . VAL C  3  285 ? -37.793  48.364  342.592 1.00 55.41  ? 285 VAL 3 CG1   1 
ATOM   6884  C  CG2   . VAL C  3  285 ? -37.815  50.261  344.228 1.00 62.74  ? 285 VAL 3 CG2   1 
ATOM   6885  N  N     . ASN C  3  286 ? -38.618  47.034  345.108 1.00 80.06  ? 286 ASN 3 N     1 
ATOM   6886  C  CA    . ASN C  3  286 ? -39.691  46.415  345.879 1.00 69.12  ? 286 ASN 3 CA    1 
ATOM   6887  C  C     . ASN C  3  286 ? -39.599  44.908  345.707 1.00 64.03  ? 286 ASN 3 C     1 
ATOM   6888  O  O     . ASN C  3  286 ? -39.434  44.410  344.591 1.00 65.80  ? 286 ASN 3 O     1 
ATOM   6889  C  CB    . ASN C  3  286 ? -41.076  46.956  345.474 1.00 63.93  ? 286 ASN 3 CB    1 
ATOM   6890  C  CG    . ASN C  3  286 ? -41.696  46.219  344.295 1.00 59.93  ? 286 ASN 3 CG    1 
ATOM   6891  O  OD1   . ASN C  3  286 ? -41.080  46.052  343.247 1.00 57.75  ? 286 ASN 3 OD1   1 
ATOM   6892  N  ND2   . ASN C  3  286 ? -42.918  45.753  344.477 1.00 59.21  ? 286 ASN 3 ND2   1 
ATOM   6893  N  N     . GLU C  3  287 ? -39.687  44.188  346.817 1.00 63.98  ? 287 GLU 3 N     1 
ATOM   6894  C  CA    . GLU C  3  287 ? -39.292  42.788  346.799 1.00 72.78  ? 287 GLU 3 CA    1 
ATOM   6895  C  C     . GLU C  3  287 ? -40.327  41.927  346.095 1.00 64.83  ? 287 GLU 3 C     1 
ATOM   6896  O  O     . GLU C  3  287 ? -40.075  41.392  345.015 1.00 57.09  ? 287 GLU 3 O     1 
ATOM   6897  C  CB    . GLU C  3  287 ? -39.102  42.303  348.235 1.00 84.82  ? 287 GLU 3 CB    1 
ATOM   6898  C  CG    . GLU C  3  287 ? -37.872  42.860  348.913 1.00 93.56  ? 287 GLU 3 CG    1 
ATOM   6899  C  CD    . GLU C  3  287 ? -37.998  42.841  350.419 1.00 98.56  ? 287 GLU 3 CD    1 
ATOM   6900  O  OE1   . GLU C  3  287 ? -39.120  43.061  350.922 1.00 99.96  ? 287 GLU 3 OE1   1 
ATOM   6901  O  OE2   . GLU C  3  287 ? -36.979  42.617  351.101 1.00 100.72 ? 287 GLU 3 OE2   1 
ATOM   6902  N  N     . ILE C  3  288 ? -41.496  41.794  346.715 1.00 61.91  ? 288 ILE 3 N     1 
ATOM   6903  C  CA    . ILE C  3  288 ? -42.671  41.165  346.126 1.00 59.71  ? 288 ILE 3 CA    1 
ATOM   6904  C  C     . ILE C  3  288 ? -43.887  42.016  346.477 1.00 55.59  ? 288 ILE 3 C     1 
ATOM   6905  O  O     . ILE C  3  288 ? -45.023  41.534  346.463 1.00 37.88  ? 288 ILE 3 O     1 
ATOM   6906  C  CB    . ILE C  3  288 ? -42.830  39.709  346.603 1.00 59.22  ? 288 ILE 3 CB    1 
ATOM   6907  C  CG1   . ILE C  3  288 ? -43.036  39.656  348.115 1.00 61.54  ? 288 ILE 3 CG1   1 
ATOM   6908  C  CG2   . ILE C  3  288 ? -41.624  38.863  346.202 1.00 57.68  ? 288 ILE 3 CG2   1 
ATOM   6909  C  CD1   . ILE C  3  288 ? -43.143  38.253  348.675 1.00 63.65  ? 288 ILE 3 CD1   1 
ATOM   6910  N  N     . TRP C  3  289 ? -43.647  43.268  346.861 1.00 62.37  ? 289 TRP 3 N     1 
ATOM   6911  C  CA    . TRP C  3  289 ? -44.649  44.107  347.505 1.00 65.30  ? 289 TRP 3 CA    1 
ATOM   6912  C  C     . TRP C  3  289 ? -45.308  45.079  346.532 1.00 65.83  ? 289 TRP 3 C     1 
ATOM   6913  O  O     . TRP C  3  289 ? -44.713  45.490  345.536 1.00 62.47  ? 289 TRP 3 O     1 
ATOM   6914  C  CB    . TRP C  3  289 ? -44.017  44.892  348.655 1.00 67.63  ? 289 TRP 3 CB    1 
ATOM   6915  C  CG    . TRP C  3  289 ? -43.199  44.044  349.578 1.00 68.11  ? 289 TRP 3 CG    1 
ATOM   6916  C  CD1   . TRP C  3  289 ? -41.918  44.278  349.978 1.00 75.79  ? 289 TRP 3 CD1   1 
ATOM   6917  C  CD2   . TRP C  3  289 ? -43.596  42.818  350.208 1.00 56.72  ? 289 TRP 3 CD2   1 
ATOM   6918  N  NE1   . TRP C  3  289 ? -41.493  43.281  350.820 1.00 75.79  ? 289 TRP 3 NE1   1 
ATOM   6919  C  CE2   . TRP C  3  289 ? -42.506  42.373  350.975 1.00 64.94  ? 289 TRP 3 CE2   1 
ATOM   6920  C  CE3   . TRP C  3  289 ? -44.766  42.057  350.201 1.00 50.13  ? 289 TRP 3 CE3   1 
ATOM   6921  C  CZ2   . TRP C  3  289 ? -42.552  41.204  351.723 1.00 58.79  ? 289 TRP 3 CZ2   1 
ATOM   6922  C  CZ3   . TRP C  3  289 ? -44.806  40.900  350.942 1.00 53.12  ? 289 TRP 3 CZ3   1 
ATOM   6923  C  CH2   . TRP C  3  289 ? -43.710  40.483  351.692 1.00 51.23  ? 289 TRP 3 CH2   1 
ATOM   6924  N  N     . ILE C  3  290 ? -46.551  45.447  346.843 1.00 70.09  ? 290 ILE 3 N     1 
ATOM   6925  C  CA    . ILE C  3  290 ? -47.271  46.504  346.144 1.00 80.52  ? 290 ILE 3 CA    1 
ATOM   6926  C  C     . ILE C  3  290 ? -48.022  47.329  347.182 1.00 83.29  ? 290 ILE 3 C     1 
ATOM   6927  O  O     . ILE C  3  290 ? -48.494  46.805  348.196 1.00 89.98  ? 290 ILE 3 O     1 
ATOM   6928  C  CB    . ILE C  3  290 ? -48.243  45.929  345.082 1.00 89.94  ? 290 ILE 3 CB    1 
ATOM   6929  C  CG1   . ILE C  3  290 ? -47.472  45.302  343.924 1.00 89.10  ? 290 ILE 3 CG1   1 
ATOM   6930  C  CG2   . ILE C  3  290 ? -49.155  46.995  344.526 1.00 95.27  ? 290 ILE 3 CG2   1 
ATOM   6931  C  CD1   . ILE C  3  290 ? -46.616  46.291  343.159 1.00 88.45  ? 290 ILE 3 CD1   1 
ATOM   6932  N  N     . CYS C  3  291 ? -48.129  48.630  346.939 1.00 71.26  ? 291 CYS 3 N     1 
ATOM   6933  C  CA    . CYS C  3  291 ? -48.940  49.461  347.814 1.00 64.44  ? 291 CYS 3 CA    1 
ATOM   6934  C  C     . CYS C  3  291 ? -50.403  49.375  347.398 1.00 59.72  ? 291 CYS 3 C     1 
ATOM   6935  O  O     . CYS C  3  291 ? -50.725  49.150  346.228 1.00 38.78  ? 291 CYS 3 O     1 
ATOM   6936  C  CB    . CYS C  3  291 ? -48.472  50.915  347.787 1.00 57.05  ? 291 CYS 3 CB    1 
ATOM   6937  S  SG    . CYS C  3  291 ? -49.181  51.881  346.455 1.00 61.27  ? 291 CYS 3 SG    1 
ATOM   6938  N  N     . ASP C  3  292 ? -51.289  49.517  348.387 1.00 60.22  ? 292 ASP 3 N     1 
ATOM   6939  C  CA    . ASP C  3  292 ? -52.721  49.375  348.141 1.00 50.62  ? 292 ASP 3 CA    1 
ATOM   6940  C  C     . ASP C  3  292 ? -53.191  50.318  347.043 1.00 52.76  ? 292 ASP 3 C     1 
ATOM   6941  O  O     . ASP C  3  292 ? -53.967  49.926  346.168 1.00 43.54  ? 292 ASP 3 O     1 
ATOM   6942  C  CB    . ASP C  3  292 ? -53.501  49.637  349.425 1.00 42.53  ? 292 ASP 3 CB    1 
ATOM   6943  C  CG    . ASP C  3  292 ? -53.307  48.550  350.444 1.00 39.90  ? 292 ASP 3 CG    1 
ATOM   6944  O  OD1   . ASP C  3  292 ? -52.855  47.454  350.057 1.00 42.09  ? 292 ASP 3 OD1   1 
ATOM   6945  O  OD2   . ASP C  3  292 ? -53.601  48.780  351.634 1.00 40.15  ? 292 ASP 3 OD2   1 
ATOM   6946  N  N     . ALA C  3  293 ? -52.745  51.573  347.084 1.00 63.55  ? 293 ALA 3 N     1 
ATOM   6947  C  CA    . ALA C  3  293 ? -53.125  52.521  346.044 1.00 59.99  ? 293 ALA 3 CA    1 
ATOM   6948  C  C     . ALA C  3  293 ? -52.578  52.107  344.685 1.00 51.71  ? 293 ALA 3 C     1 
ATOM   6949  O  O     . ALA C  3  293 ? -53.218  52.353  343.658 1.00 48.67  ? 293 ALA 3 O     1 
ATOM   6950  C  CB    . ALA C  3  293 ? -52.654  53.924  346.417 1.00 39.20  ? 293 ALA 3 CB    1 
ATOM   6951  N  N     . GLY C  3  294 ? -51.399  51.489  344.653 1.00 42.79  ? 294 GLY 3 N     1 
ATOM   6952  C  CA    . GLY C  3  294 ? -50.863  51.021  343.387 1.00 46.82  ? 294 GLY 3 CA    1 
ATOM   6953  C  C     . GLY C  3  294 ? -51.690  49.906  342.776 1.00 50.61  ? 294 GLY 3 C     1 
ATOM   6954  O  O     . GLY C  3  294 ? -51.891  49.866  341.561 1.00 61.20  ? 294 GLY 3 O     1 
ATOM   6955  N  N     . ARG C  3  295 ? -52.190  48.997  343.609 1.00 38.68  ? 295 ARG 3 N     1 
ATOM   6956  C  CA    . ARG C  3  295 ? -52.848  47.781  343.146 1.00 40.39  ? 295 ARG 3 CA    1 
ATOM   6957  C  C     . ARG C  3  295 ? -54.339  47.988  342.906 1.00 38.99  ? 295 ARG 3 C     1 
ATOM   6958  O  O     . ARG C  3  295 ? -54.899  47.422  341.961 1.00 38.97  ? 295 ARG 3 O     1 
ATOM   6959  C  CB    . ARG C  3  295 ? -52.630  46.653  344.162 1.00 40.91  ? 295 ARG 3 CB    1 
ATOM   6960  C  CG    . ARG C  3  295 ? -53.610  45.493  344.107 1.00 39.00  ? 295 ARG 3 CG    1 
ATOM   6961  C  CD    . ARG C  3  295 ? -53.511  44.681  345.386 1.00 39.16  ? 295 ARG 3 CD    1 
ATOM   6962  N  NE    . ARG C  3  295 ? -52.122  44.367  345.687 1.00 52.88  ? 295 ARG 3 NE    1 
ATOM   6963  C  CZ    . ARG C  3  295 ? -51.487  43.280  345.264 1.00 55.67  ? 295 ARG 3 CZ    1 
ATOM   6964  N  NH1   . ARG C  3  295 ? -52.113  42.378  344.519 1.00 49.62  ? 295 ARG 3 NH1   1 
ATOM   6965  N  NH2   . ARG C  3  295 ? -50.216  43.099  345.589 1.00 61.78  ? 295 ARG 3 NH2   1 
ATOM   6966  N  N     . PHE C  3  296 ? -54.989  48.805  343.735 1.00 39.23  ? 296 PHE 3 N     1 
ATOM   6967  C  CA    . PHE C  3  296 ? -56.431  49.007  343.689 1.00 57.41  ? 296 PHE 3 CA    1 
ATOM   6968  C  C     . PHE C  3  296 ? -56.844  50.242  342.898 1.00 39.51  ? 296 PHE 3 C     1 
ATOM   6969  O  O     . PHE C  3  296 ? -58.043  50.488  342.743 1.00 42.70  ? 296 PHE 3 O     1 
ATOM   6970  C  CB    . PHE C  3  296 ? -56.997  49.113  345.115 1.00 61.27  ? 296 PHE 3 CB    1 
ATOM   6971  C  CG    . PHE C  3  296 ? -56.686  47.923  345.993 1.00 64.63  ? 296 PHE 3 CG    1 
ATOM   6972  C  CD1   . PHE C  3  296 ? -57.063  46.646  345.620 1.00 59.69  ? 296 PHE 3 CD1   1 
ATOM   6973  C  CD2   . PHE C  3  296 ? -56.042  48.088  347.206 1.00 65.20  ? 296 PHE 3 CD2   1 
ATOM   6974  C  CE1   . PHE C  3  296 ? -56.779  45.562  346.430 1.00 52.52  ? 296 PHE 3 CE1   1 
ATOM   6975  C  CE2   . PHE C  3  296 ? -55.761  47.002  348.015 1.00 60.02  ? 296 PHE 3 CE2   1 
ATOM   6976  C  CZ    . PHE C  3  296 ? -56.131  45.743  347.624 1.00 55.68  ? 296 PHE 3 CZ    1 
ATOM   6977  N  N     . GLY C  3  297 ? -55.896  51.032  342.409 1.00 39.26  ? 297 GLY 3 N     1 
ATOM   6978  C  CA    . GLY C  3  297 ? -56.250  52.219  341.657 1.00 39.24  ? 297 GLY 3 CA    1 
ATOM   6979  C  C     . GLY C  3  297 ? -56.273  52.026  340.155 1.00 39.06  ? 297 GLY 3 C     1 
ATOM   6980  O  O     . GLY C  3  297 ? -55.678  52.818  339.421 1.00 38.86  ? 297 GLY 3 O     1 
ATOM   6981  N  N     . HIS C  3  298 ? -56.940  50.977  339.682 1.00 39.13  ? 298 HIS 3 N     1 
ATOM   6982  C  CA    . HIS C  3  298 ? -56.990  50.683  338.257 1.00 45.91  ? 298 HIS 3 CA    1 
ATOM   6983  C  C     . HIS C  3  298 ? -58.388  50.766  337.661 1.00 50.45  ? 298 HIS 3 C     1 
ATOM   6984  O  O     . HIS C  3  298 ? -58.528  50.589  336.446 1.00 51.20  ? 298 HIS 3 O     1 
ATOM   6985  C  CB    . HIS C  3  298 ? -56.412  49.289  337.976 1.00 46.65  ? 298 HIS 3 CB    1 
ATOM   6986  C  CG    . HIS C  3  298 ? -57.204  48.176  338.584 1.00 46.31  ? 298 HIS 3 CG    1 
ATOM   6987  N  ND1   . HIS C  3  298 ? -58.331  47.655  337.982 1.00 39.19  ? 298 HIS 3 ND1   1 
ATOM   6988  C  CD2   . HIS C  3  298 ? -57.040  47.490  339.739 1.00 42.32  ? 298 HIS 3 CD2   1 
ATOM   6989  C  CE1   . HIS C  3  298 ? -58.824  46.693  338.739 1.00 41.79  ? 298 HIS 3 CE1   1 
ATOM   6990  N  NE2   . HIS C  3  298 ? -58.060  46.573  339.810 1.00 39.35  ? 298 HIS 3 NE2   1 
ATOM   6991  N  N     . GLU C  3  299 ? -59.425  51.017  338.468 1.00 57.17  ? 299 GLU 3 N     1 
ATOM   6992  C  CA    . GLU C  3  299 ? -60.787  51.055  337.936 1.00 68.35  ? 299 GLU 3 CA    1 
ATOM   6993  C  C     . GLU C  3  299 ? -60.929  52.077  336.816 1.00 74.79  ? 299 GLU 3 C     1 
ATOM   6994  O  O     . GLU C  3  299 ? -61.801  51.930  335.951 1.00 80.78  ? 299 GLU 3 O     1 
ATOM   6995  C  CB    . GLU C  3  299 ? -61.799  51.324  339.053 1.00 73.89  ? 299 GLU 3 CB    1 
ATOM   6996  C  CG    . GLU C  3  299 ? -61.966  50.157  340.024 1.00 71.17  ? 299 GLU 3 CG    1 
ATOM   6997  C  CD    . GLU C  3  299 ? -63.055  49.182  339.599 1.00 56.69  ? 299 GLU 3 CD    1 
ATOM   6998  O  OE1   . GLU C  3  299 ? -63.066  48.768  338.423 1.00 53.97  ? 299 GLU 3 OE1   1 
ATOM   6999  O  OE2   . GLU C  3  299 ? -63.901  48.828  340.443 1.00 50.40  ? 299 GLU 3 OE2   1 
ATOM   7000  N  N     . TRP C  3  300 ? -60.099  53.117  336.820 1.00 73.58  ? 300 TRP 3 N     1 
ATOM   7001  C  CA    . TRP C  3  300 ? -60.180  54.156  335.803 1.00 72.25  ? 300 TRP 3 CA    1 
ATOM   7002  C  C     . TRP C  3  300 ? -59.527  53.723  334.496 1.00 81.36  ? 300 TRP 3 C     1 
ATOM   7003  O  O     . TRP C  3  300 ? -59.665  54.424  333.488 1.00 83.27  ? 300 TRP 3 O     1 
ATOM   7004  C  CB    . TRP C  3  300 ? -59.524  55.447  336.304 1.00 55.66  ? 300 TRP 3 CB    1 
ATOM   7005  C  CG    . TRP C  3  300 ? -58.108  55.265  336.766 1.00 46.48  ? 300 TRP 3 CG    1 
ATOM   7006  C  CD1   . TRP C  3  300 ? -57.692  54.815  337.982 1.00 51.10  ? 300 TRP 3 CD1   1 
ATOM   7007  C  CD2   . TRP C  3  300 ? -56.922  55.545  336.014 1.00 38.78  ? 300 TRP 3 CD2   1 
ATOM   7008  N  NE1   . TRP C  3  300 ? -56.318  54.785  338.030 1.00 52.27  ? 300 TRP 3 NE1   1 
ATOM   7009  C  CE2   . TRP C  3  300 ? -55.824  55.232  336.834 1.00 46.64  ? 300 TRP 3 CE2   1 
ATOM   7010  C  CE3   . TRP C  3  300 ? -56.684  56.023  334.726 1.00 38.61  ? 300 TRP 3 CE3   1 
ATOM   7011  C  CZ2   . TRP C  3  300 ? -54.508  55.385  336.408 1.00 48.16  ? 300 TRP 3 CZ2   1 
ATOM   7012  C  CZ3   . TRP C  3  300 ? -55.377  56.176  334.307 1.00 53.05  ? 300 TRP 3 CZ3   1 
ATOM   7013  C  CH2   . TRP C  3  300 ? -54.307  55.856  335.143 1.00 51.43  ? 300 TRP 3 CH2   1 
ATOM   7014  N  N     . ALA C  3  301 ? -58.803  52.598  334.497 1.00 84.91  ? 301 ALA 3 N     1 
ATOM   7015  C  CA    . ALA C  3  301 ? -58.133  52.126  333.290 1.00 83.83  ? 301 ALA 3 CA    1 
ATOM   7016  C  C     . ALA C  3  301 ? -59.087  51.411  332.340 1.00 82.98  ? 301 ALA 3 C     1 
ATOM   7017  O  O     . ALA C  3  301 ? -58.935  51.526  331.119 1.00 87.38  ? 301 ALA 3 O     1 
ATOM   7018  C  CB    . ALA C  3  301 ? -56.972  51.198  333.658 1.00 82.13  ? 301 ALA 3 CB    1 
ATOM   7019  N  N     . ASP C  3  302 ? -60.073  50.681  332.868 1.00 77.51  ? 302 ASP 3 N     1 
ATOM   7020  C  CA    . ASP C  3  302 ? -60.923  49.838  332.040 1.00 80.69  ? 302 ASP 3 CA    1 
ATOM   7021  C  C     . ASP C  3  302 ? -62.336  50.369  331.851 1.00 84.68  ? 302 ASP 3 C     1 
ATOM   7022  O  O     . ASP C  3  302 ? -63.055  49.860  330.984 1.00 93.49  ? 302 ASP 3 O     1 
ATOM   7023  C  CB    . ASP C  3  302 ? -61.012  48.430  332.649 1.00 83.50  ? 302 ASP 3 CB    1 
ATOM   7024  C  CG    . ASP C  3  302 ? -61.709  48.421  334.002 1.00 86.22  ? 302 ASP 3 CG    1 
ATOM   7025  O  OD1   . ASP C  3  302 ? -61.578  49.410  334.748 1.00 86.90  ? 302 ASP 3 OD1   1 
ATOM   7026  O  OD2   . ASP C  3  302 ? -62.386  47.422  334.324 1.00 86.82  ? 302 ASP 3 OD2   1 
ATOM   7027  N  N     . GLN C  3  303 ? -62.749  51.380  332.614 1.00 74.32  ? 303 GLN 3 N     1 
ATOM   7028  C  CA    . GLN C  3  303 ? -64.150  51.787  332.646 1.00 64.20  ? 303 GLN 3 CA    1 
ATOM   7029  C  C     . GLN C  3  303 ? -64.431  53.023  331.798 1.00 57.94  ? 303 GLN 3 C     1 
ATOM   7030  O  O     . GLN C  3  303 ? -65.222  52.966  330.853 1.00 66.84  ? 303 GLN 3 O     1 
ATOM   7031  C  CB    . GLN C  3  303 ? -64.606  52.028  334.091 1.00 64.56  ? 303 GLN 3 CB    1 
ATOM   7032  C  CG    . GLN C  3  303 ? -66.120  52.047  334.245 1.00 67.99  ? 303 GLN 3 CG    1 
ATOM   7033  C  CD    . GLN C  3  303 ? -66.781  50.793  333.706 1.00 59.61  ? 303 GLN 3 CD    1 
ATOM   7034  O  OE1   . GLN C  3  303 ? -66.755  49.744  334.344 1.00 58.50  ? 303 GLN 3 OE1   1 
ATOM   7035  N  NE2   . GLN C  3  303 ? -67.379  50.898  332.524 1.00 40.79  ? 303 GLN 3 NE2   1 
ATOM   7036  N  N     . ASN C  3  304 ? -63.783  54.142  332.109 1.00 48.18  ? 304 ASN 3 N     1 
ATOM   7037  C  CA    . ASN C  3  304 ? -64.102  55.415  331.475 1.00 52.57  ? 304 ASN 3 CA    1 
ATOM   7038  C  C     . ASN C  3  304 ? -62.816  56.141  331.126 1.00 56.67  ? 304 ASN 3 C     1 
ATOM   7039  O  O     . ASN C  3  304 ? -62.031  56.485  332.012 1.00 56.46  ? 304 ASN 3 O     1 
ATOM   7040  C  CB    . ASN C  3  304 ? -64.974  56.284  332.386 1.00 55.23  ? 304 ASN 3 CB    1 
ATOM   7041  C  CG    . ASN C  3  304 ? -66.372  56.490  331.837 1.00 46.02  ? 304 ASN 3 CG    1 
ATOM   7042  O  OD1   . ASN C  3  304 ? -66.579  56.525  330.624 1.00 40.58  ? 304 ASN 3 OD1   1 
ATOM   7043  N  ND2   . ASN C  3  304 ? -67.340  56.629  332.731 1.00 40.89  ? 304 ASN 3 ND2   1 
ATOM   7044  N  N     . ARG C  3  305 ? -62.607  56.357  329.833 1.00 60.85  ? 305 ARG 3 N     1 
ATOM   7045  C  CA    . ARG C  3  305 ? -61.442  57.064  329.326 1.00 64.48  ? 305 ARG 3 CA    1 
ATOM   7046  C  C     . ARG C  3  305 ? -61.788  57.559  327.931 1.00 53.71  ? 305 ARG 3 C     1 
ATOM   7047  O  O     . ARG C  3  305 ? -62.793  57.156  327.342 1.00 51.75  ? 305 ARG 3 O     1 
ATOM   7048  C  CB    . ARG C  3  305 ? -60.201  56.165  329.312 1.00 73.76  ? 305 ARG 3 CB    1 
ATOM   7049  C  CG    . ARG C  3  305 ? -60.361  54.926  328.451 1.00 76.89  ? 305 ARG 3 CG    1 
ATOM   7050  C  CD    . ARG C  3  305 ? -59.175  53.995  328.588 1.00 75.76  ? 305 ARG 3 CD    1 
ATOM   7051  N  NE    . ARG C  3  305 ? -57.935  54.650  328.191 1.00 76.33  ? 305 ARG 3 NE    1 
ATOM   7052  C  CZ    . ARG C  3  305 ? -56.749  54.053  328.180 1.00 80.93  ? 305 ARG 3 CZ    1 
ATOM   7053  N  NH1   . ARG C  3  305 ? -56.639  52.785  328.544 1.00 78.06  ? 305 ARG 3 NH1   1 
ATOM   7054  N  NH2   . ARG C  3  305 ? -55.674  54.722  327.804 1.00 90.61  ? 305 ARG 3 NH2   1 
ATOM   7055  N  N     . LEU C  3  306 ? -60.959  58.455  327.413 1.00 49.85  ? 306 LEU 3 N     1 
ATOM   7056  C  CA    . LEU C  3  306 ? -61.253  59.088  326.137 1.00 55.29  ? 306 LEU 3 CA    1 
ATOM   7057  C  C     . LEU C  3  306 ? -60.695  58.216  325.023 1.00 60.96  ? 306 LEU 3 C     1 
ATOM   7058  O  O     . LEU C  3  306 ? -59.537  57.794  325.077 1.00 64.13  ? 306 LEU 3 O     1 
ATOM   7059  C  CB    . LEU C  3  306 ? -60.657  60.496  326.074 1.00 58.78  ? 306 LEU 3 CB    1 
ATOM   7060  C  CG    . LEU C  3  306 ? -60.729  61.200  324.726 1.00 59.67  ? 306 LEU 3 CG    1 
ATOM   7061  C  CD1   . LEU C  3  306 ? -62.180  61.511  324.447 1.00 67.29  ? 306 LEU 3 CD1   1 
ATOM   7062  C  CD2   . LEU C  3  306 ? -59.892  62.467  324.726 1.00 51.77  ? 306 LEU 3 CD2   1 
ATOM   7063  N  N     . LYS C  3  307 ? -61.523  57.948  324.019 1.00 64.65  ? 307 LYS 3 N     1 
ATOM   7064  C  CA    . LYS C  3  307 ? -61.151  57.071  322.924 1.00 69.67  ? 307 LYS 3 CA    1 
ATOM   7065  C  C     . LYS C  3  307 ? -61.098  57.778  321.581 1.00 70.43  ? 307 LYS 3 C     1 
ATOM   7066  O  O     . LYS C  3  307 ? -60.554  57.210  320.627 1.00 70.28  ? 307 LYS 3 O     1 
ATOM   7067  C  CB    . LYS C  3  307 ? -62.125  55.884  322.829 1.00 73.09  ? 307 LYS 3 CB    1 
ATOM   7068  C  CG    . LYS C  3  307 ? -62.063  54.931  324.012 1.00 75.60  ? 307 LYS 3 CG    1 
ATOM   7069  C  CD    . LYS C  3  307 ? -63.115  53.840  323.900 1.00 83.98  ? 307 LYS 3 CD    1 
ATOM   7070  C  CE    . LYS C  3  307 ? -63.204  53.294  322.489 1.00 96.15  ? 307 LYS 3 CE    1 
ATOM   7071  N  NZ    . LYS C  3  307 ? -64.383  52.403  322.316 1.00 106.06 ? 307 LYS 3 NZ    1 
ATOM   7072  N  N     . THR C  3  308 ? -61.638  58.992  321.475 1.00 69.60  ? 308 THR 3 N     1 
ATOM   7073  C  CA    . THR C  3  308 ? -61.682  59.708  320.216 1.00 67.48  ? 308 THR 3 CA    1 
ATOM   7074  C  C     . THR C  3  308 ? -61.365  61.177  320.456 1.00 59.57  ? 308 THR 3 C     1 
ATOM   7075  O  O     . THR C  3  308 ? -61.850  61.769  321.429 1.00 38.91  ? 308 THR 3 O     1 
ATOM   7076  C  CB    . THR C  3  308 ? -63.059  59.590  319.548 1.00 70.78  ? 308 THR 3 CB    1 
ATOM   7077  O  OG1   . THR C  3  308 ? -64.071  60.034  320.460 1.00 75.07  ? 308 THR 3 OG1   1 
ATOM   7078  C  CG2   . THR C  3  308 ? -63.346  58.153  319.135 1.00 67.12  ? 308 THR 3 CG2   1 
ATOM   7079  N  N     . PRO C  3  309 ? -60.576  61.793  319.582 1.00 56.21  ? 309 PRO 3 N     1 
ATOM   7080  C  CA    . PRO C  3  309 ? -60.290  63.222  319.740 1.00 58.11  ? 309 PRO 3 CA    1 
ATOM   7081  C  C     . PRO C  3  309 ? -61.542  64.061  319.533 1.00 64.45  ? 309 PRO 3 C     1 
ATOM   7082  O  O     . PRO C  3  309 ? -62.397  63.741  318.705 1.00 66.23  ? 309 PRO 3 O     1 
ATOM   7083  C  CB    . PRO C  3  309 ? -59.237  63.498  318.660 1.00 48.45  ? 309 PRO 3 CB    1 
ATOM   7084  C  CG    . PRO C  3  309 ? -59.392  62.385  317.676 1.00 38.96  ? 309 PRO 3 CG    1 
ATOM   7085  C  CD    . PRO C  3  309 ? -59.837  61.195  318.459 1.00 38.33  ? 309 PRO 3 CD    1 
ATOM   7086  N  N     . LEU C  3  310 ? -61.651  65.130  320.313 1.00 76.36  ? 310 LEU 3 N     1 
ATOM   7087  C  CA    . LEU C  3  310 ? -62.748  66.077  320.201 1.00 80.67  ? 310 LEU 3 CA    1 
ATOM   7088  C  C     . LEU C  3  310 ? -62.206  67.400  319.678 1.00 78.35  ? 310 LEU 3 C     1 
ATOM   7089  O  O     . LEU C  3  310 ? -61.042  67.742  319.891 1.00 74.67  ? 310 LEU 3 O     1 
ATOM   7090  C  CB    . LEU C  3  310 ? -63.463  66.296  321.541 1.00 89.52  ? 310 LEU 3 CB    1 
ATOM   7091  C  CG    . LEU C  3  310 ? -64.066  65.081  322.253 1.00 91.10  ? 310 LEU 3 CG    1 
ATOM   7092  C  CD1   . LEU C  3  310 ? -64.692  65.493  323.577 1.00 91.35  ? 310 LEU 3 CD1   1 
ATOM   7093  C  CD2   . LEU C  3  310 ? -65.102  64.409  321.367 1.00 89.85  ? 310 LEU 3 CD2   1 
ATOM   7094  N  N     . VAL C  3  311 ? -63.064  68.127  318.972 1.00 82.59  ? 311 VAL 3 N     1 
ATOM   7095  C  CA    . VAL C  3  311 ? -62.707  69.413  318.391 1.00 91.29  ? 311 VAL 3 CA    1 
ATOM   7096  C  C     . VAL C  3  311 ? -63.805  70.417  318.703 1.00 91.27  ? 311 VAL 3 C     1 
ATOM   7097  O  O     . VAL C  3  311 ? -64.987  70.071  318.801 1.00 92.87  ? 311 VAL 3 O     1 
ATOM   7098  C  CB    . VAL C  3  311 ? -62.470  69.308  316.861 1.00 96.97  ? 311 VAL 3 CB    1 
ATOM   7099  C  CG1   . VAL C  3  311 ? -63.765  68.989  316.124 1.00 102.01 ? 311 VAL 3 CG1   1 
ATOM   7100  C  CG2   . VAL C  3  311 ? -61.842  70.587  316.318 1.00 95.49  ? 311 VAL 3 CG2   1 
