data_6Q8O
# 
_entry.id   6Q8O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   6Q8O         pdb_00006q8o 10.2210/pdb6q8o/pdb 
WWPDB D_1200012673 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-02 
2 'Structure model' 1 1 2024-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'        
2 2 'Structure model' 'Database references'    
3 2 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom                
2 2 'Structure model' chem_comp_bond                
3 2 'Structure model' database_2                    
4 2 'Structure model' pdbx_initial_refinement_model 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                
2 2 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q8O 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Submitted PDB 6I0D contains the same complex with decyl-ubiquinone bound' 6I0D unspecified 
PDB 'Submitted PDB 6I1P contains the same complex with NADH bound'             6I1P unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'  48693.715 2  1.6.5.11 ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'  20309.162 2  1.6.5.11 ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'  86656.203 2  1.6.5.11 ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'  46428.027 2  1.6.5.11 ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'  23893.254 2  1.6.5.11 ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'  20262.564 2  1.6.5.11 ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'  20106.309 2  1.6.5.11 ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15' 14812.074 2  1.6.5.11 ? ? ? 
9  polymer     nat 'NADH-quinone oxidoreductase subunit 16' 14201.612 2  ?        ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'  13154.656 2  1.6.5.11 ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10' 18563.330 2  1.6.5.11 ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11' 10002.788 2  1.6.5.11 ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12' 65189.930 2  1.6.5.11 ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13' 49247.117 2  1.6.5.11 ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14' 44463.895 2  1.6.5.11 ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'  41034.523 2  1.6.5.11 ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                    351.640   14 ?        ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                  456.344   2  ?        ? ? ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'             175.820   4  ?        ? ? ? 
20 non-polymer syn 'Piericidin A'                           415.566   2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
17 'IRON/SULFUR CLUSTER'        SF4 
18 'FLAVIN MONONUCLEOTIDE'      FMN 
19 'FE2/S2 (INORGANIC) CLUSTER' FES 
20 'Piericidin A'               HQH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                          'C3 H7 N O2 S'    121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                          'Fe2 S2'          175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'      'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE                    ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                          'C6 H10 N3 O2 1'  156.162 
HQH non-polymer         . 'Piericidin A'               ?                          'C25 H37 N O4'    415.566 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                          'C3 H7 N O3'      105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                          'Fe4 S4'          351.640 
THR 'L-peptide linking' y THREONINE                    ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ?                          'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A  1  1   MET 1   1   ?   ?   ?   1 . n 
A  1  2   THR 2   2   2   THR THR 1 . n 
A  1  3   GLY 3   3   3   GLY GLY 1 . n 
A  1  4   PRO 4   4   4   PRO PRO 1 . n 
A  1  5   ILE 5   5   5   ILE ILE 1 . n 
A  1  6   LEU 6   6   6   LEU LEU 1 . n 
A  1  7   SER 7   7   7   SER SER 1 . n 
A  1  8   GLY 8   8   8   GLY GLY 1 . n 
A  1  9   LEU 9   9   9   LEU LEU 1 . n 
A  1  10  ASP 10  10  10  ASP ASP 1 . n 
A  1  11  PRO 11  11  11  PRO PRO 1 . n 
A  1  12  ARG 12  12  12  ARG ARG 1 . n 
A  1  13  PHE 13  13  13  PHE PHE 1 . n 
A  1  14  GLU 14  14  14  GLU GLU 1 . n 
A  1  15  ARG 15  15  15  ARG ARG 1 . n 
A  1  16  THR 16  16  16  THR THR 1 . n 
A  1  17  LEU 17  17  17  LEU LEU 1 . n 
A  1  18  TYR 18  18  18  TYR TYR 1 . n 
A  1  19  ALA 19  19  19  ALA ALA 1 . n 
A  1  20  HIS 20  20  20  HIS HIS 1 . n 
A  1  21  VAL 21  21  21  VAL VAL 1 . n 
A  1  22  GLY 22  22  22  GLY GLY 1 . n 
A  1  23  LYS 23  23  23  LYS LYS 1 . n 
A  1  24  GLU 24  24  24  GLU GLU 1 . n 
A  1  25  GLY 25  25  25  GLY GLY 1 . n 
A  1  26  SER 26  26  26  SER SER 1 . n 
A  1  27  TRP 27  27  27  TRP TRP 1 . n 
A  1  28  THR 28  28  28  THR THR 1 . n 
A  1  29  LEU 29  29  29  LEU LEU 1 . n 
A  1  30  ASP 30  30  30  ASP ASP 1 . n 
A  1  31  TYR 31  31  31  TYR TYR 1 . n 
A  1  32  TYR 32  32  32  TYR TYR 1 . n 
A  1  33  LEU 33  33  33  LEU LEU 1 . n 
A  1  34  ARG 34  34  34  ARG ARG 1 . n 
A  1  35  HIS 35  35  35  HIS HIS 1 . n 
A  1  36  GLY 36  36  36  GLY GLY 1 . n 
A  1  37  GLY 37  37  37  GLY GLY 1 . n 
A  1  38  TYR 38  38  38  TYR TYR 1 . n 
A  1  39  GLU 39  39  39  GLU GLU 1 . n 
A  1  40  THR 40  40  40  THR THR 1 . n 
A  1  41  ALA 41  41  41  ALA ALA 1 . n 
A  1  42  LYS 42  42  42  LYS LYS 1 . n 
A  1  43  ARG 43  43  43  ARG ARG 1 . n 
A  1  44  VAL 44  44  44  VAL VAL 1 . n 
A  1  45  LEU 45  45  45  LEU LEU 1 . n 
A  1  46  LYS 46  46  46  LYS LYS 1 . n 
A  1  47  GLU 47  47  47  GLU GLU 1 . n 
A  1  48  LYS 48  48  48  LYS LYS 1 . n 
A  1  49  THR 49  49  49  THR THR 1 . n 
A  1  50  PRO 50  50  50  PRO PRO 1 . n 
A  1  51  ASP 51  51  51  ASP ASP 1 . n 
A  1  52  GLU 52  52  52  GLU GLU 1 . n 
A  1  53  VAL 53  53  53  VAL VAL 1 . n 
A  1  54  ILE 54  54  54  ILE ILE 1 . n 
A  1  55  GLU 55  55  55  GLU GLU 1 . n 
A  1  56  GLU 56  56  56  GLU GLU 1 . n 
A  1  57  VAL 57  57  57  VAL VAL 1 . n 
A  1  58  LYS 58  58  58  LYS LYS 1 . n 
A  1  59  ARG 59  59  59  ARG ARG 1 . n 
A  1  60  SER 60  60  60  SER SER 1 . n 
A  1  61  GLY 61  61  61  GLY GLY 1 . n 
A  1  62  LEU 62  62  62  LEU LEU 1 . n 
A  1  63  ARG 63  63  63  ARG ARG 1 . n 
A  1  64  GLY 64  64  64  GLY GLY 1 . n 
A  1  65  ARG 65  65  65  ARG ARG 1 . n 
A  1  66  GLY 66  66  66  GLY GLY 1 . n 
A  1  67  GLY 67  67  67  GLY GLY 1 . n 
A  1  68  ALA 68  68  68  ALA ALA 1 . n 
A  1  69  GLY 69  69  69  GLY GLY 1 . n 
A  1  70  PHE 70  70  70  PHE PHE 1 . n 
A  1  71  PRO 71  71  71  PRO PRO 1 . n 
A  1  72  THR 72  72  72  THR THR 1 . n 
A  1  73  GLY 73  73  73  GLY GLY 1 . n 
A  1  74  LEU 74  74  74  LEU LEU 1 . n 
A  1  75  LYS 75  75  75  LYS LYS 1 . n 
A  1  76  TRP 76  76  76  TRP TRP 1 . n 
A  1  77  SER 77  77  77  SER SER 1 . n 
A  1  78  PHE 78  78  78  PHE PHE 1 . n 
A  1  79  MET 79  79  79  MET MET 1 . n 
A  1  80  PRO 80  80  80  PRO PRO 1 . n 
A  1  81  LYS 81  81  81  LYS LYS 1 . n 
A  1  82  ASP 82  82  82  ASP ASP 1 . n 
A  1  83  ASP 83  83  83  ASP ASP 1 . n 
A  1  84  GLY 84  84  84  GLY GLY 1 . n 
A  1  85  LYS 85  85  85  LYS LYS 1 . n 
A  1  86  GLN 86  86  86  GLN GLN 1 . n 
A  1  87  HIS 87  87  87  HIS HIS 1 . n 
A  1  88  TYR 88  88  88  TYR TYR 1 . n 
A  1  89  LEU 89  89  89  LEU LEU 1 . n 
A  1  90  ILE 90  90  90  ILE ILE 1 . n 
A  1  91  CYS 91  91  91  CYS CYS 1 . n 
A  1  92  ASN 92  92  92  ASN ASN 1 . n 
A  1  93  ALA 93  93  93  ALA ALA 1 . n 
A  1  94  ASP 94  94  94  ASP ASP 1 . n 
A  1  95  GLU 95  95  95  GLU GLU 1 . n 
A  1  96  SER 96  96  96  SER SER 1 . n 
A  1  97  GLU 97  97  97  GLU GLU 1 . n 
A  1  98  PRO 98  98  98  PRO PRO 1 . n 
A  1  99  GLY 99  99  99  GLY GLY 1 . n 
A  1  100 SER 100 100 100 SER SER 1 . n 
A  1  101 PHE 101 101 101 PHE PHE 1 . n 
A  1  102 LYS 102 102 102 LYS LYS 1 . n 
A  1  103 ASP 103 103 103 ASP ASP 1 . n 
A  1  104 ARG 104 104 104 ARG ARG 1 . n 
A  1  105 TYR 105 105 105 TYR TYR 1 . n 
A  1  106 ILE 106 106 106 ILE ILE 1 . n 
A  1  107 LEU 107 107 107 LEU LEU 1 . n 
A  1  108 GLU 108 108 108 GLU GLU 1 . n 
A  1  109 ASP 109 109 109 ASP ASP 1 . n 
A  1  110 VAL 110 110 110 VAL VAL 1 . n 
A  1  111 PRO 111 111 111 PRO PRO 1 . n 
A  1  112 HIS 112 112 112 HIS HIS 1 . n 
A  1  113 LEU 113 113 113 LEU LEU 1 . n 
A  1  114 LEU 114 114 114 LEU LEU 1 . n 
A  1  115 ILE 115 115 115 ILE ILE 1 . n 
A  1  116 GLU 116 116 116 GLU GLU 1 . n 
A  1  117 GLY 117 117 117 GLY GLY 1 . n 
A  1  118 MET 118 118 118 MET MET 1 . n 
A  1  119 ILE 119 119 119 ILE ILE 1 . n 
A  1  120 LEU 120 120 120 LEU LEU 1 . n 
A  1  121 ALA 121 121 121 ALA ALA 1 . n 
A  1  122 GLY 122 122 122 GLY GLY 1 . n 
A  1  123 TYR 123 123 123 TYR TYR 1 . n 
A  1  124 ALA 124 124 124 ALA ALA 1 . n 
A  1  125 ILE 125 125 125 ILE ILE 1 . n 
A  1  126 ARG 126 126 126 ARG ARG 1 . n 
A  1  127 ALA 127 127 127 ALA ALA 1 . n 
A  1  128 THR 128 128 128 THR THR 1 . n 
A  1  129 VAL 129 129 129 VAL VAL 1 . n 
A  1  130 GLY 130 130 130 GLY GLY 1 . n 
A  1  131 TYR 131 131 131 TYR TYR 1 . n 
A  1  132 ILE 132 132 132 ILE ILE 1 . n 
A  1  133 TYR 133 133 133 TYR TYR 1 . n 
A  1  134 VAL 134 134 134 VAL VAL 1 . n 
A  1  135 ARG 135 135 135 ARG ARG 1 . n 
A  1  136 GLY 136 136 136 GLY GLY 1 . n 
A  1  137 GLU 137 137 137 GLU GLU 1 . n 
A  1  138 TYR 138 138 138 TYR TYR 1 . n 
A  1  139 ARG 139 139 139 ARG ARG 1 . n 
A  1  140 ARG 140 140 140 ARG ARG 1 . n 
A  1  141 ALA 141 141 141 ALA ALA 1 . n 
A  1  142 ALA 142 142 142 ALA ALA 1 . n 
A  1  143 ASP 143 143 143 ASP ASP 1 . n 
A  1  144 ARG 144 144 144 ARG ARG 1 . n 
A  1  145 LEU 145 145 145 LEU LEU 1 . n 
A  1  146 GLU 146 146 146 GLU GLU 1 . n 
A  1  147 GLN 147 147 147 GLN GLN 1 . n 
A  1  148 ALA 148 148 148 ALA ALA 1 . n 
A  1  149 ILE 149 149 149 ILE ILE 1 . n 
A  1  150 LYS 150 150 150 LYS LYS 1 . n 
A  1  151 GLU 151 151 151 GLU GLU 1 . n 
A  1  152 ALA 152 152 152 ALA ALA 1 . n 
A  1  153 ARG 153 153 153 ARG ARG 1 . n 
A  1  154 ALA 154 154 154 ALA ALA 1 . n 
A  1  155 ARG 155 155 155 ARG ARG 1 . n 
A  1  156 GLY 156 156 156 GLY GLY 1 . n 
A  1  157 TYR 157 157 157 TYR TYR 1 . n 
A  1  158 LEU 158 158 158 LEU LEU 1 . n 
A  1  159 GLY 159 159 159 GLY GLY 1 . n 
A  1  160 LYS 160 160 160 LYS LYS 1 . n 
A  1  161 ASN 161 161 161 ASN ASN 1 . n 
A  1  162 LEU 162 162 162 LEU LEU 1 . n 
A  1  163 PHE 163 163 163 PHE PHE 1 . n 
A  1  164 GLY 164 164 164 GLY GLY 1 . n 
A  1  165 THR 165 165 165 THR THR 1 . n 
A  1  166 ASP 166 166 166 ASP ASP 1 . n 
A  1  167 PHE 167 167 167 PHE PHE 1 . n 
A  1  168 SER 168 168 168 SER SER 1 . n 
A  1  169 PHE 169 169 169 PHE PHE 1 . n 
A  1  170 ASP 170 170 170 ASP ASP 1 . n 
A  1  171 LEU 171 171 171 LEU LEU 1 . n 
A  1  172 HIS 172 172 172 HIS HIS 1 . n 
A  1  173 VAL 173 173 173 VAL VAL 1 . n 
A  1  174 HIS 174 174 174 HIS HIS 1 . n 
A  1  175 ARG 175 175 175 ARG ARG 1 . n 
A  1  176 GLY 176 176 176 GLY GLY 1 . n 
A  1  177 ALA 177 177 177 ALA ALA 1 . n 
A  1  178 GLY 178 178 178 GLY GLY 1 . n 
A  1  179 ALA 179 179 179 ALA ALA 1 . n 
A  1  180 TYR 180 180 180 TYR TYR 1 . n 
A  1  181 ILE 181 181 181 ILE ILE 1 . n 
A  1  182 CYS 182 182 182 CYS CYS 1 . n 
A  1  183 GLY 183 183 183 GLY GLY 1 . n 
A  1  184 GLU 184 184 184 GLU GLU 1 . n 
A  1  185 GLU 185 185 185 GLU GLU 1 . n 
A  1  186 THR 186 186 186 THR THR 1 . n 
A  1  187 ALA 187 187 187 ALA ALA 1 . n 
A  1  188 LEU 188 188 188 LEU LEU 1 . n 
A  1  189 MET 189 189 189 MET MET 1 . n 
A  1  190 ASN 190 190 190 ASN ASN 1 . n 
A  1  191 SER 191 191 191 SER SER 1 . n 
A  1  192 LEU 192 192 192 LEU LEU 1 . n 
A  1  193 GLU 193 193 193 GLU GLU 1 . n 
A  1  194 GLY 194 194 194 GLY GLY 1 . n 
A  1  195 LEU 195 195 195 LEU LEU 1 . n 
A  1  196 ARG 196 196 196 ARG ARG 1 . n 
A  1  197 ALA 197 197 197 ALA ALA 1 . n 
A  1  198 ASN 198 198 198 ASN ASN 1 . n 
A  1  199 PRO 199 199 199 PRO PRO 1 . n 
A  1  200 ARG 200 200 200 ARG ARG 1 . n 
A  1  201 LEU 201 201 201 LEU LEU 1 . n 
A  1  202 LYS 202 202 202 LYS LYS 1 . n 
A  1  203 PRO 203 203 203 PRO PRO 1 . n 
A  1  204 PRO 204 204 204 PRO PRO 1 . n 
A  1  205 PHE 205 205 205 PHE PHE 1 . n 
A  1  206 PRO 206 206 206 PRO PRO 1 . n 
A  1  207 ALA 207 207 207 ALA ALA 1 . n 
A  1  208 GLN 208 208 208 GLN GLN 1 . n 
A  1  209 SER 209 209 209 SER SER 1 . n 
A  1  210 GLY 210 210 210 GLY GLY 1 . n 
A  1  211 LEU 211 211 211 LEU LEU 1 . n 
A  1  212 TRP 212 212 212 TRP TRP 1 . n 
A  1  213 GLY 213 213 213 GLY GLY 1 . n 
A  1  214 LYS 214 214 214 LYS LYS 1 . n 
A  1  215 PRO 215 215 215 PRO PRO 1 . n 
A  1  216 THR 216 216 216 THR THR 1 . n 
A  1  217 THR 217 217 217 THR THR 1 . n 
A  1  218 ILE 218 218 218 ILE ILE 1 . n 
A  1  219 ASN 219 219 219 ASN ASN 1 . n 
A  1  220 ASN 220 220 220 ASN ASN 1 . n 
A  1  221 VAL 221 221 221 VAL VAL 1 . n 
A  1  222 GLU 222 222 222 GLU GLU 1 . n 
A  1  223 THR 223 223 223 THR THR 1 . n 
A  1  224 LEU 224 224 224 LEU LEU 1 . n 
A  1  225 ALA 225 225 225 ALA ALA 1 . n 
A  1  226 SER 226 226 226 SER SER 1 . n 
A  1  227 VAL 227 227 227 VAL VAL 1 . n 
A  1  228 VAL 228 228 228 VAL VAL 1 . n 
A  1  229 PRO 229 229 229 PRO PRO 1 . n 
A  1  230 ILE 230 230 230 ILE ILE 1 . n 
A  1  231 MET 231 231 231 MET MET 1 . n 
A  1  232 GLU 232 232 232 GLU GLU 1 . n 
A  1  233 ARG 233 233 233 ARG ARG 1 . n 
A  1  234 GLY 234 234 234 GLY GLY 1 . n 
A  1  235 ALA 235 235 235 ALA ALA 1 . n 
A  1  236 ASP 236 236 236 ASP ASP 1 . n 
A  1  237 TRP 237 237 237 TRP TRP 1 . n 
A  1  238 PHE 238 238 238 PHE PHE 1 . n 
A  1  239 ALA 239 239 239 ALA ALA 1 . n 
A  1  240 GLN 240 240 240 GLN GLN 1 . n 
A  1  241 MET 241 241 241 MET MET 1 . n 
A  1  242 GLY 242 242 242 GLY GLY 1 . n 
A  1  243 THR 243 243 243 THR THR 1 . n 
A  1  244 GLU 244 244 244 GLU GLU 1 . n 
A  1  245 GLN 245 245 245 GLN GLN 1 . n 
A  1  246 SER 246 246 246 SER SER 1 . n 
A  1  247 LYS 247 247 247 LYS LYS 1 . n 
A  1  248 GLY 248 248 248 GLY GLY 1 . n 
A  1  249 MET 249 249 249 MET MET 1 . n 
A  1  250 LYS 250 250 250 LYS LYS 1 . n 
A  1  251 LEU 251 251 251 LEU LEU 1 . n 
A  1  252 TYR 252 252 252 TYR TYR 1 . n 
A  1  253 GLN 253 253 253 GLN GLN 1 . n 
A  1  254 ILE 254 254 254 ILE ILE 1 . n 
A  1  255 SER 255 255 255 SER SER 1 . n 
A  1  256 GLY 256 256 256 GLY GLY 1 . n 
A  1  257 PRO 257 257 257 PRO PRO 1 . n 
A  1  258 VAL 258 258 258 VAL VAL 1 . n 
A  1  259 LYS 259 259 259 LYS LYS 1 . n 
A  1  260 ARG 260 260 260 ARG ARG 1 . n 
A  1  261 PRO 261 261 261 PRO PRO 1 . n 
A  1  262 GLY 262 262 262 GLY GLY 1 . n 
A  1  263 VAL 263 263 263 VAL VAL 1 . n 
A  1  264 TYR 264 264 264 TYR TYR 1 . n 
A  1  265 GLU 265 265 265 GLU GLU 1 . n 
A  1  266 LEU 266 266 266 LEU LEU 1 . n 
A  1  267 PRO 267 267 267 PRO PRO 1 . n 
A  1  268 MET 268 268 268 MET MET 1 . n 
A  1  269 GLY 269 269 269 GLY GLY 1 . n 
A  1  270 THR 270 270 270 THR THR 1 . n 
A  1  271 THR 271 271 271 THR THR 1 . n 
A  1  272 PHE 272 272 272 PHE PHE 1 . n 
A  1  273 ARG 273 273 273 ARG ARG 1 . n 
A  1  274 GLU 274 274 274 GLU GLU 1 . n 
A  1  275 LEU 275 275 275 LEU LEU 1 . n 
A  1  276 ILE 276 276 276 ILE ILE 1 . n 
A  1  277 TYR 277 277 277 TYR TYR 1 . n 
A  1  278 GLU 278 278 278 GLU GLU 1 . n 
A  1  279 TRP 279 279 279 TRP TRP 1 . n 
A  1  280 ALA 280 280 280 ALA ALA 1 . n 
A  1  281 GLY 281 281 281 GLY GLY 1 . n 
A  1  282 GLY 282 282 282 GLY GLY 1 . n 
A  1  283 PRO 283 283 283 PRO PRO 1 . n 
A  1  284 LEU 284 284 284 LEU LEU 1 . n 
A  1  285 GLU 285 285 285 GLU GLU 1 . n 
A  1  286 PRO 286 286 286 PRO PRO 1 . n 
A  1  287 ILE 287 287 287 ILE ILE 1 . n 
A  1  288 GLN 288 288 288 GLN GLN 1 . n 
A  1  289 ALA 289 289 289 ALA ALA 1 . n 
A  1  290 ILE 290 290 290 ILE ILE 1 . n 
A  1  291 ILE 291 291 291 ILE ILE 1 . n 
A  1  292 PRO 292 292 292 PRO PRO 1 . n 
A  1  293 GLY 293 293 293 GLY GLY 1 . n 
A  1  294 GLY 294 294 294 GLY GLY 1 . n 
A  1  295 SER 295 295 295 SER SER 1 . n 
A  1  296 SER 296 296 296 SER SER 1 . n 
A  1  297 THR 297 297 297 THR THR 1 . n 
A  1  298 PRO 298 298 298 PRO PRO 1 . n 
A  1  299 PRO 299 299 299 PRO PRO 1 . n 
A  1  300 LEU 300 300 300 LEU LEU 1 . n 
A  1  301 PRO 301 301 301 PRO PRO 1 . n 
A  1  302 PHE 302 302 302 PHE PHE 1 . n 
A  1  303 THR 303 303 303 THR THR 1 . n 
A  1  304 GLU 304 304 304 GLU GLU 1 . n 
A  1  305 GLU 305 305 305 GLU GLU 1 . n 
A  1  306 VAL 306 306 306 VAL VAL 1 . n 
A  1  307 LEU 307 307 307 LEU LEU 1 . n 
A  1  308 ASP 308 308 308 ASP ASP 1 . n 
A  1  309 THR 309 309 309 THR THR 1 . n 
A  1  310 PRO 310 310 310 PRO PRO 1 . n 
A  1  311 MET 311 311 311 MET MET 1 . n 
A  1  312 SER 312 312 312 SER SER 1 . n 
A  1  313 TYR 313 313 313 TYR TYR 1 . n 
A  1  314 GLU 314 314 314 GLU GLU 1 . n 
A  1  315 HIS 315 315 315 HIS HIS 1 . n 
A  1  316 LEU 316 316 316 LEU LEU 1 . n 
A  1  317 GLN 317 317 317 GLN GLN 1 . n 
A  1  318 ALA 318 318 318 ALA ALA 1 . n 
A  1  319 LYS 319 319 319 LYS LYS 1 . n 
A  1  320 GLY 320 320 320 GLY GLY 1 . n 
A  1  321 SER 321 321 321 SER SER 1 . n 
A  1  322 MET 322 322 322 MET MET 1 . n 
A  1  323 LEU 323 323 323 LEU LEU 1 . n 
A  1  324 GLY 324 324 324 GLY GLY 1 . n 
A  1  325 THR 325 325 325 THR THR 1 . n 
A  1  326 GLY 326 326 326 GLY GLY 1 . n 
A  1  327 GLY 327 327 327 GLY GLY 1 . n 
A  1  328 VAL 328 328 328 VAL VAL 1 . n 
A  1  329 ILE 329 329 329 ILE ILE 1 . n 
A  1  330 LEU 330 330 330 LEU LEU 1 . n 
A  1  331 ILE 331 331 331 ILE ILE 1 . n 
A  1  332 PRO 332 332 332 PRO PRO 1 . n 
A  1  333 GLU 333 333 333 GLU GLU 1 . n 
A  1  334 ARG 334 334 334 ARG ARG 1 . n 
A  1  335 VAL 335 335 335 VAL VAL 1 . n 
A  1  336 SER 336 336 336 SER SER 1 . n 
A  1  337 MET 337 337 337 MET MET 1 . n 
A  1  338 VAL 338 338 338 VAL VAL 1 . n 
A  1  339 ASP 339 339 339 ASP ASP 1 . n 
A  1  340 ALA 340 340 340 ALA ALA 1 . n 
A  1  341 MET 341 341 341 MET MET 1 . n 
A  1  342 TRP 342 342 342 TRP TRP 1 . n 
A  1  343 ASN 343 343 343 ASN ASN 1 . n 
A  1  344 LEU 344 344 344 LEU LEU 1 . n 
A  1  345 THR 345 345 345 THR THR 1 . n 
A  1  346 ARG 346 346 346 ARG ARG 1 . n 
A  1  347 PHE 347 347 347 PHE PHE 1 . n 
A  1  348 TYR 348 348 348 TYR TYR 1 . n 
A  1  349 ALA 349 349 349 ALA ALA 1 . n 
A  1  350 HIS 350 350 350 HIS HIS 1 . n 
A  1  351 GLU 351 351 351 GLU GLU 1 . n 
A  1  352 SER 352 352 352 SER SER 1 . n 
A  1  353 CYS 353 353 353 CYS CYS 1 . n 
A  1  354 GLY 354 354 354 GLY GLY 1 . n 
A  1  355 LYS 355 355 355 LYS LYS 1 . n 
A  1  356 CYS 356 356 356 CYS CYS 1 . n 
A  1  357 THR 357 357 357 THR THR 1 . n 
A  1  358 PRO 358 358 358 PRO PRO 1 . n 
A  1  359 CYS 359 359 359 CYS CYS 1 . n 
A  1  360 ARG 360 360 360 ARG ARG 1 . n 
A  1  361 GLU 361 361 361 GLU GLU 1 . n 
A  1  362 GLY 362 362 362 GLY GLY 1 . n 
A  1  363 VAL 363 363 363 VAL VAL 1 . n 
A  1  364 ALA 364 364 364 ALA ALA 1 . n 
A  1  365 GLY 365 365 365 GLY GLY 1 . n 
A  1  366 PHE 366 366 366 PHE PHE 1 . n 
A  1  367 MET 367 367 367 MET MET 1 . n 
A  1  368 VAL 368 368 368 VAL VAL 1 . n 
A  1  369 ASN 369 369 369 ASN ASN 1 . n 
A  1  370 LEU 370 370 370 LEU LEU 1 . n 
A  1  371 PHE 371 371 371 PHE PHE 1 . n 
A  1  372 ALA 372 372 372 ALA ALA 1 . n 
A  1  373 LYS 373 373 373 LYS LYS 1 . n 
A  1  374 ILE 374 374 374 ILE ILE 1 . n 
A  1  375 GLY 375 375 375 GLY GLY 1 . n 
A  1  376 THR 376 376 376 THR THR 1 . n 
A  1  377 GLY 377 377 377 GLY GLY 1 . n 
A  1  378 GLN 378 378 378 GLN GLN 1 . n 
A  1  379 GLY 379 379 379 GLY GLY 1 . n 
A  1  380 GLU 380 380 380 GLU GLU 1 . n 
A  1  381 GLU 381 381 381 GLU GLU 1 . n 
A  1  382 LYS 382 382 382 LYS LYS 1 . n 
A  1  383 ASP 383 383 383 ASP ASP 1 . n 
A  1  384 VAL 384 384 384 VAL VAL 1 . n 
A  1  385 GLU 385 385 385 GLU GLU 1 . n 
A  1  386 ASN 386 386 386 ASN ASN 1 . n 
A  1  387 LEU 387 387 387 LEU LEU 1 . n 
A  1  388 GLU 388 388 388 GLU GLU 1 . n 
A  1  389 ALA 389 389 389 ALA ALA 1 . n 
A  1  390 LEU 390 390 390 LEU LEU 1 . n 
A  1  391 LEU 391 391 391 LEU LEU 1 . n 
A  1  392 PRO 392 392 392 PRO PRO 1 . n 
A  1  393 LEU 393 393 393 LEU LEU 1 . n 
A  1  394 ILE 394 394 394 ILE ILE 1 . n 
A  1  395 GLU 395 395 395 GLU GLU 1 . n 
A  1  396 GLY 396 396 396 GLY GLY 1 . n 
A  1  397 ARG 397 397 397 ARG ARG 1 . n 
A  1  398 SER 398 398 398 SER SER 1 . n 
A  1  399 PHE 399 399 399 PHE PHE 1 . n 
A  1  400 CYS 400 400 400 CYS CYS 1 . n 
A  1  401 PRO 401 401 401 PRO PRO 1 . n 
A  1  402 LEU 402 402 402 LEU LEU 1 . n 
A  1  403 ALA 403 403 403 ALA ALA 1 . n 
A  1  404 ASP 404 404 404 ASP ASP 1 . n 
A  1  405 ALA 405 405 405 ALA ALA 1 . n 
A  1  406 ALA 406 406 406 ALA ALA 1 . n 
A  1  407 VAL 407 407 407 VAL VAL 1 . n 
A  1  408 TRP 408 408 408 TRP TRP 1 . n 
A  1  409 PRO 409 409 409 PRO PRO 1 . n 
A  1  410 VAL 410 410 410 VAL VAL 1 . n 
A  1  411 LYS 411 411 411 LYS LYS 1 . n 
A  1  412 GLY 412 412 412 GLY GLY 1 . n 
A  1  413 SER 413 413 413 SER SER 1 . n 
A  1  414 LEU 414 414 414 LEU LEU 1 . n 
A  1  415 ARG 415 415 415 ARG ARG 1 . n 
A  1  416 HIS 416 416 416 HIS HIS 1 . n 
A  1  417 PHE 417 417 417 PHE PHE 1 . n 
A  1  418 LYS 418 418 418 LYS LYS 1 . n 
A  1  419 ASP 419 419 419 ASP ASP 1 . n 
A  1  420 GLN 420 420 420 GLN GLN 1 . n 
A  1  421 TYR 421 421 421 TYR TYR 1 . n 
A  1  422 LEU 422 422 422 LEU LEU 1 . n 
A  1  423 ALA 423 423 423 ALA ALA 1 . n 
A  1  424 LEU 424 424 424 LEU LEU 1 . n 
A  1  425 ALA 425 425 425 ALA ALA 1 . n 
A  1  426 ARG 426 426 426 ARG ARG 1 . n 
A  1  427 GLU 427 427 427 GLU GLU 1 . n 
A  1  428 LYS 428 428 428 LYS LYS 1 . n 
A  1  429 ARG 429 429 429 ARG ARG 1 . n 
A  1  430 PRO 430 430 430 PRO PRO 1 . n 
A  1  431 VAL 431 431 431 VAL VAL 1 . n 
A  1  432 PRO 432 432 432 PRO PRO 1 . n 
A  1  433 ARG 433 433 433 ARG ARG 1 . n 
A  1  434 PRO 434 434 434 PRO PRO 1 . n 
A  1  435 SER 435 435 435 SER SER 1 . n 
A  1  436 LEU 436 436 436 LEU LEU 1 . n 
A  1  437 TRP 437 437 437 TRP TRP 1 . n 
A  1  438 ARG 438 438 438 ARG ARG 1 . n 
B  2  1   MET 1   1   ?   ?   ?   2 . n 
B  2  2   GLY 2   2   ?   ?   ?   2 . n 
B  2  3   PHE 3   3   3   PHE PHE 2 . n 
B  2  4   PHE 4   4   4   PHE PHE 2 . n 
B  2  5   ASP 5   5   5   ASP ASP 2 . n 
B  2  6   ASP 6   6   6   ASP ASP 2 . n 
B  2  7   LYS 7   7   7   LYS LYS 2 . n 
B  2  8   GLN 8   8   8   GLN GLN 2 . n 
B  2  9   ASP 9   9   9   ASP ASP 2 . n 
B  2  10  PHE 10  10  10  PHE PHE 2 . n 
B  2  11  LEU 11  11  11  LEU LEU 2 . n 
B  2  12  GLU 12  12  12  GLU GLU 2 . n 
B  2  13  GLU 13  13  13  GLU GLU 2 . n 
B  2  14  THR 14  14  14  THR THR 2 . n 
B  2  15  PHE 15  15  15  PHE PHE 2 . n 
B  2  16  ALA 16  16  16  ALA ALA 2 . n 
B  2  17  LYS 17  17  17  LYS LYS 2 . n 
B  2  18  TYR 18  18  18  TYR TYR 2 . n 
B  2  19  PRO 19  19  19  PRO PRO 2 . n 
B  2  20  PRO 20  20  20  PRO PRO 2 . n 
B  2  21  GLU 21  21  21  GLU GLU 2 . n 
B  2  22  GLY 22  22  22  GLY GLY 2 . n 
B  2  23  ARG 23  23  23  ARG ARG 2 . n 
B  2  24  ARG 24  24  24  ARG ARG 2 . n 
B  2  25  ALA 25  25  25  ALA ALA 2 . n 
B  2  26  ALA 26  26  26  ALA ALA 2 . n 
B  2  27  ILE 27  27  27  ILE ILE 2 . n 
B  2  28  MET 28  28  28  MET MET 2 . n 
B  2  29  PRO 29  29  29  PRO PRO 2 . n 
B  2  30  LEU 30  30  30  LEU LEU 2 . n 
B  2  31  LEU 31  31  31  LEU LEU 2 . n 
B  2  32  ARG 32  32  32  ARG ARG 2 . n 
B  2  33  ARG 33  33  33  ARG ARG 2 . n 
B  2  34  VAL 34  34  34  VAL VAL 2 . n 
B  2  35  GLN 35  35  35  GLN GLN 2 . n 
B  2  36  GLN 36  36  36  GLN GLN 2 . n 
B  2  37  GLU 37  37  37  GLU GLU 2 . n 
B  2  38  GLU 38  38  38  GLU GLU 2 . n 
B  2  39  GLY 39  39  39  GLY GLY 2 . n 
B  2  40  TRP 40  40  40  TRP TRP 2 . n 
B  2  41  ILE 41  41  41  ILE ILE 2 . n 
B  2  42  ARG 42  42  42  ARG ARG 2 . n 
B  2  43  PRO 43  43  43  PRO PRO 2 . n 
B  2  44  GLU 44  44  44  GLU GLU 2 . n 
B  2  45  ARG 45  45  45  ARG ARG 2 . n 
B  2  46  ILE 46  46  46  ILE ILE 2 . n 
B  2  47  GLU 47  47  47  GLU GLU 2 . n 
B  2  48  GLU 48  48  48  GLU GLU 2 . n 
B  2  49  ILE 49  49  49  ILE ILE 2 . n 
B  2  50  ALA 50  50  50  ALA ALA 2 . n 
B  2  51  ARG 51  51  51  ARG ARG 2 . n 
B  2  52  LEU 52  52  52  LEU LEU 2 . n 
B  2  53  VAL 53  53  53  VAL VAL 2 . n 
B  2  54  GLY 54  54  54  GLY GLY 2 . n 
B  2  55  THR 55  55  55  THR THR 2 . n 
B  2  56  THR 56  56  56  THR THR 2 . n 
B  2  57  PRO 57  57  57  PRO PRO 2 . n 
B  2  58  THR 58  58  58  THR THR 2 . n 
B  2  59  GLU 59  59  59  GLU GLU 2 . n 
B  2  60  VAL 60  60  60  VAL VAL 2 . n 
B  2  61  MET 61  61  61  MET MET 2 . n 
B  2  62  GLY 62  62  62  GLY GLY 2 . n 
B  2  63  VAL 63  63  63  VAL VAL 2 . n 
B  2  64  ALA 64  64  64  ALA ALA 2 . n 
B  2  65  SER 65  65  65  SER SER 2 . n 
B  2  66  PHE 66  66  66  PHE PHE 2 . n 
B  2  67  TYR 67  67  67  TYR TYR 2 . n 
B  2  68  SER 68  68  68  SER SER 2 . n 
B  2  69  TYR 69  69  69  TYR TYR 2 . n 
B  2  70  TYR 70  70  70  TYR TYR 2 . n 
B  2  71  GLN 71  71  71  GLN GLN 2 . n 
B  2  72  PHE 72  72  72  PHE PHE 2 . n 
B  2  73  VAL 73  73  73  VAL VAL 2 . n 
B  2  74  PRO 74  74  74  PRO PRO 2 . n 
B  2  75  THR 75  75  75  THR THR 2 . n 
B  2  76  GLY 76  76  76  GLY GLY 2 . n 
B  2  77  LYS 77  77  77  LYS LYS 2 . n 
B  2  78  TYR 78  78  78  TYR TYR 2 . n 
B  2  79  HIS 79  79  79  HIS HIS 2 . n 
B  2  80  LEU 80  80  80  LEU LEU 2 . n 
B  2  81  GLN 81  81  81  GLN GLN 2 . n 
B  2  82  VAL 82  82  82  VAL VAL 2 . n 
B  2  83  CYS 83  83  83  CYS CYS 2 . n 
B  2  84  ALA 84  84  84  ALA ALA 2 . n 
B  2  85  THR 85  85  85  THR THR 2 . n 
B  2  86  LEU 86  86  86  LEU LEU 2 . n 
B  2  87  SER 87  87  87  SER SER 2 . n 
B  2  88  CYS 88  88  88  CYS CYS 2 . n 
B  2  89  LYS 89  89  89  LYS LYS 2 . n 
B  2  90  LEU 90  90  90  LEU LEU 2 . n 
B  2  91  ALA 91  91  91  ALA ALA 2 . n 
B  2  92  GLY 92  92  92  GLY GLY 2 . n 
B  2  93  ALA 93  93  93  ALA ALA 2 . n 
B  2  94  GLU 94  94  94  GLU GLU 2 . n 
B  2  95  GLU 95  95  95  GLU GLU 2 . n 
B  2  96  LEU 96  96  96  LEU LEU 2 . n 
B  2  97  TRP 97  97  97  TRP TRP 2 . n 
B  2  98  ASP 98  98  98  ASP ASP 2 . n 
B  2  99  TYR 99  99  99  TYR TYR 2 . n 
B  2  100 LEU 100 100 100 LEU LEU 2 . n 
B  2  101 THR 101 101 101 THR THR 2 . n 
B  2  102 GLU 102 102 102 GLU GLU 2 . n 
B  2  103 THR 103 103 103 THR THR 2 . n 
B  2  104 LEU 104 104 104 LEU LEU 2 . n 
B  2  105 GLY 105 105 105 GLY GLY 2 . n 
B  2  106 ILE 106 106 106 ILE ILE 2 . n 
B  2  107 GLY 107 107 107 GLY GLY 2 . n 
B  2  108 PRO 108 108 108 PRO PRO 2 . n 
B  2  109 GLY 109 109 109 GLY GLY 2 . n 
B  2  110 GLU 110 110 110 GLU GLU 2 . n 
B  2  111 VAL 111 111 111 VAL VAL 2 . n 
B  2  112 THR 112 112 112 THR THR 2 . n 
B  2  113 PRO 113 113 113 PRO PRO 2 . n 
B  2  114 ASP 114 114 114 ASP ASP 2 . n 
B  2  115 GLY 115 115 115 GLY GLY 2 . n 
B  2  116 LEU 116 116 116 LEU LEU 2 . n 
B  2  117 PHE 117 117 117 PHE PHE 2 . n 
B  2  118 SER 118 118 118 SER SER 2 . n 
B  2  119 VAL 119 119 119 VAL VAL 2 . n 
B  2  120 GLN 120 120 120 GLN GLN 2 . n 
B  2  121 LYS 121 121 121 LYS LYS 2 . n 
B  2  122 VAL 122 122 122 VAL VAL 2 . n 
B  2  123 GLU 123 123 123 GLU GLU 2 . n 
B  2  124 CYS 124 124 124 CYS CYS 2 . n 
B  2  125 LEU 125 125 125 LEU LEU 2 . n 
B  2  126 GLY 126 126 126 GLY GLY 2 . n 
B  2  127 SER 127 127 127 SER SER 2 . n 
B  2  128 CYS 128 128 128 CYS CYS 2 . n 
B  2  129 HIS 129 129 129 HIS HIS 2 . n 
B  2  130 THR 130 130 130 THR THR 2 . n 
B  2  131 ALA 131 131 131 ALA ALA 2 . n 
B  2  132 PRO 132 132 132 PRO PRO 2 . n 
B  2  133 VAL 133 133 133 VAL VAL 2 . n 
B  2  134 ILE 134 134 134 ILE ILE 2 . n 
B  2  135 GLN 135 135 135 GLN GLN 2 . n 
B  2  136 VAL 136 136 136 VAL VAL 2 . n 
B  2  137 ASN 137 137 137 ASN ASN 2 . n 
B  2  138 ASP 138 138 138 ASP ASP 2 . n 
B  2  139 GLU 139 139 139 GLU GLU 2 . n 
B  2  140 PRO 140 140 140 PRO PRO 2 . n 
B  2  141 TYR 141 141 141 TYR TYR 2 . n 
B  2  142 VAL 142 142 142 VAL VAL 2 . n 
B  2  143 GLU 143 143 143 GLU GLU 2 . n 
B  2  144 CYS 144 144 144 CYS CYS 2 . n 
B  2  145 VAL 145 145 145 VAL VAL 2 . n 
B  2  146 THR 146 146 146 THR THR 2 . n 
B  2  147 ARG 147 147 147 ARG ARG 2 . n 
B  2  148 ALA 148 148 148 ALA ALA 2 . n 
B  2  149 ARG 149 149 149 ARG ARG 2 . n 
B  2  150 LEU 150 150 150 LEU LEU 2 . n 
B  2  151 GLU 151 151 151 GLU GLU 2 . n 
B  2  152 ALA 152 152 152 ALA ALA 2 . n 
B  2  153 LEU 153 153 153 LEU LEU 2 . n 
B  2  154 LEU 154 154 154 LEU LEU 2 . n 
B  2  155 ALA 155 155 155 ALA ALA 2 . n 
B  2  156 GLY 156 156 156 GLY GLY 2 . n 
B  2  157 LEU 157 157 157 LEU LEU 2 . n 
B  2  158 ARG 158 158 158 ARG ARG 2 . n 
B  2  159 ALA 159 159 159 ALA ALA 2 . n 
B  2  160 GLY 160 160 160 GLY GLY 2 . n 
B  2  161 LYS 161 161 161 LYS LYS 2 . n 
B  2  162 ARG 162 162 162 ARG ARG 2 . n 
B  2  163 LEU 163 163 163 LEU LEU 2 . n 
B  2  164 GLU 164 164 164 GLU GLU 2 . n 
B  2  165 GLU 165 165 165 GLU GLU 2 . n 
B  2  166 ILE 166 166 166 ILE ILE 2 . n 
B  2  167 GLU 167 167 167 GLU GLU 2 . n 
B  2  168 LEU 168 168 168 LEU LEU 2 . n 
B  2  169 PRO 169 169 169 PRO PRO 2 . n 
B  2  170 GLY 170 170 170 GLY GLY 2 . n 
B  2  171 LYS 171 171 171 LYS LYS 2 . n 
B  2  172 CYS 172 172 172 CYS CYS 2 . n 
B  2  173 GLY 173 173 173 GLY GLY 2 . n 
B  2  174 HIS 174 174 174 HIS HIS 2 . n 
B  2  175 HIS 175 175 175 HIS HIS 2 . n 
B  2  176 VAL 176 176 176 VAL VAL 2 . n 
B  2  177 HIS 177 177 177 HIS HIS 2 . n 
B  2  178 GLU 178 178 178 GLU GLU 2 . n 
B  2  179 VAL 179 179 179 VAL VAL 2 . n 
B  2  180 GLU 180 180 180 GLU GLU 2 . n 
B  2  181 VAL 181 181 ?   ?   ?   2 . n 
C  3  1   MET 1   1   1   MET MET 3 . n 
C  3  2   VAL 2   2   2   VAL VAL 3 . n 
C  3  3   ARG 3   3   3   ARG ARG 3 . n 
C  3  4   VAL 4   4   4   VAL VAL 3 . n 
C  3  5   LYS 5   5   5   LYS LYS 3 . n 
C  3  6   VAL 6   6   6   VAL VAL 3 . n 
C  3  7   ASN 7   7   7   ASN ASN 3 . n 
C  3  8   ASP 8   8   8   ASP ASP 3 . n 
C  3  9   ARG 9   9   9   ARG ARG 3 . n 
C  3  10  ILE 10  10  10  ILE ILE 3 . n 
C  3  11  VAL 11  11  11  VAL VAL 3 . n 
C  3  12  GLU 12  12  12  GLU GLU 3 . n 
C  3  13  VAL 13  13  13  VAL VAL 3 . n 
C  3  14  PRO 14  14  14  PRO PRO 3 . n 
C  3  15  PRO 15  15  15  PRO PRO 3 . n 
C  3  16  GLY 16  16  16  GLY GLY 3 . n 
C  3  17  THR 17  17  17  THR THR 3 . n 
C  3  18  SER 18  18  18  SER SER 3 . n 
C  3  19  VAL 19  19  19  VAL VAL 3 . n 
C  3  20  MET 20  20  20  MET MET 3 . n 
C  3  21  ASP 21  21  21  ASP ASP 3 . n 
C  3  22  ALA 22  22  22  ALA ALA 3 . n 
C  3  23  VAL 23  23  23  VAL VAL 3 . n 
C  3  24  PHE 24  24  24  PHE PHE 3 . n 
C  3  25  HIS 25  25  25  HIS HIS 3 . n 
C  3  26  ALA 26  26  26  ALA ALA 3 . n 
C  3  27  GLY 27  27  27  GLY GLY 3 . n 
C  3  28  TYR 28  28  28  TYR TYR 3 . n 
C  3  29  ASP 29  29  29  ASP ASP 3 . n 
C  3  30  VAL 30  30  30  VAL VAL 3 . n 
C  3  31  PRO 31  31  31  PRO PRO 3 . n 
C  3  32  LEU 32  32  32  LEU LEU 3 . n 
C  3  33  PHE 33  33  33  PHE PHE 3 . n 
C  3  34  CYS 34  34  34  CYS CYS 3 . n 
C  3  35  SER 35  35  35  SER SER 3 . n 
C  3  36  GLU 36  36  36  GLU GLU 3 . n 
C  3  37  LYS 37  37  37  LYS LYS 3 . n 
C  3  38  HIS 38  38  38  HIS HIS 3 . n 
C  3  39  LEU 39  39  39  LEU LEU 3 . n 
C  3  40  SER 40  40  40  SER SER 3 . n 
C  3  41  PRO 41  41  41  PRO PRO 3 . n 
C  3  42  ILE 42  42  42  ILE ILE 3 . n 
C  3  43  GLY 43  43  43  GLY GLY 3 . n 
C  3  44  ALA 44  44  44  ALA ALA 3 . n 
C  3  45  CYS 45  45  45  CYS CYS 3 . n 
C  3  46  ARG 46  46  46  ARG ARG 3 . n 
C  3  47  MET 47  47  47  MET MET 3 . n 
C  3  48  CYS 48  48  48  CYS CYS 3 . n 
C  3  49  LEU 49  49  49  LEU LEU 3 . n 
C  3  50  VAL 50  50  50  VAL VAL 3 . n 
C  3  51  ARG 51  51  51  ARG ARG 3 . n 
C  3  52  ILE 52  52  52  ILE ILE 3 . n 
C  3  53  GLY 53  53  53  GLY GLY 3 . n 
C  3  54  LEU 54  54  54  LEU LEU 3 . n 
C  3  55  PRO 55  55  55  PRO PRO 3 . n 
C  3  56  LYS 56  56  ?   ?   ?   3 . n 
C  3  57  LYS 57  57  ?   ?   ?   3 . n 
C  3  58  GLY 58  58  ?   ?   ?   3 . n 
C  3  59  PRO 59  59  ?   ?   ?   3 . n 
C  3  60  ASP 60  60  ?   ?   ?   3 . n 
C  3  61  GLY 61  61  ?   ?   ?   3 . n 
C  3  62  LYS 62  62  ?   ?   ?   3 . n 
C  3  63  PRO 63  63  ?   ?   ?   3 . n 
C  3  64  LEU 64  64  ?   ?   ?   3 . n 
C  3  65  LEU 65  65  ?   ?   ?   3 . n 
C  3  66  ASN 66  66  ?   ?   ?   3 . n 
C  3  67  GLU 67  67  ?   ?   ?   3 . n 
C  3  68  LYS 68  68  ?   ?   ?   3 . n 
C  3  69  GLY 69  69  ?   ?   ?   3 . n 
C  3  70  GLU 70  70  ?   ?   ?   3 . n 
C  3  71  PRO 71  71  ?   ?   ?   3 . n 
C  3  72  GLU 72  72  ?   ?   ?   3 . n 
C  3  73  ILE 73  73  73  ILE ILE 3 . n 
C  3  74  GLN 74  74  74  GLN GLN 3 . n 
C  3  75  TRP 75  75  75  TRP TRP 3 . n 
C  3  76  GLN 76  76  76  GLN GLN 3 . n 
C  3  77  PRO 77  77  77  PRO PRO 3 . n 
C  3  78  LYS 78  78  78  LYS LYS 3 . n 
C  3  79  LEU 79  79  79  LEU LEU 3 . n 
C  3  80  ALA 80  80  80  ALA ALA 3 . n 
C  3  81  ALA 81  81  81  ALA ALA 3 . n 
C  3  82  SER 82  82  82  SER SER 3 . n 
C  3  83  CYS 83  83  83  CYS CYS 3 . n 
C  3  84  VAL 84  84  84  VAL VAL 3 . n 
C  3  85  THR 85  85  85  THR THR 3 . n 
C  3  86  ALA 86  86  86  ALA ALA 3 . n 
C  3  87  VAL 87  87  87  VAL VAL 3 . n 
C  3  88  ALA 88  88  88  ALA ALA 3 . n 
C  3  89  ASP 89  89  89  ASP ASP 3 . n 
C  3  90  GLY 90  90  90  GLY GLY 3 . n 
C  3  91  MET 91  91  91  MET MET 3 . n 
C  3  92  VAL 92  92  92  VAL VAL 3 . n 
C  3  93  VAL 93  93  93  VAL VAL 3 . n 
C  3  94  ASP 94  94  94  ASP ASP 3 . n 
C  3  95  THR 95  95  95  THR THR 3 . n 
C  3  96  LEU 96  96  96  LEU LEU 3 . n 
C  3  97  SER 97  97  97  SER SER 3 . n 
C  3  98  ASP 98  98  98  ASP ASP 3 . n 
C  3  99  VAL 99  99  99  VAL VAL 3 . n 
C  3  100 VAL 100 100 100 VAL VAL 3 . n 
C  3  101 ARG 101 101 101 ARG ARG 3 . n 
C  3  102 GLU 102 102 102 GLU GLU 3 . n 
C  3  103 ALA 103 103 103 ALA ALA 3 . n 
C  3  104 GLN 104 104 104 GLN GLN 3 . n 
C  3  105 ALA 105 105 105 ALA ALA 3 . n 
C  3  106 GLY 106 106 106 GLY GLY 3 . n 
C  3  107 MET 107 107 107 MET MET 3 . n 
C  3  108 VAL 108 108 108 VAL VAL 3 . n 
C  3  109 GLU 109 109 109 GLU GLU 3 . n 
C  3  110 PHE 110 110 110 PHE PHE 3 . n 
C  3  111 THR 111 111 111 THR THR 3 . n 
C  3  112 LEU 112 112 112 LEU LEU 3 . n 
C  3  113 LEU 113 113 113 LEU LEU 3 . n 
C  3  114 ASN 114 114 114 ASN ASN 3 . n 
C  3  115 HIS 115 115 115 HIS HIS 3 . n 
C  3  116 PRO 116 116 116 PRO PRO 3 . n 
C  3  117 LEU 117 117 117 LEU LEU 3 . n 
C  3  118 ASP 118 118 118 ASP ASP 3 . n 
C  3  119 CYS 119 119 119 CYS CYS 3 . n 
C  3  120 PRO 120 120 120 PRO PRO 3 . n 
C  3  121 THR 121 121 121 THR THR 3 . n 
C  3  122 CYS 122 122 122 CYS CYS 3 . n 
C  3  123 ASP 123 123 123 ASP ASP 3 . n 
C  3  124 LYS 124 124 124 LYS LYS 3 . n 
C  3  125 GLY 125 125 125 GLY GLY 3 . n 
C  3  126 GLY 126 126 126 GLY GLY 3 . n 
C  3  127 ALA 127 127 127 ALA ALA 3 . n 
C  3  128 CYS 128 128 128 CYS CYS 3 . n 
C  3  129 GLU 129 129 129 GLU GLU 3 . n 
C  3  130 LEU 130 130 130 LEU LEU 3 . n 
C  3  131 GLN 131 131 131 GLN GLN 3 . n 
C  3  132 ASP 132 132 132 ASP ASP 3 . n 
C  3  133 ARG 133 133 133 ARG ARG 3 . n 
C  3  134 THR 134 134 134 THR THR 3 . n 
C  3  135 VAL 135 135 135 VAL VAL 3 . n 
C  3  136 GLU 136 136 136 GLU GLU 3 . n 
C  3  137 TYR 137 137 137 TYR TYR 3 . n 
C  3  138 GLY 138 138 138 GLY GLY 3 . n 
C  3  139 LEU 139 139 139 LEU LEU 3 . n 
C  3  140 TYR 140 140 140 TYR TYR 3 . n 
C  3  141 GLU 141 141 141 GLU GLU 3 . n 
C  3  142 LYS 142 142 142 LYS LYS 3 . n 
C  3  143 TYR 143 143 143 TYR TYR 3 . n 
C  3  144 TYR 144 144 ?   ?   ?   3 . n 
C  3  145 GLN 145 145 ?   ?   ?   3 . n 
C  3  146 LYS 146 146 ?   ?   ?   3 . n 
C  3  147 GLY 147 147 ?   ?   ?   3 . n 
C  3  148 PRO 148 148 148 PRO PRO 3 . n 
C  3  149 LEU 149 149 149 LEU LEU 3 . n 
C  3  150 GLU 150 150 150 GLU GLU 3 . n 
C  3  151 LEU 151 151 151 LEU LEU 3 . n 
C  3  152 PRO 152 152 152 PRO PRO 3 . n 
C  3  153 VAL 153 153 153 VAL VAL 3 . n 
C  3  154 TYR 154 154 154 TYR TYR 3 . n 
C  3  155 THR 155 155 155 THR THR 3 . n 
C  3  156 ARG 156 156 156 ARG ARG 3 . n 
C  3  157 PHE 157 157 157 PHE PHE 3 . n 
C  3  158 GLU 158 158 158 GLU GLU 3 . n 
C  3  159 PHE 159 159 159 PHE PHE 3 . n 
C  3  160 THR 160 160 160 THR THR 3 . n 
C  3  161 ARG 161 161 161 ARG ARG 3 . n 
C  3  162 ARG 162 162 162 ARG ARG 3 . n 
C  3  163 HIS 163 163 163 HIS HIS 3 . n 
C  3  164 VAL 164 164 164 VAL VAL 3 . n 
C  3  165 ASP 165 165 165 ASP ASP 3 . n 
C  3  166 LYS 166 166 166 LYS LYS 3 . n 
C  3  167 HIS 167 167 167 HIS HIS 3 . n 
C  3  168 HIS 168 168 168 HIS HIS 3 . n 
C  3  169 PRO 169 169 169 PRO PRO 3 . n 
C  3  170 LEU 170 170 170 LEU LEU 3 . n 
C  3  171 SER 171 171 171 SER SER 3 . n 
C  3  172 PRO 172 172 172 PRO PRO 3 . n 
C  3  173 PHE 173 173 173 PHE PHE 3 . n 
C  3  174 VAL 174 174 174 VAL VAL 3 . n 
C  3  175 ILE 175 175 175 ILE ILE 3 . n 
C  3  176 LEU 176 176 176 LEU LEU 3 . n 
C  3  177 ASP 177 177 177 ASP ASP 3 . n 
C  3  178 ARG 178 178 178 ARG ARG 3 . n 
C  3  179 GLU 179 179 179 GLU GLU 3 . n 
C  3  180 ARG 180 180 180 ARG ARG 3 . n 
C  3  181 CYS 181 181 181 CYS CYS 3 . n 
C  3  182 ILE 182 182 182 ILE ILE 3 . n 
C  3  183 HIS 183 183 183 HIS HIS 3 . n 
C  3  184 CYS 184 184 184 CYS CYS 3 . n 
C  3  185 LYS 185 185 185 LYS LYS 3 . n 
C  3  186 ARG 186 186 186 ARG ARG 3 . n 
C  3  187 CYS 187 187 187 CYS CYS 3 . n 
C  3  188 VAL 188 188 188 VAL VAL 3 . n 
C  3  189 ARG 189 189 189 ARG ARG 3 . n 
C  3  190 TYR 190 190 190 TYR TYR 3 . n 
C  3  191 PHE 191 191 191 PHE PHE 3 . n 
C  3  192 GLU 192 192 192 GLU GLU 3 . n 
C  3  193 GLU 193 193 193 GLU GLU 3 . n 
C  3  194 VAL 194 194 194 VAL VAL 3 . n 
C  3  195 PRO 195 195 195 PRO PRO 3 . n 
C  3  196 GLY 196 196 196 GLY GLY 3 . n 
C  3  197 ASP 197 197 197 ASP ASP 3 . n 
C  3  198 GLU 198 198 198 GLU GLU 3 . n 
C  3  199 VAL 199 199 199 VAL VAL 3 . n 
C  3  200 LEU 200 200 200 LEU LEU 3 . n 
C  3  201 ASP 201 201 201 ASP ASP 3 . n 
C  3  202 PHE 202 202 202 PHE PHE 3 . n 
C  3  203 ILE 203 203 203 ILE ILE 3 . n 
C  3  204 GLU 204 204 204 GLU GLU 3 . n 
C  3  205 ARG 205 205 205 ARG ARG 3 . n 
C  3  206 GLY 206 206 206 GLY GLY 3 . n 
C  3  207 VAL 207 207 207 VAL VAL 3 . n 
C  3  208 HIS 208 208 208 HIS HIS 3 . n 
C  3  209 THR 209 209 209 THR THR 3 . n 
C  3  210 PHE 210 210 210 PHE PHE 3 . n 
C  3  211 ILE 211 211 211 ILE ILE 3 . n 
C  3  212 GLY 212 212 212 GLY GLY 3 . n 
C  3  213 THR 213 213 213 THR THR 3 . n 
C  3  214 MET 214 214 214 MET MET 3 . n 
C  3  215 ASP 215 215 215 ASP ASP 3 . n 
C  3  216 PHE 216 216 216 PHE PHE 3 . n 
C  3  217 GLY 217 217 217 GLY GLY 3 . n 
C  3  218 LEU 218 218 218 LEU LEU 3 . n 
C  3  219 PRO 219 219 219 PRO PRO 3 . n 
C  3  220 SER 220 220 220 SER SER 3 . n 
C  3  221 GLY 221 221 221 GLY GLY 3 . n 
C  3  222 PHE 222 222 222 PHE PHE 3 . n 
C  3  223 SER 223 223 223 SER SER 3 . n 
C  3  224 GLY 224 224 224 GLY GLY 3 . n 
C  3  225 ASN 225 225 225 ASN ASN 3 . n 
C  3  226 ILE 226 226 226 ILE ILE 3 . n 
C  3  227 THR 227 227 227 THR THR 3 . n 
C  3  228 ASP 228 228 228 ASP ASP 3 . n 
C  3  229 ILE 229 229 229 ILE ILE 3 . n 
C  3  230 CYS 230 230 230 CYS CYS 3 . n 
C  3  231 PRO 231 231 231 PRO PRO 3 . n 
C  3  232 VAL 232 232 232 VAL VAL 3 . n 
C  3  233 GLY 233 233 233 GLY GLY 3 . n 
C  3  234 ALA 234 234 234 ALA ALA 3 . n 
C  3  235 LEU 235 235 235 LEU LEU 3 . n 
C  3  236 LEU 236 236 236 LEU LEU 3 . n 
C  3  237 ASP 237 237 237 ASP ASP 3 . n 