ATOM   7101  N  N     . ARG C  3  312 ? -63.399  71.666  318.901 1.00 90.03  ? 312 ARG 3 N     1 
ATOM   7102  C  CA    . ARG C  3  312 ? -64.332  72.763  319.116 1.00 95.85  ? 312 ARG 3 CA    1 
ATOM   7103  C  C     . ARG C  3  312 ? -64.688  73.347  317.757 1.00 95.70  ? 312 ARG 3 C     1 
ATOM   7104  O  O     . ARG C  3  312 ? -63.844  73.971  317.105 1.00 92.63  ? 312 ARG 3 O     1 
ATOM   7105  C  CB    . ARG C  3  312 ? -63.731  73.824  320.031 1.00 106.31 ? 312 ARG 3 CB    1 
ATOM   7106  C  CG    . ARG C  3  312 ? -64.661  75.000  320.283 1.00 116.72 ? 312 ARG 3 CG    1 
ATOM   7107  C  CD    . ARG C  3  312 ? -64.317  75.728  321.573 1.00 119.62 ? 312 ARG 3 CD    1 
ATOM   7108  N  NE    . ARG C  3  312 ? -64.465  74.871  322.744 1.00 117.92 ? 312 ARG 3 NE    1 
ATOM   7109  C  CZ    . ARG C  3  312 ? -64.449  75.314  323.996 1.00 112.46 ? 312 ARG 3 CZ    1 
ATOM   7110  N  NH1   . ARG C  3  312 ? -64.287  76.606  324.240 1.00 109.66 ? 312 ARG 3 NH1   1 
ATOM   7111  N  NH2   . ARG C  3  312 ? -64.592  74.465  325.004 1.00 111.12 ? 312 ARG 3 NH2   1 
ATOM   7112  N  N     . LYS C  3  313 ? -65.931  73.141  317.323 1.00 100.80 ? 313 LYS 3 N     1 
ATOM   7113  C  CA    . LYS C  3  313 ? -66.379  73.656  316.038 1.00 103.62 ? 313 LYS 3 CA    1 
ATOM   7114  C  C     . LYS C  3  313 ? -67.430  74.745  316.202 1.00 114.86 ? 313 LYS 3 C     1 
ATOM   7115  O  O     . LYS C  3  313 ? -67.197  75.889  315.803 1.00 114.87 ? 313 LYS 3 O     1 
ATOM   7116  C  CB    . LYS C  3  313 ? -66.935  72.501  315.188 1.00 93.87  ? 313 LYS 3 CB    1 
ATOM   7117  C  CG    . LYS C  3  313 ? -66.819  72.698  313.684 1.00 85.70  ? 313 LYS 3 CG    1 
ATOM   7118  C  CD    . LYS C  3  313 ? -65.404  72.406  313.203 1.00 76.40  ? 313 LYS 3 CD    1 
ATOM   7119  C  CE    . LYS C  3  313 ? -65.386  71.940  311.758 1.00 62.71  ? 313 LYS 3 CE    1 
ATOM   7120  N  NZ    . LYS C  3  313 ? -64.406  70.847  311.548 1.00 49.71  ? 313 LYS 3 NZ    1 
ATOM   7121  N  N     . GLU C  3  314 ? -68.584  74.427  316.783 1.00 125.65 ? 314 GLU 3 N     1 
ATOM   7122  C  CA    . GLU C  3  314 ? -69.567  75.434  317.166 1.00 135.09 ? 314 GLU 3 CA    1 
ATOM   7123  C  C     . GLU C  3  314 ? -69.558  75.603  318.683 1.00 126.93 ? 314 GLU 3 C     1 
ATOM   7124  O  O     . GLU C  3  314 ? -70.500  75.209  319.376 1.00 125.14 ? 314 GLU 3 O     1 
ATOM   7125  C  CB    . GLU C  3  314 ? -70.958  75.039  316.653 1.00 149.38 ? 314 GLU 3 CB    1 
ATOM   7126  C  CG    . GLU C  3  314 ? -70.977  74.596  315.202 1.00 159.96 ? 314 GLU 3 CG    1 
ATOM   7127  C  CD    . GLU C  3  314 ? -70.923  75.762  314.241 1.00 166.63 ? 314 GLU 3 CD    1 
ATOM   7128  O  OE1   . GLU C  3  314 ? -71.796  76.649  314.333 1.00 173.41 ? 314 GLU 3 OE1   1 
ATOM   7129  O  OE2   . GLU C  3  314 ? -70.005  75.792  313.393 1.00 171.18 ? 314 GLU 3 OE2   1 
ATOM   7130  N  N     . GLY C  3  315 ? -68.498  76.227  319.197 1.00 119.90 ? 315 GLY 3 N     1 
ATOM   7131  C  CA    . GLY C  3  315 ? -68.390  76.472  320.627 1.00 113.57 ? 315 GLY 3 CA    1 
ATOM   7132  C  C     . GLY C  3  315 ? -68.657  75.260  321.501 1.00 108.34 ? 315 GLY 3 C     1 
ATOM   7133  O  O     . GLY C  3  315 ? -68.973  75.402  322.686 1.00 110.12 ? 315 GLY 3 O     1 
ATOM   7134  N  N     . ARG C  3  316 ? -68.545  74.065  320.925 1.00 105.23 ? 316 ARG 3 N     1 
ATOM   7135  C  CA    . ARG C  3  316 ? -68.907  72.824  321.594 1.00 107.22 ? 316 ARG 3 CA    1 
ATOM   7136  C  C     . ARG C  3  316 ? -67.942  71.723  321.178 1.00 112.49 ? 316 ARG 3 C     1 
ATOM   7137  O  O     . ARG C  3  316 ? -67.019  71.940  320.391 1.00 114.48 ? 316 ARG 3 O     1 
ATOM   7138  C  CB    . ARG C  3  316 ? -70.343  72.418  321.249 1.00 104.06 ? 316 ARG 3 CB    1 
ATOM   7139  C  CG    . ARG C  3  316 ? -70.516  72.054  319.782 1.00 95.52  ? 316 ARG 3 CG    1 
ATOM   7140  C  CD    . ARG C  3  316 ? -71.673  71.104  319.566 1.00 87.01  ? 316 ARG 3 CD    1 
ATOM   7141  N  NE    . ARG C  3  316 ? -71.671  70.547  318.217 1.00 86.79  ? 316 ARG 3 NE    1 
ATOM   7142  C  CZ    . ARG C  3  316 ? -72.164  69.355  317.900 1.00 93.88  ? 316 ARG 3 CZ    1 
ATOM   7143  N  NH1   . ARG C  3  316 ? -72.706  68.589  318.834 1.00 97.46  ? 316 ARG 3 NH1   1 
ATOM   7144  N  NH2   . ARG C  3  316 ? -72.121  68.931  316.644 1.00 96.75  ? 316 ARG 3 NH2   1 
ATOM   7145  N  N     . LEU C  3  317 ? -68.177  70.524  321.698 1.00 113.98 ? 317 LEU 3 N     1 
ATOM   7146  C  CA    . LEU C  3  317 ? -67.293  69.393  321.478 1.00 113.50 ? 317 LEU 3 CA    1 
ATOM   7147  C  C     . LEU C  3  317 ? -67.838  68.531  320.348 1.00 111.26 ? 317 LEU 3 C     1 
ATOM   7148  O  O     . LEU C  3  317 ? -69.047  68.302  320.255 1.00 116.01 ? 317 LEU 3 O     1 
ATOM   7149  C  CB    . LEU C  3  317 ? -67.157  68.553  322.750 1.00 115.93 ? 317 LEU 3 CB    1 
ATOM   7150  C  CG    . LEU C  3  317 ? -66.574  69.193  324.016 1.00 116.90 ? 317 LEU 3 CG    1 
ATOM   7151  C  CD1   . LEU C  3  317 ? -65.306  69.985  323.706 1.00 116.28 ? 317 LEU 3 CD1   1 
ATOM   7152  C  CD2   . LEU C  3  317 ? -67.598  70.048  324.763 1.00 117.66 ? 317 LEU 3 CD2   1 
ATOM   7153  N  N     . VAL C  3  318 ? -66.941  68.064  319.482 1.00 105.30 ? 318 VAL 3 N     1 
ATOM   7154  C  CA    . VAL C  3  318 ? -67.302  67.242  318.335 1.00 104.99 ? 318 VAL 3 CA    1 
ATOM   7155  C  C     . VAL C  3  318 ? -66.361  66.049  318.297 1.00 99.87  ? 318 VAL 3 C     1 
ATOM   7156  O  O     . VAL C  3  318 ? -65.140  66.219  318.348 1.00 96.94  ? 318 VAL 3 O     1 
ATOM   7157  C  CB    . VAL C  3  318 ? -67.224  68.032  317.013 1.00 108.28 ? 318 VAL 3 CB    1 
ATOM   7158  C  CG1   . VAL C  3  318 ? -67.516  67.124  315.824 1.00 108.01 ? 318 VAL 3 CG1   1 
ATOM   7159  C  CG2   . VAL C  3  318 ? -68.180  69.221  317.036 1.00 111.09 ? 318 VAL 3 CG2   1 
ATOM   7160  N  N     . GLU C  3  319 ? -66.926  64.851  318.196 1.00 97.32  ? 319 GLU 3 N     1 
ATOM   7161  C  CA    . GLU C  3  319 ? -66.129  63.653  317.982 1.00 91.08  ? 319 GLU 3 CA    1 
ATOM   7162  C  C     . GLU C  3  319 ? -65.595  63.694  316.557 1.00 78.28  ? 319 GLU 3 C     1 
ATOM   7163  O  O     . GLU C  3  319 ? -66.379  63.746  315.604 1.00 80.65  ? 319 GLU 3 O     1 
ATOM   7164  C  CB    . GLU C  3  319 ? -66.998  62.419  318.212 1.00 100.11 ? 319 GLU 3 CB    1 
ATOM   7165  C  CG    . GLU C  3  319 ? -67.608  62.363  319.614 1.00 104.32 ? 319 GLU 3 CG    1 
ATOM   7166  C  CD    . GLU C  3  319 ? -68.960  61.667  319.649 1.00 105.00 ? 319 GLU 3 CD    1 
ATOM   7167  O  OE1   . GLU C  3  319 ? -69.676  61.709  318.629 1.00 105.48 ? 319 GLU 3 OE1   1 
ATOM   7168  O  OE2   . GLU C  3  319 ? -69.317  61.101  320.704 1.00 103.50 ? 319 GLU 3 OE2   1 
ATOM   7169  N  N     . ALA C  3  320 ? -64.273  63.671  316.394 1.00 66.25  ? 320 ALA 3 N     1 
ATOM   7170  C  CA    . ALA C  3  320 ? -63.709  63.957  315.083 1.00 64.71  ? 320 ALA 3 CA    1 
ATOM   7171  C  C     . ALA C  3  320 ? -62.543  63.040  314.750 1.00 59.67  ? 320 ALA 3 C     1 
ATOM   7172  O  O     . ALA C  3  320 ? -61.821  62.567  315.630 1.00 46.91  ? 320 ALA 3 O     1 
ATOM   7173  C  CB    . ALA C  3  320 ? -63.236  65.412  314.997 1.00 62.79  ? 320 ALA 3 CB    1 
ATOM   7174  N  N     . THR C  3  321 ? -62.383  62.802  313.452 1.00 62.67  ? 321 THR 3 N     1 
ATOM   7175  C  CA    . THR C  3  321 ? -61.276  62.047  312.893 1.00 72.67  ? 321 THR 3 CA    1 
ATOM   7176  C  C     . THR C  3  321 ? -59.962  62.795  313.091 1.00 80.40  ? 321 THR 3 C     1 
ATOM   7177  O  O     . THR C  3  321 ? -59.931  64.018  313.251 1.00 85.61  ? 321 THR 3 O     1 
ATOM   7178  C  CB    . THR C  3  321 ? -61.502  61.790  311.401 1.00 82.12  ? 321 THR 3 CB    1 
ATOM   7179  O  OG1   . THR C  3  321 ? -62.898  61.583  311.161 1.00 87.94  ? 321 THR 3 OG1   1 
ATOM   7180  C  CG2   . THR C  3  321 ? -60.731  60.559  310.938 1.00 86.42  ? 321 THR 3 CG2   1 
ATOM   7181  N  N     . TRP C  3  322 ? -58.866  62.035  313.092 1.00 84.43  ? 322 TRP 3 N     1 
ATOM   7182  C  CA    . TRP C  3  322 ? -57.542  62.637  313.196 1.00 89.92  ? 322 TRP 3 CA    1 
ATOM   7183  C  C     . TRP C  3  322 ? -57.274  63.584  312.037 1.00 87.43  ? 322 TRP 3 C     1 
ATOM   7184  O  O     . TRP C  3  322 ? -56.519  64.553  312.185 1.00 82.16  ? 322 TRP 3 O     1 
ATOM   7185  C  CB    . TRP C  3  322 ? -56.472  61.544  313.220 1.00 99.56  ? 322 TRP 3 CB    1 
ATOM   7186  C  CG    . TRP C  3  322 ? -56.359  60.836  314.519 1.00 107.51 ? 322 TRP 3 CG    1 
ATOM   7187  C  CD1   . TRP C  3  322 ? -57.126  59.798  314.950 1.00 110.35 ? 322 TRP 3 CD1   1 
ATOM   7188  C  CD2   . TRP C  3  322 ? -55.423  61.106  315.566 1.00 113.31 ? 322 TRP 3 CD2   1 
ATOM   7189  N  NE1   . TRP C  3  322 ? -56.727  59.402  316.201 1.00 114.30 ? 322 TRP 3 NE1   1 
ATOM   7190  C  CE2   . TRP C  3  322 ? -55.683  60.191  316.602 1.00 116.84 ? 322 TRP 3 CE2   1 
ATOM   7191  C  CE3   . TRP C  3  322 ? -54.391  62.034  315.731 1.00 115.23 ? 322 TRP 3 CE3   1 
ATOM   7192  C  CZ2   . TRP C  3  322 ? -54.950  60.176  317.784 1.00 120.00 ? 322 TRP 3 CZ2   1 
ATOM   7193  C  CZ3   . TRP C  3  322 ? -53.666  62.016  316.905 1.00 116.33 ? 322 TRP 3 CZ3   1 
ATOM   7194  C  CH2   . TRP C  3  322 ? -53.947  61.095  317.916 1.00 118.59 ? 322 TRP 3 CH2   1 
ATOM   7195  N  N     . GLU C  3  323 ? -57.886  63.317  310.883 1.00 94.13  ? 323 GLU 3 N     1 
ATOM   7196  C  CA    . GLU C  3  323 ? -57.679  64.141  309.698 1.00 104.53 ? 323 GLU 3 CA    1 
ATOM   7197  C  C     . GLU C  3  323 ? -58.058  65.591  309.962 1.00 112.96 ? 323 GLU 3 C     1 
ATOM   7198  O  O     . GLU C  3  323 ? -57.259  66.508  309.738 1.00 116.34 ? 323 GLU 3 O     1 
ATOM   7199  C  CB    . GLU C  3  323 ? -58.512  63.582  308.544 1.00 109.76 ? 323 GLU 3 CB    1 
ATOM   7200  C  CG    . GLU C  3  323 ? -58.251  62.121  308.215 1.00 115.28 ? 323 GLU 3 CG    1 
ATOM   7201  C  CD    . GLU C  3  323 ? -58.624  61.782  306.787 1.00 118.68 ? 323 GLU 3 CD    1 
ATOM   7202  O  OE1   . GLU C  3  323 ? -59.710  62.214  306.347 1.00 121.93 ? 323 GLU 3 OE1   1 
ATOM   7203  O  OE2   . GLU C  3  323 ? -57.848  61.080  306.109 1.00 116.84 ? 323 GLU 3 OE2   1 
ATOM   7204  N  N     . GLU C  3  324 ? -59.272  65.813  310.469 1.00 116.58 ? 324 GLU 3 N     1 
ATOM   7205  C  CA    . GLU C  3  324 ? -59.753  67.172  310.683 1.00 114.90 ? 324 GLU 3 CA    1 
ATOM   7206  C  C     . GLU C  3  324 ? -59.011  67.852  311.822 1.00 101.86 ? 324 GLU 3 C     1 
ATOM   7207  O  O     . GLU C  3  324 ? -58.750  69.058  311.759 1.00 100.97 ? 324 GLU 3 O     1 
ATOM   7208  C  CB    . GLU C  3  324 ? -61.256  67.137  310.968 1.00 126.35 ? 324 GLU 3 CB    1 
ATOM   7209  C  CG    . GLU C  3  324 ? -62.104  66.775  309.757 1.00 135.74 ? 324 GLU 3 CG    1 
ATOM   7210  C  CD    . GLU C  3  324 ? -63.569  66.595  310.100 1.00 141.07 ? 324 GLU 3 CD    1 
ATOM   7211  O  OE1   . GLU C  3  324 ? -64.071  67.315  310.987 1.00 142.61 ? 324 GLU 3 OE1   1 
ATOM   7212  O  OE2   . GLU C  3  324 ? -64.215  65.720  309.487 1.00 142.59 ? 324 GLU 3 OE2   1 
ATOM   7213  N  N     . ALA C  3  325 ? -58.623  67.086  312.843 1.00 94.01  ? 325 ALA 3 N     1 
ATOM   7214  C  CA    . ALA C  3  325 ? -57.860  67.653  313.947 1.00 88.96  ? 325 ALA 3 CA    1 
ATOM   7215  C  C     . ALA C  3  325 ? -56.502  68.153  313.474 1.00 87.68  ? 325 ALA 3 C     1 
ATOM   7216  O  O     . ALA C  3  325 ? -56.119  69.294  313.748 1.00 90.07  ? 325 ALA 3 O     1 
ATOM   7217  C  CB    . ALA C  3  325 ? -57.695  66.614  315.057 1.00 85.73  ? 325 ALA 3 CB    1 
ATOM   7218  N  N     . PHE C  3  326 ? -55.767  67.318  312.734 1.00 81.04  ? 326 PHE 3 N     1 
ATOM   7219  C  CA    . PHE C  3  326 ? -54.454  67.729  312.244 1.00 72.84  ? 326 PHE 3 CA    1 
ATOM   7220  C  C     . PHE C  3  326 ? -54.558  68.830  311.188 1.00 71.60  ? 326 PHE 3 C     1 
ATOM   7221  O  O     . PHE C  3  326 ? -53.667  69.681  311.096 1.00 64.29  ? 326 PHE 3 O     1 
ATOM   7222  C  CB    . PHE C  3  326 ? -53.696  66.509  311.707 1.00 63.35  ? 326 PHE 3 CB    1 
ATOM   7223  C  CG    . PHE C  3  326 ? -52.323  66.824  311.165 1.00 56.03  ? 326 PHE 3 CG    1 
ATOM   7224  C  CD1   . PHE C  3  326 ? -51.454  67.634  311.868 1.00 54.69  ? 326 PHE 3 CD1   1 
ATOM   7225  C  CD2   . PHE C  3  326 ? -51.896  66.290  309.963 1.00 54.67  ? 326 PHE 3 CD2   1 
ATOM   7226  C  CE1   . PHE C  3  326 ? -50.194  67.921  311.373 1.00 54.27  ? 326 PHE 3 CE1   1 
ATOM   7227  C  CE2   . PHE C  3  326 ? -50.634  66.578  309.468 1.00 55.83  ? 326 PHE 3 CE2   1 
ATOM   7228  C  CZ    . PHE C  3  326 ? -49.788  67.392  310.175 1.00 41.95  ? 326 PHE 3 CZ    1 
ATOM   7229  N  N     . LEU C  3  327 ? -55.642  68.856  310.407 1.00 79.84  ? 327 LEU 3 N     1 
ATOM   7230  C  CA    . LEU C  3  327 ? -55.829  69.932  309.436 1.00 92.90  ? 327 LEU 3 CA    1 
ATOM   7231  C  C     . LEU C  3  327 ? -56.065  71.271  310.128 1.00 107.54 ? 327 LEU 3 C     1 
ATOM   7232  O  O     . LEU C  3  327 ? -55.397  72.272  309.821 1.00 115.17 ? 327 LEU 3 O     1 
ATOM   7233  C  CB    . LEU C  3  327 ? -56.992  69.599  308.501 1.00 94.38  ? 327 LEU 3 CB    1 
ATOM   7234  C  CG    . LEU C  3  327 ? -56.616  68.940  307.174 1.00 97.85  ? 327 LEU 3 CG    1 
ATOM   7235  C  CD1   . LEU C  3  327 ? -57.772  69.030  306.189 1.00 98.76  ? 327 LEU 3 CD1   1 
ATOM   7236  C  CD2   . LEU C  3  327 ? -55.358  69.578  306.598 1.00 99.78  ? 327 LEU 3 CD2   1 
ATOM   7237  N  N     . ALA C  3  328 ? -57.042  71.318  311.038 1.00 110.71 ? 328 ALA 3 N     1 
ATOM   7238  C  CA    . ALA C  3  328 ? -57.261  72.525  311.827 1.00 111.38 ? 328 ALA 3 CA    1 
ATOM   7239  C  C     . ALA C  3  328 ? -56.011  72.908  312.602 1.00 108.87 ? 328 ALA 3 C     1 
ATOM   7240  O  O     . ALA C  3  328 ? -55.754  74.095  312.822 1.00 113.32 ? 328 ALA 3 O     1 
ATOM   7241  C  CB    . ALA C  3  328 ? -58.444  72.324  312.775 1.00 111.67 ? 328 ALA 3 CB    1 
ATOM   7242  N  N     . LEU C  3  329 ? -55.217  71.915  313.005 1.00 98.99  ? 329 LEU 3 N     1 
ATOM   7243  C  CA    . LEU C  3  329 ? -53.964  72.177  313.701 1.00 92.01  ? 329 LEU 3 CA    1 
ATOM   7244  C  C     . LEU C  3  329 ? -52.983  72.921  312.802 1.00 95.24  ? 329 LEU 3 C     1 
ATOM   7245  O  O     . LEU C  3  329 ? -52.426  73.955  313.189 1.00 98.39  ? 329 LEU 3 O     1 
ATOM   7246  C  CB    . LEU C  3  329 ? -53.380  70.845  314.168 1.00 83.99  ? 329 LEU 3 CB    1 
ATOM   7247  C  CG    . LEU C  3  329 ? -52.657  70.784  315.503 1.00 80.42  ? 329 LEU 3 CG    1 
ATOM   7248  C  CD1   . LEU C  3  329 ? -53.685  70.802  316.606 1.00 79.93  ? 329 LEU 3 CD1   1 
ATOM   7249  C  CD2   . LEU C  3  329 ? -51.821  69.520  315.569 1.00 76.80  ? 329 LEU 3 CD2   1 
ATOM   7250  N  N     . LYS C  3  330 ? -52.753  72.393  311.597 1.00 94.01  ? 330 LYS 3 N     1 
ATOM   7251  C  CA    . LYS C  3  330 ? -51.906  73.079  310.627 1.00 94.85  ? 330 LYS 3 CA    1 
ATOM   7252  C  C     . LYS C  3  330 ? -52.378  74.505  310.387 1.00 95.93  ? 330 LYS 3 C     1 
ATOM   7253  O  O     . LYS C  3  330 ? -51.573  75.441  310.370 1.00 98.63  ? 330 LYS 3 O     1 
ATOM   7254  C  CB    . LYS C  3  330 ? -51.871  72.318  309.301 1.00 95.61  ? 330 LYS 3 CB    1 
ATOM   7255  C  CG    . LYS C  3  330 ? -50.896  71.162  309.238 1.00 90.79  ? 330 LYS 3 CG    1 
ATOM   7256  C  CD    . LYS C  3  330 ? -50.814  70.631  307.813 1.00 80.03  ? 330 LYS 3 CD    1 
ATOM   7257  C  CE    . LYS C  3  330 ? -49.608  69.737  307.623 1.00 70.88  ? 330 LYS 3 CE    1 
ATOM   7258  N  NZ    . LYS C  3  330 ? -49.894  68.614  306.699 1.00 71.11  ? 330 LYS 3 NZ    1 
ATOM   7259  N  N     . GLU C  3  331 ? -53.683  74.691  310.183 1.00 91.94  ? 331 GLU 3 N     1 
ATOM   7260  C  CA    . GLU C  3  331 ? -54.164  76.028  309.843 1.00 86.76  ? 331 GLU 3 CA    1 
ATOM   7261  C  C     . GLU C  3  331 ? -54.021  76.990  311.018 1.00 89.37  ? 331 GLU 3 C     1 
ATOM   7262  O  O     . GLU C  3  331 ? -53.557  78.123  310.849 1.00 91.73  ? 331 GLU 3 O     1 
ATOM   7263  C  CB    . GLU C  3  331 ? -55.611  75.979  309.354 1.00 79.18  ? 331 GLU 3 CB    1 
ATOM   7264  C  CG    . GLU C  3  331 ? -56.118  77.342  308.902 1.00 74.97  ? 331 GLU 3 CG    1 
ATOM   7265  C  CD    . GLU C  3  331 ? -55.516  77.786  307.579 1.00 73.02  ? 331 GLU 3 CD    1 
ATOM   7266  O  OE1   . GLU C  3  331 ? -54.840  76.971  306.922 1.00 72.89  ? 331 GLU 3 OE1   1 
ATOM   7267  O  OE2   . GLU C  3  331 ? -55.689  78.963  307.207 1.00 74.43  ? 331 GLU 3 OE2   1 
ATOM   7268  N  N     . GLY C  3  332 ? -54.406  76.557  312.220 1.00 90.42  ? 332 GLY 3 N     1 
ATOM   7269  C  CA    . GLY C  3  332 ? -54.328  77.419  313.387 1.00 91.23  ? 332 GLY 3 CA    1 
ATOM   7270  C  C     . GLY C  3  332 ? -52.922  77.688  313.876 1.00 83.04  ? 332 GLY 3 C     1 
ATOM   7271  O  O     . GLY C  3  332 ? -52.709  78.668  314.599 1.00 88.55  ? 332 GLY 3 O     1 
ATOM   7272  N  N     . LEU C  3  333 ? -51.959  76.843  313.508 1.00 65.51  ? 333 LEU 3 N     1 
ATOM   7273  C  CA    . LEU C  3  333 ? -50.573  77.055  313.898 1.00 60.10  ? 333 LEU 3 CA    1 
ATOM   7274  C  C     . LEU C  3  333 ? -49.667  77.472  312.747 1.00 64.58  ? 333 LEU 3 C     1 
ATOM   7275  O  O     . LEU C  3  333 ? -48.456  77.596  312.951 1.00 62.52  ? 333 LEU 3 O     1 
ATOM   7276  C  CB    . LEU C  3  333 ? -50.024  75.791  314.566 1.00 57.14  ? 333 LEU 3 CB    1 
ATOM   7277  C  CG    . LEU C  3  333 ? -50.947  75.280  315.666 1.00 48.65  ? 333 LEU 3 CG    1 
ATOM   7278  C  CD1   . LEU C  3  333 ? -50.413  73.989  316.257 1.00 42.09  ? 333 LEU 3 CD1   1 
ATOM   7279  C  CD2   . LEU C  3  333 ? -51.137  76.345  316.732 1.00 46.90  ? 333 LEU 3 CD2   1 
ATOM   7280  N  N     . LYS C  3  334 ? -50.211  77.678  311.547 1.00 72.09  ? 334 LYS 3 N     1 
ATOM   7281  C  CA    . LYS C  3  334 ? -49.371  78.064  310.417 1.00 80.70  ? 334 LYS 3 CA    1 
ATOM   7282  C  C     . LYS C  3  334 ? -48.585  79.328  310.729 1.00 95.19  ? 334 LYS 3 C     1 
ATOM   7283  O  O     . LYS C  3  334 ? -47.408  79.445  310.366 1.00 101.80 ? 334 LYS 3 O     1 
ATOM   7284  C  CB    . LYS C  3  334 ? -50.228  78.264  309.167 1.00 73.34  ? 334 LYS 3 CB    1 
ATOM   7285  C  CG    . LYS C  3  334 ? -49.452  78.746  307.952 1.00 69.48  ? 334 LYS 3 CG    1 
ATOM   7286  C  CD    . LYS C  3  334 ? -50.353  78.946  306.743 1.00 68.33  ? 334 LYS 3 CD    1 
ATOM   7287  C  CE    . LYS C  3  334 ? -51.262  80.149  306.913 1.00 65.91  ? 334 LYS 3 CE    1 
ATOM   7288  N  NZ    . LYS C  3  334 ? -52.530  79.817  307.621 1.00 63.14  ? 334 LYS 3 NZ    1 
ATOM   7289  N  N     . GLU C  3  335 ? -49.215  80.280  311.415 1.00 99.02  ? 335 GLU 3 N     1 
ATOM   7290  C  CA    . GLU C  3  335 ? -48.552  81.493  311.873 1.00 103.73 ? 335 GLU 3 CA    1 
ATOM   7291  C  C     . GLU C  3  335 ? -48.197  81.432  313.354 1.00 103.35 ? 335 GLU 3 C     1 
ATOM   7292  O  O     . GLU C  3  335 ? -48.224  82.457  314.042 1.00 109.32 ? 335 GLU 3 O     1 
ATOM   7293  C  CB    . GLU C  3  335 ? -49.418  82.718  311.582 1.00 110.17 ? 335 GLU 3 CB    1 
ATOM   7294  C  CG    . GLU C  3  335 ? -49.235  83.254  310.176 1.00 113.50 ? 335 GLU 3 CG    1 
ATOM   7295  C  CD    . GLU C  3  335 ? -47.817  83.721  309.914 1.00 113.45 ? 335 GLU 3 CD    1 
ATOM   7296  O  OE1   . GLU C  3  335 ? -47.156  84.201  310.858 1.00 112.99 ? 335 GLU 3 OE1   1 
ATOM   7297  O  OE2   . GLU C  3  335 ? -47.356  83.593  308.762 1.00 113.14 ? 335 GLU 3 OE2   1 
ATOM   7298  N  N     . ALA C  3  336 ? -47.846  80.253  313.854 1.00 96.68  ? 336 ALA 3 N     1 
ATOM   7299  C  CA    . ALA C  3  336 ? -47.475  80.082  315.250 1.00 94.10  ? 336 ALA 3 CA    1 
ATOM   7300  C  C     . ALA C  3  336 ? -45.960  80.146  315.369 1.00 95.93  ? 336 ALA 3 C     1 
ATOM   7301  O  O     . ALA C  3  336 ? -45.246  79.406  314.684 1.00 96.35  ? 336 ALA 3 O     1 
ATOM   7302  C  CB    . ALA C  3  336 ? -47.998  78.758  315.804 1.00 89.28  ? 336 ALA 3 CB    1 
ATOM   7303  N  N     . ARG C  3  337 ? -45.478  81.029  316.234 1.00 93.74  ? 337 ARG 3 N     1 
ATOM   7304  C  CA    . ARG C  3  337 ? -44.050  81.222  316.429 1.00 89.74  ? 337 ARG 3 CA    1 
ATOM   7305  C  C     . ARG C  3  337 ? -43.552  80.268  317.501 1.00 88.22  ? 337 ARG 3 C     1 
ATOM   7306  O  O     . ARG C  3  337 ? -44.265  79.965  318.462 1.00 90.43  ? 337 ARG 3 O     1 
ATOM   7307  C  CB    . ARG C  3  337 ? -43.735  82.662  316.845 1.00 87.87  ? 337 ARG 3 CB    1 
ATOM   7308  C  CG    . ARG C  3  337 ? -44.220  83.054  318.244 1.00 91.61  ? 337 ARG 3 CG    1 
ATOM   7309  C  CD    . ARG C  3  337 ? -45.722  83.217  318.357 1.00 100.72 ? 337 ARG 3 CD    1 
ATOM   7310  N  NE    . ARG C  3  337 ? -46.069  84.312  319.252 1.00 109.42 ? 337 ARG 3 NE    1 
ATOM   7311  C  CZ    . ARG C  3  337 ? -47.277  84.503  319.769 1.00 114.79 ? 337 ARG 3 CZ    1 
ATOM   7312  N  NH1   . ARG C  3  337 ? -48.266  83.669  319.484 1.00 114.22 ? 337 ARG 3 NH1   1 
ATOM   7313  N  NH2   . ARG C  3  337 ? -47.492  85.529  320.578 1.00 118.61 ? 337 ARG 3 NH2   1 
ATOM   7314  N  N     . GLY C  3  338 ? -42.326  79.784  317.324 1.00 81.73  ? 338 GLY 3 N     1 
ATOM   7315  C  CA    . GLY C  3  338 ? -41.810  78.759  318.207 1.00 70.22  ? 338 GLY 3 CA    1 
ATOM   7316  C  C     . GLY C  3  338 ? -41.576  79.201  319.634 1.00 62.99  ? 338 GLY 3 C     1 
ATOM   7317  O  O     . GLY C  3  338 ? -41.406  78.340  320.499 1.00 50.32  ? 338 GLY 3 O     1 
ATOM   7318  N  N     . GLU C  3  339 ? -41.629  80.502  319.915 1.00 75.93  ? 339 GLU 3 N     1 