C  3  238 LEU 238 238 238 LEU LEU 3 . n 
C  3  239 THR 239 239 239 THR THR 3 . n 
C  3  240 ALA 240 240 240 ALA ALA 3 . n 
C  3  241 ARG 241 241 241 ARG ARG 3 . n 
C  3  242 PHE 242 242 242 PHE PHE 3 . n 
C  3  243 ARG 243 243 243 ARG ARG 3 . n 
C  3  244 ALA 244 244 244 ALA ALA 3 . n 
C  3  245 ARG 245 245 245 ARG ARG 3 . n 
C  3  246 ASN 246 246 246 ASN ASN 3 . n 
C  3  247 TRP 247 247 247 TRP TRP 3 . n 
C  3  248 GLU 248 248 248 GLU GLU 3 . n 
C  3  249 MET 249 249 249 MET MET 3 . n 
C  3  250 GLU 250 250 250 GLU GLU 3 . n 
C  3  251 GLU 251 251 251 GLU GLU 3 . n 
C  3  252 THR 252 252 252 THR THR 3 . n 
C  3  253 PRO 253 253 253 PRO PRO 3 . n 
C  3  254 THR 254 254 254 THR THR 3 . n 
C  3  255 THR 255 255 255 THR THR 3 . n 
C  3  256 CYS 256 256 256 CYS CYS 3 . n 
C  3  257 ALA 257 257 257 ALA ALA 3 . n 
C  3  258 LEU 258 258 258 LEU LEU 3 . n 
C  3  259 CYS 259 259 259 CYS CYS 3 . n 
C  3  260 PRO 260 260 260 PRO PRO 3 . n 
C  3  261 VAL 261 261 261 VAL VAL 3 . n 
C  3  262 GLY 262 262 262 GLY GLY 3 . n 
C  3  263 CYS 263 263 263 CYS CYS 3 . n 
C  3  264 GLY 264 264 264 GLY GLY 3 . n 
C  3  265 ILE 265 265 265 ILE ILE 3 . n 
C  3  266 THR 266 266 266 THR THR 3 . n 
C  3  267 ALA 267 267 267 ALA ALA 3 . n 
C  3  268 ASP 268 268 268 ASP ASP 3 . n 
C  3  269 THR 269 269 269 THR THR 3 . n 
C  3  270 ARG 270 270 270 ARG ARG 3 . n 
C  3  271 SER 271 271 271 SER SER 3 . n 
C  3  272 GLY 272 272 272 GLY GLY 3 . n 
C  3  273 GLU 273 273 273 GLU GLU 3 . n 
C  3  274 LEU 274 274 274 LEU LEU 3 . n 
C  3  275 LEU 275 275 275 LEU LEU 3 . n 
C  3  276 ARG 276 276 276 ARG ARG 3 . n 
C  3  277 ILE 277 277 277 ILE ILE 3 . n 
C  3  278 ARG 278 278 278 ARG ARG 3 . n 
C  3  279 ALA 279 279 279 ALA ALA 3 . n 
C  3  280 ARG 280 280 280 ARG ARG 3 . n 
C  3  281 GLU 281 281 281 GLU GLU 3 . n 
C  3  282 VAL 282 282 282 VAL VAL 3 . n 
C  3  283 PRO 283 283 283 PRO PRO 3 . n 
C  3  284 GLU 284 284 284 GLU GLU 3 . n 
C  3  285 VAL 285 285 285 VAL VAL 3 . n 
C  3  286 ASN 286 286 286 ASN ASN 3 . n 
C  3  287 GLU 287 287 287 GLU GLU 3 . n 
C  3  288 ILE 288 288 288 ILE ILE 3 . n 
C  3  289 TRP 289 289 289 TRP TRP 3 . n 
C  3  290 ILE 290 290 290 ILE ILE 3 . n 
C  3  291 CYS 291 291 291 CYS CYS 3 . n 
C  3  292 ASP 292 292 292 ASP ASP 3 . n 
C  3  293 ALA 293 293 293 ALA ALA 3 . n 
C  3  294 GLY 294 294 294 GLY GLY 3 . n 
C  3  295 ARG 295 295 295 ARG ARG 3 . n 
C  3  296 PHE 296 296 296 PHE PHE 3 . n 
C  3  297 GLY 297 297 297 GLY GLY 3 . n 
C  3  298 HIS 298 298 298 HIS HIS 3 . n 
C  3  299 GLU 299 299 299 GLU GLU 3 . n 
C  3  300 TRP 300 300 300 TRP TRP 3 . n 
C  3  301 ALA 301 301 301 ALA ALA 3 . n 
C  3  302 ASP 302 302 302 ASP ASP 3 . n 
C  3  303 GLN 303 303 303 GLN GLN 3 . n 
C  3  304 ASN 304 304 304 ASN ASN 3 . n 
C  3  305 ARG 305 305 305 ARG ARG 3 . n 
C  3  306 LEU 306 306 306 LEU LEU 3 . n 
C  3  307 LYS 307 307 307 LYS LYS 3 . n 
C  3  308 THR 308 308 308 THR THR 3 . n 
C  3  309 PRO 309 309 309 PRO PRO 3 . n 
C  3  310 LEU 310 310 310 LEU LEU 3 . n 
C  3  311 VAL 311 311 311 VAL VAL 3 . n 
C  3  312 ARG 312 312 312 ARG ARG 3 . n 
C  3  313 LYS 313 313 313 LYS LYS 3 . n 
C  3  314 GLU 314 314 314 GLU GLU 3 . n 
C  3  315 GLY 315 315 315 GLY GLY 3 . n 
C  3  316 ARG 316 316 316 ARG ARG 3 . n 
C  3  317 LEU 317 317 317 LEU LEU 3 . n 
C  3  318 VAL 318 318 318 VAL VAL 3 . n 
C  3  319 GLU 319 319 319 GLU GLU 3 . n 
C  3  320 ALA 320 320 320 ALA ALA 3 . n 
C  3  321 THR 321 321 321 THR THR 3 . n 
C  3  322 TRP 322 322 322 TRP TRP 3 . n 
C  3  323 GLU 323 323 323 GLU GLU 3 . n 
C  3  324 GLU 324 324 324 GLU GLU 3 . n 
C  3  325 ALA 325 325 325 ALA ALA 3 . n 
C  3  326 PHE 326 326 326 PHE PHE 3 . n 
C  3  327 LEU 327 327 327 LEU LEU 3 . n 
C  3  328 ALA 328 328 328 ALA ALA 3 . n 
C  3  329 LEU 329 329 329 LEU LEU 3 . n 
C  3  330 LYS 330 330 330 LYS LYS 3 . n 
C  3  331 GLU 331 331 331 GLU GLU 3 . n 
C  3  332 GLY 332 332 332 GLY GLY 3 . n 
C  3  333 LEU 333 333 333 LEU LEU 3 . n 
C  3  334 LYS 334 334 334 LYS LYS 3 . n 
C  3  335 GLU 335 335 335 GLU GLU 3 . n 
C  3  336 ALA 336 336 336 ALA ALA 3 . n 
C  3  337 ARG 337 337 337 ARG ARG 3 . n 
C  3  338 GLY 338 338 338 GLY GLY 3 . n 
C  3  339 GLU 339 339 339 GLU GLU 3 . n 
C  3  340 GLU 340 340 340 GLU GLU 3 . n 
C  3  341 VAL 341 341 341 VAL VAL 3 . n 
C  3  342 GLY 342 342 342 GLY GLY 3 . n 
C  3  343 LEU 343 343 343 LEU LEU 3 . n 
C  3  344 TYR 344 344 344 TYR TYR 3 . n 
C  3  345 LEU 345 345 345 LEU LEU 3 . n 
C  3  346 ALA 346 346 346 ALA ALA 3 . n 
C  3  347 HIS 347 347 347 HIS HIS 3 . n 
C  3  348 ASP 348 348 348 ASP ASP 3 . n 
C  3  349 ALA 349 349 349 ALA ALA 3 . n 
C  3  350 THR 350 350 350 THR THR 3 . n 
C  3  351 LEU 351 351 351 LEU LEU 3 . n 
C  3  352 GLU 352 352 352 GLU GLU 3 . n 
C  3  353 GLU 353 353 353 GLU GLU 3 . n 
C  3  354 GLY 354 354 354 GLY GLY 3 . n 
C  3  355 LEU 355 355 355 LEU LEU 3 . n 
C  3  356 LEU 356 356 356 LEU LEU 3 . n 
C  3  357 ALA 357 357 357 ALA ALA 3 . n 
C  3  358 SER 358 358 358 SER SER 3 . n 
C  3  359 GLU 359 359 359 GLU GLU 3 . n 
C  3  360 LEU 360 360 360 LEU LEU 3 . n 
C  3  361 ALA 361 361 361 ALA ALA 3 . n 
C  3  362 LYS 362 362 362 LYS LYS 3 . n 
C  3  363 ALA 363 363 363 ALA ALA 3 . n 
C  3  364 LEU 364 364 364 LEU LEU 3 . n 
C  3  365 LYS 365 365 365 LYS LYS 3 . n 
C  3  366 THR 366 366 366 THR THR 3 . n 
C  3  367 PRO 367 367 367 PRO PRO 3 . n 
C  3  368 HIS 368 368 368 HIS HIS 3 . n 
C  3  369 LEU 369 369 369 LEU LEU 3 . n 
C  3  370 ASP 370 370 370 ASP ASP 3 . n 
C  3  371 PHE 371 371 371 PHE PHE 3 . n 
C  3  372 GLN 372 372 372 GLN GLN 3 . n 
C  3  373 GLY 373 373 373 GLY GLY 3 . n 
C  3  374 ARG 374 374 374 ARG ARG 3 . n 
C  3  375 THR 375 375 375 THR THR 3 . n 
C  3  376 ALA 376 376 376 ALA ALA 3 . n 
C  3  377 ALA 377 377 377 ALA ALA 3 . n 
C  3  378 PRO 378 378 378 PRO PRO 3 . n 
C  3  379 ALA 379 379 379 ALA ALA 3 . n 
C  3  380 SER 380 380 380 SER SER 3 . n 
C  3  381 LEU 381 381 381 LEU LEU 3 . n 
C  3  382 PHE 382 382 382 PHE PHE 3 . n 
C  3  383 PRO 383 383 383 PRO PRO 3 . n 
C  3  384 PRO 384 384 384 PRO PRO 3 . n 
C  3  385 ALA 385 385 385 ALA ALA 3 . n 
C  3  386 SER 386 386 386 SER SER 3 . n 
C  3  387 LEU 387 387 387 LEU LEU 3 . n 
C  3  388 GLU 388 388 388 GLU GLU 3 . n 
C  3  389 ASP 389 389 389 ASP ASP 3 . n 
C  3  390 LEU 390 390 390 LEU LEU 3 . n 
C  3  391 LEU 391 391 391 LEU LEU 3 . n 
C  3  392 GLN 392 392 392 GLN GLN 3 . n 
C  3  393 ALA 393 393 393 ALA ALA 3 . n 
C  3  394 ASP 394 394 394 ASP ASP 3 . n 
C  3  395 PHE 395 395 395 PHE PHE 3 . n 
C  3  396 ALA 396 396 396 ALA ALA 3 . n 
C  3  397 LEU 397 397 397 LEU LEU 3 . n 
C  3  398 VAL 398 398 398 VAL VAL 3 . n 
C  3  399 LEU 399 399 399 LEU LEU 3 . n 
C  3  400 GLY 400 400 400 GLY GLY 3 . n 
C  3  401 ASP 401 401 401 ASP ASP 3 . n 
C  3  402 PRO 402 402 402 PRO PRO 3 . n 
C  3  403 THR 403 403 403 THR THR 3 . n 
C  3  404 GLU 404 404 404 GLU GLU 3 . n 
C  3  405 GLU 405 405 405 GLU GLU 3 . n 
C  3  406 ALA 406 406 406 ALA ALA 3 . n 
C  3  407 PRO 407 407 407 PRO PRO 3 . n 
C  3  408 ILE 408 408 408 ILE ILE 3 . n 
C  3  409 LEU 409 409 409 LEU LEU 3 . n 
C  3  410 HIS 410 410 410 HIS HIS 3 . n 
C  3  411 LEU 411 411 411 LEU LEU 3 . n 
C  3  412 ARG 412 412 412 ARG ARG 3 . n 
C  3  413 LEU 413 413 413 LEU LEU 3 . n 
C  3  414 SER 414 414 414 SER SER 3 . n 
C  3  415 GLU 415 415 415 GLU GLU 3 . n 
C  3  416 PHE 416 416 416 PHE PHE 3 . n 
C  3  417 VAL 417 417 417 VAL VAL 3 . n 
C  3  418 ARG 418 418 418 ARG ARG 3 . n 
C  3  419 ASP 419 419 419 ASP ASP 3 . n 
C  3  420 LEU 420 420 420 LEU LEU 3 . n 
C  3  421 LYS 421 421 421 LYS LYS 3 . n 
C  3  422 PRO 422 422 422 PRO PRO 3 . n 
C  3  423 PRO 423 423 423 PRO PRO 3 . n 
C  3  424 HIS 424 424 424 HIS HIS 3 . n 
C  3  425 ARG 425 425 425 ARG ARG 3 . n 
C  3  426 TYR 426 426 426 TYR TYR 3 . n 
C  3  427 ASN 427 427 427 ASN ASN 3 . n 
C  3  428 HIS 428 428 428 HIS HIS 3 . n 
C  3  429 GLY 429 429 429 GLY GLY 3 . n 
C  3  430 THR 430 430 430 THR THR 3 . n 
C  3  431 PRO 431 431 431 PRO PRO 3 . n 
C  3  432 PHE 432 432 432 PHE PHE 3 . n 
C  3  433 ALA 433 433 433 ALA ALA 3 . n 
C  3  434 ASP 434 434 434 ASP ASP 3 . n 
C  3  435 LEU 435 435 435 LEU LEU 3 . n 
C  3  436 GLN 436 436 436 GLN GLN 3 . n 
C  3  437 ILE 437 437 437 ILE ILE 3 . n 
C  3  438 LYS 438 438 438 LYS LYS 3 . n 
C  3  439 GLU 439 439 439 GLU GLU 3 . n 
C  3  440 ARG 440 440 440 ARG ARG 3 . n 
C  3  441 MET 441 441 441 MET MET 3 . n 
C  3  442 PRO 442 442 442 PRO PRO 3 . n 
C  3  443 ARG 443 443 443 ARG ARG 3 . n 
C  3  444 ARG 444 444 444 ARG ARG 3 . n 
C  3  445 THR 445 445 445 THR THR 3 . n 
C  3  446 ASP 446 446 446 ASP ASP 3 . n 
C  3  447 LYS 447 447 447 LYS LYS 3 . n 
C  3  448 MET 448 448 448 MET MET 3 . n 
C  3  449 ALA 449 449 449 ALA ALA 3 . n 
C  3  450 LEU 450 450 450 LEU LEU 3 . n 
C  3  451 PHE 451 451 451 PHE PHE 3 . n 
C  3  452 ALA 452 452 452 ALA ALA 3 . n 
C  3  453 PRO 453 453 453 PRO PRO 3 . n 
C  3  454 TYR 454 454 454 TYR TYR 3 . n 
C  3  455 ARG 455 455 455 ARG ARG 3 . n 
C  3  456 ALA 456 456 456 ALA ALA 3 . n 
C  3  457 PRO 457 457 457 PRO PRO 3 . n 
C  3  458 LEU 458 458 458 LEU LEU 3 . n 
C  3  459 MET 459 459 459 MET MET 3 . n 
C  3  460 LYS 460 460 460 LYS LYS 3 . n 
C  3  461 TRP 461 461 461 TRP TRP 3 . n 
C  3  462 ALA 462 462 462 ALA ALA 3 . n 
C  3  463 ALA 463 463 463 ALA ALA 3 . n 
C  3  464 ILE 464 464 464 ILE ILE 3 . n 
C  3  465 HIS 465 465 465 HIS HIS 3 . n 
C  3  466 GLU 466 466 466 GLU GLU 3 . n 
C  3  467 VAL 467 467 467 VAL VAL 3 . n 
C  3  468 HIS 468 468 468 HIS HIS 3 . n 
C  3  469 ARG 469 469 469 ARG ARG 3 . n 
C  3  470 PRO 470 470 470 PRO PRO 3 . n 
C  3  471 GLY 471 471 471 GLY GLY 3 . n 
C  3  472 GLU 472 472 472 GLU GLU 3 . n 
C  3  473 GLU 473 473 473 GLU GLU 3 . n 
C  3  474 ARG 474 474 474 ARG ARG 3 . n 
C  3  475 GLU 475 475 475 GLU GLU 3 . n 
C  3  476 ILE 476 476 476 ILE ILE 3 . n 
C  3  477 LEU 477 477 477 LEU LEU 3 . n 
C  3  478 LEU 478 478 478 LEU LEU 3 . n 
C  3  479 ALA 479 479 479 ALA ALA 3 . n 
C  3  480 LEU 480 480 480 LEU LEU 3 . n 
C  3  481 LEU 481 481 481 LEU LEU 3 . n 
C  3  482 GLY 482 482 482 GLY GLY 3 . n 
C  3  483 ASP 483 483 483 ASP ASP 3 . n 
C  3  484 LYS 484 484 484 LYS LYS 3 . n 
C  3  485 GLU 485 485 485 GLU GLU 3 . n 
C  3  486 GLY 486 486 486 GLY GLY 3 . n 
C  3  487 SER 487 487 487 SER SER 3 . n 
C  3  488 GLU 488 488 488 GLU GLU 3 . n 
C  3  489 MET 489 489 489 MET MET 3 . n 
C  3  490 VAL 490 490 490 VAL VAL 3 . n 
C  3  491 ALA 491 491 491 ALA ALA 3 . n 
C  3  492 LYS 492 492 492 LYS LYS 3 . n 
C  3  493 ALA 493 493 493 ALA ALA 3 . n 
C  3  494 LYS 494 494 494 LYS LYS 3 . n 
C  3  495 GLU 495 495 495 GLU GLU 3 . n 
C  3  496 ALA 496 496 496 ALA ALA 3 . n 
C  3  497 TRP 497 497 497 TRP TRP 3 . n 
C  3  498 GLU 498 498 498 GLU GLU 3 . n 
C  3  499 LYS 499 499 499 LYS LYS 3 . n 
C  3  500 ALA 500 500 500 ALA ALA 3 . n 
C  3  501 LYS 501 501 501 LYS LYS 3 . n 
C  3  502 ASN 502 502 502 ASN ASN 3 . n 
C  3  503 PRO 503 503 503 PRO PRO 3 . n 
C  3  504 VAL 504 504 504 VAL VAL 3 . n 
C  3  505 LEU 505 505 505 LEU LEU 3 . n 
C  3  506 ILE 506 506 506 ILE ILE 3 . n 
C  3  507 LEU 507 507 507 LEU LEU 3 . n 
C  3  508 GLY 508 508 508 GLY GLY 3 . n 
C  3  509 ALA 509 509 509 ALA ALA 3 . n 
C  3  510 GLY 510 510 510 GLY GLY 3 . n 
C  3  511 VAL 511 511 511 VAL VAL 3 . n 
C  3  512 LEU 512 512 512 LEU LEU 3 . n 
C  3  513 GLN 513 513 513 GLN GLN 3 . n 
C  3  514 ASP 514 514 514 ASP ASP 3 . n 
C  3  515 THR 515 515 515 THR THR 3 . n 
C  3  516 VAL 516 516 516 VAL VAL 3 . n 
C  3  517 ALA 517 517 517 ALA ALA 3 . n 
C  3  518 ALA 518 518 518 ALA ALA 3 . n 
C  3  519 GLU 519 519 519 GLU GLU 3 . n 
C  3  520 ARG 520 520 520 ARG ARG 3 . n 
C  3  521 ALA 521 521 521 ALA ALA 3 . n 
C  3  522 ARG 522 522 522 ARG ARG 3 . n 
C  3  523 LEU 523 523 523 LEU LEU 3 . n 
C  3  524 LEU 524 524 524 LEU LEU 3 . n 
C  3  525 ALA 525 525 525 ALA ALA 3 . n 
C  3  526 GLU 526 526 526 GLU GLU 3 . n 
C  3  527 ARG 527 527 527 ARG ARG 3 . n 
C  3  528 LYS 528 528 528 LYS LYS 3 . n 
C  3  529 GLY 529 529 529 GLY GLY 3 . n 
C  3  530 ALA 530 530 530 ALA ALA 3 . n 
C  3  531 LYS 531 531 531 LYS LYS 3 . n 
C  3  532 VAL 532 532 532 VAL VAL 3 . n 
C  3  533 LEU 533 533 533 LEU LEU 3 . n 
C  3  534 ALA 534 534 534 ALA ALA 3 . n 
C  3  535 MET 535 535 535 MET MET 3 . n 
C  3  536 THR 536 536 536 THR THR 3 . n 
C  3  537 PRO 537 537 537 PRO PRO 3 . n 
C  3  538 ALA 538 538 538 ALA ALA 3 . n 
C  3  539 ALA 539 539 539 ALA ALA 3 . n 
C  3  540 ASN 540 540 540 ASN ASN 3 . n 
C  3  541 ALA 541 541 541 ALA ALA 3 . n 
C  3  542 ARG 542 542 542 ARG ARG 3 . n 
C  3  543 GLY 543 543 543 GLY GLY 3 . n 
C  3  544 LEU 544 544 544 LEU LEU 3 . n 
C  3  545 GLU 545 545 545 GLU GLU 3 . n 
C  3  546 ALA 546 546 546 ALA ALA 3 . n 
C  3  547 MET 547 547 547 MET MET 3 . n 
C  3  548 GLY 548 548 548 GLY GLY 3 . n 
C  3  549 VAL 549 549 549 VAL VAL 3 . n 
C  3  550 LEU 550 550 550 LEU LEU 3 . n 
C  3  551 PRO 551 551 551 PRO PRO 3 . n 
C  3  552 GLY 552 552 552 GLY GLY 3 . n 
C  3  553 ALA 553 553 553 ALA ALA 3 . n 
C  3  554 LYS 554 554 554 LYS LYS 3 . n 
C  3  555 GLY 555 555 555 GLY GLY 3 . n 
C  3  556 ALA 556 556 556 ALA ALA 3 . n 
C  3  557 SER 557 557 557 SER SER 3 . n 
C  3  558 TRP 558 558 558 TRP TRP 3 . n 
C  3  559 ASP 559 559 559 ASP ASP 3 . n 
C  3  560 GLU 560 560 560 GLU GLU 3 . n 
C  3  561 PRO 561 561 561 PRO PRO 3 . n 
C  3  562 GLY 562 562 562 GLY GLY 3 . n 
C  3  563 ALA 563 563 563 ALA ALA 3 . n 
C  3  564 LEU 564 564 564 LEU LEU 3 . n 
C  3  565 TYR 565 565 565 TYR TYR 3 . n 
C  3  566 ALA 566 566 566 ALA ALA 3 . n 
C  3  567 TYR 567 567 567 TYR TYR 3 . n 
C  3  568 TYR 568 568 568 TYR TYR 3 . n 
C  3  569 GLY 569 569 569 GLY GLY 3 . n 
C  3  570 PHE 570 570 570 PHE PHE 3 . n 
C  3  571 VAL 571 571 571 VAL VAL 3 . n 
C  3  572 PRO 572 572 572 PRO PRO 3 . n 
C  3  573 PRO 573 573 573 PRO PRO 3 . n 
C  3  574 GLU 574 574 574 GLU GLU 3 . n 
C  3  575 GLU 575 575 575 GLU GLU 3 . n 
C  3  576 ALA 576 576 576 ALA ALA 3 . n 
C  3  577 LEU 577 577 577 LEU LEU 3 . n 
C  3  578 LYS 578 578 578 LYS LYS 3 . n 
C  3  579 GLY 579 579 579 GLY GLY 3 . n 
C  3  580 LYS 580 580 580 LYS LYS 3 . n 
C  3  581 ARG 581 581 581 ARG ARG 3 . n 
C  3  582 PHE 582 582 582 PHE PHE 3 . n 
C  3  583 VAL 583 583 583 VAL VAL 3 . n 
C  3  584 VAL 584 584 584 VAL VAL 3 . n 
C  3  585 MET 585 585 585 MET MET 3 . n 
C  3  586 HIS 586 586 586 HIS HIS 3 . n 
C  3  587 LEU 587 587 587 LEU LEU 3 . n 
C  3  588 SER 588 588 588 SER SER 3 . n 
C  3  589 HIS 589 589 589 HIS HIS 3 . n 
C  3  590 LEU 590 590 590 LEU LEU 3 . n 
C  3  591 HIS 591 591 591 HIS HIS 3 . n 
C  3  592 PRO 592 592 592 PRO PRO 3 . n 
C  3  593 LEU 593 593 593 LEU LEU 3 . n 
C  3  594 ALA 594 594 594 ALA ALA 3 . n 
C  3  595 GLU 595 595 595 GLU GLU 3 . n 
C  3  596 ARG 596 596 596 ARG ARG 3 . n 
C  3  597 TYR 597 597 597 TYR TYR 3 . n 
C  3  598 ALA 598 598 598 ALA ALA 3 . n 
C  3  599 HIS 599 599 599 HIS HIS 3 . n 
C  3  600 VAL 600 600 600 VAL VAL 3 . n 
C  3  601 VAL 601 601 601 VAL VAL 3 . n 
C  3  602 LEU 602 602 602 LEU LEU 3 . n 
C  3  603 PRO 603 603 603 PRO PRO 3 . n 
C  3  604 ALA 604 604 604 ALA ALA 3 . n 
C  3  605 PRO 605 605 605 PRO PRO 3 . n 
C  3  606 THR 606 606 606 THR THR 3 . n 
C  3  607 PHE 607 607 607 PHE PHE 3 . n 
C  3  608 TYR 608 608 608 TYR TYR 3 . n 
C  3  609 GLU 609 609 609 GLU GLU 3 . n 
C  3  610 LYS 610 610 610 LYS LYS 3 . n 
C  3  611 ARG 611 611 611 ARG ARG 3 . n 
C  3  612 GLY 612 612 612 GLY GLY 3 . n 
C  3  613 HIS 613 613 613 HIS HIS 3 . n 
C  3  614 LEU 614 614 614 LEU LEU 3 . n 
C  3  615 VAL 615 615 615 VAL VAL 3 . n 
C  3  616 ASN 616 616 616 ASN ASN 3 . n 
C  3  617 LEU 617 617 617 LEU LEU 3 . n 
C  3  618 GLU 618 618 618 GLU GLU 3 . n 
C  3  619 GLY 619 619 619 GLY GLY 3 . n 
C  3  620 ARG 620 620 620 ARG ARG 3 . n 
C  3  621 VAL 621 621 621 VAL VAL 3 . n 
C  3  622 LEU 622 622 622 LEU LEU 3 . n 
C  3  623 PRO 623 623 623 PRO PRO 3 . n 
C  3  624 LEU 624 624 624 LEU LEU 3 . n 
C  3  625 SER 625 625 625 SER SER 3 . n 
C  3  626 PRO 626 626 626 PRO PRO 3 . n 
C  3  627 ALA 627 627 627 ALA ALA 3 . n 
C  3  628 PRO 628 628 628 PRO PRO 3 . n 
C  3  629 ILE 629 629 629 ILE ILE 3 . n 
C  3  630 GLU 630 630 630 GLU GLU 3 . n 
C  3  631 ASN 631 631 631 ASN ASN 3 . n 
C  3  632 GLY 632 632 632 GLY GLY 3 . n 
C  3  633 GLU 633 633 633 GLU GLU 3 . n 
C  3  634 ALA 634 634 634 ALA ALA 3 . n 
C  3  635 GLU 635 635 635 GLU GLU 3 . n 
C  3  636 GLY 636 636 636 GLY GLY 3 . n 
C  3  637 ALA 637 637 637 ALA ALA 3 . n 
C  3  638 LEU 638 638 638 LEU LEU 3 . n 
C  3  639 GLN 639 639 639 GLN GLN 3 . n 
C  3  640 VAL 640 640 640 VAL VAL 3 . n 
C  3  641 LEU 641 641 641 LEU LEU 3 . n 
C  3  642 ALA 642 642 642 ALA ALA 3 . n 
C  3  643 LEU 643 643 643 LEU LEU 3 . n 
C  3  644 LEU 644 644 644 LEU LEU 3 . n 
C  3  645 ALA 645 645 645 ALA ALA 3 . n 
C  3  646 GLU 646 646 646 GLU GLU 3 . n 
C  3  647 ALA 647 647 647 ALA ALA 3 . n 
C  3  648 LEU 648 648 648 LEU LEU 3 . n 
C  3  649 GLY 649 649 649 GLY GLY 3 . n 
C  3  650 VAL 650 650 650 VAL VAL 3 . n 
C  3  651 ARG 651 651 651 ARG ARG 3 . n 
C  3  652 PRO 652 652 652 PRO PRO 3 . n 
C  3  653 PRO 653 653 653 PRO PRO 3 . n 
C  3  654 PHE 654 654 654 PHE PHE 3 . n 
C  3  655 ARG 655 655 655 ARG ARG 3 . n 
C  3  656 LEU 656 656 656 LEU LEU 3 . n 
C  3  657 HIS 657 657 657 HIS HIS 3 . n 
C  3  658 LEU 658 658 658 LEU LEU 3 . n 
C  3  659 GLU 659 659 659 GLU GLU 3 . n 
C  3  660 ALA 660 660 660 ALA ALA 3 . n 
C  3  661 GLN 661 661 661 GLN GLN 3 . n 
C  3  662 LYS 662 662 662 LYS LYS 3 . n 
C  3  663 ALA 663 663 663 ALA ALA 3 . n 
C  3  664 LEU 664 664 664 LEU LEU 3 . n 
C  3  665 LYS 665 665 665 LYS LYS 3 . n 
C  3  666 ALA 666 666 666 ALA ALA 3 . n 
C  3  667 ARG 667 667 667 ARG ARG 3 . n 
C  3  668 LYS 668 668 668 LYS LYS 3 . n 
C  3  669 VAL 669 669 669 VAL VAL 3 . n 
C  3  670 PRO 670 670 670 PRO PRO 3 . n 
C  3  671 GLU 671 671 671 GLU GLU 3 . n 
C  3  672 ALA 672 672 672 ALA ALA 3 . n 
C  3  673 MET 673 673 673 MET MET 3 . n 
C  3  674 GLY 674 674 674 GLY GLY 3 . n 
C  3  675 ARG 675 675 675 ARG ARG 3 . n 
C  3  676 LEU 676 676 676 LEU LEU 3 . n 
C  3  677 SER 677 677 677 SER SER 3 . n 
C  3  678 PHE 678 678 678 PHE PHE 3 . n 
C  3  679 ARG 679 679 679 ARG ARG 3 . n 
C  3  680 LEU 680 680 680 LEU LEU 3 . n 
C  3  681 LYS 681 681 681 LYS LYS 3 . n 
C  3  682 GLU 682 682 682 GLU GLU 3 . n 
C  3  683 LEU 683 683 683 LEU LEU 3 . n 
C  3  684 ARG 684 684 684 ARG ARG 3 . n 
C  3  685 PRO 685 685 685 PRO PRO 3 . n 
C  3  686 LYS 686 686 686 LYS LYS 3 . n 
C  3  687 GLU 687 687 687 GLU GLU 3 . n 
C  3  688 ARG 688 688 688 ARG ARG 3 . n 
C  3  689 LYS 689 689 689 LYS LYS 3 . n 
C  3  690 GLY 690 690 690 GLY GLY 3 . n 
C  3  691 ALA 691 691 691 ALA ALA 3 . n 
C  3  692 PHE 692 692 692 PHE PHE 3 . n 
C  3  693 TYR 693 693 693 TYR TYR 3 . n 
C  3  694 LEU 694 694 694 LEU LEU 3 . n 
C  3  695 ARG 695 695 695 ARG ARG 3 . n 
C  3  696 PRO 696 696 696 PRO PRO 3 . n 
C  3  697 THR 697 697 697 THR THR 3 . n 
C  3  698 MET 698 698 698 MET MET 3 . n 
C  3  699 TRP 699 699 699 TRP TRP 3 . n 
C  3  700 LYS 700 700 700 LYS LYS 3 . n 
C  3  701 ALA 701 701 701 ALA ALA 3 . n 
C  3  702 HIS 702 702 702 HIS HIS 3 . n 
C  3  703 GLN 703 703 703 GLN GLN 3 . n 
C  3  704 ALA 704 704 704 ALA ALA 3 . n 
C  3  705 VAL 705 705 705 VAL VAL 3 . n 
C  3  706 GLY 706 706 706 GLY GLY 3 . n 
C  3  707 LYS 707 707 707 LYS LYS 3 . n 
C  3  708 ALA 708 708 708 ALA ALA 3 . n 
C  3  709 GLN 709 709 709 GLN GLN 3 . n 
C  3  710 GLU 710 710 710 GLU GLU 3 . n 
C  3  711 ALA 711 711 711 ALA ALA 3 . n 
C  3  712 ALA 712 712 712 ALA ALA 3 . n 
C  3  713 ARG 713 713 713 ARG ARG 3 . n 
C  3  714 ALA 714 714 714 ALA ALA 3 . n 
C  3  715 GLU 715 715 715 GLU GLU 3 . n 
C  3  716 LEU 716 716 716 LEU LEU 3 . n 
C  3  717 TRP 717 717 717 TRP TRP 3 . n 
C  3  718 ALA 718 718 718 ALA ALA 3 . n 
C  3  719 HIS 719 719 719 HIS HIS 3 . n 
C  3  720 PRO 720 720 720 PRO PRO 3 . n 
C  3  721 GLU 721 721 721 GLU GLU 3 . n 
C  3  722 THR 722 722 722 THR THR 3 . n 
C  3  723 ALA 723 723 723 ALA ALA 3 . n 
C  3  724 ARG 724 724 724 ARG ARG 3 . n 
C  3  725 ALA 725 725 725 ALA ALA 3 . n 
C  3  726 GLU 726 726 726 GLU GLU 3 . n 
C  3  727 ALA 727 727 727 ALA ALA 3 . n 
C  3  728 LEU 728 728 728 LEU LEU 3 . n 
C  3  729 PRO 729 729 729 PRO PRO 3 . n 
C  3  730 GLU 730 730 730 GLU GLU 3 . n 
C  3  731 GLY 731 731 731 GLY GLY 3 . n 
C  3  732 ALA 732 732 732 ALA ALA 3 . n 
C  3  733 GLN 733 733 733 GLN GLN 3 . n 
C  3  734 VAL 734 734 734 VAL VAL 3 . n 
C  3  735 ALA 735 735 735 ALA ALA 3 . n 
C  3  736 VAL 736 736 736 VAL VAL 3 . n 
C  3  737 GLU 737 737 737 GLU GLU 3 . n 
C  3  738 THR 738 738 738 THR THR 3 . n 
C  3  739 PRO 739 739 739 PRO PRO 3 . n 
C  3  740 PHE 740 740 740 PHE PHE 3 . n 
C  3  741 GLY 741 741 741 GLY GLY 3 . n 
C  3  742 ARG 742 742 742 ARG ARG 3 . n 
C  3  743 VAL 743 743 743 VAL VAL 3 . n 
C  3  744 GLU 744 744 744 GLU GLU 3 . n 
C  3  745 ALA 745 745 745 ALA ALA 3 . n 
C  3  746 ARG 746 746 746 ARG ARG 3 . n 
C  3  747 VAL 747 747 747 VAL VAL 3 . n 
C  3  748 VAL 748 748 748 VAL VAL 3 . n 
C  3  749 HIS 749 749 749 HIS HIS 3 . n 
C  3  750 ARG 750 750 750 ARG ARG 3 . n 
C  3  751 GLU 751 751 751 GLU GLU 3 . n 
C  3  752 ASP 752 752 752 ASP ASP 3 . n 
C  3  753 VAL 753 753 753 VAL VAL 3 . n 
C  3  754 PRO 754 754 754 PRO PRO 3 . n 
C  3  755 LYS 755 755 755 LYS LYS 3 . n 
C  3  756 GLY 756 756 756 GLY GLY 3 . n 
C  3  757 HIS 757 757 757 HIS HIS 3 . n 
C  3  758 LEU 758 758 758 LEU LEU 3 . n 
C  3  759 TYR 759 759 759 TYR TYR 3 . n 
C  3  760 LEU 760 760 760 LEU LEU 3 . n 
C  3  761 SER 761 761 761 SER SER 3 . n 
C  3  762 ALA 762 762 762 ALA ALA 3 . n 
C  3  763 LEU 763 763 763 LEU LEU 3 . n 
C  3  764 GLY 764 764 764 GLY GLY 3 . n 
C  3  765 PRO 765 765 765 PRO PRO 3 . n 
C  3  766 ALA 766 766 766 ALA ALA 3 . n 
C  3  767 ALA 767 767 767 ALA ALA 3 . n 
C  3  768 GLY 768 768 768 GLY GLY 3 . n 
C  3  769 LEU 769 769 769 LEU LEU 3 . n 
C  3  770 ARG 770 770 770 ARG ARG 3 . n 
C  3  771 VAL 771 771 771 VAL VAL 3 . n 
C  3  772 GLU 772 772 772 GLU GLU 3 . n 
C  3  773 GLY 773 773 773 GLY GLY 3 . n 
C  3  774 ARG 774 774 774 ARG ARG 3 . n 
C  3  775 VAL 775 775 775 VAL VAL 3 . n 
C  3  776 LEU 776 776 776 LEU LEU 3 . n 
C  3  777 VAL 777 777 777 VAL VAL 3 . n 
C  3  778 PRO 778 778 ?   ?   ?   3 . n 
C  3  779 ALA 779 779 ?   ?   ?   3 . n 
C  3  780 GLY 780 780 ?   ?   ?   3 . n 
C  3  781 GLY 781 781 ?   ?   ?   3 . n 
C  3  782 GLU 782 782 ?   ?   ?   3 . n 
C  3  783 ALA 783 783 ?   ?   ?   3 . n 
D  4  1   MET 1   1   ?   ?   ?   4 . n 
D  4  2   ARG 2   2   ?   ?   ?   4 . n 
D  4  3   GLU 3   3   ?   ?   ?   4 . n 
D  4  4   GLU 4   4   ?   ?   ?   4 . n 
D  4  5   PHE 5   5   ?   ?   ?   4 . n 
D  4  6   LEU 6   6   ?   ?   ?   4 . n 
D  4  7   GLU 7   7   ?   ?   ?   4 . n 
D  4  8   GLU 8   8   ?   ?   ?   4 . n 
D  4  9   ILE 9   9   ?   ?   ?   4 . n 
D  4  10  PRO 10  10  ?   ?   ?   4 . n 
D  4  11  LEU 11  11  ?   ?   ?   4 . n 
D  4  12  ASP 12  12  ?   ?   ?   4 . n 
D  4  13  ALA 13  13  ?   ?   ?   4 . n 
D  4  14  PRO 14  14  ?   ?   ?   4 . n 
D  4  15  PRO 15  15  ?   ?   ?   4 . n 
D  4  16  GLU 16  16  ?   ?   ?   4 . n 
D  4  17  GLU 17  17  ?   ?   ?   4 . n 
D  4  18  ALA 18  18  ?   ?   ?   4 . n 
D  4  19  LYS 19  19  ?   ?   ?   4 . n 
D  4  20  GLU 20  20  ?   ?   ?   4 . n 
D  4  21  LEU 21  21  ?   ?   ?   4 . n 
D  4  22  ARG 22  22  ?   ?   ?   4 . n 
D  4  23  THR 23  23  ?   ?   ?   4 . n 
D  4  24  GLU 24  24  ?   ?   ?   4 . n 
D  4  25  VAL 25  25  ?   ?   ?   4 . n 
D  4  26  MET 26  26  26  MET MET 4 . n 
D  4  27  THR 27  27  27  THR THR 4 . n 
D  4  28  LEU 28  28  28  LEU LEU 4 . n 
D  4  29  ASN 29  29  29  ASN ASN 4 . n 
D  4  30  VAL 30  30  30  VAL VAL 4 . n 
D  4  31  GLY 31  31  31  GLY GLY 4 . n 
D  4  32  PRO 32  32  32  PRO PRO 4 . n 
D  4  33  GLN 33  33  33  GLN GLN 4 . n 
D  4  34  HIS 34  34  34  HIS HIS 4 . n 
D  4  35  PRO 35  35  35  PRO PRO 4 . n 
D  4  36  SER 36  36  36  SER SER 4 . n 
D  4  37  THR 37  37  37  THR THR 4 . n 
D  4  38  HIS 38  38  38  HIS HIS 4 . n 
D  4  39  GLY 39  39  39  GLY GLY 4 . n 
D  4  40  VAL 40  40  40  VAL VAL 4 . n 
D  4  41  LEU 41  41  41  LEU LEU 4 . n 
D  4  42  ARG 42  42  42  ARG ARG 4 . n 
D  4  43  LEU 43  43  43  LEU LEU 4 . n 
D  4  44  MET 44  44  44  MET MET 4 . n 
D  4  45  VAL 45  45  45  VAL VAL 4 . n 
D  4  46  THR 46  46  46  THR THR 4 . n 
D  4  47  LEU 47  47  47  LEU LEU 4 . n 
D  4  48  SER 48  48  48  SER SER 4 . n 
D  4  49  GLY 49  49  49  GLY GLY 4 . n 
D  4  50  GLU 50  50  50  GLU GLU 4 . n 
D  4  51  GLU 51  51  51  GLU GLU 4 . n 
D  4  52  VAL 52  52  52  VAL VAL 4 . n 
D  4  53  LEU 53  53  53  LEU LEU 4 . n 
D  4  54  GLU 54  54  54  GLU GLU 4 . n 
D  4  55  VAL 55  55  55  VAL VAL 4 . n 
D  4  56  VAL 56  56  56  VAL VAL 4 . n 
D  4  57  PRO 57  57  57  PRO PRO 4 . n 
D  4  58  HIS 58  58  58  HIS HIS 4 . n 
D  4  59  ILE 59  59  59  ILE ILE 4 . n 
D  4  60  GLY 60  60  60  GLY GLY 4 . n 
D  4  61  TYR 61  61  61  TYR TYR 4 . n 
D  4  62  LEU 62  62  62  LEU LEU 4 . n 
D  4  63  HIS 63  63  63  HIS HIS 4 . n 
D  4  64  THR 64  64  64  THR THR 4 . n 
D  4  65  GLY 65  65  65  GLY GLY 4 . n 
D  4  66  PHE 66  66  66  PHE PHE 4 . n 
D  4  67  GLU 67  67  67  GLU GLU 4 . n 
D  4  68  LYS 68  68  68  LYS LYS 4 . n 
D  4  69  THR 69  69  69  THR THR 4 . n 
D  4  70  MET 70  70  70  MET MET 4 . n 
D  4  71  GLU 71  71  71  GLU GLU 4 . n 
D  4  72  HIS 72  72  72  HIS HIS 4 . n 
D  4  73  ARG 73  73  73  ARG ARG 4 . n 
D  4  74  THR 74  74  74  THR THR 4 . n 
D  4  75  TYR 75  75  75  TYR TYR 4 . n 
D  4  76  LEU 76  76  76  LEU LEU 4 . n 
D  4  77  GLN 77  77  77  GLN GLN 4 . n 
D  4  78  ASN 78  78  78  ASN ASN 4 . n 
D  4  79  ILE 79  79  79  ILE ILE 4 . n 
D  4  80  THR 80  80  80  THR THR 4 . n 
D  4  81  TYR 81  81  81  TYR TYR 4 . n 
D  4  82  THR 82  82  82  THR THR 4 . n 
D  4  83  PRO 83  83  83  PRO PRO 4 . n 
D  4  84  ARG 84  84  84  ARG ARG 4 . n 
D  4  85  MET 85  85  85  MET MET 4 . n 
D  4  86  ASP 86  86  86  ASP ASP 4 . n 
D  4  87  TYR 87  87  87  TYR TYR 4 . n 
D  4  88  LEU 88  88  88  LEU LEU 4 . n 
D  4  89  HIS 89  89  89  HIS HIS 4 . n 
D  4  90  SER 90  90  90  SER SER 4 . n 
D  4  91  PHE 91  91  91  PHE PHE 4 . n 
D  4  92  ALA 92  92  92  ALA ALA 4 . n 
D  4  93  HIS 93  93  93  HIS HIS 4 . n 
D  4  94  ASP 94  94  94  ASP ASP 4 . n 
D  4  95  LEU 95  95  95  LEU LEU 4 . n 
D  4  96  ALA 96  96  96  ALA ALA 4 . n 
D  4  97  TYR 97  97  97  TYR TYR 4 . n 
D  4  98  ALA 98  98  98  ALA ALA 4 . n 
D  4  99  LEU 99  99  99  LEU LEU 4 . n 
D  4  100 ALA 100 100 100 ALA ALA 4 . n 
D  4  101 VAL 101 101 101 VAL VAL 4 . n 
D  4  102 GLU 102 102 102 GLU GLU 4 . n 
D  4  103 LYS 103 103 103 LYS LYS 4 . n 
D  4  104 LEU 104 104 104 LEU LEU 4 . n 
D  4  105 LEU 105 105 105 LEU LEU 4 . n 
D  4  106 GLY 106 106 106 GLY GLY 4 . n 
D  4  107 ALA 107 107 107 ALA ALA 4 . n 
D  4  108 VAL 108 108 108 VAL VAL 4 . n 
D  4  109 VAL 109 109 109 VAL VAL 4 . n 
D  4  110 PRO 110 110 110 PRO PRO 4 . n 
D  4  111 PRO 111 111 111 PRO PRO 4 . n 
D  4  112 ARG 112 112 112 ARG ARG 4 . n 
D  4  113 ALA 113 113 113 ALA ALA 4 . n 
D  4  114 GLU 114 114 114 GLU GLU 4 . n 
D  4  115 THR 115 115 115 THR THR 4 . n 
D  4  116 ILE 116 116 116 ILE ILE 4 . n 
D  4  117 ARG 117 117 117 ARG ARG 4 . n 
D  4  118 VAL 118 118 118 VAL VAL 4 . n 
D  4  119 ILE 119 119 119 ILE ILE 4 . n 
D  4  120 LEU 120 120 120 LEU LEU 4 . n 
D  4  121 ASN 121 121 121 ASN ASN 4 . n 
D  4  122 GLU 122 122 122 GLU GLU 4 . n 
D  4  123 LEU 123 123 123 LEU LEU 4 . n 
D  4  124 SER 124 124 124 SER SER 4 . n 
D  4  125 ARG 125 125 125 ARG ARG 4 . n 
D  4  126 LEU 126 126 126 LEU LEU 4 . n 
D  4  127 ALA 127 127 127 ALA ALA 4 . n 
D  4  128 SER 128 128 128 SER SER 4 . n 
D  4  129 HIS 129 129 129 HIS HIS 4 . n 
D  4  130 LEU 130 130 130 LEU LEU 4 . n 
D  4  131 VAL 131 131 131 VAL VAL 4 . n 
D  4  132 PHE 132 132 132 PHE PHE 4 . n 
D  4  133 LEU 133 133 133 LEU LEU 4 . n 
D  4  134 GLY 134 134 134 GLY GLY 4 . n 
D  4  135 THR 135 135 135 THR THR 4 . n 
D  4  136 GLY 136 136 136 GLY GLY 4 . n 
D  4  137 LEU 137 137 137 LEU LEU 4 . n 
D  4  138 LEU 138 138 138 LEU LEU 4 . n 
D  4  139 ASP 139 139 139 ASP ASP 4 . n 
D  4  140 LEU 140 140 140 LEU LEU 4 . n 
D  4  141 GLY 141 141 141 GLY GLY 4 . n 
D  4  142 ALA 142 142 142 ALA ALA 4 . n 
D  4  143 LEU 143 143 143 LEU LEU 4 . n 
D  4  144 THR 144 144 144 THR THR 4 . n 
D  4  145 PRO 145 145 145 PRO PRO 4 . n 
D  4  146 PHE 146 146 146 PHE PHE 4 . n 
D  4  147 PHE 147 147 147 PHE PHE 4 . n 
D  4  148 TYR 148 148 148 TYR TYR 4 . n 
D  4  149 ALA 149 149 149 ALA ALA 4 . n 
D  4  150 PHE 150 150 150 PHE PHE 4 . n 
D  4  151 ARG 151 151 151 ARG ARG 4 . n 
D  4  152 GLU 152 152 152 GLU GLU 4 . n 
D  4  153 ARG 153 153 153 ARG ARG 4 . n 
D  4  154 GLU 154 154 154 GLU GLU 4 . n 
D  4  155 THR 155 155 155 THR THR 4 . n 
D  4  156 ILE 156 156 156 ILE ILE 4 . n 
D  4  157 LEU 157 157 157 LEU LEU 4 . n 
D  4  158 ASP 158 158 158 ASP ASP 4 . n 
D  4  159 LEU 159 159 159 LEU LEU 4 . n 
D  4  160 PHE 160 160 160 PHE PHE 4 . n 
D  4  161 GLU 161 161 161 GLU GLU 4 . n 
D  4  162 TRP 162 162 162 TRP TRP 4 . n 
D  4  163 VAL 163 163 163 VAL VAL 4 . n 
D  4  164 THR 164 164 164 THR THR 4 . n 
D  4  165 GLY 165 165 165 GLY GLY 4 . n 
D  4  166 GLN 166 166 166 GLN GLN 4 . n 
D  4  167 ARG 167 167 167 ARG ARG 4 . n 
D  4  168 PHE 168 168 168 PHE PHE 4 . n 
D  4  169 HIS 169 169 169 HIS HIS 4 . n 
D  4  170 HIS 170 170 170 HIS HIS 4 . n 
D  4  171 ASN 171 171 171 ASN ASN 4 . n 
D  4  172 TYR 172 172 172 TYR TYR 4 . n 
D  4  173 ILE 173 173 173 ILE ILE 4 . n 
D  4  174 ARG 174 174 174 ARG ARG 4 . n 
D  4  175 ILE 175 175 175 ILE ILE 4 . n 
D  4  176 GLY 176 176 176 GLY GLY 4 . n 
D  4  177 GLY 177 177 177 GLY GLY 4 . n 
D  4  178 VAL 178 178 178 VAL VAL 4 . n 
D  4  179 LYS 179 179 179 LYS LYS 4 . n 
D  4  180 GLU 180 180 180 GLU GLU 4 . n 
D  4  181 ASP 181 181 181 ASP ASP 4 . n 
D  4  182 LEU 182 182 182 LEU LEU 4 . n 
D  4  183 PRO 183 183 183 PRO PRO 4 . n 
D  4  184 GLU 184 184 184 GLU GLU 4 . n 
D  4  185 GLU 185 185 185 GLU GLU 4 . n 
D  4  186 PHE 186 186 186 PHE PHE 4 . n 
D  4  187 VAL 187 187 187 VAL VAL 4 . n 
D  4  188 PRO 188 188 188 PRO PRO 4 . n 
D  4  189 GLU 189 189 189 GLU GLU 4 . n 
D  4  190 LEU 190 190 190 LEU LEU 4 . n 
D  4  191 LYS 191 191 191 LYS LYS 4 . n 
D  4  192 LYS 192 192 192 LYS LYS 4 . n 
D  4  193 LEU 193 193 193 LEU LEU 4 . n 
D  4  194 LEU 194 194 194 LEU LEU 4 . n 
D  4  195 GLU 195 195 195 GLU GLU 4 . n 
D  4  196 VAL 196 196 196 VAL VAL 4 . n 
D  4  197 LEU 197 197 197 LEU LEU 4 . n 
D  4  198 PRO 198 198 198 PRO PRO 4 . n 
D  4  199 HIS 199 199 199 HIS HIS 4 . n 
D  4  200 ARG 200 200 200 ARG ARG 4 . n 
D  4  201 ILE 201 201 201 ILE ILE 4 . n 
D  4  202 ASP 202 202 202 ASP ASP 4 . n 
D  4  203 GLU 203 203 203 GLU GLU 4 . n 
D  4  204 TYR 204 204 204 TYR TYR 4 . n 
D  4  205 GLU 205 205 205 GLU GLU 4 . n 
D  4  206 ALA 206 206 206 ALA ALA 4 . n 
D  4  207 LEU 207 207 207 LEU LEU 4 . n 
D  4  208 PHE 208 208 208 PHE PHE 4 . n 
D  4  209 ALA 209 209 209 ALA ALA 4 . n 
D  4  210 GLU 210 210 210 GLU GLU 4 . n 
D  4  211 SER 211 211 211 SER SER 4 . n 
D  4  212 PRO 212 212 212 PRO PRO 4 . n 
D  4  213 ILE 213 213 213 ILE ILE 4 . n 
D  4  214 PHE 214 214 214 PHE PHE 4 . n 
D  4  215 TYR 215 215 215 TYR TYR 4 . n 
D  4  216 GLU 216 216 216 GLU GLU 4 . n 
D  4  217 ARG 217 217 217 ARG ARG 4 . n 
D  4  218 ALA 218 218 218 ALA ALA 4 . n 
D  4  219 ARG 219 219 219 ARG ARG 4 . n 
D  4  220 GLY 220 220 220 GLY GLY 4 . n 
D  4  221 VAL 221 221 221 VAL VAL 4 . n 
D  4  222 GLY 222 222 222 GLY GLY 4 . n 
D  4  223 VAL 223 223 223 VAL VAL 4 . n 
D  4  224 ILE 224 224 224 ILE ILE 4 . n 
D  4  225 PRO 225 225 225 PRO PRO 4 . n 
D  4  226 PRO 226 226 226 PRO PRO 4 . n 
D  4  227 GLU 227 227 227 GLU GLU 4 . n 
D  4  228 VAL 228 228 228 VAL VAL 4 . n 
D  4  229 ALA 229 229 229 ALA ALA 4 . n 
D  4  230 ILE 230 230 230 ILE ILE 4 . n 
D  4  231 ASP 231 231 231 ASP ASP 4 . n 
D  4  232 LEU 232 232 232 LEU LEU 4 . n 
D  4  233 GLY 233 233 233 GLY GLY 4 . n 
D  4  234 LEU 234 234 234 LEU LEU 4 . n 
D  4  235 THR 235 235 235 THR THR 4 . n 
D  4  236 GLY 236 236 236 GLY GLY 4 . n 
D  4  237 GLY 237 237 237 GLY GLY 4 . n 
D  4  238 SER 238 238 238 SER SER 4 . n 
D  4  239 LEU 239 239 239 LEU LEU 4 . n 
D  4  240 ARG 240 240 240 ARG ARG 4 . n 
D  4  241 ALA 241 241 241 ALA ALA 4 . n 
D  4  242 SER 242 242 242 SER SER 4 . n 
D  4  243 GLY 243 243 243 GLY GLY 4 . n 
D  4  244 VAL 244 244 244 VAL VAL 4 . n 
D  4  245 ASN 245 245 245 ASN ASN 4 . n 
D  4  246 TYR 246 246 246 TYR TYR 4 . n 
D  4  247 ASP 247 247 247 ASP ASP 4 . n 
D  4  248 VAL 248 248 248 VAL VAL 4 . n 
D  4  249 ARG 249 249 249 ARG ARG 4 . n 
D  4  250 LYS 250 250 250 LYS LYS 4 . n 
D  4  251 ALA 251 251 251 ALA ALA 4 . n 
D  4  252 TYR 252 252 252 TYR TYR 4 . n 
D  4  253 PRO 253 253 253 PRO PRO 4 . n 
D  4  254 TYR 254 254 254 TYR TYR 4 . n 
D  4  255 SER 255 255 255 SER SER 4 . n 
D  4  256 GLY 256 256 256 GLY GLY 4 . n 
D  4  257 TYR 257 257 257 TYR TYR 4 . n 
D  4  258 GLU 258 258 258 GLU GLU 4 . n 
D  4  259 THR 259 259 259 THR THR 4 . n 
D  4  260 TYR 260 260 260 TYR TYR 4 . n 
D  4  261 THR 261 261 261 THR THR 4 . n 
D  4  262 PHE 262 262 262 PHE PHE 4 . n 
D  4  263 ASP 263 263 263 ASP ASP 4 . n 
D  4  264 VAL 264 264 264 VAL VAL 4 . n 
D  4  265 PRO 265 265 265 PRO PRO 4 . n 
D  4  266 LEU 266 266 266 LEU LEU 4 . n 
D  4  267 GLY 267 267 267 GLY GLY 4 . n 
D  4  268 GLU 268 268 268 GLU GLU 4 . n 
D  4  269 ARG 269 269 269 ARG ARG 4 . n 
D  4  270 GLY 270 270 270 GLY GLY 4 . n 
D  4  271 ASP 271 271 271 ASP ASP 4 . n 
D  4  272 VAL 272 272 272 VAL VAL 4 . n 
D  4  273 PHE 273 273 273 PHE PHE 4 . n 
D  4  274 ASP 274 274 274 ASP ASP 4 . n 
D  4  275 ARG 275 275 275 ARG ARG 4 . n 
D  4  276 MET 276 276 276 MET MET 4 . n 
D  4  277 LEU 277 277 277 LEU LEU 4 . n 
D  4  278 VAL 278 278 278 VAL VAL 4 . n 
D  4  279 ARG 279 279 279 ARG ARG 4 . n 
D  4  280 ILE 280 280 280 ILE ILE 4 . n 
D  4  281 ARG 281 281 281 ARG ARG 4 . n 
D  4  282 GLU 282 282 282 GLU GLU 4 . n 
D  4  283 MET 283 283 283 MET MET 4 . n 
D  4  284 ARG 284 284 284 ARG ARG 4 . n 
D  4  285 GLU 285 285 285 GLU GLU 4 . n 
D  4  286 SER 286 286 286 SER SER 4 . n 
D  4  287 VAL 287 287 287 VAL VAL 4 . n 
D  4  288 LYS 288 288 288 LYS LYS 4 . n 
D  4  289 ILE 289 289 289 ILE ILE 4 . n 
D  4  290 ILE 290 290 290 ILE ILE 4 . n 
D  4  291 LYS 291 291 291 LYS LYS 4 . n 
D  4  292 GLN 292 292 292 GLN GLN 4 . n 
D  4  293 ALA 293 293 293 ALA ALA 4 . n 
D  4  294 LEU 294 294 294 LEU LEU 4 . n 
D  4  295 GLU 295 295 295 GLU GLU 4 . n 
D  4  296 ARG 296 296 296 ARG ARG 4 . n 
D  4  297 LEU 297 297 297 LEU LEU 4 . n 
D  4  298 GLU 298 298 298 GLU GLU 4 . n 
D  4  299 PRO 299 299 299 PRO PRO 4 . n 
D  4  300 GLY 300 300 300 GLY GLY 4 . n 
D  4  301 PRO 301 301 301 PRO PRO 4 . n 
D  4  302 VAL 302 302 302 VAL VAL 4 . n 
D  4  303 ARG 303 303 303 ARG ARG 4 . n 
D  4  304 ASP 304 304 304 ASP ASP 4 . n 
D  4  305 PRO 305 305 305 PRO PRO 4 . n 
D  4  306 ASN 306 306 306 ASN ASN 4 . n 
D  4  307 PRO 307 307 307 PRO PRO 4 . n 
D  4  308 GLN 308 308 308 GLN GLN 4 . n 
D  4  309 ILE 309 309 309 ILE ILE 4 . n 
D  4  310 THR 310 310 310 THR THR 4 . n 
D  4  311 PRO 311 311 311 PRO PRO 4 . n 
D  4  312 PRO 312 312 312 PRO PRO 4 . n 
D  4  313 PRO 313 313 313 PRO PRO 4 . n 
D  4  314 ARG 314 314 314 ARG ARG 4 . n 
D  4  315 HIS 315 315 315 HIS HIS 4 . n 
D  4  316 LEU 316 316 316 LEU LEU 4 . n 
D  4  317 LEU 317 317 317 LEU LEU 4 . n 
D  4  318 GLU 318 318 318 GLU GLU 4 . n 
D  4  319 THR 319 319 319 THR THR 4 . n 
D  4  320 SER 320 320 320 SER SER 4 . n 
D  4  321 MET 321 321 321 MET MET 4 . n 
D  4  322 GLU 322 322 322 GLU GLU 4 . n 
D  4  323 ALA 323 323 323 ALA ALA 4 . n 
D  4  324 VAL 324 324 324 VAL VAL 4 . n 
D  4  325 ILE 325 325 325 ILE ILE 4 . n 
D  4  326 TYR 326 326 326 TYR TYR 4 . n 
D  4  327 HIS 327 327 327 HIS HIS 4 . n 
D  4  328 PHE 328 328 328 PHE PHE 4 . n 
D  4  329 LYS 329 329 329 LYS LYS 4 . n 
D  4  330 HIS 330 330 330 HIS HIS 4 . n 
D  4  331 TYR 331 331 331 TYR TYR 4 . n 
D  4  332 THR 332 332 332 THR THR 4 . n 
D  4  333 GLU 333 333 333 GLU GLU 4 . n 
D  4  334 GLY 334 334 334 GLY GLY 4 . n 
D  4  335 PHE 335 335 335 PHE PHE 4 . n 
D  4  336 HIS 336 336 336 HIS HIS 4 . n 
D  4  337 PRO 337 337 337 PRO PRO 4 . n 
D  4  338 PRO 338 338 338 PRO PRO 4 . n 
D  4  339 LYS 339 339 339 LYS LYS 4 . n 
D  4  340 GLY 340 340 340 GLY GLY 4 . n 
D  4  341 GLU 341 341 341 GLU GLU 4 . n 
D  4  342 VAL 342 342 342 VAL VAL 4 . n 
D  4  343 TYR 343 343 343 TYR TYR 4 . n 
D  4  344 VAL 344 344 344 VAL VAL 4 . n 
D  4  345 PRO 345 345 345 PRO PRO 4 . n 
D  4  346 THR 346 346 346 THR THR 4 . n 
D  4  347 GLU 347 347 347 GLU GLU 4 . n 
D  4  348 SER 348 348 348 SER SER 4 . n 
D  4  349 ALA 349 349 349 ALA ALA 4 . n 
D  4  350 ARG 350 350 350 ARG ARG 4 . n 
D  4  351 GLY 351 351 351 GLY GLY 4 . n 
D  4  352 GLU 352 352 352 GLU GLU 4 . n 
D  4  353 LEU 353 353 353 LEU LEU 4 . n 
D  4  354 GLY 354 354 354 GLY GLY 4 . n 
D  4  355 TYR 355 355 355 TYR TYR 4 . n 
D  4  356 TYR 356 356 356 TYR TYR 4 . n 
D  4  357 ILE 357 357 357 ILE ILE 4 . n 
D  4  358 VAL 358 358 358 VAL VAL 4 . n 
D  4  359 SER 359 359 359 SER SER 4 . n 
D  4  360 ASP 360 360 360 ASP ASP 4 . n 
D  4  361 GLY 361 361 361 GLY GLY 4 . n 
D  4  362 GLY 362 362 362 GLY GLY 4 . n 
D  4  363 SER 363 363 363 SER SER 4 . n 
D  4  364 MET 364 364 364 MET MET 4 . n 
D  4  365 PRO 365 365 365 PRO PRO 4 . n 
D  4  366 TYR 366 366 366 TYR TYR 4 . n 
D  4  367 ARG 367 367 367 ARG ARG 4 . n 
D  4  368 VAL 368 368 368 VAL VAL 4 . n 
D  4  369 LYS 369 369 369 LYS LYS 4 . n 
D  4  370 VAL 370 370 370 VAL VAL 4 . n 
D  4  371 ARG 371 371 371 ARG ARG 4 . n 
D  4  372 ALA 372 372 372 ALA ALA 4 . n 
D  4  373 PRO 373 373 373 PRO PRO 4 . n 
D  4  374 SER 374 374 374 SER SER 4 . n 
D  4  375 PHE 375 375 375 PHE PHE 4 . n 
D  4  376 VAL 376 376 376 VAL VAL 4 . n 
D  4  377 ASN 377 377 377 ASN ASN 4 . n 
D  4  378 LEU 378 378 378 LEU LEU 4 . n 
D  4  379 GLN 379 379 379 GLN GLN 4 . n 
D  4  380 SER 380 380 380 SER SER 4 . n 
D  4  381 LEU 381 381 381 LEU LEU 4 . n 
D  4  382 PRO 382 382 382 PRO PRO 4 . n 
D  4  383 TYR 383 383 383 TYR TYR 4 . n 
D  4  384 ALA 384 384 384 ALA ALA 4 . n 
D  4  385 CYS 385 385 385 CYS CYS 4 . n 
D  4  386 LYS 386 386 386 LYS LYS 4 . n 
D  4  387 GLY 387 387 387 GLY GLY 4 . n 
D  4  388 GLU 388 388 388 GLU GLU 4 . n 
D  4  389 GLN 389 389 389 GLN GLN 4 . n 
D  4  390 VAL 390 390 390 VAL VAL 4 . n 
D  4  391 PRO 391 391 391 PRO PRO 4 . n 
D  4  392 ASP 392 392 392 ASP ASP 4 . n 
D  4  393 MET 393 393 393 MET MET 4 . n 
D  4  394 VAL 394 394 394 VAL VAL 4 . n 
D  4  395 ALA 395 395 395 ALA ALA 4 . n 
D  4  396 ILE 396 396 396 ILE ILE 4 . n 
D  4  397 ILE 397 397 397 ILE ILE 4 . n 
D  4  398 ALA 398 398 398 ALA ALA 4 . n 
D  4  399 SER 399 399 399 SER SER 4 . n 
D  4  400 LEU 400 400 400 LEU LEU 4 . n 
D  4  401 ASP 401 401 401 ASP ASP 4 . n 