ATOM   7319  C  CA    . GLU C  3  339 ? -41.271  81.033  321.224 1.00 81.54  ? 339 GLU 3 CA    1 
ATOM   7320  C  C     . GLU C  3  339 ? -42.478  81.343  322.098 1.00 84.34  ? 339 GLU 3 C     1 
ATOM   7321  O  O     . GLU C  3  339 ? -42.325  81.957  323.156 1.00 81.80  ? 339 GLU 3 O     1 
ATOM   7322  C  CB    . GLU C  3  339 ? -40.398  82.282  321.065 1.00 79.94  ? 339 GLU 3 CB    1 
ATOM   7323  C  CG    . GLU C  3  339 ? -41.077  83.453  320.365 1.00 77.98  ? 339 GLU 3 CG    1 
ATOM   7324  C  CD    . GLU C  3  339 ? -40.947  83.385  318.851 1.00 77.74  ? 339 GLU 3 CD    1 
ATOM   7325  O  OE1   . GLU C  3  339 ? -40.454  82.359  318.339 1.00 78.84  ? 339 GLU 3 OE1   1 
ATOM   7326  O  OE2   . GLU C  3  339 ? -41.333  84.358  318.170 1.00 76.80  ? 339 GLU 3 OE2   1 
ATOM   7327  N  N     . GLU C  3  340 ? -43.671  80.932  321.678 1.00 89.26  ? 340 GLU 3 N     1 
ATOM   7328  C  CA    . GLU C  3  340 ? -44.857  80.986  322.521 1.00 93.52  ? 340 GLU 3 CA    1 
ATOM   7329  C  C     . GLU C  3  340 ? -45.492  79.612  322.664 1.00 91.96  ? 340 GLU 3 C     1 
ATOM   7330  O  O     . GLU C  3  340 ? -46.603  79.502  323.195 1.00 88.89  ? 340 GLU 3 O     1 
ATOM   7331  C  CB    . GLU C  3  340 ? -45.865  82.009  321.997 1.00 98.56  ? 340 GLU 3 CB    1 
ATOM   7332  C  CG    . GLU C  3  340 ? -45.470  83.422  322.361 1.00 106.81 ? 340 GLU 3 CG    1 
ATOM   7333  C  CD    . GLU C  3  340 ? -45.214  83.574  323.852 1.00 113.42 ? 340 GLU 3 CD    1 
ATOM   7334  O  OE1   . GLU C  3  340 ? -46.051  83.112  324.657 1.00 115.29 ? 340 GLU 3 OE1   1 
ATOM   7335  O  OE2   . GLU C  3  340 ? -44.163  84.136  324.222 1.00 114.89 ? 340 GLU 3 OE2   1 
ATOM   7336  N  N     . VAL C  3  341 ? -44.817  78.570  322.190 1.00 89.42  ? 341 VAL 3 N     1 
ATOM   7337  C  CA    . VAL C  3  341 ? -45.327  77.212  322.292 1.00 81.22  ? 341 VAL 3 CA    1 
ATOM   7338  C  C     . VAL C  3  341 ? -45.021  76.695  323.687 1.00 78.17  ? 341 VAL 3 C     1 
ATOM   7339  O  O     . VAL C  3  341 ? -43.895  76.829  324.181 1.00 82.59  ? 341 VAL 3 O     1 
ATOM   7340  C  CB    . VAL C  3  341 ? -44.699  76.312  321.216 1.00 71.27  ? 341 VAL 3 CB    1 
ATOM   7341  C  CG1   . VAL C  3  341 ? -45.535  75.060  321.007 1.00 63.84  ? 341 VAL 3 CG1   1 
ATOM   7342  C  CG2   . VAL C  3  341 ? -44.528  77.074  319.912 1.00 70.94  ? 341 VAL 3 CG2   1 
ATOM   7343  N  N     . GLY C  3  342 ? -46.023  76.102  324.331 1.00 67.61  ? 342 GLY 3 N     1 
ATOM   7344  C  CA    . GLY C  3  342 ? -45.846  75.521  325.643 1.00 59.31  ? 342 GLY 3 CA    1 
ATOM   7345  C  C     . GLY C  3  342 ? -45.722  74.016  325.511 1.00 59.22  ? 342 GLY 3 C     1 
ATOM   7346  O  O     . GLY C  3  342 ? -46.536  73.368  324.852 1.00 61.25  ? 342 GLY 3 O     1 
ATOM   7347  N  N     . LEU C  3  343 ? -44.684  73.474  326.125 1.00 62.98  ? 343 LEU 3 N     1 
ATOM   7348  C  CA    . LEU C  3  343 ? -44.479  72.034  326.170 1.00 67.04  ? 343 LEU 3 CA    1 
ATOM   7349  C  C     . LEU C  3  343 ? -44.514  71.643  327.640 1.00 55.34  ? 343 LEU 3 C     1 
ATOM   7350  O  O     . LEU C  3  343 ? -43.497  71.697  328.339 1.00 52.01  ? 343 LEU 3 O     1 
ATOM   7351  C  CB    . LEU C  3  343 ? -43.175  71.649  325.487 1.00 76.20  ? 343 LEU 3 CB    1 
ATOM   7352  C  CG    . LEU C  3  343 ? -43.159  71.963  323.990 1.00 78.77  ? 343 LEU 3 CG    1 
ATOM   7353  C  CD1   . LEU C  3  343 ? -41.856  71.512  323.348 1.00 84.20  ? 343 LEU 3 CD1   1 
ATOM   7354  C  CD2   . LEU C  3  343 ? -44.354  71.315  323.307 1.00 74.43  ? 343 LEU 3 CD2   1 
ATOM   7355  N  N     . TYR C  3  344 ? -45.691  71.232  328.094 1.00 46.85  ? 344 TYR 3 N     1 
ATOM   7356  C  CA    . TYR C  3  344 ? -45.951  70.944  329.497 1.00 47.57  ? 344 TYR 3 CA    1 
ATOM   7357  C  C     . TYR C  3  344 ? -46.380  69.486  329.568 1.00 52.09  ? 344 TYR 3 C     1 
ATOM   7358  O  O     . TYR C  3  344 ? -47.515  69.153  329.214 1.00 52.95  ? 344 TYR 3 O     1 
ATOM   7359  C  CB    . TYR C  3  344 ? -47.021  71.883  330.056 1.00 56.23  ? 344 TYR 3 CB    1 
ATOM   7360  C  CG    . TYR C  3  344 ? -46.612  73.350  330.069 1.00 66.09  ? 344 TYR 3 CG    1 
ATOM   7361  C  CD1   . TYR C  3  344 ? -45.557  73.795  330.852 1.00 67.44  ? 344 TYR 3 CD1   1 
ATOM   7362  C  CD2   . TYR C  3  344 ? -47.277  74.286  329.289 1.00 66.64  ? 344 TYR 3 CD2   1 
ATOM   7363  C  CE1   . TYR C  3  344 ? -45.184  75.132  330.860 1.00 64.37  ? 344 TYR 3 CE1   1 
ATOM   7364  C  CE2   . TYR C  3  344 ? -46.913  75.620  329.298 1.00 63.83  ? 344 TYR 3 CE2   1 
ATOM   7365  C  CZ    . TYR C  3  344 ? -45.867  76.037  330.081 1.00 64.92  ? 344 TYR 3 CZ    1 
ATOM   7366  O  OH    . TYR C  3  344 ? -45.509  77.364  330.079 1.00 68.26  ? 344 TYR 3 OH    1 
ATOM   7367  N  N     . LEU C  3  345 ? -45.480  68.626  330.030 1.00 56.14  ? 345 LEU 3 N     1 
ATOM   7368  C  CA    . LEU C  3  345 ? -45.654  67.184  329.944 1.00 52.12  ? 345 LEU 3 CA    1 
ATOM   7369  C  C     . LEU C  3  345 ? -46.170  66.613  331.259 1.00 54.79  ? 345 LEU 3 C     1 
ATOM   7370  O  O     . LEU C  3  345 ? -46.164  67.267  332.302 1.00 64.29  ? 345 LEU 3 O     1 
ATOM   7371  C  CB    . LEU C  3  345 ? -44.331  66.507  329.570 1.00 49.26  ? 345 LEU 3 CB    1 
ATOM   7372  C  CG    . LEU C  3  345 ? -43.456  67.188  328.520 1.00 60.88  ? 345 LEU 3 CG    1 
ATOM   7373  C  CD1   . LEU C  3  345 ? -42.227  66.340  328.230 1.00 66.68  ? 345 LEU 3 CD1   1 
ATOM   7374  C  CD2   . LEU C  3  345 ? -44.250  67.434  327.250 1.00 67.95  ? 345 LEU 3 CD2   1 
ATOM   7375  N  N     . ALA C  3  346 ? -46.612  65.365  331.194 1.00 50.71  ? 346 ALA 3 N     1 
ATOM   7376  C  CA    . ALA C  3  346 ? -47.198  64.694  332.340 1.00 55.86  ? 346 ALA 3 CA    1 
ATOM   7377  C  C     . ALA C  3  346 ? -46.124  63.954  333.130 1.00 60.70  ? 346 ALA 3 C     1 
ATOM   7378  O  O     . ALA C  3  346 ? -45.031  63.680  332.632 1.00 62.68  ? 346 ALA 3 O     1 
ATOM   7379  C  CB    . ALA C  3  346 ? -48.292  63.724  331.892 1.00 56.53  ? 346 ALA 3 CB    1 
ATOM   7380  N  N     . HIS C  3  347 ? -46.452  63.640  334.387 1.00 62.67  ? 347 HIS 3 N     1 
ATOM   7381  C  CA    . HIS C  3  347 ? -45.495  63.017  335.298 1.00 67.16  ? 347 HIS 3 CA    1 
ATOM   7382  C  C     . HIS C  3  347 ? -45.080  61.615  334.866 1.00 71.26  ? 347 HIS 3 C     1 
ATOM   7383  O  O     . HIS C  3  347 ? -43.997  61.161  335.254 1.00 74.91  ? 347 HIS 3 O     1 
ATOM   7384  C  CB    . HIS C  3  347 ? -46.063  62.993  336.720 1.00 70.93  ? 347 HIS 3 CB    1 
ATOM   7385  C  CG    . HIS C  3  347 ? -47.164  62.000  336.923 1.00 74.21  ? 347 HIS 3 CG    1 
ATOM   7386  N  ND1   . HIS C  3  347 ? -46.961  60.770  337.512 1.00 77.63  ? 347 HIS 3 ND1   1 
ATOM   7387  C  CD2   . HIS C  3  347 ? -48.485  62.065  336.628 1.00 78.03  ? 347 HIS 3 CD2   1 
ATOM   7388  C  CE1   . HIS C  3  347 ? -48.108  60.117  337.566 1.00 77.97  ? 347 HIS 3 CE1   1 
ATOM   7389  N  NE2   . HIS C  3  347 ? -49.047  60.879  337.034 1.00 78.33  ? 347 HIS 3 NE2   1 
ATOM   7390  N  N     . ASP C  3  348 ? -45.902  60.911  334.088 1.00 62.10  ? 348 ASP 3 N     1 
ATOM   7391  C  CA    . ASP C  3  348 ? -45.551  59.575  333.627 1.00 49.48  ? 348 ASP 3 CA    1 
ATOM   7392  C  C     . ASP C  3  348 ? -44.932  59.588  332.235 1.00 53.74  ? 348 ASP 3 C     1 
ATOM   7393  O  O     . ASP C  3  348 ? -44.900  58.549  331.569 1.00 65.12  ? 348 ASP 3 O     1 
ATOM   7394  C  CB    . ASP C  3  348 ? -46.775  58.652  333.651 1.00 44.45  ? 348 ASP 3 CB    1 
ATOM   7395  C  CG    . ASP C  3  348 ? -47.919  59.152  332.780 1.00 45.76  ? 348 ASP 3 CG    1 
ATOM   7396  O  OD1   . ASP C  3  348 ? -47.692  59.479  331.599 1.00 48.91  ? 348 ASP 3 OD1   1 
ATOM   7397  O  OD2   . ASP C  3  348 ? -49.059  59.219  333.279 1.00 41.91  ? 348 ASP 3 OD2   1 
ATOM   7398  N  N     . ALA C  3  349 ? -44.432  60.736  331.787 1.00 49.53  ? 349 ALA 3 N     1 
ATOM   7399  C  CA    . ALA C  3  349 ? -43.845  60.817  330.459 1.00 49.97  ? 349 ALA 3 CA    1 
ATOM   7400  C  C     . ALA C  3  349 ? -42.577  59.978  330.399 1.00 58.97  ? 349 ALA 3 C     1 
ATOM   7401  O  O     . ALA C  3  349 ? -41.712  60.081  331.273 1.00 64.00  ? 349 ALA 3 O     1 
ATOM   7402  C  CB    . ALA C  3  349 ? -43.540  62.270  330.101 1.00 47.36  ? 349 ALA 3 CB    1 
ATOM   7403  N  N     . THR C  3  350 ? -42.478  59.139  329.371 1.00 59.91  ? 350 THR 3 N     1 
ATOM   7404  C  CA    . THR C  3  350 ? -41.334  58.255  329.218 1.00 59.50  ? 350 THR 3 CA    1 
ATOM   7405  C  C     . THR C  3  350 ? -40.068  59.057  328.916 1.00 61.07  ? 350 THR 3 C     1 
ATOM   7406  O  O     . THR C  3  350 ? -40.104  60.246  328.588 1.00 55.72  ? 350 THR 3 O     1 
ATOM   7407  C  CB    . THR C  3  350 ? -41.584  57.223  328.115 1.00 52.38  ? 350 THR 3 CB    1 
ATOM   7408  O  OG1   . THR C  3  350 ? -41.539  57.864  326.837 1.00 49.58  ? 350 THR 3 OG1   1 
ATOM   7409  C  CG2   . THR C  3  350 ? -42.936  56.554  328.294 1.00 52.03  ? 350 THR 3 CG2   1 
ATOM   7410  N  N     . LEU C  3  351 ? -38.926  58.381  329.054 1.00 50.09  ? 351 LEU 3 N     1 
ATOM   7411  C  CA    . LEU C  3  351 ? -37.662  58.974  328.632 1.00 52.97  ? 351 LEU 3 CA    1 
ATOM   7412  C  C     . LEU C  3  351 ? -37.694  59.332  327.156 1.00 47.78  ? 351 LEU 3 C     1 
ATOM   7413  O  O     . LEU C  3  351 ? -37.185  60.381  326.749 1.00 42.19  ? 351 LEU 3 O     1 
ATOM   7414  C  CB    . LEU C  3  351 ? -36.515  58.004  328.908 1.00 58.37  ? 351 LEU 3 CB    1 
ATOM   7415  C  CG    . LEU C  3  351 ? -35.584  58.422  330.031 1.00 57.58  ? 351 LEU 3 CG    1 
ATOM   7416  C  CD1   . LEU C  3  351 ? -36.438  58.720  331.228 1.00 61.84  ? 351 LEU 3 CD1   1 
ATOM   7417  C  CD2   . LEU C  3  351 ? -34.580  57.325  330.322 1.00 49.62  ? 351 LEU 3 CD2   1 
ATOM   7418  N  N     . GLU C  3  352 ? -38.276  58.456  326.339 1.00 46.96  ? 352 GLU 3 N     1 
ATOM   7419  C  CA    . GLU C  3  352 ? -38.366  58.711  324.909 1.00 47.71  ? 352 GLU 3 CA    1 
ATOM   7420  C  C     . GLU C  3  352 ? -39.131  59.999  324.638 1.00 50.91  ? 352 GLU 3 C     1 
ATOM   7421  O  O     . GLU C  3  352 ? -38.665  60.873  323.900 1.00 51.35  ? 352 GLU 3 O     1 
ATOM   7422  C  CB    . GLU C  3  352 ? -39.050  57.524  324.230 1.00 51.68  ? 352 GLU 3 CB    1 
ATOM   7423  C  CG    . GLU C  3  352 ? -38.250  56.223  324.284 1.00 56.83  ? 352 GLU 3 CG    1 
ATOM   7424  C  CD    . GLU C  3  352 ? -38.419  55.470  325.593 1.00 53.47  ? 352 GLU 3 CD    1 
ATOM   7425  O  OE1   . GLU C  3  352 ? -39.091  55.995  326.501 1.00 51.29  ? 352 GLU 3 OE1   1 
ATOM   7426  O  OE2   . GLU C  3  352 ? -37.871  54.355  325.719 1.00 48.48  ? 352 GLU 3 OE2   1 
ATOM   7427  N  N     . GLU C  3  353 ? -40.306  60.136  325.251 1.00 57.26  ? 353 GLU 3 N     1 
ATOM   7428  C  CA    . GLU C  3  353 ? -41.154  61.300  325.018 1.00 61.80  ? 353 GLU 3 CA    1 
ATOM   7429  C  C     . GLU C  3  353 ? -40.545  62.564  325.612 1.00 62.65  ? 353 GLU 3 C     1 
ATOM   7430  O  O     . GLU C  3  353 ? -40.598  63.634  324.994 1.00 63.82  ? 353 GLU 3 O     1 
ATOM   7431  C  CB    . GLU C  3  353 ? -42.545  61.018  325.581 1.00 62.87  ? 353 GLU 3 CB    1 
ATOM   7432  C  CG    . GLU C  3  353 ? -43.246  59.917  324.799 1.00 64.61  ? 353 GLU 3 CG    1 
ATOM   7433  C  CD    . GLU C  3  353 ? -44.433  59.337  325.523 1.00 69.35  ? 353 GLU 3 CD    1 
ATOM   7434  O  OE1   . GLU C  3  353 ? -44.718  59.785  326.650 1.00 72.93  ? 353 GLU 3 OE1   1 
ATOM   7435  O  OE2   . GLU C  3  353 ? -45.067  58.412  324.975 1.00 69.22  ? 353 GLU 3 OE2   1 
ATOM   7436  N  N     . GLY C  3  354 ? -39.956  62.463  326.805 1.00 59.56  ? 354 GLY 3 N     1 
ATOM   7437  C  CA    . GLY C  3  354 ? -39.298  63.621  327.382 1.00 59.03  ? 354 GLY 3 CA    1 
ATOM   7438  C  C     . GLY C  3  354 ? -38.135  64.099  326.535 1.00 55.03  ? 354 GLY 3 C     1 
ATOM   7439  O  O     . GLY C  3  354 ? -37.985  65.298  326.284 1.00 46.94  ? 354 GLY 3 O     1 
ATOM   7440  N  N     . LEU C  3  355 ? -37.308  63.163  326.066 1.00 58.18  ? 355 LEU 3 N     1 
ATOM   7441  C  CA    . LEU C  3  355 ? -36.190  63.529  325.207 1.00 55.97  ? 355 LEU 3 CA    1 
ATOM   7442  C  C     . LEU C  3  355 ? -36.687  64.106  323.891 1.00 57.13  ? 355 LEU 3 C     1 
ATOM   7443  O  O     . LEU C  3  355 ? -36.083  65.034  323.348 1.00 57.19  ? 355 LEU 3 O     1 
ATOM   7444  C  CB    . LEU C  3  355 ? -35.285  62.324  324.954 1.00 56.16  ? 355 LEU 3 CB    1 
ATOM   7445  C  CG    . LEU C  3  355 ? -34.129  62.627  323.998 1.00 59.20  ? 355 LEU 3 CG    1 
ATOM   7446  C  CD1   . LEU C  3  355 ? -33.331  63.824  324.497 1.00 54.15  ? 355 LEU 3 CD1   1 
ATOM   7447  C  CD2   . LEU C  3  355 ? -33.230  61.417  323.791 1.00 66.13  ? 355 LEU 3 CD2   1 
ATOM   7448  N  N     . LEU C  3  356 ? -37.777  63.557  323.350 1.00 57.18  ? 356 LEU 3 N     1 
ATOM   7449  C  CA    . LEU C  3  356 ? -38.310  64.084  322.100 1.00 51.32  ? 356 LEU 3 CA    1 
ATOM   7450  C  C     . LEU C  3  356 ? -38.792  65.518  322.276 1.00 52.49  ? 356 LEU 3 C     1 
ATOM   7451  O  O     . LEU C  3  356 ? -38.534  66.373  321.425 1.00 52.83  ? 356 LEU 3 O     1 
ATOM   7452  C  CB    . LEU C  3  356 ? -39.441  63.195  321.577 1.00 43.04  ? 356 LEU 3 CB    1 
ATOM   7453  C  CG    . LEU C  3  356 ? -40.342  63.879  320.546 1.00 39.39  ? 356 LEU 3 CG    1 
ATOM   7454  C  CD1   . LEU C  3  356 ? -39.602  64.121  319.239 1.00 19.55  ? 356 LEU 3 CD1   1 
ATOM   7455  C  CD2   . LEU C  3  356 ? -41.628  63.099  320.314 1.00 20.71  ? 356 LEU 3 CD2   1 
ATOM   7456  N  N     . ALA C  3  357 ? -39.482  65.806  323.382 1.00 48.17  ? 357 ALA 3 N     1 
ATOM   7457  C  CA    . ALA C  3  357 ? -39.921  67.177  323.632 1.00 48.69  ? 357 ALA 3 CA    1 
ATOM   7458  C  C     . ALA C  3  357 ? -38.733  68.111  323.848 1.00 51.78  ? 357 ALA 3 C     1 
ATOM   7459  O  O     . ALA C  3  357 ? -38.735  69.253  323.369 1.00 52.91  ? 357 ALA 3 O     1 
ATOM   7460  C  CB    . ALA C  3  357 ? -40.863  67.214  324.835 1.00 49.41  ? 357 ALA 3 CB    1 
ATOM   7461  N  N     . SER C  3  358 ? -37.703  67.642  324.557 1.00 51.94  ? 358 SER 3 N     1 
ATOM   7462  C  CA    . SER C  3  358 ? -36.518  68.468  324.770 1.00 57.69  ? 358 SER 3 CA    1 
ATOM   7463  C  C     . SER C  3  358 ? -35.831  68.785  323.448 1.00 62.53  ? 358 SER 3 C     1 
ATOM   7464  O  O     . SER C  3  358 ? -35.462  69.934  323.188 1.00 59.39  ? 358 SER 3 O     1 
ATOM   7465  C  CB    . SER C  3  358 ? -35.553  67.772  325.730 1.00 67.61  ? 358 SER 3 CB    1 
ATOM   7466  O  OG    . SER C  3  358 ? -34.258  68.350  325.673 1.00 71.85  ? 358 SER 3 OG    1 
ATOM   7467  N  N     . GLU C  3  359 ? -35.645  67.771  322.598 1.00 75.22  ? 359 GLU 3 N     1 
ATOM   7468  C  CA    . GLU C  3  359 ? -35.019  67.988  321.297 1.00 84.58  ? 359 GLU 3 CA    1 
ATOM   7469  C  C     . GLU C  3  359 ? -35.886  68.861  320.398 1.00 85.70  ? 359 GLU 3 C     1 
ATOM   7470  O  O     . GLU C  3  359 ? -35.364  69.644  319.594 1.00 88.41  ? 359 GLU 3 O     1 
ATOM   7471  C  CB    . GLU C  3  359 ? -34.742  66.643  320.615 1.00 82.27  ? 359 GLU 3 CB    1 
ATOM   7472  C  CG    . GLU C  3  359 ? -33.786  65.710  321.358 1.00 80.94  ? 359 GLU 3 CG    1 
ATOM   7473  C  CD    . GLU C  3  359 ? -32.356  66.212  321.394 1.00 84.41  ? 359 GLU 3 CD    1 
ATOM   7474  O  OE1   . GLU C  3  359 ? -32.088  67.218  322.080 1.00 88.16  ? 359 GLU 3 OE1   1 
ATOM   7475  O  OE2   . GLU C  3  359 ? -31.493  65.593  320.739 1.00 84.95  ? 359 GLU 3 OE2   1 
ATOM   7476  N  N     . LEU C  3  360 ? -37.207  68.744  320.522 1.00 78.07  ? 360 LEU 3 N     1 
ATOM   7477  C  CA    . LEU C  3  360 ? -38.099  69.576  319.728 1.00 68.59  ? 360 LEU 3 CA    1 
ATOM   7478  C  C     . LEU C  3  360 ? -37.979  71.037  320.139 1.00 66.49  ? 360 LEU 3 C     1 
ATOM   7479  O  O     . LEU C  3  360 ? -37.969  71.929  319.284 1.00 71.81  ? 360 LEU 3 O     1 
ATOM   7480  C  CB    . LEU C  3  360 ? -39.533  69.055  319.858 1.00 61.54  ? 360 LEU 3 CB    1 
ATOM   7481  C  CG    . LEU C  3  360 ? -40.690  69.922  319.375 1.00 49.68  ? 360 LEU 3 CG    1 
ATOM   7482  C  CD1   . LEU C  3  360 ? -40.705  69.973  317.864 1.00 41.23  ? 360 LEU 3 CD1   1 
ATOM   7483  C  CD2   . LEU C  3  360 ? -42.005  69.375  319.905 1.00 44.27  ? 360 LEU 3 CD2   1 
ATOM   7484  N  N     . ALA C  3  361 ? -37.851  71.301  321.439 1.00 60.65  ? 361 ALA 3 N     1 
ATOM   7485  C  CA    . ALA C  3  361 ? -37.596  72.667  321.886 1.00 64.77  ? 361 ALA 3 CA    1 
ATOM   7486  C  C     . ALA C  3  361 ? -36.176  73.112  321.569 1.00 63.27  ? 361 ALA 3 C     1 
ATOM   7487  O  O     . ALA C  3  361 ? -35.909  74.316  321.506 1.00 61.51  ? 361 ALA 3 O     1 
ATOM   7488  C  CB    . ALA C  3  361 ? -37.846  72.797  323.381 1.00 70.05  ? 361 ALA 3 CB    1 
ATOM   7489  N  N     . LYS C  3  362 ? -35.255  72.167  321.405 1.00 62.41  ? 362 LYS 3 N     1 
ATOM   7490  C  CA    . LYS C  3  362 ? -33.935  72.494  320.882 1.00 67.48  ? 362 LYS 3 CA    1 
ATOM   7491  C  C     . LYS C  3  362 ? -34.056  73.070  319.477 1.00 82.46  ? 362 LYS 3 C     1 
ATOM   7492  O  O     . LYS C  3  362 ? -33.598  74.185  319.203 1.00 88.27  ? 362 LYS 3 O     1 
ATOM   7493  C  CB    . LYS C  3  362 ? -33.048  71.245  320.900 1.00 58.32  ? 362 LYS 3 CB    1 
ATOM   7494  C  CG    . LYS C  3  362 ? -31.710  71.399  320.197 1.00 56.06  ? 362 LYS 3 CG    1 
ATOM   7495  C  CD    . LYS C  3  362 ? -31.064  70.041  319.941 1.00 53.52  ? 362 LYS 3 CD    1 
ATOM   7496  C  CE    . LYS C  3  362 ? -29.553  70.107  320.088 1.00 52.31  ? 362 LYS 3 CE    1 
ATOM   7497  N  NZ    . LYS C  3  362 ? -28.864  69.242  319.092 1.00 49.32  ? 362 LYS 3 NZ    1 
ATOM   7498  N  N     . ALA C  3  363 ? -34.688  72.320  318.573 1.00 86.08  ? 363 ALA 3 N     1 
ATOM   7499  C  CA    . ALA C  3  363 ? -34.957  72.831  317.231 1.00 86.33  ? 363 ALA 3 CA    1 
ATOM   7500  C  C     . ALA C  3  363 ? -35.880  74.046  317.282 1.00 89.58  ? 363 ALA 3 C     1 
ATOM   7501  O  O     . ALA C  3  363 ? -35.521  75.141  316.833 1.00 87.98  ? 363 ALA 3 O     1 
ATOM   7502  C  CB    . ALA C  3  363 ? -35.560  71.726  316.362 1.00 80.44  ? 363 ALA 3 CB    1 
ATOM   7503  N  N     . LEU C  3  364 ? -37.077  73.868  317.837 1.00 90.26  ? 364 LEU 3 N     1 
ATOM   7504  C  CA    . LEU C  3  364 ? -38.088  74.920  317.904 1.00 85.74  ? 364 LEU 3 CA    1 
ATOM   7505  C  C     . LEU C  3  364 ? -37.806  75.810  319.108 1.00 86.30  ? 364 LEU 3 C     1 
ATOM   7506  O  O     . LEU C  3  364 ? -38.047  75.412  320.252 1.00 92.08  ? 364 LEU 3 O     1 
ATOM   7507  C  CB    . LEU C  3  364 ? -39.479  74.301  317.991 1.00 85.15  ? 364 LEU 3 CB    1 
ATOM   7508  C  CG    . LEU C  3  364 ? -40.674  75.229  318.180 1.00 85.47  ? 364 LEU 3 CG    1 
ATOM   7509  C  CD1   . LEU C  3  364 ? -41.295  75.542  316.832 1.00 90.70  ? 364 LEU 3 CD1   1 
ATOM   7510  C  CD2   . LEU C  3  364 ? -41.695  74.601  319.122 1.00 81.68  ? 364 LEU 3 CD2   1 
ATOM   7511  N  N     . LYS C  3  365 ? -37.313  77.020  318.858 1.00 83.28  ? 365 LYS 3 N     1 
ATOM   7512  C  CA    . LYS C  3  365 ? -36.851  77.904  319.928 1.00 86.42  ? 365 LYS 3 CA    1 
ATOM   7513  C  C     . LYS C  3  365 ? -38.030  78.307  320.802 1.00 78.15  ? 365 LYS 3 C     1 
ATOM   7514  O  O     . LYS C  3  365 ? -38.803  79.196  320.445 1.00 72.94  ? 365 LYS 3 O     1 
ATOM   7515  C  CB    . LYS C  3  365 ? -36.196  79.146  319.333 1.00 96.10  ? 365 LYS 3 CB    1 
ATOM   7516  C  CG    . LYS C  3  365 ? -34.981  78.885  318.464 1.00 99.88  ? 365 LYS 3 CG    1 
ATOM   7517  C  CD    . LYS C  3  365 ? -34.628  80.125  317.653 1.00 92.22  ? 365 LYS 3 CD    1 
ATOM   7518  C  CE    . LYS C  3  365 ? -33.437  79.874  316.748 1.00 86.69  ? 365 LYS 3 CE    1 
ATOM   7519  N  NZ    . LYS C  3  365 ? -33.362  80.876  315.654 1.00 83.33  ? 365 LYS 3 NZ    1 
ATOM   7520  N  N     . THR C  3  366 ? -38.149  77.676  321.973 1.00 78.50  ? 366 THR 3 N     1 
ATOM   7521  C  CA    . THR C  3  366 ? -39.144  78.045  322.973 1.00 79.45  ? 366 THR 3 CA    1 
ATOM   7522  C  C     . THR C  3  366 ? -38.432  78.067  324.320 1.00 84.60  ? 366 THR 3 C     1 
ATOM   7523  O  O     . THR C  3  366 ? -37.705  77.111  324.654 1.00 90.84  ? 366 THR 3 O     1 
ATOM   7524  C  CB    . THR C  3  366 ? -40.354  77.099  323.024 1.00 77.95  ? 366 THR 3 CB    1 
ATOM   7525  O  OG1   . THR C  3  366 ? -41.214  77.474  324.107 1.00 74.15  ? 366 THR 3 OG1   1 
ATOM   7526  C  CG2   . THR C  3  366 ? -39.942  75.643  323.179 1.00 78.43  ? 366 THR 3 CG2   1 
ATOM   7527  N  N     . PRO C  3  367 ? -38.588  79.135  325.104 1.00 80.63  ? 367 PRO 3 N     1 
ATOM   7528  C  CA    . PRO C  3  367 ? -37.958  79.158  326.428 1.00 77.90  ? 367 PRO 3 CA    1 
ATOM   7529  C  C     . PRO C  3  367 ? -38.755  78.437  327.493 1.00 74.20  ? 367 PRO 3 C     1 
ATOM   7530  O  O     . PRO C  3  367 ? -38.178  78.074  328.527 1.00 75.04  ? 367 PRO 3 O     1 
ATOM   7531  C  CB    . PRO C  3  367 ? -37.862  80.656  326.735 1.00 80.02  ? 367 PRO 3 CB    1 
ATOM   7532  C  CG    . PRO C  3  367 ? -39.049  81.232  326.028 1.00 82.70  ? 367 PRO 3 CG    1 
ATOM   7533  C  CD    . PRO C  3  367 ? -39.181  80.437  324.750 1.00 83.13  ? 367 PRO 3 CD    1 
ATOM   7534  N  N     . HIS C  3  368 ? -40.044  78.194  327.272 1.00 71.87  ? 368 HIS 3 N     1 
ATOM   7535  C  CA    . HIS C  3  368 ? -40.902  77.577  328.279 1.00 68.89  ? 368 HIS 3 CA    1 
ATOM   7536  C  C     . HIS C  3  368 ? -41.331  76.195  327.799 1.00 57.17  ? 368 HIS 3 C     1 