D  4  402 PRO 402 402 402 PRO PRO 4 . n 
D  4  403 VAL 403 403 403 VAL VAL 4 . n 
D  4  404 MET 404 404 404 MET MET 4 . n 
D  4  405 GLY 405 405 405 GLY GLY 4 . n 
D  4  406 ASP 406 406 406 ASP ASP 4 . n 
D  4  407 VAL 407 407 407 VAL VAL 4 . n 
D  4  408 ASP 408 408 408 ASP ASP 4 . n 
D  4  409 ARG 409 409 409 ARG ARG 4 . n 
E  5  1   MET 1   1   1   MET MET 5 . n 
E  5  2   ARG 2   2   2   ARG ARG 5 . n 
E  5  3   LEU 3   3   3   LEU LEU 5 . n 
E  5  4   GLU 4   4   4   GLU GLU 5 . n 
E  5  5   ARG 5   5   5   ARG ARG 5 . n 
E  5  6   VAL 6   6   6   VAL VAL 5 . n 
E  5  7   LEU 7   7   7   LEU LEU 5 . n 
E  5  8   GLU 8   8   8   GLU GLU 5 . n 
E  5  9   GLU 9   9   9   GLU GLU 5 . n 
E  5  10  ALA 10  10  10  ALA ALA 5 . n 
E  5  11  ARG 11  11  11  ARG ARG 5 . n 
E  5  12  ALA 12  12  12  ALA ALA 5 . n 
E  5  13  LYS 13  13  13  LYS LYS 5 . n 
E  5  14  GLY 14  14  14  GLY GLY 5 . n 
E  5  15  TYR 15  15  15  TYR TYR 5 . n 
E  5  16  PRO 16  16  16  PRO PRO 5 . n 
E  5  17  ILE 17  17  17  ILE ILE 5 . n 
E  5  18  GLU 18  18  18  GLU GLU 5 . n 
E  5  19  ASP 19  19  19  ASP ASP 5 . n 
E  5  20  ASN 20  20  20  ASN ASN 5 . n 
E  5  21  GLY 21  21  21  GLY GLY 5 . n 
E  5  22  LEU 22  22  22  LEU LEU 5 . n 
E  5  23  GLY 23  23  23  GLY GLY 5 . n 
E  5  24  ASN 24  24  24  ASN ASN 5 . n 
E  5  25  LEU 25  25  25  LEU LEU 5 . n 
E  5  26  TRP 26  26  26  TRP TRP 5 . n 
E  5  27  VAL 27  27  27  VAL VAL 5 . n 
E  5  28  VAL 28  28  28  VAL VAL 5 . n 
E  5  29  LEU 29  29  29  LEU LEU 5 . n 
E  5  30  PRO 30  30  30  PRO PRO 5 . n 
E  5  31  ARG 31  31  31  ARG ARG 5 . n 
E  5  32  GLU 32  32  32  GLU GLU 5 . n 
E  5  33  ARG 33  33  33  ARG ARG 5 . n 
E  5  34  PHE 34  34  34  PHE PHE 5 . n 
E  5  35  LYS 35  35  35  LYS LYS 5 . n 
E  5  36  GLU 36  36  36  GLU GLU 5 . n 
E  5  37  GLU 37  37  37  GLU GLU 5 . n 
E  5  38  MET 38  38  38  MET MET 5 . n 
E  5  39  ALA 39  39  39  ALA ALA 5 . n 
E  5  40  HIS 40  40  40  HIS HIS 5 . n 
E  5  41  TYR 41  41  41  TYR TYR 5 . n 
E  5  42  LYS 42  42  42  LYS LYS 5 . n 
E  5  43  ALA 43  43  43  ALA ALA 5 . n 
E  5  44  MET 44  44  44  MET MET 5 . n 
E  5  45  GLY 45  45  45  GLY GLY 5 . n 
E  5  46  PHE 46  46  46  PHE PHE 5 . n 
E  5  47  ASN 47  47  47  ASN ASN 5 . n 
E  5  48  PHE 48  48  48  PHE PHE 5 . n 
E  5  49  LEU 49  49  49  LEU LEU 5 . n 
E  5  50  ALA 50  50  50  ALA ALA 5 . n 
E  5  51  ASP 51  51  51  ASP ASP 5 . n 
E  5  52  ILE 52  52  52  ILE ILE 5 . n 
E  5  53  VAL 53  53  53  VAL VAL 5 . n 
E  5  54  GLY 54  54  54  GLY GLY 5 . n 
E  5  55  LEU 55  55  55  LEU LEU 5 . n 
E  5  56  ASP 56  56  56  ASP ASP 5 . n 
E  5  57  TYR 57  57  57  TYR TYR 5 . n 
E  5  58  LEU 58  58  58  LEU LEU 5 . n 
E  5  59  THR 59  59  59  THR THR 5 . n 
E  5  60  TYR 60  60  60  TYR TYR 5 . n 
E  5  61  PRO 61  61  61  PRO PRO 5 . n 
E  5  62  ASP 62  62  62  ASP ASP 5 . n 
E  5  63  PRO 63  63  63  PRO PRO 5 . n 
E  5  64  ARG 64  64  64  ARG ARG 5 . n 
E  5  65  PRO 65  65  65  PRO PRO 5 . n 
E  5  66  GLU 66  66  66  GLU GLU 5 . n 
E  5  67  ARG 67  67  67  ARG ARG 5 . n 
E  5  68  PHE 68  68  68  PHE PHE 5 . n 
E  5  69  ALA 69  69  69  ALA ALA 5 . n 
E  5  70  VAL 70  70  70  VAL VAL 5 . n 
E  5  71  VAL 71  71  71  VAL VAL 5 . n 
E  5  72  TYR 72  72  72  TYR TYR 5 . n 
E  5  73  GLU 73  73  73  GLU GLU 5 . n 
E  5  74  LEU 74  74  74  LEU LEU 5 . n 
E  5  75  VAL 75  75  75  VAL VAL 5 . n 
E  5  76  SER 76  76  76  SER SER 5 . n 
E  5  77  LEU 77  77  77  LEU LEU 5 . n 
E  5  78  PRO 78  78  78  PRO PRO 5 . n 
E  5  79  GLY 79  79  79  GLY GLY 5 . n 
E  5  80  TRP 80  80  80  TRP TRP 5 . n 
E  5  81  LYS 81  81  81  LYS LYS 5 . n 
E  5  82  ASP 82  82  82  ASP ASP 5 . n 
E  5  83  GLY 83  83  83  GLY GLY 5 . n 
E  5  84  ASP 84  84  84  ASP ASP 5 . n 
E  5  85  GLY 85  85  85  GLY GLY 5 . n 
E  5  86  SER 86  86  86  SER SER 5 . n 
E  5  87  ARG 87  87  87  ARG ARG 5 . n 
E  5  88  PHE 88  88  88  PHE PHE 5 . n 
E  5  89  PHE 89  89  89  PHE PHE 5 . n 
E  5  90  VAL 90  90  90  VAL VAL 5 . n 
E  5  91  ARG 91  91  91  ARG ARG 5 . n 
E  5  92  VAL 92  92  92  VAL VAL 5 . n 
E  5  93  TYR 93  93  93  TYR TYR 5 . n 
E  5  94  VAL 94  94  94  VAL VAL 5 . n 
E  5  95  PRO 95  95  95  PRO PRO 5 . n 
E  5  96  GLU 96  96  96  GLU GLU 5 . n 
E  5  97  GLU 97  97  97  GLU GLU 5 . n 
E  5  98  ASP 98  98  98  ASP ASP 5 . n 
E  5  99  PRO 99  99  99  PRO PRO 5 . n 
E  5  100 ARG 100 100 100 ARG ARG 5 . n 
E  5  101 LEU 101 101 101 LEU LEU 5 . n 
E  5  102 PRO 102 102 102 PRO PRO 5 . n 
E  5  103 THR 103 103 103 THR THR 5 . n 
E  5  104 VAL 104 104 104 VAL VAL 5 . n 
E  5  105 THR 105 105 105 THR THR 5 . n 
E  5  106 ASP 106 106 106 ASP ASP 5 . n 
E  5  107 LEU 107 107 107 LEU LEU 5 . n 
E  5  108 TRP 108 108 108 TRP TRP 5 . n 
E  5  109 GLY 109 109 109 GLY GLY 5 . n 
E  5  110 SER 110 110 110 SER SER 5 . n 
E  5  111 ALA 111 111 111 ALA ALA 5 . n 
E  5  112 ASN 112 112 112 ASN ASN 5 . n 
E  5  113 PHE 113 113 113 PHE PHE 5 . n 
E  5  114 LEU 114 114 114 LEU LEU 5 . n 
E  5  115 GLU 115 115 115 GLU GLU 5 . n 
E  5  116 ARG 116 116 116 ARG ARG 5 . n 
E  5  117 GLU 117 117 117 GLU GLU 5 . n 
E  5  118 VAL 118 118 118 VAL VAL 5 . n 
E  5  119 TYR 119 119 119 TYR TYR 5 . n 
E  5  120 ASP 120 120 120 ASP ASP 5 . n 
E  5  121 LEU 121 121 121 LEU LEU 5 . n 
E  5  122 PHE 122 122 122 PHE PHE 5 . n 
E  5  123 GLY 123 123 123 GLY GLY 5 . n 
E  5  124 ILE 124 124 124 ILE ILE 5 . n 
E  5  125 VAL 125 125 125 VAL VAL 5 . n 
E  5  126 PHE 126 126 126 PHE PHE 5 . n 
E  5  127 GLU 127 127 127 GLU GLU 5 . n 
E  5  128 GLY 128 128 128 GLY GLY 5 . n 
E  5  129 HIS 129 129 129 HIS HIS 5 . n 
E  5  130 PRO 130 130 130 PRO PRO 5 . n 
E  5  131 ASP 131 131 131 ASP ASP 5 . n 
E  5  132 LEU 132 132 132 LEU LEU 5 . n 
E  5  133 ARG 133 133 133 ARG ARG 5 . n 
E  5  134 LYS 134 134 134 LYS LYS 5 . n 
E  5  135 ILE 135 135 135 ILE ILE 5 . n 
E  5  136 LEU 136 136 136 LEU LEU 5 . n 
E  5  137 THR 137 137 137 THR THR 5 . n 
E  5  138 PRO 138 138 138 PRO PRO 5 . n 
E  5  139 GLU 139 139 139 GLU GLU 5 . n 
E  5  140 ASP 140 140 140 ASP ASP 5 . n 
E  5  141 LEU 141 141 141 LEU LEU 5 . n 
E  5  142 GLU 142 142 142 GLU GLU 5 . n 
E  5  143 GLY 143 143 143 GLY GLY 5 . n 
E  5  144 HIS 144 144 144 HIS HIS 5 . n 
E  5  145 PRO 145 145 145 PRO PRO 5 . n 
E  5  146 LEU 146 146 146 LEU LEU 5 . n 
E  5  147 ARG 147 147 147 ARG ARG 5 . n 
E  5  148 LYS 148 148 148 LYS LYS 5 . n 
E  5  149 ASP 149 149 149 ASP ASP 5 . n 
E  5  150 TYR 150 150 150 TYR TYR 5 . n 
E  5  151 PRO 151 151 151 PRO PRO 5 . n 
E  5  152 LEU 152 152 152 LEU LEU 5 . n 
E  5  153 GLY 153 153 153 GLY GLY 5 . n 
E  5  154 GLU 154 154 154 GLU GLU 5 . n 
E  5  155 THR 155 155 155 THR THR 5 . n 
E  5  156 PRO 156 156 156 PRO PRO 5 . n 
E  5  157 THR 157 157 157 THR THR 5 . n 
E  5  158 LEU 158 158 158 LEU LEU 5 . n 
E  5  159 PHE 159 159 159 PHE PHE 5 . n 
E  5  160 ARG 160 160 160 ARG ARG 5 . n 
E  5  161 GLU 161 161 161 GLU GLU 5 . n 
E  5  162 GLY 162 162 162 GLY GLY 5 . n 
E  5  163 ARG 163 163 163 ARG ARG 5 . n 
E  5  164 TYR 164 164 164 TYR TYR 5 . n 
E  5  165 ILE 165 165 165 ILE ILE 5 . n 
E  5  166 ILE 166 166 166 ILE ILE 5 . n 
E  5  167 PRO 167 167 167 PRO PRO 5 . n 
E  5  168 ALA 168 168 168 ALA ALA 5 . n 
E  5  169 GLU 169 169 169 GLU GLU 5 . n 
E  5  170 PHE 170 170 170 PHE PHE 5 . n 
E  5  171 ARG 171 171 171 ARG ARG 5 . n 
E  5  172 ALA 172 172 172 ALA ALA 5 . n 
E  5  173 ALA 173 173 173 ALA ALA 5 . n 
E  5  174 LEU 174 174 174 LEU LEU 5 . n 
E  5  175 THR 175 175 175 THR THR 5 . n 
E  5  176 GLY 176 176 176 GLY GLY 5 . n 
E  5  177 LYS 177 177 177 LYS LYS 5 . n 
E  5  178 ASP 178 178 178 ASP ASP 5 . n 
E  5  179 PRO 179 179 179 PRO PRO 5 . n 
E  5  180 GLY 180 180 180 GLY GLY 5 . n 
E  5  181 LEU 181 181 181 LEU LEU 5 . n 
E  5  182 THR 182 182 182 THR THR 5 . n 
E  5  183 PHE 183 183 183 PHE PHE 5 . n 
E  5  184 TYR 184 184 184 TYR TYR 5 . n 
E  5  185 LYS 185 185 185 LYS LYS 5 . n 
E  5  186 GLY 186 186 186 GLY GLY 5 . n 
E  5  187 GLY 187 187 187 GLY GLY 5 . n 
E  5  188 SER 188 188 188 SER SER 5 . n 
E  5  189 ARG 189 189 189 ARG ARG 5 . n 
E  5  190 LYS 190 190 190 LYS LYS 5 . n 
E  5  191 GLY 191 191 191 GLY GLY 5 . n 
E  5  192 TYR 192 192 192 TYR TYR 5 . n 
E  5  193 ARG 193 193 193 ARG ARG 5 . n 
E  5  194 SER 194 194 194 SER SER 5 . n 
E  5  195 LEU 195 195 195 LEU LEU 5 . n 
E  5  196 TRP 196 196 196 TRP TRP 5 . n 
E  5  197 ALA 197 197 ?   ?   ?   5 . n 
E  5  198 ASP 198 198 ?   ?   ?   5 . n 
E  5  199 LEU 199 199 ?   ?   ?   5 . n 
E  5  200 LYS 200 200 ?   ?   ?   5 . n 
E  5  201 LYS 201 201 ?   ?   ?   5 . n 
E  5  202 ALA 202 202 ?   ?   ?   5 . n 
E  5  203 ARG 203 203 ?   ?   ?   5 . n 
E  5  204 GLU 204 204 ?   ?   ?   5 . n 
E  5  205 VAL 205 205 ?   ?   ?   5 . n 
E  5  206 LYS 206 206 ?   ?   ?   5 . n 
E  5  207 GLY 207 207 ?   ?   ?   5 . n 
F  6  1   MET 1   1   ?   ?   ?   6 . n 
F  6  2   ALA 2   2   ?   ?   ?   6 . n 
F  6  3   LEU 3   3   ?   ?   ?   6 . n 
F  6  4   LYS 4   4   ?   ?   ?   6 . n 
F  6  5   ASP 5   5   ?   ?   ?   6 . n 
F  6  6   LEU 6   6   ?   ?   ?   6 . n 
F  6  7   PHE 7   7   ?   ?   ?   6 . n 
F  6  8   GLU 8   8   ?   ?   ?   6 . n 
F  6  9   ARG 9   9   ?   ?   ?   6 . n 
F  6  10  ASP 10  10  ?   ?   ?   6 . n 
F  6  11  VAL 11  11  ?   ?   ?   6 . n 
F  6  12  GLN 12  12  ?   ?   ?   6 . n 
F  6  13  GLU 13  13  ?   ?   ?   6 . n 
F  6  14  LEU 14  14  ?   ?   ?   6 . n 
F  6  15  GLU 15  15  ?   ?   ?   6 . n 
F  6  16  ARG 16  16  16  ARG ARG 6 . n 
F  6  17  GLU 17  17  17  GLU GLU 6 . n 
F  6  18  GLY 18  18  18  GLY GLY 6 . n 
F  6  19  ILE 19  19  19  ILE ILE 6 . n 
F  6  20  LEU 20  20  20  LEU LEU 6 . n 
F  6  21  PHE 21  21  21  PHE PHE 6 . n 
F  6  22  THR 22  22  22  THR THR 6 . n 
F  6  23  THR 23  23  23  THR THR 6 . n 
F  6  24  LEU 24  24  24  LEU LEU 6 . n 
F  6  25  GLU 25  25  25  GLU GLU 6 . n 
F  6  26  LYS 26  26  26  LYS LYS 6 . n 
F  6  27  LEU 27  27  27  LEU LEU 6 . n 
F  6  28  VAL 28  28  28  VAL VAL 6 . n 
F  6  29  ALA 29  29  29  ALA ALA 6 . n 
F  6  30  TRP 30  30  30  TRP TRP 6 . n 
F  6  31  GLY 31  31  31  GLY GLY 6 . n 
F  6  32  ARG 32  32  32  ARG ARG 6 . n 
F  6  33  SER 33  33  33  SER SER 6 . n 
F  6  34  ASN 34  34  34  ASN ASN 6 . n 
F  6  35  SER 35  35  35  SER SER 6 . n 
F  6  36  LEU 36  36  36  LEU LEU 6 . n 
F  6  37  TRP 37  37  37  TRP TRP 6 . n 
F  6  38  PRO 38  38  38  PRO PRO 6 . n 
F  6  39  ALA 39  39  39  ALA ALA 6 . n 
F  6  40  THR 40  40  40  THR THR 6 . n 
F  6  41  PHE 41  41  41  PHE PHE 6 . n 
F  6  42  GLY 42  42  42  GLY GLY 6 . n 
F  6  43  LEU 43  43  43  LEU LEU 6 . n 
F  6  44  ALA 44  44  44  ALA ALA 6 . n 
F  6  45  CYS 45  45  45  CYS CYS 6 . n 
F  6  46  CYS 46  46  46  CYS CYS 6 . n 
F  6  47  ALA 47  47  47  ALA ALA 6 . n 
F  6  48  ILE 48  48  48  ILE ILE 6 . n 
F  6  49  GLU 49  49  49  GLU GLU 6 . n 
F  6  50  MET 50  50  50  MET MET 6 . n 
F  6  51  MET 51  51  51  MET MET 6 . n 
F  6  52  ALA 52  52  52  ALA ALA 6 . n 
F  6  53  SER 53  53  53  SER SER 6 . n 
F  6  54  THR 54  54  54  THR THR 6 . n 
F  6  55  ASP 55  55  55  ASP ASP 6 . n 
F  6  56  ALA 56  56  56  ALA ALA 6 . n 
F  6  57  ARG 57  57  57  ARG ARG 6 . n 
F  6  58  ASN 58  58  58  ASN ASN 6 . n 
F  6  59  ASP 59  59  59  ASP ASP 6 . n 
F  6  60  LEU 60  60  60  LEU LEU 6 . n 
F  6  61  ALA 61  61  61  ALA ALA 6 . n 
F  6  62  ARG 62  62  62  ARG ARG 6 . n 
F  6  63  PHE 63  63  63  PHE PHE 6 . n 
F  6  64  GLY 64  64  64  GLY GLY 6 . n 
F  6  65  SER 65  65  65  SER SER 6 . n 
F  6  66  GLU 66  66  66  GLU GLU 6 . n 
F  6  67  VAL 67  67  67  VAL VAL 6 . n 
F  6  68  PHE 68  68  68  PHE PHE 6 . n 
F  6  69  ARG 69  69  69  ARG ARG 6 . n 
F  6  70  ALA 70  70  70  ALA ALA 6 . n 
F  6  71  SER 71  71  71  SER SER 6 . n 
F  6  72  PRO 72  72  72  PRO PRO 6 . n 
F  6  73  ARG 73  73  73  ARG ARG 6 . n 
F  6  74  GLN 74  74  74  GLN GLN 6 . n 
F  6  75  ALA 75  75  75  ALA ALA 6 . n 
F  6  76  ASP 76  76  76  ASP ASP 6 . n 
F  6  77  VAL 77  77  77  VAL VAL 6 . n 
F  6  78  MET 78  78  78  MET MET 6 . n 
F  6  79  ILE 79  79  79  ILE ILE 6 . n 
F  6  80  VAL 80  80  80  VAL VAL 6 . n 
F  6  81  ALA 81  81  81  ALA ALA 6 . n 
F  6  82  GLY 82  82  82  GLY GLY 6 . n 
F  6  83  ARG 83  83  83  ARG ARG 6 . n 
F  6  84  LEU 84  84  84  LEU LEU 6 . n 
F  6  85  SER 85  85  85  SER SER 6 . n 
F  6  86  LYS 86  86  86  LYS LYS 6 . n 
F  6  87  LYS 87  87  87  LYS LYS 6 . n 
F  6  88  MET 88  88  88  MET MET 6 . n 
F  6  89  ALA 89  89  89  ALA ALA 6 . n 
F  6  90  PRO 90  90  90  PRO PRO 6 . n 
F  6  91  VAL 91  91  91  VAL VAL 6 . n 
F  6  92  MET 92  92  92  MET MET 6 . n 
F  6  93  ARG 93  93  93  ARG ARG 6 . n 
F  6  94  ARG 94  94  94  ARG ARG 6 . n 
F  6  95  VAL 95  95  95  VAL VAL 6 . n 
F  6  96  TRP 96  96  96  TRP TRP 6 . n 
F  6  97  GLU 97  97  97  GLU GLU 6 . n 
F  6  98  GLN 98  98  98  GLN GLN 6 . n 
F  6  99  MET 99  99  99  MET MET 6 . n 
F  6  100 PRO 100 100 100 PRO PRO 6 . n 
F  6  101 ASP 101 101 101 ASP ASP 6 . n 
F  6  102 PRO 102 102 102 PRO PRO 6 . n 
F  6  103 LYS 103 103 103 LYS LYS 6 . n 
F  6  104 TRP 104 104 104 TRP TRP 6 . n 
F  6  105 VAL 105 105 105 VAL VAL 6 . n 
F  6  106 ILE 106 106 106 ILE ILE 6 . n 
F  6  107 SER 107 107 107 SER SER 6 . n 
F  6  108 MET 108 108 108 MET MET 6 . n 
F  6  109 GLY 109 109 109 GLY GLY 6 . n 
F  6  110 ALA 110 110 110 ALA ALA 6 . n 
F  6  111 CYS 111 111 111 CYS CYS 6 . n 
F  6  112 ALA 112 112 112 ALA ALA 6 . n 
F  6  113 SER 113 113 113 SER SER 6 . n 
F  6  114 SER 114 114 114 SER SER 6 . n 
F  6  115 GLY 115 115 115 GLY GLY 6 . n 
F  6  116 GLY 116 116 116 GLY GLY 6 . n 
F  6  117 MET 117 117 117 MET MET 6 . n 
F  6  118 PHE 118 118 118 PHE PHE 6 . n 
F  6  119 ASN 119 119 119 ASN ASN 6 . n 
F  6  120 ASN 120 120 120 ASN ASN 6 . n 
F  6  121 TYR 121 121 121 TYR TYR 6 . n 
F  6  122 ALA 122 122 122 ALA ALA 6 . n 
F  6  123 ILE 123 123 123 ILE ILE 6 . n 
F  6  124 VAL 124 124 124 VAL VAL 6 . n 
F  6  125 GLN 125 125 125 GLN GLN 6 . n 
F  6  126 ASN 126 126 126 ASN ASN 6 . n 
F  6  127 VAL 127 127 127 VAL VAL 6 . n 
F  6  128 ASP 128 128 128 ASP ASP 6 . n 
F  6  129 SER 129 129 129 SER SER 6 . n 
F  6  130 VAL 130 130 130 VAL VAL 6 . n 
F  6  131 VAL 131 131 131 VAL VAL 6 . n 
F  6  132 PRO 132 132 132 PRO PRO 6 . n 
F  6  133 VAL 133 133 133 VAL VAL 6 . n 
F  6  134 ASP 134 134 134 ASP ASP 6 . n 
F  6  135 VAL 135 135 135 VAL VAL 6 . n 
F  6  136 TYR 136 136 136 TYR TYR 6 . n 
F  6  137 VAL 137 137 137 VAL VAL 6 . n 
F  6  138 PRO 138 138 138 PRO PRO 6 . n 
F  6  139 GLY 139 139 139 GLY GLY 6 . n 
F  6  140 CYS 140 140 140 CYS CYS 6 . n 
F  6  141 PRO 141 141 141 PRO PRO 6 . n 
F  6  142 PRO 142 142 142 PRO PRO 6 . n 
F  6  143 ARG 143 143 143 ARG ARG 6 . n 
F  6  144 PRO 144 144 144 PRO PRO 6 . n 
F  6  145 GLU 145 145 145 GLU GLU 6 . n 
F  6  146 ALA 146 146 146 ALA ALA 6 . n 
F  6  147 LEU 147 147 147 LEU LEU 6 . n 
F  6  148 ILE 148 148 148 ILE ILE 6 . n 
F  6  149 TYR 149 149 149 TYR TYR 6 . n 
F  6  150 ALA 150 150 150 ALA ALA 6 . n 
F  6  151 VAL 151 151 151 VAL VAL 6 . n 
F  6  152 MET 152 152 152 MET MET 6 . n 
F  6  153 GLN 153 153 153 GLN GLN 6 . n 
F  6  154 LEU 154 154 154 LEU LEU 6 . n 
F  6  155 GLN 155 155 155 GLN GLN 6 . n 
F  6  156 LYS 156 156 156 LYS LYS 6 . n 
F  6  157 LYS 157 157 157 LYS LYS 6 . n 
F  6  158 VAL 158 158 158 VAL VAL 6 . n 
F  6  159 ARG 159 159 159 ARG ARG 6 . n 
F  6  160 GLY 160 160 160 GLY GLY 6 . n 
F  6  161 GLN 161 161 161 GLN GLN 6 . n 
F  6  162 ALA 162 162 162 ALA ALA 6 . n 
F  6  163 TYR 163 163 163 TYR TYR 6 . n 
F  6  164 ASN 164 164 164 ASN ASN 6 . n 
F  6  165 GLU 165 165 165 GLU GLU 6 . n 
F  6  166 ARG 166 166 166 ARG ARG 6 . n 
F  6  167 GLY 167 167 167 GLY GLY 6 . n 
F  6  168 GLU 168 168 168 GLU GLU 6 . n 
F  6  169 ARG 169 169 169 ARG ARG 6 . n 
F  6  170 LEU 170 170 170 LEU LEU 6 . n 
F  6  171 PRO 171 171 171 PRO PRO 6 . n 
F  6  172 PRO 172 172 172 PRO PRO 6 . n 
F  6  173 VAL 173 173 173 VAL VAL 6 . n 
F  6  174 ALA 174 174 174 ALA ALA 6 . n 
F  6  175 ALA 175 175 175 ALA ALA 6 . n 
F  6  176 TRP 176 176 176 TRP TRP 6 . n 
F  6  177 LYS 177 177 177 LYS LYS 6 . n 
F  6  178 ARG 178 178 178 ARG ARG 6 . n 
F  6  179 THR 179 179 179 THR THR 6 . n 
F  6  180 ARG 180 180 180 ARG ARG 6 . n 
F  6  181 GLY 181 181 181 GLY GLY 6 . n 
G  7  1   MET 1   1   ?   ?   ?   9 . n 
G  7  2   THR 2   2   2   THR THR 9 . n 
G  7  3   LEU 3   3   3   LEU LEU 9 . n 
G  7  4   LYS 4   4   4   LYS LYS 9 . n 
G  7  5   ALA 5   5   5   ALA ALA 9 . n 
G  7  6   LEU 6   6   6   LEU LEU 9 . n 
G  7  7   ALA 7   7   7   ALA ALA 9 . n 
G  7  8   GLN 8   8   8   GLN GLN 9 . n 
G  7  9   SER 9   9   9   SER SER 9 . n 
G  7  10  LEU 10  10  10  LEU LEU 9 . n 
G  7  11  GLY 11  11  11  GLY GLY 9 . n 
G  7  12  ILE 12  12  12  ILE ILE 9 . n 
G  7  13  THR 13  13  13  THR THR 9 . n 
G  7  14  LEU 14  14  14  LEU LEU 9 . n 
G  7  15  LYS 15  15  15  LYS LYS 9 . n 
G  7  16  TYR 16  16  16  TYR TYR 9 . n 
G  7  17  LEU 17  17  17  LEU LEU 9 . n 
G  7  18  PHE 18  18  18  PHE PHE 9 . n 
G  7  19  SER 19  19  19  SER SER 9 . n 
G  7  20  LYS 20  20  20  LYS LYS 9 . n 
G  7  21  PRO 21  21  21  PRO PRO 9 . n 
G  7  22  VAL 22  22  22  VAL VAL 9 . n 
G  7  23  THR 23  23  23  THR THR 9 . n 
G  7  24  VAL 24  24  24  VAL VAL 9 . n 
G  7  25  PRO 25  25  25  PRO PRO 9 . n 
G  7  26  TYR 26  26  26  TYR TYR 9 . n 
G  7  27  PRO 27  27  27  PRO PRO 9 . n 
G  7  28  ASP 28  28  28  ASP ASP 9 . n 
G  7  29  ALA 29  29  29  ALA ALA 9 . n 
G  7  30  PRO 30  30  30  PRO PRO 9 . n 
G  7  31  VAL 31  31  31  VAL VAL 9 . n 
G  7  32  ALA 32  32  32  ALA ALA 9 . n 
G  7  33  LEU 33  33  33  LEU LEU 9 . n 
G  7  34  LYS 34  34  34  LYS LYS 9 . n 
G  7  35  PRO 35  35  35  PRO PRO 9 . n 
G  7  36  ARG 36  36  36  ARG ARG 9 . n 
G  7  37  PHE 37  37  37  PHE PHE 9 . n 
G  7  38  HIS 38  38  38  HIS HIS 9 . n 
G  7  39  GLY 39  39  39  GLY GLY 9 . n 
G  7  40  ARG 40  40  40  ARG ARG 9 . n 
G  7  41  HIS 41  41  41  HIS HIS 9 . n 
G  7  42  VAL 42  42  42  VAL VAL 9 . n 
G  7  43  LEU 43  43  43  LEU LEU 9 . n 
G  7  44  THR 44  44  44  THR THR 9 . n 
G  7  45  ARG 45  45  45  ARG ARG 9 . n 
G  7  46  HIS 46  46  46  HIS HIS 9 . n 
G  7  47  PRO 47  47  47  PRO PRO 9 . n 
G  7  48  ASN 48  48  48  ASN ASN 9 . n 
G  7  49  GLY 49  49  49  GLY GLY 9 . n 
G  7  50  LEU 50  50  50  LEU LEU 9 . n 
G  7  51  GLU 51  51  51  GLU GLU 9 . n 
G  7  52  LYS 52  52  52  LYS LYS 9 . n 
G  7  53  CYS 53  53  53  CYS CYS 9 . n 
G  7  54  ILE 54  54  54  ILE ILE 9 . n 
G  7  55  GLY 55  55  55  GLY GLY 9 . n 
G  7  56  CYS 56  56  56  CYS CYS 9 . n 
G  7  57  SER 57  57  57  SER SER 9 . n 
G  7  58  LEU 58  58  58  LEU LEU 9 . n 
G  7  59  CYS 59  59  59  CYS CYS 9 . n 
G  7  60  ALA 60  60  60  ALA ALA 9 . n 
G  7  61  ALA 61  61  61  ALA ALA 9 . n 
G  7  62  ALA 62  62  62  ALA ALA 9 . n 
G  7  63  CYS 63  63  63  CYS CYS 9 . n 
G  7  64  PRO 64  64  64  PRO PRO 9 . n 
G  7  65  ALA 65  65  65  ALA ALA 9 . n 
G  7  66  TYR 66  66  66  TYR TYR 9 . n 
G  7  67  ALA 67  67  67  ALA ALA 9 . n 
G  7  68  ILE 68  68  68  ILE ILE 9 . n 
G  7  69  TYR 69  69  69  TYR TYR 9 . n 
G  7  70  VAL 70  70  70  VAL VAL 9 . n 
G  7  71  GLU 71  71  71  GLU GLU 9 . n 
G  7  72  PRO 72  72  72  PRO PRO 9 . n 
G  7  73  ALA 73  73  73  ALA ALA 9 . n 
G  7  74  GLU 74  74  74  GLU GLU 9 . n 
G  7  75  ASN 75  75  75  ASN ASN 9 . n 
G  7  76  ASP 76  76  76  ASP ASP 9 . n 
G  7  77  PRO 77  77  77  PRO PRO 9 . n 
G  7  78  GLU 78  78  78  GLU GLU 9 . n 
G  7  79  ASN 79  79  79  ASN ASN 9 . n 
G  7  80  PRO 80  80  80  PRO PRO 9 . n 
G  7  81  VAL 81  81  81  VAL VAL 9 . n 
G  7  82  SER 82  82  82  SER SER 9 . n 
G  7  83  ALA 83  83  83  ALA ALA 9 . n 
G  7  84  GLY 84  84  84  GLY GLY 9 . n 
G  7  85  GLU 85  85  85  GLU GLU 9 . n 
G  7  86  ARG 86  86  86  ARG ARG 9 . n 
G  7  87  TYR 87  87  87  TYR TYR 9 . n 
G  7  88  ALA 88  88  88  ALA ALA 9 . n 
G  7  89  LYS 89  89  89  LYS LYS 9 . n 
G  7  90  VAL 90  90  90  VAL VAL 9 . n 
G  7  91  TYR 91  91  91  TYR TYR 9 . n 
G  7  92  GLU 92  92  92  GLU GLU 9 . n 
G  7  93  ILE 93  93  93  ILE ILE 9 . n 
G  7  94  ASN 94  94  94  ASN ASN 9 . n 
G  7  95  MET 95  95  95  MET MET 9 . n 
G  7  96  LEU 96  96  96  LEU LEU 9 . n 
G  7  97  ARG 97  97  97  ARG ARG 9 . n 
G  7  98  CYS 98  98  98  CYS CYS 9 . n 
G  7  99  ILE 99  99  99  ILE ILE 9 . n 
G  7  100 PHE 100 100 100 PHE PHE 9 . n 
G  7  101 CYS 101 101 101 CYS CYS 9 . n 
G  7  102 GLY 102 102 102 GLY GLY 9 . n 
G  7  103 LEU 103 103 103 LEU LEU 9 . n 
G  7  104 CYS 104 104 104 CYS CYS 9 . n 
G  7  105 GLU 105 105 105 GLU GLU 9 . n 
G  7  106 GLU 106 106 106 GLU GLU 9 . n 
G  7  107 ALA 107 107 107 ALA ALA 9 . n 
G  7  108 CYS 108 108 108 CYS CYS 9 . n 
G  7  109 PRO 109 109 109 PRO PRO 9 . n 
G  7  110 THR 110 110 110 THR THR 9 . n 
G  7  111 GLY 111 111 111 GLY GLY 9 . n 
G  7  112 ALA 112 112 112 ALA ALA 9 . n 
G  7  113 ILE 113 113 113 ILE ILE 9 . n 
G  7  114 VAL 114 114 114 VAL VAL 9 . n 
G  7  115 LEU 115 115 115 LEU LEU 9 . n 
G  7  116 GLY 116 116 116 GLY GLY 9 . n 
G  7  117 TYR 117 117 117 TYR TYR 9 . n 
G  7  118 ASP 118 118 118 ASP ASP 9 . n 
G  7  119 PHE 119 119 119 PHE PHE 9 . n 
G  7  120 GLU 120 120 120 GLU GLU 9 . n 
G  7  121 MET 121 121 121 MET MET 9 . n 
G  7  122 ALA 122 122 122 ALA ALA 9 . n 
G  7  123 ASP 123 123 123 ASP ASP 9 . n 
G  7  124 TYR 124 124 124 TYR TYR 9 . n 
G  7  125 GLU 125 125 125 GLU GLU 9 . n 
G  7  126 TYR 126 126 126 TYR TYR 9 . n 
G  7  127 SER 127 127 127 SER SER 9 . n 
G  7  128 ASP 128 128 128 ASP ASP 9 . n 
G  7  129 LEU 129 129 129 LEU LEU 9 . n 
G  7  130 VAL 130 130 130 VAL VAL 9 . n 
G  7  131 TYR 131 131 131 TYR TYR 9 . n 
G  7  132 GLY 132 132 132 GLY GLY 9 . n 
G  7  133 LYS 133 133 133 LYS LYS 9 . n 
G  7  134 GLU 134 134 134 GLU GLU 9 . n 
G  7  135 ASP 135 135 135 ASP ASP 9 . n 
G  7  136 MET 136 136 136 MET MET 9 . n 
G  7  137 LEU 137 137 137 LEU LEU 9 . n 
G  7  138 VAL 138 138 138 VAL VAL 9 . n 
G  7  139 ASP 139 139 139 ASP ASP 9 . n 
G  7  140 VAL 140 140 140 VAL VAL 9 . n 
G  7  141 VAL 141 141 141 VAL VAL 9 . n 
G  7  142 GLY 142 142 142 GLY GLY 9 . n 
G  7  143 THR 143 143 143 THR THR 9 . n 
G  7  144 LYS 144 144 144 LYS LYS 9 . n 
G  7  145 PRO 145 145 145 PRO PRO 9 . n 
G  7  146 GLN 146 146 146 GLN GLN 9 . n 
G  7  147 ARG 147 147 147 ARG ARG 9 . n 
G  7  148 ARG 148 148 148 ARG ARG 9 . n 
G  7  149 GLU 149 149 149 GLU GLU 9 . n 
G  7  150 ALA 150 150 150 ALA ALA 9 . n 
G  7  151 LYS 151 151 151 LYS LYS 9 . n 
G  7  152 ARG 152 152 152 ARG ARG 9 . n 
G  7  153 THR 153 153 153 THR THR 9 . n 
G  7  154 GLY 154 154 154 GLY GLY 9 . n 
G  7  155 LYS 155 155 155 LYS LYS 9 . n 
G  7  156 PRO 156 156 156 PRO PRO 9 . n 
G  7  157 VAL 157 157 157 VAL VAL 9 . n 
G  7  158 LYS 158 158 158 LYS LYS 9 . n 
G  7  159 VAL 159 159 159 VAL VAL 9 . n 
G  7  160 GLY 160 160 160 GLY GLY 9 . n 
G  7  161 TYR 161 161 161 TYR TYR 9 . n 
G  7  162 VAL 162 162 162 VAL VAL 9 . n 
G  7  163 VAL 163 163 163 VAL VAL 9 . n 
G  7  164 PRO 164 164 164 PRO PRO 9 . n 
G  7  165 TYR 165 165 165 TYR TYR 9 . n 
G  7  166 VAL 166 166 166 VAL VAL 9 . n 
G  7  167 ARG 167 167 167 ARG ARG 9 . n 
G  7  168 PRO 168 168 168 PRO PRO 9 . n 
G  7  169 GLU 169 169 169 GLU GLU 9 . n 
G  7  170 LEU 170 170 170 LEU LEU 9 . n 
G  7  171 GLU 171 171 171 GLU GLU 9 . n 
G  7  172 GLY 172 172 172 GLY GLY 9 . n 
G  7  173 PHE 173 173 173 PHE PHE 9 . n 
G  7  174 LYS 174 174 174 LYS LYS 9 . n 
G  7  175 ALA 175 175 175 ALA ALA 9 . n 
G  7  176 PRO 176 176 176 PRO PRO 9 . n 
G  7  177 THR 177 177 177 THR THR 9 . n 
G  7  178 GLU 178 178 178 GLU GLU 9 . n 
G  7  179 GLY 179 179 179 GLY GLY 9 . n 
G  7  180 GLY 180 180 180 GLY GLY 9 . n 
G  7  181 LYS 181 181 181 LYS LYS 9 . n 
G  7  182 ARG 182 182 ?   ?   ?   9 . n 
H  8  1   MET 1   1   ?   ?   ?   7 . n 
H  8  2   SER 2   2   ?   ?   ?   7 . n 
H  8  3   ALA 3   3   3   ALA ALA 7 . n 
H  8  4   SER 4   4   4   SER SER 7 . n 
H  8  5   SER 5   5   5   SER SER 7 . n 
H  8  6   GLU 6   6   6   GLU GLU 7 . n 
H  8  7   ARG 7   7   7   ARG ARG 7 . n 
H  8  8   GLU 8   8   8   GLU GLU 7 . n 
H  8  9   LEU 9   9   9   LEU LEU 7 . n 
H  8  10  TYR 10  10  10  TYR TYR 7 . n 
H  8  11  GLU 11  11  11  GLU GLU 7 . n 
H  8  12  ALA 12  12  12  ALA ALA 7 . n 
H  8  13  TRP 13  13  13  TRP TRP 7 . n 
H  8  14  VAL 14  14  14  VAL VAL 7 . n 
H  8  15  GLU 15  15  15  GLU GLU 7 . n 
H  8  16  LEU 16  16  16  LEU LEU 7 . n 
H  8  17  LEU 17  17  17  LEU LEU 7 . n 
H  8  18  SER 18  18  18  SER SER 7 . n 
H  8  19  TRP 19  19  19  TRP TRP 7 . n 
H  8  20  MET 20  20  20  MET MET 7 . n 
H  8  21  ARG 21  21  21  ARG ARG 7 . n 
H  8  22  GLU 22  22  22  GLU GLU 7 . n 
H  8  23  TYR 23  23  23  TYR TYR 7 . n 
H  8  24  ALA 24  24  24  ALA ALA 7 . n 
H  8  25  GLN 25  25  25  GLN GLN 7 . n 
H  8  26  ALA 26  26  26  ALA ALA 7 . n 
H  8  27  LYS 27  27  27  LYS LYS 7 . n 
H  8  28  GLY 28  28  28  GLY GLY 7 . n 
H  8  29  VAL 29  29  29  VAL VAL 7 . n 
H  8  30  ARG 30  30  30  ARG ARG 7 . n 
H  8  31  PHE 31  31  31  PHE PHE 7 . n 
H  8  32  GLU 32  32  32  GLU GLU 7 . n 
H  8  33  LYS 33  33  33  LYS LYS 7 . n 
H  8  34  GLU 34  34  34  GLU GLU 7 . n 
H  8  35  ALA 35  35  35  ALA ALA 7 . n 
H  8  36  ASP 36  36  36  ASP ASP 7 . n 
H  8  37  PHE 37  37  37  PHE PHE 7 . n 
H  8  38  PRO 38  38  38  PRO PRO 7 . n 
H  8  39  ASP 39  39  39  ASP ASP 7 . n 
H  8  40  PHE 40  40  40  PHE PHE 7 . n 
H  8  41  ILE 41  41  41  ILE ILE 7 . n 
H  8  42  TYR 42  42  42  TYR TYR 7 . n 
H  8  43  ARG 43  43  43  ARG ARG 7 . n 
H  8  44  MET 44  44  44  MET MET 7 . n 
H  8  45  GLU 45  45  45  GLU GLU 7 . n 
H  8  46  ARG 46  46  46  ARG ARG 7 . n 
H  8  47  PRO 47  47  47  PRO PRO 7 . n 
H  8  48  TYR 48  48  48  TYR TYR 7 . n 
H  8  49  ASP 49  49  49  ASP ASP 7 . n 
H  8  50  LEU 50  50  50  LEU LEU 7 . n 
H  8  51  PRO 51  51  51  PRO PRO 7 . n 
H  8  52  THR 52  52  52  THR THR 7 . n 
H  8  53  THR 53  53  53  THR THR 7 . n 
H  8  54  ILE 54  54  54  ILE ILE 7 . n 
H  8  55  MET 55  55  55  MET MET 7 . n 
H  8  56  THR 56  56  56  THR THR 7 . n 
H  8  57  ALA 57  57  57  ALA ALA 7 . n 
H  8  58  SER 58  58  58  SER SER 7 . n 
H  8  59  LEU 59  59  59  LEU LEU 7 . n 
H  8  60  SER 60  60  60  SER SER 7 . n 
H  8  61  ASP 61  61  61  ASP ASP 7 . n 
H  8  62  GLY 62  62  62  GLY GLY 7 . n 
H  8  63  LEU 63  63  63  LEU LEU 7 . n 
H  8  64  GLY 64  64  64  GLY GLY 7 . n 
H  8  65  GLU 65  65  65  GLU GLU 7 . n 
H  8  66  PRO 66  66  66  PRO PRO 7 . n 
H  8  67  PHE 67  67  67  PHE PHE 7 . n 
H  8  68  LEU 68  68  68  LEU LEU 7 . n 
H  8  69  LEU 69  69  69  LEU LEU 7 . n 
H  8  70  ALA 70  70  70  ALA ALA 7 . n 
H  8  71  ASP 71  71  71  ASP ASP 7 . n 
H  8  72  VAL 72  72  72  VAL VAL 7 . n 
H  8  73  SER 73  73  73  SER SER 7 . n 
H  8  74  PRO 74  74  74  PRO PRO 7 . n 
H  8  75  ARG 75  75  75  ARG ARG 7 . n 
H  8  76  HIS 76  76  76  HIS HIS 7 . n 
H  8  77  ALA 77  77  77  ALA ALA 7 . n 
H  8  78  LYS 78  78  78  LYS LYS 7 . n 
H  8  79  LEU 79  79  79  LEU LEU 7 . n 
H  8  80  LYS 80  80  80  LYS LYS 7 . n 
H  8  81  ARG 81  81  81  ARG ARG 7 . n 
H  8  82  ILE 82  82  82  ILE ILE 7 . n 
H  8  83  GLY 83  83  83  GLY GLY 7 . n 
H  8  84  LEU 84  84  84  LEU LEU 7 . n 
H  8  85  ARG 85  85  85  ARG ARG 7 . n 
H  8  86  LEU 86  86  86  LEU LEU 7 . n 
H  8  87  PRO 87  87  87  PRO PRO 7 . n 
H  8  88  ARG 88  88  88  ARG ARG 7 . n 
H  8  89  ALA 89  89  89  ALA ALA 7 . n 
H  8  90  HIS 90  90  90  HIS HIS 7 . n 
H  8  91  ILE 91  91  91  ILE ILE 7 . n 
H  8  92  HIS 92  92  92  HIS HIS 7 . n 
H  8  93  LEU 93  93  93  LEU LEU 7 . n 
H  8  94  HIS 94  94  94  HIS HIS 7 . n 
H  8  95  ALA 95  95  95  ALA ALA 7 . n 
H  8  96  HIS 96  96  96  HIS HIS 7 . n 
H  8  97  TYR 97  97  97  TYR TYR 7 . n 
H  8  98  GLU 98  98  98  GLU GLU 7 . n 
H  8  99  PRO 99  99  99  PRO PRO 7 . n 
H  8  100 GLY 100 100 100 GLY GLY 7 . n 
H  8  101 LYS 101 101 101 LYS LYS 7 . n 
H  8  102 GLY 102 102 102 GLY GLY 7 . n 
H  8  103 LEU 103 103 103 LEU LEU 7 . n 
H  8  104 VAL 104 104 104 VAL VAL 7 . n 
H  8  105 THR 105 105 105 THR THR 7 . n 
H  8  106 GLY 106 106 106 GLY GLY 7 . n 
H  8  107 LYS 107 107 107 LYS LYS 7 . n 
H  8  108 ILE 108 108 108 ILE ILE 7 . n 
H  8  109 PRO 109 109 109 PRO PRO 7 . n 
H  8  110 LEU 110 110 110 LEU LEU 7 . n 
H  8  111 THR 111 111 111 THR THR 7 . n 
H  8  112 LYS 112 112 112 LYS LYS 7 . n 
H  8  113 GLU 113 113 113 GLU GLU 7 . n 
H  8  114 ARG 114 114 114 ARG ARG 7 . n 
H  8  115 PHE 115 115 115 PHE PHE 7 . n 
H  8  116 PHE 116 116 116 PHE PHE 7 . n 
H  8  117 ALA 117 117 117 ALA ALA 7 . n 
H  8  118 LEU 118 118 118 LEU LEU 7 . n 
H  8  119 ALA 119 119 119 ALA ALA 7 . n 
H  8  120 ASP 120 120 120 ASP ASP 7 . n 
H  8  121 ARG 121 121 121 ARG ARG 7 . n 
H  8  122 ALA 122 122 122 ALA ALA 7 . n 
H  8  123 ARG 123 123 123 ARG ARG 7 . n 
H  8  124 GLU 124 124 124 GLU GLU 7 . n 
H  8  125 ALA 125 125 125 ALA ALA 7 . n 
H  8  126 LEU 126 126 126 LEU LEU 7 . n 
H  8  127 ALA 127 127 127 ALA ALA 7 . n 
H  8  128 PHE 128 128 128 PHE PHE 7 . n 
H  8  129 ALA 129 129 129 ALA ALA 7 . n 
I  9  1   MET 1   1   1   MET MET W . n 
I  9  2   VAL 2   2   2   VAL VAL W . n 
I  9  3   ARG 3   3   3   ARG ARG W . n 
I  9  4   VAL 4   4   4   VAL VAL W . n 
I  9  5   GLY 5   5   5   GLY GLY W . n 
I  9  6   MET 6   6   6   MET MET W . n 
I  9  7   ARG 7   7   7   ARG ARG W . n 
I  9  8   ALA 8   8   8   ALA ALA W . n 
I  9  9   ALA 9   9   9   ALA ALA W . n 
I  9  10  PRO 10  10  10  PRO PRO W . n 
I  9  11  ARG 11  11  11  ARG ARG W . n 
I  9  12  VAL 12  12  12  VAL VAL W . n 
I  9  13  SER 13  13  13  SER SER W . n 
I  9  14  LEU 14  14  14  LEU LEU W . n 
I  9  15  GLU 15  15  15  GLU GLU W . n 
I  9  16  ALA 16  16  16  ALA ALA W . n 
I  9  17  LEU 17  17  17  LEU LEU W . n 
I  9  18  LYS 18  18  18  LYS LYS W . n 
I  9  19  ALA 19  19  19  ALA ALA W . n 
I  9  20  ALA 20  20  20  ALA ALA W . n 
I  9  21  LEU 21  21  21  LEU LEU W . n 
I  9  22  GLY 22  22  22  GLY GLY W . n 
I  9  23  GLY 23  23  23  GLY GLY W . n 
I  9  24  LEU 24  24  24  LEU LEU W . n 
I  9  25  LYS 25  25  25  LYS LYS W . n 
I  9  26  LEU 26  26  26  LEU LEU W . n 
I  9  27  SER 27  27  27  SER SER W . n 
I  9  28  GLU 28  28  28  GLU GLU W . n 
I  9  29  ALA 29  29  29  ALA ALA W . n 
I  9  30  LYS 30  30  30  LYS LYS W . n 
I  9  31  VAL 31  31  31  VAL VAL W . n 
I  9  32  TYR 32  32  32  TYR TYR W . n 
I  9  33  LEU 33  33  33  LEU LEU W . n 
I  9  34  ILE 34  34  34  ILE ILE W . n 
I  9  35  THR 35  35  35  THR THR W . n 
I  9  36  ASP 36  36  36  ASP ASP W . n 
I  9  37  TRP 37  37  37  TRP TRP W . n 
I  9  38  GLN 38  38  38  GLN GLN W . n 
I  9  39  ASP 39  39  39  ASP ASP W . n 
I  9  40  LYS 40  40  40  LYS LYS W . n 
I  9  41  ARG 41  41  41  ARG ARG W . n 
I  9  42  ASP 42  42  42  ASP ASP W . n 
I  9  43  GLN 43  43  43  GLN GLN W . n 
I  9  44  ALA 44  44  44  ALA ALA W . n 
I  9  45  ARG 45  45  45  ARG ARG W . n 
I  9  46  TYR 46  46  46  TYR TYR W . n 
I  9  47  ALA 47  47  47  ALA ALA W . n 
I  9  48  LEU 48  48  48  LEU LEU W . n 
I  9  49  LEU 49  49  49  LEU LEU W . n 
I  9  50  LEU 50  50  50  LEU LEU W . n 
I  9  51  HIS 51  51  51  HIS HIS W . n 
I  9  52  THR 52  52  52  THR THR W . n 
I  9  53  GLY 53  53  53  GLY GLY W . n 
I  9  54  LYS 54  54  54  LYS LYS W . n 
I  9  55  LYS 55  55  55  LYS LYS W . n 
I  9  56  ASP 56  56  56  ASP ASP W . n 
I  9  57  LEU 57  57  57  LEU LEU W . n 
I  9  58  LEU 58  58  58  LEU LEU W . n 
I  9  59  VAL 59  59  59  VAL VAL W . n 
I  9  60  PRO 60  60  60  PRO PRO W . n 
I  9  61  ASP 61  61  61  ASP ASP W . n 
I  9  62  ALA 62  62  62  ALA ALA W . n 
I  9  63  PHE 63  63  63  PHE PHE W . n 
I  9  64  GLY 64  64  64  GLY GLY W . n 
I  9  65  PRO 65  65  65  PRO PRO W . n 
I  9  66  ALA 66  66  66  ALA ALA W . n 
I  9  67  PHE 67  67  67  PHE PHE W . n 
I  9  68  PRO 68  68  68  PRO PRO W . n 
I  9  69  GLY 69  69  69  GLY GLY W . n 
I  9  70  GLY 70  70  70  GLY GLY W . n 
I  9  71  GLU 71  71  71  GLU GLU W . n 
I  9  72  GLU 72  72  72  GLU GLU W . n 
I  9  73  ALA 73  73  73  ALA ALA W . n 
I  9  74  LEU 74  74  74  LEU LEU W . n 
I  9  75  SER 75  75  75  SER SER W . n 
I  9  76  GLU 76  76  76  GLU GLU W . n 
I  9  77  LEU 77  77  77  LEU LEU W . n 
I  9  78  VAL 78  78  78  VAL VAL W . n 
I  9  79  GLY 79  79  79  GLY GLY W . n 
I  9  80  LEU 80  80  80  LEU LEU W . n 
I  9  81  LEU 81  81  81  LEU LEU W . n 
I  9  82  LEU 82  82  82  LEU LEU W . n 
I  9  83  ALA 83  83  83  ALA ALA W . n 
I  9  84  GLN 84  84  84  GLN GLN W . n 
I  9  85  GLY 85  85  85  GLY GLY W . n 
I  9  86  ALA 86  86  86  ALA ALA W . n 
I  9  87  ARG 87  87  87  ARG ARG W . n 
I  9  88  ARG 88  88  88  ARG ARG W . n 
I  9  89  PHE 89  89  89  PHE PHE W . n 
I  9  90  TYR 90  90  90  TYR TYR W . n 
I  9  91  GLU 91  91  91  GLU GLU W . n 
I  9  92  ALA 92  92  92  ALA ALA W . n 
I  9  93  VAL 93  93  93  VAL VAL W . n 
I  9  94  VAL 94  94  94  VAL VAL W . n 
I  9  95  SER 95  95  95  SER SER W . n 
I  9  96  PRO 96  96  96  PRO PRO W . n 
I  9  97  GLY 97  97  97  GLY GLY W . n 
I  9  98  GLU 98  98  98  GLU GLU W . n 
I  9  99  MET 99  99  99  MET MET W . n 
I  9  100 THR 100 100 100 THR THR W . n 
I  9  101 ALA 101 101 101 ALA ALA W . n 
I  9  102 LEU 102 102 102 LEU LEU W . n 
I  9  103 LEU 103 103 103 LEU LEU W . n 
I  9  104 ASP 104 104 104 ASP ASP W . n 
I  9  105 LEU 105 105 105 LEU LEU W . n 
I  9  106 PRO 106 106 106 PRO PRO W . n 
I  9  107 PRO 107 107 107 PRO PRO W . n 
I  9  108 GLU 108 108 108 GLU GLU W . n 
I  9  109 GLU 109 109 109 GLU GLU W . n 
I  9  110 LEU 110 110 110 LEU LEU W . n 
I  9  111 LEU 111 111 111 LEU LEU W . n 
I  9  112 LYS 112 112 112 LYS LYS W . n 
I  9  113 ARG 113 113 113 ARG ARG W . n 
I  9  114 VAL 114 114 114 VAL VAL W . n 
I  9  115 MET 115 115 115 MET MET W . n 
I  9  116 ALA 116 116 116 ALA ALA W . n 
I  9  117 ILE 117 117 117 ILE ILE W . n 
I  9  118 ALA 118 118 118 ALA ALA W . n 
I  9  119 ASN 119 119 119 ASN ASN W . n 
I  9  120 PRO 120 120 120 PRO PRO W . n 
I  9  121 THR 121 121 121 THR THR W . n 
I  9  122 ASP 122 122 122 ASP ASP W . n 
I  9  123 PRO 123 123 123 PRO PRO W . n 
I  9  124 GLY 124 124 124 GLY GLY W . n 
I  9  125 ILE 125 125 125 ILE ILE W . n 
I  9  126 TYR 126 126 126 TYR TYR W . n 
I  9  127 LEU 127 127 127 LEU LEU W . n 
I  9  128 LYS 128 128 ?   ?   ?   W . n 
I  9  129 ARG 129 129 ?   ?   ?   W . n 
I  9  130 ALA 130 130 ?   ?   ?   W . n 
I  9  131 ALA 131 131 ?   ?   ?   W . n 
J  10 1   MET 1   1   1   MET MET A . n 
J  10 2   ALA 2   2   2   ALA ALA A . n 
J  10 3   PRO 3   3   3   PRO PRO A . n 
J  10 4   ILE 4   4   4   ILE ILE A . n 
J  10 5   GLN 5   5   5   GLN GLN A . n 
J  10 6   GLU 6   6   6   GLU GLU A . n 
J  10 7   TYR 7   7   7   TYR TYR A . n 
J  10 8   VAL 8   8   8   VAL VAL A . n 
J  10 9   GLY 9   9   9   GLY GLY A . n 
J  10 10  THR 10  10  10  THR THR A . n 
J  10 11  LEU 11  11  11  LEU LEU A . n 
J  10 12  ILE 12  12  12  ILE ILE A . n 
J  10 13  TYR 13  13  13  TYR TYR A . n 
J  10 14  VAL 14  14  14  VAL VAL A . n 
J  10 15  GLY 15  15  15  GLY GLY A . n 
J  10 16  VAL 16  16  16  VAL VAL A . n 
J  10 17  ALA 17  17  17  ALA ALA A . n 
J  10 18  LEU 18  18  18  LEU LEU A . n 
J  10 19  PHE 19  19  19  PHE PHE A . n 
J  10 20  ILE 20  20  20  ILE ILE A . n 
J  10 21  GLY 21  21  21  GLY GLY A . n 
J  10 22  VAL 22  22  22  VAL VAL A . n 
J  10 23  ALA 23  23  23  ALA ALA A . n 
J  10 24  ALA 24  24  24  ALA ALA A . n 
J  10 25  LEU 25  25  25  LEU LEU A . n 
J  10 26  LEU 26  26  26  LEU LEU A . n 
J  10 27  VAL 27  27  27  VAL VAL A . n 
J  10 28  GLY 28  28  28  GLY GLY A . n 
J  10 29  ALA 29  29  29  ALA ALA A . n 
J  10 30  LEU 30  30  30  LEU LEU A . n 
J  10 31  LEU 31  31  31  LEU LEU A . n 
J  10 32  GLY 32  32  32  GLY GLY A . n 
J  10 33  PRO 33  33  33  PRO PRO A . n 
J  10 34  LYS 34  34  34  LYS LYS A . n 
J  10 35  LYS 35  35  35  LYS LYS A . n 
J  10 36  PRO 36  36  36  PRO PRO A . n 
J  10 37  GLY 37  37  37  GLY GLY A . n 
J  10 38  ARG 38  38  38  ARG ARG A . n 
J  10 39  ALA 39  39  39  ALA ALA A . n 
J  10 40  LYS 40  40  40  LYS LYS A . n 
J  10 41  LEU 41  41  41  LEU LEU A . n 
J  10 42  MET 42  42  42  MET MET A . n 
J  10 43  PRO 43  43  43  PRO PRO A . n 
J  10 44  TYR 44  44  44  TYR TYR A . n 
J  10 45  GLU 45  45  45  GLU GLU A . n 
J  10 46  SER 46  46  46  SER SER A . n 
J  10 47  GLY 47  47  47  GLY GLY A . n 
J  10 48  ASN 48  48  48  ASN ASN A . n 
J  10 49  ASP 49  49  49  ASP ASP A . n 
J  10 50  PRO 50  50  50  PRO PRO A . n 
J  10 51  ALA 51  51  51  ALA ALA A . n 
J  10 52  GLY 52  52  52  GLY GLY A . n 
J  10 53  GLU 53  53  53  GLU GLU A . n 
J  10 54  VAL 54  54  54  VAL VAL A . n 
J  10 55  LYS 55  55  55  LYS LYS A . n 
J  10 56  ARG 56  56  56  ARG ARG A . n 
J  10 57  PHE 57  57  57  PHE PHE A . n 
J  10 58  PRO 58  58  58  PRO PRO A . n 
J  10 59  VAL 59  59  59  VAL VAL A . n 
J  10 60  HIS 60  60  60  HIS HIS A . n 
J  10 61  PHE 61  61  61  PHE PHE A . n 
J  10 62  TYR 62  62  62  TYR TYR A . n 
J  10 63  VAL 63  63  63  VAL VAL A . n 
J  10 64  VAL 64  64  64  VAL VAL A . n 
J  10 65  ALA 65  65  65  ALA ALA A . n 
J  10 66  MET 66  66  66  MET MET A . n 
J  10 67  LEU 67  67  67  LEU LEU A . n 
J  10 68  PHE 68  68  68  PHE PHE A . n 
J  10 69  ILE 69  69  69  ILE ILE A . n 
J  10 70  LEU 70  70  70  LEU LEU A . n 
J  10 71  PHE 71  71  71  PHE PHE A . n 
J  10 72  ASP 72  72  72  ASP ASP A . n 
J  10 73  VAL 73  73  73  VAL VAL A . n 
J  10 74  GLU 74  74  74  GLU GLU A . n 
J  10 75  VAL 75  75  75  VAL VAL A . n 
J  10 76  ALA 76  76  76  ALA ALA A . n 
J  10 77  PHE 77  77  77  PHE PHE A . n 
J  10 78  LEU 78  78  78  LEU LEU A . n 
J  10 79  TRP 79  79  79  TRP TRP A . n 
J  10 80  PRO 80  80  80  PRO PRO A . n 
J  10 81  TYR 81  81  81  TYR TYR A . n 
J  10 82  ALA 82  82  82  ALA ALA A . n 
J  10 83  VAL 83  83  83  VAL VAL A . n 
J  10 84  SER 84  84  84  SER SER A . n 
J  10 85  ALA 85  85  85  ALA ALA A . n 
J  10 86  GLY 86  86  86  GLY GLY A . n 
J  10 87  GLY 87  87  87  GLY GLY A . n 
J  10 88  LEU 88  88  88  LEU LEU A . n 
J  10 89  GLY 89  89  89  GLY GLY A . n 
J  10 90  LEU 90  90  90  LEU LEU A . n 
J  10 91  TYR 91  91  91  TYR TYR A . n 
J  10 92  GLY 92  92  92  GLY GLY A . n 
J  10 93  PHE 93  93  93  PHE PHE A . n 
J  10 94  LEU 94  94  94  LEU LEU A . n 
J  10 95  GLY 95  95  95  GLY GLY A . n 
J  10 96  VAL 96  96  96  VAL VAL A . n 
J  10 97  LEU 97  97  97  LEU LEU A . n 
J  10 98  ALA 98  98  98  ALA ALA A . n 
J  10 99  PHE 99  99  99  PHE PHE A . n 
J  10 100 THR 100 100 100 THR THR A . n 
J  10 101 LEU 101 101 101 LEU LEU A . n 
J  10 102 LEU 102 102 102 LEU LEU A . n 
J  10 103 LEU 103 103 103 LEU LEU A . n 
J  10 104 PHE 104 104 104 PHE PHE A . n 
J  10 105 VAL 105 105 105 VAL VAL A . n 
J  10 106 GLY 106 106 106 GLY GLY A . n 
J  10 107 PHE 107 107 107 PHE PHE A . n 
J  10 108 LEU 108 108 108 LEU LEU A . n 
J  10 109 TYR 109 109 109 TYR TYR A . n 