ATOM   7537  O  O     . HIS C  3  368 ? -42.274  76.062  327.013 1.00 49.98  ? 368 HIS 3 O     1 
ATOM   7538  C  CB    . HIS C  3  368 ? -42.121  78.433  328.610 1.00 77.03  ? 368 HIS 3 CB    1 
ATOM   7539  C  CG    . HIS C  3  368 ? -42.615  79.274  327.474 1.00 75.83  ? 368 HIS 3 CG    1 
ATOM   7540  N  ND1   . HIS C  3  368 ? -42.301  80.611  327.347 1.00 80.73  ? 368 HIS 3 ND1   1 
ATOM   7541  C  CD2   . HIS C  3  368 ? -43.434  78.979  326.436 1.00 80.99  ? 368 HIS 3 CD2   1 
ATOM   7542  C  CE1   . HIS C  3  368 ? -42.887  81.096  326.266 1.00 78.26  ? 368 HIS 3 CE1   1 
ATOM   7543  N  NE2   . HIS C  3  368 ? -43.580  80.127  325.697 1.00 80.17  ? 368 HIS 3 NE2   1 
ATOM   7544  N  N     . LEU C  3  369 ? -40.635  75.174  328.279 1.00 54.04  ? 369 LEU 3 N     1 
ATOM   7545  C  CA    . LEU C  3  369 ? -41.181  73.835  328.382 1.00 51.50  ? 369 LEU 3 CA    1 
ATOM   7546  C  C     . LEU C  3  369 ? -41.044  73.390  329.825 1.00 57.27  ? 369 LEU 3 C     1 
ATOM   7547  O  O     . LEU C  3  369 ? -40.123  73.801  330.531 1.00 61.14  ? 369 LEU 3 O     1 
ATOM   7548  C  CB    . LEU C  3  369 ? -40.486  72.810  327.469 1.00 40.42  ? 369 LEU 3 CB    1 
ATOM   7549  C  CG    . LEU C  3  369 ? -38.979  72.575  327.366 1.00 32.23  ? 369 LEU 3 CG    1 
ATOM   7550  C  CD1   . LEU C  3  369 ? -38.333  72.131  328.645 1.00 30.90  ? 369 LEU 3 CD1   1 
ATOM   7551  C  CD2   . LEU C  3  369 ? -38.792  71.477  326.358 1.00 29.33  ? 369 LEU 3 CD2   1 
ATOM   7552  N  N     . ASP C  3  370 ? -41.972  72.562  330.268 1.00 58.13  ? 370 ASP 3 N     1 
ATOM   7553  C  CA    . ASP C  3  370 ? -41.929  72.093  331.640 1.00 58.07  ? 370 ASP 3 CA    1 
ATOM   7554  C  C     . ASP C  3  370 ? -42.725  70.801  331.704 1.00 63.68  ? 370 ASP 3 C     1 
ATOM   7555  O  O     . ASP C  3  370 ? -43.156  70.267  330.679 1.00 67.52  ? 370 ASP 3 O     1 
ATOM   7556  C  CB    . ASP C  3  370 ? -42.460  73.152  332.607 1.00 56.54  ? 370 ASP 3 CB    1 
ATOM   7557  C  CG    . ASP C  3  370 ? -41.924  72.962  333.994 1.00 30.63  ? 370 ASP 3 CG    1 
ATOM   7558  O  OD1   . ASP C  3  370 ? -41.011  72.133  334.138 1.00 30.44  ? 370 ASP 3 OD1   1 
ATOM   7559  O  OD2   . ASP C  3  370 ? -42.400  73.626  334.930 1.00 31.47  ? 370 ASP 3 OD2   1 
ATOM   7560  N  N     . PHE C  3  371 ? -42.884  70.277  332.913 1.00 61.30  ? 371 PHE 3 N     1 
ATOM   7561  C  CA    . PHE C  3  371 ? -43.587  69.024  333.098 1.00 52.61  ? 371 PHE 3 CA    1 
ATOM   7562  C  C     . PHE C  3  371 ? -44.441  69.104  334.351 1.00 62.43  ? 371 PHE 3 C     1 
ATOM   7563  O  O     . PHE C  3  371 ? -44.260  69.977  335.202 1.00 64.98  ? 371 PHE 3 O     1 
ATOM   7564  C  CB    . PHE C  3  371 ? -42.614  67.841  333.145 1.00 42.60  ? 371 PHE 3 CB    1 
ATOM   7565  C  CG    . PHE C  3  371 ? -41.604  67.919  334.251 1.00 46.24  ? 371 PHE 3 CG    1 
ATOM   7566  C  CD1   . PHE C  3  371 ? -40.445  68.653  334.098 1.00 53.18  ? 371 PHE 3 CD1   1 
ATOM   7567  C  CD2   . PHE C  3  371 ? -41.789  67.217  335.423 1.00 49.62  ? 371 PHE 3 CD2   1 
ATOM   7568  C  CE1   . PHE C  3  371 ? -39.502  68.713  335.112 1.00 63.09  ? 371 PHE 3 CE1   1 
ATOM   7569  C  CE2   . PHE C  3  371 ? -40.847  67.270  336.433 1.00 46.39  ? 371 PHE 3 CE2   1 
ATOM   7570  C  CZ    . PHE C  3  371 ? -39.705  68.016  336.276 1.00 59.85  ? 371 PHE 3 CZ    1 
ATOM   7571  N  N     . GLN C  3  372 ? -45.382  68.165  334.442 1.00 71.18  ? 372 GLN 3 N     1 
ATOM   7572  C  CA    . GLN C  3  372 ? -46.466  68.252  335.415 1.00 76.38  ? 372 GLN 3 CA    1 
ATOM   7573  C  C     . GLN C  3  372 ? -45.948  68.369  336.841 1.00 76.64  ? 372 GLN 3 C     1 
ATOM   7574  O  O     . GLN C  3  372 ? -46.532  69.081  337.666 1.00 74.83  ? 372 GLN 3 O     1 
ATOM   7575  C  CB    . GLN C  3  372 ? -47.355  67.018  335.273 1.00 77.38  ? 372 GLN 3 CB    1 
ATOM   7576  C  CG    . GLN C  3  372 ? -48.657  67.062  336.018 1.00 76.99  ? 372 GLN 3 CG    1 
ATOM   7577  C  CD    . GLN C  3  372 ? -49.468  65.806  335.789 1.00 80.54  ? 372 GLN 3 CD    1 
ATOM   7578  O  OE1   . GLN C  3  372 ? -49.024  64.882  335.105 1.00 84.23  ? 372 GLN 3 OE1   1 
ATOM   7579  N  NE2   . GLN C  3  372 ? -50.665  65.764  336.354 1.00 81.87  ? 372 GLN 3 NE2   1 
ATOM   7580  N  N     . GLY C  3  373 ? -44.852  67.692  337.150 1.00 79.41  ? 373 GLY 3 N     1 
ATOM   7581  C  CA    . GLY C  3  373 ? -44.359  67.686  338.509 1.00 84.45  ? 373 GLY 3 CA    1 
ATOM   7582  C  C     . GLY C  3  373 ? -43.063  68.440  338.704 1.00 88.93  ? 373 GLY 3 C     1 
ATOM   7583  O  O     . GLY C  3  373 ? -42.252  68.046  339.547 1.00 90.16  ? 373 GLY 3 O     1 
ATOM   7584  N  N     . ARG C  3  374 ? -42.837  69.512  337.945 1.00 90.92  ? 374 ARG 3 N     1 
ATOM   7585  C  CA    . ARG C  3  374 ? -41.560  70.205  338.051 1.00 89.03  ? 374 ARG 3 CA    1 
ATOM   7586  C  C     . ARG C  3  374 ? -41.383  70.766  339.446 1.00 95.15  ? 374 ARG 3 C     1 
ATOM   7587  O  O     . ARG C  3  374 ? -42.279  71.417  339.992 1.00 98.43  ? 374 ARG 3 O     1 
ATOM   7588  C  CB    . ARG C  3  374 ? -41.415  71.328  337.028 1.00 78.94  ? 374 ARG 3 CB    1 
ATOM   7589  C  CG    . ARG C  3  374 ? -39.976  71.865  336.974 1.00 73.22  ? 374 ARG 3 CG    1 
ATOM   7590  C  CD    . ARG C  3  374 ? -39.888  73.375  336.800 1.00 84.72  ? 374 ARG 3 CD    1 
ATOM   7591  N  NE    . ARG C  3  374 ? -40.317  74.122  337.977 1.00 101.59 ? 374 ARG 3 NE    1 
ATOM   7592  C  CZ    . ARG C  3  374 ? -40.500  75.439  337.994 1.00 112.53 ? 374 ARG 3 CZ    1 
ATOM   7593  N  NH1   . ARG C  3  374 ? -40.286  76.158  336.900 1.00 113.79 ? 374 ARG 3 NH1   1 
ATOM   7594  N  NH2   . ARG C  3  374 ? -40.897  76.044  339.105 1.00 116.38 ? 374 ARG 3 NH2   1 
ATOM   7595  N  N     . THR C  3  375 ? -40.218  70.508  340.012 1.00 97.25  ? 375 THR 3 N     1 
ATOM   7596  C  CA    . THR C  3  375 ? -39.866  70.995  341.329 1.00 99.20  ? 375 THR 3 CA    1 
ATOM   7597  C  C     . THR C  3  375 ? -39.068  72.280  341.174 1.00 97.39  ? 375 THR 3 C     1 
ATOM   7598  O  O     . THR C  3  375 ? -38.247  72.404  340.259 1.00 91.28  ? 375 THR 3 O     1 
ATOM   7599  C  CB    . THR C  3  375 ? -39.056  69.943  342.088 1.00 103.19 ? 375 THR 3 CB    1 
ATOM   7600  O  OG1   . THR C  3  375 ? -37.861  69.643  341.359 1.00 107.02 ? 375 THR 3 OG1   1 
ATOM   7601  C  CG2   . THR C  3  375 ? -39.864  68.662  342.247 1.00 102.53 ? 375 THR 3 CG2   1 
ATOM   7602  N  N     . ALA C  3  376 ? -39.339  73.249  342.052 1.00 102.30 ? 376 ALA 3 N     1 
ATOM   7603  C  CA    . ALA C  3  376 ? -38.593  74.502  342.019 1.00 99.90  ? 376 ALA 3 CA    1 
ATOM   7604  C  C     . ALA C  3  376 ? -37.100  74.242  342.118 1.00 91.16  ? 376 ALA 3 C     1 
ATOM   7605  O  O     . ALA C  3  376 ? -36.297  74.958  341.508 1.00 83.96  ? 376 ALA 3 O     1 
ATOM   7606  C  CB    . ALA C  3  376 ? -39.061  75.429  343.143 1.00 103.13 ? 376 ALA 3 CB    1 
ATOM   7607  N  N     . ALA C  3  377 ? -36.717  73.210  342.864 1.00 88.65  ? 377 ALA 3 N     1 
ATOM   7608  C  CA    . ALA C  3  377 ? -35.351  72.726  342.896 1.00 83.64  ? 377 ALA 3 CA    1 
ATOM   7609  C  C     . ALA C  3  377 ? -35.310  71.388  342.180 1.00 73.74  ? 377 ALA 3 C     1 
ATOM   7610  O  O     . ALA C  3  377 ? -36.041  70.468  342.574 1.00 66.92  ? 377 ALA 3 O     1 
ATOM   7611  C  CB    . ALA C  3  377 ? -34.861  72.573  344.333 1.00 85.02  ? 377 ALA 3 CB    1 
ATOM   7612  N  N     . PRO C  3  378 ? -34.496  71.227  341.141 1.00 70.74  ? 378 PRO 3 N     1 
ATOM   7613  C  CA    . PRO C  3  378 ? -34.463  69.943  340.433 1.00 65.71  ? 378 PRO 3 CA    1 
ATOM   7614  C  C     . PRO C  3  378 ? -34.040  68.824  341.370 1.00 60.54  ? 378 PRO 3 C     1 
ATOM   7615  O  O     . PRO C  3  378 ? -33.058  68.939  342.104 1.00 57.74  ? 378 PRO 3 O     1 
ATOM   7616  C  CB    . PRO C  3  378 ? -33.436  70.166  339.318 1.00 67.82  ? 378 PRO 3 CB    1 
ATOM   7617  C  CG    . PRO C  3  378 ? -33.229  71.623  339.231 1.00 70.47  ? 378 PRO 3 CG    1 
ATOM   7618  C  CD    . PRO C  3  378 ? -33.653  72.253  340.511 1.00 73.31  ? 378 PRO 3 CD    1 
ATOM   7619  N  N     . ALA C  3  379 ? -34.801  67.735  341.348 1.00 58.17  ? 379 ALA 3 N     1 
ATOM   7620  C  CA    . ALA C  3  379 ? -34.451  66.573  342.149 1.00 56.61  ? 379 ALA 3 CA    1 
ATOM   7621  C  C     . ALA C  3  379 ? -33.158  65.915  341.691 1.00 52.28  ? 379 ALA 3 C     1 
ATOM   7622  O  O     . ALA C  3  379 ? -32.611  65.086  342.426 1.00 58.69  ? 379 ALA 3 O     1 
ATOM   7623  C  CB    . ALA C  3  379 ? -35.590  65.562  342.117 1.00 62.22  ? 379 ALA 3 CB    1 
ATOM   7624  N  N     . SER C  3  380 ? -32.656  66.273  340.507 1.00 39.78  ? 380 SER 3 N     1 
ATOM   7625  C  CA    . SER C  3  380 ? -31.387  65.754  340.013 1.00 39.86  ? 380 SER 3 CA    1 
ATOM   7626  C  C     . SER C  3  380 ? -30.199  66.189  340.861 1.00 48.57  ? 380 SER 3 C     1 
ATOM   7627  O  O     . SER C  3  380 ? -29.112  65.623  340.702 1.00 54.55  ? 380 SER 3 O     1 
ATOM   7628  C  CB    . SER C  3  380 ? -31.178  66.186  338.559 1.00 37.78  ? 380 SER 3 CB    1 
ATOM   7629  O  OG    . SER C  3  380 ? -32.209  65.693  337.722 1.00 30.53  ? 380 SER 3 OG    1 
ATOM   7630  N  N     . LEU C  3  381 ? -30.379  67.171  341.751 1.00 49.49  ? 381 LEU 3 N     1 
ATOM   7631  C  CA    . LEU C  3  381 ? -29.293  67.624  342.619 1.00 49.51  ? 381 LEU 3 CA    1 
ATOM   7632  C  C     . LEU C  3  381 ? -28.648  66.484  343.391 1.00 57.68  ? 381 LEU 3 C     1 
ATOM   7633  O  O     . LEU C  3  381 ? -27.451  66.538  343.698 1.00 59.84  ? 381 LEU 3 O     1 
ATOM   7634  C  CB    . LEU C  3  381 ? -29.815  68.653  343.626 1.00 40.03  ? 381 LEU 3 CB    1 
ATOM   7635  C  CG    . LEU C  3  381 ? -29.672  70.138  343.315 1.00 38.74  ? 381 LEU 3 CG    1 
ATOM   7636  C  CD1   . LEU C  3  381 ? -28.201  70.512  343.282 1.00 37.77  ? 381 LEU 3 CD1   1 
ATOM   7637  C  CD2   . LEU C  3  381 ? -30.364  70.501  342.020 1.00 41.38  ? 381 LEU 3 CD2   1 
ATOM   7638  N  N     . PHE C  3  382 ? -29.369  65.498  343.680 1.00 61.52  ? 382 PHE 3 N     1 
ATOM   7639  C  CA    . PHE C  3  382 ? -28.782  64.665  344.706 1.00 68.87  ? 382 PHE 3 CA    1 
ATOM   7640  C  C     . PHE C  3  382 ? -28.175  63.399  344.115 1.00 69.48  ? 382 PHE 3 C     1 
ATOM   7641  O  O     . PHE C  3  382 ? -28.587  62.936  343.048 1.00 69.21  ? 382 PHE 3 O     1 
ATOM   7642  C  CB    . PHE C  3  382 ? -29.836  64.303  345.755 1.00 72.76  ? 382 PHE 3 CB    1 
ATOM   7643  C  CG    . PHE C  3  382 ? -30.623  65.487  346.247 1.00 69.97  ? 382 PHE 3 CG    1 
ATOM   7644  C  CD1   . PHE C  3  382 ? -31.748  65.922  345.572 1.00 68.90  ? 382 PHE 3 CD1   1 
ATOM   7645  C  CD2   . PHE C  3  382 ? -30.209  66.190  347.362 1.00 63.77  ? 382 PHE 3 CD2   1 
ATOM   7646  C  CE1   . PHE C  3  382 ? -32.458  67.017  346.017 1.00 65.15  ? 382 PHE 3 CE1   1 
ATOM   7647  C  CE2   . PHE C  3  382 ? -30.917  67.284  347.805 1.00 61.83  ? 382 PHE 3 CE2   1 
ATOM   7648  C  CZ    . PHE C  3  382 ? -32.039  67.696  347.131 1.00 62.86  ? 382 PHE 3 CZ    1 
ATOM   7649  N  N     . PRO C  3  383 ? -27.185  62.837  344.798 1.00 73.55  ? 383 PRO 3 N     1 
ATOM   7650  C  CA    . PRO C  3  383 ? -26.644  61.548  344.389 1.00 73.43  ? 383 PRO 3 CA    1 
ATOM   7651  C  C     . PRO C  3  383 ? -27.680  60.456  344.580 1.00 69.72  ? 383 PRO 3 C     1 
ATOM   7652  O  O     . PRO C  3  383 ? -28.328  60.380  345.634 1.00 62.75  ? 383 PRO 3 O     1 
ATOM   7653  C  CB    . PRO C  3  383 ? -25.438  61.351  345.318 1.00 79.40  ? 383 PRO 3 CB    1 
ATOM   7654  C  CG    . PRO C  3  383 ? -25.656  62.282  346.464 1.00 81.63  ? 383 PRO 3 CG    1 
ATOM   7655  C  CD    . PRO C  3  383 ? -26.492  63.409  345.965 1.00 78.96  ? 383 PRO 3 CD    1 
ATOM   7656  N  N     . PRO C  3  384 ? -27.890  59.613  343.573 1.00 79.23  ? 384 PRO 3 N     1 
ATOM   7657  C  CA    . PRO C  3  384 ? -28.834  58.503  343.739 1.00 87.16  ? 384 PRO 3 CA    1 
ATOM   7658  C  C     . PRO C  3  384 ? -28.336  57.510  344.779 1.00 86.41  ? 384 PRO 3 C     1 
ATOM   7659  O  O     . PRO C  3  384 ? -27.143  57.208  344.857 1.00 90.24  ? 384 PRO 3 O     1 
ATOM   7660  C  CB    . PRO C  3  384 ? -28.886  57.872  342.342 1.00 91.50  ? 384 PRO 3 CB    1 
ATOM   7661  C  CG    . PRO C  3  384 ? -28.458  58.972  341.414 1.00 88.73  ? 384 PRO 3 CG    1 
ATOM   7662  C  CD    . PRO C  3  384 ? -27.433  59.750  342.180 1.00 84.91  ? 384 PRO 3 CD    1 
ATOM   7663  N  N     . ALA C  3  385 ? -29.265  57.013  345.591 1.00 78.94  ? 385 ALA 3 N     1 
ATOM   7664  C  CA    . ALA C  3  385 ? -28.973  56.025  346.618 1.00 71.59  ? 385 ALA 3 CA    1 
ATOM   7665  C  C     . ALA C  3  385 ? -29.757  54.755  346.324 1.00 70.56  ? 385 ALA 3 C     1 
ATOM   7666  O  O     . ALA C  3  385 ? -30.965  54.815  346.077 1.00 71.35  ? 385 ALA 3 O     1 
ATOM   7667  C  CB    . ALA C  3  385 ? -29.330  56.557  348.008 1.00 67.26  ? 385 ALA 3 CB    1 
ATOM   7668  N  N     . SER C  3  386 ? -29.079  53.612  346.346 1.00 65.93  ? 386 SER 3 N     1 
ATOM   7669  C  CA    . SER C  3  386 ? -29.766  52.343  346.169 1.00 55.93  ? 386 SER 3 CA    1 
ATOM   7670  C  C     . SER C  3  386 ? -30.440  51.948  347.473 1.00 47.74  ? 386 SER 3 C     1 
ATOM   7671  O  O     . SER C  3  386 ? -29.952  52.247  348.566 1.00 39.39  ? 386 SER 3 O     1 
ATOM   7672  C  CB    . SER C  3  386 ? -28.799  51.244  345.723 1.00 52.89  ? 386 SER 3 CB    1 
ATOM   7673  O  OG    . SER C  3  386 ? -29.365  49.954  345.890 1.00 52.96  ? 386 SER 3 OG    1 
ATOM   7674  N  N     . LEU C  3  387 ? -31.592  51.293  347.350 1.00 52.01  ? 387 LEU 3 N     1 
ATOM   7675  C  CA    . LEU C  3  387 ? -32.357  50.936  348.539 1.00 63.79  ? 387 LEU 3 CA    1 
ATOM   7676  C  C     . LEU C  3  387 ? -31.617  49.911  349.391 1.00 79.26  ? 387 LEU 3 C     1 
ATOM   7677  O  O     . LEU C  3  387 ? -31.664  49.965  350.626 1.00 87.08  ? 387 LEU 3 O     1 
ATOM   7678  C  CB    . LEU C  3  387 ? -33.738  50.429  348.130 1.00 58.86  ? 387 LEU 3 CB    1 
ATOM   7679  C  CG    . LEU C  3  387 ? -34.511  51.502  347.364 1.00 46.67  ? 387 LEU 3 CG    1 
ATOM   7680  C  CD1   . LEU C  3  387 ? -35.928  51.058  347.056 1.00 38.23  ? 387 LEU 3 CD1   1 
ATOM   7681  C  CD2   . LEU C  3  387 ? -34.489  52.803  348.130 1.00 42.53  ? 387 LEU 3 CD2   1 
ATOM   7682  N  N     . GLU C  3  388 ? -30.942  48.956  348.760 1.00 84.53  ? 388 GLU 3 N     1 
ATOM   7683  C  CA    . GLU C  3  388 ? -30.110  48.057  349.548 1.00 92.63  ? 388 GLU 3 CA    1 
ATOM   7684  C  C     . GLU C  3  388 ? -28.952  48.811  350.197 1.00 86.96  ? 388 GLU 3 C     1 
ATOM   7685  O  O     . GLU C  3  388 ? -28.501  48.431  351.284 1.00 87.60  ? 388 GLU 3 O     1 
ATOM   7686  C  CB    . GLU C  3  388 ? -29.628  46.891  348.685 1.00 103.96 ? 388 GLU 3 CB    1 
ATOM   7687  C  CG    . GLU C  3  388 ? -30.771  45.949  348.314 1.00 112.62 ? 388 GLU 3 CG    1 
ATOM   7688  C  CD    . GLU C  3  388 ? -30.323  44.746  347.515 1.00 119.46 ? 388 GLU 3 CD    1 
ATOM   7689  O  OE1   . GLU C  3  388 ? -29.160  44.726  347.065 1.00 122.38 ? 388 GLU 3 OE1   1 
ATOM   7690  O  OE2   . GLU C  3  388 ? -31.136  43.815  347.341 1.00 120.86 ? 388 GLU 3 OE2   1 
ATOM   7691  N  N     . ASP C  3  389 ? -28.474  49.890  349.565 1.00 79.47  ? 389 ASP 3 N     1 
ATOM   7692  C  CA    . ASP C  3  389 ? -27.550  50.787  350.255 1.00 72.51  ? 389 ASP 3 CA    1 
ATOM   7693  C  C     . ASP C  3  389 ? -28.220  51.441  351.453 1.00 62.75  ? 389 ASP 3 C     1 
ATOM   7694  O  O     . ASP C  3  389 ? -27.550  51.760  352.441 1.00 64.36  ? 389 ASP 3 O     1 
ATOM   7695  C  CB    . ASP C  3  389 ? -27.002  51.855  349.306 1.00 72.97  ? 389 ASP 3 CB    1 
ATOM   7696  C  CG    . ASP C  3  389 ? -26.246  51.265  348.133 1.00 77.38  ? 389 ASP 3 CG    1 
ATOM   7697  O  OD1   . ASP C  3  389 ? -25.861  50.081  348.211 1.00 80.96  ? 389 ASP 3 OD1   1 
ATOM   7698  O  OD2   . ASP C  3  389 ? -26.021  51.991  347.141 1.00 76.64  ? 389 ASP 3 OD2   1 
ATOM   7699  N  N     . LEU C  3  390 ? -29.538  51.650  351.386 1.00 52.84  ? 390 LEU 3 N     1 
ATOM   7700  C  CA    . LEU C  3  390 ? -30.263  52.126  352.560 1.00 50.59  ? 390 LEU 3 CA    1 
ATOM   7701  C  C     . LEU C  3  390 ? -30.245  51.085  353.667 1.00 44.84  ? 390 LEU 3 C     1 
ATOM   7702  O  O     . LEU C  3  390 ? -30.079  51.424  354.844 1.00 44.72  ? 390 LEU 3 O     1 
ATOM   7703  C  CB    . LEU C  3  390 ? -31.702  52.485  352.201 1.00 53.45  ? 390 LEU 3 CB    1 
ATOM   7704  C  CG    . LEU C  3  390 ? -32.519  52.918  353.415 1.00 55.52  ? 390 LEU 3 CG    1 
ATOM   7705  C  CD1   . LEU C  3  390 ? -32.179  54.346  353.806 1.00 59.91  ? 390 LEU 3 CD1   1 
ATOM   7706  C  CD2   . LEU C  3  390 ? -34.016  52.734  353.180 1.00 57.21  ? 390 LEU 3 CD2   1 
ATOM   7707  N  N     . LEU C  3  391 ? -30.430  49.811  353.318 1.00 46.02  ? 391 LEU 3 N     1 
ATOM   7708  C  CA    . LEU C  3  391 ? -30.342  48.783  354.350 1.00 58.68  ? 391 LEU 3 CA    1 
ATOM   7709  C  C     . LEU C  3  391 ? -28.935  48.711  354.926 1.00 64.33  ? 391 LEU 3 C     1 
ATOM   7710  O  O     . LEU C  3  391 ? -28.765  48.465  356.125 1.00 66.96  ? 391 LEU 3 O     1 
ATOM   7711  C  CB    . LEU C  3  391 ? -30.763  47.421  353.797 1.00 65.97  ? 391 LEU 3 CB    1 
ATOM   7712  C  CG    . LEU C  3  391 ? -32.216  47.332  353.340 1.00 73.90  ? 391 LEU 3 CG    1 
ATOM   7713  C  CD1   . LEU C  3  391 ? -32.586  45.899  352.980 1.00 76.29  ? 391 LEU 3 CD1   1 
ATOM   7714  C  CD2   . LEU C  3  391 ? -33.137  47.892  354.405 1.00 78.49  ? 391 LEU 3 CD2   1 
ATOM   7715  N  N     . GLN C  3  392 ? -27.922  48.938  354.094 1.00 66.49  ? 392 GLN 3 N     1 
ATOM   7716  C  CA    . GLN C  3  392 ? -26.553  49.055  354.574 1.00 72.73  ? 392 GLN 3 CA    1 
ATOM   7717  C  C     . GLN C  3  392 ? -26.229  50.439  355.123 1.00 85.97  ? 392 GLN 3 C     1 
ATOM   7718  O  O     . GLN C  3  392 ? -25.133  50.630  355.662 1.00 93.29  ? 392 GLN 3 O     1 
ATOM   7719  C  CB    . GLN C  3  392 ? -25.570  48.698  353.455 1.00 65.72  ? 392 GLN 3 CB    1 
ATOM   7720  C  CG    . GLN C  3  392 ? -25.735  47.286  352.930 1.00 64.58  ? 392 GLN 3 CG    1 
ATOM   7721  C  CD    . GLN C  3  392 ? -24.885  46.292  353.689 1.00 74.29  ? 392 GLN 3 CD    1 
ATOM   7722  O  OE1   . GLN C  3  392 ? -24.713  46.406  354.902 1.00 80.93  ? 392 GLN 3 OE1   1 
ATOM   7723  N  NE2   . GLN C  3  392 ? -24.343  45.314  352.977 1.00 77.38  ? 392 GLN 3 NE2   1 
ATOM   7724  N  N     . ALA C  3  393 ? -27.138  51.402  354.996 1.00 86.67  ? 393 ALA 3 N     1 
ATOM   7725  C  CA    . ALA C  3  393 ? -26.886  52.736  355.518 1.00 84.66  ? 393 ALA 3 CA    1 
ATOM   7726  C  C     . ALA C  3  393 ? -26.842  52.718  357.041 1.00 86.23  ? 393 ALA 3 C     1 
ATOM   7727  O  O     . ALA C  3  393 ? -27.358  51.809  357.699 1.00 86.66  ? 393 ALA 3 O     1 
ATOM   7728  C  CB    . ALA C  3  393 ? -27.957  53.715  355.043 1.00 81.69  ? 393 ALA 3 CB    1 
ATOM   7729  N  N     . ASP C  3  394 ? -26.215  53.748  357.600 1.00 86.64  ? 394 ASP 3 N     1 
ATOM   7730  C  CA    . ASP C  3  394 ? -26.066  53.868  359.044 1.00 88.20  ? 394 ASP 3 CA    1 
ATOM   7731  C  C     . ASP C  3  394 ? -27.207  54.652  359.674 1.00 88.19  ? 394 ASP 3 C     1 
ATOM   7732  O  O     . ASP C  3  394 ? -27.690  54.287  360.751 1.00 94.54  ? 394 ASP 3 O     1 
ATOM   7733  C  CB    . ASP C  3  394 ? -24.732  54.537  359.373 1.00 91.31  ? 394 ASP 3 CB    1 
ATOM   7734  C  CG    . ASP C  3  394 ? -23.558  53.820  358.745 1.00 96.35  ? 394 ASP 3 CG    1 
ATOM   7735  O  OD1   . ASP C  3  394 ? -23.650  52.594  358.529 1.00 100.45 ? 394 ASP 3 OD1   1 
ATOM   7736  O  OD2   . ASP C  3  394 ? -22.548  54.481  358.449 1.00 96.57  ? 394 ASP 3 OD2   1 
ATOM   7737  N  N     . PHE C  3  395 ? -27.642  55.727  359.025 1.00 81.27  ? 395 PHE 3 N     1 
ATOM   7738  C  CA    . PHE C  3  395 ? -28.648  56.607  359.593 1.00 73.65  ? 395 PHE 3 CA    1 
ATOM   7739  C  C     . PHE C  3  395 ? -29.553  57.121  358.484 1.00 74.67  ? 395 PHE 3 C     1 
ATOM   7740  O  O     . PHE C  3  395 ? -29.128  57.283  357.337 1.00 82.71  ? 395 PHE 3 O     1 
ATOM   7741  C  CB    . PHE C  3  395 ? -27.988  57.775  360.336 1.00 65.28  ? 395 PHE 3 CB    1 
ATOM   7742  C  CG    . PHE C  3  395 ? -28.914  58.505  361.252 1.00 61.12  ? 395 PHE 3 CG    1 
ATOM   7743  C  CD1   . PHE C  3  395 ? -29.226  57.989  362.492 1.00 62.76  ? 395 PHE 3 CD1   1 
ATOM   7744  C  CD2   . PHE C  3  395 ? -29.465  59.712  360.879 1.00 60.50  ? 395 PHE 3 CD2   1 
ATOM   7745  C  CE1   . PHE C  3  395 ? -30.081  58.661  363.339 1.00 63.45  ? 395 PHE 3 CE1   1 
ATOM   7746  C  CE2   . PHE C  3  395 ? -30.318  60.387  361.726 1.00 61.50  ? 395 PHE 3 CE2   1 
ATOM   7747  C  CZ    . PHE C  3  395 ? -30.623  59.859  362.955 1.00 61.67  ? 395 PHE 3 CZ    1 
ATOM   7748  N  N     . ALA C  3  396 ? -30.808  57.388  358.840 1.00 63.61  ? 396 ALA 3 N     1 
ATOM   7749  C  CA    . ALA C  3  396 ? -31.822  57.806  357.877 1.00 49.12  ? 396 ALA 3 CA    1 
ATOM   7750  C  C     . ALA C  3  396 ? -32.494  59.065  358.404 1.00 48.16  ? 396 ALA 3 C     1 
ATOM   7751  O  O     . ALA C  3  396 ? -33.301  58.997  359.339 1.00 47.40  ? 396 ALA 3 O     1 
ATOM   7752  C  CB    . ALA C  3  396 ? -32.847  56.696  357.643 1.00 45.91  ? 396 ALA 3 CB    1 
ATOM   7753  N  N     . LEU C  3  397 ? -32.161  60.210  357.812 1.00 51.49  ? 397 LEU 3 N     1 
ATOM   7754  C  CA    . LEU C  3  397 ? -32.740  61.491  358.212 1.00 50.59  ? 397 LEU 3 CA    1 
ATOM   7755  C  C     . LEU C  3  397 ? -33.834  61.855  357.217 1.00 50.55  ? 397 LEU 3 C     1 
ATOM   7756  O  O     . LEU C  3  397 ? -33.546  62.129  356.050 1.00 54.16  ? 397 LEU 3 O     1 
ATOM   7757  C  CB    . LEU C  3  397 ? -31.684  62.589  358.279 1.00 47.68  ? 397 LEU 3 CB    1 
ATOM   7758  C  CG    . LEU C  3  397 ? -32.311  63.961  358.512 1.00 46.48  ? 397 LEU 3 CG    1 
ATOM   7759  C  CD1   . LEU C  3  397 ? -33.169  63.947  359.771 1.00 47.72  ? 397 LEU 3 CD1   1 
ATOM   7760  C  CD2   . LEU C  3  397 ? -31.251  65.043  358.582 1.00 46.42  ? 397 LEU 3 CD2   1 
ATOM   7761  N  N     . VAL C  3  398 ? -35.081  61.882  357.679 1.00 46.50  ? 398 VAL 3 N     1 
ATOM   7762  C  CA    . VAL C  3  398 ? -36.247  61.959  356.808 1.00 52.63  ? 398 VAL 3 CA    1 
ATOM   7763  C  C     . VAL C  3  398 ? -36.952  63.287  357.028 1.00 59.47  ? 398 VAL 3 C     1 
ATOM   7764  O  O     . VAL C  3  398 ? -37.161  63.711  358.171 1.00 66.69  ? 398 VAL 3 O     1 
ATOM   7765  C  CB    . VAL C  3  398 ? -37.211  60.787  357.060 1.00 53.56  ? 398 VAL 3 CB    1 
ATOM   7766  C  CG1   . VAL C  3  398 ? -38.277  60.732  355.978 1.00 52.09  ? 398 VAL 3 CG1   1 
ATOM   7767  C  CG2   . VAL C  3  398 ? -36.445  59.469  357.145 1.00 54.51  ? 398 VAL 3 CG2   1 
ATOM   7768  N  N     . LEU C  3  399 ? -37.321  63.935  355.926 1.00 61.37  ? 399 LEU 3 N     1 
ATOM   7769  C  CA    . LEU C  3  399 ? -38.182  65.115  355.920 1.00 64.65  ? 399 LEU 3 CA    1 
ATOM   7770  C  C     . LEU C  3  399 ? -39.250  64.878  354.863 1.00 74.93  ? 399 LEU 3 C     1 
ATOM   7771  O  O     . LEU C  3  399 ? -38.938  64.809  353.670 1.00 82.12  ? 399 LEU 3 O     1 
ATOM   7772  C  CB    . LEU C  3  399 ? -37.395  66.390  355.638 1.00 62.48  ? 399 LEU 3 CB    1 
ATOM   7773  C  CG    . LEU C  3  399 ? -36.386  66.726  356.732 1.00 71.48  ? 399 LEU 3 CG    1 
ATOM   7774  C  CD1   . LEU C  3  399 ? -35.016  66.119  356.458 1.00 75.10  ? 399 LEU 3 CD1   1 
ATOM   7775  C  CD2   . LEU C  3  399 ? -36.310  68.220  356.960 1.00 76.88  ? 399 LEU 3 CD2   1 
ATOM   7776  N  N     . GLY C  3  400 ? -40.496  64.755  355.294 1.00 75.04  ? 400 GLY 3 N     1 
ATOM   7777  C  CA    . GLY C  3  400 ? -41.570  64.254  354.463 1.00 73.30  ? 400 GLY 3 CA    1 
ATOM   7778  C  C     . GLY C  3  400 ? -42.090  62.929  354.996 1.00 76.75  ? 400 GLY 3 C     1 
ATOM   7779  O  O     . GLY C  3  400 ? -41.565  62.356  355.951 1.00 78.81  ? 400 GLY 3 O     1 
ATOM   7780  N  N     . ASP C  3  401 ? -43.164  62.445  354.369 1.00 80.06  ? 401 ASP 3 N     1 
ATOM   7781  C  CA    . ASP C  3  401 ? -43.890  61.288  354.887 1.00 81.53  ? 401 ASP 3 CA    1 
ATOM   7782  C  C     . ASP C  3  401 ? -43.724  60.104  353.938 1.00 68.68  ? 401 ASP 3 C     1 
ATOM   7783  O  O     . ASP C  3  401 ? -44.461  59.989  352.947 1.00 63.21  ? 401 ASP 3 O     1 
ATOM   7784  C  CB    . ASP C  3  401 ? -45.370  61.627  355.085 1.00 89.99  ? 401 ASP 3 CB    1 
ATOM   7785  C  CG    . ASP C  3  401 ? -46.110  60.578  355.898 1.00 95.47  ? 401 ASP 3 CG    1 
ATOM   7786  O  OD1   . ASP C  3  401 ? -45.448  59.671  356.438 1.00 97.54  ? 401 ASP 3 OD1   1 
ATOM   7787  O  OD2   . ASP C  3  401 ? -47.353  60.656  356.000 1.00 96.87  ? 401 ASP 3 OD2   1 
ATOM   7788  N  N     . PRO C  3  402 ? -42.750  59.218  354.177 1.00 62.69  ? 402 PRO 3 N     1 
ATOM   7789  C  CA    . PRO C  3  402 ? -42.580  58.037  353.315 1.00 62.05  ? 402 PRO 3 CA    1 
ATOM   7790  C  C     . PRO C  3  402 ? -43.842  57.228  353.092 1.00 70.81  ? 402 PRO 3 C     1 
ATOM   7791  O  O     . PRO C  3  402 ? -44.008  56.657  352.006 1.00 80.40  ? 402 PRO 3 O     1 
ATOM   7792  C  CB    . PRO C  3  402 ? -41.520  57.214  354.060 1.00 59.36  ? 402 PRO 3 CB    1 
ATOM   7793  C  CG    . PRO C  3  402 ? -40.823  58.175  354.981 1.00 61.38  ? 402 PRO 3 CG    1 
ATOM   7794  C  CD    . PRO C  3  402 ? -41.543  59.489  354.973 1.00 62.71  ? 402 PRO 3 CD    1 
ATOM   7795  N  N     . THR C  3  403 ? -44.722  57.128  354.089 1.00 67.31  ? 403 THR 3 N     1 
ATOM   7796  C  CA    . THR C  3  403 ? -45.961  56.383  353.898 1.00 67.24  ? 403 THR 3 CA    1 
ATOM   7797  C  C     . THR C  3  403 ? -46.733  56.906  352.692 1.00 74.52  ? 403 THR 3 C     1 
ATOM   7798  O  O     . THR C  3  403 ? -47.415  56.135  352.008 1.00 73.09  ? 403 THR 3 O     1 
ATOM   7799  C  CB    . THR C  3  403 ? -46.829  56.452  355.163 1.00 64.97  ? 403 THR 3 CB    1 
ATOM   7800  O  OG1   . THR C  3  403 ? -46.074  55.997  356.290 1.00 57.96  ? 403 THR 3 OG1   1 
ATOM   7801  C  CG2   . THR C  3  403 ? -48.063  55.575  355.033 1.00 70.47  ? 403 THR 3 CG2   1 
ATOM   7802  N  N     . GLU C  3  404 ? -46.618  58.202  352.400 1.00 81.40  ? 404 GLU 3 N     1 
ATOM   7803  C  CA    . GLU C  3  404 ? -47.326  58.812  351.282 1.00 82.90  ? 404 GLU 3 CA    1 
ATOM   7804  C  C     . GLU C  3  404 ? -46.456  59.029  350.045 1.00 80.08  ? 404 GLU 3 C     1 
ATOM   7805  O  O     . GLU C  3  404 ? -46.853  58.639  348.944 1.00 85.00  ? 404 GLU 3 O     1 
ATOM   7806  C  CB    . GLU C  3  404 ? -47.944  60.145  351.721 1.00 88.01  ? 404 GLU 3 CB    1 
ATOM   7807  C  CG    . GLU C  3  404 ? -48.970  59.997  352.828 1.00 97.59  ? 404 GLU 3 CG    1 
ATOM   7808  C  CD    . GLU C  3  404 ? -50.142  59.130  352.417 1.00 106.35 ? 404 GLU 3 CD    1 
ATOM   7809  O  OE1   . GLU C  3  404 ? -50.596  59.245  351.261 1.00 106.97 ? 404 GLU 3 OE1   1 
ATOM   7810  O  OE2   . GLU C  3  404 ? -50.615  58.330  353.251 1.00 110.03 ? 404 GLU 3 OE2   1 
ATOM   7811  N  N     . GLU C  3  405 ? -45.268  59.623  350.196 1.00 72.40  ? 405 GLU 3 N     1 
ATOM   7812  C  CA    . GLU C  3  405 ? -44.494  60.025  349.021 1.00 70.43  ? 405 GLU 3 CA    1 
ATOM   7813  C  C     . GLU C  3  405 ? -43.726  58.867  348.390 1.00 78.28  ? 405 GLU 3 C     1 
ATOM   7814  O  O     . GLU C  3  405 ? -43.698  58.741  347.160 1.00 80.35  ? 405 GLU 3 O     1 
ATOM   7815  C  CB    . GLU C  3  405 ? -43.537  61.154  349.386 1.00 71.72  ? 405 GLU 3 CB    1 
ATOM   7816  C  CG    . GLU C  3  405 ? -44.205  62.347  350.020 1.00 81.44  ? 405 GLU 3 CG    1 
ATOM   7817  C  CD    . GLU C  3  405 ? -43.332  63.573  349.938 1.00 90.81  ? 405 GLU 3 CD    1 
ATOM   7818  O  OE1   . GLU C  3  405 ? -42.686  63.760  348.889 1.00 92.19  ? 405 GLU 3 OE1   1 
ATOM   7819  O  OE2   . GLU C  3  405 ? -43.298  64.356  350.905 1.00 94.53  ? 405 GLU 3 OE2   1 
ATOM   7820  N  N     . ALA C  3  406 ? -43.108  58.010  349.199 1.00 79.03  ? 406 ALA 3 N     1 
ATOM   7821  C  CA    . ALA C  3  406 ? -42.318  56.878  348.708 1.00 68.11  ? 406 ALA 3 CA    1 
ATOM   7822  C  C     . ALA C  3  406 ? -42.776  55.642  349.468 1.00 64.95  ? 406 ALA 3 C     1 
ATOM   7823  O  O     . ALA C  3  406 ? -42.121  55.208  350.425 1.00 70.84  ? 406 ALA 3 O     1 
ATOM   7824  C  CB    . ALA C  3  406 ? -40.819  57.122  348.884 1.00 64.53  ? 406 ALA 3 CB    1 
ATOM   7825  N  N     . PRO C  3  407 ? -43.908  55.056  349.071 1.00 56.04  ? 407 PRO 3 N     1 
ATOM   7826  C  CA    . PRO C  3  407 ? -44.552  54.043  349.928 1.00 57.70  ? 407 PRO 3 CA    1 
ATOM   7827  C  C     . PRO C  3  407 ? -43.659  52.880  350.333 1.00 55.19  ? 407 PRO 3 C     1 
ATOM   7828  O  O     . PRO C  3  407 ? -43.515  52.600  351.530 1.00 52.16  ? 407 PRO 3 O     1 
ATOM   7829  C  CB    . PRO C  3  407 ? -45.733  53.592  349.063 1.00 60.05  ? 407 PRO 3 CB    1 
ATOM   7830  C  CG    . PRO C  3  407 ? -46.074  54.806  348.252 1.00 54.68  ? 407 PRO 3 CG    1 
ATOM   7831  C  CD    . PRO C  3  407 ? -44.745  55.418  347.913 1.00 52.70  ? 407 PRO 3 CD    1 
ATOM   7832  N  N     . ILE C  3  408 ? -43.041  52.197  349.364 1.00 58.17  ? 408 ILE 3 N     1 
ATOM   7833  C  CA    . ILE C  3  408 ? -42.304  50.973  349.661 1.00 66.26  ? 408 ILE 3 CA    1 
ATOM   7834  C  C     . ILE C  3  408 ? -41.087  51.236  350.533 1.00 70.33  ? 408 ILE 3 C     1 
ATOM   7835  O  O     . ILE C  3  408 ? -40.587  50.309  351.182 1.00 74.22  ? 408 ILE 3 O     1 
ATOM   7836  C  CB    . ILE C  3  408 ? -41.883  50.262  348.362 1.00 67.38  ? 408 ILE 3 CB    1 
ATOM   7837  C  CG1   . ILE C  3  408 ? -40.977  51.164  347.517 1.00 61.70  ? 408 ILE 3 CG1   1 
ATOM   7838  C  CG2   . ILE C  3  408 ? -43.114  49.831  347.582 1.00 72.73  ? 408 ILE 3 CG2   1 
ATOM   7839  C  CD1   . ILE C  3  408 ? -39.497  50.808  347.600 1.00 56.74  ? 408 ILE 3 CD1   1 
ATOM   7840  N  N     . LEU C  3  409 ? -40.600  52.479  350.574 1.00 71.15  ? 409 LEU 3 N     1 
ATOM   7841  C  CA    . LEU C  3  409 ? -39.536  52.820  351.511 1.00 74.22  ? 409 LEU 3 CA    1 
ATOM   7842  C  C     . LEU C  3  409 ? -39.927  52.426  352.925 1.00 70.55  ? 409 LEU 3 C     1 
ATOM   7843  O  O     . LEU C  3  409 ? -39.123  51.842  353.662 1.00 70.49  ? 409 LEU 3 O     1 
ATOM   7844  C  CB    . LEU C  3  409 ? -39.226  54.317  351.437 1.00 80.56  ? 409 LEU 3 CB    1 
ATOM   7845  C  CG    . LEU C  3  409 ? -38.248  54.728  350.343 1.00 85.00  ? 409 LEU 3 CG    1 
ATOM   7846  C  CD1   . LEU C  3  409 ? -37.610  56.065  350.675 1.00 84.06  ? 409 LEU 3 CD1   1 
ATOM   7847  C  CD2   . LEU C  3  409 ? -37.197  53.647  350.193 1.00 91.38  ? 409 LEU 3 CD2   1 
ATOM   7848  N  N     . HIS C  3  410 ? -41.181  52.702  353.295 1.00 66.43  ? 410 HIS 3 N     1 
ATOM   7849  C  CA    . HIS C  3  410 ? -41.741  52.263  354.564 1.00 67.15  ? 410 HIS 3 CA    1 
ATOM   7850  C  C     . HIS C  3  410 ? -41.359  50.812  354.822 1.00 67.47  ? 410 HIS 3 C     1 
ATOM   7851  O  O     . HIS C  3  410 ? -40.704  50.488  355.820 1.00 74.32  ? 410 HIS 3 O     1 
ATOM   7852  C  CB    . HIS C  3  410 ? -43.265  52.457  354.521 1.00 74.24  ? 410 HIS 3 CB    1 
ATOM   7853  C  CG    . HIS C  3  410 ? -43.981  52.074  355.779 1.00 86.20  ? 410 HIS 3 CG    1 
ATOM   7854  N  ND1   . HIS C  3  410 ? -44.940  52.879  356.357 1.00 91.44  ? 410 HIS 3 ND1   1 
ATOM   7855  C  CD2   . HIS C  3  410 ? -43.891  50.974  356.564 1.00 92.29  ? 410 HIS 3 CD2   1 
ATOM   7856  C  CE1   . HIS C  3  410 ? -45.407  52.292  357.444 1.00 92.78  ? 410 HIS 3 CE1   1 
ATOM   7857  N  NE2   . HIS C  3  410 ? -44.784  51.136  357.593 1.00 92.66  ? 410 HIS 3 NE2   1 
ATOM   7858  N  N     . LEU C  3  411 ? -41.691  49.939  353.871 1.00 62.89  ? 411 LEU 3 N     1 
ATOM   7859  C  CA    . LEU C  3  411 ? -41.395  48.521  354.035 1.00 67.76  ? 411 LEU 3 CA    1 
ATOM   7860  C  C     . LEU C  3  411 ? -39.892  48.292  354.139 1.00 81.75  ? 411 LEU 3 C     1 
ATOM   7861  O  O     . LEU C  3  411 ? -39.419  47.568  355.024 1.00 88.41  ? 411 LEU 3 O     1 
ATOM   7862  C  CB    . LEU C  3  411 ? -41.980  47.722  352.868 1.00 62.89  ? 411 LEU 3 CB    1 
ATOM   7863  C  CG    . LEU C  3  411 ? -43.438  47.956  352.457 1.00 56.76  ? 411 LEU 3 CG    1 
ATOM   7864  C  CD1   . LEU C  3  411 ? -43.891  46.834  351.540 1.00 49.15  ? 411 LEU 3 CD1   1 
ATOM   7865  C  CD2   . LEU C  3  411 ? -44.388  48.127  353.642 1.00 59.60  ? 411 LEU 3 CD2   1 
ATOM   7866  N  N     . ARG C  3  412 ? -39.122  48.914  353.239 1.00 85.43  ? 412 ARG 3 N     1 
ATOM   7867  C  CA    . ARG C  3  412 ? -37.670  48.811  353.315 1.00 85.23  ? 412 ARG 3 CA    1 
ATOM   7868  C  C     . ARG C  3  412 ? -37.160  49.366  354.634 1.00 89.80  ? 412 ARG 3 C     1 
ATOM   7869  O  O     . ARG C  3  412 ? -36.189  48.849  355.203 1.00 97.11  ? 412 ARG 3 O     1 
ATOM   7870  C  CB    . ARG C  3  412 ? -37.025  49.521  352.126 1.00 82.02  ? 412 ARG 3 CB    1 
ATOM   7871  C  CG    . ARG C  3  412 ? -37.557  49.043  350.790 1.00 81.40  ? 412 ARG 3 CG    1 
ATOM   7872  C  CD    . ARG C  3  412 ? -37.478  47.526  350.686 1.00 82.83  ? 412 ARG 3 CD    1 
ATOM   7873  N  NE    . ARG C  3  412 ? -37.089  47.076  349.354 1.00 82.37  ? 412 ARG 3 NE    1 
ATOM   7874  C  CZ    . ARG C  3  412 ? -35.963  46.427  349.084 1.00 82.87  ? 412 ARG 3 CZ    1 
ATOM   7875  N  NH1   . ARG C  3  412 ? -35.111  46.135  350.058 1.00 86.79  ? 412 ARG 3 NH1   1 
ATOM   7876  N  NH2   . ARG C  3  412 ? -35.695  46.055  347.841 1.00 79.66  ? 412 ARG 3 NH2   1 
ATOM   7877  N  N     . LEU C  3  413 ? -37.811  50.415  355.139 1.00 85.00  ? 413 LEU 3 N     1 
ATOM   7878  C  CA    . LEU C  3  413 ? -37.437  50.951  356.440 1.00 82.59  ? 413 LEU 3 CA    1 
ATOM   7879  C  C     . LEU C  3  413 ? -37.651  49.907  357.524 1.00 87.22  ? 413 LEU 3 C     1 
ATOM   7880  O  O     . LEU C  3  413 ? -36.833  49.774  358.444 1.00 84.22  ? 413 LEU 3 O     1 
ATOM   7881  C  CB    . LEU C  3  413 ? -38.238  52.219  356.729 1.00 78.86  ? 413 LEU 3 CB    1 
ATOM   7882  C  CG    . LEU C  3  413 ? -37.693  53.456  356.016 1.00 77.17  ? 413 LEU 3 CG    1 
ATOM   7883  C  CD1   . LEU C  3  413 ? -38.674  54.614  356.087 1.00 75.22  ? 413 LEU 3 CD1   1 
ATOM   7884  C  CD2   . LEU C  3  413 ? -36.351  53.840  356.618 1.00 80.44  ? 413 LEU 3 CD2   1 
ATOM   7885  N  N     . SER C  3  414 ? -38.734  49.134  357.410 1.00 94.86  ? 414 SER 3 N     1 
ATOM   7886  C  CA    . SER C  3  414 ? -38.935  48.010  358.313 1.00 98.67  ? 414 SER 3 CA    1 
ATOM   7887  C  C     . SER C  3  414 ? -37.753  47.053  358.264 1.00 98.33  ? 414 SER 3 C     1 
ATOM   7888  O  O     . SER C  3  414 ? -37.320  46.539  359.300 1.00 102.86 ? 414 SER 3 O     1 
ATOM   7889  C  CB    . SER C  3  414 ? -40.225  47.282  357.951 1.00 95.77  ? 414 SER 3 CB    1 
ATOM   7890  O  OG    . SER C  3  414 ? -40.485  46.199  358.825 1.00 93.59  ? 414 SER 3 OG    1 
ATOM   7891  N  N     . GLU C  3  415 ? -37.182  46.836  357.078 1.00 88.42  ? 415 GLU 3 N     1 
ATOM   7892  C  CA    . GLU C  3  415 ? -35.976  46.023  357.020 1.00 80.65  ? 415 GLU 3 CA    1 
ATOM   7893  C  C     . GLU C  3  415 ? -34.811  46.748  357.670 1.00 76.06  ? 415 GLU 3 C     1 
ATOM   7894  O  O     . GLU C  3  415 ? -34.053  46.153  358.443 1.00 80.82  ? 415 GLU 3 O     1 
ATOM   7895  C  CB    . GLU C  3  415 ? -35.628  45.657  355.577 1.00 83.67  ? 415 GLU 3 CB    1 
ATOM   7896  C  CG    . GLU C  3  415 ? -36.686  44.879  354.830 1.00 88.60  ? 415 GLU 3 CG    1 
ATOM   7897  C  CD    . GLU C  3  415 ? -36.101  44.146  353.641 1.00 91.71  ? 415 GLU 3 CD    1 
ATOM   7898  O  OE1   . GLU C  3  415 ? -35.637  44.817  352.698 1.00 90.63  ? 415 GLU 3 OE1   1 
ATOM   7899  O  OE2   . GLU C  3  415 ? -36.072  42.900  353.667 1.00 92.81  ? 415 GLU 3 OE2   1 
ATOM   7900  N  N     . PHE C  3  416 ? -34.685  48.048  357.412 1.00 70.91  ? 416 PHE 3 N     1 
ATOM   7901  C  CA    . PHE C  3  416 ? -33.553  48.791  357.952 1.00 75.01  ? 416 PHE 3 CA    1 
ATOM   7902  C  C     . PHE C  3  416 ? -33.643  48.894  359.470 1.00 79.06  ? 416 PHE 3 C     1 
ATOM   7903  O  O     . PHE C  3  416 ? -32.669  48.614  360.178 1.00 82.51  ? 416 PHE 3 O     1 
ATOM   7904  C  CB    . PHE C  3  416 ? -33.474  50.168  357.293 1.00 77.96  ? 416 PHE 3 CB    1 
ATOM   7905  C  CG    . PHE C  3  416 ? -32.656  51.160  358.056 1.00 81.36  ? 416 PHE 3 CG    1 
ATOM   7906  C  CD1   . PHE C  3  416 ? -31.304  50.957  358.258 1.00 82.69  ? 416 PHE 3 CD1   1 
ATOM   7907  C  CD2   . PHE C  3  416 ? -33.233  52.312  358.547 1.00 81.67  ? 416 PHE 3 CD2   1 
ATOM   7908  C  CE1   . PHE C  3  416 ? -30.550  51.873  358.962 1.00 82.69  ? 416 PHE 3 CE1   1 
ATOM   7909  C  CE2   . PHE C  3  416 ? -32.484  53.229  359.245 1.00 81.24  ? 416 PHE 3 CE2   1 
ATOM   7910  C  CZ    . PHE C  3  416 ? -31.142  53.009  359.450 1.00 82.33  ? 416 PHE 3 CZ    1 
ATOM   7911  N  N     . VAL C  3  417 ? -34.811  49.282  359.989 1.00 78.01  ? 417 VAL 3 N     1 
ATOM   7912  C  CA    . VAL C  3  417 ? -34.942  49.538  361.419 1.00 79.14  ? 417 VAL 3 CA    1 
ATOM   7913  C  C     . VAL C  3  417 ? -34.754  48.272  362.250 1.00 82.08  ? 417 VAL 3 C     1 
ATOM   7914  O  O     . VAL C  3  417 ? -34.454  48.362  363.445 1.00 88.76  ? 417 VAL 3 O     1 
ATOM   7915  C  CB    . VAL C  3  417 ? -36.304  50.198  361.714 1.00 77.49  ? 417 VAL 3 CB    1 
ATOM   7916  C  CG1   . VAL C  3  417 ? -37.403  49.152  361.860 1.00 81.01  ? 417 VAL 3 CG1   1 
ATOM   7917  C  CG2   . VAL C  3  417 ? -36.220  51.071  362.952 1.00 76.45  ? 417 VAL 3 CG2   1 
ATOM   7918  N  N     . ARG C  3  418 ? -34.897  47.090  361.648 1.00 78.43  ? 418 ARG 3 N     1 
ATOM   7919  C  CA    . ARG C  3  418 ? -34.741  45.826  362.355 1.00 79.95  ? 418 ARG 3 CA    1 
ATOM   7920  C  C     . ARG C  3  418 ? -33.341  45.240  362.208 1.00 95.95  ? 418 ARG 3 C     1 
ATOM   7921  O  O     . ARG C  3  418 ? -33.147  44.050  362.480 1.00 100.94 ? 418 ARG 3 O     1 
ATOM   7922  C  CB    . ARG C  3  418 ? -35.775  44.809  361.871 1.00 67.86  ? 418 ARG 3 CB    1 
ATOM   7923  C  CG    . ARG C  3  418 ? -37.228  45.189  362.103 1.00 59.28  ? 418 ARG 3 CG    1 
ATOM   7924  C  CD    . ARG C  3  418 ? -38.144  44.247  361.333 1.00 52.80  ? 418 ARG 3 CD    1 
ATOM   7925  N  NE    . ARG C  3  418 ? -38.141  44.555  359.907 1.00 49.11  ? 418 ARG 3 NE    1 
ATOM   7926  C  CZ    . ARG C  3  418 ? -38.694  43.792  358.970 1.00 48.47  ? 418 ARG 3 CZ    1 
ATOM   7927  N  NH1   . ARG C  3  418 ? -39.294  42.659  359.298 1.00 57.19  ? 418 ARG 3 NH1   1 
ATOM   7928  N  NH2   . ARG C  3  418 ? -38.633  44.157  357.699 1.00 47.40  ? 418 ARG 3 NH2   1 
ATOM   7929  N  N     . ASP C  3  419 ? -32.373  46.039  361.756 1.00 103.34 ? 419 ASP 3 N     1 
ATOM   7930  C  CA    . ASP C  3  419 ? -30.997  45.609  361.522 1.00 107.87 ? 419 ASP 3 CA    1 
ATOM   7931  C  C     . ASP C  3  419 ? -30.880  44.593  360.393 1.00 100.82 ? 419 ASP 3 C     1 
ATOM   7932  O  O     . ASP C  3  419 ? -29.859  43.905  360.287 1.00 104.17 ? 419 ASP 3 O     1 
ATOM   7933  C  CB    . ASP C  3  419 ? -30.349  45.039  362.793 1.00 114.05 ? 419 ASP 3 CB    1 
ATOM   7934  C  CG    . ASP C  3  419 ? -29.418  46.025  363.471 1.00 113.73 ? 419 ASP 3 CG    1 
ATOM   7935  O  OD1   . ASP C  3  419 ? -29.266  47.151  362.961 1.00 110.69 ? 419 ASP 3 OD1   1 
ATOM   7936  O  OD2   . ASP C  3  419 ? -28.827  45.669  364.510 1.00 114.26 ? 419 ASP 3 OD2   1 
ATOM   7937  N  N     . LEU C  3  420 ? -31.903  44.465  359.548 1.00 87.59  ? 420 LEU 3 N     1 
ATOM   7938  C  CA    . LEU C  3  420 ? -31.805  43.548  358.425 1.00 75.46  ? 420 LEU 3 CA    1 
ATOM   7939  C  C     . LEU C  3  420 ? -30.687  43.982  357.480 1.00 81.63  ? 420 LEU 3 C     1 
ATOM   7940  O  O     . LEU C  3  420 ? -30.159  45.094  357.546 1.00 82.67  ? 420 LEU 3 O     1 
ATOM   7941  C  CB    . LEU C  3  420 ? -33.130  43.436  357.672 1.00 62.45  ? 420 LEU 3 CB    1 
ATOM   7942  C  CG    . LEU C  3  420 ? -34.266  42.797  358.465 1.00 60.03  ? 420 LEU 3 CG    1 
ATOM   7943  C  CD1   . LEU C  3  420 ? -35.501  42.581  357.604 1.00 58.57  ? 420 LEU 3 CD1   1 
ATOM   7944  C  CD2   . LEU C  3  420 ? -33.786  41.487  359.046 1.00 64.32  ? 420 LEU 3 CD2   1 
ATOM   7945  N  N     . LYS C  3  421 ? -30.335  43.071  356.588 1.00 86.03  ? 421 LYS 3 N     1 
ATOM   7946  C  CA    . LYS C  3  421 ? -29.225  43.234  355.668 1.00 87.19  ? 421 LYS 3 CA    1 
ATOM   7947  C  C     . LYS C  3  421 ? -29.655  42.682  354.320 1.00 86.85  ? 421 LYS 3 C     1 
ATOM   7948  O  O     . LYS C  3  421 ? -30.641  41.941  354.237 1.00 85.87  ? 421 LYS 3 O     1 
ATOM   7949  C  CB    . LYS C  3  421 ? -27.990  42.490  356.196 1.00 88.51  ? 421 LYS 3 CB    1 
ATOM   7950  C  CG    . LYS C  3  421 ? -27.121  43.331  357.108 1.00 91.02  ? 421 LYS 3 CG    1 
ATOM   7951  C  CD    . LYS C  3  421 ? -26.686  42.532  358.324 1.00 97.01  ? 421 LYS 3 CD    1 
ATOM   7952  C  CE    . LYS C  3  421 ? -26.265  43.446  359.464 1.00 102.97 ? 421 LYS 3 CE    1 
ATOM   7953  N  NZ    . LYS C  3  421 ? -25.632  42.695  360.586 1.00 104.91 ? 421 LYS 3 NZ    1 
ATOM   7954  N  N     . PRO C  3  422 ? -28.967  43.053  353.245 1.00 87.86  ? 422 PRO 3 N     1 
ATOM   7955  C  CA    . PRO C  3  422 ? -29.323  42.526  351.927 1.00 84.00  ? 422 PRO 3 CA    1 
ATOM   7956  C  C     . PRO C  3  422 ? -29.266  41.010  351.930 1.00 82.67  ? 422 PRO 3 C     1 
ATOM   7957  O  O     . PRO C  3  422 ? -28.308  40.416  352.448 1.00 80.19  ? 422 PRO 3 O     1 
ATOM   7958  C  CB    . PRO C  3  422 ? -28.251  43.127  351.006 1.00 85.22  ? 422 PRO 3 CB    1 
ATOM   7959  C  CG    . PRO C  3  422 ? -27.823  44.371  351.721 1.00 89.15  ? 422 PRO 3 CG    1 
ATOM   7960  C  CD    . PRO C  3  422 ? -27.849  44.007  353.167 1.00 90.33  ? 422 PRO 3 CD    1 
ATOM   7961  N  N     . PRO C  3  423 ? -30.278  40.345  351.381 1.00 84.31  ? 423 PRO 3 N     1 
ATOM   7962  C  CA    . PRO C  3  423 ? -30.333  38.885  351.486 1.00 91.67  ? 423 PRO 3 CA    1 
ATOM   7963  C  C     . PRO C  3  423 ? -29.213  38.234  350.691 1.00 103.19 ? 423 PRO 3 C     1 
ATOM   7964  O  O     . PRO C  3  423 ? -28.605  38.835  349.804 1.00 107.17 ? 423 PRO 3 O     1 
ATOM   7965  C  CB    . PRO C  3  423 ? -31.705  38.537  350.901 1.00 87.38  ? 423 PRO 3 CB    1 
ATOM   7966  C  CG    . PRO C  3  423 ? -32.013  39.667  349.977 1.00 86.08  ? 423 PRO 3 CG    1 
ATOM   7967  C  CD    . PRO C  3  423 ? -31.392  40.892  350.588 1.00 85.23  ? 423 PRO 3 CD    1 
ATOM   7968  N  N     . HIS C  3  424 ? -28.933  36.984  351.038 1.00 112.86 ? 424 HIS 3 N     1 
ATOM   7969  C  CA    . HIS C  3  424 ? -28.012  36.188  350.243 1.00 122.47 ? 424 HIS 3 CA    1 
ATOM   7970  C  C     . HIS C  3  424 ? -28.694  35.769  348.947 1.00 116.33 ? 424 HIS 3 C     1 
ATOM   7971  O  O     . HIS C  3  424 ? -29.875  35.412  348.939 1.00 116.36 ? 424 HIS 3 O     1 
ATOM   7972  C  CB    . HIS C  3  424 ? -27.550  34.969  351.042 1.00 136.25 ? 424 HIS 3 CB    1 