J  10 110 GLU 110 110 110 GLU GLU A . n 
J  10 111 TRP 111 111 111 TRP TRP A . n 
J  10 112 TRP 112 112 112 TRP TRP A . n 
J  10 113 LYS 113 113 113 LYS LYS A . n 
J  10 114 GLY 114 114 114 GLY GLY A . n 
J  10 115 VAL 115 115 115 VAL VAL A . n 
J  10 116 MET 116 116 116 MET MET A . n 
J  10 117 ARG 117 117 117 ARG ARG A . n 
J  10 118 TRP 118 118 ?   ?   ?   A . n 
J  10 119 HIS 119 119 ?   ?   ?   A . n 
K  11 1   MET 1   1   1   MET MET J . n 
K  11 2   SER 2   2   2   SER SER J . n 
K  11 3   LEU 3   3   3   LEU LEU J . n 
K  11 4   LEU 4   4   4   LEU LEU J . n 
K  11 5   GLU 5   5   5   GLU GLU J . n 
K  11 6   GLY 6   6   6   GLY GLY J . n 
K  11 7   LEU 7   7   7   LEU LEU J . n 
K  11 8   ALA 8   8   8   ALA ALA J . n 
K  11 9   LEU 9   9   9   LEU LEU J . n 
K  11 10  PHE 10  10  10  PHE PHE J . n 
K  11 11  LEU 11  11  11  LEU LEU J . n 
K  11 12  LEU 12  12  12  LEU LEU J . n 
K  11 13  LEU 13  13  13  LEU LEU J . n 
K  11 14  LEU 14  14  14  LEU LEU J . n 
K  11 15  SER 15  15  15  SER SER J . n 
K  11 16  GLY 16  16  16  GLY GLY J . n 
K  11 17  VAL 17  17  17  VAL VAL J . n 
K  11 18  LEU 18  18  18  LEU LEU J . n 
K  11 19  VAL 19  19  19  VAL VAL J . n 
K  11 20  VAL 20  20  20  VAL VAL J . n 
K  11 21  THR 21  21  21  THR THR J . n 
K  11 22  LEU 22  22  22  LEU LEU J . n 
K  11 23  ARG 23  23  23  ARG ARG J . n 
K  11 24  ASN 24  24  24  ASN ASN J . n 
K  11 25  ALA 25  25  25  ALA ALA J . n 
K  11 26  ILE 26  26  26  ILE ILE J . n 
K  11 27  HIS 27  27  27  HIS HIS J . n 
K  11 28  ALA 28  28  28  ALA ALA J . n 
K  11 29  ALA 29  29  29  ALA ALA J . n 
K  11 30  LEU 30  30  30  LEU LEU J . n 
K  11 31  ALA 31  31  31  ALA ALA J . n 
K  11 32  LEU 32  32  32  LEU LEU J . n 
K  11 33  ILE 33  33  33  ILE ILE J . n 
K  11 34  LEU 34  34  34  LEU LEU J . n 
K  11 35  ASN 35  35  35  ASN ASN J . n 
K  11 36  PHE 36  36  36  PHE PHE J . n 
K  11 37  LEU 37  37  37  LEU LEU J . n 
K  11 38  VAL 38  38  38  VAL VAL J . n 
K  11 39  LEU 39  39  39  LEU LEU J . n 
K  11 40  ALA 40  40  40  ALA ALA J . n 
K  11 41  GLY 41  41  41  GLY GLY J . n 
K  11 42  VAL 42  42  42  VAL VAL J . n 
K  11 43  TYR 43  43  43  TYR TYR J . n 
K  11 44  VAL 44  44  44  VAL VAL J . n 
K  11 45  ALA 45  45  45  ALA ALA J . n 
K  11 46  LEU 46  46  46  LEU LEU J . n 
K  11 47  ASP 47  47  47  ASP ASP J . n 
K  11 48  ALA 48  48  48  ALA ALA J . n 
K  11 49  ARG 49  49  49  ARG ARG J . n 
K  11 50  PHE 50  50  50  PHE PHE J . n 
K  11 51  LEU 51  51  51  LEU LEU J . n 
K  11 52  GLY 52  52  52  GLY GLY J . n 
K  11 53  PHE 53  53  53  PHE PHE J . n 
K  11 54  ILE 54  54  54  ILE ILE J . n 
K  11 55  GLN 55  55  55  GLN GLN J . n 
K  11 56  VAL 56  56  56  VAL VAL J . n 
K  11 57  ILE 57  57  57  ILE ILE J . n 
K  11 58  VAL 58  58  58  VAL VAL J . n 
K  11 59  TYR 59  59  59  TYR TYR J . n 
K  11 60  ALA 60  60  60  ALA ALA J . n 
K  11 61  GLY 61  61  61  GLY GLY J . n 
K  11 62  ALA 62  62  62  ALA ALA J . n 
K  11 63  ILE 63  63  63  ILE ILE J . n 
K  11 64  VAL 64  64  64  VAL VAL J . n 
K  11 65  VAL 65  65  65  VAL VAL J . n 
K  11 66  LEU 66  66  66  LEU LEU J . n 
K  11 67  PHE 67  67  67  PHE PHE J . n 
K  11 68  LEU 68  68  68  LEU LEU J . n 
K  11 69  PHE 69  69  69  PHE PHE J . n 
K  11 70  VAL 70  70  70  VAL VAL J . n 
K  11 71  ILE 71  71  71  ILE ILE J . n 
K  11 72  MET 72  72  72  MET MET J . n 
K  11 73  LEU 73  73  73  LEU LEU J . n 
K  11 74  LEU 74  74  74  LEU LEU J . n 
K  11 75  PHE 75  75  75  PHE PHE J . n 
K  11 76  ALA 76  76  76  ALA ALA J . n 
K  11 77  ALA 77  77  77  ALA ALA J . n 
K  11 78  GLN 78  78  78  GLN GLN J . n 
K  11 79  GLY 79  79  79  GLY GLY J . n 
K  11 80  GLU 80  80  80  GLU GLU J . n 
K  11 81  ILE 81  81  81  ILE ILE J . n 
K  11 82  GLY 82  82  82  GLY GLY J . n 
K  11 83  PHE 83  83  83  PHE PHE J . n 
K  11 84  ASP 84  84  84  ASP ASP J . n 
K  11 85  PRO 85  85  85  PRO PRO J . n 
K  11 86  LEU 86  86  86  LEU LEU J . n 
K  11 87  VAL 87  87  87  VAL VAL J . n 
K  11 88  ARG 88  88  88  ARG ARG J . n 
K  11 89  SER 89  89  89  SER SER J . n 
K  11 90  ARG 90  90  90  ARG ARG J . n 
K  11 91  PRO 91  91  91  PRO PRO J . n 
K  11 92  LEU 92  92  92  LEU LEU J . n 
K  11 93  ALA 93  93  93  ALA ALA J . n 
K  11 94  ALA 94  94  94  ALA ALA J . n 
K  11 95  LEU 95  95  95  LEU LEU J . n 
K  11 96  LEU 96  96  96  LEU LEU J . n 
K  11 97  ALA 97  97  97  ALA ALA J . n 
K  11 98  LEU 98  98  98  LEU LEU J . n 
K  11 99  GLY 99  99  99  GLY GLY J . n 
K  11 100 VAL 100 100 100 VAL VAL J . n 
K  11 101 ALA 101 101 101 ALA ALA J . n 
K  11 102 GLY 102 102 102 GLY GLY J . n 
K  11 103 ILE 103 103 103 ILE ILE J . n 
K  11 104 LEU 104 104 104 LEU LEU J . n 
K  11 105 ALA 105 105 105 ALA ALA J . n 
K  11 106 ALA 106 106 106 ALA ALA J . n 
K  11 107 GLY 107 107 107 GLY GLY J . n 
K  11 108 LEU 108 108 108 LEU LEU J . n 
K  11 109 TRP 109 109 109 TRP TRP J . n 
K  11 110 GLY 110 110 110 GLY GLY J . n 
K  11 111 LEU 111 111 111 LEU LEU J . n 
K  11 112 ASP 112 112 112 ASP ASP J . n 
K  11 113 LEU 113 113 113 LEU LEU J . n 
K  11 114 ALA 114 114 114 ALA ALA J . n 
K  11 115 PHE 115 115 115 PHE PHE J . n 
K  11 116 THR 116 116 116 THR THR J . n 
K  11 117 GLN 117 117 117 GLN GLN J . n 
K  11 118 ASP 118 118 118 ASP ASP J . n 
K  11 119 LEU 119 119 119 LEU LEU J . n 
K  11 120 LYS 120 120 120 LYS LYS J . n 
K  11 121 GLY 121 121 121 GLY GLY J . n 
K  11 122 GLY 122 122 122 GLY GLY J . n 
K  11 123 LEU 123 123 123 LEU LEU J . n 
K  11 124 PRO 124 124 124 PRO PRO J . n 
K  11 125 GLN 125 125 125 GLN GLN J . n 
K  11 126 ALA 126 126 126 ALA ALA J . n 
K  11 127 LEU 127 127 127 LEU LEU J . n 
K  11 128 GLY 128 128 128 GLY GLY J . n 
K  11 129 PRO 129 129 129 PRO PRO J . n 
K  11 130 LEU 130 130 130 LEU LEU J . n 
K  11 131 LEU 131 131 131 LEU LEU J . n 
K  11 132 TYR 132 132 132 TYR TYR J . n 
K  11 133 GLY 133 133 133 GLY GLY J . n 
K  11 134 ASP 134 134 134 ASP ASP J . n 
K  11 135 TRP 135 135 135 TRP TRP J . n 
K  11 136 LEU 136 136 136 LEU LEU J . n 
K  11 137 PHE 137 137 137 PHE PHE J . n 
K  11 138 VAL 138 138 138 VAL VAL J . n 
K  11 139 LEU 139 139 139 LEU LEU J . n 
K  11 140 LEU 140 140 140 LEU LEU J . n 
K  11 141 ALA 141 141 141 ALA ALA J . n 
K  11 142 VAL 142 142 142 VAL VAL J . n 
K  11 143 GLY 143 143 143 GLY GLY J . n 
K  11 144 PHE 144 144 144 PHE PHE J . n 
K  11 145 LEU 145 145 145 LEU LEU J . n 
K  11 146 LEU 146 146 146 LEU LEU J . n 
K  11 147 MET 147 147 147 MET MET J . n 
K  11 148 ALA 148 148 148 ALA ALA J . n 
K  11 149 ALA 149 149 149 ALA ALA J . n 
K  11 150 THR 150 150 150 THR THR J . n 
K  11 151 VAL 151 151 151 VAL VAL J . n 
K  11 152 VAL 152 152 152 VAL VAL J . n 
K  11 153 ALA 153 153 153 ALA ALA J . n 
K  11 154 VAL 154 154 154 VAL VAL J . n 
K  11 155 ALA 155 155 155 ALA ALA J . n 
K  11 156 LEU 156 156 156 LEU LEU J . n 
K  11 157 VAL 157 157 157 VAL VAL J . n 
K  11 158 GLU 158 158 158 GLU GLU J . n 
K  11 159 PRO 159 159 159 PRO PRO J . n 
K  11 160 GLY 160 160 160 GLY GLY J . n 
K  11 161 LYS 161 161 ?   ?   ?   J . n 
K  11 162 ALA 162 162 ?   ?   ?   J . n 
K  11 163 SER 163 163 ?   ?   ?   J . n 
K  11 164 ARG 164 164 ?   ?   ?   J . n 
K  11 165 ALA 165 165 ?   ?   ?   J . n 
K  11 166 LYS 166 166 ?   ?   ?   J . n 
K  11 167 GLU 167 167 ?   ?   ?   J . n 
K  11 168 ALA 168 168 ?   ?   ?   J . n 
K  11 169 GLU 169 169 ?   ?   ?   J . n 
K  11 170 LYS 170 170 ?   ?   ?   J . n 
K  11 171 ARG 171 171 ?   ?   ?   J . n 
K  11 172 GLU 172 172 ?   ?   ?   J . n 
K  11 173 GLU 173 173 ?   ?   ?   J . n 
K  11 174 VAL 174 174 ?   ?   ?   J . n 
K  11 175 ALA 175 175 ?   ?   ?   J . n 
K  11 176 ARG 176 176 ?   ?   ?   J . n 
L  12 1   MET 1   1   1   MET MET K . n 
L  12 2   SER 2   2   2   SER SER K . n 
L  12 3   TYR 3   3   3   TYR TYR K . n 
L  12 4   LEU 4   4   4   LEU LEU K . n 
L  12 5   LEU 5   5   5   LEU LEU K . n 
L  12 6   THR 6   6   6   THR THR K . n 
L  12 7   SER 7   7   7   SER SER K . n 
L  12 8   ALA 8   8   8   ALA ALA K . n 
L  12 9   LEU 9   9   9   LEU LEU K . n 
L  12 10  LEU 10  10  10  LEU LEU K . n 
L  12 11  PHE 11  11  11  PHE PHE K . n 
L  12 12  ALA 12  12  12  ALA ALA K . n 
L  12 13  LEU 13  13  13  LEU LEU K . n 
L  12 14  GLY 14  14  14  GLY GLY K . n 
L  12 15  VAL 15  15  15  VAL VAL K . n 
L  12 16  TYR 16  16  16  TYR TYR K . n 
L  12 17  GLY 17  17  17  GLY GLY K . n 
L  12 18  VAL 18  18  18  VAL VAL K . n 
L  12 19  LEU 19  19  19  LEU LEU K . n 
L  12 20  THR 20  20  20  THR THR K . n 
L  12 21  ARG 21  21  21  ARG ARG K . n 
L  12 22  ARG 22  22  22  ARG ARG K . n 
L  12 23  THR 23  23  23  THR THR K . n 
L  12 24  ALA 24  24  24  ALA ALA K . n 
L  12 25  ILE 25  25  25  ILE ILE K . n 
L  12 26  LEU 26  26  26  LEU LEU K . n 
L  12 27  VAL 27  27  27  VAL VAL K . n 
L  12 28  PHE 28  28  28  PHE PHE K . n 
L  12 29  LEU 29  29  29  LEU LEU K . n 
L  12 30  SER 30  30  30  SER SER K . n 
L  12 31  ILE 31  31  31  ILE ILE K . n 
L  12 32  GLU 32  32  32  GLU GLU K . n 
L  12 33  LEU 33  33  33  LEU LEU K . n 
L  12 34  MET 34  34  34  MET MET K . n 
L  12 35  LEU 35  35  35  LEU LEU K . n 
L  12 36  ASN 36  36  36  ASN ASN K . n 
L  12 37  ALA 37  37  37  ALA ALA K . n 
L  12 38  ALA 38  38  38  ALA ALA K . n 
L  12 39  ASN 39  39  39  ASN ASN K . n 
L  12 40  LEU 40  40  40  LEU LEU K . n 
L  12 41  SER 41  41  41  SER SER K . n 
L  12 42  LEU 42  42  42  LEU LEU K . n 
L  12 43  VAL 43  43  43  VAL VAL K . n 
L  12 44  GLY 44  44  44  GLY GLY K . n 
L  12 45  PHE 45  45  45  PHE PHE K . n 
L  12 46  ALA 46  46  46  ALA ALA K . n 
L  12 47  ARG 47  47  47  ARG ARG K . n 
L  12 48  ALA 48  48  48  ALA ALA K . n 
L  12 49  TYR 49  49  49  TYR TYR K . n 
L  12 50  GLY 50  50  50  GLY GLY K . n 
L  12 51  LEU 51  51  51  LEU LEU K . n 
L  12 52  ASP 52  52  52  ASP ASP K . n 
L  12 53  GLY 53  53  53  GLY GLY K . n 
L  12 54  GLN 54  54  54  GLN GLN K . n 
L  12 55  VAL 55  55  55  VAL VAL K . n 
L  12 56  ALA 56  56  56  ALA ALA K . n 
L  12 57  ALA 57  57  57  ALA ALA K . n 
L  12 58  LEU 58  58  58  LEU LEU K . n 
L  12 59  MET 59  59  59  MET MET K . n 
L  12 60  VAL 60  60  60  VAL VAL K . n 
L  12 61  ILE 61  61  61  ILE ILE K . n 
L  12 62  ALA 62  62  62  ALA ALA K . n 
L  12 63  VAL 63  63  63  VAL VAL K . n 
L  12 64  ALA 64  64  64  ALA ALA K . n 
L  12 65  ALA 65  65  65  ALA ALA K . n 
L  12 66  ALA 66  66  66  ALA ALA K . n 
L  12 67  GLU 67  67  67  GLU GLU K . n 
L  12 68  VAL 68  68  68  VAL VAL K . n 
L  12 69  ALA 69  69  69  ALA ALA K . n 
L  12 70  VAL 70  70  70  VAL VAL K . n 
L  12 71  GLY 71  71  71  GLY GLY K . n 
L  12 72  LEU 72  72  72  LEU LEU K . n 
L  12 73  GLY 73  73  73  GLY GLY K . n 
L  12 74  LEU 74  74  74  LEU LEU K . n 
L  12 75  ILE 75  75  75  ILE ILE K . n 
L  12 76  VAL 76  76  76  VAL VAL K . n 
L  12 77  ALA 77  77  77  ALA ALA K . n 
L  12 78  ILE 78  78  78  ILE ILE K . n 
L  12 79  PHE 79  79  79  PHE PHE K . n 
L  12 80  ARG 80  80  80  ARG ARG K . n 
L  12 81  HIS 81  81  81  HIS HIS K . n 
L  12 82  ARG 82  82  82  ARG ARG K . n 
L  12 83  GLU 83  83  83  GLU GLU K . n 
L  12 84  SER 84  84  84  SER SER K . n 
L  12 85  THR 85  85  85  THR THR K . n 
L  12 86  ALA 86  86  86  ALA ALA K . n 
L  12 87  VAL 87  87  87  VAL VAL K . n 
L  12 88  ASP 88  88  88  ASP ASP K . n 
L  12 89  ASP 89  89  89  ASP ASP K . n 
L  12 90  LEU 90  90  90  LEU LEU K . n 
L  12 91  SER 91  91  91  SER SER K . n 
L  12 92  GLU 92  92  92  GLU GLU K . n 
L  12 93  LEU 93  93  93  LEU LEU K . n 
L  12 94  ARG 94  94  94  ARG ARG K . n 
L  12 95  GLY 95  95  95  GLY GLY K . n 
M  13 1   MET 1   1   1   MET MET L . n 
M  13 2   ALA 2   2   2   ALA ALA L . n 
M  13 3   LEU 3   3   3   LEU LEU L . n 
M  13 4   LEU 4   4   4   LEU LEU L . n 
M  13 5   GLY 5   5   5   GLY GLY L . n 
M  13 6   THR 6   6   6   THR THR L . n 
M  13 7   ILE 7   7   7   ILE ILE L . n 
M  13 8   LEU 8   8   8   LEU LEU L . n 
M  13 9   LEU 9   9   9   LEU LEU L . n 
M  13 10  PRO 10  10  10  PRO PRO L . n 
M  13 11  LEU 11  11  11  LEU LEU L . n 
M  13 12  LEU 12  12  12  LEU LEU L . n 
M  13 13  GLY 13  13  13  GLY GLY L . n 
M  13 14  PHE 14  14  14  PHE PHE L . n 
M  13 15  ALA 15  15  15  ALA ALA L . n 
M  13 16  LEU 16  16  16  LEU LEU L . n 
M  13 17  LEU 17  17  17  LEU LEU L . n 
M  13 18  GLY 18  18  18  GLY GLY L . n 
M  13 19  LEU 19  19  19  LEU LEU L . n 
M  13 20  PHE 20  20  20  PHE PHE L . n 
M  13 21  GLY 21  21  21  GLY GLY L . n 
M  13 22  LYS 22  22  22  LYS LYS L . n 
M  13 23  ARG 23  23  23  ARG ARG L . n 
M  13 24  MET 24  24  24  MET MET L . n 
M  13 25  ARG 25  25  25  ARG ARG L . n 
M  13 26  GLU 26  26  26  GLU GLU L . n 
M  13 27  PRO 27  27  27  PRO PRO L . n 
M  13 28  LEU 28  28  28  LEU LEU L . n 
M  13 29  PRO 29  29  29  PRO PRO L . n 
M  13 30  GLY 30  30  30  GLY GLY L . n 
M  13 31  VAL 31  31  31  VAL VAL L . n 
M  13 32  LEU 32  32  32  LEU LEU L . n 
M  13 33  ALA 33  33  33  ALA ALA L . n 
M  13 34  SER 34  34  34  SER SER L . n 
M  13 35  GLY 35  35  35  GLY GLY L . n 
M  13 36  LEU 36  36  36  LEU LEU L . n 
M  13 37  VAL 37  37  37  VAL VAL L . n 
M  13 38  LEU 38  38  38  LEU LEU L . n 
M  13 39  ALA 39  39  39  ALA ALA L . n 
M  13 40  SER 40  40  40  SER SER L . n 
M  13 41  PHE 41  41  41  PHE PHE L . n 
M  13 42  LEU 42  42  42  LEU LEU L . n 
M  13 43  LEU 43  43  43  LEU LEU L . n 
M  13 44  GLY 44  44  44  GLY GLY L . n 
M  13 45  ALA 45  45  45  ALA ALA L . n 
M  13 46  GLY 46  46  46  GLY GLY L . n 
M  13 47  LEU 47  47  47  LEU LEU L . n 
M  13 48  LEU 48  48  48  LEU LEU L . n 
M  13 49  LEU 49  49  49  LEU LEU L . n 
M  13 50  SER 50  50  50  SER SER L . n 
M  13 51  GLY 51  51  51  GLY GLY L . n 
M  13 52  GLY 52  52  52  GLY GLY L . n 
M  13 53  ALA 53  53  53  ALA ALA L . n 
M  13 54  ARG 54  54  54  ARG ARG L . n 
M  13 55  PHE 55  55  55  PHE PHE L . n 
M  13 56  GLN 56  56  56  GLN GLN L . n 
M  13 57  ALA 57  57  57  ALA ALA L . n 
M  13 58  GLU 58  58  58  GLU GLU L . n 
M  13 59  TRP 59  59  59  TRP TRP L . n 
M  13 60  LEU 60  60  60  LEU LEU L . n 
M  13 61  PRO 61  61  61  PRO PRO L . n 
M  13 62  GLY 62  62  62  GLY GLY L . n 
M  13 63  ILE 63  63  63  ILE ILE L . n 
M  13 64  PRO 64  64  64  PRO PRO L . n 
M  13 65  PHE 65  65  65  PHE PHE L . n 
M  13 66  SER 66  66  66  SER SER L . n 
M  13 67  LEU 67  67  67  LEU LEU L . n 
M  13 68  LEU 68  68  68  LEU LEU L . n 
M  13 69  LEU 69  69  69  LEU LEU L . n 
M  13 70  ASP 70  70  70  ASP ASP L . n 
M  13 71  ASN 71  71  71  ASN ASN L . n 
M  13 72  LEU 72  72  72  LEU LEU L . n 
M  13 73  SER 73  73  73  SER SER L . n 
M  13 74  GLY 74  74  74  GLY GLY L . n 
M  13 75  PHE 75  75  75  PHE PHE L . n 
M  13 76  MET 76  76  76  MET MET L . n 
M  13 77  LEU 77  77  77  LEU LEU L . n 
M  13 78  LEU 78  78  78  LEU LEU L . n 
M  13 79  ILE 79  79  79  ILE ILE L . n 
M  13 80  VAL 80  80  80  VAL VAL L . n 
M  13 81  THR 81  81  81  THR THR L . n 
M  13 82  GLY 82  82  82  GLY GLY L . n 
M  13 83  VAL 83  83  83  VAL VAL L . n 
M  13 84  GLY 84  84  84  GLY GLY L . n 
M  13 85  PHE 85  85  85  PHE PHE L . n 
M  13 86  LEU 86  86  86  LEU LEU L . n 
M  13 87  ILE 87  87  87  ILE ILE L . n 
M  13 88  HIS 88  88  88  HIS HIS L . n 
M  13 89  VAL 89  89  89  VAL VAL L . n 
M  13 90  TYR 90  90  90  TYR TYR L . n 
M  13 91  ALA 91  91  91  ALA ALA L . n 
M  13 92  ILE 92  92  92  ILE ILE L . n 
M  13 93  GLY 93  93  93  GLY GLY L . n 
M  13 94  TYR 94  94  94  TYR TYR L . n 
M  13 95  MET 95  95  95  MET MET L . n 
M  13 96  GLY 96  96  96  GLY GLY L . n 
M  13 97  GLY 97  97  97  GLY GLY L . n 
M  13 98  ASP 98  98  98  ASP ASP L . n 
M  13 99  PRO 99  99  99  PRO PRO L . n 
M  13 100 GLY 100 100 100 GLY GLY L . n 
M  13 101 TYR 101 101 101 TYR TYR L . n 
M  13 102 SER 102 102 102 SER SER L . n 
M  13 103 ARG 103 103 103 ARG ARG L . n 
M  13 104 PHE 104 104 104 PHE PHE L . n 
M  13 105 PHE 105 105 105 PHE PHE L . n 
M  13 106 ALA 106 106 106 ALA ALA L . n 
M  13 107 TYR 107 107 107 TYR TYR L . n 
M  13 108 PHE 108 108 108 PHE PHE L . n 
M  13 109 ASN 109 109 109 ASN ASN L . n 
M  13 110 LEU 110 110 110 LEU LEU L . n 
M  13 111 PHE 111 111 111 PHE PHE L . n 
M  13 112 ILE 112 112 112 ILE ILE L . n 
M  13 113 ALA 113 113 113 ALA ALA L . n 
M  13 114 MET 114 114 114 MET MET L . n 
M  13 115 MET 115 115 115 MET MET L . n 
M  13 116 LEU 116 116 116 LEU LEU L . n 
M  13 117 THR 117 117 117 THR THR L . n 
M  13 118 LEU 118 118 118 LEU LEU L . n 
M  13 119 VAL 119 119 119 VAL VAL L . n 
M  13 120 LEU 120 120 120 LEU LEU L . n 
M  13 121 ALA 121 121 121 ALA ALA L . n 
M  13 122 ASP 122 122 122 ASP ASP L . n 
M  13 123 SER 123 123 123 SER SER L . n 
M  13 124 TYR 124 124 124 TYR TYR L . n 
M  13 125 PRO 125 125 125 PRO PRO L . n 
M  13 126 VAL 126 126 126 VAL VAL L . n 
M  13 127 MET 127 127 127 MET MET L . n 
M  13 128 PHE 128 128 128 PHE PHE L . n 
M  13 129 ILE 129 129 129 ILE ILE L . n 
M  13 130 GLY 130 130 130 GLY GLY L . n 
M  13 131 TRP 131 131 131 TRP TRP L . n 
M  13 132 GLU 132 132 132 GLU GLU L . n 
M  13 133 GLY 133 133 133 GLY GLY L . n 
M  13 134 VAL 134 134 134 VAL VAL L . n 
M  13 135 GLY 135 135 135 GLY GLY L . n 
M  13 136 LEU 136 136 136 LEU LEU L . n 
M  13 137 ALA 137 137 137 ALA ALA L . n 
M  13 138 SER 138 138 138 SER SER L . n 
M  13 139 PHE 139 139 139 PHE PHE L . n 
M  13 140 LEU 140 140 140 LEU LEU L . n 
M  13 141 LEU 141 141 141 LEU LEU L . n 
M  13 142 ILE 142 142 142 ILE ILE L . n 
M  13 143 GLY 143 143 143 GLY GLY L . n 
M  13 144 PHE 144 144 144 PHE PHE L . n 
M  13 145 TRP 145 145 145 TRP TRP L . n 
M  13 146 TYR 146 146 146 TYR TYR L . n 
M  13 147 LYS 147 147 147 LYS LYS L . n 
M  13 148 ASN 148 148 148 ASN ASN L . n 
M  13 149 PRO 149 149 149 PRO PRO L . n 
M  13 150 GLN 150 150 150 GLN GLN L . n 
M  13 151 TYR 151 151 151 TYR TYR L . n 
M  13 152 ALA 152 152 152 ALA ALA L . n 
M  13 153 ASP 153 153 153 ASP ASP L . n 
M  13 154 SER 154 154 154 SER SER L . n 
M  13 155 ALA 155 155 155 ALA ALA L . n 
M  13 156 ARG 156 156 156 ARG ARG L . n 
M  13 157 LYS 157 157 157 LYS LYS L . n 
M  13 158 ALA 158 158 158 ALA ALA L . n 
M  13 159 PHE 159 159 159 PHE PHE L . n 
M  13 160 ILE 160 160 160 ILE ILE L . n 
M  13 161 VAL 161 161 161 VAL VAL L . n 
M  13 162 ASN 162 162 162 ASN ASN L . n 
M  13 163 ARG 163 163 163 ARG ARG L . n 
M  13 164 ILE 164 164 164 ILE ILE L . n 
M  13 165 GLY 165 165 165 GLY GLY L . n 
M  13 166 ASP 166 166 166 ASP ASP L . n 
M  13 167 LEU 167 167 167 LEU LEU L . n 
M  13 168 GLY 168 168 168 GLY GLY L . n 
M  13 169 PHE 169 169 169 PHE PHE L . n 
M  13 170 MET 170 170 170 MET MET L . n 
M  13 171 LEU 171 171 171 LEU LEU L . n 
M  13 172 GLY 172 172 172 GLY GLY L . n 
M  13 173 MET 173 173 173 MET MET L . n 
M  13 174 ALA 174 174 174 ALA ALA L . n 
M  13 175 ILE 175 175 175 ILE ILE L . n 
M  13 176 LEU 176 176 176 LEU LEU L . n 
M  13 177 TRP 177 177 177 TRP TRP L . n 
M  13 178 ALA 178 178 178 ALA ALA L . n 
M  13 179 LEU 179 179 179 LEU LEU L . n 
M  13 180 TYR 180 180 180 TYR TYR L . n 
M  13 181 GLY 181 181 181 GLY GLY L . n 
M  13 182 THR 182 182 182 THR THR L . n 
M  13 183 LEU 183 183 183 LEU LEU L . n 
M  13 184 SER 184 184 184 SER SER L . n 
M  13 185 ILE 185 185 185 ILE ILE L . n 
M  13 186 SER 186 186 186 SER SER L . n 
M  13 187 GLU 187 187 187 GLU GLU L . n 
M  13 188 LEU 188 188 188 LEU LEU L . n 
M  13 189 LYS 189 189 189 LYS LYS L . n 
M  13 190 GLU 190 190 190 GLU GLU L . n 
M  13 191 ALA 191 191 191 ALA ALA L . n 
M  13 192 MET 192 192 192 MET MET L . n 
M  13 193 GLU 193 193 193 GLU GLU L . n 
M  13 194 GLY 194 194 194 GLY GLY L . n 
M  13 195 PRO 195 195 195 PRO PRO L . n 
M  13 196 LEU 196 196 196 LEU LEU L . n 
M  13 197 LYS 197 197 197 LYS LYS L . n 
M  13 198 ASN 198 198 198 ASN ASN L . n 
M  13 199 PRO 199 199 199 PRO PRO L . n 
M  13 200 ASP 200 200 200 ASP ASP L . n 
M  13 201 LEU 201 201 201 LEU LEU L . n 
M  13 202 LEU 202 202 202 LEU LEU L . n 
M  13 203 ALA 203 203 203 ALA ALA L . n 
M  13 204 LEU 204 204 204 LEU LEU L . n 
M  13 205 ALA 205 205 205 ALA ALA L . n 
M  13 206 GLY 206 206 206 GLY GLY L . n 
M  13 207 LEU 207 207 207 LEU LEU L . n 
M  13 208 LEU 208 208 208 LEU LEU L . n 
M  13 209 LEU 209 209 209 LEU LEU L . n 
M  13 210 PHE 210 210 210 PHE PHE L . n 
M  13 211 LEU 211 211 211 LEU LEU L . n 
M  13 212 GLY 212 212 212 GLY GLY L . n 
M  13 213 ALA 213 213 213 ALA ALA L . n 
M  13 214 VAL 214 214 214 VAL VAL L . n 
M  13 215 GLY 215 215 215 GLY GLY L . n 
M  13 216 LYS 216 216 216 LYS LYS L . n 
M  13 217 SER 217 217 217 SER SER L . n 
M  13 218 ALA 218 218 218 ALA ALA L . n 
M  13 219 GLN 219 219 219 GLN GLN L . n 
M  13 220 ILE 220 220 220 ILE ILE L . n 
M  13 221 PRO 221 221 221 PRO PRO L . n 
M  13 222 LEU 222 222 222 LEU LEU L . n 
M  13 223 MET 223 223 223 MET MET L . n 
M  13 224 VAL 224 224 224 VAL VAL L . n 
M  13 225 TRP 225 225 225 TRP TRP L . n 
M  13 226 LEU 226 226 226 LEU LEU L . n 
M  13 227 PRO 227 227 227 PRO PRO L . n 
M  13 228 ASP 228 228 228 ASP ASP L . n 
M  13 229 ALA 229 229 229 ALA ALA L . n 
M  13 230 MET 230 230 230 MET MET L . n 
M  13 231 ALA 231 231 231 ALA ALA L . n 
M  13 232 GLY 232 232 232 GLY GLY L . n 
M  13 233 PRO 233 233 233 PRO PRO L . n 
M  13 234 THR 234 234 234 THR THR L . n 
M  13 235 PRO 235 235 235 PRO PRO L . n 
M  13 236 VAL 236 236 236 VAL VAL L . n 
M  13 237 SER 237 237 237 SER SER L . n 
M  13 238 ALA 238 238 238 ALA ALA L . n 
M  13 239 LEU 239 239 239 LEU LEU L . n 
M  13 240 ILE 240 240 240 ILE ILE L . n 
M  13 241 HIS 241 241 241 HIS HIS L . n 
M  13 242 ALA 242 242 242 ALA ALA L . n 
M  13 243 ALA 243 243 243 ALA ALA L . n 
M  13 244 THR 244 244 244 THR THR L . n 
M  13 245 MET 245 245 245 MET MET L . n 
M  13 246 VAL 246 246 246 VAL VAL L . n 
M  13 247 THR 247 247 247 THR THR L . n 
M  13 248 ALA 248 248 248 ALA ALA L . n 
M  13 249 GLY 249 249 249 GLY GLY L . n 
M  13 250 VAL 250 250 250 VAL VAL L . n 
M  13 251 TYR 251 251 251 TYR TYR L . n 
M  13 252 LEU 252 252 252 LEU LEU L . n 
M  13 253 ILE 253 253 253 ILE ILE L . n 
M  13 254 ALA 254 254 254 ALA ALA L . n 
M  13 255 ARG 255 255 255 ARG ARG L . n 
M  13 256 SER 256 256 256 SER SER L . n 
M  13 257 SER 257 257 257 SER SER L . n 
M  13 258 PHE 258 258 258 PHE PHE L . n 
M  13 259 LEU 259 259 259 LEU LEU L . n 
M  13 260 TYR 260 260 260 TYR TYR L . n 
M  13 261 SER 261 261 261 SER SER L . n 
M  13 262 VAL 262 262 262 VAL VAL L . n 
M  13 263 LEU 263 263 263 LEU LEU L . n 
M  13 264 PRO 264 264 264 PRO PRO L . n 
M  13 265 ASP 265 265 265 ASP ASP L . n 
M  13 266 VAL 266 266 266 VAL VAL L . n 
M  13 267 SER 267 267 267 SER SER L . n 
M  13 268 TYR 268 268 268 TYR TYR L . n 
M  13 269 ALA 269 269 269 ALA ALA L . n 
M  13 270 ILE 270 270 270 ILE ILE L . n 
M  13 271 ALA 271 271 271 ALA ALA L . n 
M  13 272 VAL 272 272 272 VAL VAL L . n 
M  13 273 VAL 273 273 273 VAL VAL L . n 
M  13 274 GLY 274 274 274 GLY GLY L . n 
M  13 275 LEU 275 275 275 LEU LEU L . n 
M  13 276 LEU 276 276 276 LEU LEU L . n 
M  13 277 THR 277 277 277 THR THR L . n 
M  13 278 ALA 278 278 278 ALA ALA L . n 
M  13 279 ALA 279 279 279 ALA ALA L . n 
M  13 280 TYR 280 280 280 TYR TYR L . n 
M  13 281 GLY 281 281 281 GLY GLY L . n 
M  13 282 ALA 282 282 282 ALA ALA L . n 
M  13 283 LEU 283 283 283 LEU LEU L . n 
M  13 284 SER 284 284 284 SER SER L . n 
M  13 285 ALA 285 285 285 ALA ALA L . n 
M  13 286 PHE 286 286 286 PHE PHE L . n 
M  13 287 GLY 287 287 287 GLY GLY L . n 
M  13 288 GLN 288 288 288 GLN GLN L . n 
M  13 289 THR 289 289 289 THR THR L . n 
M  13 290 ASP 290 290 290 ASP ASP L . n 
M  13 291 ILE 291 291 291 ILE ILE L . n 
M  13 292 LYS 292 292 292 LYS LYS L . n 
M  13 293 LYS 293 293 293 LYS LYS L . n 
M  13 294 ILE 294 294 294 ILE ILE L . n 
M  13 295 VAL 295 295 295 VAL VAL L . n 
M  13 296 ALA 296 296 296 ALA ALA L . n 
M  13 297 TYR 297 297 297 TYR TYR L . n 
M  13 298 SER 298 298 298 SER SER L . n 
M  13 299 THR 299 299 299 THR THR L . n 
M  13 300 ILE 300 300 300 ILE ILE L . n 
M  13 301 SER 301 301 301 SER SER L . n 
M  13 302 GLN 302 302 302 GLN GLN L . n 
M  13 303 LEU 303 303 303 LEU LEU L . n 
M  13 304 GLY 304 304 304 GLY GLY L . n 
M  13 305 TYR 305 305 305 TYR TYR L . n 
M  13 306 MET 306 306 306 MET MET L . n 
M  13 307 PHE 307 307 307 PHE PHE L . n 
M  13 308 LEU 308 308 308 LEU LEU L . n 
M  13 309 ALA 309 309 309 ALA ALA L . n 
M  13 310 ALA 310 310 310 ALA ALA L . n 
M  13 311 GLY 311 311 311 GLY GLY L . n 
M  13 312 VAL 312 312 312 VAL VAL L . n 
M  13 313 GLY 313 313 313 GLY GLY L . n 
M  13 314 ALA 314 314 314 ALA ALA L . n 
M  13 315 TYR 315 315 315 TYR TYR L . n 
M  13 316 TRP 316 316 316 TRP TRP L . n 
M  13 317 VAL 317 317 317 VAL VAL L . n 
M  13 318 ALA 318 318 318 ALA ALA L . n 
M  13 319 LEU 319 319 319 LEU LEU L . n 
M  13 320 PHE 320 320 320 PHE PHE L . n 
M  13 321 HIS 321 321 321 HIS HIS L . n 
M  13 322 VAL 322 322 322 VAL VAL L . n 
M  13 323 PHE 323 323 323 PHE PHE L . n 
M  13 324 THR 324 324 324 THR THR L . n 
M  13 325 HIS 325 325 325 HIS HIS L . n 
M  13 326 ALA 326 326 326 ALA ALA L . n 
M  13 327 PHE 327 327 327 PHE PHE L . n 
M  13 328 PHE 328 328 328 PHE PHE L . n 
M  13 329 LYS 329 329 329 LYS LYS L . n 
M  13 330 ALA 330 330 330 ALA ALA L . n 
M  13 331 LEU 331 331 331 LEU LEU L . n 
M  13 332 LEU 332 332 332 LEU LEU L . n 
M  13 333 PHE 333 333 333 PHE PHE L . n 
M  13 334 LEU 334 334 334 LEU LEU L . n 
M  13 335 ALA 335 335 335 ALA ALA L . n 
M  13 336 SER 336 336 336 SER SER L . n 
M  13 337 GLY 337 337 337 GLY GLY L . n 
M  13 338 SER 338 338 338 SER SER L . n 
M  13 339 VAL 339 339 339 VAL VAL L . n 
M  13 340 ILE 340 340 340 ILE ILE L . n 
M  13 341 HIS 341 341 341 HIS HIS L . n 
M  13 342 ALA 342 342 342 ALA ALA L . n 
M  13 343 LEU 343 343 343 LEU LEU L . n 
M  13 344 GLY 344 344 344 GLY GLY L . n 
M  13 345 GLY 345 345 345 GLY GLY L . n 
M  13 346 GLU 346 346 346 GLU GLU L . n 
M  13 347 GLN 347 347 347 GLN GLN L . n 
M  13 348 ASP 348 348 348 ASP ASP L . n 
M  13 349 VAL 349 349 349 VAL VAL L . n 
M  13 350 ARG 350 350 350 ARG ARG L . n 
M  13 351 LYS 351 351 351 LYS LYS L . n 
M  13 352 MET 352 352 352 MET MET L . n 
M  13 353 GLY 353 353 353 GLY GLY L . n 
M  13 354 GLY 354 354 354 GLY GLY L . n 
M  13 355 LEU 355 355 355 LEU LEU L . n 
M  13 356 TRP 356 356 356 TRP TRP L . n 
M  13 357 LYS 357 357 357 LYS LYS L . n 
M  13 358 HIS 358 358 358 HIS HIS L . n 
M  13 359 LEU 359 359 359 LEU LEU L . n 
M  13 360 PRO 360 360 360 PRO PRO L . n 
M  13 361 GLN 361 361 361 GLN GLN L . n 
M  13 362 THR 362 362 362 THR THR L . n 
M  13 363 ARG 363 363 363 ARG ARG L . n 
M  13 364 TRP 364 364 364 TRP TRP L . n 
M  13 365 HIS 365 365 365 HIS HIS L . n 
M  13 366 ALA 366 366 366 ALA ALA L . n 
M  13 367 LEU 367 367 367 LEU LEU L . n 
M  13 368 ILE 368 368 368 ILE ILE L . n 
M  13 369 GLY 369 369 369 GLY GLY L . n 
M  13 370 ALA 370 370 370 ALA ALA L . n 
M  13 371 LEU 371 371 371 LEU LEU L . n 
M  13 372 ALA 372 372 372 ALA ALA L . n 
M  13 373 LEU 373 373 373 LEU LEU L . n 
M  13 374 GLY 374 374 374 GLY GLY L . n 
M  13 375 GLY 375 375 375 GLY GLY L . n 
M  13 376 LEU 376 376 376 LEU LEU L . n 
M  13 377 PRO 377 377 377 PRO PRO L . n 
M  13 378 LEU 378 378 378 LEU LEU L . n 
M  13 379 LEU 379 379 379 LEU LEU L . n 
M  13 380 SER 380 380 380 SER SER L . n 
M  13 381 GLY 381 381 381 GLY GLY L . n 
M  13 382 PHE 382 382 382 PHE PHE L . n 
M  13 383 TRP 383 383 383 TRP TRP L . n 
M  13 384 SER 384 384 384 SER SER L . n 
M  13 385 LYS 385 385 385 LYS LYS L . n 
M  13 386 ASP 386 386 386 ASP ASP L . n 
M  13 387 ALA 387 387 387 ALA ALA L . n 
M  13 388 ILE 388 388 388 ILE ILE L . n 
M  13 389 LEU 389 389 389 LEU LEU L . n 
M  13 390 ALA 390 390 390 ALA ALA L . n 
M  13 391 ALA 391 391 391 ALA ALA L . n 
M  13 392 THR 392 392 392 THR THR L . n 
M  13 393 LEU 393 393 393 LEU LEU L . n 
M  13 394 THR 394 394 394 THR THR L . n 
M  13 395 TYR 395 395 395 TYR TYR L . n 
M  13 396 PRO 396 396 396 PRO PRO L . n 
M  13 397 PHE 397 397 397 PHE PHE L . n 
M  13 398 GLY 398 398 398 GLY GLY L . n 
M  13 399 GLY 399 399 399 GLY GLY L . n 
M  13 400 VAL 400 400 400 VAL VAL L . n 
M  13 401 GLY 401 401 401 GLY GLY L . n 
M  13 402 PHE 402 402 402 PHE PHE L . n 
M  13 403 TYR 403 403 403 TYR TYR L . n 
M  13 404 VAL 404 404 404 VAL VAL L . n 
M  13 405 GLY 405 405 405 GLY GLY L . n 
M  13 406 ALA 406 406 406 ALA ALA L . n 
M  13 407 LEU 407 407 407 LEU LEU L . n 
M  13 408 LEU 408 408 408 LEU LEU L . n 
M  13 409 VAL 409 409 409 VAL VAL L . n 
M  13 410 ALA 410 410 410 ALA ALA L . n 
M  13 411 VAL 411 411 411 VAL VAL L . n 
M  13 412 LEU 412 412 412 LEU LEU L . n 
M  13 413 THR 413 413 413 THR THR L . n 
M  13 414 ALA 414 414 414 ALA ALA L . n 
M  13 415 MET 415 415 415 MET MET L . n 
M  13 416 TYR 416 416 416 TYR TYR L . n 
M  13 417 ALA 417 417 417 ALA ALA L . n 
M  13 418 MET 418 418 418 MET MET L . n 
M  13 419 ARG 419 419 419 ARG ARG L . n 
M  13 420 TRP 420 420 420 TRP TRP L . n 
M  13 421 PHE 421 421 421 PHE PHE L . n 
M  13 422 VAL 422 422 422 VAL VAL L . n 
M  13 423 LEU 423 423 423 LEU LEU L . n 
M  13 424 VAL 424 424 424 VAL VAL L . n 
M  13 425 PHE 425 425 425 PHE PHE L . n 
M  13 426 LEU 426 426 426 LEU LEU L . n 
M  13 427 GLY 427 427 427 GLY GLY L . n 
M  13 428 GLU 428 428 428 GLU GLU L . n 
M  13 429 GLU 429 429 429 GLU GLU L . n 
M  13 430 ARG 430 430 430 ARG ARG L . n 
M  13 431 GLY 431 431 431 GLY GLY L . n 
M  13 432 HIS 432 432 432 HIS HIS L . n 
M  13 433 HIS 433 433 433 HIS HIS L . n 
M  13 434 HIS 434 434 434 HIS HIS L . n 
M  13 435 PRO 435 435 435 PRO PRO L . n 
M  13 436 HIS 436 436 436 HIS HIS L . n 
M  13 437 GLU 437 437 437 GLU GLU L . n 
M  13 438 ALA 438 438 438 ALA ALA L . n 
M  13 439 PRO 439 439 439 PRO PRO L . n 
M  13 440 PRO 440 440 440 PRO PRO L . n 
M  13 441 VAL 441 441 441 VAL VAL L . n 
M  13 442 MET 442 442 442 MET MET L . n 
M  13 443 LEU 443 443 443 LEU LEU L . n 
M  13 444 TRP 444 444 444 TRP TRP L . n 
M  13 445 PRO 445 445 445 PRO PRO L . n 
M  13 446 ASN 446 446 446 ASN ASN L . n 
M  13 447 HIS 447 447 447 HIS HIS L . n 
M  13 448 LEU 448 448 448 LEU LEU L . n 
M  13 449 LEU 449 449 449 LEU LEU L . n 
M  13 450 ALA 450 450 450 ALA ALA L . n 
M  13 451 LEU 451 451 451 LEU LEU L . n 
M  13 452 GLY 452 452 452 GLY GLY L . n 
M  13 453 SER 453 453 453 SER SER L . n 
M  13 454 VAL 454 454 454 VAL VAL L . n 
M  13 455 LEU 455 455 455 LEU LEU L . n 
M  13 456 ALA 456 456 456 ALA ALA L . n 
M  13 457 GLY 457 457 457 GLY GLY L . n 
M  13 458 TYR 458 458 458 TYR TYR L . n 
M  13 459 LEU 459 459 459 LEU LEU L . n 
M  13 460 ALA 460 460 460 ALA ALA L . n 
M  13 461 LEU 461 461 461 LEU LEU L . n 
M  13 462 PRO 462 462 462 PRO PRO L . n 
M  13 463 HIS 463 463 463 HIS HIS L . n 
M  13 464 PRO 464 464 464 PRO PRO L . n 
M  13 465 LEU 465 465 465 LEU LEU L . n 
M  13 466 PRO 466 466 466 PRO PRO L . n 
M  13 467 ASN 467 467 467 ASN ASN L . n 
M  13 468 VAL 468 468 468 VAL VAL L . n 
M  13 469 LEU 469 469 469 LEU LEU L . n 
M  13 470 GLU 470 470 470 GLU GLU L . n 
M  13 471 PRO 471 471 471 PRO PRO L . n 
M  13 472 PHE 472 472 472 PHE PHE L . n 
M  13 473 LEU 473 473 473 LEU LEU L . n 
M  13 474 LYS 474 474 474 LYS LYS L . n 
M  13 475 PRO 475 475 475 PRO PRO L . n 
M  13 476 ALA 476 476 476 ALA ALA L . n 
M  13 477 LEU 477 477 477 LEU LEU L . n 
M  13 478 ALA 478 478 478 ALA ALA L . n 
M  13 479 GLU 479 479 479 GLU GLU L . n 
M  13 480 VAL 480 480 480 VAL VAL L . n 
M  13 481 GLU 481 481 481 GLU GLU L . n 
M  13 482 ALA 482 482 482 ALA ALA L . n 
M  13 483 HIS 483 483 483 HIS HIS L . n 
M  13 484 HIS 484 484 484 HIS HIS L . n 
M  13 485 LEU 485 485 485 LEU LEU L . n 
M  13 486 SER 486 486 486 SER SER L . n 
M  13 487 LEU 487 487 487 LEU LEU L . n 
M  13 488 GLY 488 488 488 GLY GLY L . n 
M  13 489 ALA 489 489 489 ALA ALA L . n 
M  13 490 GLU 490 490 490 GLU GLU L . n 
M  13 491 TRP 491 491 491 TRP TRP L . n 
M  13 492 GLY 492 492 492 GLY GLY L . n 
M  13 493 LEU 493 493 493 LEU LEU L . n 
M  13 494 ILE 494 494 494 ILE ILE L . n 
M  13 495 ALA 495 495 495 ALA ALA L . n 
M  13 496 LEU 496 496 496 LEU LEU L . n 
M  13 497 SER 497 497 497 SER SER L . n 
M  13 498 ALA 498 498 498 ALA ALA L . n 
M  13 499 ALA 499 499 499 ALA ALA L . n 
M  13 500 VAL 500 500 500 VAL VAL L . n 
M  13 501 ALA 501 501 501 ALA ALA L . n 
M  13 502 LEU 502 502 502 LEU LEU L . n 
M  13 503 LEU 503 503 503 LEU LEU L . n 
M  13 504 GLY 504 504 504 GLY GLY L . n 
M  13 505 LEU 505 505 505 LEU LEU L . n 
M  13 506 TRP 506 506 506 TRP TRP L . n 
M  13 507 ALA 507 507 507 ALA ALA L . n 
M  13 508 GLY 508 508 508 GLY GLY L . n 
M  13 509 PHE 509 509 509 PHE PHE L . n 
M  13 510 VAL 510 510 510 VAL VAL L . n 
M  13 511 PHE 511 511 511 PHE PHE L . n 
M  13 512 PHE 512 512 512 PHE PHE L . n 
M  13 513 GLN 513 513 513 GLN GLN L . n 
M  13 514 ARG 514 514 514 ARG ARG L . n 
M  13 515 LYS 515 515 515 LYS LYS L . n 
M  13 516 VAL 516 516 516 VAL VAL L . n 
M  13 517 PHE 517 517 517 PHE PHE L . n 
M  13 518 PRO 518 518 518 PRO PRO L . n 
M  13 519 ALA 519 519 519 ALA ALA L . n 
M  13 520 TRP 520 520 520 TRP TRP L . n 
M  13 521 TYR 521 521 521 TYR TYR L . n 
M  13 522 LEU 522 522 522 LEU LEU L . n 
M  13 523 ALA 523 523 523 ALA ALA L . n 
M  13 524 PHE 524 524 524 PHE PHE L . n 
M  13 525 GLU 525 525 525 GLU GLU L . n 
M  13 526 ALA 526 526 526 ALA ALA L . n 
M  13 527 ALA 527 527 527 ALA ALA L . n 
M  13 528 SER 528 528 528 SER SER L . n 
M  13 529 ARG 529 529 529 ARG ARG L . n 
M  13 530 GLU 530 530 530 GLU GLU L . n 
M  13 531 ALA 531 531 531 ALA ALA L . n 
M  13 532 PHE 532 532 532 PHE PHE L . n 
M  13 533 TYR 533 533 533 TYR TYR L . n 
M  13 534 VAL 534 534 534 VAL VAL L . n 
M  13 535 ASP 535 535 535 ASP ASP L . n 
M  13 536 ARG 536 536 536 ARG ARG L . n 
M  13 537 ALA 537 537 537 ALA ALA L . n 
M  13 538 TYR 538 538 538 TYR TYR L . n 
M  13 539 ASN 539 539 539 ASN ASN L . n 
M  13 540 ALA 540 540 540 ALA ALA L . n 
M  13 541 LEU 541 541 541 LEU LEU L . n 
M  13 542 ILE 542 542 542 ILE ILE L . n 
M  13 543 VAL 543 543 543 VAL VAL L . n 
M  13 544 ASN 544 544 544 ASN ASN L . n 
M  13 545 PRO 545 545 545 PRO PRO L . n 
M  13 546 LEU 546 546 546 LEU LEU L . n 
M  13 547 LYS 547 547 547 LYS LYS L . n 
M  13 548 ALA 548 548 548 ALA ALA L . n 
M  13 549 LEU 549 549 549 LEU LEU L . n 
M  13 550 ALA 550 550 550 ALA ALA L . n 
M  13 551 GLU 551 551 551 GLU GLU L . n 
M  13 552 ALA 552 552 552 ALA ALA L . n 
M  13 553 LEU 553 553 553 LEU LEU L . n 
M  13 554 PHE 554 554 554 PHE PHE L . n 
M  13 555 TYR 555 555 555 TYR TYR L . n 
M  13 556 GLY 556 556 556 GLY GLY L . n 
M  13 557 ASP 557 557 557 ASP ASP L . n 
M  13 558 ARG 558 558 558 ARG ARG L . n 
M  13 559 GLY 559 559 559 GLY GLY L . n 
M  13 560 LEU 560 560 560 LEU LEU L . n 
M  13 561 LEU 561 561 561 LEU LEU L . n 
M  13 562 SER 562 562 562 SER SER L . n 
M  13 563 GLY 563 563 563 GLY GLY L . n 
M  13 564 TYR 564 564 564 TYR TYR L . n 
M  13 565 PHE 565 565 565 PHE PHE L . n 
M  13 566 GLY 566 566 566 GLY GLY L . n 
M  13 567 LEU 567 567 567 LEU LEU L . n 
M  13 568 GLY 568 568 568 GLY GLY L . n 
M  13 569 GLY 569 569 569 GLY GLY L . n 
M  13 570 ALA 570 570 570 ALA ALA L . n 
M  13 571 ALA 571 571 571 ALA ALA L . n 
M  13 572 ARG 572 572 572 ARG ARG L . n 
M  13 573 SER 573 573 573 SER SER L . n 
M  13 574 LEU 574 574 574 LEU LEU L . n 
M  13 575 GLY 575 575 575 GLY GLY L . n 
M  13 576 GLN 576 576 576 GLN GLN L . n 
M  13 577 GLY 577 577 577 GLY GLY L . n 
M  13 578 LEU 578 578 578 LEU LEU L . n 
M  13 579 ALA 579 579 579 ALA ALA L . n 
M  13 580 ARG 580 580 580 ARG ARG L . n 
M  13 581 LEU 581 581 581 LEU LEU L . n 
M  13 582 GLN 582 582 582 GLN GLN L . n 
M  13 583 THR 583 583 583 THR THR L . n 
M  13 584 GLY 584 584 584 GLY GLY L . n 
M  13 585 TYR 585 585 585 TYR TYR L . n 
M  13 586 LEU 586 586 586 LEU LEU L . n 
M  13 587 ARG 587 587 587 ARG ARG L . n 
M  13 588 VAL 588 588 588 VAL VAL L . n 
M  13 589 TYR 589 589 589 TYR TYR L . n 
M  13 590 ALA 590 590 590 ALA ALA L . n 
M  13 591 LEU 591 591 591 LEU LEU L . n 
M  13 592 LEU 592 592 592 LEU LEU L . n 
M  13 593 PHE 593 593 593 PHE PHE L . n 
M  13 594 VAL 594 594 594 VAL VAL L . n 
M  13 595 LEU 595 595 595 LEU LEU L . n 
M  13 596 GLY 596 596 596 GLY GLY L . n 
M  13 597 ALA 597 597 597 ALA ALA L . n 
M  13 598 LEU 598 598 598 LEU LEU L . n 
M  13 599 LEU 599 599 599 LEU LEU L . n 
M  13 600 LEU 600 600 600 LEU LEU L . n 
M  13 601 LEU 601 601 601 LEU LEU L . n 
M  13 602 GLY 602 602 602 GLY GLY L . n 
M  13 603 VAL 603 603 603 VAL VAL L . n 
M  13 604 MET 604 604 604 MET MET L . n 
M  13 605 ARG 605 605 605 ARG ARG L . n 
M  13 606 TRP 606 606 ?   ?   ?   L . n 
N  14 1   MET 1   1   1   MET MET M . n 
N  14 2   VAL 2   2   2   VAL VAL M . n 
N  14 3   VAL 3   3   3   VAL VAL M . n 
N  14 4   LEU 4   4   4   LEU LEU M . n 
N  14 5   ALA 5   5   5   ALA ALA M . n 
N  14 6   VAL 6   6   6   VAL VAL M . n 
N  14 7   LEU 7   7   7   LEU LEU M . n 
N  14 8   LEU 8   8   8   LEU LEU M . n 
N  14 9   PRO 9   9   9   PRO PRO M . n 
N  14 10  VAL 10  10  10  VAL VAL M . n 
N  14 11  VAL 11  11  11  VAL VAL M . n 
N  14 12  PHE 12  12  12  PHE PHE M . n 
N  14 13  GLY 13  13  13  GLY GLY M . n 
N  14 14  ALA 14  14  14  ALA ALA M . n 
N  14 15  LEU 15  15  15  LEU LEU M . n 
N  14 16  LEU 16  16  16  LEU LEU M . n 
N  14 17  LEU 17  17  17  LEU LEU M . n 
N  14 18  LEU 18  18  18  LEU LEU M . n 
N  14 19  GLY 19  19  19  GLY GLY M . n 
N  14 20  LEU 20  20  20  LEU LEU M . n 
N  14 21  PRO 21  21  21  PRO PRO M . n 
N  14 22  ARG 22  22  22  ARG ARG M . n 
N  14 23  ALA 23  23  23  ALA ALA M . n 
N  14 24  LEU 24  24  24  LEU LEU M . n 
N  14 25  GLY 25  25  25  GLY GLY M . n 
N  14 26  VAL 26  26  26  VAL VAL M . n 
N  14 27  LEU 27  27  27  LEU LEU M . n 
N  14 28  GLY 28  28  28  GLY GLY M . n 
N  14 29  ALA 29  29  29  ALA ALA M . n 
N  14 30  GLY 30  30  30  GLY GLY M . n 
N  14 31  LEU 31  31  31  LEU LEU M . n 
N  14 32  SER 32  32  32  SER SER M . n 
N  14 33  PHE 33  33  33  PHE PHE M . n 
N  14 34  LEU 34  34  34  LEU LEU M . n 
N  14 35  LEU 35  35  35  LEU LEU M . n 
N  14 36  ASN 36  36  36  ASN ASN M . n 
N  14 37  LEU 37  37  37  LEU LEU M . n 
N  14 38  TYR 38  38  38  TYR TYR M . n 
N  14 39  LEU 39  39  39  LEU LEU M . n 
N  14 40  PHE 40  40  40  PHE PHE M . n 
N  14 41  LEU 41  41  41  LEU LEU M . n 
N  14 42  THR 42  42  42  THR THR M . n 
N  14 43  HIS 43  43  43  HIS HIS M . n 
N  14 44  PRO 44  44  44  PRO PRO M . n 
N  14 45  GLY 45  45  45  GLY GLY M . n 
N  14 46  GLY 46  46  46  GLY GLY M . n 
N  14 47  VAL 47  47  47  VAL VAL M . n 
N  14 48  ALA 48  48  48  ALA ALA M . n 
N  14 49  HIS 49  49  49  HIS HIS M . n 
N  14 50  ALA 50  50  50  ALA ALA M . n 
N  14 51  PHE 51  51  51  PHE PHE M . n 
N  14 52  GLN 52  52  52  GLN GLN M . n 
N  14 53  ALA 53  53  53  ALA ALA M . n 
N  14 54  PRO 54  54  54  PRO PRO M . n 
N  14 55  LEU 55  55  55  LEU LEU M . n 
N  14 56  LEU 56  56  56  LEU LEU M . n 
N  14 57  PRO 57  57  57  PRO PRO M . n 
N  14 58  GLY 58  58  58  GLY GLY M . n 
N  14 59  ALA 59  59  59  ALA ALA M . n 