ATOM   7973  C  CG    . HIS C  3  424 ? -26.971  35.315  352.379 1.00 149.61 ? 424 HIS 3 CG    1 
ATOM   7974  N  ND1   . HIS C  3  424 ? -25.708  35.848  352.531 1.00 151.60 ? 424 HIS 3 ND1   1 
ATOM   7975  C  CD2   . HIS C  3  424 ? -27.493  35.222  353.626 1.00 152.26 ? 424 HIS 3 CD2   1 
ATOM   7976  C  CE1   . HIS C  3  424 ? -25.473  36.058  353.814 1.00 153.67 ? 424 HIS 3 CE1   1 
ATOM   7977  N  NE2   . HIS C  3  424 ? -26.540  35.687  354.499 1.00 153.23 ? 424 HIS 3 NE2   1 
ATOM   7978  N  N     . ARG C  3  425 ? -27.950  35.816  347.847 1.00 112.92 ? 425 ARG 3 N     1 
ATOM   7979  C  CA    . ARG C  3  425 ? -28.514  35.598  346.517 1.00 112.90 ? 425 ARG 3 CA    1 
ATOM   7980  C  C     . ARG C  3  425 ? -28.239  34.158  346.100 1.00 120.69 ? 425 ARG 3 C     1 
ATOM   7981  O  O     . ARG C  3  425 ? -27.113  33.809  345.739 1.00 125.95 ? 425 ARG 3 O     1 
ATOM   7982  C  CB    . ARG C  3  425 ? -27.936  36.586  345.510 1.00 107.92 ? 425 ARG 3 CB    1 
ATOM   7983  C  CG    . ARG C  3  425 ? -28.965  37.539  344.934 1.00 109.57 ? 425 ARG 3 CG    1 
ATOM   7984  C  CD    . ARG C  3  425 ? -29.735  36.862  343.815 1.00 113.49 ? 425 ARG 3 CD    1 
ATOM   7985  N  NE    . ARG C  3  425 ? -30.637  37.771  343.117 1.00 118.04 ? 425 ARG 3 NE    1 
ATOM   7986  C  CZ    . ARG C  3  425 ? -31.153  37.529  341.916 1.00 120.50 ? 425 ARG 3 CZ    1 
ATOM   7987  N  NH1   . ARG C  3  425 ? -30.856  36.405  341.279 1.00 117.52 ? 425 ARG 3 NH1   1 
ATOM   7988  N  NH2   . ARG C  3  425 ? -31.968  38.408  341.352 1.00 124.44 ? 425 ARG 3 NH2   1 
ATOM   7989  N  N     . TYR C  3  426 ? -29.274  33.320  346.152 1.00 122.30 ? 426 TYR 3 N     1 
ATOM   7990  C  CA    . TYR C  3  426 ? -29.143  31.915  345.800 1.00 123.90 ? 426 TYR 3 CA    1 
ATOM   7991  C  C     . TYR C  3  426 ? -29.506  31.715  344.328 1.00 121.33 ? 426 TYR 3 C     1 
ATOM   7992  O  O     . TYR C  3  426 ? -29.809  32.665  343.602 1.00 124.01 ? 426 TYR 3 O     1 
ATOM   7993  C  CB    . TYR C  3  426 ? -29.998  31.044  346.721 1.00 123.36 ? 426 TYR 3 CB    1 
ATOM   7994  C  CG    . TYR C  3  426 ? -29.646  31.194  348.186 1.00 120.86 ? 426 TYR 3 CG    1 
ATOM   7995  C  CD1   . TYR C  3  426 ? -30.053  32.302  348.910 1.00 121.51 ? 426 TYR 3 CD1   1 
ATOM   7996  C  CD2   . TYR C  3  426 ? -28.860  30.252  348.828 1.00 118.94 ? 426 TYR 3 CD2   1 
ATOM   7997  C  CE1   . TYR C  3  426 ? -29.722  32.449  350.239 1.00 123.24 ? 426 TYR 3 CE1   1 
ATOM   7998  C  CE2   . TYR C  3  426 ? -28.517  30.397  350.158 1.00 120.56 ? 426 TYR 3 CE2   1 
ATOM   7999  C  CZ    . TYR C  3  426 ? -28.953  31.497  350.860 1.00 123.33 ? 426 TYR 3 CZ    1 
ATOM   8000  O  OH    . TYR C  3  426 ? -28.625  31.659  352.186 1.00 125.26 ? 426 TYR 3 OH    1 
ATOM   8001  N  N     . ASN C  3  427 ? -29.482  30.456  343.877 1.00 114.76 ? 427 ASN 3 N     1 
ATOM   8002  C  CA    . ASN C  3  427 ? -29.830  30.165  342.488 1.00 111.43 ? 427 ASN 3 CA    1 
ATOM   8003  C  C     . ASN C  3  427 ? -31.299  30.434  342.197 1.00 102.25 ? 427 ASN 3 C     1 
ATOM   8004  O  O     . ASN C  3  427 ? -31.650  30.787  341.067 1.00 102.72 ? 427 ASN 3 O     1 
ATOM   8005  C  CB    . ASN C  3  427 ? -29.492  28.715  342.146 1.00 119.60 ? 427 ASN 3 CB    1 
ATOM   8006  C  CG    . ASN C  3  427 ? -28.043  28.535  341.750 1.00 127.81 ? 427 ASN 3 CG    1 
ATOM   8007  O  OD1   . ASN C  3  427 ? -27.268  29.491  341.738 1.00 133.16 ? 427 ASN 3 OD1   1 
ATOM   8008  N  ND2   . ASN C  3  427 ? -27.668  27.303  341.425 1.00 128.25 ? 427 ASN 3 ND2   1 
ATOM   8009  N  N     . HIS C  3  428 ? -32.163  30.290  343.198 1.00 92.42  ? 428 HIS 3 N     1 
ATOM   8010  C  CA    . HIS C  3  428 ? -33.581  30.581  343.054 1.00 80.28  ? 428 HIS 3 CA    1 
ATOM   8011  C  C     . HIS C  3  428 ? -33.924  31.966  343.589 1.00 84.08  ? 428 HIS 3 C     1 
ATOM   8012  O  O     . HIS C  3  428 ? -35.053  32.210  344.025 1.00 83.48  ? 428 HIS 3 O     1 
ATOM   8013  C  CB    . HIS C  3  428 ? -34.433  29.499  343.722 1.00 67.82  ? 428 HIS 3 CB    1 
ATOM   8014  C  CG    . HIS C  3  428 ? -34.025  29.162  345.124 1.00 51.11  ? 428 HIS 3 CG    1 
ATOM   8015  N  ND1   . HIS C  3  428 ? -32.747  28.759  345.453 1.00 51.13  ? 428 HIS 3 ND1   1 
ATOM   8016  C  CD2   . HIS C  3  428 ? -34.736  29.141  346.277 1.00 53.09  ? 428 HIS 3 CD2   1 
ATOM   8017  C  CE1   . HIS C  3  428 ? -32.685  28.522  346.750 1.00 51.34  ? 428 HIS 3 CE1   1 
ATOM   8018  N  NE2   . HIS C  3  428 ? -33.878  28.744  347.273 1.00 55.11  ? 428 HIS 3 NE2   1 
ATOM   8019  N  N     . GLY C  3  429 ? -32.955  32.874  343.568 1.00 87.08  ? 429 GLY 3 N     1 
ATOM   8020  C  CA    . GLY C  3  429 ? -33.250  34.280  343.793 1.00 90.03  ? 429 GLY 3 CA    1 
ATOM   8021  C  C     . GLY C  3  429 ? -33.405  34.571  345.264 1.00 88.46  ? 429 GLY 3 C     1 
ATOM   8022  O  O     . GLY C  3  429 ? -32.531  34.238  346.068 1.00 90.08  ? 429 GLY 3 O     1 
ATOM   8023  N  N     . THR C  3  430 ? -34.512  35.205  345.622 1.00 83.22  ? 430 THR 3 N     1 
ATOM   8024  C  CA    . THR C  3  430 ? -34.770  35.506  347.018 1.00 82.83  ? 430 THR 3 CA    1 
ATOM   8025  C  C     . THR C  3  430 ? -34.867  34.208  347.813 1.00 74.67  ? 430 THR 3 C     1 
ATOM   8026  O  O     . THR C  3  430 ? -35.621  33.307  347.426 1.00 74.24  ? 430 THR 3 O     1 
ATOM   8027  C  CB    . THR C  3  430 ? -36.065  36.303  347.166 1.00 92.07  ? 430 THR 3 CB    1 
ATOM   8028  O  OG1   . THR C  3  430 ? -35.939  37.562  346.493 1.00 94.87  ? 430 THR 3 OG1   1 
ATOM   8029  C  CG2   . THR C  3  430 ? -36.365  36.552  348.631 1.00 97.63  ? 430 THR 3 CG2   1 
ATOM   8030  N  N     . PRO C  3  431 ? -34.123  34.067  348.907 1.00 67.29  ? 431 PRO 3 N     1 
ATOM   8031  C  CA    . PRO C  3  431 ? -34.217  32.840  349.700 1.00 58.88  ? 431 PRO 3 CA    1 
ATOM   8032  C  C     . PRO C  3  431 ? -35.607  32.717  350.301 1.00 63.36  ? 431 PRO 3 C     1 
ATOM   8033  O  O     . PRO C  3  431 ? -36.236  33.713  350.661 1.00 62.56  ? 431 PRO 3 O     1 
ATOM   8034  C  CB    . PRO C  3  431 ? -33.142  33.026  350.776 1.00 59.78  ? 431 PRO 3 CB    1 
ATOM   8035  C  CG    . PRO C  3  431 ? -32.929  34.502  350.844 1.00 66.78  ? 431 PRO 3 CG    1 
ATOM   8036  C  CD    . PRO C  3  431 ? -33.119  34.997  349.448 1.00 71.14  ? 431 PRO 3 CD    1 
ATOM   8037  N  N     . PHE C  3  432 ? -36.091  31.478  350.396 1.00 68.75  ? 432 PHE 3 N     1 
ATOM   8038  C  CA    . PHE C  3  432 ? -37.462  31.260  350.847 1.00 67.15  ? 432 PHE 3 CA    1 
ATOM   8039  C  C     . PHE C  3  432 ? -37.592  31.487  352.347 1.00 61.12  ? 432 PHE 3 C     1 
ATOM   8040  O  O     . PHE C  3  432 ? -38.580  32.068  352.808 1.00 60.22  ? 432 PHE 3 O     1 
ATOM   8041  C  CB    . PHE C  3  432 ? -37.913  29.847  350.478 1.00 69.34  ? 432 PHE 3 CB    1 
ATOM   8042  C  CG    . PHE C  3  432 ? -38.398  29.716  349.063 1.00 70.41  ? 432 PHE 3 CG    1 
ATOM   8043  C  CD1   . PHE C  3  432 ? -38.396  30.805  348.214 1.00 69.17  ? 432 PHE 3 CD1   1 
ATOM   8044  C  CD2   . PHE C  3  432 ? -38.833  28.501  348.575 1.00 74.37  ? 432 PHE 3 CD2   1 
ATOM   8045  C  CE1   . PHE C  3  432 ? -38.834  30.685  346.912 1.00 71.95  ? 432 PHE 3 CE1   1 
ATOM   8046  C  CE2   . PHE C  3  432 ? -39.275  28.380  347.271 1.00 73.91  ? 432 PHE 3 CE2   1 
ATOM   8047  C  CZ    . PHE C  3  432 ? -39.272  29.474  346.442 1.00 72.97  ? 432 PHE 3 CZ    1 
ATOM   8048  N  N     . ALA C  3  433 ? -36.607  31.043  353.124 1.00 56.33  ? 433 ALA 3 N     1 
ATOM   8049  C  CA    . ALA C  3  433 ? -36.620  31.228  354.574 1.00 52.20  ? 433 ALA 3 CA    1 
ATOM   8050  C  C     . ALA C  3  433 ? -35.213  31.605  355.027 1.00 50.04  ? 433 ALA 3 C     1 
ATOM   8051  O  O     . ALA C  3  433 ? -34.372  30.730  355.237 1.00 45.83  ? 433 ALA 3 O     1 
ATOM   8052  C  CB    . ALA C  3  433 ? -37.110  29.968  355.272 1.00 58.07  ? 433 ALA 3 CB    1 
ATOM   8053  N  N     . ASP C  3  434 ? -34.962  32.900  355.193 1.00 56.92  ? 434 ASP 3 N     1 
ATOM   8054  C  CA    . ASP C  3  434 ? -33.666  33.382  355.656 1.00 61.08  ? 434 ASP 3 CA    1 
ATOM   8055  C  C     . ASP C  3  434 ? -33.667  33.435  357.179 1.00 64.33  ? 434 ASP 3 C     1 
ATOM   8056  O  O     . ASP C  3  434 ? -34.446  34.183  357.779 1.00 63.44  ? 434 ASP 3 O     1 
ATOM   8057  C  CB    . ASP C  3  434 ? -33.336  34.754  355.068 1.00 59.92  ? 434 ASP 3 CB    1 
ATOM   8058  C  CG    . ASP C  3  434 ? -31.838  35.018  355.017 1.00 65.30  ? 434 ASP 3 CG    1 
ATOM   8059  O  OD1   . ASP C  3  434 ? -31.079  34.285  355.681 1.00 67.84  ? 434 ASP 3 OD1   1 
ATOM   8060  O  OD2   . ASP C  3  434 ? -31.414  35.954  354.313 1.00 68.84  ? 434 ASP 3 OD2   1 
ATOM   8061  N  N     . LEU C  3  435 ? -32.801  32.628  357.795 1.00 65.81  ? 435 LEU 3 N     1 
ATOM   8062  C  CA    . LEU C  3  435 ? -32.689  32.568  359.249 1.00 59.75  ? 435 LEU 3 CA    1 
ATOM   8063  C  C     . LEU C  3  435 ? -32.391  33.920  359.881 1.00 59.63  ? 435 LEU 3 C     1 
ATOM   8064  O  O     . LEU C  3  435 ? -32.655  34.102  361.072 1.00 54.94  ? 435 LEU 3 O     1 
ATOM   8065  C  CB    . LEU C  3  435 ? -31.588  31.580  359.639 1.00 57.32  ? 435 LEU 3 CB    1 
ATOM   8066  C  CG    . LEU C  3  435 ? -31.807  30.097  359.350 1.00 55.79  ? 435 LEU 3 CG    1 
ATOM   8067  C  CD1   . LEU C  3  435 ? -31.017  29.278  360.344 1.00 52.97  ? 435 LEU 3 CD1   1 
ATOM   8068  C  CD2   . LEU C  3  435 ? -33.280  29.741  359.421 1.00 59.58  ? 435 LEU 3 CD2   1 
ATOM   8069  N  N     . GLN C  3  436 ? -31.850  34.867  359.112 1.00 68.36  ? 436 GLN 3 N     1 
ATOM   8070  C  CA    . GLN C  3  436 ? -31.576  36.202  359.633 1.00 72.61  ? 436 GLN 3 CA    1 
ATOM   8071  C  C     . GLN C  3  436 ? -32.821  36.863  360.211 1.00 75.67  ? 436 GLN 3 C     1 
ATOM   8072  O  O     . GLN C  3  436 ? -32.713  37.721  361.093 1.00 78.83  ? 436 GLN 3 O     1 
ATOM   8073  C  CB    . GLN C  3  436 ? -30.980  37.071  358.522 1.00 72.23  ? 436 GLN 3 CB    1 
ATOM   8074  C  CG    . GLN C  3  436 ? -30.726  38.515  358.906 1.00 73.91  ? 436 GLN 3 CG    1 
ATOM   8075  C  CD    . GLN C  3  436 ? -30.440  39.393  357.705 1.00 80.26  ? 436 GLN 3 CD    1 
ATOM   8076  O  OE1   . GLN C  3  436 ? -30.022  40.539  357.849 1.00 86.96  ? 436 GLN 3 OE1   1 
ATOM   8077  N  NE2   . GLN C  3  436 ? -30.659  38.855  356.510 1.00 77.98  ? 436 GLN 3 NE2   1 
ATOM   8078  N  N     . ILE C  3  437 ? -34.003  36.467  359.756 1.00 76.01  ? 437 ILE 3 N     1 
ATOM   8079  C  CA    . ILE C  3  437 ? -35.254  37.081  360.186 1.00 79.01  ? 437 ILE 3 CA    1 
ATOM   8080  C  C     . ILE C  3  437 ? -35.921  36.153  361.191 1.00 82.91  ? 437 ILE 3 C     1 
ATOM   8081  O  O     . ILE C  3  437 ? -36.439  35.093  360.826 1.00 84.42  ? 437 ILE 3 O     1 
ATOM   8082  C  CB    . ILE C  3  437 ? -36.181  37.378  359.000 1.00 79.93  ? 437 ILE 3 CB    1 
ATOM   8083  C  CG1   . ILE C  3  437 ? -35.398  38.055  357.879 1.00 87.84  ? 437 ILE 3 CG1   1 
ATOM   8084  C  CG2   . ILE C  3  437 ? -37.324  38.280  359.433 1.00 77.32  ? 437 ILE 3 CG2   1 
ATOM   8085  C  CD1   . ILE C  3  437 ? -36.101  38.043  356.540 1.00 93.32  ? 437 ILE 3 CD1   1 
ATOM   8086  N  N     . LYS C  3  438 ? -35.899  36.546  362.459 1.00 86.35  ? 438 LYS 3 N     1 
ATOM   8087  C  CA    . LYS C  3  438 ? -36.706  35.909  363.487 1.00 89.31  ? 438 LYS 3 CA    1 
ATOM   8088  C  C     . LYS C  3  438 ? -38.053  36.618  363.592 1.00 90.97  ? 438 LYS 3 C     1 
ATOM   8089  O  O     . LYS C  3  438 ? -38.275  37.680  363.011 1.00 94.17  ? 438 LYS 3 O     1 
ATOM   8090  C  CB    . LYS C  3  438 ? -35.982  35.917  364.836 1.00 89.81  ? 438 LYS 3 CB    1 
ATOM   8091  C  CG    . LYS C  3  438 ? -34.560  35.378  364.793 1.00 90.61  ? 438 LYS 3 CG    1 
ATOM   8092  C  CD    . LYS C  3  438 ? -34.565  33.862  364.640 1.00 93.17  ? 438 LYS 3 CD    1 
ATOM   8093  C  CE    . LYS C  3  438 ? -33.254  33.237  365.097 1.00 94.22  ? 438 LYS 3 CE    1 
ATOM   8094  N  NZ    . LYS C  3  438 ? -32.173  33.400  364.088 1.00 93.80  ? 438 LYS 3 NZ    1 
ATOM   8095  N  N     . GLU C  3  439 ? -38.966  36.001  364.330 1.00 87.03  ? 439 GLU 3 N     1 
ATOM   8096  C  CA    . GLU C  3  439 ? -40.304  36.545  364.473 1.00 84.51  ? 439 GLU 3 CA    1 
ATOM   8097  C  C     . GLU C  3  439 ? -40.334  37.638  365.537 1.00 86.14  ? 439 GLU 3 C     1 
ATOM   8098  O  O     . GLU C  3  439 ? -39.491  37.687  366.436 1.00 89.61  ? 439 GLU 3 O     1 
ATOM   8099  C  CB    . GLU C  3  439 ? -41.286  35.432  364.840 1.00 87.38  ? 439 GLU 3 CB    1 
ATOM   8100  C  CG    . GLU C  3  439 ? -42.729  35.877  364.905 1.00 95.03  ? 439 GLU 3 CG    1 
ATOM   8101  C  CD    . GLU C  3  439 ? -43.661  34.766  365.308 1.00 100.84 ? 439 GLU 3 CD    1 
ATOM   8102  O  OE1   . GLU C  3  439 ? -43.179  33.656  365.612 1.00 101.52 ? 439 GLU 3 OE1   1 
ATOM   8103  O  OE2   . GLU C  3  439 ? -44.881  35.012  365.343 1.00 103.86 ? 439 GLU 3 OE2   1 
ATOM   8104  N  N     . ARG C  3  440 ? -41.318  38.531  365.413 1.00 83.80  ? 440 ARG 3 N     1 
ATOM   8105  C  CA    . ARG C  3  440 ? -41.549  39.599  366.384 1.00 81.03  ? 440 ARG 3 CA    1 
ATOM   8106  C  C     . ARG C  3  440 ? -40.287  40.429  366.584 1.00 87.27  ? 440 ARG 3 C     1 
ATOM   8107  O  O     . ARG C  3  440 ? -39.836  40.654  367.707 1.00 92.56  ? 440 ARG 3 O     1 
ATOM   8108  C  CB    . ARG C  3  440 ? -42.044  39.032  367.717 1.00 72.26  ? 440 ARG 3 CB    1 
ATOM   8109  C  CG    . ARG C  3  440 ? -43.414  38.379  367.659 1.00 65.22  ? 440 ARG 3 CG    1 
ATOM   8110  C  CD    . ARG C  3  440 ? -44.523  39.413  367.561 1.00 59.62  ? 440 ARG 3 CD    1 
ATOM   8111  N  NE    . ARG C  3  440 ? -44.458  40.387  368.642 1.00 61.18  ? 440 ARG 3 NE    1 
ATOM   8112  C  CZ    . ARG C  3  440 ? -45.292  41.413  368.769 1.00 64.41  ? 440 ARG 3 CZ    1 
ATOM   8113  N  NH1   . ARG C  3  440 ? -46.262  41.598  367.886 1.00 62.26  ? 440 ARG 3 NH1   1 
ATOM   8114  N  NH2   . ARG C  3  440 ? -45.155  42.255  369.783 1.00 68.84  ? 440 ARG 3 NH2   1 
ATOM   8115  N  N     . MET C  3  441 ? -39.705  40.873  365.479 1.00 85.65  ? 441 MET 3 N     1 
ATOM   8116  C  CA    . MET C  3  441 ? -38.412  41.522  365.572 1.00 80.48  ? 441 MET 3 CA    1 
ATOM   8117  C  C     . MET C  3  441 ? -38.541  42.879  366.259 1.00 74.29  ? 441 MET 3 C     1 
ATOM   8118  O  O     . MET C  3  441 ? -39.457  43.652  365.961 1.00 62.71  ? 441 MET 3 O     1 
ATOM   8119  C  CB    . MET C  3  441 ? -37.786  41.683  364.191 1.00 75.34  ? 441 MET 3 CB    1 
ATOM   8120  C  CG    . MET C  3  441 ? -37.114  40.415  363.711 1.00 68.25  ? 441 MET 3 CG    1 
ATOM   8121  S  SD    . MET C  3  441 ? -36.390  40.526  362.070 1.00 62.60  ? 441 MET 3 SD    1 
ATOM   8122  C  CE    . MET C  3  441 ? -34.853  41.353  362.458 1.00 58.40  ? 441 MET 3 CE    1 
ATOM   8123  N  N     . PRO C  3  442 ? -37.641  43.189  367.186 1.00 81.97  ? 442 PRO 3 N     1 
ATOM   8124  C  CA    . PRO C  3  442 ? -37.668  44.496  367.843 1.00 86.85  ? 442 PRO 3 CA    1 
ATOM   8125  C  C     . PRO C  3  442 ? -37.084  45.568  366.941 1.00 89.21  ? 442 PRO 3 C     1 
ATOM   8126  O  O     . PRO C  3  442 ? -36.097  45.346  366.236 1.00 87.83  ? 442 PRO 3 O     1 
ATOM   8127  C  CB    . PRO C  3  442 ? -36.802  44.277  369.086 1.00 91.99  ? 442 PRO 3 CB    1 
ATOM   8128  C  CG    . PRO C  3  442 ? -35.834  43.219  368.663 1.00 92.54  ? 442 PRO 3 CG    1 
ATOM   8129  C  CD    . PRO C  3  442 ? -36.589  42.312  367.728 1.00 88.33  ? 442 PRO 3 CD    1 
ATOM   8130  N  N     . ARG C  3  443 ? -37.705  46.740  366.965 1.00 93.69  ? 443 ARG 3 N     1 
ATOM   8131  C  CA    . ARG C  3  443 ? -37.349  47.822  366.062 1.00 92.73  ? 443 ARG 3 CA    1 
ATOM   8132  C  C     . ARG C  3  443 ? -36.641  48.918  366.842 1.00 99.72  ? 443 ARG 3 C     1 
ATOM   8133  O  O     . ARG C  3  443 ? -37.136  49.374  367.877 1.00 102.92 ? 443 ARG 3 O     1 
ATOM   8134  C  CB    . ARG C  3  443 ? -38.594  48.366  365.362 1.00 81.79  ? 443 ARG 3 CB    1 
ATOM   8135  C  CG    . ARG C  3  443 ? -39.644  47.291  365.175 1.00 73.69  ? 443 ARG 3 CG    1 
ATOM   8136  C  CD    . ARG C  3  443 ? -40.772  47.732  364.283 1.00 65.72  ? 443 ARG 3 CD    1 
ATOM   8137  N  NE    . ARG C  3  443 ? -40.490  47.315  362.919 1.00 63.32  ? 443 ARG 3 NE    1 
ATOM   8138  C  CZ    . ARG C  3  443 ? -41.199  46.411  362.259 1.00 63.08  ? 443 ARG 3 CZ    1 
ATOM   8139  N  NH1   . ARG C  3  443 ? -42.231  45.817  362.838 1.00 56.20  ? 443 ARG 3 NH1   1 
ATOM   8140  N  NH2   . ARG C  3  443 ? -40.867  46.087  361.020 1.00 68.05  ? 443 ARG 3 NH2   1 
ATOM   8141  N  N     . ARG C  3  444 ? -35.482  49.329  366.341 1.00 100.25 ? 444 ARG 3 N     1 
ATOM   8142  C  CA    . ARG C  3  444 ? -34.690  50.351  367.003 1.00 99.41  ? 444 ARG 3 CA    1 
ATOM   8143  C  C     . ARG C  3  444 ? -35.365  51.709  366.889 1.00 96.89  ? 444 ARG 3 C     1 
ATOM   8144  O  O     . ARG C  3  444 ? -35.914  52.066  365.846 1.00 87.75  ? 444 ARG 3 O     1 
ATOM   8145  C  CB    . ARG C  3  444 ? -33.288  50.398  366.397 1.00 102.23 ? 444 ARG 3 CB    1 
ATOM   8146  C  CG    . ARG C  3  444 ? -32.528  49.085  366.524 1.00 109.90 ? 444 ARG 3 CG    1 
ATOM   8147  C  CD    . ARG C  3  444 ? -31.122  49.172  365.952 1.00 118.50 ? 444 ARG 3 CD    1 
ATOM   8148  N  NE    . ARG C  3  444 ? -30.435  50.409  366.309 1.00 126.18 ? 444 ARG 3 NE    1 
ATOM   8149  C  CZ    . ARG C  3  444 ? -29.185  50.687  365.954 1.00 127.90 ? 444 ARG 3 CZ    1 
ATOM   8150  N  NH1   . ARG C  3  444 ? -28.492  49.816  365.235 1.00 129.42 ? 444 ARG 3 NH1   1 
ATOM   8151  N  NH2   . ARG C  3  444 ? -28.625  51.833  366.315 1.00 125.49 ? 444 ARG 3 NH2   1 
ATOM   8152  N  N     . THR C  3  445 ? -35.339  52.461  367.982 1.00 108.09 ? 445 THR 3 N     1 
ATOM   8153  C  CA    . THR C  3  445 ? -35.830  53.830  367.991 1.00 118.71 ? 445 THR 3 CA    1 
ATOM   8154  C  C     . THR C  3  445 ? -34.733  54.842  367.688 1.00 118.45 ? 445 THR 3 C     1 
ATOM   8155  O  O     . THR C  3  445 ? -35.025  56.036  367.560 1.00 119.97 ? 445 THR 3 O     1 
ATOM   8156  C  CB    . THR C  3  445 ? -36.468  54.150  369.349 1.00 128.34 ? 445 THR 3 CB    1 
ATOM   8157  O  OG1   . THR C  3  445 ? -35.489  54.007  370.384 1.00 132.86 ? 445 THR 3 OG1   1 
ATOM   8158  C  CG2   . THR C  3  445 ? -37.628  53.206  369.633 1.00 129.73 ? 445 THR 3 CG2   1 
ATOM   8159  N  N     . ASP C  3  446 ? -33.487  54.386  367.552 1.00 113.82 ? 446 ASP 3 N     1 
ATOM   8160  C  CA    . ASP C  3  446 ? -32.336  55.256  367.371 1.00 108.54 ? 446 ASP 3 CA    1 
ATOM   8161  C  C     . ASP C  3  446 ? -31.788  55.261  365.955 1.00 103.02 ? 446 ASP 3 C     1 
ATOM   8162  O  O     . ASP C  3  446 ? -30.929  56.095  365.650 1.00 106.42 ? 446 ASP 3 O     1 
ATOM   8163  C  CB    . ASP C  3  446 ? -31.200  54.841  368.315 1.00 108.36 ? 446 ASP 3 CB    1 
ATOM   8164  C  CG    . ASP C  3  446 ? -30.546  53.540  367.893 1.00 104.92 ? 446 ASP 3 CG    1 
ATOM   8165  O  OD1   . ASP C  3  446 ? -31.273  52.568  367.607 1.00 103.69 ? 446 ASP 3 OD1   1 
ATOM   8166  O  OD2   . ASP C  3  446 ? -29.300  53.492  367.832 1.00 103.18 ? 446 ASP 3 OD2   1 
ATOM   8167  N  N     . LYS C  3  447 ? -32.252  54.367  365.089 1.00 94.40  ? 447 LYS 3 N     1 
ATOM   8168  C  CA    . LYS C  3  447 ? -31.644  54.195  363.779 1.00 84.31  ? 447 LYS 3 CA    1 
ATOM   8169  C  C     . LYS C  3  447 ? -32.284  55.049  362.697 1.00 70.84  ? 447 LYS 3 C     1 
ATOM   8170  O  O     . LYS C  3  447 ? -31.820  55.015  361.556 1.00 68.02  ? 447 LYS 3 O     1 
ATOM   8171  C  CB    . LYS C  3  447 ? -31.705  52.724  363.358 1.00 88.87  ? 447 LYS 3 CB    1 
ATOM   8172  C  CG    . LYS C  3  447 ? -30.416  52.218  362.745 1.00 91.88  ? 447 LYS 3 CG    1 
ATOM   8173  C  CD    . LYS C  3  447 ? -30.446  50.716  362.543 1.00 96.34  ? 447 LYS 3 CD    1 
ATOM   8174  C  CE    . LYS C  3  447 ? -29.164  50.245  361.893 1.00 102.00 ? 447 LYS 3 CE    1 
ATOM   8175  N  NZ    . LYS C  3  447 ? -29.203  48.793  361.607 1.00 106.39 ? 447 LYS 3 NZ    1 
ATOM   8176  N  N     . MET C  3  448 ? -33.309  55.829  363.021 1.00 66.95  ? 448 MET 3 N     1 
ATOM   8177  C  CA    . MET C  3  448 ? -33.909  56.714  362.037 1.00 69.44  ? 448 MET 3 CA    1 
ATOM   8178  C  C     . MET C  3  448 ? -34.447  57.947  362.745 1.00 74.56  ? 448 MET 3 C     1 
ATOM   8179  O  O     . MET C  3  448 ? -34.929  57.867  363.876 1.00 80.19  ? 448 MET 3 O     1 
ATOM   8180  C  CB    . MET C  3  448 ? -35.014  55.993  361.251 1.00 72.70  ? 448 MET 3 CB    1 
ATOM   8181  C  CG    . MET C  3  448 ? -36.219  55.575  362.074 1.00 74.99  ? 448 MET 3 CG    1 
ATOM   8182  S  SD    . MET C  3  448 ? -37.467  54.742  361.076 1.00 74.63  ? 448 MET 3 SD    1 
ATOM   8183  C  CE    . MET C  3  448 ? -38.187  56.120  360.200 1.00 73.31  ? 448 MET 3 CE    1 
ATOM   8184  N  N     . ALA C  3  449 ? -34.363  59.089  362.066 1.00 75.86  ? 449 ALA 3 N     1 
ATOM   8185  C  CA    . ALA C  3  449 ? -34.860  60.351  362.599 1.00 81.74  ? 449 ALA 3 CA    1 
ATOM   8186  C  C     . ALA C  3  449 ? -35.779  60.982  361.567 1.00 79.24  ? 449 ALA 3 C     1 
ATOM   8187  O  O     . ALA C  3  449 ? -35.481  60.957  360.370 1.00 77.52  ? 449 ALA 3 O     1 
ATOM   8188  C  CB    . ALA C  3  449 ? -33.723  61.312  362.945 1.00 84.38  ? 449 ALA 3 CB    1 
ATOM   8189  N  N     . LEU C  3  450 ? -36.901  61.529  362.031 1.00 76.50  ? 450 LEU 3 N     1 
ATOM   8190  C  CA    . LEU C  3  450 ? -37.978  61.954  361.152 1.00 71.24  ? 450 LEU 3 CA    1 
ATOM   8191  C  C     . LEU C  3  450 ? -38.451  63.350  361.529 1.00 75.25  ? 450 LEU 3 C     1 
ATOM   8192  O  O     . LEU C  3  450 ? -38.469  63.726  362.705 1.00 80.43  ? 450 LEU 3 O     1 
ATOM   8193  C  CB    . LEU C  3  450 ? -39.155  60.969  361.212 1.00 63.83  ? 450 LEU 3 CB    1 
ATOM   8194  C  CG    . LEU C  3  450 ? -40.171  60.986  360.070 1.00 61.01  ? 450 LEU 3 CG    1 
ATOM   8195  C  CD1   . LEU C  3  450 ? -40.763  59.604  359.875 1.00 61.73  ? 450 LEU 3 CD1   1 
ATOM   8196  C  CD2   . LEU C  3  450 ? -41.281  61.996  360.320 1.00 63.30  ? 450 LEU 3 CD2   1 
ATOM   8197  N  N     . PHE C  3  451 ? -38.840  64.115  360.510 1.00 73.54  ? 451 PHE 3 N     1 
ATOM   8198  C  CA    . PHE C  3  451 ? -39.483  65.410  360.701 1.00 74.07  ? 451 PHE 3 CA    1 
ATOM   8199  C  C     . PHE C  3  451 ? -40.549  65.573  359.628 1.00 65.56  ? 451 PHE 3 C     1 
ATOM   8200  O  O     . PHE C  3  451 ? -40.229  65.640  358.439 1.00 63.45  ? 451 PHE 3 O     1 
ATOM   8201  C  CB    . PHE C  3  451 ? -38.458  66.545  360.643 1.00 86.01  ? 451 PHE 3 CB    1 
ATOM   8202  C  CG    . PHE C  3  451 ? -37.486  66.525  361.788 1.00 103.30 ? 451 PHE 3 CG    1 
ATOM   8203  C  CD1   . PHE C  3  451 ? -37.754  67.213  362.959 1.00 112.33 ? 451 PHE 3 CD1   1 
ATOM   8204  C  CD2   . PHE C  3  451 ? -36.305  65.811  361.698 1.00 112.19 ? 451 PHE 3 CD2   1 
ATOM   8205  C  CE1   . PHE C  3  451 ? -36.863  67.182  364.019 1.00 119.57 ? 451 PHE 3 CE1   1 
ATOM   8206  C  CE2   . PHE C  3  451 ? -35.413  65.778  362.752 1.00 120.72 ? 451 PHE 3 CE2   1 
ATOM   8207  C  CZ    . PHE C  3  451 ? -35.692  66.465  363.913 1.00 123.07 ? 451 PHE 3 CZ    1 
ATOM   8208  N  N     . ALA C  3  452 ? -41.806  65.647  360.048 1.00 64.32  ? 452 ALA 3 N     1 
ATOM   8209  C  CA    . ALA C  3  452 ? -42.942  65.721  359.145 1.00 64.71  ? 452 ALA 3 CA    1 
ATOM   8210  C  C     . ALA C  3  452 ? -43.892  66.826  359.581 1.00 67.94  ? 452 ALA 3 C     1 
ATOM   8211  O  O     . ALA C  3  452 ? -43.936  67.185  360.763 1.00 74.60  ? 452 ALA 3 O     1 
ATOM   8212  C  CB    . ALA C  3  452 ? -43.702  64.386  359.101 1.00 65.91  ? 452 ALA 3 CB    1 
ATOM   8213  N  N     . PRO C  3  453 ? -44.660  67.392  358.645 1.00 61.25  ? 453 PRO 3 N     1 
ATOM   8214  C  CA    . PRO C  3  453 ? -45.605  68.457  359.016 1.00 61.00  ? 453 PRO 3 CA    1 
ATOM   8215  C  C     . PRO C  3  453 ? -46.750  67.985  359.893 1.00 67.76  ? 453 PRO 3 C     1 
ATOM   8216  O  O     . PRO C  3  453 ? -47.445  68.830  360.473 1.00 70.99  ? 453 PRO 3 O     1 
ATOM   8217  C  CB    . PRO C  3  453 ? -46.120  68.954  357.659 1.00 57.11  ? 453 PRO 3 CB    1 
ATOM   8218  C  CG    . PRO C  3  453 ? -45.886  67.808  356.724 1.00 55.69  ? 453 PRO 3 CG    1 
ATOM   8219  C  CD    . PRO C  3  453 ? -44.619  67.173  357.190 1.00 58.14  ? 453 PRO 3 CD    1 
ATOM   8220  N  N     . TYR C  3  454 ? -46.967  66.678  360.018 1.00 72.22  ? 454 TYR 3 N     1 
ATOM   8221  C  CA    . TYR C  3  454 ? -47.994  66.147  360.899 1.00 77.07  ? 454 TYR 3 CA    1 
ATOM   8222  C  C     . TYR C  3  454 ? -47.425  64.925  361.605 1.00 77.17  ? 454 TYR 3 C     1 
ATOM   8223  O  O     . TYR C  3  454 ? -46.296  64.500  361.342 1.00 69.59  ? 454 TYR 3 O     1 
ATOM   8224  C  CB    . TYR C  3  454 ? -49.278  65.806  360.134 1.00 81.04  ? 454 TYR 3 CB    1 
ATOM   8225  C  CG    . TYR C  3  454 ? -49.098  64.890  358.945 1.00 85.34  ? 454 TYR 3 CG    1 
ATOM   8226  C  CD1   . TYR C  3  454 ? -48.829  65.399  357.685 1.00 84.61  ? 454 TYR 3 CD1   1 
ATOM   8227  C  CD2   . TYR C  3  454 ? -49.211  63.515  359.082 1.00 90.04  ? 454 TYR 3 CD2   1 
ATOM   8228  C  CE1   . TYR C  3  454 ? -48.672  64.566  356.594 1.00 84.87  ? 454 TYR 3 CE1   1 
ATOM   8229  C  CE2   . TYR C  3  454 ? -49.054  62.675  357.994 1.00 91.89  ? 454 TYR 3 CE2   1 
ATOM   8230  C  CZ    . TYR C  3  454 ? -48.785  63.207  356.753 1.00 90.83  ? 454 TYR 3 CZ    1 
ATOM   8231  O  OH    . TYR C  3  454 ? -48.626  62.381  355.665 1.00 95.66  ? 454 TYR 3 OH    1 
ATOM   8232  N  N     . ARG C  3  455 ? -48.219  64.343  362.501 1.00 87.28  ? 455 ARG 3 N     1 
ATOM   8233  C  CA    . ARG C  3  455 ? -47.756  63.172  363.231 1.00 99.51  ? 455 ARG 3 CA    1 
ATOM   8234  C  C     . ARG C  3  455 ? -47.735  61.964  362.305 1.00 109.22 ? 455 ARG 3 C     1 
ATOM   8235  O  O     . ARG C  3  455 ? -48.725  61.232  362.202 1.00 108.91 ? 455 ARG 3 O     1 
ATOM   8236  C  CB    . ARG C  3  455 ? -48.637  62.910  364.456 1.00 102.55 ? 455 ARG 3 CB    1 
ATOM   8237  C  CG    . ARG C  3  455 ? -48.052  61.908  365.443 1.00 104.89 ? 455 ARG 3 CG    1 
ATOM   8238  C  CD    . ARG C  3  455 ? -49.145  61.108  366.123 1.00 109.38 ? 455 ARG 3 CD    1 
ATOM   8239  N  NE    . ARG C  3  455 ? -50.058  60.511  365.155 1.00 110.83 ? 455 ARG 3 NE    1 
ATOM   8240  C  CZ    . ARG C  3  455 ? -51.289  60.103  365.446 1.00 107.80 ? 455 ARG 3 CZ    1 
ATOM   8241  N  NH1   . ARG C  3  455 ? -51.757  60.230  366.679 1.00 109.50 ? 455 ARG 3 NH1   1 
ATOM   8242  N  NH2   . ARG C  3  455 ? -52.054  59.572  364.502 1.00 108.16 ? 455 ARG 3 NH2   1 
ATOM   8243  N  N     . ALA C  3  456 ? -46.613  61.760  361.626 1.00 118.17 ? 456 ALA 3 N     1 
ATOM   8244  C  CA    . ALA C  3  456 ? -46.488  60.655  360.685 1.00 123.19 ? 456 ALA 3 CA    1 
ATOM   8245  C  C     . ALA C  3  456 ? -46.462  59.331  361.442 1.00 124.08 ? 456 ALA 3 C     1 
ATOM   8246  O  O     . ALA C  3  456 ? -45.773  59.222  362.462 1.00 126.34 ? 456 ALA 3 O     1 
ATOM   8247  C  CB    . ALA C  3  456 ? -45.226  60.810  359.845 1.00 124.70 ? 456 ALA 3 CB    1 
ATOM   8248  N  N     . PRO C  3  457 ? -47.216  58.324  360.999 1.00 119.25 ? 457 PRO 3 N     1 
ATOM   8249  C  CA    . PRO C  3  457 ? -47.227  57.033  361.709 1.00 116.33 ? 457 PRO 3 CA    1 
ATOM   8250  C  C     . PRO C  3  457 ? -45.850  56.449  361.985 1.00 111.14 ? 457 PRO 3 C     1 
ATOM   8251  O  O     . PRO C  3  457 ? -45.684  55.737  362.984 1.00 119.84 ? 457 PRO 3 O     1 
ATOM   8252  C  CB    . PRO C  3  457 ? -48.037  56.125  360.773 1.00 118.82 ? 457 PRO 3 CB    1 
ATOM   8253  C  CG    . PRO C  3  457 ? -48.686  57.035  359.749 1.00 119.86 ? 457 PRO 3 CG    1 
ATOM   8254  C  CD    . PRO C  3  457 ? -48.348  58.453  360.069 1.00 120.22 ? 457 PRO 3 CD    1 
ATOM   8255  N  N     . LEU C  3  458 ? -44.855  56.721  361.138 1.00 98.92  ? 458 LEU 3 N     1 
ATOM   8256  C  CA    . LEU C  3  458 ? -43.527  56.168  361.374 1.00 94.79  ? 458 LEU 3 CA    1 
ATOM   8257  C  C     . LEU C  3  458 ? -42.841  56.780  362.584 1.00 95.72  ? 458 LEU 3 C     1 
ATOM   8258  O  O     . LEU C  3  458 ? -41.817  56.249  363.029 1.00 99.66  ? 458 LEU 3 O     1 
ATOM   8259  C  CB    . LEU C  3  458 ? -42.641  56.358  360.146 1.00 91.15  ? 458 LEU 3 CB    1 
ATOM   8260  C  CG    . LEU C  3  458 ? -43.160  55.716  358.867 1.00 90.83  ? 458 LEU 3 CG    1 
ATOM   8261  C  CD1   . LEU C  3  458 ? -43.690  56.807  357.971 1.00 91.17  ? 458 LEU 3 CD1   1 
ATOM   8262  C  CD2   . LEU C  3  458 ? -42.087  54.882  358.180 1.00 89.79  ? 458 LEU 3 CD2   1 
ATOM   8263  N  N     . MET C  3  459 ? -43.382  57.870  363.128 1.00 94.22  ? 459 MET 3 N     1 
ATOM   8264  C  CA    . MET C  3  459 ? -42.800  58.488  364.311 1.00 102.01 ? 459 MET 3 CA    1 
ATOM   8265  C  C     . MET C  3  459 ? -42.740  57.509  365.473 1.00 105.00 ? 459 MET 3 C     1 
ATOM   8266  O  O     . MET C  3  459 ? -41.992  57.731  366.430 1.00 105.22 ? 459 MET 3 O     1 
ATOM   8267  C  CB    . MET C  3  459 ? -43.613  59.725  364.685 1.00 108.18 ? 459 MET 3 CB    1 
ATOM   8268  C  CG    . MET C  3  459 ? -42.998  61.019  364.204 1.00 111.62 ? 459 MET 3 CG    1 
ATOM   8269  S  SD    . MET C  3  459 ? -44.192  62.358  364.172 1.00 116.37 ? 459 MET 3 SD    1 
ATOM   8270  C  CE    . MET C  3  459 ? -43.703  63.197  362.673 1.00 111.36 ? 459 MET 3 CE    1 
ATOM   8271  N  N     . LYS C  3  460 ? -43.528  56.435  365.397 1.00 108.62 ? 460 LYS 3 N     1 
ATOM   8272  C  CA    . LYS C  3  460 ? -43.448  55.350  366.363 1.00 108.95 ? 460 LYS 3 CA    1 
ATOM   8273  C  C     . LYS C  3  460 ? -42.028  54.814  366.484 1.00 108.25 ? 460 LYS 3 C     1 
ATOM   8274  O  O     . LYS C  3  460 ? -41.501  54.665  367.592 1.00 115.41 ? 460 LYS 3 O     1 
ATOM   8275  C  CB    . LYS C  3  460 ? -44.407  54.228  365.955 1.00 108.70 ? 460 LYS 3 CB    1 
ATOM   8276  C  CG    . LYS C  3  460 ? -44.439  53.048  366.911 1.00 112.28 ? 460 LYS 3 CG    1 
ATOM   8277  C  CD    . LYS C  3  460 ? -45.032  53.434  368.251 1.00 118.31 ? 460 LYS 3 CD    1 
ATOM   8278  C  CE    . LYS C  3  460 ? -46.512  53.104  368.306 1.00 121.42 ? 460 LYS 3 CE    1 
ATOM   8279  N  NZ    . LYS C  3  460 ? -47.044  53.174  369.693 1.00 124.27 ? 460 LYS 3 NZ    1 
ATOM   8280  N  N     . TRP C  3  461 ? -41.385  54.527  365.352 1.00 117.56 ? 461 TRP 3 N     1 
ATOM   8281  C  CA    . TRP C  3  461 ? -40.100  53.839  365.371 1.00 106.91 ? 461 TRP 3 CA    1 
ATOM   8282  C  C     . TRP C  3  461 ? -38.919  54.792  365.460 1.00 102.90 ? 461 TRP 3 C     1 
ATOM   8283  O  O     . TRP C  3  461 ? -37.772  54.335  365.481 1.00 102.26 ? 461 TRP 3 O     1 
ATOM   8284  C  CB    . TRP C  3  461 ? -39.931  52.982  364.116 1.00 97.27  ? 461 TRP 3 CB    1 
ATOM   8285  C  CG    . TRP C  3  461 ? -41.114  52.156  363.765 1.00 95.76  ? 461 TRP 3 CG    1 
ATOM   8286  C  CD1   . TRP C  3  461 ? -42.077  51.698  364.609 1.00 97.22  ? 461 TRP 3 CD1   1 
ATOM   8287  C  CD2   . TRP C  3  461 ? -41.460  51.681  362.461 1.00 98.79  ? 461 TRP 3 CD2   1 
ATOM   8288  N  NE1   . TRP C  3  461 ? -43.010  50.973  363.910 1.00 101.60 ? 461 TRP 3 NE1   1 
ATOM   8289  C  CE2   . TRP C  3  461 ? -42.650  50.945  362.588 1.00 103.40 ? 461 TRP 3 CE2   1 
ATOM   8290  C  CE3   . TRP C  3  461 ? -40.879  51.807  361.198 1.00 98.56  ? 461 TRP 3 CE3   1 
ATOM   8291  C  CZ2   . TRP C  3  461 ? -43.269  50.338  361.501 1.00 105.34 ? 461 TRP 3 CZ2   1 
ATOM   8292  C  CZ3   . TRP C  3  461 ? -41.494  51.204  360.120 1.00 97.08  ? 461 TRP 3 CZ3   1 
ATOM   8293  C  CH2   . TRP C  3  461 ? -42.677  50.479  360.278 1.00 99.97  ? 461 TRP 3 CH2   1 
ATOM   8294  N  N     . ALA C  3  462 ? -39.167  56.093  365.509 1.00 100.24 ? 462 ALA 3 N     1 
ATOM   8295  C  CA    . ALA C  3  462 ? -38.114  57.094  365.617 1.00 94.86  ? 462 ALA 3 CA    1 
ATOM   8296  C  C     . ALA C  3  462 ? -38.325  57.832  366.932 1.00 96.90  ? 462 ALA 3 C     1 
ATOM   8297  O  O     . ALA C  3  462 ? -39.206  58.691  367.031 1.00 100.67 ? 462 ALA 3 O     1 
ATOM   8298  C  CB    . ALA C  3  462 ? -38.136  58.049  364.427 1.00 90.45  ? 462 ALA 3 CB    1 
ATOM   8299  N  N     . ALA C  3  463 ? -37.548  57.468  367.953 1.00 96.43  ? 463 ALA 3 N     1 
ATOM   8300  C  CA    . ALA C  3  463 ? -37.585  58.226  369.198 1.00 102.15 ? 463 ALA 3 CA    1 
ATOM   8301  C  C     . ALA C  3  463 ? -37.260  59.692  368.946 1.00 107.51 ? 463 ALA 3 C     1 
ATOM   8302  O  O     . ALA C  3  463 ? -37.911  60.586  369.500 1.00 109.19 ? 463 ALA 3 O     1 
ATOM   8303  C  CB    . ALA C  3  463 ? -36.620  57.624  370.218 1.00 101.68 ? 463 ALA 3 CB    1 
ATOM   8304  N  N     . ILE C  3  464 ? -36.253  59.957  368.116 1.00 104.88 ? 464 ILE 3 N     1 
ATOM   8305  C  CA    . ILE C  3  464 ? -35.930  61.319  367.705 1.00 97.43  ? 464 ILE 3 CA    1 
ATOM   8306  C  C     . ILE C  3  464 ? -36.992  61.720  366.684 1.00 86.09  ? 464 ILE 3 C     1 
ATOM   8307  O  O     . ILE C  3  464 ? -36.867  61.410  365.499 1.00 93.82  ? 464 ILE 3 O     1 
ATOM   8308  C  CB    . ILE C  3  464 ? -34.521  61.417  367.116 1.00 95.57  ? 464 ILE 3 CB    1 
ATOM   8309  C  CG1   . ILE C  3  464 ? -33.474  60.965  368.135 1.00 96.66  ? 464 ILE 3 CG1   1 
ATOM   8310  C  CG2   . ILE C  3  464 ? -34.226  62.844  366.663 1.00 94.86  ? 464 ILE 3 CG2   1 
ATOM   8311  C  CD1   . ILE C  3  464 ? -32.999  59.526  367.931 1.00 93.47  ? 464 ILE 3 CD1   1 
ATOM   8312  N  N     . HIS C  3  465 ? -38.036  62.414  367.131 1.00 86.05  ? 465 HIS 3 N     1 
ATOM   8313  C  CA    . HIS C  3  465 ? -39.116  62.777  366.222 1.00 85.32  ? 465 HIS 3 CA    1 
ATOM   8314  C  C     . HIS C  3  465 ? -39.830  64.020  366.724 1.00 77.59  ? 465 HIS 3 C     1 
ATOM   8315  O  O     . HIS C  3  465 ? -40.211  64.098  367.896 1.00 82.32  ? 465 HIS 3 O     1 
ATOM   8316  C  CB    . HIS C  3  465 ? -40.114  61.626  366.045 1.00 87.72  ? 465 HIS 3 CB    1 
ATOM   8317  C  CG    . HIS C  3  465 ? -40.786  61.186  367.312 1.00 92.72  ? 465 HIS 3 CG    1 
ATOM   8318  N  ND1   . HIS C  3  465 ? -40.150  60.417  368.262 1.00 91.86  ? 465 HIS 3 ND1   1 
ATOM   8319  C  CD2   . HIS C  3  465 ? -42.048  61.378  367.768 1.00 92.84  ? 465 HIS 3 CD2   1 
ATOM   8320  C  CE1   . HIS C  3  465 ? -40.985  60.165  369.254 1.00 93.17  ? 465 HIS 3 CE1   1 
ATOM   8321  N  NE2   . HIS C  3  465 ? -42.143  60.738  368.980 1.00 92.43  ? 465 HIS 3 NE2   1 
ATOM   8322  N  N     . GLU C  3  466 ? -40.046  64.962  365.814 1.00 77.04  ? 466 GLU 3 N     1 
ATOM   8323  C  CA    . GLU C  3  466 ? -40.640  66.252  366.117 1.00 90.94  ? 466 GLU 3 CA    1 
ATOM   8324  C  C     . GLU C  3  466 ? -41.593  66.607  364.994 1.00 92.26  ? 466 GLU 3 C     1 
ATOM   8325  O  O     . GLU C  3  466 ? -41.199  66.600  363.824 1.00 93.03  ? 466 GLU 3 O     1 
ATOM   8326  C  CB    . GLU C  3  466 ? -39.571  67.342  366.244 1.00 95.80  ? 466 GLU 3 CB    1 
ATOM   8327  C  CG    . GLU C  3  466 ? -40.111  68.759  366.318 1.00 97.85  ? 466 GLU 3 CG    1 
ATOM   8328  C  CD    . GLU C  3  466 ? -39.418  69.592  367.375 1.00 103.23 ? 466 GLU 3 CD    1 
ATOM   8329  O  OE1   . GLU C  3  466 ? -39.066  69.042  368.439 1.00 105.50 ? 466 GLU 3 OE1   1 
ATOM   8330  O  OE2   . GLU C  3  466 ? -39.206  70.797  367.133 1.00 104.63 ? 466 GLU 3 OE2   1 
ATOM   8331  N  N     . VAL C  3  467 ? -42.840  66.902  365.339 1.00 88.19  ? 467 VAL 3 N     1 
ATOM   8332  C  CA    . VAL C  3  467 ? -43.819  67.336  364.352 1.00 84.00  ? 467 VAL 3 CA    1 
ATOM   8333  C  C     . VAL C  3  467 ? -43.654  68.842  364.220 1.00 85.17  ? 467 VAL 3 C     1 
ATOM   8334  O  O     . VAL C  3  467 ? -43.910  69.593  365.164 1.00 84.71  ? 467 VAL 3 O     1 
ATOM   8335  C  CB    . VAL C  3  467 ? -45.250  66.972  364.758 1.00 85.07  ? 467 VAL 3 CB    1 
ATOM   8336  C  CG1   . VAL C  3  467 ? -46.230  67.464  363.708 1.00 79.49  ? 467 VAL 3 CG1   1 
ATOM   8337  C  CG2   . VAL C  3  467 ? -45.388  65.480  364.957 1.00 79.75  ? 467 VAL 3 CG2   1 
ATOM   8338  N  N     . HIS C  3  468 ? -43.224  69.286  363.049 1.00 86.37  ? 468 HIS 3 N     1 
ATOM   8339  C  CA    . HIS C  3  468 ? -43.066  70.699  362.775 1.00 90.97  ? 468 HIS 3 CA    1 
ATOM   8340  C  C     . HIS C  3  468 ? -44.260  71.185  361.964 1.00 91.71  ? 468 HIS 3 C     1 
ATOM   8341  O  O     . HIS C  3  468 ? -45.167  70.422  361.625 1.00 94.99  ? 468 HIS 3 O     1 
ATOM   8342  C  CB    . HIS C  3  468 ? -41.735  70.949  362.065 1.00 94.99  ? 468 HIS 3 CB    1 
ATOM   8343  C  CG    . HIS C  3  468 ? -41.555  70.139  360.818 1.00 93.44  ? 468 HIS 3 CG    1 
ATOM   8344  N  ND1   . HIS C  3  468 ? -41.703  70.670  359.554 1.00 95.57  ? 468 HIS 3 ND1   1 
ATOM   8345  C  CD2   . HIS C  3  468 ? -41.227  68.836  360.643 1.00 95.59  ? 468 HIS 3 CD2   1 
ATOM   8346  C  CE1   . HIS C  3  468 ? -41.481  69.728  358.655 1.00 93.57  ? 468 HIS 3 CE1   1 
ATOM   8347  N  NE2   . HIS C  3  468 ? -41.190  68.607  359.289 1.00 93.84  ? 468 HIS 3 NE2   1 
ATOM   8348  N  N     . ARG C  3  469 ? -44.252  72.466  361.641 1.00 86.45  ? 469 ARG 3 N     1 
ATOM   8349  C  CA    . ARG C  3  469 ? -45.294  73.085  360.840 1.00 84.88  ? 469 ARG 3 CA    1 
ATOM   8350  C  C     . ARG C  3  469 ? -44.786  73.464  359.452 1.00 82.91  ? 469 ARG 3 C     1 
ATOM   8351  O  O     . ARG C  3  469 ? -43.576  73.487  359.209 1.00 77.64  ? 469 ARG 3 O     1 
ATOM   8352  C  CB    . ARG C  3  469 ? -45.849  74.306  361.591 1.00 88.38  ? 469 ARG 3 CB    1 
ATOM   8353  C  CG    . ARG C  3  469 ? -44.888  74.910  362.597 1.00 94.55  ? 469 ARG 3 CG    1 
ATOM   8354  C  CD    . ARG C  3  469 ? -45.626  75.872  363.518 1.00 101.84 ? 469 ARG 3 CD    1 
ATOM   8355  N  NE    . ARG C  3  469 ? -44.901  76.117  364.761 1.00 103.76 ? 469 ARG 3 NE    1 
ATOM   8356  C  CZ    . ARG C  3  469 ? -45.096  75.434  365.886 1.00 100.85 ? 469 ARG 3 CZ    1 
ATOM   8357  N  NH1   . ARG C  3  469 ? -45.995  74.460  365.926 1.00 101.87 ? 469 ARG 3 NH1   1 
ATOM   8358  N  NH2   . ARG C  3  469 ? -44.394  75.721  366.972 1.00 99.90  ? 469 ARG 3 NH2   1 
ATOM   8359  N  N     . PRO C  3  470 ? -45.688  73.709  358.498 1.00 92.25  ? 470 PRO 3 N     1 
ATOM   8360  C  CA    . PRO C  3  470 ? -45.259  74.024  357.130 1.00 102.55 ? 470 PRO 3 CA    1 
ATOM   8361  C  C     . PRO C  3  470 ? -44.344  75.239  357.073 1.00 123.37 ? 470 PRO 3 C     1 
ATOM   8362  O  O     . PRO C  3  470 ? -44.335  76.094  357.960 1.00 133.17 ? 470 PRO 3 O     1 
ATOM   8363  C  CB    . PRO C  3  470 ? -46.580  74.292  356.403 1.00 97.27  ? 470 PRO 3 CB    1 
ATOM   8364  C  CG    . PRO C  3  470 ? -47.547  73.418  357.117 1.00 96.30  ? 470 PRO 3 CG    1 
ATOM   8365  C  CD    . PRO C  3  470 ? -47.145  73.489  358.565 1.00 95.70  ? 470 PRO 3 CD    1 
ATOM   8366  N  N     . GLY C  3  471 ? -43.557  75.302  356.000 1.00 130.41 ? 471 GLY 3 N     1 
ATOM   8367  C  CA    . GLY C  3  471 ? -42.618  76.391  355.803 1.00 133.34 ? 471 GLY 3 CA    1 
ATOM   8368  C  C     . GLY C  3  471 ? -41.559  76.506  356.874 1.00 135.38 ? 471 GLY 3 C     1 
ATOM   8369  O  O     . GLY C  3  471 ? -40.900  77.544  356.977 1.00 138.10 ? 471 GLY 3 O     1 
ATOM   8370  N  N     . GLU C  3  472 ? -41.373  75.458  357.679 1.00 134.38 ? 472 GLU 3 N     1 
ATOM   8371  C  CA    . GLU C  3  472 ? -40.382  75.446  358.742 1.00 136.81 ? 472 GLU 3 CA    1 
ATOM   8372  C  C     . GLU C  3  472 ? -39.226  74.495  358.468 1.00 140.60 ? 472 GLU 3 C     1 
ATOM   8373  O  O     . GLU C  3  472 ? -38.203  74.579  359.159 1.00 145.03 ? 472 GLU 3 O     1 
ATOM   8374  C  CB    . GLU C  3  472 ? -41.053  75.066  360.075 1.00 138.89 ? 472 GLU 3 CB    1 
ATOM   8375  C  CG    . GLU C  3  472 ? -40.273  75.407  361.333 1.00 139.38 ? 472 GLU 3 CG    1 
ATOM   8376  C  CD    . GLU C  3  472 ? -41.166  75.503  362.556 1.00 135.92 ? 472 GLU 3 CD    1 
ATOM   8377  O  OE1   . GLU C  3  472 ? -41.895  76.507  362.686 1.00 134.47 ? 472 GLU 3 OE1   1 
ATOM   8378  O  OE2   . GLU C  3  472 ? -41.141  74.569  363.384 1.00 133.73 ? 472 GLU 3 OE2   1 
ATOM   8379  N  N     . GLU C  3  473 ? -39.359  73.611  357.473 1.00 138.82 ? 473 GLU 3 N     1 
ATOM   8380  C  CA    . GLU C  3  473 ? -38.333  72.617  357.169 1.00 133.84 ? 473 GLU 3 CA    1 
ATOM   8381  C  C     . GLU C  3  473 ? -36.964  73.266  357.028 1.00 124.44 ? 473 GLU 3 C     1 
ATOM   8382  O  O     . GLU C  3  473 ? -36.007  72.901  357.719 1.00 120.85 ? 473 GLU 3 O     1 
ATOM   8383  C  CB    . GLU C  3  473 ? -38.695  71.874  355.880 1.00 134.12 ? 473 GLU 3 CB    1 
ATOM   8384  C  CG    . GLU C  3  473 ? -40.051  71.192  355.896 1.00 137.14 ? 473 GLU 3 CG    1 
ATOM   8385  C  CD    . GLU C  3  473 ? -41.176  72.132  355.500 1.00 139.21 ? 473 GLU 3 CD    1 
ATOM   8386  O  OE1   . GLU C  3  473 ? -40.899  73.327  355.264 1.00 138.20 ? 473 GLU 3 OE1   1 
ATOM   8387  O  OE2   . GLU C  3  473 ? -42.337  71.680  355.431 1.00 140.62 ? 473 GLU 3 OE2   1 
ATOM   8388  N  N     . ARG C  3  474 ? -36.869  74.241  356.125 1.00 116.49 ? 474 ARG 3 N     1 
ATOM   8389  C  CA    . ARG C  3  474 ? -35.638  74.949  355.799 1.00 105.50 ? 474 ARG 3 CA    1 
ATOM   8390  C  C     . ARG C  3  474 ? -34.834  75.289  357.051 1.00 100.97 ? 474 ARG 3 C     1 
ATOM   8391  O  O     . ARG C  3  474 ? -33.609  75.135  357.067 1.00 102.33 ? 474 ARG 3 O     1 
ATOM   8392  C  CB    . ARG C  3  474 ? -35.983  76.196  354.979 1.00 102.35 ? 474 ARG 3 CB    1 
ATOM   8393  C  CG    . ARG C  3  474 ? -36.688  77.297  355.758 1.00 103.61 ? 474 ARG 3 CG    1 
ATOM   8394  C  CD    . ARG C  3  474 ? -37.569  78.157  354.862 1.00 103.36 ? 474 ARG 3 CD    1 
ATOM   8395  N  NE    . ARG C  3  474 ? -36.842  78.793  353.772 1.00 100.71 ? 474 ARG 3 NE    1 
ATOM   8396  C  CZ    . ARG C  3  474 ? -37.425  79.505  352.815 1.00 98.12  ? 474 ARG 3 CZ    1 
ATOM   8397  N  NH1   . ARG C  3  474 ? -38.741  79.665  352.815 1.00 99.59  ? 474 ARG 3 NH1   1 
ATOM   8398  N  NH2   . ARG C  3  474 ? -36.697  80.054  351.855 1.00 94.83  ? 474 ARG 3 NH2   1 
ATOM   8399  N  N     . GLU C  3  475 ? -35.511  75.703  358.125 1.00 94.42  ? 475 GLU 3 N     1 
ATOM   8400  C  CA    . GLU C  3  475 ? -34.800  76.024  359.358 1.00 92.53  ? 475 GLU 3 CA    1 
ATOM   8401  C  C     . GLU C  3  475 ? -34.384  74.777  360.131 1.00 90.22  ? 475 GLU 3 C     1 
ATOM   8402  O  O     . GLU C  3  475 ? -33.344  74.796  360.801 1.00 99.63  ? 475 GLU 3 O     1 
ATOM   8403  C  CB    . GLU C  3  475 ? -35.638  76.957  360.228 1.00 97.72  ? 475 GLU 3 CB    1 
ATOM   8404  C  CG    . GLU C  3  475 ? -35.470  78.420  359.836 1.00 108.18 ? 475 GLU 3 CG    1 
ATOM   8405  C  CD    . GLU C  3  475 ? -36.712  79.248  360.069 1.00 119.66 ? 475 GLU 3 CD    1 
ATOM   8406  O  OE1   . GLU C  3  475 ? -37.393  79.032  361.092 1.00 124.93 ? 475 GLU 3 OE1   1 
ATOM   8407  O  OE2   . GLU C  3  475 ? -37.005  80.120  359.224 1.00 121.93 ? 475 GLU 3 OE2   1 
ATOM   8408  N  N     . ILE C  3  476 ? -35.157  73.690  360.058 1.00 79.05  ? 476 ILE 3 N     1 