N  14 60  GLY 60  60  60  GLY GLY M . n 
N  14 61  VAL 61  61  61  VAL VAL M . n 
N  14 62  TYR 62  62  62  TYR TYR M . n 
N  14 63  TRP 63  63  63  TRP TRP M . n 
N  14 64  ALA 64  64  64  ALA ALA M . n 
N  14 65  PHE 65  65  65  PHE PHE M . n 
N  14 66  GLY 66  66  66  GLY GLY M . n 
N  14 67  LEU 67  67  67  LEU LEU M . n 
N  14 68  ASP 68  68  68  ASP ASP M . n 
N  14 69  GLY 69  69  69  GLY GLY M . n 
N  14 70  LEU 70  70  70  LEU LEU M . n 
N  14 71  SER 71  71  71  SER SER M . n 
N  14 72  ALA 72  72  72  ALA ALA M . n 
N  14 73  LEU 73  73  73  LEU LEU M . n 
N  14 74  PHE 74  74  74  PHE PHE M . n 
N  14 75  PHE 75  75  75  PHE PHE M . n 
N  14 76  LEU 76  76  76  LEU LEU M . n 
N  14 77  THR 77  77  77  THR THR M . n 
N  14 78  ILE 78  78  78  ILE ILE M . n 
N  14 79  ALA 79  79  79  ALA ALA M . n 
N  14 80  LEU 80  80  80  LEU LEU M . n 
N  14 81  THR 81  81  81  THR THR M . n 
N  14 82  VAL 82  82  82  VAL VAL M . n 
N  14 83  PHE 83  83  83  PHE PHE M . n 
N  14 84  LEU 84  84  84  LEU LEU M . n 
N  14 85  GLY 85  85  85  GLY GLY M . n 
N  14 86  ALA 86  86  86  ALA ALA M . n 
N  14 87  LEU 87  87  87  LEU LEU M . n 
N  14 88  VAL 88  88  88  VAL VAL M . n 
N  14 89  ALA 89  89  89  ALA ALA M . n 
N  14 90  ARG 90  90  90  ARG ARG M . n 
N  14 91  VAL 91  91  91  VAL VAL M . n 
N  14 92  GLU 92  92  92  GLU GLU M . n 
N  14 93  GLY 93  93  93  GLY GLY M . n 
N  14 94  ARG 94  94  94  ARG ARG M . n 
N  14 95  PHE 95  95  95  PHE PHE M . n 
N  14 96  LEU 96  96  96  LEU LEU M . n 
N  14 97  GLY 97  97  97  GLY GLY M . n 
N  14 98  LEU 98  98  98  LEU LEU M . n 
N  14 99  ALA 99  99  99  ALA ALA M . n 
N  14 100 LEU 100 100 100 LEU LEU M . n 
N  14 101 LEU 101 101 101 LEU LEU M . n 
N  14 102 MET 102 102 102 MET MET M . n 
N  14 103 GLU 103 103 103 GLU GLU M . n 
N  14 104 GLY 104 104 104 GLY GLY M . n 
N  14 105 LEU 105 105 105 LEU LEU M . n 
N  14 106 LEU 106 106 106 LEU LEU M . n 
N  14 107 LEU 107 107 107 LEU LEU M . n 
N  14 108 GLY 108 108 108 GLY GLY M . n 
N  14 109 LEU 109 109 109 LEU LEU M . n 
N  14 110 PHE 110 110 110 PHE PHE M . n 
N  14 111 ALA 111 111 111 ALA ALA M . n 
N  14 112 ALA 112 112 112 ALA ALA M . n 
N  14 113 ARG 113 113 113 ARG ARG M . n 
N  14 114 ASP 114 114 114 ASP ASP M . n 
N  14 115 LEU 115 115 115 LEU LEU M . n 
N  14 116 LEU 116 116 116 LEU LEU M . n 
N  14 117 VAL 117 117 117 VAL VAL M . n 
N  14 118 PHE 118 118 118 PHE PHE M . n 
N  14 119 TYR 119 119 119 TYR TYR M . n 
N  14 120 VAL 120 120 120 VAL VAL M . n 
N  14 121 PHE 121 121 121 PHE PHE M . n 
N  14 122 PHE 122 122 122 PHE PHE M . n 
N  14 123 GLU 123 123 123 GLU GLU M . n 
N  14 124 ALA 124 124 124 ALA ALA M . n 
N  14 125 ALA 125 125 125 ALA ALA M . n 
N  14 126 LEU 126 126 126 LEU LEU M . n 
N  14 127 ILE 127 127 127 ILE ILE M . n 
N  14 128 PRO 128 128 128 PRO PRO M . n 
N  14 129 ALA 129 129 129 ALA ALA M . n 
N  14 130 LEU 130 130 130 LEU LEU M . n 
N  14 131 LEU 131 131 131 LEU LEU M . n 
N  14 132 MET 132 132 132 MET MET M . n 
N  14 133 LEU 133 133 133 LEU LEU M . n 
N  14 134 TYR 134 134 134 TYR TYR M . n 
N  14 135 LEU 135 135 135 LEU LEU M . n 
N  14 136 TYR 136 136 136 TYR TYR M . n 
N  14 137 GLY 137 137 137 GLY GLY M . n 
N  14 138 GLY 138 138 138 GLY GLY M . n 
N  14 139 GLU 139 139 139 GLU GLU M . n 
N  14 140 GLY 140 140 140 GLY GLY M . n 
N  14 141 ARG 141 141 141 ARG ARG M . n 
N  14 142 THR 142 142 142 THR THR M . n 
N  14 143 ARG 143 143 143 ARG ARG M . n 
N  14 144 ALA 144 144 144 ALA ALA M . n 
N  14 145 LEU 145 145 145 LEU LEU M . n 
N  14 146 TYR 146 146 146 TYR TYR M . n 
N  14 147 THR 147 147 147 THR THR M . n 
N  14 148 PHE 148 148 148 PHE PHE M . n 
N  14 149 VAL 149 149 149 VAL VAL M . n 
N  14 150 LEU 150 150 150 LEU LEU M . n 
N  14 151 PHE 151 151 151 PHE PHE M . n 
N  14 152 THR 152 152 152 THR THR M . n 
N  14 153 LEU 153 153 153 LEU LEU M . n 
N  14 154 VAL 154 154 154 VAL VAL M . n 
N  14 155 GLY 155 155 155 GLY GLY M . n 
N  14 156 SER 156 156 156 SER SER M . n 
N  14 157 LEU 157 157 157 LEU LEU M . n 
N  14 158 PRO 158 158 158 PRO PRO M . n 
N  14 159 MET 159 159 159 MET MET M . n 
N  14 160 LEU 160 160 160 LEU LEU M . n 
N  14 161 ALA 161 161 161 ALA ALA M . n 
N  14 162 ALA 162 162 162 ALA ALA M . n 
N  14 163 VAL 163 163 163 VAL VAL M . n 
N  14 164 LEU 164 164 164 LEU LEU M . n 
N  14 165 GLY 165 165 165 GLY GLY M . n 
N  14 166 ALA 166 166 166 ALA ALA M . n 
N  14 167 ARG 167 167 167 ARG ARG M . n 
N  14 168 LEU 168 168 168 LEU LEU M . n 
N  14 169 LEU 169 169 169 LEU LEU M . n 
N  14 170 SER 170 170 170 SER SER M . n 
N  14 171 GLY 171 171 171 GLY GLY M . n 
N  14 172 SER 172 172 172 SER SER M . n 
N  14 173 PRO 173 173 173 PRO PRO M . n 
N  14 174 THR 174 174 174 THR THR M . n 
N  14 175 PHE 175 175 175 PHE PHE M . n 
N  14 176 LEU 176 176 176 LEU LEU M . n 
N  14 177 LEU 177 177 177 LEU LEU M . n 
N  14 178 GLU 178 178 178 GLU GLU M . n 
N  14 179 ASP 179 179 179 ASP ASP M . n 
N  14 180 LEU 180 180 180 LEU LEU M . n 
N  14 181 LEU 181 181 181 LEU LEU M . n 
N  14 182 ALA 182 182 182 ALA ALA M . n 
N  14 183 HIS 183 183 183 HIS HIS M . n 
N  14 184 PRO 184 184 184 PRO PRO M . n 
N  14 185 LEU 185 185 185 LEU LEU M . n 
N  14 186 GLN 186 186 186 GLN GLN M . n 
N  14 187 GLU 187 187 187 GLU GLU M . n 
N  14 188 GLU 188 188 188 GLU GLU M . n 
N  14 189 ALA 189 189 189 ALA ALA M . n 
N  14 190 ALA 190 190 190 ALA ALA M . n 
N  14 191 PHE 191 191 191 PHE PHE M . n 
N  14 192 TRP 192 192 192 TRP TRP M . n 
N  14 193 VAL 193 193 193 VAL VAL M . n 
N  14 194 PHE 194 194 194 PHE PHE M . n 
N  14 195 LEU 195 195 195 LEU LEU M . n 
N  14 196 GLY 196 196 196 GLY GLY M . n 
N  14 197 PHE 197 197 197 PHE PHE M . n 
N  14 198 ALA 198 198 198 ALA ALA M . n 
N  14 199 LEU 199 199 199 LEU LEU M . n 
N  14 200 ALA 200 200 200 ALA ALA M . n 
N  14 201 PHE 201 201 201 PHE PHE M . n 
N  14 202 ALA 202 202 202 ALA ALA M . n 
N  14 203 ILE 203 203 203 ILE ILE M . n 
N  14 204 LYS 204 204 204 LYS LYS M . n 
N  14 205 THR 205 205 205 THR THR M . n 
N  14 206 PRO 206 206 206 PRO PRO M . n 
N  14 207 LEU 207 207 207 LEU LEU M . n 
N  14 208 PHE 208 208 208 PHE PHE M . n 
N  14 209 PRO 209 209 209 PRO PRO M . n 
N  14 210 LEU 210 210 210 LEU LEU M . n 
N  14 211 HIS 211 211 211 HIS HIS M . n 
N  14 212 ALA 212 212 212 ALA ALA M . n 
N  14 213 TRP 213 213 213 TRP TRP M . n 
N  14 214 LEU 214 214 214 LEU LEU M . n 
N  14 215 PRO 215 215 215 PRO PRO M . n 
N  14 216 PRO 216 216 216 PRO PRO M . n 
N  14 217 PHE 217 217 217 PHE PHE M . n 
N  14 218 HIS 218 218 218 HIS HIS M . n 
N  14 219 GLN 219 219 219 GLN GLN M . n 
N  14 220 GLU 220 220 220 GLU GLU M . n 
N  14 221 ASN 221 221 221 ASN ASN M . n 
N  14 222 HIS 222 222 222 HIS HIS M . n 
N  14 223 PRO 223 223 223 PRO PRO M . n 
N  14 224 SER 224 224 224 SER SER M . n 
N  14 225 GLY 225 225 225 GLY GLY M . n 
N  14 226 LEU 226 226 226 LEU LEU M . n 
N  14 227 ALA 227 227 227 ALA ALA M . n 
N  14 228 ASP 228 228 228 ASP ASP M . n 
N  14 229 ALA 229 229 229 ALA ALA M . n 
N  14 230 LEU 230 230 230 LEU LEU M . n 
N  14 231 GLY 231 231 231 GLY GLY M . n 
N  14 232 THR 232 232 232 THR THR M . n 
N  14 233 LEU 233 233 233 LEU LEU M . n 
N  14 234 TYR 234 234 234 TYR TYR M . n 
N  14 235 LYS 235 235 235 LYS LYS M . n 
N  14 236 VAL 236 236 236 VAL VAL M . n 
N  14 237 GLY 237 237 237 GLY GLY M . n 
N  14 238 VAL 238 238 238 VAL VAL M . n 
N  14 239 PHE 239 239 239 PHE PHE M . n 
N  14 240 ALA 240 240 240 ALA ALA M . n 
N  14 241 PHE 241 241 241 PHE PHE M . n 
N  14 242 PHE 242 242 242 PHE PHE M . n 
N  14 243 ARG 243 243 243 ARG ARG M . n 
N  14 244 PHE 244 244 244 PHE PHE M . n 
N  14 245 ALA 245 245 245 ALA ALA M . n 
N  14 246 ILE 246 246 246 ILE ILE M . n 
N  14 247 PRO 247 247 247 PRO PRO M . n 
N  14 248 LEU 248 248 248 LEU LEU M . n 
N  14 249 ALA 249 249 249 ALA ALA M . n 
N  14 250 PRO 250 250 250 PRO PRO M . n 
N  14 251 GLU 251 251 251 GLU GLU M . n 
N  14 252 GLY 252 252 252 GLY GLY M . n 
N  14 253 PHE 253 253 253 PHE PHE M . n 
N  14 254 ALA 254 254 254 ALA ALA M . n 
N  14 255 GLN 255 255 255 GLN GLN M . n 
N  14 256 ALA 256 256 256 ALA ALA M . n 
N  14 257 GLN 257 257 257 GLN GLN M . n 
N  14 258 GLY 258 258 258 GLY GLY M . n 
N  14 259 LEU 259 259 259 LEU LEU M . n 
N  14 260 LEU 260 260 260 LEU LEU M . n 
N  14 261 LEU 261 261 261 LEU LEU M . n 
N  14 262 PHE 262 262 262 PHE PHE M . n 
N  14 263 LEU 263 263 263 LEU LEU M . n 
N  14 264 ALA 264 264 264 ALA ALA M . n 
N  14 265 ALA 265 265 265 ALA ALA M . n 
N  14 266 LEU 266 266 266 LEU LEU M . n 
N  14 267 SER 267 267 267 SER SER M . n 
N  14 268 ALA 268 268 268 ALA ALA M . n 
N  14 269 LEU 269 269 269 LEU LEU M . n 
N  14 270 TYR 270 270 270 TYR TYR M . n 
N  14 271 GLY 271 271 271 GLY GLY M . n 
N  14 272 ALA 272 272 272 ALA ALA M . n 
N  14 273 TRP 273 273 273 TRP TRP M . n 
N  14 274 VAL 274 274 274 VAL VAL M . n 
N  14 275 ALA 275 275 275 ALA ALA M . n 
N  14 276 PHE 276 276 276 PHE PHE M . n 
N  14 277 ALA 277 277 277 ALA ALA M . n 
N  14 278 ALA 278 278 278 ALA ALA M . n 
N  14 279 LYS 279 279 279 LYS LYS M . n 
N  14 280 ASP 280 280 280 ASP ASP M . n 
N  14 281 PHE 281 281 281 PHE PHE M . n 
N  14 282 LYS 282 282 282 LYS LYS M . n 
N  14 283 THR 283 283 283 THR THR M . n 
N  14 284 LEU 284 284 284 LEU LEU M . n 
N  14 285 LEU 285 285 285 LEU LEU M . n 
N  14 286 ALA 286 286 286 ALA ALA M . n 
N  14 287 TYR 287 287 287 TYR TYR M . n 
N  14 288 ALA 288 288 288 ALA ALA M . n 
N  14 289 GLY 289 289 289 GLY GLY M . n 
N  14 290 LEU 290 290 290 LEU LEU M . n 
N  14 291 SER 291 291 291 SER SER M . n 
N  14 292 HIS 292 292 292 HIS HIS M . n 
N  14 293 MET 293 293 293 MET MET M . n 
N  14 294 GLY 294 294 294 GLY GLY M . n 
N  14 295 VAL 295 295 295 VAL VAL M . n 
N  14 296 ALA 296 296 296 ALA ALA M . n 
N  14 297 ALA 297 297 297 ALA ALA M . n 
N  14 298 LEU 298 298 298 LEU LEU M . n 
N  14 299 GLY 299 299 299 GLY GLY M . n 
N  14 300 VAL 300 300 300 VAL VAL M . n 
N  14 301 PHE 301 301 301 PHE PHE M . n 
N  14 302 SER 302 302 302 SER SER M . n 
N  14 303 GLY 303 303 303 GLY GLY M . n 
N  14 304 THR 304 304 304 THR THR M . n 
N  14 305 PRO 305 305 305 PRO PRO M . n 
N  14 306 GLU 306 306 306 GLU GLU M . n 
N  14 307 GLY 307 307 307 GLY GLY M . n 
N  14 308 ALA 308 308 308 ALA ALA M . n 
N  14 309 MET 309 309 309 MET MET M . n 
N  14 310 GLY 310 310 310 GLY GLY M . n 
N  14 311 GLY 311 311 311 GLY GLY M . n 
N  14 312 LEU 312 312 312 LEU LEU M . n 
N  14 313 TYR 313 313 313 TYR TYR M . n 
N  14 314 LEU 314 314 314 LEU LEU M . n 
N  14 315 LEU 315 315 315 LEU LEU M . n 
N  14 316 ALA 316 316 316 ALA ALA M . n 
N  14 317 ALA 317 317 317 ALA ALA M . n 
N  14 318 SER 318 318 318 SER SER M . n 
N  14 319 GLY 319 319 319 GLY GLY M . n 
N  14 320 VAL 320 320 320 VAL VAL M . n 
N  14 321 TYR 321 321 321 TYR TYR M . n 
N  14 322 THR 322 322 322 THR THR M . n 
N  14 323 GLY 323 323 323 GLY GLY M . n 
N  14 324 GLY 324 324 324 GLY GLY M . n 
N  14 325 LEU 325 325 325 LEU LEU M . n 
N  14 326 PHE 326 326 326 PHE PHE M . n 
N  14 327 LEU 327 327 327 LEU LEU M . n 
N  14 328 LEU 328 328 328 LEU LEU M . n 
N  14 329 ALA 329 329 329 ALA ALA M . n 
N  14 330 GLY 330 330 330 GLY GLY M . n 
N  14 331 ARG 331 331 331 ARG ARG M . n 
N  14 332 LEU 332 332 332 LEU LEU M . n 
N  14 333 TYR 333 333 333 TYR TYR M . n 
N  14 334 GLU 334 334 334 GLU GLU M . n 
N  14 335 ARG 335 335 335 ARG ARG M . n 
N  14 336 THR 336 336 336 THR THR M . n 
N  14 337 GLY 337 337 337 GLY GLY M . n 
N  14 338 THR 338 338 338 THR THR M . n 
N  14 339 LEU 339 339 339 LEU LEU M . n 
N  14 340 GLU 340 340 340 GLU GLU M . n 
N  14 341 ILE 341 341 341 ILE ILE M . n 
N  14 342 GLY 342 342 342 GLY GLY M . n 
N  14 343 ARG 343 343 343 ARG ARG M . n 
N  14 344 TYR 344 344 344 TYR TYR M . n 
N  14 345 ARG 345 345 345 ARG ARG M . n 
N  14 346 GLY 346 346 346 GLY GLY M . n 
N  14 347 LEU 347 347 347 LEU LEU M . n 
N  14 348 ALA 348 348 348 ALA ALA M . n 
N  14 349 GLN 349 349 349 GLN GLN M . n 
N  14 350 SER 350 350 350 SER SER M . n 
N  14 351 ALA 351 351 351 ALA ALA M . n 
N  14 352 PRO 352 352 352 PRO PRO M . n 
N  14 353 GLY 353 353 353 GLY GLY M . n 
N  14 354 LEU 354 354 354 LEU LEU M . n 
N  14 355 ALA 355 355 355 ALA ALA M . n 
N  14 356 ALA 356 356 356 ALA ALA M . n 
N  14 357 LEU 357 357 357 LEU LEU M . n 
N  14 358 ALA 358 358 358 ALA ALA M . n 
N  14 359 LEU 359 359 359 LEU LEU M . n 
N  14 360 ILE 360 360 360 ILE ILE M . n 
N  14 361 LEU 361 361 361 LEU LEU M . n 
N  14 362 PHE 362 362 362 PHE PHE M . n 
N  14 363 LEU 363 363 363 LEU LEU M . n 
N  14 364 ALA 364 364 364 ALA ALA M . n 
N  14 365 MET 365 365 365 MET MET M . n 
N  14 366 VAL 366 366 366 VAL VAL M . n 
N  14 367 GLY 367 367 367 GLY GLY M . n 
N  14 368 LEU 368 368 368 LEU LEU M . n 
N  14 369 PRO 369 369 369 PRO PRO M . n 
N  14 370 GLY 370 370 370 GLY GLY M . n 
N  14 371 LEU 371 371 371 LEU LEU M . n 
N  14 372 SER 372 372 372 SER SER M . n 
N  14 373 GLY 373 373 373 GLY GLY M . n 
N  14 374 PHE 374 374 374 PHE PHE M . n 
N  14 375 PRO 375 375 375 PRO PRO M . n 
N  14 376 GLY 376 376 376 GLY GLY M . n 
N  14 377 GLU 377 377 377 GLU GLU M . n 
N  14 378 PHE 378 378 378 PHE PHE M . n 
N  14 379 LEU 379 379 379 LEU LEU M . n 
N  14 380 THR 380 380 380 THR THR M . n 
N  14 381 LEU 381 381 381 LEU LEU M . n 
N  14 382 LEU 382 382 382 LEU LEU M . n 
N  14 383 GLY 383 383 383 GLY GLY M . n 
N  14 384 ALA 384 384 384 ALA ALA M . n 
N  14 385 TYR 385 385 385 TYR TYR M . n 
N  14 386 LYS 386 386 386 LYS LYS M . n 
N  14 387 ALA 387 387 387 ALA ALA M . n 
N  14 388 SER 388 388 388 SER SER M . n 
N  14 389 PRO 389 389 389 PRO PRO M . n 
N  14 390 TRP 390 390 390 TRP TRP M . n 
N  14 391 LEU 391 391 391 LEU LEU M . n 
N  14 392 ALA 392 392 392 ALA ALA M . n 
N  14 393 ALA 393 393 393 ALA ALA M . n 
N  14 394 LEU 394 394 394 LEU LEU M . n 
N  14 395 ALA 395 395 395 ALA ALA M . n 
N  14 396 PHE 396 396 396 PHE PHE M . n 
N  14 397 LEU 397 397 397 LEU LEU M . n 
N  14 398 SER 398 398 398 SER SER M . n 
N  14 399 VAL 399 399 399 VAL VAL M . n 
N  14 400 ILE 400 400 400 ILE ILE M . n 
N  14 401 ALA 401 401 401 ALA ALA M . n 
N  14 402 SER 402 402 402 SER SER M . n 
N  14 403 ALA 403 403 403 ALA ALA M . n 
N  14 404 ALA 404 404 404 ALA ALA M . n 
N  14 405 TYR 405 405 405 TYR TYR M . n 
N  14 406 ALA 406 406 406 ALA ALA M . n 
N  14 407 LEU 407 407 407 LEU LEU M . n 
N  14 408 THR 408 408 408 THR THR M . n 
N  14 409 ALA 409 409 409 ALA ALA M . n 
N  14 410 PHE 410 410 410 PHE PHE M . n 
N  14 411 GLN 411 411 411 GLN GLN M . n 
N  14 412 LYS 412 412 412 LYS LYS M . n 
N  14 413 THR 413 413 413 THR THR M . n 
N  14 414 PHE 414 414 414 PHE PHE M . n 
N  14 415 TRP 415 415 415 TRP TRP M . n 
N  14 416 GLU 416 416 416 GLU GLU M . n 
N  14 417 GLU 417 417 417 GLU GLU M . n 
N  14 418 GLY 418 418 418 GLY GLY M . n 
N  14 419 GLY 419 419 419 GLY GLY M . n 
N  14 420 SER 420 420 420 SER SER M . n 
N  14 421 GLY 421 421 421 GLY GLY M . n 
N  14 422 VAL 422 422 422 VAL VAL M . n 
N  14 423 LYS 423 423 423 LYS LYS M . n 
N  14 424 ASP 424 424 424 ASP ASP M . n 
N  14 425 LEU 425 425 425 LEU LEU M . n 
N  14 426 ALA 426 426 426 ALA ALA M . n 
N  14 427 GLY 427 427 427 GLY GLY M . n 
N  14 428 ALA 428 428 428 ALA ALA M . n 
N  14 429 GLU 429 429 429 GLU GLU M . n 
N  14 430 TRP 430 430 430 TRP TRP M . n 
N  14 431 GLY 431 431 431 GLY GLY M . n 
N  14 432 PHE 432 432 432 PHE PHE M . n 
N  14 433 ALA 433 433 433 ALA ALA M . n 
N  14 434 LEU 434 434 434 LEU LEU M . n 
N  14 435 LEU 435 435 435 LEU LEU M . n 
N  14 436 SER 436 436 436 SER SER M . n 
N  14 437 VAL 437 437 437 VAL VAL M . n 
N  14 438 LEU 438 438 438 LEU LEU M . n 
N  14 439 ALA 439 439 439 ALA ALA M . n 
N  14 440 LEU 440 440 440 LEU LEU M . n 
N  14 441 LEU 441 441 441 LEU LEU M . n 
N  14 442 LEU 442 442 442 LEU LEU M . n 
N  14 443 MET 443 443 443 MET MET M . n 
N  14 444 GLY 444 444 444 GLY GLY M . n 
N  14 445 VAL 445 445 445 VAL VAL M . n 
N  14 446 PHE 446 446 446 PHE PHE M . n 
N  14 447 PRO 447 447 447 PRO PRO M . n 
N  14 448 GLY 448 448 448 GLY GLY M . n 
N  14 449 TYR 449 449 449 TYR TYR M . n 
N  14 450 PHE 450 450 450 PHE PHE M . n 
N  14 451 ALA 451 451 451 ALA ALA M . n 
N  14 452 ARG 452 452 452 ARG ARG M . n 
N  14 453 GLY 453 453 453 GLY GLY M . n 
N  14 454 LEU 454 454 454 LEU LEU M . n 
N  14 455 HIS 455 455 455 HIS HIS M . n 
N  14 456 PRO 456 456 456 PRO PRO M . n 
N  14 457 LEU 457 457 457 LEU LEU M . n 
N  14 458 ALA 458 458 458 ALA ALA M . n 
N  14 459 GLU 459 459 459 GLU GLU M . n 
N  14 460 ALA 460 460 460 ALA ALA M . n 
N  14 461 PHE 461 461 461 PHE PHE M . n 
N  14 462 ALA 462 462 462 ALA ALA M . n 
N  14 463 LYS 463 463 463 LYS LYS M . n 
N  14 464 LEU 464 464 464 LEU LEU M . n 
N  14 465 LEU 465 465 465 LEU LEU M . n 
N  14 466 GLY 466 466 466 GLY GLY M . n 
N  14 467 GLY 467 467 467 GLY GLY M . n 
N  14 468 GLY 468 468 ?   ?   ?   M . n 
N  14 469 ALA 469 469 ?   ?   ?   M . n 
O  15 1   MET 1   1   1   MET MET N . n 
O  15 2   THR 2   2   2   THR THR N . n 
O  15 3   LEU 3   3   3   LEU LEU N . n 
O  15 4   ALA 4   4   4   ALA ALA N . n 
O  15 5   ILE 5   5   5   ILE ILE N . n 
O  15 6   LEU 6   6   6   LEU LEU N . n 
O  15 7   ALA 7   7   7   ALA ALA N . n 
O  15 8   VAL 8   8   8   VAL VAL N . n 
O  15 9   PHE 9   9   9   PHE PHE N . n 
O  15 10  SER 10  10  10  SER SER N . n 
O  15 11  VAL 11  11  11  VAL VAL N . n 
O  15 12  ALA 12  12  12  ALA ALA N . n 
O  15 13  LEU 13  13  13  LEU LEU N . n 
O  15 14  THR 14  14  14  THR THR N . n 
O  15 15  LEU 15  15  15  LEU LEU N . n 
O  15 16  LEU 16  16  16  LEU LEU N . n 
O  15 17  GLY 17  17  17  GLY GLY N . n 
O  15 18  PHE 18  18  18  PHE PHE N . n 
O  15 19  VAL 19  19  19  VAL VAL N . n 
O  15 20  LEU 20  20  20  LEU LEU N . n 
O  15 21  PRO 21  21  21  PRO PRO N . n 
O  15 22  PRO 22  22  22  PRO PRO N . n 
O  15 23  GLN 23  23  23  GLN GLN N . n 
O  15 24  GLY 24  24  24  GLY GLY N . n 
O  15 25  VAL 25  25  25  VAL VAL N . n 
O  15 26  LYS 26  26  26  LYS LYS N . n 
O  15 27  ARG 27  27  27  ARG ARG N . n 
O  15 28  ALA 28  28  28  ALA ALA N . n 
O  15 29  THR 29  29  29  THR THR N . n 
O  15 30  LEU 30  30  30  LEU LEU N . n 
O  15 31  LEU 31  31  31  LEU LEU N . n 
O  15 32  GLY 32  32  32  GLY GLY N . n 
O  15 33  LEU 33  33  33  LEU LEU N . n 
O  15 34  ALA 34  34  34  ALA ALA N . n 
O  15 35  LEU 35  35  35  LEU LEU N . n 
O  15 36  ALA 36  36  36  ALA ALA N . n 
O  15 37  LEU 37  37  37  LEU LEU N . n 
O  15 38  ALA 38  38  38  ALA ALA N . n 
O  15 39  SER 39  39  39  SER SER N . n 
O  15 40  LEU 40  40  40  LEU LEU N . n 
O  15 41  LEU 41  41  41  LEU LEU N . n 
O  15 42  LEU 42  42  42  LEU LEU N . n 
O  15 43  THR 43  43  43  THR THR N . n 
O  15 44  TRP 44  44  44  TRP TRP N . n 
O  15 45  GLY 45  45  45  GLY GLY N . n 
O  15 46  LYS 46  46  46  LYS LYS N . n 
O  15 47  PRO 47  47  47  PRO PRO N . n 
O  15 48  PHE 48  48  48  PHE PHE N . n 
O  15 49  ALA 49  49  49  ALA ALA N . n 
O  15 50  PHE 50  50  50  PHE PHE N . n 
O  15 51  GLY 51  51  51  GLY GLY N . n 
O  15 52  PRO 52  52  52  PRO PRO N . n 
O  15 53  TYR 53  53  53  TYR TYR N . n 
O  15 54  ALA 54  54  54  ALA ALA N . n 
O  15 55  VAL 55  55  55  VAL VAL N . n 
O  15 56  ASP 56  56  56  ASP ASP N . n 
O  15 57  GLY 57  57  57  GLY GLY N . n 
O  15 58  VAL 58  58  58  VAL VAL N . n 
O  15 59  SER 59  59  59  SER SER N . n 
O  15 60  GLN 60  60  60  GLN GLN N . n 
O  15 61  VAL 61  61  61  VAL VAL N . n 
O  15 62  PHE 62  62  62  PHE PHE N . n 
O  15 63  THR 63  63  63  THR THR N . n 
O  15 64  LEU 64  64  64  LEU LEU N . n 
O  15 65  LEU 65  65  65  LEU LEU N . n 
O  15 66  ALA 66  66  66  ALA ALA N . n 
O  15 67  LEU 67  67  67  LEU LEU N . n 
O  15 68  LEU 68  68  68  LEU LEU N . n 
O  15 69  GLY 69  69  69  GLY GLY N . n 
O  15 70  ALA 70  70  70  ALA ALA N . n 
O  15 71  LEU 71  71  71  LEU LEU N . n 
O  15 72  TRP 72  72  72  TRP TRP N . n 
O  15 73  THR 73  73  73  THR THR N . n 
O  15 74  VAL 74  74  74  VAL VAL N . n 
O  15 75  GLY 75  75  75  GLY GLY N . n 
O  15 76  LEU 76  76  76  LEU LEU N . n 
O  15 77  VAL 77  77  77  VAL VAL N . n 
O  15 78  ARG 78  78  78  ARG ARG N . n 
O  15 79  SER 79  79  79  SER SER N . n 
O  15 80  GLY 80  80  80  GLY GLY N . n 
O  15 81  ARG 81  81  81  ARG ARG N . n 
O  15 82  PHE 82  82  82  PHE PHE N . n 
O  15 83  GLU 83  83  83  GLU GLU N . n 
O  15 84  PHE 84  84  84  PHE PHE N . n 
O  15 85  TYR 85  85  85  TYR TYR N . n 
O  15 86  LEU 86  86  86  LEU LEU N . n 
O  15 87  LEU 87  87  87  LEU LEU N . n 
O  15 88  VAL 88  88  88  VAL VAL N . n 
O  15 89  LEU 89  89  89  LEU LEU N . n 
O  15 90  TYR 90  90  90  TYR TYR N . n 
O  15 91  ALA 91  91  91  ALA ALA N . n 
O  15 92  ALA 92  92  92  ALA ALA N . n 
O  15 93  LEU 93  93  93  LEU LEU N . n 
O  15 94  GLY 94  94  94  GLY GLY N . n 
O  15 95  MET 95  95  95  MET MET N . n 
O  15 96  HIS 96  96  96  HIS HIS N . n 
O  15 97  LEU 97  97  97  LEU LEU N . n 
O  15 98  LEU 98  98  98  LEU LEU N . n 
O  15 99  ALA 99  99  99  ALA ALA N . n 
O  15 100 SER 100 100 100 SER SER N . n 
O  15 101 THR 101 101 101 THR THR N . n 
O  15 102 ARG 102 102 102 ARG ARG N . n 
O  15 103 HIS 103 103 103 HIS HIS N . n 
O  15 104 LEU 104 104 104 LEU LEU N . n 
O  15 105 LEU 105 105 105 LEU LEU N . n 
O  15 106 LEU 106 106 106 LEU LEU N . n 
O  15 107 MET 107 107 107 MET MET N . n 
O  15 108 LEU 108 108 108 LEU LEU N . n 
O  15 109 VAL 109 109 109 VAL VAL N . n 
O  15 110 ALA 110 110 110 ALA ALA N . n 
O  15 111 LEU 111 111 111 LEU LEU N . n 
O  15 112 GLU 112 112 112 GLU GLU N . n 
O  15 113 ALA 113 113 113 ALA ALA N . n 
O  15 114 LEU 114 114 114 LEU LEU N . n 
O  15 115 SER 115 115 115 SER SER N . n 
O  15 116 LEU 116 116 116 LEU LEU N . n 
O  15 117 PRO 117 117 117 PRO PRO N . n 
O  15 118 LEU 118 118 118 LEU LEU N . n 
O  15 119 TYR 119 119 119 TYR TYR N . n 
O  15 120 ALA 120 120 120 ALA ALA N . n 
O  15 121 LEU 121 121 121 LEU LEU N . n 
O  15 122 ALA 122 122 122 ALA ALA N . n 
O  15 123 THR 123 123 123 THR THR N . n 
O  15 124 TRP 124 124 124 TRP TRP N . n 
O  15 125 ARG 125 125 125 ARG ARG N . n 
O  15 126 ARG 126 126 126 ARG ARG N . n 
O  15 127 GLY 127 127 127 GLY GLY N . n 
O  15 128 GLN 128 128 128 GLN GLN N . n 
O  15 129 GLY 129 129 129 GLY GLY N . n 
O  15 130 LEU 130 130 130 LEU LEU N . n 
O  15 131 GLU 131 131 131 GLU GLU N . n 
O  15 132 ALA 132 132 132 ALA ALA N . n 
O  15 133 ALA 133 133 133 ALA ALA N . n 
O  15 134 LEU 134 134 134 LEU LEU N . n 
O  15 135 LYS 135 135 135 LYS LYS N . n 
O  15 136 TYR 136 136 136 TYR TYR N . n 
O  15 137 PHE 137 137 137 PHE PHE N . n 
O  15 138 LEU 138 138 138 LEU LEU N . n 
O  15 139 LEU 139 139 139 LEU LEU N . n 
O  15 140 GLY 140 140 140 GLY GLY N . n 
O  15 141 ALA 141 141 141 ALA ALA N . n 
O  15 142 LEU 142 142 142 LEU LEU N . n 
O  15 143 ALA 143 143 143 ALA ALA N . n 
O  15 144 ALA 144 144 144 ALA ALA N . n 
O  15 145 ALA 145 145 145 ALA ALA N . n 
O  15 146 PHE 146 146 146 PHE PHE N . n 
O  15 147 PHE 147 147 147 PHE PHE N . n 
O  15 148 LEU 148 148 148 LEU LEU N . n 
O  15 149 TYR 149 149 149 TYR TYR N . n 
O  15 150 GLY 150 150 150 GLY GLY N . n 
O  15 151 ALA 151 151 151 ALA ALA N . n 
O  15 152 ALA 152 152 152 ALA ALA N . n 
O  15 153 LEU 153 153 153 LEU LEU N . n 
O  15 154 PHE 154 154 154 PHE PHE N . n 
O  15 155 TYR 155 155 155 TYR TYR N . n 
O  15 156 GLY 156 156 156 GLY GLY N . n 
O  15 157 ALA 157 157 157 ALA ALA N . n 
O  15 158 THR 158 158 158 THR THR N . n 
O  15 159 GLY 159 159 159 GLY GLY N . n 
O  15 160 SER 160 160 160 SER SER N . n 
O  15 161 LEU 161 161 161 LEU LEU N . n 
O  15 162 VAL 162 162 162 VAL VAL N . n 
O  15 163 LEU 163 163 163 LEU LEU N . n 
O  15 164 GLY 164 164 164 GLY GLY N . n 
O  15 165 ALA 165 165 165 ALA ALA N . n 
O  15 166 PRO 166 166 166 PRO PRO N . n 
O  15 167 GLY 167 167 167 GLY GLY N . n 
O  15 168 GLU 168 168 168 GLU GLU N . n 
O  15 169 GLY 169 169 169 GLY GLY N . n 
O  15 170 PRO 170 170 170 PRO PRO N . n 
O  15 171 LEU 171 171 171 LEU LEU N . n 
O  15 172 TYR 172 172 172 TYR TYR N . n 
O  15 173 ALA 173 173 173 ALA ALA N . n 
O  15 174 LEU 174 174 174 LEU LEU N . n 
O  15 175 ALA 175 175 175 ALA ALA N . n 
O  15 176 LEU 176 176 176 LEU LEU N . n 
O  15 177 GLY 177 177 177 GLY GLY N . n 
O  15 178 LEU 178 178 178 LEU LEU N . n 
O  15 179 LEU 179 179 179 LEU LEU N . n 
O  15 180 LEU 180 180 180 LEU LEU N . n 
O  15 181 VAL 181 181 181 VAL VAL N . n 
O  15 182 GLY 182 182 182 GLY GLY N . n 
O  15 183 LEU 183 183 183 LEU LEU N . n 
O  15 184 GLY 184 184 184 GLY GLY N . n 
O  15 185 PHE 185 185 185 PHE PHE N . n 
O  15 186 LYS 186 186 186 LYS LYS N . n 
O  15 187 ALA 187 187 187 ALA ALA N . n 
O  15 188 ALA 188 188 188 ALA ALA N . n 
O  15 189 LEU 189 189 189 LEU LEU N . n 
O  15 190 ALA 190 190 190 ALA ALA N . n 
O  15 191 PRO 191 191 191 PRO PRO N . n 
O  15 192 PHE 192 192 192 PHE PHE N . n 
O  15 193 HIS 193 193 193 HIS HIS N . n 
O  15 194 PHE 194 194 194 PHE PHE N . n 
O  15 195 TRP 195 195 195 TRP TRP N . n 
O  15 196 THR 196 196 196 THR THR N . n 
O  15 197 PRO 197 197 197 PRO PRO N . n 
O  15 198 ASP 198 198 198 ASP ASP N . n 
O  15 199 VAL 199 199 199 VAL VAL N . n 
O  15 200 TYR 200 200 200 TYR TYR N . n 
O  15 201 GLN 201 201 201 GLN GLN N . n 
O  15 202 GLY 202 202 202 GLY GLY N . n 
O  15 203 SER 203 203 203 SER SER N . n 
O  15 204 PRO 204 204 204 PRO PRO N . n 
O  15 205 THR 205 205 205 THR THR N . n 
O  15 206 PRO 206 206 206 PRO PRO N . n 
O  15 207 VAL 207 207 207 VAL VAL N . n 
O  15 208 VAL 208 208 208 VAL VAL N . n 
O  15 209 LEU 209 209 209 LEU LEU N . n 
O  15 210 PHE 210 210 210 PHE PHE N . n 
O  15 211 MET 211 211 211 MET MET N . n 
O  15 212 ALA 212 212 212 ALA ALA N . n 
O  15 213 THR 213 213 213 THR THR N . n 
O  15 214 SER 214 214 214 SER SER N . n 
O  15 215 VAL 215 215 215 VAL VAL N . n 
O  15 216 LYS 216 216 216 LYS LYS N . n 
O  15 217 ALA 217 217 217 ALA ALA N . n 
O  15 218 ALA 218 218 218 ALA ALA N . n 
O  15 219 ALA 219 219 219 ALA ALA N . n 
O  15 220 PHE 220 220 220 PHE PHE N . n 
O  15 221 ALA 221 221 221 ALA ALA N . n 
O  15 222 ALA 222 222 222 ALA ALA N . n 
O  15 223 LEU 223 223 223 LEU LEU N . n 
O  15 224 LEU 224 224 224 LEU LEU N . n 
O  15 225 ARG 225 225 225 ARG ARG N . n 
O  15 226 VAL 226 226 226 VAL VAL N . n 
O  15 227 ALA 227 227 227 ALA ALA N . n 
O  15 228 ALA 228 228 228 ALA ALA N . n 
O  15 229 PRO 229 229 229 PRO PRO N . n 
O  15 230 PRO 230 230 230 PRO PRO N . n 
O  15 231 GLU 231 231 231 GLU GLU N . n 
O  15 232 ALA 232 232 232 ALA ALA N . n 
O  15 233 LEU 233 233 233 LEU LEU N . n 
O  15 234 ALA 234 234 234 ALA ALA N . n 
O  15 235 LEU 235 235 235 LEU LEU N . n 
O  15 236 LEU 236 236 236 LEU LEU N . n 
O  15 237 VAL 237 237 237 VAL VAL N . n 
O  15 238 ALA 238 238 238 ALA ALA N . n 
O  15 239 LEU 239 239 239 LEU LEU N . n 
O  15 240 SER 240 240 240 SER SER N . n 
O  15 241 VAL 241 241 241 VAL VAL N . n 
O  15 242 VAL 242 242 242 VAL VAL N . n 
O  15 243 VAL 243 243 243 VAL VAL N . n 
O  15 244 GLY 244 244 244 GLY GLY N . n 
O  15 245 ASN 245 245 245 ASN ASN N . n 
O  15 246 LEU 246 246 246 LEU LEU N . n 
O  15 247 ALA 247 247 247 ALA ALA N . n 
O  15 248 ALA 248 248 248 ALA ALA N . n 
O  15 249 LEU 249 249 249 LEU LEU N . n 
O  15 250 ALA 250 250 250 ALA ALA N . n 
O  15 251 GLN 251 251 251 GLN GLN N . n 
O  15 252 LYS 252 252 252 LYS LYS N . n 
O  15 253 GLU 253 253 253 GLU GLU N . n 
O  15 254 ALA 254 254 254 ALA ALA N . n 
O  15 255 LYS 255 255 255 LYS LYS N . n 
O  15 256 ARG 256 256 256 ARG ARG N . n 
O  15 257 LEU 257 257 257 LEU LEU N . n 
O  15 258 LEU 258 258 258 LEU LEU N . n 
O  15 259 ALA 259 259 259 ALA ALA N . n 
O  15 260 TYR 260 260 260 TYR TYR N . n 
O  15 261 SER 261 261 261 SER SER N . n 
O  15 262 SER 262 262 262 SER SER N . n 
O  15 263 ILE 263 263 263 ILE ILE N . n 
O  15 264 ALA 264 264 264 ALA ALA N . n 
O  15 265 HIS 265 265 265 HIS HIS N . n 
O  15 266 ALA 266 266 266 ALA ALA N . n 
O  15 267 GLY 267 267 267 GLY GLY N . n 
O  15 268 TYR 268 268 268 TYR TYR N . n 
O  15 269 MET 269 269 269 MET MET N . n 
O  15 270 ALA 270 270 270 ALA ALA N . n 
O  15 271 LEU 271 271 271 LEU LEU N . n 
O  15 272 ALA 272 272 272 ALA ALA N . n 
O  15 273 LEU 273 273 273 LEU LEU N . n 
O  15 274 TYR 274 274 274 TYR TYR N . n 
O  15 275 THR 275 275 275 THR THR N . n 
O  15 276 GLY 276 276 276 GLY GLY N . n 
O  15 277 ASN 277 277 277 ASN ASN N . n 
O  15 278 ALA 278 278 278 ALA ALA N . n 
O  15 279 GLN 279 279 279 GLN GLN N . n 
O  15 280 ALA 280 280 280 ALA ALA N . n 
O  15 281 LEU 281 281 281 LEU LEU N . n 
O  15 282 GLY 282 282 282 GLY GLY N . n 
O  15 283 PHE 283 283 283 PHE PHE N . n 
O  15 284 TYR 284 284 284 TYR TYR N . n 
O  15 285 LEU 285 285 285 LEU LEU N . n 
O  15 286 LEU 286 286 286 LEU LEU N . n 
O  15 287 THR 287 287 287 THR THR N . n 
O  15 288 TYR 288 288 288 TYR TYR N . n 
O  15 289 VAL 289 289 289 VAL VAL N . n 
O  15 290 LEU 290 290 290 LEU LEU N . n 
O  15 291 ALA 291 291 291 ALA ALA N . n 
O  15 292 THR 292 292 292 THR THR N . n 
O  15 293 GLY 293 293 293 GLY GLY N . n 
O  15 294 LEU 294 294 294 LEU LEU N . n 
O  15 295 ALA 295 295 295 ALA ALA N . n 
O  15 296 PHE 296 296 296 PHE PHE N . n 
O  15 297 ALA 297 297 297 ALA ALA N . n 
O  15 298 VAL 298 298 298 VAL VAL N . n 
O  15 299 LEU 299 299 299 LEU LEU N . n 
O  15 300 SER 300 300 300 SER SER N . n 
O  15 301 GLN 301 301 301 GLN GLN N . n 
O  15 302 ILE 302 302 302 ILE ILE N . n 
O  15 303 SER 303 303 303 SER SER N . n 
O  15 304 PRO 304 304 304 PRO PRO N . n 
O  15 305 ASP 305 305 305 ASP ASP N . n 
O  15 306 ARG 306 306 306 ARG ARG N . n 
O  15 307 VAL 307 307 307 VAL VAL N . n 
O  15 308 PRO 308 308 308 PRO PRO N . n 
O  15 309 LEU 309 309 309 LEU LEU N . n 
O  15 310 GLU 310 310 310 GLU GLU N . n 
O  15 311 ALA 311 311 311 ALA ALA N . n 
O  15 312 LEU 312 312 312 LEU LEU N . n 
O  15 313 ARG 313 313 313 ARG ARG N . n 
O  15 314 GLY 314 314 314 GLY GLY N . n 
O  15 315 LEU 315 315 315 LEU LEU N . n 
O  15 316 TYR 316 316 316 TYR TYR N . n 
O  15 317 ARG 317 317 317 ARG ARG N . n 
O  15 318 LYS 318 318 318 LYS LYS N . n 
O  15 319 ASP 319 319 319 ASP ASP N . n 
O  15 320 PRO 320 320 320 PRO PRO N . n 
O  15 321 LEU 321 321 321 LEU LEU N . n 
O  15 322 LEU 322 322 322 LEU LEU N . n 
O  15 323 GLY 323 323 323 GLY GLY N . n 
O  15 324 LEU 324 324 324 LEU LEU N . n 
O  15 325 ALA 325 325 325 ALA ALA N . n 
O  15 326 PHE 326 326 326 PHE PHE N . n 
O  15 327 LEU 327 327 327 LEU LEU N . n 
O  15 328 VAL 328 328 328 VAL VAL N . n 
O  15 329 ALA 329 329 329 ALA ALA N . n 
O  15 330 MET 330 330 330 MET MET N . n 
O  15 331 LEU 331 331 331 LEU LEU N . n 
O  15 332 SER 332 332 332 SER SER N . n 
O  15 333 LEU 333 333 333 LEU LEU N . n 
O  15 334 LEU 334 334 334 LEU LEU N . n 
O  15 335 GLY 335 335 335 GLY GLY N . n 
O  15 336 LEU 336 336 336 LEU LEU N . n 
O  15 337 PRO 337 337 337 PRO PRO N . n 
O  15 338 PRO 338 338 338 PRO PRO N . n 
O  15 339 LEU 339 339 339 LEU LEU N . n 
O  15 340 ALA 340 340 340 ALA ALA N . n 
O  15 341 GLY 341 341 341 GLY GLY N . n 
O  15 342 PHE 342 342 342 PHE PHE N . n 
O  15 343 TRP 343 343 343 TRP TRP N . n 
O  15 344 GLY 344 344 344 GLY GLY N . n 
O  15 345 LYS 345 345 345 LYS LYS N . n 
O  15 346 TYR 346 346 346 TYR TYR N . n 
O  15 347 LEU 347 347 347 LEU LEU N . n 
O  15 348 ALA 348 348 348 ALA ALA N . n 
O  15 349 PHE 349 349 349 PHE PHE N . n 
O  15 350 ALA 350 350 350 ALA ALA N . n 
O  15 351 GLU 351 351 351 GLU GLU N . n 
O  15 352 ALA 352 352 352 ALA ALA N . n 
O  15 353 ALA 353 353 353 ALA ALA N . n 
O  15 354 ARG 354 354 354 ARG ARG N . n 
O  15 355 ALA 355 355 355 ALA ALA N . n 
O  15 356 GLY 356 356 356 GLY GLY N . n 
O  15 357 ALA 357 357 357 ALA ALA N . n 
O  15 358 TRP 358 358 358 TRP TRP N . n 
O  15 359 GLY 359 359 359 GLY GLY N . n 
O  15 360 VAL 360 360 360 VAL VAL N . n 
O  15 361 LEU 361 361 361 LEU LEU N . n 
O  15 362 VAL 362 362 362 VAL VAL N . n 
O  15 363 LEU 363 363 363 LEU LEU N . n 
O  15 364 ALA 364 364 364 ALA ALA N . n 
O  15 365 LEU 365 365 365 LEU LEU N . n 
O  15 366 VAL 366 366 366 VAL VAL N . n 
O  15 367 THR 367 367 367 THR THR N . n 
O  15 368 SER 368 368 368 SER SER N . n 
O  15 369 ALA 369 369 369 ALA ALA N . n 
O  15 370 VAL 370 370 370 VAL VAL N . n 
O  15 371 SER 371 371 371 SER SER N . n 
O  15 372 ALA 372 372 372 ALA ALA N . n 
O  15 373 TYR 373 373 373 TYR TYR N . n 
O  15 374 TYR 374 374 374 TYR TYR N . n 
O  15 375 TYR 375 375 375 TYR TYR N . n 
O  15 376 LEU 376 376 376 LEU LEU N . n 
O  15 377 GLY 377 377 377 GLY GLY N . n 
O  15 378 LEU 378 378 378 LEU LEU N . n 
O  15 379 GLY 379 379 379 GLY GLY N . n 
O  15 380 LEU 380 380 380 LEU LEU N . n 
O  15 381 ALA 381 381 381 ALA ALA N . n 
O  15 382 VAL 382 382 382 VAL VAL N . n 
O  15 383 PHE 383 383 383 PHE PHE N . n 
O  15 384 ALA 384 384 384 ALA ALA N . n 
O  15 385 ARG 385 385 385 ARG ARG N . n 
O  15 386 PRO 386 386 386 PRO PRO N . n 
O  15 387 GLU 387 387 387 GLU GLU N . n 
O  15 388 GLU 388 388 388 GLU GLU N . n 
O  15 389 THR 389 389 389 THR THR N . n 
O  15 390 PRO 390 390 390 PRO PRO N . n 
O  15 391 PHE 391 391 391 PHE PHE N . n 
O  15 392 ARG 392 392 392 ARG ARG N . n 
O  15 393 PRO 393 393 393 PRO PRO N . n 
O  15 394 GLY 394 394 394 GLY GLY N . n 
O  15 395 PRO 395 395 395 PRO PRO N . n 
O  15 396 PRO 396 396 396 PRO PRO N . n 
O  15 397 TRP 397 397 397 TRP TRP N . n 
O  15 398 ALA 398 398 398 ALA ALA N . n 
O  15 399 ARG 399 399 399 ARG ARG N . n 
O  15 400 ALA 400 400 400 ALA ALA N . n 
O  15 401 ALA 401 401 401 ALA ALA N . n 
O  15 402 VAL 402 402 402 VAL VAL N . n 
O  15 403 VAL 403 403 403 VAL VAL N . n 
O  15 404 ALA 404 404 404 ALA ALA N . n 
O  15 405 ALA 405 405 405 ALA ALA N . n 
O  15 406 GLY 406 406 406 GLY GLY N . n 
O  15 407 VAL 407 407 407 VAL VAL N . n 
O  15 408 LEU 408 408 408 LEU LEU N . n 
O  15 409 LEU 409 409 409 LEU LEU N . n 
O  15 410 LEU 410 410 410 LEU LEU N . n 
O  15 411 ALA 411 411 411 ALA ALA N . n 
O  15 412 LEU 412 412 412 LEU LEU N . n 
O  15 413 GLY 413 413 413 GLY GLY N . n 
O  15 414 LEU 414 414 414 LEU LEU N . n 
O  15 415 LEU 415 415 415 LEU LEU N . n 
O  15 416 PRO 416 416 416 PRO PRO N . n 
O  15 417 GLY 417 417 417 GLY GLY N . n 
O  15 418 LEU 418 418 418 LEU LEU N . n 
O  15 419 VAL 419 419 419 VAL VAL N . n 
O  15 420 LEU 420 420 420 LEU LEU N . n 
O  15 421 PRO 421 421 421 PRO PRO N . n 
O  15 422 ALA 422 422 422 ALA ALA N . n 
O  15 423 LEU 423 423 423 LEU LEU N . n 
O  15 424 ALA 424 424 424 ALA ALA N . n 
O  15 425 ALA 425 425 425 ALA ALA N . n 
O  15 426 GLY 426 426 426 GLY GLY N . n 
O  15 427 GLY 427 427 427 GLY GLY N . n 
P  16 1   MET 1   1   ?   ?   ?   H . n 
P  16 2   THR 2   2   2   THR THR H . n 
P  16 3   TRP 3   3   3   TRP TRP H . n 
P  16 4   SER 4   4   4   SER SER H . n 
P  16 5   TYR 5   5   5   TYR TYR H . n 
P  16 6   PRO 6   6   6   PRO PRO H . n 
P  16 7   VAL 7   7   7   VAL VAL H . n 
P  16 8   ASP 8   8   8   ASP ASP H . n 
P  16 9   PRO 9   9   9   PRO PRO H . n 
P  16 10  TYR 10  10  10  TYR TYR H . n 
P  16 11  TRP 11  11  11  TRP TRP H . n 
P  16 12  MET 12  12  12  MET MET H . n 
P  16 13  VAL 13  13  13  VAL VAL H . n 
P  16 14  ALA 14  14  14  ALA ALA H . n 
P  16 15  LEU 15  15  15  LEU LEU H . n 
P  16 16  LYS 16  16  16  LYS LYS H . n 
P  16 17  ALA 17  17  17  ALA ALA H . n 
P  16 18  LEU 18  18  18  LEU LEU H . n 
P  16 19  LEU 19  19  19  LEU LEU H . n 
P  16 20  VAL 20  20  20  VAL VAL H . n 
P  16 21  VAL 21  21  21  VAL VAL H . n 
P  16 22  VAL 22  22  22  VAL VAL H . n 
P  16 23  GLY 23  23  23  GLY GLY H . n 
P  16 24  LEU 24  24  24  LEU LEU H . n 
P  16 25  LEU 25  25  25  LEU LEU H . n 
P  16 26  THR 26  26  26  THR THR H . n 
P  16 27  ALA 27  27  27  ALA ALA H . n 
P  16 28  PHE 28  28  28  PHE PHE H . n 
P  16 29  ALA 29  29  29  ALA ALA H . n 
P  16 30  PHE 30  30  30  PHE PHE H . n 
P  16 31  MET 31  31  31  MET MET H . n 
P  16 32  THR 32  32  32  THR THR H . n 
P  16 33  LEU 33  33  33  LEU LEU H . n 
P  16 34  ILE 34  34  34  ILE ILE H . n 
P  16 35  GLU 35  35  35  GLU GLU H . n 
P  16 36  ARG 36  36  36  ARG ARG H . n 
P  16 37  ARG 37  37  37  ARG ARG H . n 
P  16 38  LEU 38  38  38  LEU LEU H . n 
P  16 39  LEU 39  39  39  LEU LEU H . n 
P  16 40  ALA 40  40  40  ALA ALA H . n 
P  16 41  ARG 41  41  41  ARG ARG H . n 
P  16 42  PHE 42  42  42  PHE PHE H . n 
P  16 43  GLN 43  43  43  GLN GLN H . n 
P  16 44  VAL 44  44  44  VAL VAL H . n 
P  16 45  ARG 45  45  45  ARG ARG H . n 
P  16 46  MET 46  46  46  MET MET H . n 
P  16 47  GLY 47  47  47  GLY GLY H . n 
P  16 48  PRO 48  48  48  PRO PRO H . n 
P  16 49  ASN 49  49  49  ASN ASN H . n 
P  16 50  ARG 50  50  50  ARG ARG H . n 
P  16 51  VAL 51  51  51  VAL VAL H . n 
P  16 52  GLY 52  52  52  GLY GLY H . n 
P  16 53  PRO 53  53  53  PRO PRO H . n 
P  16 54  PHE 54  54  54  PHE PHE H . n 
P  16 55  GLY 55  55  55  GLY GLY H . n 
P  16 56  LEU 56  56  56  LEU LEU H . n 
P  16 57  LEU 57  57  57  LEU LEU H . n 
P  16 58  GLN 58  58  58  GLN GLN H . n 
P  16 59  PRO 59  59  59  PRO PRO H . n 
P  16 60  LEU 60  60  60  LEU LEU H . n 
P  16 61  ALA 61  61  61  ALA ALA H . n 
P  16 62  ASP 62  62  62  ASP ASP H . n 
P  16 63  ALA 63  63  63  ALA ALA H . n 
P  16 64  ILE 64  64  64  ILE ILE H . n 
P  16 65  LYS 65  65  65  LYS LYS H . n 
P  16 66  SER 66  66  66  SER SER H . n 
P  16 67  ILE 67  67  67  ILE ILE H . n 
P  16 68  PHE 68  68  68  PHE PHE H . n 
P  16 69  LYS 69  69  69  LYS LYS H . n 
P  16 70  GLU 70  70  70  GLU GLU H . n 
P  16 71  ASP 71  71  71  ASP ASP H . n 
P  16 72  ILE 72  72  72  ILE ILE H . n 
P  16 73  VAL 73  73  73  VAL VAL H . n 
P  16 74  VAL 74  74  74  VAL VAL H . n 
P  16 75  ALA 75  75  75  ALA ALA H . n 
P  16 76  GLN 76  76  76  GLN GLN H . n 
P  16 77  ALA 77  77  77  ALA ALA H . n 
P  16 78  ASP 78  78  78  ASP ASP H . n 
P  16 79  ARG 79  79  79  ARG ARG H . n 
P  16 80  PHE 80  80  80  PHE PHE H . n 
P  16 81  LEU 81  81  81  LEU LEU H . n 
P  16 82  PHE 82  82  82  PHE PHE H . n 
P  16 83  VAL 83  83  83  VAL VAL H . n 
P  16 84  LEU 84  84  84  LEU LEU H . n 
P  16 85  ALA 85  85  85  ALA ALA H . n 
P  16 86  PRO 86  86  86  PRO PRO H . n 
P  16 87  LEU 87  87  87  LEU LEU H . n 
P  16 88  ILE 88  88  88  ILE ILE H . n 
P  16 89  SER 89  89  89  SER SER H . n 
P  16 90  VAL 90  90  90  VAL VAL H . n 
P  16 91  VAL 91  91  91  VAL VAL H . n 
P  16 92  PHE 92  92  92  PHE PHE H . n 
P  16 93  ALA 93  93  93  ALA ALA H . n 
P  16 94  LEU 94  94  94  LEU LEU H . n 
P  16 95  LEU 95  95  95  LEU LEU H . n 
P  16 96  ALA 96  96  96  ALA ALA H . n 
P  16 97  PHE 97  97  97  PHE PHE H . n 
P  16 98  GLY 98  98  98  GLY GLY H . n 
P  16 99  LEU 99  99  99  LEU LEU H . n 
P  16 100 ILE 100 100 100 ILE ILE H . n 
P  16 101 PRO 101 101 101 PRO PRO H . n 
P  16 102 PHE 102 102 102 PHE PHE H . n 
P  16 103 GLY 103 103 103 GLY GLY H . n 
P  16 104 PRO 104 104 104 PRO PRO H . n 
P  16 105 PRO 105 105 105 PRO PRO H . n 
P  16 106 GLY 106 106 106 GLY GLY H . n 
P  16 107 SER 107 107 107 SER SER H . n 
P  16 108 PHE 108 108 108 PHE PHE H . n 
P  16 109 PHE 109 109 109 PHE PHE H . n 
P  16 110 GLY 110 110 110 GLY GLY H . n 
P  16 111 TYR 111 111 111 TYR TYR H . n 
P  16 112 GLN 112 112 112 GLN GLN H . n 
P  16 113 PRO 113 113 113 PRO PRO H . n 
P  16 114 TRP 114 114 114 TRP TRP H . n 
P  16 115 VAL 115 115 115 VAL VAL H . n 
P  16 116 ILE 116 116 116 ILE ILE H . n 
P  16 117 ASN 117 117 117 ASN ASN H . n 
P  16 118 LEU 118 118 118 LEU LEU H . n 
P  16 119 ASP 119 119 119 ASP ASP H . n 
P  16 120 LEU 120 120 120 LEU LEU H . n 
P  16 121 GLY 121 121 121 GLY GLY H . n 
P  16 122 ILE 122 122 122 ILE ILE H . n 
P  16 123 LEU 123 123 123 LEU LEU H . n 
P  16 124 TYR 124 124 124 TYR TYR H . n 
P  16 125 LEU 125 125 125 LEU LEU H . n 
P  16 126 PHE 126 126 126 PHE PHE H . n 
P  16 127 ALA 127 127 127 ALA ALA H . n 
P  16 128 VAL 128 128 128 VAL VAL H . n 
P  16 129 SER 129 129 129 SER SER H . n 
P  16 130 GLU 130 130 130 GLU GLU H . n 
P  16 131 LEU 131 131 131 LEU LEU H . n 
P  16 132 ALA 132 132 132 ALA ALA H . n 
P  16 133 VAL 133 133 133 VAL VAL H . n 
P  16 134 TYR 134 134 134 TYR TYR H . n 
P  16 135 GLY 135 135 135 GLY GLY H . n 
P  16 136 ILE 136 136 136 ILE ILE H . n 
P  16 137 PHE 137 137 137 PHE PHE H . n 
P  16 138 LEU 138 138 138 LEU LEU H . n 
P  16 139 SER 139 139 139 SER SER H . n 
P  16 140 GLY 140 140 140 GLY GLY H . n 
P  16 141 TRP 141 141 141 TRP TRP H . n 
P  16 142 ALA 142 142 142 ALA ALA H . n 
P  16 143 SER 143 143 143 SER SER H . n 
P  16 144 GLY 144 144 144 GLY GLY H . n 
P  16 145 SER 145 145 145 SER SER H . n 
P  16 146 LYS 146 146 146 LYS LYS H . n 
P  16 147 TYR 147 147 147 TYR TYR H . n 
P  16 148 SER 148 148 148 SER SER H . n 
P  16 149 LEU 149 149 149 LEU LEU H . n 
P  16 150 LEU 150 150 150 LEU LEU H . n 
P  16 151 GLY 151 151 151 GLY GLY H . n 
P  16 152 SER 152 152 152 SER SER H . n 
P  16 153 LEU 153 153 153 LEU LEU H . n 
P  16 154 ARG 154 154 154 ARG ARG H . n 
P  16 155 SER 155 155 155 SER SER H . n 
P  16 156 SER 156 156 156 SER SER H . n 
P  16 157 ALA 157 157 157 ALA ALA H . n 
P  16 158 SER 158 158 158 SER SER H . n 
P  16 159 LEU 159 159 159 LEU LEU H . n 
P  16 160 ILE 160 160 160 ILE ILE H . n 
P  16 161 SER 161 161 161 SER SER H . n 
P  16 162 TYR 162 162 162 TYR TYR H . n 
P  16 163 GLU 163 163 163 GLU GLU H . n 
P  16 164 LEU 164 164 164 LEU LEU H . n 
P  16 165 GLY 165 165 165 GLY GLY H . n 
P  16 166 LEU 166 166 166 LEU LEU H . n 
P  16 167 GLY 167 167 167 GLY GLY H . n 
P  16 168 LEU 168 168 168 LEU LEU H . n 
P  16 169 ALA 169 169 169 ALA ALA H . n 
P  16 170 LEU 170 170 170 LEU LEU H . n 
P  16 171 LEU 171 171 171 LEU LEU H . n 
P  16 172 ALA 172 172 172 ALA ALA H . n 
P  16 173 PRO 173 173 173 PRO PRO H . n 
P  16 174 VAL 174 174 174 VAL VAL H . n 
P  16 175 LEU 175 175 175 LEU LEU H . n 
P  16 176 LEU 176 176 176 LEU LEU H . n 
P  16 177 VAL 177 177 177 VAL VAL H . n 
P  16 178 GLY 178 178 178 GLY GLY H . n 
P  16 179 SER 179 179 179 SER SER H . n 
P  16 180 LEU 180 180 180 LEU LEU H . n 
P  16 181 ASN 181 181 181 ASN ASN H . n 
P  16 182 LEU 182 182 182 LEU LEU H . n 
P  16 183 ASN 183 183 183 ASN ASN H . n 
P  16 184 ASP 184 184 184 ASP ASP H . n 
P  16 185 ILE 185 185 185 ILE ILE H . n 
P  16 186 VAL 186 186 186 VAL VAL H . n 
P  16 187 ASN 187 187 187 ASN ASN H . n 
P  16 188 TRP 188 188 188 TRP TRP H . n 
P  16 189 GLN 189 189 189 GLN GLN H . n 
P  16 190 LYS 190 190 190 LYS LYS H . n 
P  16 191 GLU 191 191 191 GLU GLU H . n 
P  16 192 HIS 192 192 192 HIS HIS H . n 
P  16 193 GLY 193 193 193 GLY GLY H . n 
P  16 194 TRP 194 194 194 TRP TRP H . n 
P  16 195 LEU 195 195 195 LEU LEU H . n 
P  16 196 PHE 196 196 196 PHE PHE H . n 
P  16 197 LEU 197 197 197 LEU LEU H . n 
P  16 198 TYR 198 198 198 TYR TYR H . n 
P  16 199 ALA 199 199 199 ALA ALA H . n 
P  16 200 PHE 200 200 200 PHE PHE H . n 
P  16 201 PRO 201 201 201 PRO PRO H . n 
P  16 202 ALA 202 202 202 ALA ALA H . n 
P  16 203 PHE 203 203 203 PHE PHE H . n 
P  16 204 LEU 204 204 204 LEU LEU H . n 
P  16 205 VAL 205 205 205 VAL VAL H . n 
P  16 206 TYR 206 206 206 TYR TYR H . n 
P  16 207 LEU 207 207 207 LEU LEU H . n 
P  16 208 ILE 208 208 208 ILE ILE H . n 
P  16 209 ALA 209 209 209 ALA ALA H . n 
P  16 210 SER 210 210 210 SER SER H . n 
P  16 211 MET 211 211 211 MET MET H . n 
P  16 212 ALA 212 212 212 ALA ALA H . n 
P  16 213 GLU 213 213 213 GLU GLU H . n 
P  16 214 ALA 214 214 214 ALA ALA H . n 
P  16 215 ALA 215 215 215 ALA ALA H . n 
P  16 216 ARG 216 216 216 ARG ARG H . n 
P  16 217 THR 217 217 217 THR THR H . n 
P  16 218 PRO 218 218 218 PRO PRO H . n 
P  16 219 PHE 219 219 219 PHE PHE H . n 
P  16 220 ASP 220 220 220 ASP ASP H . n 
P  16 221 LEU 221 221 221 LEU LEU H . n 
P  16 222 PRO 222 222 222 PRO PRO H . n 
P  16 223 GLU 223 223 223 GLU GLU H . n 
P  16 224 ALA 224 224 224 ALA ALA H . n 
P  16 225 GLU 225 225 225 GLU GLU H . n 
P  16 226 GLN 226 226 226 GLN GLN H . n 
P  16 227 GLU 227 227 227 GLU GLU H . n 
P  16 228 LEU 228 228 228 LEU LEU H . n 
P  16 229 VAL 229 229 229 VAL VAL H . n 
P  16 230 GLY 230 230 230 GLY GLY H . n 
P  16 231 GLY 231 231 231 GLY GLY H . n 
P  16 232 TYR 232 232 232 TYR TYR H . n 
P  16 233 HIS 233 233 233 HIS HIS H . n 
P  16 234 THR 234 234 234 THR THR H . n 
P  16 235 GLU 235 235 235 GLU GLU H . n 
P  16 236 TYR 236 236 236 TYR TYR H . n 
P  16 237 SER 237 237 237 SER SER H . n 
P  16 238 SER 238 238 238 SER SER H . n 
P  16 239 ILE 239 239 239 ILE ILE H . n 
P  16 240 LYS 240 240 240 LYS LYS H . n 
P  16 241 TRP 241 241 241 TRP TRP H . n 
P  16 242 ALA 242 242 242 ALA ALA H . n 
P  16 243 LEU 243 243 243 LEU LEU H . n 
P  16 244 PHE 244 244 244 PHE PHE H . n 
P  16 245 GLN 245 245 245 GLN GLN H . n 
P  16 246 MET 246 246 246 MET MET H . n 
P  16 247 ALA 247 247 247 ALA ALA H . n 
P  16 248 GLU 248 248 248 GLU GLU H . n 
P  16 249 TYR 249 249 249 TYR TYR H . n 
P  16 250 ILE 250 250 250 ILE ILE H . n 
P  16 251 HIS 251 251 251 HIS HIS H . n 
P  16 252 PHE 252 252 252 PHE PHE H . n 
P  16 253 ILE 253 253 253 ILE ILE H . n 
P  16 254 THR 254 254 254 THR THR H . n 
P  16 255 ALA 255 255 255 ALA ALA H . n 
P  16 256 SER 256 256 256 SER SER H . n 
P  16 257 ALA 257 257 257 ALA ALA H . n 
P  16 258 LEU 258 258 258 LEU LEU H . n 
P  16 259 ILE 259 259 259 ILE ILE H . n 
P  16 260 PRO 260 260 260 PRO PRO H . n 
P  16 261 THR 261 261 261 THR THR H . n 
P  16 262 LEU 262 262 262 LEU LEU H . n 
P  16 263 PHE 263 263 263 PHE PHE H . n 
P  16 264 LEU 264 264 264 LEU LEU H . n 
P  16 265 GLY 265 265 265 GLY GLY H . n 
P  16 266 GLY 266 266 266 GLY GLY H . n 
P  16 267 TRP 267 267 267 TRP TRP H . n 
P  16 268 THR 268 268 268 THR THR H . n 
P  16 269 MET 269 269 269 MET MET H . n 
P  16 270 PRO 270 270 270 PRO PRO H . n 
P  16 271 VAL 271 271 271 VAL VAL H . n 
P  16 272 LEU 272 272 272 LEU LEU H . n 
P  16 273 GLU 273 273 273 GLU GLU H . n 
P  16 274 VAL 274 274 274 VAL VAL H . n 
P  16 275 PRO 275 275 275 PRO PRO H . n 
P  16 276 TYR 276 276 276 TYR TYR H . n 
P  16 277 LEU 277 277 277 LEU LEU H . n 
P  16 278 TRP 278 278 278 TRP TRP H . n 
P  16 279 MET 279 279 279 MET MET H . n 
P  16 280 PHE 280 280 280 PHE PHE H . n 
P  16 281 LEU 281 281 281 LEU LEU H . n 
P  16 282 LYS 282 282 282 LYS LYS H . n 
P  16 283 ILE 283 283 283 ILE ILE H . n 
P  16 284 ALA 284 284 284 ALA ALA H . n 
P  16 285 PHE 285 285 285 PHE PHE H . n 
P  16 286 PHE 286 286 286 PHE PHE H . n 
P  16 287 LEU 287 287 287 LEU LEU H . n 
P  16 288 PHE 288 288 288 PHE PHE H . n 
P  16 289 PHE 289 289 289 PHE PHE H . n 
P  16 290 PHE 290 290 290 PHE PHE H . n 
P  16 291 ILE 291 291 291 ILE ILE H . n 
P  16 292 TRP 292 292 292 TRP TRP H . n 
P  16 293 ILE 293 293 293 ILE ILE H . n 
P  16 294 ARG 294 294 294 ARG ARG H . n 
P  16 295 ALA 295 295 295 ALA ALA H . n 
P  16 296 THR 296 296 296 THR THR H . n 
P  16 297 TRP 297 297 297 TRP TRP H . n 
P  16 298 PHE 298 298 298 PHE PHE H . n 
P  16 299 ARG 299 299 299 ARG ARG H . n 
P  16 300 LEU 300 300 300 LEU LEU H . n 
P  16 301 ARG 301 301 301 ARG ARG H . n 
P  16 302 TYR 302 302 302 TYR TYR H . n 
P  16 303 ASP 303 303 303 ASP ASP H . n 
P  16 304 GLN 304 304 304 GLN GLN H . n 
P  16 305 LEU 305 305 305 LEU LEU H . n 
P  16 306 LEU 306 306 306 LEU LEU H . n 
P  16 307 ARG 307 307 307 ARG ARG H . n 
P  16 308 PHE 308 308 308 PHE PHE H . n 
P  16 309 GLY 309 309 309 GLY GLY H . n 
P  16 310 TRP 310 310 310 TRP TRP H . n 
P  16 311 GLY 311 311 311 GLY GLY H . n 
P  16 312 PHE 312 312 312 PHE PHE H . n 
P  16 313 LEU 313 313 313 LEU LEU H . n 
P  16 314 PHE 314 314 314 PHE PHE H . n 
P  16 315 PRO 315 315 315 PRO PRO H . n 
P  16 316 LEU 316 316 316 LEU LEU H . n 
P  16 317 ALA 317 317 317 ALA ALA H . n 
P  16 318 LEU 318 318 318 LEU LEU H . n 
P  16 319 LEU 319 319 319 LEU LEU H . n 
P  16 320 TRP 320 320 320 TRP TRP H . n 
P  16 321 PHE 321 321 321 PHE PHE H . n 
P  16 322 LEU 322 322 322 LEU LEU H . n 
P  16 323 VAL 323 323 323 VAL VAL H . n 
P  16 324 THR 324 324 324 THR THR H . n 
P  16 325 ALA 325 325 325 ALA ALA H . n 
P  16 326 LEU 326 326 326 LEU LEU H . n 
P  16 327 VAL 327 327 327 VAL VAL H . n 
P  16 328 VAL 328 328 328 VAL VAL H . n 
P  16 329 ALA 329 329 329 ALA ALA H . n 
P  16 330 LEU 330 330 330 LEU LEU H . n 
P  16 331 ASP 331 331 331 ASP ASP H . n 
P  16 332 LEU 332 332 332 LEU LEU H . n 
P  16 333 PRO 333 333 333 PRO PRO H . n 
P  16 334 ARG 334 334 334 ARG ARG H . n 
P  16 335 THR 335 335 335 THR THR H . n 
P  16 336 TYR 336 336 336 TYR TYR H . n 
P  16 337 LEU 337 337 337 LEU LEU H . n 
P  16 338 LEU 338 338 338 LEU LEU H . n 
P  16 339 TYR 339 339 339 TYR TYR H . n 
P  16 340 LEU 340 340 340 LEU LEU H . n 
P  16 341 SER 341 341 341 SER SER H . n 
P  16 342 ALA 342 342 342 ALA ALA H . n 
P  16 343 LEU 343 343 343 LEU LEU H . n 
P  16 344 SER 344 344 344 SER SER H . n 
P  16 345 PHE 345 345 345 PHE PHE H . n 
P  16 346 LEU 346 346 346 LEU LEU H . n 
P  16 347 VAL 347 347 347 VAL VAL H . n 
P  16 348 LEU 348 348 348 LEU LEU H . n 
P  16 349 LEU 349 349 349 LEU LEU H . n 
P  16 350 GLY 350 350 350 GLY GLY H . n 
P  16 351 ALA 351 351 351 ALA ALA H . n 
P  16 352 VAL 352 352 352 VAL VAL H . n 
P  16 353 LEU 353 353 353 LEU LEU H . n 
P  16 354 TYR 354 354 354 TYR TYR H . n 
P  16 355 THR 355 355 ?   ?   ?   H . n 
P  16 356 PRO 356 356 ?   ?   ?   H . n 
P  16 357 LYS 357 357 ?   ?   ?   H . n 
P  16 358 PRO 358 358 ?   ?   ?   H . n 
P  16 359 ALA 359 359 ?   ?   ?   H . n 
P  16 360 ARG 360 360 ?   ?   ?   H . n 
P  16 361 LYS 361 361 ?   ?   ?   H . n 
P  16 362 GLY 362 362 ?   ?   ?   H . n 
P  16 363 GLY 363 363 ?   ?   ?   H . n 
P  16 364 GLY 364 364 ?   ?   ?   H . n 
P  16 365 ALA 365 365 ?   ?   ?   H . n 
Q  1  1   MET 1   1   ?   ?   ?   B . n 
Q  1  2   THR 2   2   2   THR THR B . n 
Q  1  3   GLY 3   3   3   GLY GLY B . n 
Q  1  4   PRO 4   4   4   PRO PRO B . n 
Q  1  5   ILE 5   5   5   ILE ILE B . n 
Q  1  6   LEU 6   6   6   LEU LEU B . n 
Q  1  7   SER 7   7   7   SER SER B . n 
Q  1  8   GLY 8   8   8   GLY GLY B . n 
Q  1  9   LEU 9   9   9   LEU LEU B . n 
Q  1  10  ASP 10  10  10  ASP ASP B . n 
Q  1  11  PRO 11  11  11  PRO PRO B . n 
Q  1  12  ARG 12  12  12  ARG ARG B . n 
Q  1  13  PHE 13  13  13  PHE PHE B . n 
Q  1  14  GLU 14  14  14  GLU GLU B . n 
Q  1  15  ARG 15  15  15  ARG ARG B . n 
Q  1  16  THR 16  16  16  THR THR B . n 
Q  1  17  LEU 17  17  17  LEU LEU B . n 
Q  1  18  TYR 18  18  18  TYR TYR B . n 
Q  1  19  ALA 19  19  19  ALA ALA B . n 
Q  1  20  HIS 20  20  20  HIS HIS B . n 
Q  1  21  VAL 21  21  21  VAL VAL B . n 
Q  1  22  GLY 22  22  22  GLY GLY B . n 
Q  1  23  LYS 23  23  23  LYS LYS B . n 
Q  1  24  GLU 24  24  24  GLU GLU B . n 
Q  1  25  GLY 25  25  25  GLY GLY B . n 
Q  1  26  SER 26  26  26  SER SER B . n 
Q  1  27  TRP 27  27  27  TRP TRP B . n 
Q  1  28  THR 28  28  28  THR THR B . n 
Q  1  29  LEU 29  29  29  LEU LEU B . n 
Q  1  30  ASP 30  30  30  ASP ASP B . n 
Q  1  31  TYR 31  31  31  TYR TYR B . n 
Q  1  32  TYR 32  32  32  TYR TYR B . n 
Q  1  33  LEU 33  33  33  LEU LEU B . n 
Q  1  34  ARG 34  34  34  ARG ARG B . n 
Q  1  35  HIS 35  35  35  HIS HIS B . n 
Q  1  36  GLY 36  36  36  GLY GLY B . n 
Q  1  37  GLY 37  37  37  GLY GLY B . n 
Q  1  38  TYR 38  38  38  TYR TYR B . n 
Q  1  39  GLU 39  39  39  GLU GLU B . n 
Q  1  40  THR 40  40  40  THR THR B . n 
Q  1  41  ALA 41  41  41  ALA ALA B . n 
Q  1  42  LYS 42  42  42  LYS LYS B . n 
Q  1  43  ARG 43  43  43  ARG ARG B . n 
Q  1  44  VAL 44  44  44  VAL VAL B . n 
Q  1  45  LEU 45  45  45  LEU LEU B . n 
Q  1  46  LYS 46  46  46  LYS LYS B . n 
Q  1  47  GLU 47  47  47  GLU GLU B . n 
Q  1  48  LYS 48  48  48  LYS LYS B . n 
Q  1  49  THR 49  49  49  THR THR B . n 
Q  1  50  PRO 50  50  50  PRO PRO B . n 
Q  1  51  ASP 51  51  51  ASP ASP B . n 
Q  1  52  GLU 52  52  52  GLU GLU B . n 
Q  1  53  VAL 53  53  53  VAL VAL B . n 
Q  1  54  ILE 54  54  54  ILE ILE B . n 
Q  1  55  GLU 55  55  55  GLU GLU B . n 
Q  1  56  GLU 56  56  56  GLU GLU B . n 
Q  1  57  VAL 57  57  57  VAL VAL B . n 
Q  1  58  LYS 58  58  58  LYS LYS B . n 
Q  1  59  ARG 59  59  59  ARG ARG B . n 
Q  1  60  SER 60  60  60  SER SER B . n 
Q  1  61  GLY 61  61  61  GLY GLY B . n 
Q  1  62  LEU 62  62  62  LEU LEU B . n 
Q  1  63  ARG 63  63  63  ARG ARG B . n 
Q  1  64  GLY 64  64  64  GLY GLY B . n 
Q  1  65  ARG 65  65  65  ARG ARG B . n 
Q  1  66  GLY 66  66  66  GLY GLY B . n 
Q  1  67  GLY 67  67  67  GLY GLY B . n 
Q  1  68  ALA 68  68  68  ALA ALA B . n 
Q  1  69  GLY 69  69  69  GLY GLY B . n 
Q  1  70  PHE 70  70  70  PHE PHE B . n 
Q  1  71  PRO 71  71  71  PRO PRO B . n 
Q  1  72  THR 72  72  72  THR THR B . n 
Q  1  73  GLY 73  73  73  GLY GLY B . n 
Q  1  74  LEU 74  74  74  LEU LEU B . n 
Q  1  75  LYS 75  75  75  LYS LYS B . n 
Q  1  76  TRP 76  76  76  TRP TRP B . n 
Q  1  77  SER 77  77  77  SER SER B . n 
Q  1  78  PHE 78  78  78  PHE PHE B . n 
Q  1  79  MET 79  79  79  MET MET B . n 
Q  1  80  PRO 80  80  80  PRO PRO B . n 
Q  1  81  LYS 81  81  81  LYS LYS B . n 
Q  1  82  ASP 82  82  82  ASP ASP B . n 
Q  1  83  ASP 83  83  83  ASP ASP B . n 
Q  1  84  GLY 84  84  84  GLY GLY B . n 
Q  1  85  LYS 85  85  85  LYS LYS B . n 
Q  1  86  GLN 86  86  86  GLN GLN B . n 
Q  1  87  HIS 87  87  87  HIS HIS B . n 
Q  1  88  TYR 88  88  88  TYR TYR B . n 
Q  1  89  LEU 89  89  89  LEU LEU B . n 
Q  1  90  ILE 90  90  90  ILE ILE B . n 
Q  1  91  CYS 91  91  91  CYS CYS B . n 
Q  1  92  ASN 92  92  92  ASN ASN B . n 
Q  1  93  ALA 93  93  93  ALA ALA B . n 
Q  1  94  ASP 94  94  94  ASP ASP B . n 
Q  1  95  GLU 95  95  95  GLU GLU B . n 
Q  1  96  SER 96  96  96  SER SER B . n 
Q  1  97  GLU 97  97  97  GLU GLU B . n 
Q  1  98  PRO 98  98  98  PRO PRO B . n 
Q  1  99  GLY 99  99  99  GLY GLY B . n 
Q  1  100 SER 100 100 100 SER SER B . n 
Q  1  101 PHE 101 101 101 PHE PHE B . n 
Q  1  102 LYS 102 102 102 LYS LYS B . n 
Q  1  103 ASP 103 103 103 ASP ASP B . n 
Q  1  104 ARG 104 104 104 ARG ARG B . n 
Q  1  105 TYR 105 105 105 TYR TYR B . n 
Q  1  106 ILE 106 106 106 ILE ILE B . n 
Q  1  107 LEU 107 107 107 LEU LEU B . n 
Q  1  108 GLU 108 108 108 GLU GLU B . n 
Q  1  109 ASP 109 109 109 ASP ASP B . n 
Q  1  110 VAL 110 110 110 VAL VAL B . n 
Q  1  111 PRO 111 111 111 PRO PRO B . n 
Q  1  112 HIS 112 112 112 HIS HIS B . n 
Q  1  113 LEU 113 113 113 LEU LEU B . n 
Q  1  114 LEU 114 114 114 LEU LEU B . n 
Q  1  115 ILE 115 115 115 ILE ILE B . n 
Q  1  116 GLU 116 116 116 GLU GLU B . n 
Q  1  117 GLY 117 117 117 GLY GLY B . n 
Q  1  118 MET 118 118 118 MET MET B . n 
Q  1  119 ILE 119 119 119 ILE ILE B . n 
Q  1  120 LEU 120 120 120 LEU LEU B . n 
Q  1  121 ALA 121 121 121 ALA ALA B . n 
Q  1  122 GLY 122 122 122 GLY GLY B . n 
Q  1  123 TYR 123 123 123 TYR TYR B . n 
Q  1  124 ALA 124 124 124 ALA ALA B . n 
Q  1  125 ILE 125 125 125 ILE ILE B . n 
Q  1  126 ARG 126 126 126 ARG ARG B . n 
Q  1  127 ALA 127 127 127 ALA ALA B . n 
Q  1  128 THR 128 128 128 THR THR B . n 
Q  1  129 VAL 129 129 129 VAL VAL B . n 
Q  1  130 GLY 130 130 130 GLY GLY B . n 
Q  1  131 TYR 131 131 131 TYR TYR B . n 
Q  1  132 ILE 132 132 132 ILE ILE B . n 
Q  1  133 TYR 133 133 133 TYR TYR B . n 
Q  1  134 VAL 134 134 134 VAL VAL B . n 
Q  1  135 ARG 135 135 135 ARG ARG B . n 
Q  1  136 GLY 136 136 136 GLY GLY B . n 
Q  1  137 GLU 137 137 137 GLU GLU B . n 
Q  1  138 TYR 138 138 138 TYR TYR B . n 
Q  1  139 ARG 139 139 139 ARG ARG B . n 
Q  1  140 ARG 140 140 140 ARG ARG B . n 
Q  1  141 ALA 141 141 141 ALA ALA B . n 
Q  1  142 ALA 142 142 142 ALA ALA B . n 
Q  1  143 ASP 143 143 143 ASP ASP B . n 
Q  1  144 ARG 144 144 144 ARG ARG B . n 
Q  1  145 LEU 145 145 145 LEU LEU B . n 
Q  1  146 GLU 146 146 146 GLU GLU B . n 
Q  1  147 GLN 147 147 147 GLN GLN B . n 
Q  1  148 ALA 148 148 148 ALA ALA B . n 
Q  1  149 ILE 149 149 149 ILE ILE B . n 
Q  1  150 LYS 150 150 150 LYS LYS B . n 
Q  1  151 GLU 151 151 151 GLU GLU B . n 
Q  1  152 ALA 152 152 152 ALA ALA B . n 
Q  1  153 ARG 153 153 153 ARG ARG B . n 
Q  1  154 ALA 154 154 154 ALA ALA B . n 
Q  1  155 ARG 155 155 155 ARG ARG B . n 
Q  1  156 GLY 156 156 156 GLY GLY B . n 
Q  1  157 TYR 157 157 157 TYR TYR B . n 
Q  1  158 LEU 158 158 158 LEU LEU B . n 
Q  1  159 GLY 159 159 159 GLY GLY B . n 
Q  1  160 LYS 160 160 160 LYS LYS B . n 
Q  1  161 ASN 161 161 161 ASN ASN B . n 
Q  1  162 LEU 162 162 162 LEU LEU B . n 
Q  1  163 PHE 163 163 163 PHE PHE B . n 
Q  1  164 GLY 164 164 164 GLY GLY B . n 
Q  1  165 THR 165 165 165 THR THR B . n 
Q  1  166 ASP 166 166 166 ASP ASP B . n 
Q  1  167 PHE 167 167 167 PHE PHE B . n 
Q  1  168 SER 168 168 168 SER SER B . n 
Q  1  169 PHE 169 169 169 PHE PHE B . n 
Q  1  170 ASP 170 170 170 ASP ASP B . n 
Q  1  171 LEU 171 171 171 LEU LEU B . n 
Q  1  172 HIS 172 172 172 HIS HIS B . n 
Q  1  173 VAL 173 173 173 VAL VAL B . n 
Q  1  174 HIS 174 174 174 HIS HIS B . n 
Q  1  175 ARG 175 175 175 ARG ARG B . n 
Q  1  176 GLY 176 176 176 GLY GLY B . n 
Q  1  177 ALA 177 177 177 ALA ALA B . n 
Q  1  178 GLY 178 178 178 GLY GLY B . n 
Q  1  179 ALA 179 179 179 ALA ALA B . n 
Q  1  180 TYR 180 180 180 TYR TYR B . n 
Q  1  181 ILE 181 181 181 ILE ILE B . n 
Q  1  182 CYS 182 182 182 CYS CYS B . n 
Q  1  183 GLY 183 183 183 GLY GLY B . n 
Q  1  184 GLU 184 184 184 GLU GLU B . n 
Q  1  185 GLU 185 185 185 GLU GLU B . n 
Q  1  186 THR 186 186 186 THR THR B . n 
Q  1  187 ALA 187 187 187 ALA ALA B . n 
Q  1  188 LEU 188 188 188 LEU LEU B . n 
Q  1  189 MET 189 189 189 MET MET B . n 
Q  1  190 ASN 190 190 190 ASN ASN B . n 
Q  1  191 SER 191 191 191 SER SER B . n 
Q  1  192 LEU 192 192 192 LEU LEU B . n 
Q  1  193 GLU 193 193 193 GLU GLU B . n 
Q  1  194 GLY 194 194 194 GLY GLY B . n 
Q  1  195 LEU 195 195 195 LEU LEU B . n 
Q  1  196 ARG 196 196 196 ARG ARG B . n 
Q  1  197 ALA 197 197 197 ALA ALA B . n 
Q  1  198 ASN 198 198 198 ASN ASN B . n 
Q  1  199 PRO 199 199 199 PRO PRO B . n 
Q  1  200 ARG 200 200 200 ARG ARG B . n 
Q  1  201 LEU 201 201 201 LEU LEU B . n 
Q  1  202 LYS 202 202 202 LYS LYS B . n 
Q  1  203 PRO 203 203 203 PRO PRO B . n 
Q  1  204 PRO 204 204 204 PRO PRO B . n 
Q  1  205 PHE 205 205 205 PHE PHE B . n 
Q  1  206 PRO 206 206 206 PRO PRO B . n 
Q  1  207 ALA 207 207 207 ALA ALA B . n 
Q  1  208 GLN 208 208 208 GLN GLN B . n 
Q  1  209 SER 209 209 209 SER SER B . n 
Q  1  210 GLY 210 210 210 GLY GLY B . n 
Q  1  211 LEU 211 211 211 LEU LEU B . n 
Q  1  212 TRP 212 212 212 TRP TRP B . n 
Q  1  213 GLY 213 213 213 GLY GLY B . n 
Q  1  214 LYS 214 214 214 LYS LYS B . n 
Q  1  215 PRO 215 215 215 PRO PRO B . n 
Q  1  216 THR 216 216 216 THR THR B . n 
Q  1  217 THR 217 217 217 THR THR B . n 
Q  1  218 ILE 218 218 218 ILE ILE B . n 
Q  1  219 ASN 219 219 219 ASN ASN B . n 
Q  1  220 ASN 220 220 220 ASN ASN B . n 
Q  1  221 VAL 221 221 221 VAL VAL B . n 
Q  1  222 GLU 222 222 222 GLU GLU B . n 
Q  1  223 THR 223 223 223 THR THR B . n 
Q  1  224 LEU 224 224 224 LEU LEU B . n 
Q  1  225 ALA 225 225 225 ALA ALA B . n 
Q  1  226 SER 226 226 226 SER SER B . n 
Q  1  227 VAL 227 227 227 VAL VAL B . n 
Q  1  228 VAL 228 228 228 VAL VAL B . n 
Q  1  229 PRO 229 229 229 PRO PRO B . n 
Q  1  230 ILE 230 230 230 ILE ILE B . n 
Q  1  231 MET 231 231 231 MET MET B . n 
Q  1  232 GLU 232 232 232 GLU GLU B . n 
Q  1  233 ARG 233 233 233 ARG ARG B . n 
Q  1  234 GLY 234 234 234 GLY GLY B . n 
Q  1  235 ALA 235 235 235 ALA ALA B . n 
Q  1  236 ASP 236 236 236 ASP ASP B . n 
Q  1  237 TRP 237 237 237 TRP TRP B . n 
Q  1  238 PHE 238 238 238 PHE PHE B . n 
Q  1  239 ALA 239 239 239 ALA ALA B . n 
Q  1  240 GLN 240 240 240 GLN GLN B . n 
Q  1  241 MET 241 241 241 MET MET B . n 
Q  1  242 GLY 242 242 242 GLY GLY B . n 
Q  1  243 THR 243 243 243 THR THR B . n 
Q  1  244 GLU 244 244 244 GLU GLU B . n 
Q  1  245 GLN 245 245 245 GLN GLN B . n 
Q  1  246 SER 246 246 246 SER SER B . n 
Q  1  247 LYS 247 247 247 LYS LYS B . n 
Q  1  248 GLY 248 248 248 GLY GLY B . n 
Q  1  249 MET 249 249 249 MET MET B . n 
Q  1  250 LYS 250 250 250 LYS LYS B . n 
Q  1  251 LEU 251 251 251 LEU LEU B . n 
Q  1  252 TYR 252 252 252 TYR TYR B . n 
Q  1  253 GLN 253 253 253 GLN GLN B . n 
Q  1  254 ILE 254 254 254 ILE ILE B . n 
Q  1  255 SER 255 255 255 SER SER B . n 
Q  1  256 GLY 256 256 256 GLY GLY B . n 
Q  1  257 PRO 257 257 257 PRO PRO B . n 
Q  1  258 VAL 258 258 258 VAL VAL B . n 
Q  1  259 LYS 259 259 259 LYS LYS B . n 
Q  1  260 ARG 260 260 260 ARG ARG B . n 
Q  1  261 PRO 261 261 261 PRO PRO B . n 
Q  1  262 GLY 262 262 262 GLY GLY B . n 
Q  1  263 VAL 263 263 263 VAL VAL B . n 
Q  1  264 TYR 264 264 264 TYR TYR B . n 
Q  1  265 GLU 265 265 265 GLU GLU B . n 
Q  1  266 LEU 266 266 266 LEU LEU B . n 
Q  1  267 PRO 267 267 267 PRO PRO B . n 
Q  1  268 MET 268 268 268 MET MET B . n 
Q  1  269 GLY 269 269 269 GLY GLY B . n 
Q  1  270 THR 270 270 270 THR THR B . n 
Q  1  271 THR 271 271 271 THR THR B . n 
Q  1  272 PHE 272 272 272 PHE PHE B . n 
Q  1  273 ARG 273 273 273 ARG ARG B . n 
Q  1  274 GLU 274 274 274 GLU GLU B . n 
Q  1  275 LEU 275 275 275 LEU LEU B . n 
Q  1  276 ILE 276 276 276 ILE ILE B . n 
Q  1  277 TYR 277 277 277 TYR TYR B . n 
Q  1  278 GLU 278 278 278 GLU GLU B . n 
Q  1  279 TRP 279 279 279 TRP TRP B . n 
Q  1  280 ALA 280 280 280 ALA ALA B . n 
Q  1  281 GLY 281 281 281 GLY GLY B . n 
Q  1  282 GLY 282 282 282 GLY GLY B . n 
Q  1  283 PRO 283 283 283 PRO PRO B . n 
Q  1  284 LEU 284 284 284 LEU LEU B . n 
Q  1  285 GLU 285 285 285 GLU GLU B . n 
Q  1  286 PRO 286 286 286 PRO PRO B . n 
Q  1  287 ILE 287 287 287 ILE ILE B . n 
Q  1  288 GLN 288 288 288 GLN GLN B . n 
Q  1  289 ALA 289 289 289 ALA ALA B . n 
Q  1  290 ILE 290 290 290 ILE ILE B . n 
Q  1  291 ILE 291 291 291 ILE ILE B . n 
Q  1  292 PRO 292 292 292 PRO PRO B . n 
Q  1  293 GLY 293 293 293 GLY GLY B . n 
Q  1  294 GLY 294 294 294 GLY GLY B . n 
Q  1  295 SER 295 295 295 SER SER B . n 
Q  1  296 SER 296 296 296 SER SER B . n 
Q  1  297 THR 297 297 297 THR THR B . n 
Q  1  298 PRO 298 298 298 PRO PRO B . n 
Q  1  299 PRO 299 299 299 PRO PRO B . n 
Q  1  300 LEU 300 300 300 LEU LEU B . n 
Q  1  301 PRO 301 301 301 PRO PRO B . n 
Q  1  302 PHE 302 302 302 PHE PHE B . n 
Q  1  303 THR 303 303 303 THR THR B . n 
Q  1  304 GLU 304 304 304 GLU GLU B . n 
Q  1  305 GLU 305 305 305 GLU GLU B . n 
Q  1  306 VAL 306 306 306 VAL VAL B . n 
Q  1  307 LEU 307 307 307 LEU LEU B . n 
Q  1  308 ASP 308 308 308 ASP ASP B . n 
Q  1  309 THR 309 309 309 THR THR B . n 
Q  1  310 PRO 310 310 310 PRO PRO B . n 
Q  1  311 MET 311 311 311 MET MET B . n 
Q  1  312 SER 312 312 312 SER SER B . n 
Q  1  313 TYR 313 313 313 TYR TYR B . n 
Q  1  314 GLU 314 314 314 GLU GLU B . n 
Q  1  315 HIS 315 315 315 HIS HIS B . n 
Q  1  316 LEU 316 316 316 LEU LEU B . n 
Q  1  317 GLN 317 317 317 GLN GLN B . n 
Q  1  318 ALA 318 318 318 ALA ALA B . n 
Q  1  319 LYS 319 319 319 LYS LYS B . n 
Q  1  320 GLY 320 320 320 GLY GLY B . n 
Q  1  321 SER 321 321 321 SER SER B . n 
Q  1  322 MET 322 322 322 MET MET B . n 
Q  1  323 LEU 323 323 323 LEU LEU B . n 
Q  1  324 GLY 324 324 324 GLY GLY B . n 
Q  1  325 THR 325 325 325 THR THR B . n 
Q  1  326 GLY 326 326 326 GLY GLY B . n 
Q  1  327 GLY 327 327 327 GLY GLY B . n 
Q  1  328 VAL 328 328 328 VAL VAL B . n 
Q  1  329 ILE 329 329 329 ILE ILE B . n 
Q  1  330 LEU 330 330 330 LEU LEU B . n 
Q  1  331 ILE 331 331 331 ILE ILE B . n 
Q  1  332 PRO 332 332 332 PRO PRO B . n 
Q  1  333 GLU 333 333 333 GLU GLU B . n 
Q  1  334 ARG 334 334 334 ARG ARG B . n 
Q  1  335 VAL 335 335 335 VAL VAL B . n 
Q  1  336 SER 336 336 336 SER SER B . n 
Q  1  337 MET 337 337 337 MET MET B . n 
Q  1  338 VAL 338 338 338 VAL VAL B . n 
Q  1  339 ASP 339 339 339 ASP ASP B . n 
Q  1  340 ALA 340 340 340 ALA ALA B . n 
Q  1  341 MET 341 341 341 MET MET B . n 
Q  1  342 TRP 342 342 342 TRP TRP B . n 
Q  1  343 ASN 343 343 343 ASN ASN B . n 
Q  1  344 LEU 344 344 344 LEU LEU B . n 
Q  1  345 THR 345 345 345 THR THR B . n 
Q  1  346 ARG 346 346 346 ARG ARG B . n 
Q  1  347 PHE 347 347 347 PHE PHE B . n 
Q  1  348 TYR 348 348 348 TYR TYR B . n 
Q  1  349 ALA 349 349 349 ALA ALA B . n 
Q  1  350 HIS 350 350 350 HIS HIS B . n 
Q  1  351 GLU 351 351 351 GLU GLU B . n 
Q  1  352 SER 352 352 352 SER SER B . n 
Q  1  353 CYS 353 353 353 CYS CYS B . n 
Q  1  354 GLY 354 354 354 GLY GLY B . n 
Q  1  355 LYS 355 355 355 LYS LYS B . n 
Q  1  356 CYS 356 356 356 CYS CYS B . n 
Q  1  357 THR 357 357 357 THR THR B . n 
Q  1  358 PRO 358 358 358 PRO PRO B . n 
Q  1  359 CYS 359 359 359 CYS CYS B . n 
Q  1  360 ARG 360 360 360 ARG ARG B . n 
Q  1  361 GLU 361 361 361 GLU GLU B . n 
Q  1  362 GLY 362 362 362 GLY GLY B . n 
Q  1  363 VAL 363 363 363 VAL VAL B . n 
Q  1  364 ALA 364 364 364 ALA ALA B . n 
Q  1  365 GLY 365 365 365 GLY GLY B . n 
Q  1  366 PHE 366 366 366 PHE PHE B . n 
Q  1  367 MET 367 367 367 MET MET B . n 
Q  1  368 VAL 368 368 368 VAL VAL B . n 
Q  1  369 ASN 369 369 369 ASN ASN B . n 
Q  1  370 LEU 370 370 370 LEU LEU B . n 
Q  1  371 PHE 371 371 371 PHE PHE B . n 
Q  1  372 ALA 372 372 372 ALA ALA B . n 
Q  1  373 LYS 373 373 373 LYS LYS B . n 
Q  1  374 ILE 374 374 374 ILE ILE B . n 
Q  1  375 GLY 375 375 375 GLY GLY B . n 
Q  1  376 THR 376 376 376 THR THR B . n 
Q  1  377 GLY 377 377 377 GLY GLY B . n 
Q  1  378 GLN 378 378 378 GLN GLN B . n 
Q  1  379 GLY 379 379 379 GLY GLY B . n 
Q  1  380 GLU 380 380 380 GLU GLU B . n 
Q  1  381 GLU 381 381 381 GLU GLU B . n 
Q  1  382 LYS 382 382 382 LYS LYS B . n 
Q  1  383 ASP 383 383 383 ASP ASP B . n 
Q  1  384 VAL 384 384 384 VAL VAL B . n 
Q  1  385 GLU 385 385 385 GLU GLU B . n 
Q  1  386 ASN 386 386 386 ASN ASN B . n 
Q  1  387 LEU 387 387 387 LEU LEU B . n 
Q  1  388 GLU 388 388 388 GLU GLU B . n 
Q  1  389 ALA 389 389 389 ALA ALA B . n 
Q  1  390 LEU 390 390 390 LEU LEU B . n 
Q  1  391 LEU 391 391 391 LEU LEU B . n 
Q  1  392 PRO 392 392 392 PRO PRO B . n 
Q  1  393 LEU 393 393 393 LEU LEU B . n 
Q  1  394 ILE 394 394 394 ILE ILE B . n 
Q  1  395 GLU 395 395 395 GLU GLU B . n 
Q  1  396 GLY 396 396 396 GLY GLY B . n 
Q  1  397 ARG 397 397 397 ARG ARG B . n 
Q  1  398 SER 398 398 398 SER SER B . n 
Q  1  399 PHE 399 399 399 PHE PHE B . n 
Q  1  400 CYS 400 400 400 CYS CYS B . n 
Q  1  401 PRO 401 401 401 PRO PRO B . n 
Q  1  402 LEU 402 402 402 LEU LEU B . n 
Q  1  403 ALA 403 403 403 ALA ALA B . n 
Q  1  404 ASP 404 404 404 ASP ASP B . n 
Q  1  405 ALA 405 405 405 ALA ALA B . n 
Q  1  406 ALA 406 406 406 ALA ALA B . n 
Q  1  407 VAL 407 407 407 VAL VAL B . n 
Q  1  408 TRP 408 408 408 TRP TRP B . n 
Q  1  409 PRO 409 409 409 PRO PRO B . n 
Q  1  410 VAL 410 410 410 VAL VAL B . n 
Q  1  411 LYS 411 411 411 LYS LYS B . n 
Q  1  412 GLY 412 412 412 GLY GLY B . n 
Q  1  413 SER 413 413 413 SER SER B . n 
Q  1  414 LEU 414 414 414 LEU LEU B . n 
Q  1  415 ARG 415 415 415 ARG ARG B . n 
Q  1  416 HIS 416 416 416 HIS HIS B . n 
Q  1  417 PHE 417 417 417 PHE PHE B . n 
Q  1  418 LYS 418 418 418 LYS LYS B . n 
Q  1  419 ASP 419 419 419 ASP ASP B . n 
Q  1  420 GLN 420 420 420 GLN GLN B . n 
Q  1  421 TYR 421 421 421 TYR TYR B . n 
Q  1  422 LEU 422 422 422 LEU LEU B . n 
Q  1  423 ALA 423 423 423 ALA ALA B . n 
Q  1  424 LEU 424 424 424 LEU LEU B . n 
Q  1  425 ALA 425 425 425 ALA ALA B . n 
Q  1  426 ARG 426 426 426 ARG ARG B . n 
Q  1  427 GLU 427 427 427 GLU GLU B . n 
Q  1  428 LYS 428 428 428 LYS LYS B . n 
Q  1  429 ARG 429 429 429 ARG ARG B . n 
Q  1  430 PRO 430 430 430 PRO PRO B . n 
Q  1  431 VAL 431 431 431 VAL VAL B . n 
Q  1  432 PRO 432 432 432 PRO PRO B . n 
Q  1  433 ARG 433 433 433 ARG ARG B . n 
Q  1  434 PRO 434 434 434 PRO PRO B . n 
Q  1  435 SER 435 435 435 SER SER B . n 
Q  1  436 LEU 436 436 436 LEU LEU B . n 
Q  1  437 TRP 437 437 437 TRP TRP B . n 
Q  1  438 ARG 438 438 438 ARG ARG B . n 
R  2  1   MET 1   1   ?   ?   ?   C . n 
R  2  2   GLY 2   2   ?   ?   ?   C . n 
R  2  3   PHE 3   3   3   PHE PHE C . n 
R  2  4   PHE 4   4   4   PHE PHE C . n 
R  2  5   ASP 5   5   5   ASP ASP C . n 
R  2  6   ASP 6   6   6   ASP ASP C . n 
R  2  7   LYS 7   7   7   LYS LYS C . n 
R  2  8   GLN 8   8   8   GLN GLN C . n 
R  2  9   ASP 9   9   9   ASP ASP C . n 
R  2  10  PHE 10  10  10  PHE PHE C . n 
R  2  11  LEU 11  11  11  LEU LEU C . n 
R  2  12  GLU 12  12  12  GLU GLU C . n 
R  2  13  GLU 13  13  13  GLU GLU C . n 
R  2  14  THR 14  14  14  THR THR C . n 
R  2  15  PHE 15  15  15  PHE PHE C . n 
R  2  16  ALA 16  16  16  ALA ALA C . n 
R  2  17  LYS 17  17  17  LYS LYS C . n 
R  2  18  TYR 18  18  18  TYR TYR C . n 
R  2  19  PRO 19  19  19  PRO PRO C . n 
R  2  20  PRO 20  20  20  PRO PRO C . n 
R  2  21  GLU 21  21  21  GLU GLU C . n 
R  2  22  GLY 22  22  22  GLY GLY C . n 
R  2  23  ARG 23  23  23  ARG ARG C . n 
R  2  24  ARG 24  24  24  ARG ARG C . n 
R  2  25  ALA 25  25  25  ALA ALA C . n 
R  2  26  ALA 26  26  26  ALA ALA C . n 
R  2  27  ILE 27  27  27  ILE ILE C . n 
R  2  28  MET 28  28  28  MET MET C . n 
R  2  29  PRO 29  29  29  PRO PRO C . n 
R  2  30  LEU 30  30  30  LEU LEU C . n 
R  2  31  LEU 31  31  31  LEU LEU C . n 
R  2  32  ARG 32  32  32  ARG ARG C . n 
R  2  33  ARG 33  33  33  ARG ARG C . n 
R  2  34  VAL 34  34  34  VAL VAL C . n 
R  2  35  GLN 35  35  35  GLN GLN C . n 
R  2  36  GLN 36  36  36  GLN GLN C . n 
R  2  37  GLU 37  37  37  GLU GLU C . n 
R  2  38  GLU 38  38  38  GLU GLU C . n 
R  2  39  GLY 39  39  39  GLY GLY C . n 
R  2  40  TRP 40  40  40  TRP TRP C . n 
R  2  41  ILE 41  41  41  ILE ILE C . n 
R  2  42  ARG 42  42  42  ARG ARG C . n 
R  2  43  PRO 43  43  43  PRO PRO C . n 
R  2  44  GLU 44  44  44  GLU GLU C . n 
R  2  45  ARG 45  45  45  ARG ARG C . n 
R  2  46  ILE 46  46  46  ILE ILE C . n 
R  2  47  GLU 47  47  47  GLU GLU C . n 
R  2  48  GLU 48  48  48  GLU GLU C . n 
R  2  49  ILE 49  49  49  ILE ILE C . n 
R  2  50  ALA 50  50  50  ALA ALA C . n 
R  2  51  ARG 51  51  51  ARG ARG C . n 
R  2  52  LEU 52  52  52  LEU LEU C . n 
R  2  53  VAL 53  53  53  VAL VAL C . n 
R  2  54  GLY 54  54  54  GLY GLY C . n 
R  2  55  THR 55  55  55  THR THR C . n 
R  2  56  THR 56  56  56  THR THR C . n 
R  2  57  PRO 57  57  57  PRO PRO C . n 
R  2  58  THR 58  58  58  THR THR C . n 
R  2  59  GLU 59  59  59  GLU GLU C . n 
R  2  60  VAL 60  60  60  VAL VAL C . n 
R  2  61  MET 61  61  61  MET MET C . n 
R  2  62  GLY 62  62  62  GLY GLY C . n 
R  2  63  VAL 63  63  63  VAL VAL C . n 
R  2  64  ALA 64  64  64  ALA ALA C . n 
R  2  65  SER 65  65  65  SER SER C . n 
R  2  66  PHE 66  66  66  PHE PHE C . n 
R  2  67  TYR 67  67  67  TYR TYR C . n 
R  2  68  SER 68  68  68  SER SER C . n 
R  2  69  TYR 69  69  69  TYR TYR C . n 
R  2  70  TYR 70  70  70  TYR TYR C . n 
R  2  71  GLN 71  71  71  GLN GLN C . n 
R  2  72  PHE 72  72  72  PHE PHE C . n 
R  2  73  VAL 73  73  73  VAL VAL C . n 
R  2  74  PRO 74  74  74  PRO PRO C . n 
R  2  75  THR 75  75  75  THR THR C . n 
R  2  76  GLY 76  76  76  GLY GLY C . n 
R  2  77  LYS 77  77  77  LYS LYS C . n 
R  2  78  TYR 78  78  78  TYR TYR C . n 
R  2  79  HIS 79  79  79  HIS HIS C . n 
R  2  80  LEU 80  80  80  LEU LEU C . n 
R  2  81  GLN 81  81  81  GLN GLN C . n 
R  2  82  VAL 82  82  82  VAL VAL C . n 
R  2  83  CYS 83  83  83  CYS CYS C . n 
R  2  84  ALA 84  84  84  ALA ALA C . n 
R  2  85  THR 85  85  85  THR THR C . n 
R  2  86  LEU 86  86  86  LEU LEU C . n 
R  2  87  SER 87  87  87  SER SER C . n 
R  2  88  CYS 88  88  88  CYS CYS C . n 
R  2  89  LYS 89  89  89  LYS LYS C . n 
R  2  90  LEU 90  90  90  LEU LEU C . n 
R  2  91  ALA 91  91  91  ALA ALA C . n 
R  2  92  GLY 92  92  92  GLY GLY C . n 
R  2  93  ALA 93  93  93  ALA ALA C . n 
R  2  94  GLU 94  94  94  GLU GLU C . n 
R  2  95  GLU 95  95  95  GLU GLU C . n 
R  2  96  LEU 96  96  96  LEU LEU C . n 
R  2  97  TRP 97  97  97  TRP TRP C . n 
R  2  98  ASP 98  98  98  ASP ASP C . n 
R  2  99  TYR 99  99  99  TYR TYR C . n 
R  2  100 LEU 100 100 100 LEU LEU C . n 
R  2  101 THR 101 101 101 THR THR C . n 
R  2  102 GLU 102 102 102 GLU GLU C . n 
R  2  103 THR 103 103 103 THR THR C . n 
R  2  104 LEU 104 104 104 LEU LEU C . n 
R  2  105 GLY 105 105 105 GLY GLY C . n 
R  2  106 ILE 106 106 106 ILE ILE C . n 
R  2  107 GLY 107 107 107 GLY GLY C . n 
R  2  108 PRO 108 108 108 PRO PRO C . n 
R  2  109 GLY 109 109 109 GLY GLY C . n 
R  2  110 GLU 110 110 110 GLU GLU C . n 
R  2  111 VAL 111 111 111 VAL VAL C . n 
R  2  112 THR 112 112 112 THR THR C . n 
R  2  113 PRO 113 113 113 PRO PRO C . n 
R  2  114 ASP 114 114 114 ASP ASP C . n 
R  2  115 GLY 115 115 115 GLY GLY C . n 
R  2  116 LEU 116 116 116 LEU LEU C . n 
R  2  117 PHE 117 117 117 PHE PHE C . n 
R  2  118 SER 118 118 118 SER SER C . n 
R  2  119 VAL 119 119 119 VAL VAL C . n 
R  2  120 GLN 120 120 120 GLN GLN C . n 
R  2  121 LYS 121 121 121 LYS LYS C . n 
R  2  122 VAL 122 122 122 VAL VAL C . n 
R  2  123 GLU 123 123 123 GLU GLU C . n 
R  2  124 CYS 124 124 124 CYS CYS C . n 
R  2  125 LEU 125 125 125 LEU LEU C . n 
R  2  126 GLY 126 126 126 GLY GLY C . n 
R  2  127 SER 127 127 127 SER SER C . n 
R  2  128 CYS 128 128 128 CYS CYS C . n 
R  2  129 HIS 129 129 129 HIS HIS C . n 
R  2  130 THR 130 130 130 THR THR C . n 
R  2  131 ALA 131 131 131 ALA ALA C . n 
R  2  132 PRO 132 132 132 PRO PRO C . n 
R  2  133 VAL 133 133 133 VAL VAL C . n 
R  2  134 ILE 134 134 134 ILE ILE C . n 
R  2  135 GLN 135 135 135 GLN GLN C . n 
R  2  136 VAL 136 136 136 VAL VAL C . n 
R  2  137 ASN 137 137 137 ASN ASN C . n 
R  2  138 ASP 138 138 138 ASP ASP C . n 
R  2  139 GLU 139 139 139 GLU GLU C . n 
R  2  140 PRO 140 140 140 PRO PRO C . n 
R  2  141 TYR 141 141 141 TYR TYR C . n 
R  2  142 VAL 142 142 142 VAL VAL C . n 
R  2  143 GLU 143 143 143 GLU GLU C . n 
R  2  144 CYS 144 144 144 CYS CYS C . n 
R  2  145 VAL 145 145 145 VAL VAL C . n 
R  2  146 THR 146 146 146 THR THR C . n 
R  2  147 ARG 147 147 147 ARG ARG C . n 
R  2  148 ALA 148 148 148 ALA ALA C . n 
R  2  149 ARG 149 149 149 ARG ARG C . n 
R  2  150 LEU 150 150 150 LEU LEU C . n 
R  2  151 GLU 151 151 151 GLU GLU C . n 
R  2  152 ALA 152 152 152 ALA ALA C . n 
R  2  153 LEU 153 153 153 LEU LEU C . n 
R  2  154 LEU 154 154 154 LEU LEU C . n 
R  2  155 ALA 155 155 155 ALA ALA C . n 
R  2  156 GLY 156 156 156 GLY GLY C . n 
R  2  157 LEU 157 157 157 LEU LEU C . n 
R  2  158 ARG 158 158 158 ARG ARG C . n 
R  2  159 ALA 159 159 159 ALA ALA C . n 
R  2  160 GLY 160 160 160 GLY GLY C . n 
R  2  161 LYS 161 161 161 LYS LYS C . n 
R  2  162 ARG 162 162 162 ARG ARG C . n 
R  2  163 LEU 163 163 163 LEU LEU C . n 
R  2  164 GLU 164 164 164 GLU GLU C . n 
R  2  165 GLU 165 165 165 GLU GLU C . n 
R  2  166 ILE 166 166 166 ILE ILE C . n 
R  2  167 GLU 167 167 167 GLU GLU C . n 
R  2  168 LEU 168 168 168 LEU LEU C . n 
R  2  169 PRO 169 169 169 PRO PRO C . n 
R  2  170 GLY 170 170 170 GLY GLY C . n 
R  2  171 LYS 171 171 171 LYS LYS C . n 
R  2  172 CYS 172 172 172 CYS CYS C . n 
R  2  173 GLY 173 173 173 GLY GLY C . n 
R  2  174 HIS 174 174 174 HIS HIS C . n 
R  2  175 HIS 175 175 175 HIS HIS C . n 
R  2  176 VAL 176 176 176 VAL VAL C . n 
R  2  177 HIS 177 177 177 HIS HIS C . n 
R  2  178 GLU 178 178 178 GLU GLU C . n 
R  2  179 VAL 179 179 179 VAL VAL C . n 
R  2  180 GLU 180 180 180 GLU GLU C . n 
R  2  181 VAL 181 181 ?   ?   ?   C . n 
S  3  1   MET 1   1   1   MET MET D . n 
S  3  2   VAL 2   2   2   VAL VAL D . n 
S  3  3   ARG 3   3   3   ARG ARG D . n 
S  3  4   VAL 4   4   4   VAL VAL D . n 
S  3  5   LYS 5   5   5   LYS LYS D . n 
S  3  6   VAL 6   6   6   VAL VAL D . n 
S  3  7   ASN 7   7   7   ASN ASN D . n 
S  3  8   ASP 8   8   8   ASP ASP D . n 
S  3  9   ARG 9   9   9   ARG ARG D . n 
S  3  10  ILE 10  10  10  ILE ILE D . n 
S  3  11  VAL 11  11  11  VAL VAL D . n 
S  3  12  GLU 12  12  12  GLU GLU D . n 
S  3  13  VAL 13  13  13  VAL VAL D . n 
S  3  14  PRO 14  14  14  PRO PRO D . n 
S  3  15  PRO 15  15  15  PRO PRO D . n 
S  3  16  GLY 16  16  16  GLY GLY D . n 
S  3  17  THR 17  17  17  THR THR D . n 
S  3  18  SER 18  18  18  SER SER D . n 
S  3  19  VAL 19  19  19  VAL VAL D . n 
S  3  20  MET 20  20  20  MET MET D . n 
S  3  21  ASP 21  21  21  ASP ASP D . n 
S  3  22  ALA 22  22  22  ALA ALA D . n 
S  3  23  VAL 23  23  23  VAL VAL D . n 
S  3  24  PHE 24  24  24  PHE PHE D . n 
S  3  25  HIS 25  25  25  HIS HIS D . n 
S  3  26  ALA 26  26  26  ALA ALA D . n 
S  3  27  GLY 27  27  27  GLY GLY D . n 
S  3  28  TYR 28  28  28  TYR TYR D . n 
S  3  29  ASP 29  29  29  ASP ASP D . n 
S  3  30  VAL 30  30  30  VAL VAL D . n 
S  3  31  PRO 31  31  31  PRO PRO D . n 
S  3  32  LEU 32  32  32  LEU LEU D . n 
S  3  33  PHE 33  33  33  PHE PHE D . n 
S  3  34  CYS 34  34  34  CYS CYS D . n 
S  3  35  SER 35  35  35  SER SER D . n 
S  3  36  GLU 36  36  36  GLU GLU D . n 
S  3  37  LYS 37  37  37  LYS LYS D . n 
S  3  38  HIS 38  38  38  HIS HIS D . n 
S  3  39  LEU 39  39  39  LEU LEU D . n 
S  3  40  SER 40  40  40  SER SER D . n 
S  3  41  PRO 41  41  41  PRO PRO D . n 
S  3  42  ILE 42  42  42  ILE ILE D . n 
S  3  43  GLY 43  43  43  GLY GLY D . n 
S  3  44  ALA 44  44  44  ALA ALA D . n 
S  3  45  CYS 45  45  45  CYS CYS D . n 
S  3  46  ARG 46  46  46  ARG ARG D . n 
S  3  47  MET 47  47  47  MET MET D . n 
S  3  48  CYS 48  48  48  CYS CYS D . n 
S  3  49  LEU 49  49  49  LEU LEU D . n 
S  3  50  VAL 50  50  50  VAL VAL D . n 
S  3  51  ARG 51  51  51  ARG ARG D . n 
S  3  52  ILE 52  52  52  ILE ILE D . n 
S  3  53  GLY 53  53  53  GLY GLY D . n 
S  3  54  LEU 54  54  54  LEU LEU D . n 
S  3  55  PRO 55  55  55  PRO PRO D . n 
S  3  56  LYS 56  56  ?   ?   ?   D . n 
S  3  57  LYS 57  57  ?   ?   ?   D . n 
S  3  58  GLY 58  58  ?   ?   ?   D . n 
S  3  59  PRO 59  59  ?   ?   ?   D . n 
S  3  60  ASP 60  60  ?   ?   ?   D . n 
S  3  61  GLY 61  61  ?   ?   ?   D . n 
S  3  62  LYS 62  62  ?   ?   ?   D . n 
S  3  63  PRO 63  63  ?   ?   ?   D . n 
S  3  64  LEU 64  64  ?   ?   ?   D . n 
S  3  65  LEU 65  65  ?   ?   ?   D . n 
S  3  66  ASN 66  66  ?   ?   ?   D . n 
S  3  67  GLU 67  67  ?   ?   ?   D . n 
S  3  68  LYS 68  68  ?   ?   ?   D . n 
S  3  69  GLY 69  69  ?   ?   ?   D . n 
S  3  70  GLU 70  70  ?   ?   ?   D . n 
S  3  71  PRO 71  71  ?   ?   ?   D . n 
S  3  72  GLU 72  72  ?   ?   ?   D . n 
S  3  73  ILE 73  73  73  ILE ILE D . n 