ATOM   8409  C  CA    . ILE C  3  476 ? -34.675  72.436  360.630 1.00 70.85  ? 476 ILE 3 CA    1 
ATOM   8410  C  C     . ILE C  3  476 ? -33.378  72.027  359.944 1.00 69.56  ? 476 ILE 3 C     1 
ATOM   8411  O  O     . ILE C  3  476 ? -32.406  71.632  360.601 1.00 69.44  ? 476 ILE 3 O     1 
ATOM   8412  C  CB    . ILE C  3  476 ? -35.747  71.330  360.525 1.00 73.83  ? 476 ILE 3 CB    1 
ATOM   8413  C  CG1   . ILE C  3  476 ? -36.895  71.565  361.511 1.00 74.86  ? 476 ILE 3 CG1   1 
ATOM   8414  C  CG2   . ILE C  3  476 ? -35.133  69.950  360.756 1.00 70.78  ? 476 ILE 3 CG2   1 
ATOM   8415  C  CD1   . ILE C  3  476 ? -38.204  71.960  360.860 1.00 73.20  ? 476 ILE 3 CD1   1 
ATOM   8416  N  N     . LEU C  3  477 ? -33.330  72.157  358.615 1.00 89.14  ? 477 LEU 3 N     1 
ATOM   8417  C  CA    . LEU C  3  477 ? -32.109  71.827  357.885 1.00 80.82  ? 477 LEU 3 CA    1 
ATOM   8418  C  C     . LEU C  3  477 ? -30.975  72.769  358.258 1.00 67.20  ? 477 LEU 3 C     1 
ATOM   8419  O  O     . LEU C  3  477 ? -29.821  72.345  358.363 1.00 71.15  ? 477 LEU 3 O     1 
ATOM   8420  C  CB    . LEU C  3  477 ? -32.342  71.867  356.375 1.00 71.07  ? 477 LEU 3 CB    1 
ATOM   8421  C  CG    . LEU C  3  477 ? -33.118  70.718  355.735 1.00 70.40  ? 477 LEU 3 CG    1 
ATOM   8422  C  CD1   . LEU C  3  477 ? -34.599  70.965  355.825 1.00 69.10  ? 477 LEU 3 CD1   1 
ATOM   8423  C  CD2   . LEU C  3  477 ? -32.688  70.502  354.301 1.00 73.58  ? 477 LEU 3 CD2   1 
ATOM   8424  N  N     . LEU C  3  478 ? -31.280  74.055  358.434 1.00 67.74  ? 478 LEU 3 N     1 
ATOM   8425  C  CA    . LEU C  3  478 ? -30.271  74.994  358.909 1.00 78.30  ? 478 LEU 3 CA    1 
ATOM   8426  C  C     . LEU C  3  478 ? -29.660  74.507  360.215 1.00 81.59  ? 478 LEU 3 C     1 
ATOM   8427  O  O     . LEU C  3  478 ? -28.435  74.424  360.352 1.00 82.28  ? 478 LEU 3 O     1 
ATOM   8428  C  CB    . LEU C  3  478 ? -30.887  76.386  359.085 1.00 78.61  ? 478 LEU 3 CB    1 
ATOM   8429  C  CG    . LEU C  3  478 ? -29.966  77.610  359.129 1.00 68.38  ? 478 LEU 3 CG    1 
ATOM   8430  C  CD1   . LEU C  3  478 ? -30.770  78.871  358.868 1.00 74.68  ? 478 LEU 3 CD1   1 
ATOM   8431  C  CD2   . LEU C  3  478 ? -29.224  77.734  360.459 1.00 69.01  ? 478 LEU 3 CD2   1 
ATOM   8432  N  N     . ALA C  3  479 ? -30.509  74.169  361.186 1.00 81.79  ? 479 ALA 3 N     1 
ATOM   8433  C  CA    . ALA C  3  479 ? -30.005  73.730  362.482 1.00 84.88  ? 479 ALA 3 CA    1 
ATOM   8434  C  C     . ALA C  3  479 ? -29.189  72.451  362.346 1.00 84.95  ? 479 ALA 3 C     1 
ATOM   8435  O  O     . ALA C  3  479 ? -28.182  72.268  363.040 1.00 87.19  ? 479 ALA 3 O     1 
ATOM   8436  C  CB    . ALA C  3  479 ? -31.165  73.536  363.458 1.00 86.86  ? 479 ALA 3 CB    1 
ATOM   8437  N  N     . LEU C  3  480 ? -29.604  71.559  361.446 1.00 82.43  ? 480 LEU 3 N     1 
ATOM   8438  C  CA    . LEU C  3  480 ? -28.831  70.347  361.196 1.00 87.60  ? 480 LEU 3 CA    1 
ATOM   8439  C  C     . LEU C  3  480 ? -27.485  70.656  360.552 1.00 97.83  ? 480 LEU 3 C     1 
ATOM   8440  O  O     . LEU C  3  480 ? -26.519  69.910  360.749 1.00 104.10 ? 480 LEU 3 O     1 
ATOM   8441  C  CB    . LEU C  3  480 ? -29.637  69.387  360.321 1.00 84.13  ? 480 LEU 3 CB    1 
ATOM   8442  C  CG    . LEU C  3  480 ? -30.961  68.966  360.954 1.00 78.98  ? 480 LEU 3 CG    1 
ATOM   8443  C  CD1   . LEU C  3  480 ? -31.865  68.277  359.947 1.00 68.14  ? 480 LEU 3 CD1   1 
ATOM   8444  C  CD2   . LEU C  3  480 ? -30.713  68.082  362.166 1.00 77.24  ? 480 LEU 3 CD2   1 
ATOM   8445  N  N     . LEU C  3  481 ? -27.400  71.746  359.789 1.00 100.14 ? 481 LEU 3 N     1 
ATOM   8446  C  CA    . LEU C  3  481 ? -26.131  72.125  359.178 1.00 104.72 ? 481 LEU 3 CA    1 
ATOM   8447  C  C     . LEU C  3  481 ? -25.101  72.504  360.231 1.00 109.92 ? 481 LEU 3 C     1 
ATOM   8448  O  O     . LEU C  3  481 ? -23.902  72.275  360.035 1.00 108.17 ? 481 LEU 3 O     1 
ATOM   8449  C  CB    . LEU C  3  481 ? -26.347  73.284  358.202 1.00 102.52 ? 481 LEU 3 CB    1 
ATOM   8450  C  CG    . LEU C  3  481 ? -26.992  72.942  356.858 1.00 96.84  ? 481 LEU 3 CG    1 
ATOM   8451  C  CD1   . LEU C  3  481 ? -27.511  74.197  356.171 1.00 98.53  ? 481 LEU 3 CD1   1 
ATOM   8452  C  CD2   . LEU C  3  481 ? -25.998  72.215  355.967 1.00 89.78  ? 481 LEU 3 CD2   1 
ATOM   8453  N  N     . GLY C  3  482 ? -25.545  73.069  361.350 1.00 113.69 ? 482 GLY 3 N     1 
ATOM   8454  C  CA    . GLY C  3  482 ? -24.659  73.444  362.429 1.00 114.85 ? 482 GLY 3 CA    1 
ATOM   8455  C  C     . GLY C  3  482 ? -24.535  74.928  362.693 1.00 113.44 ? 482 GLY 3 C     1 
ATOM   8456  O  O     . GLY C  3  482 ? -23.620  75.331  363.422 1.00 115.26 ? 482 GLY 3 O     1 
ATOM   8457  N  N     . ASP C  3  483 ? -25.407  75.759  362.122 1.00 110.89 ? 483 ASP 3 N     1 
ATOM   8458  C  CA    . ASP C  3  483 ? -25.324  77.198  362.326 1.00 116.48 ? 483 ASP 3 CA    1 
ATOM   8459  C  C     . ASP C  3  483 ? -26.282  77.727  363.389 1.00 122.59 ? 483 ASP 3 C     1 
ATOM   8460  O  O     . ASP C  3  483 ? -26.149  78.888  363.788 1.00 122.17 ? 483 ASP 3 O     1 
ATOM   8461  C  CB    . ASP C  3  483 ? -25.580  77.926  361.001 1.00 116.87 ? 483 ASP 3 CB    1 
ATOM   8462  C  CG    . ASP C  3  483 ? -24.495  77.661  359.970 1.00 113.25 ? 483 ASP 3 CG    1 
ATOM   8463  O  OD1   . ASP C  3  483 ? -23.423  77.147  360.349 1.00 110.61 ? 483 ASP 3 OD1   1 
ATOM   8464  O  OD2   . ASP C  3  483 ? -24.708  77.972  358.780 1.00 111.82 ? 483 ASP 3 OD2   1 
ATOM   8465  N  N     . LYS C  3  484 ? -27.230  76.919  363.864 1.00 129.22 ? 484 LYS 3 N     1 
ATOM   8466  C  CA    . LYS C  3  484 ? -28.130  77.337  364.931 1.00 139.59 ? 484 LYS 3 CA    1 
ATOM   8467  C  C     . LYS C  3  484 ? -28.425  76.162  365.854 1.00 144.31 ? 484 LYS 3 C     1 
ATOM   8468  O  O     . LYS C  3  484 ? -27.956  75.038  365.644 1.00 141.27 ? 484 LYS 3 O     1 
ATOM   8469  C  CB    . LYS C  3  484 ? -29.436  77.918  364.378 1.00 145.05 ? 484 LYS 3 CB    1 
ATOM   8470  C  CG    . LYS C  3  484 ? -29.311  79.312  363.805 1.00 151.10 ? 484 LYS 3 CG    1 
ATOM   8471  C  CD    . LYS C  3  484 ? -30.663  79.833  363.359 1.00 157.56 ? 484 LYS 3 CD    1 
ATOM   8472  C  CE    . LYS C  3  484 ? -31.583  79.985  364.558 1.00 162.47 ? 484 LYS 3 CE    1 
ATOM   8473  N  NZ    . LYS C  3  484 ? -31.101  81.033  365.500 1.00 165.14 ? 484 LYS 3 NZ    1 
ATOM   8474  N  N     . GLU C  3  485 ? -29.223  76.438  366.886 1.00 149.32 ? 485 GLU 3 N     1 
ATOM   8475  C  CA    . GLU C  3  485 ? -29.608  75.458  367.894 1.00 148.06 ? 485 GLU 3 CA    1 
ATOM   8476  C  C     . GLU C  3  485 ? -31.123  75.322  367.868 1.00 140.28 ? 485 GLU 3 C     1 
ATOM   8477  O  O     . GLU C  3  485 ? -31.842  76.308  368.060 1.00 137.00 ? 485 GLU 3 O     1 
ATOM   8478  C  CB    . GLU C  3  485 ? -29.122  75.871  369.286 1.00 153.21 ? 485 GLU 3 CB    1 
ATOM   8479  C  CG    . GLU C  3  485 ? -29.297  74.792  370.347 1.00 158.01 ? 485 GLU 3 CG    1 
ATOM   8480  C  CD    . GLU C  3  485 ? -28.973  75.281  371.748 1.00 163.79 ? 485 GLU 3 CD    1 
ATOM   8481  O  OE1   . GLU C  3  485 ? -29.420  76.388  372.116 1.00 166.63 ? 485 GLU 3 OE1   1 
ATOM   8482  O  OE2   . GLU C  3  485 ? -28.272  74.554  372.483 1.00 165.36 ? 485 GLU 3 OE2   1 
ATOM   8483  N  N     . GLY C  3  486 ? -31.601  74.105  367.630 1.00 135.90 ? 486 GLY 3 N     1 
ATOM   8484  C  CA    . GLY C  3  486 ? -33.012  73.813  367.524 1.00 131.35 ? 486 GLY 3 CA    1 
ATOM   8485  C  C     . GLY C  3  486 ? -33.578  73.220  368.798 1.00 124.87 ? 486 GLY 3 C     1 
ATOM   8486  O  O     . GLY C  3  486 ? -32.981  73.298  369.878 1.00 125.06 ? 486 GLY 3 O     1 
ATOM   8487  N  N     . SER C  3  487 ? -34.756  72.615  368.667 1.00 116.36 ? 487 SER 3 N     1 
ATOM   8488  C  CA    . SER C  3  487 ? -35.394  71.963  369.797 1.00 106.79 ? 487 SER 3 CA    1 
ATOM   8489  C  C     . SER C  3  487 ? -34.637  70.681  370.141 1.00 101.28 ? 487 SER 3 C     1 
ATOM   8490  O  O     . SER C  3  487 ? -33.609  70.351  369.544 1.00 96.38  ? 487 SER 3 O     1 
ATOM   8491  C  CB    . SER C  3  487 ? -36.856  71.663  369.485 1.00 103.08 ? 487 SER 3 CB    1 
ATOM   8492  O  OG    . SER C  3  487 ? -36.964  70.494  368.695 1.00 99.64  ? 487 SER 3 OG    1 
ATOM   8493  N  N     . GLU C  3  488 ? -35.154  69.950  371.128 1.00 100.43 ? 488 GLU 3 N     1 
ATOM   8494  C  CA    . GLU C  3  488 ? -34.516  68.707  371.545 1.00 98.87  ? 488 GLU 3 CA    1 
ATOM   8495  C  C     . GLU C  3  488 ? -34.334  67.755  370.370 1.00 87.34  ? 488 GLU 3 C     1 
ATOM   8496  O  O     . GLU C  3  488 ? -33.225  67.278  370.100 1.00 77.04  ? 488 GLU 3 O     1 
ATOM   8497  C  CB    . GLU C  3  488 ? -35.361  68.033  372.629 1.00 106.15 ? 488 GLU 3 CB    1 
ATOM   8498  C  CG    . GLU C  3  488 ? -35.838  68.947  373.745 1.00 112.52 ? 488 GLU 3 CG    1 
ATOM   8499  C  CD    . GLU C  3  488 ? -36.300  68.169  374.964 1.00 116.76 ? 488 GLU 3 CD    1 
ATOM   8500  O  OE1   . GLU C  3  488 ? -35.826  67.031  375.159 1.00 117.97 ? 488 GLU 3 OE1   1 
ATOM   8501  O  OE2   . GLU C  3  488 ? -37.148  68.689  375.718 1.00 118.91 ? 488 GLU 3 OE2   1 
ATOM   8502  N  N     . MET C  3  489 ? -35.422  67.489  369.647 1.00 86.33  ? 489 MET 3 N     1 
ATOM   8503  C  CA    . MET C  3  489 ? -35.388  66.536  368.543 1.00 92.10  ? 489 MET 3 CA    1 
ATOM   8504  C  C     . MET C  3  489 ? -34.432  66.973  367.439 1.00 95.55  ? 489 MET 3 C     1 
ATOM   8505  O  O     . MET C  3  489 ? -33.724  66.141  366.859 1.00 101.42 ? 489 MET 3 O     1 
ATOM   8506  C  CB    . MET C  3  489 ? -36.794  66.359  367.982 1.00 98.29  ? 489 MET 3 CB    1 
ATOM   8507  C  CG    . MET C  3  489 ? -37.778  65.702  368.933 1.00 107.80 ? 489 MET 3 CG    1 
ATOM   8508  S  SD    . MET C  3  489 ? -37.449  63.968  369.284 1.00 113.45 ? 489 MET 3 SD    1 
ATOM   8509  C  CE    . MET C  3  489 ? -36.962  64.059  371.002 1.00 123.72 ? 489 MET 3 CE    1 
ATOM   8510  N  N     . VAL C  3  490 ? -34.412  68.269  367.118 1.00 89.77  ? 490 VAL 3 N     1 
ATOM   8511  C  CA    . VAL C  3  490 ? -33.570  68.745  366.023 1.00 79.93  ? 490 VAL 3 CA    1 
ATOM   8512  C  C     . VAL C  3  490 ? -32.095  68.552  366.356 1.00 80.19  ? 490 VAL 3 C     1 
ATOM   8513  O  O     . VAL C  3  490 ? -31.307  68.109  365.514 1.00 72.14  ? 490 VAL 3 O     1 
ATOM   8514  C  CB    . VAL C  3  490 ? -33.893  70.216  365.705 1.00 80.41  ? 490 VAL 3 CB    1 
ATOM   8515  C  CG1   . VAL C  3  490 ? -33.233  70.633  364.402 1.00 78.90  ? 490 VAL 3 CG1   1 
ATOM   8516  C  CG2   . VAL C  3  490 ? -35.401  70.441  365.649 1.00 74.87  ? 490 VAL 3 CG2   1 
ATOM   8517  N  N     . ALA C  3  491 ? -31.706  68.843  367.597 1.00 74.22  ? 491 ALA 3 N     1 
ATOM   8518  C  CA    . ALA C  3  491 ? -30.315  68.656  367.996 1.00 73.79  ? 491 ALA 3 CA    1 
ATOM   8519  C  C     . ALA C  3  491 ? -29.959  67.176  368.091 1.00 81.38  ? 491 ALA 3 C     1 
ATOM   8520  O  O     . ALA C  3  491 ? -28.834  66.782  367.763 1.00 78.77  ? 491 ALA 3 O     1 
ATOM   8521  C  CB    . ALA C  3  491 ? -30.050  69.365  369.323 1.00 74.93  ? 491 ALA 3 CB    1 
ATOM   8522  N  N     . LYS C  3  492 ? -30.896  66.344  368.555 1.00 88.17  ? 492 LYS 3 N     1 
ATOM   8523  C  CA    . LYS C  3  492 ? -30.658  64.902  368.591 1.00 85.57  ? 492 LYS 3 CA    1 
ATOM   8524  C  C     . LYS C  3  492 ? -30.399  64.358  367.191 1.00 72.60  ? 492 LYS 3 C     1 
ATOM   8525  O  O     . LYS C  3  492 ? -29.450  63.592  366.969 1.00 76.30  ? 492 LYS 3 O     1 
ATOM   8526  C  CB    . LYS C  3  492 ? -31.854  64.197  369.230 1.00 75.14  ? 492 LYS 3 CB    1 
ATOM   8527  C  CG    . LYS C  3  492 ? -31.968  64.402  370.730 1.00 76.57  ? 492 LYS 3 CG    1 
ATOM   8528  C  CD    . LYS C  3  492 ? -33.359  64.044  371.223 1.00 88.59  ? 492 LYS 3 CD    1 
ATOM   8529  C  CE    . LYS C  3  492 ? -33.321  62.987  372.307 1.00 88.66  ? 492 LYS 3 CE    1 
ATOM   8530  N  NZ    . LYS C  3  492 ? -34.522  62.109  372.269 1.00 88.70  ? 492 LYS 3 NZ    1 
ATOM   8531  N  N     . ALA C  3  493 ? -31.240  64.751  366.231 1.00 72.29  ? 493 ALA 3 N     1 
ATOM   8532  C  CA    . ALA C  3  493 ? -31.050  64.324  364.850 1.00 71.01  ? 493 ALA 3 CA    1 
ATOM   8533  C  C     . ALA C  3  493 ? -29.735  64.850  364.294 1.00 69.91  ? 493 ALA 3 C     1 
ATOM   8534  O  O     . ALA C  3  493 ? -29.016  64.129  363.594 1.00 68.90  ? 493 ALA 3 O     1 
ATOM   8535  C  CB    . ALA C  3  493 ? -32.225  64.787  363.992 1.00 71.00  ? 493 ALA 3 CB    1 
ATOM   8536  N  N     . LYS C  3  494 ? -29.407  66.108  364.595 1.00 70.12  ? 494 LYS 3 N     1 
ATOM   8537  C  CA    . LYS C  3  494 ? -28.126  66.675  364.191 1.00 69.20  ? 494 LYS 3 CA    1 
ATOM   8538  C  C     . LYS C  3  494 ? -26.960  65.823  364.673 1.00 68.89  ? 494 LYS 3 C     1 
ATOM   8539  O  O     . LYS C  3  494 ? -26.099  65.424  363.884 1.00 67.78  ? 494 LYS 3 O     1 
ATOM   8540  C  CB    . LYS C  3  494 ? -28.010  68.096  364.743 1.00 86.28  ? 494 LYS 3 CB    1 
ATOM   8541  C  CG    . LYS C  3  494 ? -26.673  68.771  364.491 1.00 83.52  ? 494 LYS 3 CG    1 
ATOM   8542  C  CD    . LYS C  3  494 ? -26.622  70.149  365.140 1.00 77.85  ? 494 LYS 3 CD    1 
ATOM   8543  C  CE    . LYS C  3  494 ? -25.311  70.860  364.840 1.00 68.97  ? 494 LYS 3 CE    1 
ATOM   8544  N  NZ    . LYS C  3  494 ? -24.139  70.140  365.412 1.00 68.75  ? 494 LYS 3 NZ    1 
ATOM   8545  N  N     . GLU C  3  495 ? -26.929  65.527  365.972 1.00 69.89  ? 495 GLU 3 N     1 
ATOM   8546  C  CA    . GLU C  3  495 ? -25.809  64.791  366.551 1.00 76.05  ? 495 GLU 3 CA    1 
ATOM   8547  C  C     . GLU C  3  495 ? -25.707  63.391  365.959 1.00 69.04  ? 495 GLU 3 C     1 
ATOM   8548  O  O     . GLU C  3  495 ? -24.616  62.937  365.584 1.00 78.07  ? 495 GLU 3 O     1 
ATOM   8549  C  CB    . GLU C  3  495 ? -25.956  64.735  368.070 1.00 81.25  ? 495 GLU 3 CB    1 
ATOM   8550  C  CG    . GLU C  3  495 ? -24.786  64.080  368.777 1.00 86.40  ? 495 GLU 3 CG    1 
ATOM   8551  C  CD    . GLU C  3  495 ? -25.104  63.720  370.211 1.00 96.65  ? 495 GLU 3 CD    1 
ATOM   8552  O  OE1   . GLU C  3  495 ? -25.523  64.617  370.970 1.00 100.44 ? 495 GLU 3 OE1   1 
ATOM   8553  O  OE2   . GLU C  3  495 ? -24.934  62.538  370.578 1.00 100.60 ? 495 GLU 3 OE2   1 
ATOM   8554  N  N     . ALA C  3  496 ? -26.838  62.683  365.885 1.00 69.49  ? 496 ALA 3 N     1 
ATOM   8555  C  CA    . ALA C  3  496 ? -26.819  61.334  365.328 1.00 68.92  ? 496 ALA 3 CA    1 
ATOM   8556  C  C     . ALA C  3  496 ? -26.354  61.353  363.879 1.00 67.52  ? 496 ALA 3 C     1 
ATOM   8557  O  O     . ALA C  3  496 ? -25.608  60.468  363.446 1.00 73.77  ? 496 ALA 3 O     1 
ATOM   8558  C  CB    . ALA C  3  496 ? -28.202  60.697  365.448 1.00 69.69  ? 496 ALA 3 CB    1 
ATOM   8559  N  N     . TRP C  3  497 ? -26.781  62.362  363.115 1.00 74.85  ? 497 TRP 3 N     1 
ATOM   8560  C  CA    . TRP C  3  497 ? -26.313  62.511  361.743 1.00 73.98  ? 497 TRP 3 CA    1 
ATOM   8561  C  C     . TRP C  3  497 ? -24.806  62.707  361.707 1.00 74.13  ? 497 TRP 3 C     1 
ATOM   8562  O  O     . TRP C  3  497 ? -24.116  62.147  360.848 1.00 73.72  ? 497 TRP 3 O     1 
ATOM   8563  C  CB    . TRP C  3  497 ? -27.019  63.692  361.072 1.00 65.91  ? 497 TRP 3 CB    1 
ATOM   8564  C  CG    . TRP C  3  497 ? -26.490  63.998  359.708 1.00 70.44  ? 497 TRP 3 CG    1 
ATOM   8565  C  CD1   . TRP C  3  497 ? -25.418  64.780  359.398 1.00 70.55  ? 497 TRP 3 CD1   1 
ATOM   8566  C  CD2   . TRP C  3  497 ? -27.007  63.518  358.464 1.00 64.01  ? 497 TRP 3 CD2   1 
ATOM   8567  N  NE1   . TRP C  3  497 ? -25.234  64.814  358.038 1.00 67.54  ? 497 TRP 3 NE1   1 
ATOM   8568  C  CE2   . TRP C  3  497 ? -26.198  64.046  357.443 1.00 62.95  ? 497 TRP 3 CE2   1 
ATOM   8569  C  CE3   . TRP C  3  497 ? -28.074  62.689  358.115 1.00 64.25  ? 497 TRP 3 CE3   1 
ATOM   8570  C  CZ2   . TRP C  3  497 ? -26.424  63.776  356.100 1.00 62.15  ? 497 TRP 3 CZ2   1 
ATOM   8571  C  CZ3   . TRP C  3  497 ? -28.295  62.421  356.782 1.00 63.44  ? 497 TRP 3 CZ3   1 
ATOM   8572  C  CH2   . TRP C  3  497 ? -27.476  62.962  355.790 1.00 68.79  ? 497 TRP 3 CH2   1 
ATOM   8573  N  N     . GLU C  3  498 ? -24.280  63.514  362.629 1.00 74.21  ? 498 GLU 3 N     1 
ATOM   8574  C  CA    . GLU C  3  498 ? -22.843  63.761  362.656 1.00 70.75  ? 498 GLU 3 CA    1 
ATOM   8575  C  C     . GLU C  3  498 ? -22.080  62.466  362.890 1.00 64.75  ? 498 GLU 3 C     1 
ATOM   8576  O  O     . GLU C  3  498 ? -21.183  62.109  362.119 1.00 63.71  ? 498 GLU 3 O     1 
ATOM   8577  C  CB    . GLU C  3  498 ? -22.499  64.777  363.748 1.00 65.85  ? 498 GLU 3 CB    1 
ATOM   8578  C  CG    . GLU C  3  498 ? -23.227  66.107  363.679 1.00 69.02  ? 498 GLU 3 CG    1 
ATOM   8579  C  CD    . GLU C  3  498 ? -22.841  66.940  362.481 1.00 75.21  ? 498 GLU 3 CD    1 
ATOM   8580  O  OE1   . GLU C  3  498 ? -23.219  66.571  361.351 1.00 77.14  ? 498 GLU 3 OE1   1 
ATOM   8581  O  OE2   . GLU C  3  498 ? -22.161  67.968  362.668 1.00 79.52  ? 498 GLU 3 OE2   1 
ATOM   8582  N  N     . LYS C  3  499 ? -22.436  61.742  363.952 1.00 65.68  ? 499 LYS 3 N     1 
ATOM   8583  C  CA    . LYS C  3  499 ? -21.702  60.534  364.312 1.00 73.65  ? 499 LYS 3 CA    1 
ATOM   8584  C  C     . LYS C  3  499 ? -21.880  59.400  363.309 1.00 73.87  ? 499 LYS 3 C     1 
ATOM   8585  O  O     . LYS C  3  499 ? -21.043  58.490  363.276 1.00 73.78  ? 499 LYS 3 O     1 
ATOM   8586  C  CB    . LYS C  3  499 ? -22.107  60.061  365.708 1.00 72.02  ? 499 LYS 3 CB    1 
ATOM   8587  C  CG    . LYS C  3  499 ? -21.729  61.032  366.813 1.00 70.15  ? 499 LYS 3 CG    1 
ATOM   8588  C  CD    . LYS C  3  499 ? -21.808  60.379  368.182 1.00 70.56  ? 499 LYS 3 CD    1 
ATOM   8589  C  CE    . LYS C  3  499 ? -20.980  61.149  369.197 1.00 69.30  ? 499 LYS 3 CE    1 
ATOM   8590  N  NZ    . LYS C  3  499 ? -20.084  60.259  369.985 1.00 69.50  ? 499 LYS 3 NZ    1 
ATOM   8591  N  N     . ALA C  3  500 ? -22.938  59.421  362.505 1.00 75.57  ? 500 ALA 3 N     1 
ATOM   8592  C  CA    . ALA C  3  500 ? -23.158  58.351  361.541 1.00 83.38  ? 500 ALA 3 CA    1 
ATOM   8593  C  C     . ALA C  3  500 ? -22.006  58.275  360.547 1.00 88.71  ? 500 ALA 3 C     1 
ATOM   8594  O  O     . ALA C  3  500 ? -21.448  59.296  360.137 1.00 87.62  ? 500 ALA 3 O     1 
ATOM   8595  C  CB    . ALA C  3  500 ? -24.476  58.571  360.802 1.00 84.80  ? 500 ALA 3 CB    1 
ATOM   8596  N  N     . LYS C  3  501 ? -21.647  57.050  360.160 1.00 92.51  ? 501 LYS 3 N     1 
ATOM   8597  C  CA    . LYS C  3  501 ? -20.492  56.842  359.295 1.00 93.80  ? 501 LYS 3 CA    1 
ATOM   8598  C  C     . LYS C  3  501 ? -20.843  56.992  357.820 1.00 93.65  ? 501 LYS 3 C     1 
ATOM   8599  O  O     . LYS C  3  501 ? -20.087  57.613  357.066 1.00 89.50  ? 501 LYS 3 O     1 
ATOM   8600  C  CB    . LYS C  3  501 ? -19.879  55.457  359.535 1.00 95.76  ? 501 LYS 3 CB    1 
ATOM   8601  C  CG    . LYS C  3  501 ? -19.815  55.010  360.989 1.00 100.14 ? 501 LYS 3 CG    1 
ATOM   8602  C  CD    . LYS C  3  501 ? -21.006  54.121  361.347 1.00 104.15 ? 501 LYS 3 CD    1 
ATOM   8603  C  CE    . LYS C  3  501 ? -21.094  53.879  362.847 1.00 106.86 ? 501 LYS 3 CE    1 
ATOM   8604  N  NZ    . LYS C  3  501 ? -22.316  53.115  363.225 1.00 104.94 ? 501 LYS 3 NZ    1 
ATOM   8605  N  N     . ASN C  3  502 ? -21.985  56.446  357.396 1.00 96.06  ? 502 ASN 3 N     1 
ATOM   8606  C  CA    . ASN C  3  502 ? -22.413  56.508  355.997 1.00 91.44  ? 502 ASN 3 CA    1 
ATOM   8607  C  C     . ASN C  3  502 ? -23.936  56.518  355.957 1.00 85.90  ? 502 ASN 3 C     1 
ATOM   8608  O  O     . ASN C  3  502 ? -24.576  55.524  355.597 1.00 75.92  ? 502 ASN 3 O     1 
ATOM   8609  C  CB    . ASN C  3  502 ? -21.842  55.330  355.205 1.00 90.72  ? 502 ASN 3 CB    1 
ATOM   8610  C  CG    . ASN C  3  502 ? -20.624  55.713  354.381 1.00 94.31  ? 502 ASN 3 CG    1 
ATOM   8611  O  OD1   . ASN C  3  502 ? -20.609  56.752  353.722 1.00 96.09  ? 502 ASN 3 OD1   1 
ATOM   8612  N  ND2   . ASN C  3  502 ? -19.589  54.882  354.430 1.00 95.37  ? 502 ASN 3 ND2   1 
ATOM   8613  N  N     . PRO C  3  503 ? -24.557  57.654  356.323 1.00 82.98  ? 503 PRO 3 N     1 
ATOM   8614  C  CA    . PRO C  3  503 ? -26.023  57.705  356.422 1.00 83.80  ? 503 PRO 3 CA    1 
ATOM   8615  C  C     . PRO C  3  503 ? -26.731  58.015  355.110 1.00 74.59  ? 503 PRO 3 C     1 
ATOM   8616  O  O     . PRO C  3  503 ? -26.085  58.209  354.075 1.00 60.39  ? 503 PRO 3 O     1 
ATOM   8617  C  CB    . PRO C  3  503 ? -26.243  58.820  357.446 1.00 62.66  ? 503 PRO 3 CB    1 
ATOM   8618  C  CG    . PRO C  3  503 ? -25.147  59.776  357.138 1.00 75.05  ? 503 PRO 3 CG    1 
ATOM   8619  C  CD    . PRO C  3  503 ? -23.947  58.923  356.765 1.00 70.90  ? 503 PRO 3 CD    1 
ATOM   8620  N  N     . VAL C  3  504 ? -28.063  58.054  355.146 1.00 74.60  ? 504 VAL 3 N     1 
ATOM   8621  C  CA    . VAL C  3  504 ? -28.885  58.428  354.001 1.00 78.48  ? 504 VAL 3 CA    1 
ATOM   8622  C  C     . VAL C  3  504 ? -29.817  59.570  354.394 1.00 62.56  ? 504 VAL 3 C     1 
ATOM   8623  O  O     . VAL C  3  504 ? -30.406  59.571  355.485 1.00 63.56  ? 504 VAL 3 O     1 
ATOM   8624  C  CB    . VAL C  3  504 ? -29.684  57.222  353.458 1.00 61.88  ? 504 VAL 3 CB    1 
ATOM   8625  C  CG1   . VAL C  3  504 ? -30.779  57.677  352.506 1.00 64.32  ? 504 VAL 3 CG1   1 
ATOM   8626  C  CG2   . VAL C  3  504 ? -28.749  56.267  352.730 1.00 60.95  ? 504 VAL 3 CG2   1 
ATOM   8627  N  N     . LEU