S  3  74  GLN 74  74  74  GLN GLN D . n 
S  3  75  TRP 75  75  75  TRP TRP D . n 
S  3  76  GLN 76  76  76  GLN GLN D . n 
S  3  77  PRO 77  77  77  PRO PRO D . n 
S  3  78  LYS 78  78  78  LYS LYS D . n 
S  3  79  LEU 79  79  79  LEU LEU D . n 
S  3  80  ALA 80  80  80  ALA ALA D . n 
S  3  81  ALA 81  81  81  ALA ALA D . n 
S  3  82  SER 82  82  82  SER SER D . n 
S  3  83  CYS 83  83  83  CYS CYS D . n 
S  3  84  VAL 84  84  84  VAL VAL D . n 
S  3  85  THR 85  85  85  THR THR D . n 
S  3  86  ALA 86  86  86  ALA ALA D . n 
S  3  87  VAL 87  87  87  VAL VAL D . n 
S  3  88  ALA 88  88  88  ALA ALA D . n 
S  3  89  ASP 89  89  89  ASP ASP D . n 
S  3  90  GLY 90  90  90  GLY GLY D . n 
S  3  91  MET 91  91  91  MET MET D . n 
S  3  92  VAL 92  92  92  VAL VAL D . n 
S  3  93  VAL 93  93  93  VAL VAL D . n 
S  3  94  ASP 94  94  94  ASP ASP D . n 
S  3  95  THR 95  95  95  THR THR D . n 
S  3  96  LEU 96  96  96  LEU LEU D . n 
S  3  97  SER 97  97  97  SER SER D . n 
S  3  98  ASP 98  98  98  ASP ASP D . n 
S  3  99  VAL 99  99  99  VAL VAL D . n 
S  3  100 VAL 100 100 100 VAL VAL D . n 
S  3  101 ARG 101 101 101 ARG ARG D . n 
S  3  102 GLU 102 102 102 GLU GLU D . n 
S  3  103 ALA 103 103 103 ALA ALA D . n 
S  3  104 GLN 104 104 104 GLN GLN D . n 
S  3  105 ALA 105 105 105 ALA ALA D . n 
S  3  106 GLY 106 106 106 GLY GLY D . n 
S  3  107 MET 107 107 107 MET MET D . n 
S  3  108 VAL 108 108 108 VAL VAL D . n 
S  3  109 GLU 109 109 109 GLU GLU D . n 
S  3  110 PHE 110 110 110 PHE PHE D . n 
S  3  111 THR 111 111 111 THR THR D . n 
S  3  112 LEU 112 112 112 LEU LEU D . n 
S  3  113 LEU 113 113 113 LEU LEU D . n 
S  3  114 ASN 114 114 114 ASN ASN D . n 
S  3  115 HIS 115 115 115 HIS HIS D . n 
S  3  116 PRO 116 116 116 PRO PRO D . n 
S  3  117 LEU 117 117 117 LEU LEU D . n 
S  3  118 ASP 118 118 118 ASP ASP D . n 
S  3  119 CYS 119 119 119 CYS CYS D . n 
S  3  120 PRO 120 120 120 PRO PRO D . n 
S  3  121 THR 121 121 121 THR THR D . n 
S  3  122 CYS 122 122 122 CYS CYS D . n 
S  3  123 ASP 123 123 123 ASP ASP D . n 
S  3  124 LYS 124 124 124 LYS LYS D . n 
S  3  125 GLY 125 125 125 GLY GLY D . n 
S  3  126 GLY 126 126 126 GLY GLY D . n 
S  3  127 ALA 127 127 127 ALA ALA D . n 
S  3  128 CYS 128 128 128 CYS CYS D . n 
S  3  129 GLU 129 129 129 GLU GLU D . n 
S  3  130 LEU 130 130 130 LEU LEU D . n 
S  3  131 GLN 131 131 131 GLN GLN D . n 
S  3  132 ASP 132 132 132 ASP ASP D . n 
S  3  133 ARG 133 133 133 ARG ARG D . n 
S  3  134 THR 134 134 134 THR THR D . n 
S  3  135 VAL 135 135 135 VAL VAL D . n 
S  3  136 GLU 136 136 136 GLU GLU D . n 
S  3  137 TYR 137 137 137 TYR TYR D . n 
S  3  138 GLY 138 138 138 GLY GLY D . n 
S  3  139 LEU 139 139 139 LEU LEU D . n 
S  3  140 TYR 140 140 140 TYR TYR D . n 
S  3  141 GLU 141 141 141 GLU GLU D . n 
S  3  142 LYS 142 142 142 LYS LYS D . n 
S  3  143 TYR 143 143 143 TYR TYR D . n 
S  3  144 TYR 144 144 ?   ?   ?   D . n 
S  3  145 GLN 145 145 ?   ?   ?   D . n 
S  3  146 LYS 146 146 ?   ?   ?   D . n 
S  3  147 GLY 147 147 ?   ?   ?   D . n 
S  3  148 PRO 148 148 148 PRO PRO D . n 
S  3  149 LEU 149 149 149 LEU LEU D . n 
S  3  150 GLU 150 150 150 GLU GLU D . n 
S  3  151 LEU 151 151 151 LEU LEU D . n 
S  3  152 PRO 152 152 152 PRO PRO D . n 
S  3  153 VAL 153 153 153 VAL VAL D . n 
S  3  154 TYR 154 154 154 TYR TYR D . n 
S  3  155 THR 155 155 155 THR THR D . n 
S  3  156 ARG 156 156 156 ARG ARG D . n 
S  3  157 PHE 157 157 157 PHE PHE D . n 
S  3  158 GLU 158 158 158 GLU GLU D . n 
S  3  159 PHE 159 159 159 PHE PHE D . n 
S  3  160 THR 160 160 160 THR THR D . n 
S  3  161 ARG 161 161 161 ARG ARG D . n 
S  3  162 ARG 162 162 162 ARG ARG D . n 
S  3  163 HIS 163 163 163 HIS HIS D . n 
S  3  164 VAL 164 164 164 VAL VAL D . n 
S  3  165 ASP 165 165 165 ASP ASP D . n 
S  3  166 LYS 166 166 166 LYS LYS D . n 
S  3  167 HIS 167 167 167 HIS HIS D . n 
S  3  168 HIS 168 168 168 HIS HIS D . n 
S  3  169 PRO 169 169 169 PRO PRO D . n 
S  3  170 LEU 170 170 170 LEU LEU D . n 
S  3  171 SER 171 171 171 SER SER D . n 
S  3  172 PRO 172 172 172 PRO PRO D . n 
S  3  173 PHE 173 173 173 PHE PHE D . n 
S  3  174 VAL 174 174 174 VAL VAL D . n 
S  3  175 ILE 175 175 175 ILE ILE D . n 
S  3  176 LEU 176 176 176 LEU LEU D . n 
S  3  177 ASP 177 177 177 ASP ASP D . n 
S  3  178 ARG 178 178 178 ARG ARG D . n 
S  3  179 GLU 179 179 179 GLU GLU D . n 
S  3  180 ARG 180 180 180 ARG ARG D . n 
S  3  181 CYS 181 181 181 CYS CYS D . n 
S  3  182 ILE 182 182 182 ILE ILE D . n 
S  3  183 HIS 183 183 183 HIS HIS D . n 
S  3  184 CYS 184 184 184 CYS CYS D . n 
S  3  185 LYS 185 185 185 LYS LYS D . n 
S  3  186 ARG 186 186 186 ARG ARG D . n 
S  3  187 CYS 187 187 187 CYS CYS D . n 
S  3  188 VAL 188 188 188 VAL VAL D . n 
S  3  189 ARG 189 189 189 ARG ARG D . n 
S  3  190 TYR 190 190 190 TYR TYR D . n 
S  3  191 PHE 191 191 191 PHE PHE D . n 
S  3  192 GLU 192 192 192 GLU GLU D . n 
S  3  193 GLU 193 193 193 GLU GLU D . n 
S  3  194 VAL 194 194 194 VAL VAL D . n 
S  3  195 PRO 195 195 195 PRO PRO D . n 
S  3  196 GLY 196 196 196 GLY GLY D . n 
S  3  197 ASP 197 197 197 ASP ASP D . n 
S  3  198 GLU 198 198 198 GLU GLU D . n 
S  3  199 VAL 199 199 199 VAL VAL D . n 
S  3  200 LEU 200 200 200 LEU LEU D . n 
S  3  201 ASP 201 201 201 ASP ASP D . n 
S  3  202 PHE 202 202 202 PHE PHE D . n 
S  3  203 ILE 203 203 203 ILE ILE D . n 
S  3  204 GLU 204 204 204 GLU GLU D . n 
S  3  205 ARG 205 205 205 ARG ARG D . n 
S  3  206 GLY 206 206 206 GLY GLY D . n 
S  3  207 VAL 207 207 207 VAL VAL D . n 
S  3  208 HIS 208 208 208 HIS HIS D . n 
S  3  209 THR 209 209 209 THR THR D . n 
S  3  210 PHE 210 210 210 PHE PHE D . n 
S  3  211 ILE 211 211 211 ILE ILE D . n 
S  3  212 GLY 212 212 212 GLY GLY D . n 
S  3  213 THR 213 213 213 THR THR D . n 
S  3  214 MET 214 214 214 MET MET D . n 
S  3  215 ASP 215 215 215 ASP ASP D . n 
S  3  216 PHE 216 216 216 PHE PHE D . n 
S  3  217 GLY 217 217 217 GLY GLY D . n 
S  3  218 LEU 218 218 218 LEU LEU D . n 
S  3  219 PRO 219 219 219 PRO PRO D . n 
S  3  220 SER 220 220 220 SER SER D . n 
S  3  221 GLY 221 221 221 GLY GLY D . n 
S  3  222 PHE 222 222 222 PHE PHE D . n 
S  3  223 SER 223 223 223 SER SER D . n 
S  3  224 GLY 224 224 224 GLY GLY D . n 
S  3  225 ASN 225 225 225 ASN ASN D . n 
S  3  226 ILE 226 226 226 ILE ILE D . n 
S  3  227 THR 227 227 227 THR THR D . n 
S  3  228 ASP 228 228 228 ASP ASP D . n 
S  3  229 ILE 229 229 229 ILE ILE D . n 
S  3  230 CYS 230 230 230 CYS CYS D . n 
S  3  231 PRO 231 231 231 PRO PRO D . n 
S  3  232 VAL 232 232 232 VAL VAL D . n 
S  3  233 GLY 233 233 233 GLY GLY D . n 
S  3  234 ALA 234 234 234 ALA ALA D . n 
S  3  235 LEU 235 235 235 LEU LEU D . n 
S  3  236 LEU 236 236 236 LEU LEU D . n 
S  3  237 ASP 237 237 237 ASP ASP D . n 
S  3  238 LEU 238 238 238 LEU LEU D . n 
S  3  239 THR 239 239 239 THR THR D . n 
S  3  240 ALA 240 240 240 ALA ALA D . n 
S  3  241 ARG 241 241 241 ARG ARG D . n 
S  3  242 PHE 242 242 242 PHE PHE D . n 
S  3  243 ARG 243 243 243 ARG ARG D . n 
S  3  244 ALA 244 244 244 ALA ALA D . n 
S  3  245 ARG 245 245 245 ARG ARG D . n 
S  3  246 ASN 246 246 246 ASN ASN D . n 
S  3  247 TRP 247 247 247 TRP TRP D . n 
S  3  248 GLU 248 248 248 GLU GLU D . n 
S  3  249 MET 249 249 249 MET MET D . n 
S  3  250 GLU 250 250 250 GLU GLU D . n 
S  3  251 GLU 251 251 251 GLU GLU D . n 
S  3  252 THR 252 252 252 THR THR D . n 
S  3  253 PRO 253 253 253 PRO PRO D . n 
S  3  254 THR 254 254 254 THR THR D . n 
S  3  255 THR 255 255 255 THR THR D . n 
S  3  256 CYS 256 256 256 CYS CYS D . n 
S  3  257 ALA 257 257 257 ALA ALA D . n 
S  3  258 LEU 258 258 258 LEU LEU D . n 
S  3  259 CYS 259 259 259 CYS CYS D . n 
S  3  260 PRO 260 260 260 PRO PRO D . n 
S  3  261 VAL 261 261 261 VAL VAL D . n 
S  3  262 GLY 262 262 262 GLY GLY D . n 
S  3  263 CYS 263 263 263 CYS CYS D . n 
S  3  264 GLY 264 264 264 GLY GLY D . n 
S  3  265 ILE 265 265 265 ILE ILE D . n 
S  3  266 THR 266 266 266 THR THR D . n 
S  3  267 ALA 267 267 267 ALA ALA D . n 
S  3  268 ASP 268 268 268 ASP ASP D . n 
S  3  269 THR 269 269 269 THR THR D . n 
S  3  270 ARG 270 270 270 ARG ARG D . n 
S  3  271 SER 271 271 271 SER SER D . n 
S  3  272 GLY 272 272 272 GLY GLY D . n 
S  3  273 GLU 273 273 273 GLU GLU D . n 
S  3  274 LEU 274 274 274 LEU LEU D . n 
S  3  275 LEU 275 275 275 LEU LEU D . n 
S  3  276 ARG 276 276 276 ARG ARG D . n 
S  3  277 ILE 277 277 277 ILE ILE D . n 
S  3  278 ARG 278 278 278 ARG ARG D . n 
S  3  279 ALA 279 279 279 ALA ALA D . n 
S  3  280 ARG 280 280 280 ARG ARG D . n 
S  3  281 GLU 281 281 281 GLU GLU D . n 
S  3  282 VAL 282 282 282 VAL VAL D . n 
S  3  283 PRO 283 283 283 PRO PRO D . n 
S  3  284 GLU 284 284 284 GLU GLU D . n 
S  3  285 VAL 285 285 285 VAL VAL D . n 
S  3  286 ASN 286 286 286 ASN ASN D . n 
S  3  287 GLU 287 287 287 GLU GLU D . n 
S  3  288 ILE 288 288 288 ILE ILE D . n 
S  3  289 TRP 289 289 289 TRP TRP D . n 
S  3  290 ILE 290 290 290 ILE ILE D . n 
S  3  291 CYS 291 291 291 CYS CYS D . n 
S  3  292 ASP 292 292 292 ASP ASP D . n 
S  3  293 ALA 293 293 293 ALA ALA D . n 
S  3  294 GLY 294 294 294 GLY GLY D . n 
S  3  295 ARG 295 295 295 ARG ARG D . n 
S  3  296 PHE 296 296 296 PHE PHE D . n 
S  3  297 GLY 297 297 297 GLY GLY D . n 
S  3  298 HIS 298 298 298 HIS HIS D . n 
S  3  299 GLU 299 299 299 GLU GLU D . n 
S  3  300 TRP 300 300 300 TRP TRP D . n 
S  3  301 ALA 301 301 301 ALA ALA D . n 
S  3  302 ASP 302 302 302 ASP ASP D . n 
S  3  303 GLN 303 303 303 GLN GLN D . n 
S  3  304 ASN 304 304 304 ASN ASN D . n 
S  3  305 ARG 305 305 305 ARG ARG D . n 
S  3  306 LEU 306 306 306 LEU LEU D . n 
S  3  307 LYS 307 307 307 LYS LYS D . n 
S  3  308 THR 308 308 308 THR THR D . n 
S  3  309 PRO 309 309 309 PRO PRO D . n 
S  3  310 LEU 310 310 310 LEU LEU D . n 
S  3  311 VAL 311 311 311 VAL VAL D . n 
S  3  312 ARG 312 312 312 ARG ARG D . n 
S  3  313 LYS 313 313 313 LYS LYS D . n 
S  3  314 GLU 314 314 314 GLU GLU D . n 
S  3  315 GLY 315 315 315 GLY GLY D . n 
S  3  316 ARG 316 316 316 ARG ARG D . n 
S  3  317 LEU 317 317 317 LEU LEU D . n 
S  3  318 VAL 318 318 318 VAL VAL D . n 
S  3  319 GLU 319 319 319 GLU GLU D . n 
S  3  320 ALA 320 320 320 ALA ALA D . n 
S  3  321 THR 321 321 321 THR THR D . n 
S  3  322 TRP 322 322 322 TRP TRP D . n 
S  3  323 GLU 323 323 323 GLU GLU D . n 
S  3  324 GLU 324 324 324 GLU GLU D . n 
S  3  325 ALA 325 325 325 ALA ALA D . n 
S  3  326 PHE 326 326 326 PHE PHE D . n 
S  3  327 LEU 327 327 327 LEU LEU D . n 
S  3  328 ALA 328 328 328 ALA ALA D . n 
S  3  329 LEU 329 329 329 LEU LEU D . n 
S  3  330 LYS 330 330 330 LYS LYS D . n 
S  3  331 GLU 331 331 331 GLU GLU D . n 
S  3  332 GLY 332 332 332 GLY GLY D . n 
S  3  333 LEU 333 333 333 LEU LEU D . n 
S  3  334 LYS 334 334 334 LYS LYS D . n 
S  3  335 GLU 335 335 335 GLU GLU D . n 
S  3  336 ALA 336 336 336 ALA ALA D . n 
S  3  337 ARG 337 337 337 ARG ARG D . n 
S  3  338 GLY 338 338 338 GLY GLY D . n 
S  3  339 GLU 339 339 339 GLU GLU D . n 
S  3  340 GLU 340 340 340 GLU GLU D . n 
S  3  341 VAL 341 341 341 VAL VAL D . n 
S  3  342 GLY 342 342 342 GLY GLY D . n 
S  3  343 LEU 343 343 343 LEU LEU D . n 
S  3  344 TYR 344 344 344 TYR TYR D . n 
S  3  345 LEU 345 345 345 LEU LEU D . n 
S  3  346 ALA 346 346 346 ALA ALA D . n 
S  3  347 HIS 347 347 347 HIS HIS D . n 
S  3  348 ASP 348 348 348 ASP ASP D . n 
S  3  349 ALA 349 349 349 ALA ALA D . n 
S  3  350 THR 350 350 350 THR THR D . n 
S  3  351 LEU 351 351 351 LEU LEU D . n 
S  3  352 GLU 352 352 352 GLU GLU D . n 
S  3  353 GLU 353 353 353 GLU GLU D . n 
S  3  354 GLY 354 354 354 GLY GLY D . n 
S  3  355 LEU 355 355 355 LEU LEU D . n 
S  3  356 LEU 356 356 356 LEU LEU D . n 
S  3  357 ALA 357 357 357 ALA ALA D . n 
S  3  358 SER 358 358 358 SER SER D . n 
S  3  359 GLU 359 359 359 GLU GLU D . n 
S  3  360 LEU 360 360 360 LEU LEU D . n 
S  3  361 ALA 361 361 361 ALA ALA D . n 
S  3  362 LYS 362 362 362 LYS LYS D . n 
S  3  363 ALA 363 363 363 ALA ALA D . n 
S  3  364 LEU 364 364 364 LEU LEU D . n 
S  3  365 LYS 365 365 365 LYS LYS D . n 
S  3  366 THR 366 366 366 THR THR D . n 
S  3  367 PRO 367 367 367 PRO PRO D . n 
S  3  368 HIS 368 368 368 HIS HIS D . n 
S  3  369 LEU 369 369 369 LEU LEU D . n 
S  3  370 ASP 370 370 370 ASP ASP D . n 
S  3  371 PHE 371 371 371 PHE PHE D . n 
S  3  372 GLN 372 372 372 GLN GLN D . n 
S  3  373 GLY 373 373 373 GLY GLY D . n 
S  3  374 ARG 374 374 374 ARG ARG D . n 
S  3  375 THR 375 375 375 THR THR D . n 
S  3  376 ALA 376 376 376 ALA ALA D . n 
S  3  377 ALA 377 377 377 ALA ALA D . n 
S  3  378 PRO 378 378 378 PRO PRO D . n 
S  3  379 ALA 379 379 379 ALA ALA D . n 
S  3  380 SER 380 380 380 SER SER D . n 
S  3  381 LEU 381 381 381 LEU LEU D . n 
S  3  382 PHE 382 382 382 PHE PHE D . n 
S  3  383 PRO 383 383 383 PRO PRO D . n 
S  3  384 PRO 384 384 384 PRO PRO D . n 
S  3  385 ALA 385 385 385 ALA ALA D . n 
S  3  386 SER 386 386 386 SER SER D . n 
S  3  387 LEU 387 387 387 LEU LEU D . n 
S  3  388 GLU 388 388 388 GLU GLU D . n 
S  3  389 ASP 389 389 389 ASP ASP D . n 
S  3  390 LEU 390 390 390 LEU LEU D . n 
S  3  391 LEU 391 391 391 LEU LEU D . n 
S  3  392 GLN 392 392 392 GLN GLN D . n 
S  3  393 ALA 393 393 393 ALA ALA D . n 
S  3  394 ASP 394 394 394 ASP ASP D . n 
S  3  395 PHE 395 395 395 PHE PHE D . n 
S  3  396 ALA 396 396 396 ALA ALA D . n 
S  3  397 LEU 397 397 397 LEU LEU D . n 
S  3  398 VAL 398 398 398 VAL VAL D . n 
S  3  399 LEU 399 399 399 LEU LEU D . n 
S  3  400 GLY 400 400 400 GLY GLY D . n 
S  3  401 ASP 401 401 401 ASP ASP D . n 
S  3  402 PRO 402 402 402 PRO PRO D . n 
S  3  403 THR 403 403 403 THR THR D . n 
S  3  404 GLU 404 404 404 GLU GLU D . n 
S  3  405 GLU 405 405 405 GLU GLU D . n 
S  3  406 ALA 406 406 406 ALA ALA D . n 
S  3  407 PRO 407 407 407 PRO PRO D . n 
S  3  408 ILE 408 408 408 ILE ILE D . n 
S  3  409 LEU 409 409 409 LEU LEU D . n 
S  3  410 HIS 410 410 410 HIS HIS D . n 
S  3  411 LEU 411 411 411 LEU LEU D . n 
S  3  412 ARG 412 412 412 ARG ARG D . n 
S  3  413 LEU 413 413 413 LEU LEU D . n 
S  3  414 SER 414 414 414 SER SER D . n 
S  3  415 GLU 415 415 415 GLU GLU D . n 
S  3  416 PHE 416 416 416 PHE PHE D . n 
S  3  417 VAL 417 417 417 VAL VAL D . n 
S  3  418 ARG 418 418 418 ARG ARG D . n 
S  3  419 ASP 419 419 419 ASP ASP D . n 
S  3  420 LEU 420 420 420 LEU LEU D . n 
S  3  421 LYS 421 421 421 LYS LYS D . n 
S  3  422 PRO 422 422 422 PRO PRO D . n 
S  3  423 PRO 423 423 423 PRO PRO D . n 
S  3  424 HIS 424 424 424 HIS HIS D . n 
S  3  425 ARG 425 425 425 ARG ARG D . n 
S  3  426 TYR 426 426 426 TYR TYR D . n 
S  3  427 ASN 427 427 427 ASN ASN D . n 
S  3  428 HIS 428 428 428 HIS HIS D . n 
S  3  429 GLY 429 429 429 GLY GLY D . n 
S  3  430 THR 430 430 430 THR THR D . n 
S  3  431 PRO 431 431 431 PRO PRO D . n 
S  3  432 PHE 432 432 432 PHE PHE D . n 
S  3  433 ALA 433 433 433 ALA ALA D . n 
S  3  434 ASP 434 434 434 ASP ASP D . n 
S  3  435 LEU 435 435 435 LEU LEU D . n 
S  3  436 GLN 436 436 436 GLN GLN D . n 
S  3  437 ILE 437 437 437 ILE ILE D . n 
S  3  438 LYS 438 438 438 LYS LYS D . n 
S  3  439 GLU 439 439 439 GLU GLU D . n 
S  3  440 ARG 440 440 440 ARG ARG D . n 
S  3  441 MET 441 441 441 MET MET D . n 
S  3  442 PRO 442 442 442 PRO PRO D . n 
S  3  443 ARG 443 443 443 ARG ARG D . n 
S  3  444 ARG 444 444 444 ARG ARG D . n 
S  3  445 THR 445 445 445 THR THR D . n 
S  3  446 ASP 446 446 446 ASP ASP D . n 
S  3  447 LYS 447 447 447 LYS LYS D . n 
S  3  448 MET 448 448 448 MET MET D . n 
S  3  449 ALA 449 449 449 ALA ALA D . n 
S  3  450 LEU 450 450 450 LEU LEU D . n 
S  3  451 PHE 451 451 451 PHE PHE D . n 
S  3  452 ALA 452 452 452 ALA ALA D . n 
S  3  453 PRO 453 453 453 PRO PRO D . n 
S  3  454 TYR 454 454 454 TYR TYR D . n 
S  3  455 ARG 455 455 455 ARG ARG D . n 
S  3  456 ALA 456 456 456 ALA ALA D . n 
S  3  457 PRO 457 457 457 PRO PRO D . n 
S  3  458 LEU 458 458 458 LEU LEU D . n 
S  3  459 MET 459 459 459 MET MET D . n 
S  3  460 LYS 460 460 460 LYS LYS D . n 
S  3  461 TRP 461 461 461 TRP TRP D . n 
S  3  462 ALA 462 462 462 ALA ALA D . n 
S  3  463 ALA 463 463 463 ALA ALA D . n 
S  3  464 ILE 464 464 464 ILE ILE D . n 
S  3  465 HIS 465 465 465 HIS HIS D . n 
S  3  466 GLU 466 466 466 GLU GLU D . n 
S  3  467 VAL 467 467 467 VAL VAL D . n 
S  3  468 HIS 468 468 468 HIS HIS D . n 
S  3  469 ARG 469 469 469 ARG ARG D . n 
S  3  470 PRO 470 470 470 PRO PRO D . n 
S  3  471 GLY 471 471 471 GLY GLY D . n 
S  3  472 GLU 472 472 472 GLU GLU D . n 
S  3  473 GLU 473 473 473 GLU GLU D . n 
S  3  474 ARG 474 474 474 ARG ARG D . n 
S  3  475 GLU 475 475 475 GLU GLU D . n 
S  3  476 ILE 476 476 476 ILE ILE D . n 
S  3  477 LEU 477 477 477 LEU LEU D . n 
S  3  478 LEU 478 478 478 LEU LEU D . n 
S  3  479 ALA 479 479 479 ALA ALA D . n 
S  3  480 LEU 480 480 480 LEU LEU D . n 
S  3  481 LEU 481 481 481 LEU LEU D . n 
S  3  482 GLY 482 482 482 GLY GLY D . n 
S  3  483 ASP 483 483 483 ASP ASP D . n 
S  3  484 LYS 484 484 484 LYS LYS D . n 
S  3  485 GLU 485 485 485 GLU GLU D . n 
S  3  486 GLY 486 486 486 GLY GLY D . n 
S  3  487 SER 487 487 487 SER SER D . n 
S  3  488 GLU 488 488 488 GLU GLU D . n 
S  3  489 MET 489 489 489 MET MET D . n 
S  3  490 VAL 490 490 490 VAL VAL D . n 
S  3  491 ALA 491 491 491 ALA ALA D . n 
S  3  492 LYS 492 492 492 LYS LYS D . n 
S  3  493 ALA 493 493 493 ALA ALA D . n 
S  3  494 LYS 494 494 494 LYS LYS D . n 
S  3  495 GLU 495 495 495 GLU GLU D . n 
S  3  496 ALA 496 496 496 ALA ALA D . n 
S  3  497 TRP 497 497 497 TRP TRP D . n 
S  3  498 GLU 498 498 498 GLU GLU D . n 
S  3  499 LYS 499 499 499 LYS LYS D . n 
S  3  500 ALA 500 500 500 ALA ALA D . n 
S  3  501 LYS 501 501 501 LYS LYS D . n 
S  3  502 ASN 502 502 502 ASN ASN D . n 
S  3  503 PRO 503 503 503 PRO PRO D . n 
S  3  504 VAL 504 504 504 VAL VAL D . n 
S  3  505 LEU 505 505 505 LEU LEU D . n 
S  3  506 ILE 506 506 506 ILE ILE D . n 
S  3  507 LEU 507 507 507 LEU LEU D . n 
S  3  508 GLY 508 508 508 GLY GLY D . n 
S  3  509 ALA 509 509 509 ALA ALA D . n 
S  3  510 GLY 510 510 510 GLY GLY D . n 
S  3  511 VAL 511 511 511 VAL VAL D . n 
S  3  512 LEU 512 512 512 LEU LEU D . n 
S  3  513 GLN 513 513 513 GLN GLN D . n 
S  3  514 ASP 514 514 514 ASP ASP D . n 
S  3  515 THR 515 515 515 THR THR D . n 
S  3  516 VAL 516 516 516 VAL VAL D . n 
S  3  517 ALA 517 517 517 ALA ALA D . n 
S  3  518 ALA 518 518 518 ALA ALA D . n 
S  3  519 GLU 519 519 519 GLU GLU D . n 
S  3  520 ARG 520 520 520 ARG ARG D . n 
S  3  521 ALA 521 521 521 ALA ALA D . n 
S  3  522 ARG 522 522 522 ARG ARG D . n 
S  3  523 LEU 523 523 523 LEU LEU D . n 
S  3  524 LEU 524 524 524 LEU LEU D . n 
S  3  525 ALA 525 525 525 ALA ALA D . n 
S  3  526 GLU 526 526 526 GLU GLU D . n 
S  3  527 ARG 527 527 527 ARG ARG D . n 
S  3  528 LYS 528 528 528 LYS LYS D . n 
S  3  529 GLY 529 529 529 GLY GLY D . n 
S  3  530 ALA 530 530 530 ALA ALA D . n 
S  3  531 LYS 531 531 531 LYS LYS D . n 
S  3  532 VAL 532 532 532 VAL VAL D . n 
S  3  533 LEU 533 533 533 LEU LEU D . n 
S  3  534 ALA 534 534 534 ALA ALA D . n 
S  3  535 MET 535 535 535 MET MET D . n 
S  3  536 THR 536 536 536 THR THR D . n 
S  3  537 PRO 537 537 537 PRO PRO D . n 
S  3  538 ALA 538 538 538 ALA ALA D . n 
S  3  539 ALA 539 539 539 ALA ALA D . n 
S  3  540 ASN 540 540 540 ASN ASN D . n 
S  3  541 ALA 541 541 541 ALA ALA D . n 
S  3  542 ARG 542 542 542 ARG ARG D . n 
S  3  543 GLY 543 543 543 GLY GLY D . n 
S  3  544 LEU 544 544 544 LEU LEU D . n 
S  3  545 GLU 545 545 545 GLU GLU D . n 
S  3  546 ALA 546 546 546 ALA ALA D . n 
S  3  547 MET 547 547 547 MET MET D . n 
S  3  548 GLY 548 548 548 GLY GLY D . n 
S  3  549 VAL 549 549 549 VAL VAL D . n 
S  3  550 LEU 550 550 550 LEU LEU D . n 
S  3  551 PRO 551 551 551 PRO PRO D . n 
S  3  552 GLY 552 552 552 GLY GLY D . n 
S  3  553 ALA 553 553 553 ALA ALA D . n 
S  3  554 LYS 554 554 554 LYS LYS D . n 
S  3  555 GLY 555 555 555 GLY GLY D . n 
S  3  556 ALA 556 556 556 ALA ALA D . n 
S  3  557 SER 557 557 557 SER SER D . n 
S  3  558 TRP 558 558 558 TRP TRP D . n 
S  3  559 ASP 559 559 559 ASP ASP D . n 
S  3  560 GLU 560 560 560 GLU GLU D . n 
S  3  561 PRO 561 561 561 PRO PRO D . n 
S  3  562 GLY 562 562 562 GLY GLY D . n 
S  3  563 ALA 563 563 563 ALA ALA D . n 
S  3  564 LEU 564 564 564 LEU LEU D . n 
S  3  565 TYR 565 565 565 TYR TYR D . n 
S  3  566 ALA 566 566 566 ALA ALA D . n 
S  3  567 TYR 567 567 567 TYR TYR D . n 
S  3  568 TYR 568 568 568 TYR TYR D . n 
S  3  569 GLY 569 569 569 GLY GLY D . n 
S  3  570 PHE 570 570 570 PHE PHE D . n 
S  3  571 VAL 571 571 571 VAL VAL D . n 
S  3  572 PRO 572 572 572 PRO PRO D . n 
S  3  573 PRO 573 573 573 PRO PRO D . n 
S  3  574 GLU 574 574 574 GLU GLU D . n 
S  3  575 GLU 575 575 575 GLU GLU D . n 
S  3  576 ALA 576 576 576 ALA ALA D . n 
S  3  577 LEU 577 577 577 LEU LEU D . n 
S  3  578 LYS 578 578 578 LYS LYS D . n 
S  3  579 GLY 579 579 579 GLY GLY D . n 
S  3  580 LYS 580 580 580 LYS LYS D . n 
S  3  581 ARG 581 581 581 ARG ARG D . n 
S  3  582 PHE 582 582 582 PHE PHE D . n 
S  3  583 VAL 583 583 583 VAL VAL D . n 
S  3  584 VAL 584 584 584 VAL VAL D . n 
S  3  585 MET 585 585 585 MET MET D . n 
S  3  586 HIS 586 586 586 HIS HIS D . n 
S  3  587 LEU 587 587 587 LEU LEU D . n 
S  3  588 SER 588 588 588 SER SER D . n 
S  3  589 HIS 589 589 589 HIS HIS D . n 
S  3  590 LEU 590 590 590 LEU LEU D . n 
S  3  591 HIS 591 591 591 HIS HIS D . n 
S  3  592 PRO 592 592 592 PRO PRO D . n 
S  3  593 LEU 593 593 593 LEU LEU D . n 
S  3  594 ALA 594 594 594 ALA ALA D . n 
S  3  595 GLU 595 595 595 GLU GLU D . n 
S  3  596 ARG 596 596 596 ARG ARG D . n 
S  3  597 TYR 597 597 597 TYR TYR D . n 
S  3  598 ALA 598 598 598 ALA ALA D . n 
S  3  599 HIS 599 599 599 HIS HIS D . n 
S  3  600 VAL 600 600 600 VAL VAL D . n 
S  3  601 VAL 601 601 601 VAL VAL D . n 
S  3  602 LEU 602 602 602 LEU LEU D . n 
S  3  603 PRO 603 603 603 PRO PRO D . n 
S  3  604 ALA 604 604 604 ALA ALA D . n 
S  3  605 PRO 605 605 605 PRO PRO D . n 
S  3  606 THR 606 606 606 THR THR D . n 
S  3  607 PHE 607 607 607 PHE PHE D . n 
S  3  608 TYR 608 608 608 TYR TYR D . n 
S  3  609 GLU 609 609 609 GLU GLU D . n 
S  3  610 LYS 610 610 610 LYS LYS D . n 
S  3  611 ARG 611 611 611 ARG ARG D . n 
S  3  612 GLY 612 612 612 GLY GLY D . n 
S  3  613 HIS 613 613 613 HIS HIS D . n 
S  3  614 LEU 614 614 614 LEU LEU D . n 
S  3  615 VAL 615 615 615 VAL VAL D . n 
S  3  616 ASN 616 616 616 ASN ASN D . n 
S  3  617 LEU 617 617 617 LEU LEU D . n 
S  3  618 GLU 618 618 618 GLU GLU D . n 
S  3  619 GLY 619 619 619 GLY GLY D . n 
S  3  620 ARG 620 620 620 ARG ARG D . n 
S  3  621 VAL 621 621 621 VAL VAL D . n 
S  3  622 LEU 622 622 622 LEU LEU D . n 
S  3  623 PRO 623 623 623 PRO PRO D . n 
S  3  624 LEU 624 624 624 LEU LEU D . n 
S  3  625 SER 625 625 625 SER SER D . n 
S  3  626 PRO 626 626 626 PRO PRO D . n 
S  3  627 ALA 627 627 627 ALA ALA D . n 
S  3  628 PRO 628 628 628 PRO PRO D . n 
S  3  629 ILE 629 629 629 ILE ILE D . n 
S  3  630 GLU 630 630 630 GLU GLU D . n 
S  3  631 ASN 631 631 631 ASN ASN D . n 
S  3  632 GLY 632 632 632 GLY GLY D . n 
S  3  633 GLU 633 633 633 GLU GLU D . n 
S  3  634 ALA 634 634 634 ALA ALA D . n 
S  3  635 GLU 635 635 635 GLU GLU D . n 
S  3  636 GLY 636 636 636 GLY GLY D . n 
S  3  637 ALA 637 637 637 ALA ALA D . n 
S  3  638 LEU 638 638 638 LEU LEU D . n 
S  3  639 GLN 639 639 639 GLN GLN D . n 
S  3  640 VAL 640 640 640 VAL VAL D . n 
S  3  641 LEU 641 641 641 LEU LEU D . n 
S  3  642 ALA 642 642 642 ALA ALA D . n 
S  3  643 LEU 643 643 643 LEU LEU D . n 
S  3  644 LEU 644 644 644 LEU LEU D . n 
S  3  645 ALA 645 645 645 ALA ALA D . n 
S  3  646 GLU 646 646 646 GLU GLU D . n 
S  3  647 ALA 647 647 647 ALA ALA D . n 
S  3  648 LEU 648 648 648 LEU LEU D . n 
S  3  649 GLY 649 649 649 GLY GLY D . n 
S  3  650 VAL 650 650 650 VAL VAL D . n 
S  3  651 ARG 651 651 651 ARG ARG D . n 
S  3  652 PRO 652 652 652 PRO PRO D . n 
S  3  653 PRO 653 653 653 PRO PRO D . n 
S  3  654 PHE 654 654 654 PHE PHE D . n 
S  3  655 ARG 655 655 655 ARG ARG D . n 
S  3  656 LEU 656 656 656 LEU LEU D . n 
S  3  657 HIS 657 657 657 HIS HIS D . n 
S  3  658 LEU 658 658 658 LEU LEU D . n 
S  3  659 GLU 659 659 659 GLU GLU D . n 
S  3  660 ALA 660 660 660 ALA ALA D . n 
S  3  661 GLN 661 661 661 GLN GLN D . n 
S  3  662 LYS 662 662 662 LYS LYS D . n 
S  3  663 ALA 663 663 663 ALA ALA D . n 
S  3  664 LEU 664 664 664 LEU LEU D . n 
S  3  665 LYS 665 665 665 LYS LYS D . n 
S  3  666 ALA 666 666 666 ALA ALA D . n 
S  3  667 ARG 667 667 667 ARG ARG D . n 
S  3  668 LYS 668 668 668 LYS LYS D . n 
S  3  669 VAL 669 669 669 VAL VAL D . n 
S  3  670 PRO 670 670 670 PRO PRO D . n 
S  3  671 GLU 671 671 671 GLU GLU D . n 
S  3  672 ALA 672 672 672 ALA ALA D . n 
S  3  673 MET 673 673 673 MET MET D . n 
S  3  674 GLY 674 674 674 GLY GLY D . n 
S  3  675 ARG 675 675 675 ARG ARG D . n 
S  3  676 LEU 676 676 676 LEU LEU D . n 
S  3  677 SER 677 677 677 SER SER D . n 
S  3  678 PHE 678 678 678 PHE PHE D . n 
S  3  679 ARG 679 679 679 ARG ARG D . n 
S  3  680 LEU 680 680 680 LEU LEU D . n 
S  3  681 LYS 681 681 681 LYS LYS D . n 
S  3  682 GLU 682 682 682 GLU GLU D . n 
S  3  683 LEU 683 683 683 LEU LEU D . n 
S  3  684 ARG 684 684 684 ARG ARG D . n 
S  3  685 PRO 685 685 685 PRO PRO D . n 
S  3  686 LYS 686 686 686 LYS LYS D . n 
S  3  687 GLU 687 687 687 GLU GLU D . n 
S  3  688 ARG 688 688 688 ARG ARG D . n 
S  3  689 LYS 689 689 689 LYS LYS D . n 
S  3  690 GLY 690 690 690 GLY GLY D . n 
S  3  691 ALA 691 691 691 ALA ALA D . n 
S  3  692 PHE 692 692 692 PHE PHE D . n 
S  3  693 TYR 693 693 693 TYR TYR D . n 
S  3  694 LEU 694 694 694 LEU LEU D . n 
S  3  695 ARG 695 695 695 ARG ARG D . n 
S  3  696 PRO 696 696 696 PRO PRO D . n 
S  3  697 THR 697 697 697 THR THR D . n 
S  3  698 MET 698 698 698 MET MET D . n 
S  3  699 TRP 699 699 699 TRP TRP D . n 
S  3  700 LYS 700 700 700 LYS LYS D . n 
S  3  701 ALA 701 701 701 ALA ALA D . n 
S  3  702 HIS 702 702 702 HIS HIS D . n 
S  3  703 GLN 703 703 703 GLN GLN D . n 
S  3  704 ALA 704 704 704 ALA ALA D . n 
S  3  705 VAL 705 705 705 VAL VAL D . n 
S  3  706 GLY 706 706 706 GLY GLY D . n 
S  3  707 LYS 707 707 707 LYS LYS D . n 
S  3  708 ALA 708 708 708 ALA ALA D . n 
S  3  709 GLN 709 709 709 GLN GLN D . n 
S  3  710 GLU 710 710 710 GLU GLU D . n 
S  3  711 ALA 711 711 711 ALA ALA D . n 
S  3  712 ALA 712 712 712 ALA ALA D . n 
S  3  713 ARG 713 713 713 ARG ARG D . n 
S  3  714 ALA 714 714 714 ALA ALA D . n 
S  3  715 GLU 715 715 715 GLU GLU D . n 
S  3  716 LEU 716 716 716 LEU LEU D . n 
S  3  717 TRP 717 717 717 TRP TRP D . n 
S  3  718 ALA 718 718 718 ALA ALA D . n 
S  3  719 HIS 719 719 719 HIS HIS D . n 
S  3  720 PRO 720 720 720 PRO PRO D . n 
S  3  721 GLU 721 721 721 GLU GLU D . n 
S  3  722 THR 722 722 722 THR THR D . n 
S  3  723 ALA 723 723 723 ALA ALA D . n 
S  3  724 ARG 724 724 724 ARG ARG D . n 
S  3  725 ALA 725 725 725 ALA ALA D . n 
S  3  726 GLU 726 726 726 GLU GLU D . n 
S  3  727 ALA 727 727 727 ALA ALA D . n 
S  3  728 LEU 728 728 728 LEU LEU D . n 
S  3  729 PRO 729 729 729 PRO PRO D . n 
S  3  730 GLU 730 730 730 GLU GLU D . n 
S  3  731 GLY 731 731 731 GLY GLY D . n 
S  3  732 ALA 732 732 732 ALA ALA D . n 
S  3  733 GLN 733 733 733 GLN GLN D . n 
S  3  734 VAL 734 734 734 VAL VAL D . n 
S  3  735 ALA 735 735 735 ALA ALA D . n 
S  3  736 VAL 736 736 736 VAL VAL D . n 
S  3  737 GLU 737 737 737 GLU GLU D . n 
S  3  738 THR 738 738 738 THR THR D . n 
S  3  739 PRO 739 739 739 PRO PRO D . n 
S  3  740 PHE 740 740 740 PHE PHE D . n 
S  3  741 GLY 741 741 741 GLY GLY D . n 
S  3  742 ARG 742 742 742 ARG ARG D . n 
S  3  743 VAL 743 743 743 VAL VAL D . n 
S  3  744 GLU 744 744 744 GLU GLU D . n 
S  3  745 ALA 745 745 745 ALA ALA D . n 
S  3  746 ARG 746 746 746 ARG ARG D . n 
S  3  747 VAL 747 747 747 VAL VAL D . n 
S  3  748 VAL 748 748 748 VAL VAL D . n 
S  3  749 HIS 749 749 749 HIS HIS D . n 
S  3  750 ARG 750 750 750 ARG ARG D . n 
S  3  751 GLU 751 751 751 GLU GLU D . n 
S  3  752 ASP 752 752 752 ASP ASP D . n 
S  3  753 VAL 753 753 753 VAL VAL D . n 
S  3  754 PRO 754 754 754 PRO PRO D . n 
S  3  755 LYS 755 755 755 LYS LYS D . n 
S  3  756 GLY 756 756 756 GLY GLY D . n 
S  3  757 HIS 757 757 757 HIS HIS D . n 
S  3  758 LEU 758 758 758 LEU LEU D . n 
S  3  759 TYR 759 759 759 TYR TYR D . n 
S  3  760 LEU 760 760 760 LEU LEU D . n 
S  3  761 SER 761 761 761 SER SER D . n 
S  3  762 ALA 762 762 762 ALA ALA D . n 
S  3  763 LEU 763 763 763 LEU LEU D . n 
S  3  764 GLY 764 764 764 GLY GLY D . n 
S  3  765 PRO 765 765 765 PRO PRO D . n 
S  3  766 ALA 766 766 766 ALA ALA D . n 
S  3  767 ALA 767 767 767 ALA ALA D . n 
S  3  768 GLY 768 768 768 GLY GLY D . n 
S  3  769 LEU 769 769 769 LEU LEU D . n 
S  3  770 ARG 770 770 770 ARG ARG D . n 
S  3  771 VAL 771 771 771 VAL VAL D . n 
S  3  772 GLU 772 772 772 GLU GLU D . n 
S  3  773 GLY 773 773 773 GLY GLY D . n 
S  3  774 ARG 774 774 774 ARG ARG D . n 
S  3  775 VAL 775 775 775 VAL VAL D . n 
S  3  776 LEU 776 776 776 LEU LEU D . n 
S  3  777 VAL 777 777 777 VAL VAL D . n 
S  3  778 PRO 778 778 ?   ?   ?   D . n 
S  3  779 ALA 779 779 ?   ?   ?   D . n 
S  3  780 GLY 780 780 ?   ?   ?   D . n 
S  3  781 GLY 781 781 ?   ?   ?   D . n 
S  3  782 GLU 782 782 ?   ?   ?   D . n 
S  3  783 ALA 783 783 ?   ?   ?   D . n 
T  4  1   MET 1   1   ?   ?   ?   E . n 
T  4  2   ARG 2   2   ?   ?   ?   E . n 
T  4  3   GLU 3   3   ?   ?   ?   E . n 
T  4  4   GLU 4   4   ?   ?   ?   E . n 
T  4  5   PHE 5   5   ?   ?   ?   E . n 
T  4  6   LEU 6   6   ?   ?   ?   E . n 
T  4  7   GLU 7   7   ?   ?   ?   E . n 
T  4  8   GLU 8   8   ?   ?   ?   E . n 
T  4  9   ILE 9   9   ?   ?   ?   E . n 
T  4  10  PRO 10  10  ?   ?   ?   E . n 
T  4  11  LEU 11  11  ?   ?   ?   E . n 
T  4  12  ASP 12  12  ?   ?   ?   E . n 
T  4  13  ALA 13  13  ?   ?   ?   E . n 
T  4  14  PRO 14  14  ?   ?   ?   E . n 
T  4  15  PRO 15  15  ?   ?   ?   E . n 
T  4  16  GLU 16  16  ?   ?   ?   E . n 
T  4  17  GLU 17  17  ?   ?   ?   E . n 
T  4  18  ALA 18  18  ?   ?   ?   E . n 
T  4  19  LYS 19  19  ?   ?   ?   E . n 
T  4  20  GLU 20  20  ?   ?   ?   E . n 
T  4  21  LEU 21  21  ?   ?   ?   E . n 
T  4  22  ARG 22  22  ?   ?   ?   E . n 
T  4  23  THR 23  23  ?   ?   ?   E . n 
T  4  24  GLU 24  24  ?   ?   ?   E . n 
T  4  25  VAL 25  25  ?   ?   ?   E . n 
T  4  26  MET 26  26  26  MET MET E . n 
T  4  27  THR 27  27  27  THR THR E . n 
T  4  28  LEU 28  28  28  LEU LEU E . n 
T  4  29  ASN 29  29  29  ASN ASN E . n 
T  4  30  VAL 30  30  30  VAL VAL E . n 
T  4  31  GLY 31  31  31  GLY GLY E . n 
T  4  32  PRO 32  32  32  PRO PRO E . n 
T  4  33  GLN 33  33  33  GLN GLN E . n 
T  4  34  HIS 34  34  34  HIS HIS E . n 
T  4  35  PRO 35  35  35  PRO PRO E . n 
T  4  36  SER 36  36  36  SER SER E . n 
T  4  37  THR 37  37  37  THR THR E . n 
T  4  38  HIS 38  38  38  HIS HIS E . n 
T  4  39  GLY 39  39  39  GLY GLY E . n 
T  4  40  VAL 40  40  40  VAL VAL E . n 
T  4  41  LEU 41  41  41  LEU LEU E . n 
T  4  42  ARG 42  42  42  ARG ARG E . n 
T  4  43  LEU 43  43  43  LEU LEU E . n 
T  4  44  MET 44  44  44  MET MET E . n 
T  4  45  VAL 45  45  45  VAL VAL E . n 
T  4  46  THR 46  46  46  THR THR E . n 
T  4  47  LEU 47  47  47  LEU LEU E . n 
T  4  48  SER 48  48  48  SER SER E . n 
T  4  49  GLY 49  49  49  GLY GLY E . n 
T  4  50  GLU 50  50  50  GLU GLU E . n 
T  4  51  GLU 51  51  51  GLU GLU E . n 
T  4  52  VAL 52  52  52  VAL VAL E . n 
T  4  53  LEU 53  53  53  LEU LEU E . n 
T  4  54  GLU 54  54  54  GLU GLU E . n 
T  4  55  VAL 55  55  55  VAL VAL E . n 
T  4  56  VAL 56  56  56  VAL VAL E . n 
T  4  57  PRO 57  57  57  PRO PRO E . n 
T  4  58  HIS 58  58  58  HIS HIS E . n 
T  4  59  ILE 59  59  59  ILE ILE E . n 
T  4  60  GLY 60  60  60  GLY GLY E . n 
T  4  61  TYR 61  61  61  TYR TYR E . n 
T  4  62  LEU 62  62  62  LEU LEU E . n 
T  4  63  HIS 63  63  63  HIS HIS E . n 
T  4  64  THR 64  64  64  THR THR E . n 
T  4  65  GLY 65  65  65  GLY GLY E . n 
T  4  66  PHE 66  66  66  PHE PHE E . n 
T  4  67  GLU 67  67  67  GLU GLU E . n 
T  4  68  LYS 68  68  68  LYS LYS E . n 
T  4  69  THR 69  69  69  THR THR E . n 
T  4  70  MET 70  70  70  MET MET E . n 
T  4  71  GLU 71  71  71  GLU GLU E . n 
T  4  72  HIS 72  72  72  HIS HIS E . n 
T  4  73  ARG 73  73  73  ARG ARG E . n 
T  4  74  THR 74  74  74  THR THR E . n 
T  4  75  TYR 75  75  75  TYR TYR E . n 
T  4  76  LEU 76  76  76  LEU LEU E . n 
T  4  77  GLN 77  77  77  GLN GLN E . n 
T  4  78  ASN 78  78  78  ASN ASN E . n 
T  4  79  ILE 79  79  79  ILE ILE E . n 
T  4  80  THR 80  80  80  THR THR E . n 
T  4  81  TYR 81  81  81  TYR TYR E . n 
T  4  82  THR 82  82  82  THR THR E . n 
T  4  83  PRO 83  83  83  PRO PRO E . n 
T  4  84  ARG 84  84  84  ARG ARG E . n 
T  4  85  MET 85  85  85  MET MET E . n 
T  4  86  ASP 86  86  86  ASP ASP E . n 
T  4  87  TYR 87  87  87  TYR TYR E . n 
T  4  88  LEU 88  88  88  LEU LEU E . n 
T  4  89  HIS 89  89  89  HIS HIS E . n 
T  4  90  SER 90  90  90  SER SER E . n 
T  4  91  PHE 91  91  91  PHE PHE E . n 
T  4  92  ALA 92  92  92  ALA ALA E . n 
T  4  93  HIS 93  93  93  HIS HIS E . n 
T  4  94  ASP 94  94  94  ASP ASP E . n 
T  4  95  LEU 95  95  95  LEU LEU E . n 
T  4  96  ALA 96  96  96  ALA ALA E . n 
T  4  97  TYR 97  97  97  TYR TYR E . n 
T  4  98  ALA 98  98  98  ALA ALA E . n 
T  4  99  LEU 99  99  99  LEU LEU E . n 
T  4  100 ALA 100 100 100 ALA ALA E . n 
T  4  101 VAL 101 101 101 VAL VAL E . n 
T  4  102 GLU 102 102 102 GLU GLU E . n 
T  4  103 LYS 103 103 103 LYS LYS E . n 
T  4  104 LEU 104 104 104 LEU LEU E . n 
T  4  105 LEU 105 105 105 LEU LEU E . n 
T  4  106 GLY 106 106 106 GLY GLY E . n 
T  4  107 ALA 107 107 107 ALA ALA E . n 
T  4  108 VAL 108 108 108 VAL VAL E . n 
T  4  109 VAL 109 109 109 VAL VAL E . n 
T  4  110 PRO 110 110 110 PRO PRO E . n 
T  4  111 PRO 111 111 111 PRO PRO E . n 
T  4  112 ARG 112 112 112 ARG ARG E . n 
T  4  113 ALA 113 113 113 ALA ALA E . n 
T  4  114 GLU 114 114 114 GLU GLU E . n 
T  4  115 THR 115 115 115 THR THR E . n 
T  4  116 ILE 116 116 116 ILE ILE E . n 
T  4  117 ARG 117 117 117 ARG ARG E . n 
T  4  118 VAL 118 118 118 VAL VAL E . n 
T  4  119 ILE 119 119 119 ILE ILE E . n 
T  4  120 LEU 120 120 120 LEU LEU E . n 
T  4  121 ASN 121 121 121 ASN ASN E . n 
T  4  122 GLU 122 122 122 GLU GLU E . n 
T  4  123 LEU 123 123 123 LEU LEU E . n 
T  4  124 SER 124 124 124 SER SER E . n 
T  4  125 ARG 125 125 125 ARG ARG E . n 
T  4  126 LEU 126 126 126 LEU LEU E . n 
T  4  127 ALA 127 127 127 ALA ALA E . n 
T  4  128 SER 128 128 128 SER SER E . n 
T  4  129 HIS 129 129 129 HIS HIS E . n 
T  4  130 LEU 130 130 130 LEU LEU E . n 
T  4  131 VAL 131 131 131 VAL VAL E . n 
T  4  132 PHE 132 132 132 PHE PHE E . n 
T  4  133 LEU 133 133 133 LEU LEU E . n 
T  4  134 GLY 134 134 134 GLY GLY E . n 
T  4  135 THR 135 135 135 THR THR E . n 
T  4  136 GLY 136 136 136 GLY GLY E . n 
T  4  137 LEU 137 137 137 LEU LEU E . n 
T  4  138 LEU 138 138 138 LEU LEU E . n 
T  4  139 ASP 139 139 139 ASP ASP E . n 
T  4  140 LEU 140 140 140 LEU LEU E . n 
T  4  141 GLY 141 141 141 GLY GLY E . n 
T  4  142 ALA 142 142 142 ALA ALA E . n 
T  4  143 LEU 143 143 143 LEU LEU E . n 
T  4  144 THR 144 144 144 THR THR E . n 
T  4  145 PRO 145 145 145 PRO PRO E . n 
T  4  146 PHE 146 146 146 PHE PHE E . n 
T  4  147 PHE 147 147 147 PHE PHE E . n 
T  4  148 TYR 148 148 148 TYR TYR E . n 
T  4  149 ALA 149 149 149 ALA ALA E . n 
T  4  150 PHE 150 150 150 PHE PHE E . n 
T  4  151 ARG 151 151 151 ARG ARG E . n 
T  4  152 GLU 152 152 152 GLU GLU E . n 
T  4  153 ARG 153 153 153 ARG ARG E . n 
T  4  154 GLU 154 154 154 GLU GLU E . n 
T  4  155 THR 155 155 155 THR THR E . n 
T  4  156 ILE 156 156 156 ILE ILE E . n 
T  4  157 LEU 157 157 157 LEU LEU E . n 
T  4  158 ASP 158 158 158 ASP ASP E . n 
T  4  159 LEU 159 159 159 LEU LEU E . n 
T  4  160 PHE 160 160 160 PHE PHE E . n 
T  4  161 GLU 161 161 161 GLU GLU E . n 
T  4  162 TRP 162 162 162 TRP TRP E . n 
T  4  163 VAL 163 163 163 VAL VAL E . n 
T  4  164 THR 164 164 164 THR THR E . n 
T  4  165 GLY 165 165 165 GLY GLY E . n 
T  4  166 GLN 166 166 166 GLN GLN E . n 
T  4  167 ARG 167 167 167 ARG ARG E . n 
T  4  168 PHE 168 168 168 PHE PHE E . n 
T  4  169 HIS 169 169 169 HIS HIS E . n 
T  4  170 HIS 170 170 170 HIS HIS E . n 
T  4  171 ASN 171 171 171 ASN ASN E . n 
T  4  172 TYR 172 172 172 TYR TYR E . n 
T  4  173 ILE 173 173 173 ILE ILE E . n 
T  4  174 ARG 174 174 174 ARG ARG E . n 
T  4  175 ILE 175 175 175 ILE ILE E . n 
T  4  176 GLY 176 176 176 GLY GLY E . n 
T  4  177 GLY 177 177 177 GLY GLY E . n 
T  4  178 VAL 178 178 178 VAL VAL E . n 
T  4  179 LYS 179 179 179 LYS LYS E . n 
T  4  180 GLU 180 180 180 GLU GLU E . n 
T  4  181 ASP 181 181 181 ASP ASP E . n 
T  4  182 LEU 182 182 182 LEU LEU E . n 
T  4  183 PRO 183 183 183 PRO PRO E . n 
T  4  184 GLU 184 184 184 GLU GLU E . n 
T  4  185 GLU 185 185 185 GLU GLU E . n 
T  4  186 PHE 186 186 186 PHE PHE E . n 
T  4  187 VAL 187 187 187 VAL VAL E . n 
T  4  188 PRO 188 188 188 PRO PRO E . n 
T  4  189 GLU 189 189 189 GLU GLU E . n 
T  4  190 LEU 190 190 190 LEU LEU E . n 
T  4  191 LYS 191 191 191 LYS LYS E . n 
T  4  192 LYS 192 192 192 LYS LYS E . n 
T  4  193 LEU 193 193 193 LEU LEU E . n 
T  4  194 LEU 194 194 194 LEU LEU E . n 
T  4  195 GLU 195 195 195 GLU GLU E . n 
T  4  196 VAL 196 196 196 VAL VAL E . n 
T  4  197 LEU 197 197 197 LEU LEU E . n 
T  4  198 PRO 198 198 198 PRO PRO E . n 
T  4  199 HIS 199 199 199 HIS HIS E . n 
T  4  200 ARG 200 200 200 ARG ARG E . n 
T  4  201 ILE 201 201 201 ILE ILE E . n 
T  4  202 ASP 202 202 202 ASP ASP E . n 
T  4  203 GLU 203 203 203 GLU GLU E . n 
T  4  204 TYR 204 204 204 TYR TYR E . n 
T  4  205 GLU 205 205 205 GLU GLU E . n 
T  4  206 ALA 206 206 206 ALA ALA E . n 
T  4  207 LEU 207 207 207 LEU LEU E . n 
T  4  208 PHE 208 208 208 PHE PHE E . n 
T  4  209 ALA 209 209 209 ALA ALA E . n 
T  4  210 GLU 210 210 210 GLU GLU E . n 
T  4  211 SER 211 211 211 SER SER E . n 
T  4  212 PRO 212 212 212 PRO PRO E . n 
T  4  213 ILE 213 213 213 ILE ILE E . n 
T  4  214 PHE 214 214 214 PHE PHE E . n 
T  4  215 TYR 215 215 215 TYR TYR E . n 
T  4  216 GLU 216 216 216 GLU GLU E . n 
T  4  217 ARG 217 217 217 ARG ARG E . n 
T  4  218 ALA 218 218 218 ALA ALA E . n 
T  4  219 ARG 219 219 219 ARG ARG E . n 
T  4  220 GLY 220 220 220 GLY GLY E . n 
T  4  221 VAL 221 221 221 VAL VAL E . n 
T  4  222 GLY 222 222 222 GLY GLY E . n 
T  4  223 VAL 223 223 223 VAL VAL E . n 
T  4  224 ILE 224 224 224 ILE ILE E . n 
T  4  225 PRO 225 225 225 PRO PRO E . n 
T  4  226 PRO 226 226 226 PRO PRO E . n 
T  4  227 GLU 227 227 227 GLU GLU E . n 
T  4  228 VAL 228 228 228 VAL VAL E . n 
T  4  229 ALA 229 229 229 ALA ALA E . n 
T  4  230 ILE 230 230 230 ILE ILE E . n 
T  4  231 ASP 231 231 231 ASP ASP E . n 
T  4  232 LEU 232 232 232 LEU LEU E . n 
T  4  233 GLY 233 233 233 GLY GLY E . n 
T  4  234 LEU 234 234 234 LEU LEU E . n 
T  4  235 THR 235 235 235 THR THR E . n 
T  4  236 GLY 236 236 236 GLY GLY E . n 
T  4  237 GLY 237 237 237 GLY GLY E . n 
T  4  238 SER 238 238 238 SER SER E . n 
T  4  239 LEU 239 239 239 LEU LEU E . n 
T  4  240 ARG 240 240 240 ARG ARG E . n 
T  4  241 ALA 241 241 241 ALA ALA E . n 
T  4  242 SER 242 242 242 SER SER E . n 
T  4  243 GLY 243 243 243 GLY GLY E . n 
T  4  244 VAL 244 244 244 VAL VAL E . n 
T  4  245 ASN 245 245 245 ASN ASN E . n 
T  4  246 TYR 246 246 246 TYR TYR E . n 
T  4  247 ASP 247 247 247 ASP ASP E . n 
T  4  248 VAL 248 248 248 VAL VAL E . n 
T  4  249 ARG 249 249 249 ARG ARG E . n 
T  4  250 LYS 250 250 250 LYS LYS E . n 
T  4  251 ALA 251 251 251 ALA ALA E . n 
T  4  252 TYR 252 252 252 TYR TYR E . n 
T  4  253 PRO 253 253 253 PRO PRO E . n 
T  4  254 TYR 254 254 254 TYR TYR E . n 
T  4  255 SER 255 255 255 SER SER E . n 
T  4  256 GLY 256 256 256 GLY GLY E . n 
T  4  257 TYR 257 257 257 TYR TYR E . n 
T  4  258 GLU 258 258 258 GLU GLU E . n 
T  4  259 THR 259 259 259 THR THR E . n 
T  4  260 TYR 260 260 260 TYR TYR E . n 
T  4  261 THR 261 261 261 THR THR E . n 
T  4  262 PHE 262 262 262 PHE PHE E . n 
T  4  263 ASP 263 263 263 ASP ASP E . n 
T  4  264 VAL 264 264 264 VAL VAL E . n 
T  4  265 PRO 265 265 265 PRO PRO E . n 
T  4  266 LEU 266 266 266 LEU LEU E . n 
T  4  267 GLY 267 267 267 GLY GLY E . n 
T  4  268 GLU 268 268 268 GLU GLU E . n 
T  4  269 ARG 269 269 269 ARG ARG E . n 
T  4  270 GLY 270 270 270 GLY GLY E . n 
T  4  271 ASP 271 271 271 ASP ASP E . n 
T  4  272 VAL 272 272 272 VAL VAL E . n 
T  4  273 PHE 273 273 273 PHE PHE E . n 
T  4  274 ASP 274 274 274 ASP ASP E . n 
T  4  275 ARG 275 275 275 ARG ARG E . n 
T  4  276 MET 276 276 276 MET MET E . n 
T  4  277 LEU 277 277 277 LEU LEU E . n 
T  4  278 VAL 278 278 278 VAL VAL E . n 
T  4  279 ARG 279 279 279 ARG ARG E . n 
T  4  280 ILE 280 280 280 ILE ILE E . n 
T  4  281 ARG 281 281 281 ARG ARG E . n 
T  4  282 GLU 282 282 282 GLU GLU E . n 
T  4  283 MET 283 283 283 MET MET E . n 
T  4  284 ARG 284 284 284 ARG ARG E . n 
T  4  285 GLU 285 285 285 GLU GLU E . n 
T  4  286 SER 286 286 286 SER SER E . n 
T  4  287 VAL 287 287 287 VAL VAL E . n 
T  4  288 LYS 288 288 288 LYS LYS E . n 
T  4  289 ILE 289 289 289 ILE ILE E . n 
T  4  290 ILE 290 290 290 ILE ILE E . n 
T  4  291 LYS 291 291 291 LYS LYS E . n 
T  4  292 GLN 292 292 292 GLN GLN E . n 
T  4  293 ALA 293 293 293 ALA ALA E . n 
T  4  294 LEU 294 294 294 LEU LEU E . n 
T  4  295 GLU 295 295 295 GLU GLU E . n 
T  4  296 ARG 296 296 296 ARG ARG E . n 
T  4  297 LEU 297 297 297 LEU LEU E . n 
T  4  298 GLU 298 298 298 GLU GLU E . n 
T  4  299 PRO 299 299 299 PRO PRO E . n 
T  4  300 GLY 300 300 300 GLY GLY E . n 
T  4  301 PRO 301 301 301 PRO PRO E . n 
T  4  302 VAL 302 302 302 VAL VAL E . n 
T  4  303 ARG 303 303 303 ARG ARG E . n 
T  4  304 ASP 304 304 304 ASP ASP E . n 
T  4  305 PRO 305 305 305 PRO PRO E . n 
T  4  306 ASN 306 306 306 ASN ASN E . n 
T  4  307 PRO 307 307 307 PRO PRO E . n 
T  4  308 GLN 308 308 308 GLN GLN E . n 
T  4  309 ILE 309 309 309 ILE ILE E . n 
T  4  310 THR 310 310 310 THR THR E . n 
T  4  311 PRO 311 311 311 PRO PRO E . n 
T  4  312 PRO 312 312 312 PRO PRO E . n 
T  4  313 PRO 313 313 313 PRO PRO E . n 
T  4  314 ARG 314 314 314 ARG ARG E . n 
T  4  315 HIS 315 315 315 HIS HIS E . n 
T  4  316 LEU 316 316 316 LEU LEU E . n 
T  4  317 LEU 317 317 317 LEU LEU E . n 
T  4  318 GLU 318 318 318 GLU GLU E . n 
T  4  319 THR 319 319 319 THR THR E . n 
T  4  320 SER 320 320 320 SER SER E . n 
T  4  321 MET 321 321 321 MET MET E . n 
T  4  322 GLU 322 322 322 GLU GLU E . n 
T  4  323 ALA 323 323 323 ALA ALA E . n 
T  4  324 VAL 324 324 324 VAL VAL E . n 
T  4  325 ILE 325 325 325 ILE ILE E . n 
T  4  326 TYR 326 326 326 TYR TYR E . n 
T  4  327 HIS 327 327 327 HIS HIS E . n 
T  4  328 PHE 328 328 328 PHE PHE E . n 
T  4  329 LYS 329 329 329 LYS LYS E . n 
T  4  330 HIS 330 330 330 HIS HIS E . n 
T  4  331 TYR 331 331 331 TYR TYR E . n 
T  4  332 THR 332 332 332 THR THR E . n 
T  4  333 GLU 333 333 333 GLU GLU E . n 
T  4  334 GLY 334 334 334 GLY GLY E . n 
T  4  335 PHE 335 335 335 PHE PHE E . n 
T  4  336 HIS 336 336 336 HIS HIS E . n 
T  4  337 PRO 337 337 337 PRO PRO E . n 
T  4  338 PRO 338 338 338 PRO PRO E . n 
T  4  339 LYS 339 339 339 LYS LYS E . n 
T  4  340 GLY 340 340 340 GLY GLY E . n 
T  4  341 GLU 341 341 341 GLU GLU E . n 
T  4  342 VAL 342 342 342 VAL VAL E . n 
T  4  343 TYR 343 343 343 TYR TYR E . n 
T  4  344 VAL 344 344 344 VAL VAL E . n 
T  4  345 PRO 345 345 345 PRO PRO E . n 
T  4  346 THR 346 346 346 THR THR E . n 
T  4  347 GLU 347 347 347 GLU GLU E . n 
T  4  348 SER 348 348 348 SER SER E . n 
T  4  349 ALA 349 349 349 ALA ALA E . n 
T  4  350 ARG 350 350 350 ARG ARG E . n 
T  4  351 GLY 351 351 351 GLY GLY E . n 
T  4  352 GLU 352 352 352 GLU GLU E . n 
T  4  353 LEU 353 353 353 LEU LEU E . n 
T  4  354 GLY 354 354 354 GLY GLY E . n 
T  4  355 TYR 355 355 355 TYR TYR E . n 
T  4  356 TYR 356 356 356 TYR TYR E . n 
T  4  357 ILE 357 357 357 ILE ILE E . n 
T  4  358 VAL 358 358 358 VAL VAL E . n 
T  4  359 SER 359 359 359 SER SER E . n 
T  4  360 ASP 360 360 360 ASP ASP E . n 
T  4  361 GLY 361 361 361 GLY GLY E . n 
T  4  362 GLY 362 362 362 GLY GLY E . n 
T  4  363 SER 363 363 363 SER SER E . n 
T  4  364 MET 364 364 364 MET MET E . n 
T  4  365 PRO 365 365 365 PRO PRO E . n 
T  4  366 TYR 366 366 366 TYR TYR E . n 
T  4  367 ARG 367 367 367 ARG ARG E . n 
T  4  368 VAL 368 368 368 VAL VAL E . n 
T  4  369 LYS 369 369 369 LYS LYS E . n 
T  4  370 VAL 370 370 370 VAL VAL E . n 
T  4  371 ARG 371 371 371 ARG ARG E . n 
T  4  372 ALA 372 372 372 ALA ALA E . n 
T  4  373 PRO 373 373 373 PRO PRO E . n 
T  4  374 SER 374 374 374 SER SER E . n 
T  4  375 PHE 375 375 375 PHE PHE E . n 
T  4  376 VAL 376 376 376 VAL VAL E . n 
T  4  377 ASN 377 377 377 ASN ASN E . n 
T  4  378 LEU 378 378 378 LEU LEU E . n 
T  4  379 GLN 379 379 379 GLN GLN E . n 
T  4  380 SER 380 380 380 SER SER E . n 
T  4  381 LEU 381 381 381 LEU LEU E . n 
T  4  382 PRO 382 382 382 PRO PRO E . n 
T  4  383 TYR 383 383 383 TYR TYR E . n 
T  4  384 ALA 384 384 384 ALA ALA E . n 
T  4  385 CYS 385 385 385 CYS CYS E . n 
T  4  386 LYS 386 386 386 LYS LYS E . n 
T  4  387 GLY 387 387 387 GLY GLY E . n 
T  4  388 GLU 388 388 388 GLU GLU E . n 
T  4  389 GLN 389 389 389 GLN GLN E . n 
T  4  390 VAL 390 390 390 VAL VAL E . n 
T  4  391 PRO 391 391 391 PRO PRO E . n 
T  4  392 ASP 392 392 392 ASP ASP E . n 
T  4  393 MET 393 393 393 MET MET E . n 
T  4  394 VAL 394 394 394 VAL VAL E . n 
T  4  395 ALA 395 395 395 ALA ALA E . n 
T  4  396 ILE 396 396 396 ILE ILE E . n 
T  4  397 ILE 397 397 397 ILE ILE E . n 
T  4  398 ALA 398 398 398 ALA ALA E . n 
T  4  399 SER 399 399 399 SER SER E . n 
T  4  400 LEU 400 400 400 LEU LEU E . n 
T  4  401 ASP 401 401 401 ASP ASP E . n 
T  4  402 PRO 402 402 402 PRO PRO E . n 
T  4  403 VAL 403 403 403 VAL VAL E . n 
T  4  404 MET 404 404 404 MET MET E . n 
T  4  405 GLY 405 405 405 GLY GLY E . n 
T  4  406 ASP 406 406 406 ASP ASP E . n 
T  4  407 VAL 407 407 407 VAL VAL E . n 
T  4  408 ASP 408 408 408 ASP ASP E . n 
T  4  409 ARG 409 409 409 ARG ARG E . n 
U  5  1   MET 1   1   1   MET MET F . n 
U  5  2   ARG 2   2   2   ARG ARG F . n 
U  5  3   LEU 3   3   3   LEU LEU F . n 
U  5  4   GLU 4   4   4   GLU GLU F . n 
U  5  5   ARG 5   5   5   ARG ARG F . n 
U  5  6   VAL 6   6   6   VAL VAL F . n 
U  5  7   LEU 7   7   7   LEU LEU F . n 
U  5  8   GLU 8   8   8   GLU GLU F . n 
U  5  9   GLU 9   9   9   GLU GLU F . n 
U  5  10  ALA 10  10  10  ALA ALA F . n 
U  5  11  ARG 11  11  11  ARG ARG F . n 
U  5  12  ALA 12  12  12  ALA ALA F . n 
U  5  13  LYS 13  13  13  LYS LYS F . n 
U  5  14  GLY 14  14  14  GLY GLY F . n 
U  5  15  TYR 15  15  15  TYR TYR F . n 
U  5  16  PRO 16  16  16  PRO PRO F . n 
U  5  17  ILE 17  17  17  ILE ILE F . n 
U  5  18  GLU 18  18  18  GLU GLU F . n 
U  5  19  ASP 19  19  19  ASP ASP F . n 
U  5  20  ASN 20  20  20  ASN ASN F . n 
U  5  21  GLY 21  21  21  GLY GLY F . n 
U  5  22  LEU 22  22  22  LEU LEU F . n 
U  5  23  GLY 23  23  23  GLY GLY F . n 
U  5  24  ASN 24  24  24  ASN ASN F . n 
U  5  25  LEU 25  25  25  LEU LEU F . n 
U  5  26  TRP 26  26  26  TRP TRP F . n 
U  5  27  VAL 27  27  27  VAL VAL F . n 
U  5  28  VAL 28  28  28  VAL VAL F . n 
U  5  29  LEU 29  29  29  LEU LEU F . n 
U  5  30  PRO 30  30  30  PRO PRO F . n 
U  5  31  ARG 31  31  31  ARG ARG F . n 
U  5  32  GLU 32  32  32  GLU GLU F . n 
U  5  33  ARG 33  33  33  ARG ARG F . n 
U  5  34  PHE 34  34  34  PHE PHE F . n 
U  5  35  LYS 35  35  35  LYS LYS F . n 
U  5  36  GLU 36  36  36  GLU GLU F . n 
U  5  37  GLU 37  37  37  GLU GLU F . n 
U  5  38  MET 38  38  38  MET MET F . n 
U  5  39  ALA 39  39  39  ALA ALA F . n 
U  5  40  HIS 40  40  40  HIS HIS F . n 
U  5  41  TYR 41  41  41  TYR TYR F . n 
U  5  42  LYS 42  42  42  LYS LYS F . n 
U  5  43  ALA 43  43  43  ALA ALA F . n 
U  5  44  MET 44  44  44  MET MET F . n 
U  5  45  GLY 45  45  45  GLY GLY F . n 
U  5  46  PHE 46  46  46  PHE PHE F . n 
U  5  47  ASN 47  47  47  ASN ASN F . n 
U  5  48  PHE 48  48  48  PHE PHE F . n 
U  5  49  LEU 49  49  49  LEU LEU F . n 
U  5  50  ALA 50  50  50  ALA ALA F . n 
U  5  51  ASP 51  51  51  ASP ASP F . n 
U  5  52  ILE 52  52  52  ILE ILE F . n 
U  5  53  VAL 53  53  53  VAL VAL F . n 
U  5  54  GLY 54  54  54  GLY GLY F . n 
U  5  55  LEU 55  55  55  LEU LEU F . n 
U  5  56  ASP 56  56  56  ASP ASP F . n 
U  5  57  TYR 57  57  57  TYR TYR F . n 
U  5  58  LEU 58  58  58  LEU LEU F . n 
U  5  59  THR 59  59  59  THR THR F . n 
U  5  60  TYR 60  60  60  TYR TYR F . n 
U  5  61  PRO 61  61  61  PRO PRO F . n 
U  5  62  ASP 62  62  62  ASP ASP F . n 
U  5  63  PRO 63  63  63  PRO PRO F . n 
U  5  64  ARG 64  64  64  ARG ARG F . n 
U  5  65  PRO 65  65  65  PRO PRO F . n 
U  5  66  GLU 66  66  66  GLU GLU F . n 
U  5  67  ARG 67  67  67  ARG ARG F . n 
U  5  68  PHE 68  68  68  PHE PHE F . n 
U  5  69  ALA 69  69  69  ALA ALA F . n 
U  5  70  VAL 70  70  70  VAL VAL F . n 
U  5  71  VAL 71  71  71  VAL VAL F . n 
U  5  72  TYR 72  72  72  TYR TYR F . n 
U  5  73  GLU 73  73  73  GLU GLU F . n 
U  5  74  LEU 74  74  74  LEU LEU F . n 
U  5  75  VAL 75  75  75  VAL VAL F . n 
U  5  76  SER 76  76  76  SER SER F . n 
U  5  77  LEU 77  77  77  LEU LEU F . n 
U  5  78  PRO 78  78  78  PRO PRO F . n 
U  5  79  GLY 79  79  79  GLY GLY F . n 
U  5  80  TRP 80  80  80  TRP TRP F . n 
U  5  81  LYS 81  81  81  LYS LYS F . n 
U  5  82  ASP 82  82  82  ASP ASP F . n 
U  5  83  GLY 83  83  83  GLY GLY F . n 
U  5  84  ASP 84  84  84  ASP ASP F . n 
U  5  85  GLY 85  85  85  GLY GLY F . n 
U  5  86  SER 86  86  86  SER SER F . n 
U  5  87  ARG 87  87  87  ARG ARG F . n 
U  5  88  PHE 88  88  88  PHE PHE F . n 
U  5  89  PHE 89  89  89  PHE PHE F . n 
U  5  90  VAL 90  90  90  VAL VAL F . n 
U  5  91  ARG 91  91  91  ARG ARG F . n 
U  5  92  VAL 92  92  92  VAL VAL F . n 
U  5  93  TYR 93  93  93  TYR TYR F . n 
U  5  94  VAL 94  94  94  VAL VAL F . n 
U  5  95  PRO 95  95  95  PRO PRO F . n 
U  5  96  GLU 96  96  96  GLU GLU F . n 
U  5  97  GLU 97  97  97  GLU GLU F . n 
U  5  98  ASP 98  98  98  ASP ASP F . n 
U  5  99  PRO 99  99  99  PRO PRO F . n 
U  5  100 ARG 100 100 100 ARG ARG F . n 
U  5  101 LEU 101 101 101 LEU LEU F . n 
U  5  102 PRO 102 102 102 PRO PRO F . n 
U  5  103 THR 103 103 103 THR THR F . n 
U  5  104 VAL 104 104 104 VAL VAL F . n 
U  5  105 THR 105 105 105 THR THR F . n 
U  5  106 ASP 106 106 106 ASP ASP F . n 
U  5  107 LEU 107 107 107 LEU LEU F . n 
U  5  108 TRP 108 108 108 TRP TRP F . n 
U  5  109 GLY 109 109 109 GLY GLY F . n 
U  5  110 SER 110 110 110 SER SER F . n 
U  5  111 ALA 111 111 111 ALA ALA F . n 
U  5  112 ASN 112 112 112 ASN ASN F . n 
U  5  113 PHE 113 113 113 PHE PHE F . n 
U  5  114 LEU 114 114 114 LEU LEU F . n 
U  5  115 GLU 115 115 115 GLU GLU F . n 
U  5  116 ARG 116 116 116 ARG ARG F . n 
U  5  117 GLU 117 117 117 GLU GLU F . n 
U  5  118 VAL 118 118 118 VAL VAL F . n 
U  5  119 TYR 119 119 119 TYR TYR F . n 
U  5  120 ASP 120 120 120 ASP ASP F . n 
U  5  121 LEU 121 121 121 LEU LEU F . n 
U  5  122 PHE 122 122 122 PHE PHE F . n 
U  5  123 GLY 123 123 123 GLY GLY F . n 
U  5  124 ILE 124 124 124 ILE ILE F . n 
U  5  125 VAL 125 125 125 VAL VAL F . n 
U  5  126 PHE 126 126 126 PHE PHE F . n 
U  5  127 GLU 127 127 127 GLU GLU F . n 
U  5  128 GLY 128 128 128 GLY GLY F . n 
U  5  129 HIS 129 129 129 HIS HIS F . n 
U  5  130 PRO 130 130 130 PRO PRO F . n 
U  5  131 ASP 131 131 131 ASP ASP F . n 
U  5  132 LEU 132 132 132 LEU LEU F . n 
U  5  133 ARG 133 133 133 ARG ARG F . n 
U  5  134 LYS 134 134 134 LYS LYS F . n 
U  5  135 ILE 135 135 135 ILE ILE F . n 
U  5  136 LEU 136 136 136 LEU LEU F . n 
U  5  137 THR 137 137 137 THR THR F . n 
U  5  138 PRO 138 138 138 PRO PRO F . n 
U  5  139 GLU 139 139 139 GLU GLU F . n 
U  5  140 ASP 140 140 140 ASP ASP F . n 
U  5  141 LEU 141 141 141 LEU LEU F . n 
U  5  142 GLU 142 142 142 GLU GLU F . n 
U  5  143 GLY 143 143 143 GLY GLY F . n 
U  5  144 HIS 144 144 144 HIS HIS F . n 
U  5  145 PRO 145 145 145 PRO PRO F . n 
U  5  146 LEU 146 146 146 LEU LEU F . n 
U  5  147 ARG 147 147 147 ARG ARG F . n 
U  5  148 LYS 148 148 148 LYS LYS F . n 
U  5  149 ASP 149 149 149 ASP ASP F . n 
U  5  150 TYR 150 150 150 TYR TYR F . n 
U  5  151 PRO 151 151 151 PRO PRO F . n 
U  5  152 LEU 152 152 152 LEU LEU F . n 
U  5  153 GLY 153 153 153 GLY GLY F . n 
U  5  154 GLU 154 154 154 GLU GLU F . n 
U  5  155 THR 155 155 155 THR THR F . n 
U  5  156 PRO 156 156 156 PRO PRO F . n 
U  5  157 THR 157 157 157 THR THR F . n 
U  5  158 LEU 158 158 158 LEU LEU F . n 
U  5  159 PHE 159 159 159 PHE PHE F . n 
U  5  160 ARG 160 160 160 ARG ARG F . n 
U  5  161 GLU 161 161 161 GLU GLU F . n 
U  5  162 GLY 162 162 162 GLY GLY F . n 
U  5  163 ARG 163 163 163 ARG ARG F . n 
U  5  164 TYR 164 164 164 TYR TYR F . n 
U  5  165 ILE 165 165 165 ILE ILE F . n 
U  5  166 ILE 166 166 166 ILE ILE F . n 
U  5  167 PRO 167 167 167 PRO PRO F . n 
U  5  168 ALA 168 168 168 ALA ALA F . n 
U  5  169 GLU 169 169 169 GLU GLU F . n 
U  5  170 PHE 170 170 170 PHE PHE F . n 
U  5  171 ARG 171 171 171 ARG ARG F . n 
U  5  172 ALA 172 172 172 ALA ALA F . n 
U  5  173 ALA 173 173 173 ALA ALA F . n 
U  5  174 LEU 174 174 174 LEU LEU F . n 
U  5  175 THR 175 175 175 THR THR F . n 
U  5  176 GLY 176 176 176 GLY GLY F . n 
U  5  177 LYS 177 177 177 LYS LYS F . n 
U  5  178 ASP 178 178 178 ASP ASP F . n 
U  5  179 PRO 179 179 179 PRO PRO F . n 
U  5  180 GLY 180 180 180 GLY GLY F . n 
U  5  181 LEU 181 181 181 LEU LEU F . n 
U  5  182 THR 182 182 182 THR THR F . n 
U  5  183 PHE 183 183 183 PHE PHE F . n 
U  5  184 TYR 184 184 184 TYR TYR F . n 
U  5  185 LYS 185 185 185 LYS LYS F . n 
U  5  186 GLY 186 186 186 GLY GLY F . n 
U  5  187 GLY 187 187 187 GLY GLY F . n 
U  5  188 SER 188 188 188 SER SER F . n 
U  5  189 ARG 189 189 189 ARG ARG F . n 
U  5  190 LYS 190 190 190 LYS LYS F . n 
U  5  191 GLY 191 191 191 GLY GLY F . n 
U  5  192 TYR 192 192 192 TYR TYR F . n 
U  5  193 ARG 193 193 193 ARG ARG F . n 
U  5  194 SER 194 194 194 SER SER F . n 
U  5  195 LEU 195 195 195 LEU LEU F . n 
U  5  196 TRP 196 196 196 TRP TRP F . n 
U  5  197 ALA 197 197 ?   ?   ?   F . n 
U  5  198 ASP 198 198 ?   ?   ?   F . n 
U  5  199 LEU 199 199 ?   ?   ?   F . n 
U  5  200 LYS 200 200 ?   ?   ?   F . n 
U  5  201 LYS 201 201 ?   ?   ?   F . n 
U  5  202 ALA 202 202 ?   ?   ?   F . n 
U  5  203 ARG 203 203 ?   ?   ?   F . n 
U  5  204 GLU 204 204 ?   ?   ?   F . n 
U  5  205 VAL 205 205 ?   ?   ?   F . n 
U  5  206 LYS 206 206 ?   ?   ?   F . n 
U  5  207 GLY 207 207 ?   ?   ?   F . n 
V  6  1   MET 1   1   ?   ?   ?   G . n 
V  6  2   ALA 2   2   ?   ?   ?   G . n 
V  6  3   LEU 3   3   ?   ?   ?   G . n 
V  6  4   LYS 4   4   ?   ?   ?   G . n 
V  6  5   ASP 5   5   ?   ?   ?   G . n 
V  6  6   LEU 6   6   ?   ?   ?   G . n 
V  6  7   PHE 7   7   ?   ?   ?   G . n 
V  6  8   GLU 8   8   ?   ?   ?   G . n 
V  6  9   ARG 9   9   ?   ?   ?   G . n 
V  6  10  ASP 10  10  ?   ?   ?   G . n 
V  6  11  VAL 11  11  ?   ?   ?   G . n 
V  6  12  GLN 12  12  ?   ?   ?   G . n 
V  6  13  GLU 13  13  ?   ?   ?   G . n 
V  6  14  LEU 14  14  ?   ?   ?   G . n 
V  6  15  GLU 15  15  ?   ?   ?   G . n 
V  6  16  ARG 16  16  16  ARG ARG G . n 
V  6  17  GLU 17  17  17  GLU GLU G . n 
V  6  18  GLY 18  18  18  GLY GLY G . n 
V  6  19  ILE 19  19  19  ILE ILE G . n 
V  6  20  LEU 20  20  20  LEU LEU G . n 
V  6  21  PHE 21  21  21  PHE PHE G . n 
V  6  22  THR 22  22  22  THR THR G . n 
V  6  23  THR 23  23  23  THR THR G . n 
V  6  24  LEU 24  24  24  LEU LEU G . n 
V  6  25  GLU 25  25  25  GLU GLU G . n 
V  6  26  LYS 26  26  26  LYS LYS G . n 
V  6  27  LEU 27  27  27  LEU LEU G . n 
V  6  28  VAL 28  28  28  VAL VAL G . n 
V  6  29  ALA 29  29  29  ALA ALA G . n 
V  6  30  TRP 30  30  30  TRP TRP G . n 
V  6  31  GLY 31  31  31  GLY GLY G . n 
V  6  32  ARG 32  32  32  ARG ARG G . n 
V  6  33  SER 33  33  33  SER SER G . n 
V  6  34  ASN 34  34  34  ASN ASN G . n 
V  6  35  SER 35  35  35  SER SER G . n 
V  6  36  LEU 36  36  36  LEU LEU G . n 
V  6  37  TRP 37  37  37  TRP TRP G . n 
V  6  38  PRO 38  38  38  PRO PRO G . n 
V  6  39  ALA 39  39  39  ALA ALA G . n 
V  6  40  THR 40  40  40  THR THR G . n 
V  6  41  PHE 41  41  41  PHE PHE G . n 
V  6  42  GLY 42  42  42  GLY GLY G . n 
V  6  43  LEU 43  43  43  LEU LEU G . n 
V  6  44  ALA 44  44  44  ALA ALA G . n 
V  6  45  CYS 45  45  45  CYS CYS G . n 
V  6  46  CYS 46  46  46  CYS CYS G . n 
V  6  47  ALA 47  47  47  ALA ALA G . n 
V  6  48  ILE 48  48  48  ILE ILE G . n 
V  6  49  GLU 49  49  49  GLU GLU G . n 
V  6  50  MET 50  50  50  MET MET G . n 
V  6  51  MET 51  51  51  MET MET G . n 
V  6  52  ALA 52  52  52  ALA ALA G . n 
V  6  53  SER 53  53  53  SER SER G . n 
V  6  54  THR 54  54  54  THR THR G . n 
V  6  55  ASP 55  55  55  ASP ASP G . n 
V  6  56  ALA 56  56  56  ALA ALA G . n 
V  6  57  ARG 57  57  57  ARG ARG G . n 
V  6  58  ASN 58  58  58  ASN ASN G . n 
V  6  59  ASP 59  59  59  ASP ASP G . n 
V  6  60  LEU 60  60  60  LEU LEU G . n 
V  6  61  ALA 61  61  61  ALA ALA G . n 
V  6  62  ARG 62  62  62  ARG ARG G . n 
V  6  63  PHE 63  63  63  PHE PHE G . n 
V  6  64  GLY 64  64  64  GLY GLY G . n 
V  6  65  SER 65  65  65  SER SER G . n 
V  6  66  GLU 66  66  66  GLU GLU G . n 
V  6  67  VAL 67  67  67  VAL VAL G . n 
V  6  68  PHE 68  68  68  PHE PHE G . n 
V  6  69  ARG 69  69  69  ARG ARG G . n 
V  6  70  ALA 70  70  70  ALA ALA G . n 
V  6  71  SER 71  71  71  SER SER G . n 
V  6  72  PRO 72  72  72  PRO PRO G . n 
V  6  73  ARG 73  73  73  ARG ARG G . n 
V  6  74  GLN 74  74  74  GLN GLN G . n 
V  6  75  ALA 75  75  75  ALA ALA G . n 
V  6  76  ASP 76  76  76  ASP ASP G . n 
V  6  77  VAL 77  77  77  VAL VAL G . n 
V  6  78  MET 78  78  78  MET MET G . n 
V  6  79  ILE 79  79  79  ILE ILE G . n 
V  6  80  VAL 80  80  80  VAL VAL G . n 
V  6  81  ALA 81  81  81  ALA ALA G . n 
V  6  82  GLY 82  82  82  GLY GLY G . n 
V  6  83  ARG 83  83  83  ARG ARG G . n 
V  6  84  LEU 84  84  84  LEU LEU G . n 
V  6  85  SER 85  85  85  SER SER G . n 
V  6  86  LYS 86  86  86  LYS LYS G . n 
V  6  87  LYS 87  87  87  LYS LYS G . n 
V  6  88  MET 88  88  88  MET MET G . n 
V  6  89  ALA 89  89  89  ALA ALA G . n 
V  6  90  PRO 90  90  90  PRO PRO G . n 
V  6  91  VAL 91  91  91  VAL VAL G . n 
V  6  92  MET 92  92  92  MET MET G . n 
V  6  93  ARG 93  93  93  ARG ARG G . n 
V  6  94  ARG 94  94  94  ARG ARG G . n 
V  6  95  VAL 95  95  95  VAL VAL G . n 
V  6  96  TRP 96  96  96  TRP TRP G . n 
V  6  97  GLU 97  97  97  GLU GLU G . n 
V  6  98  GLN 98  98  98  GLN GLN G . n 
V  6  99  MET 99  99  99  MET MET G . n 
V  6  100 PRO 100 100 100 PRO PRO G . n 
V  6  101 ASP 101 101 101 ASP ASP G . n 
V  6  102 PRO 102 102 102 PRO PRO G . n 
V  6  103 LYS 103 103 103 LYS LYS G . n 
V  6  104 TRP 104 104 104 TRP TRP G . n 
V  6  105 VAL 105 105 105 VAL VAL G . n 
V  6  106 ILE 106 106 106 ILE ILE G . n 
V  6  107 SER 107 107 107 SER SER G . n 
V  6  108 MET 108 108 108 MET MET G . n 
V  6  109 GLY 109 109 109 GLY GLY G . n 
V  6  110 ALA 110 110 110 ALA ALA G . n 
V  6  111 CYS 111 111 111 CYS CYS G . n 
V  6  112 ALA 112 112 112 ALA ALA G . n 
V  6  113 SER 113 113 113 SER SER G . n 
V  6  114 SER 114 114 114 SER SER G . n 
V  6  115 GLY 115 115 115 GLY GLY G . n 
V  6  116 GLY 116 116 116 GLY GLY G . n 
V  6  117 MET 117 117 117 MET MET G . n 
V  6  118 PHE 118 118 118 PHE PHE G . n 
V  6  119 ASN 119 119 119 ASN ASN G . n 
V  6  120 ASN 120 120 120 ASN ASN G . n 
V  6  121 TYR 121 121 121 TYR TYR G . n 
V  6  122 ALA 122 122 122 ALA ALA G . n 
V  6  123 ILE 123 123 123 ILE ILE G . n 
V  6  124 VAL 124 124 124 VAL VAL G . n 
V  6  125 GLN 125 125 125 GLN GLN G . n 
V  6  126 ASN 126 126 126 ASN ASN G . n 
V  6  127 VAL 127 127 127 VAL VAL G . n 
V  6  128 ASP 128 128 128 ASP ASP G . n 
V  6  129 SER 129 129 129 SER SER G . n 
V  6  130 VAL 130 130 130 VAL VAL G . n 
V  6  131 VAL 131 131 131 VAL VAL G . n 
V  6  132 PRO 132 132 132 PRO PRO G . n 
V  6  133 VAL 133 133 133 VAL VAL G . n 
V  6  134 ASP 134 134 134 ASP ASP G . n 
V  6  135 VAL 135 135 135 VAL VAL G . n 
V  6  136 TYR 136 136 136 TYR TYR G . n 
V  6  137 VAL 137 137 137 VAL VAL G . n 
V  6  138 PRO 138 138 138 PRO PRO G . n 
V  6  139 GLY 139 139 139 GLY GLY G . n 
V  6  140 CYS 140 140 140 CYS CYS G . n 
V  6  141 PRO 141 141 141 PRO PRO G . n 
V  6  142 PRO 142 142 142 PRO PRO G . n 
V  6  143 ARG 143 143 143 ARG ARG G . n 
V  6  144 PRO 144 144 144 PRO PRO G . n 
V  6  145 GLU 145 145 145 GLU GLU G . n 
V  6  146 ALA 146 146 146 ALA ALA G . n 
V  6  147 LEU 147 147 147 LEU LEU G . n 
V  6  148 ILE 148 148 148 ILE ILE G . n 
V  6  149 TYR 149 149 149 TYR TYR G . n 
V  6  150 ALA 150 150 150 ALA ALA G . n 
V  6  151 VAL 151 151 151 VAL VAL G . n 
V  6  152 MET 152 152 152 MET MET G . n 
V  6  153 GLN 153 153 153 GLN GLN G . n 
V  6  154 LEU 154 154 154 LEU LEU G . n 
V  6  155 GLN 155 155 155 GLN GLN G . n 
V  6  156 LYS 156 156 156 LYS LYS G . n 
V  6  157 LYS 157 157 157 LYS LYS G . n 
V  6  158 VAL 158 158 158 VAL VAL G . n 
V  6  159 ARG 159 159 159 ARG ARG G . n 
V  6  160 GLY 160 160 160 GLY GLY G . n 
V  6  161 GLN 161 161 161 GLN GLN G . n 
V  6  162 ALA 162 162 162 ALA ALA G . n 
V  6  163 TYR 163 163 163 TYR TYR G . n 
V  6  164 ASN 164 164 164 ASN ASN G . n 
V  6  165 GLU 165 165 165 GLU GLU G . n 
V  6  166 ARG 166 166 166 ARG ARG G . n 
V  6  167 GLY 167 167 167 GLY GLY G . n 
V  6  168 GLU 168 168 168 GLU GLU G . n 
V  6  169 ARG 169 169 169 ARG ARG G . n 
V  6  170 LEU 170 170 170 LEU LEU G . n 
V  6  171 PRO 171 171 171 PRO PRO G . n 
V  6  172 PRO 172 172 172 PRO PRO G . n 
V  6  173 VAL 173 173 173 VAL VAL G . n 
V  6  174 ALA 174 174 174 ALA ALA G . n 
V  6  175 ALA 175 175 175 ALA ALA G . n 
V  6  176 TRP 176 176 176 TRP TRP G . n 
V  6  177 LYS 177 177 177 LYS LYS G . n 
V  6  178 ARG 178 178 178 ARG ARG G . n 
V  6  179 THR 179 179 179 THR THR G . n 
V  6  180 ARG 180 180 180 ARG ARG G . n 
V  6  181 GLY 181 181 181 GLY GLY G . n 
W  7  1   MET 1   1   ?   ?   ?   O . n 
W  7  2   THR 2   2   2   THR THR O . n 
W  7  3   LEU 3   3   3   LEU LEU O . n 
W  7  4   LYS 4   4   4   LYS LYS O . n 
W  7  5   ALA 5   5   5   ALA ALA O . n 
W  7  6   LEU 6   6   6   LEU LEU O . n 
W  7  7   ALA 7   7   7   ALA ALA O . n 
W  7  8   GLN 8   8   8   GLN GLN O . n 
W  7  9   SER 9   9   9   SER SER O . n 
W  7  10  LEU 10  10  10  LEU LEU O . n 
W  7  11  GLY 11  11  11  GLY GLY O . n 
W  7  12  ILE 12  12  12  ILE ILE O . n 
W  7  13  THR 13  13  13  THR THR O . n 
W  7  14  LEU 14  14  14  LEU LEU O . n 
W  7  15  LYS 15  15  15  LYS LYS O . n 
W  7  16  TYR 16  16  16  TYR TYR O . n 
W  7  17  LEU 17  17  17  LEU LEU O . n 
W  7  18  PHE 18  18  18  PHE PHE O . n 
W  7  19  SER 19  19  19  SER SER O . n 
W  7  20  LYS 20  20  20  LYS LYS O . n 
W  7  21  PRO 21  21  21  PRO PRO O . n 
W  7  22  VAL 22  22  22  VAL VAL O . n 
W  7  23  THR 23  23  23  THR THR O . n 
W  7  24  VAL 24  24  24  VAL VAL O . n 
W  7  25  PRO 25  25  25  PRO PRO O . n 
W  7  26  TYR 26  26  26  TYR TYR O . n 
W  7  27  PRO 27  27  27  PRO PRO O . n 
W  7  28  ASP 28  28  28  ASP ASP O . n 
W  7  29  ALA 29  29  29  ALA ALA O . n 
W  7  30  PRO 30  30  30  PRO PRO O . n 
W  7  31  VAL 31  31  31  VAL VAL O . n 
W  7  32  ALA 32  32  32  ALA ALA O . n 
W  7  33  LEU 33  33  33  LEU LEU O . n 
W  7  34  LYS 34  34  34  LYS LYS O . n 
W  7  35  PRO 35  35  35  PRO PRO O . n 
W  7  36  ARG 36  36  36  ARG ARG O . n 
W  7  37  PHE 37  37  37  PHE PHE O . n 
W  7  38  HIS 38  38  38  HIS HIS O . n 
W  7  39  GLY 39  39  39  GLY GLY O . n 
W  7  40  ARG 40  40  40  ARG ARG O . n 
W  7  41  HIS 41  41  41  HIS HIS O . n 
W  7  42  VAL 42  42  42  VAL VAL O . n 
W  7  43  LEU 43  43  43  LEU LEU O . n 
W  7  44  THR 44  44  44  THR THR O . n 
W  7  45  ARG 45  45  45  ARG ARG O . n 
W  7  46  HIS 46  46  46  HIS HIS O . n 
W  7  47  PRO 47  47  47  PRO PRO O . n 
W  7  48  ASN 48  48  48  ASN ASN O . n 
W  7  49  GLY 49  49  49  GLY GLY O . n 
W  7  50  LEU 50  50  50  LEU LEU O . n 
W  7  51  GLU 51  51  51  GLU GLU O . n 
W  7  52  LYS 52  52  52  LYS LYS O . n 
W  7  53  CYS 53  53  53  CYS CYS O . n 
W  7  54  ILE 54  54  54  ILE ILE O . n 
W  7  55  GLY 55  55  55  GLY GLY O . n 
W  7  56  CYS 56  56  56  CYS CYS O . n 
W  7  57  SER 57  57  57  SER SER O . n 
W  7  58  LEU 58  58  58  LEU LEU O . n 
W  7  59  CYS 59  59  59  CYS CYS O . n 
W  7  60  ALA 60  60  60  ALA ALA O . n 
W  7  61  ALA 61  61  61  ALA ALA O . n 
W  7  62  ALA 62  62  62  ALA ALA O . n 
W  7  63  CYS 63  63  63  CYS CYS O . n 
W  7  64  PRO 64  64  64  PRO PRO O . n 
W  7  65  ALA 65  65  65  ALA ALA O . n 
W  7  66  TYR 66  66  66  TYR TYR O . n 
W  7  67  ALA 67  67  67  ALA ALA O . n 
W  7  68  ILE 68  68  68  ILE ILE O . n 
W  7  69  TYR 69  69  69  TYR TYR O . n 
W  7  70  VAL 70  70  70  VAL VAL O . n 
W  7  71  GLU 71  71  71  GLU GLU O . n 
W  7  72  PRO 72  72  72  PRO PRO O . n 
W  7  73  ALA 73  73  73  ALA ALA O . n 
W  7  74  GLU 74  74  74  GLU GLU O . n 
W  7  75  ASN 75  75  75  ASN ASN O . n 
W  7  76  ASP 76  76  76  ASP ASP O . n 
W  7  77  PRO 77  77  77  PRO PRO O . n 
W  7  78  GLU 78  78  78  GLU GLU O . n 
W  7  79  ASN 79  79  79  ASN ASN O . n 
W  7  80  PRO 80  80  80  PRO PRO O . n 
W  7  81  VAL 81  81  81  VAL VAL O . n 
W  7  82  SER 82  82  82  SER SER O . n 
W  7  83  ALA 83  83  83  ALA ALA O . n 
W  7  84  GLY 84  84  84  GLY GLY O . n 
W  7  85  GLU 85  85  85  GLU GLU O . n 
W  7  86  ARG 86  86  86  ARG ARG O . n 
W  7  87  TYR 87  87  87  TYR TYR O . n 
W  7  88  ALA 88  88  88  ALA ALA O . n 
W  7  89  LYS 89  89  89  LYS LYS O . n 
W  7  90  VAL 90  90  90  VAL VAL O . n 
W  7  91  TYR 91  91  91  TYR TYR O . n 
W  7  92  GLU 92  92  92  GLU GLU O . n 
W  7  93  ILE 93  93  93  ILE ILE O . n 
W  7  94  ASN 94  94  94  ASN ASN O . n 
W  7  95  MET 95  95  95  MET MET O . n 
W  7  96  LEU 96  96  96  LEU LEU O . n 
W  7  97  ARG 97  97  97  ARG ARG O . n 
W  7  98  CYS 98  98  98  CYS CYS O . n 
W  7  99  ILE 99  99  99  ILE ILE O . n 
W  7  100 PHE 100 100 100 PHE PHE O . n 
W  7  101 CYS 101 101 101 CYS CYS O . n 
W  7  102 GLY 102 102 102 GLY GLY O . n 
W  7  103 LEU 103 103 103 LEU LEU O . n 
W  7  104 CYS 104 104 104 CYS CYS O . n 
W  7  105 GLU 105 105 105 GLU GLU O . n 
W  7  106 GLU 106 106 106 GLU GLU O . n 
W  7  107 ALA 107 107 107 ALA ALA O . n 
W  7  108 CYS 108 108 108 CYS CYS O . n 
W  7  109 PRO 109 109 109 PRO PRO O . n 
W  7  110 THR 110 110 110 THR THR O . n 
W  7  111 GLY 111 111 111 GLY GLY O . n 
W  7  112 ALA 112 112 112 ALA ALA O . n 
W  7  113 ILE 113 113 113 ILE ILE O . n 
W  7  114 VAL 114 114 114 VAL VAL O . n 
W  7  115 LEU 115 115 115 LEU LEU O . n 
W  7  116 GLY 116 116 116 GLY GLY O . n 
W  7  117 TYR 117 117 117 TYR TYR O . n 
W  7  118 ASP 118 118 118 ASP ASP O . n 
W  7  119 PHE 119 119 119 PHE PHE O . n 
W  7  120 GLU 120 120 120 GLU GLU O . n 
W  7  121 MET 121 121 121 MET MET O . n 
W  7  122 ALA 122 122 122 ALA ALA O . n 
W  7  123 ASP 123 123 123 ASP ASP O . n 
W  7  124 TYR 124 124 124 TYR TYR O . n 
W  7  125 GLU 125 125 125 GLU GLU O . n 
W  7  126 TYR 126 126 126 TYR TYR O . n 
W  7  127 SER 127 127 127 SER SER O . n 
W  7  128 ASP 128 128 128 ASP ASP O . n 
W  7  129 LEU 129 129 129 LEU LEU O . n 
W  7  130 VAL 130 130 130 VAL VAL O . n 
W  7  131 TYR 131 131 131 TYR TYR O . n 
W  7  132 GLY 132 132 132 GLY GLY O . n 
W  7  133 LYS 133 133 133 LYS LYS O . n 
W  7  134 GLU 134 134 134 GLU GLU O . n 
W  7  135 ASP 135 135 135 ASP ASP O . n 
W  7  136 MET 136 136 136 MET MET O . n 
W  7  137 LEU 137 137 137 LEU LEU O . n 
W  7  138 VAL 138 138 138 VAL VAL O . n 
W  7  139 ASP 139 139 139 ASP ASP O . n 
W  7  140 VAL 140 140 140 VAL VAL O . n 
W  7  141 VAL 141 141 141 VAL VAL O . n 
W  7  142 GLY 142 142 142 GLY GLY O . n 
W  7  143 THR 143 143 143 THR THR O . n 
W  7  144 LYS 144 144 144 LYS LYS O . n 
W  7  145 PRO 145 145 145 PRO PRO O . n 
W  7  146 GLN 146 146 146 GLN GLN O . n 
W  7  147 ARG 147 147 147 ARG ARG O . n 
W  7  148 ARG 148 148 148 ARG ARG O . n 
W  7  149 GLU 149 149 149 GLU GLU O . n 
W  7  150 ALA 150 150 150 ALA ALA O . n 
W  7  151 LYS 151 151 151 LYS LYS O . n 
W  7  152 ARG 152 152 152 ARG ARG O . n 
W  7  153 THR 153 153 153 THR THR O . n 
W  7  154 GLY 154 154 154 GLY GLY O . n 
W  7  155 LYS 155 155 155 LYS LYS O . n 
W  7  156 PRO 156 156 156 PRO PRO O . n 
W  7  157 VAL 157 157 157 VAL VAL O . n 
W  7  158 LYS 158 158 158 LYS LYS O . n 
W  7  159 VAL 159 159 159 VAL VAL O . n 
W  7  160 GLY 160 160 160 GLY GLY O . n 
W  7  161 TYR 161 161 161 TYR TYR O . n 
W  7  162 VAL 162 162 162 VAL VAL O . n 
W  7  163 VAL 163 163 163 VAL VAL O . n 
W  7  164 PRO 164 164 164 PRO PRO O . n 
W  7  165 TYR 165 165 165 TYR TYR O . n 
W  7  166 VAL 166 166 166 VAL VAL O . n 
W  7  167 ARG 167 167 167 ARG ARG O . n 
W  7  168 PRO 168 168 168 PRO PRO O . n 
W  7  169 GLU 169 169 169 GLU GLU O . n 
W  7  170 LEU 170 170 170 LEU LEU O . n 
W  7  171 GLU 171 171 171 GLU GLU O . n 
W  7  172 GLY 172 172 172 GLY GLY O . n 
W  7  173 PHE 173 173 173 PHE PHE O . n 
W  7  174 LYS 174 174 174 LYS LYS O . n 
W  7  175 ALA 175 175 175 ALA ALA O . n 
W  7  176 PRO 176 176 176 PRO PRO O . n 
W  7  177 THR 177 177 177 THR THR O . n 
W  7  178 GLU 178 178 178 GLU GLU O . n 
W  7  179 GLY 179 179 179 GLY GLY O . n 
W  7  180 GLY 180 180 180 GLY GLY O . n 
W  7  181 LYS 181 181 181 LYS LYS O . n 
W  7  182 ARG 182 182 ?   ?   ?   O . n 
X  8  1   MET 1   1   ?   ?   ?   I . n 
X  8  2   SER 2   2   ?   ?   ?   I . n 
X  8  3   ALA 3   3   3   ALA ALA I . n 
X  8  4   SER 4   4   4   SER SER I . n 
X  8  5   SER 5   5   5   SER SER I . n 
X  8  6   GLU 6   6   6   GLU GLU I . n 
X  8  7   ARG 7   7   7   ARG ARG I . n 
X  8  8   GLU 8   8   8   GLU GLU I . n 
X  8  9   LEU 9   9   9   LEU LEU I . n 
X  8  10  TYR 10  10  10  TYR TYR I . n 
X  8  11  GLU 11  11  11  GLU GLU I . n 
X  8  12  ALA 12  12  12  ALA ALA I . n 
X  8  13  TRP 13  13  13  TRP TRP I . n 
X  8  14  VAL 14  14  14  VAL VAL I . n 
X  8  15  GLU 15  15  15  GLU GLU I . n 
X  8  16  LEU 16  16  16  LEU LEU I . n 
X  8  17  LEU 17  17  17  LEU LEU I . n 
X  8  18  SER 18  18  18  SER SER I . n 
X  8  19  TRP 19  19  19  TRP TRP I . n 
X  8  20  MET 20  20  20  MET MET I . n 
X  8  21  ARG 21  21  21  ARG ARG I . n 
X  8  22  GLU 22  22  22  GLU GLU I . n 
X  8  23  TYR 23  23  23  TYR TYR I . n 
X  8  24  ALA 24  24  24  ALA ALA I . n 
X  8  25  GLN 25  25  25  GLN GLN I . n 
X  8  26  ALA 26  26  26  ALA ALA I . n 
X  8  27  LYS 27  27  27  LYS LYS I . n 
X  8  28  GLY 28  28  28  GLY GLY I . n 
X  8  29  VAL 29  29  29  VAL VAL I . n 
X  8  30  ARG 30  30  30  ARG ARG I . n 
X  8  31  PHE 31  31  31  PHE PHE I . n 
X  8  32  GLU 32  32  32  GLU GLU I . n 
X  8  33  LYS 33  33  33  LYS LYS I . n 
X  8  34  GLU 34  34  34  GLU GLU I . n 
X  8  35  ALA 35  35  35  ALA ALA I . n 
X  8  36  ASP 36  36  36  ASP ASP I . n 
X  8  37  PHE 37  37  37  PHE PHE I . n 
X  8  38  PRO 38  38  38  PRO PRO I . n 
X  8  39  ASP 39  39  39  ASP ASP I . n 
X  8  40  PHE 40  40  40  PHE PHE I . n 
X  8  41  ILE 41  41  41  ILE ILE I . n 
X  8  42  TYR 42  42  42  TYR TYR I . n 
X  8  43  ARG 43  43  43  ARG ARG I . n 
X  8  44  MET 44  44  44  MET MET I . n 
X  8  45  GLU 45  45  45  GLU GLU I . n 
X  8  46  ARG 46  46  46  ARG ARG I . n 
X  8  47  PRO 47  47  47  PRO PRO I . n 
X  8  48  TYR 48  48  48  TYR TYR I . n 
X  8  49  ASP 49  49  49  ASP ASP I . n 
X  8  50  LEU 50  50  50  LEU LEU I . n 
X  8  51  PRO 51  51  51  PRO PRO I . n 
X  8  52  THR 52  52  52  THR THR I . n 
X  8  53  THR 53  53  53  THR THR I . n 
X  8  54  ILE 54  54  54  ILE ILE I . n 
X  8  55  MET 55  55  55  MET MET I . n 
X  8  56  THR 56  56  56  THR THR I . n 
X  8  57  ALA 57  57  57  ALA ALA I . n 
X  8  58  SER 58  58  58  SER SER I . n 
X  8  59  LEU 59  59  59  LEU LEU I . n 
X  8  60  SER 60  60  60  SER SER I . n 
X  8  61  ASP 61  61  61  ASP ASP I . n 
X  8  62  GLY 62  62  62  GLY GLY I . n 
X  8  63  LEU 63  63  63  LEU LEU I . n 
X  8  64  GLY 64  64  64  GLY GLY I . n 
X  8  65  GLU 65  65  65  GLU GLU I . n 
X  8  66  PRO 66  66  66  PRO PRO I . n 
X  8  67  PHE 67  67  67  PHE PHE I . n 
X  8  68  LEU 68  68  68  LEU LEU I . n 
X  8  69  LEU 69  69  69  LEU LEU I . n 
X  8  70  ALA 70  70  70  ALA ALA I . n 
X  8  71  ASP 71  71  71  ASP ASP I . n 
X  8  72  VAL 72  72  72  VAL VAL I . n 
X  8  73  SER 73  73  73  SER SER I . n 
X  8  74  PRO 74  74  74  PRO PRO I . n 
X  8  75  ARG 75  75  75  ARG ARG I . n 
X  8  76  HIS 76  76  76  HIS HIS I . n 
X  8  77  ALA 77  77  77  ALA ALA I . n 
X  8  78  LYS 78  78  78  LYS LYS I . n 
X  8  79  LEU 79  79  79  LEU LEU I . n 
X  8  80  LYS 80  80  80  LYS LYS I . n 
X  8  81  ARG 81  81  81  ARG ARG I . n 
X  8  82  ILE 82  82  82  ILE ILE I . n 
X  8  83  GLY 83  83  83  GLY GLY I . n 
X  8  84  LEU 84  84  84  LEU LEU I . n 
X  8  85  ARG 85  85  85  ARG ARG I . n 
X  8  86  LEU 86  86  86  LEU LEU I . n 
X  8  87  PRO 87  87  87  PRO PRO I . n 
X  8  88  ARG 88  88  88  ARG ARG I . n 
X  8  89  ALA 89  89  89  ALA ALA I . n 
X  8  90  HIS 90  90  90  HIS HIS I . n 
X  8  91  ILE 91  91  91  ILE ILE I . n 
X  8  92  HIS 92  92  92  HIS HIS I . n 
X  8  93  LEU 93  93  93  LEU LEU I . n 
X  8  94  HIS 94  94  94  HIS HIS I . n 
X  8  95  ALA 95  95  95  ALA ALA I . n 
X  8  96  HIS 96  96  96  HIS HIS I . n 
X  8  97  TYR 97  97  97  TYR TYR I . n 
X  8  98  GLU 98  98  98  GLU GLU I . n 
X  8  99  PRO 99  99  99  PRO PRO I . n 
X  8  100 GLY 100 100 100 GLY GLY I . n 
X  8  101 LYS 101 101 101 LYS LYS I . n 
X  8  102 GLY 102 102 102 GLY GLY I . n 
X  8  103 LEU 103 103 103 LEU LEU I . n 
X  8  104 VAL 104 104 104 VAL VAL I . n 
X  8  105 THR 105 105 105 THR THR I . n 
X  8  106 GLY 106 106 106 GLY GLY I . n 
X  8  107 LYS 107 107 107 LYS LYS I . n 
X  8  108 ILE 108 108 108 ILE ILE I . n 
X  8  109 PRO 109 109 109 PRO PRO I . n 
X  8  110 LEU 110 110 110 LEU LEU I . n 
X  8  111 THR 111 111 111 THR THR I . n 
X  8  112 LYS 112 112 112 LYS LYS I . n 
X  8  113 GLU 113 113 113 GLU GLU I . n 
X  8  114 ARG 114 114 114 ARG ARG I . n 
X  8  115 PHE 115 115 115 PHE PHE I . n 
X  8  116 PHE 116 116 116 PHE PHE I . n 
X  8  117 ALA 117 117 117 ALA ALA I . n 
X  8  118 LEU 118 118 118 LEU LEU I . n 
X  8  119 ALA 119 119 119 ALA ALA I . n 
X  8  120 ASP 120 120 120 ASP ASP I . n 
X  8  121 ARG 121 121 121 ARG ARG I . n 
X  8  122 ALA 122 122 122 ALA ALA I . n 
X  8  123 ARG 123 123 123 ARG ARG I . n 
X  8  124 GLU 124 124 124 GLU GLU I . n 
X  8  125 ALA 125 125 125 ALA ALA I . n 
X  8  126 LEU 126 126 126 LEU LEU I . n 
X  8  127 ALA 127 127 127 ALA ALA I . n 
X  8  128 PHE 128 128 128 PHE PHE I . n 
X  8  129 ALA 129 129 129 ALA ALA I . n 
Y  9  1   MET 1   1   1   MET MET X . n 
Y  9  2   VAL 2   2   2   VAL VAL X . n 
Y  9  3   ARG 3   3   3   ARG ARG X . n 
Y  9  4   VAL 4   4   4   VAL VAL X . n 
Y  9  5   GLY 5   5   5   GLY GLY X . n 
Y  9  6   MET 6   6   6   MET MET X . n 
Y  9  7   ARG 7   7   7   ARG ARG X . n 
Y  9  8   ALA 8   8   8   ALA ALA X . n 
Y  9  9   ALA 9   9   9   ALA ALA X . n 
Y  9  10  PRO 10  10  10  PRO PRO X . n 
Y  9  11  ARG 11  11  11  ARG ARG X . n 
Y  9  12  VAL 12  12  12  VAL VAL X . n 
Y  9  13  SER 13  13  13  SER SER X . n 
Y  9  14  LEU 14  14  14  LEU LEU X . n 
Y  9  15  GLU 15  15  15  GLU GLU X . n 
Y  9  16  ALA 16  16  16  ALA ALA X . n 
Y  9  17  LEU 17  17  17  LEU LEU X . n 
Y  9  18  LYS 18  18  18  LYS LYS X . n 
Y  9  19  ALA 19  19  19  ALA ALA X . n 
Y  9  20  ALA 20  20  20  ALA ALA X . n 
Y  9  21  LEU 21  21  21  LEU LEU X . n 
Y  9  22  GLY 22  22  22  GLY GLY X . n 
Y  9  23  GLY 23  23  23  GLY GLY X . n 
Y  9  24  LEU 24  24  24  LEU LEU X . n 
Y  9  25  LYS 25  25  25  LYS LYS X . n 
Y  9  26  LEU 26  26  26  LEU LEU X . n 
Y  9  27  SER 27  27  27  SER SER X . n 
Y  9  28  GLU 28  28  28  GLU GLU X . n 
Y  9  29  ALA 29  29  29  ALA ALA X . n 
Y  9  30  LYS 30  30  30  LYS LYS X . n 
Y  9  31  VAL 31  31  31  VAL VAL X . n 
Y  9  32  TYR 32  32  32  TYR TYR X . n 
Y  9  33  LEU 33  33  33  LEU LEU X . n 
Y  9  34  ILE 34  34  34  ILE ILE X . n 
Y  9  35  THR 35  35  35  THR THR X . n 
Y  9  36  ASP 36  36  36  ASP ASP X . n 
Y  9  37  TRP 37  37  37  TRP TRP X . n 
Y  9  38  GLN 38  38  38  GLN GLN X . n 
Y  9  39  ASP 39  39  39  ASP ASP X . n 
Y  9  40  LYS 40  40  40  LYS LYS X . n 
Y  9  41  ARG 41  41  41  ARG ARG X . n 
Y  9  42  ASP 42  42  42  ASP ASP X . n 
Y  9  43  GLN 43  43  43  GLN GLN X . n 
Y  9  44  ALA 44  44  44  ALA ALA X . n 
Y  9  45  ARG 45  45  45  ARG ARG X . n 
Y  9  46  TYR 46  46  46  TYR TYR X . n 
Y  9  47  ALA 47  47  47  ALA ALA X . n 
Y  9  48  LEU 48  48  48  LEU LEU X . n 
Y  9  49  LEU 49  49  49  LEU LEU X . n 
Y  9  50  LEU 50  50  50  LEU LEU X . n 
Y  9  51  HIS 51  51  51  HIS HIS X . n 
Y  9  52  THR 52  52  52  THR THR X . n 
Y  9  53  GLY 53  53  53  GLY GLY X . n 
Y  9  54  LYS 54  54  54  LYS LYS X . n 
Y  9  55  LYS 55  55  55  LYS LYS X . n 
Y  9  56  ASP 56  56  56  ASP ASP X . n 
Y  9  57  LEU 57  57  57  LEU LEU X . n 
Y  9  58  LEU 58  58  58  LEU LEU X . n 
Y  9  59  VAL 59  59  59  VAL VAL X . n 
Y  9  60  PRO 60  60  60  PRO PRO X . n 
Y  9  61  ASP 61  61  61  ASP ASP X . n 
Y  9  62  ALA 62  62  62  ALA ALA X . n 
Y  9  63  PHE 63  63  63  PHE PHE X . n 
Y  9  64  GLY 64  64  64  GLY GLY X . n 
Y  9  65  PRO 65  65  65  PRO PRO X . n 
Y  9  66  ALA 66  66  66  ALA ALA X . n 
Y  9  67  PHE 67  67  67  PHE PHE X . n 
Y  9  68  PRO 68  68  68  PRO PRO X . n 
Y  9  69  GLY 69  69  69  GLY GLY X . n 
Y  9  70  GLY 70  70  70  GLY GLY X . n 
Y  9  71  GLU 71  71  71  GLU GLU X . n 
Y  9  72  GLU 72  72  72  GLU GLU X . n 
Y  9  73  ALA 73  73  73  ALA ALA X . n 
Y  9  74  LEU 74  74  74  LEU LEU X . n 
Y  9  75  SER 75  75  75  SER SER X . n 
Y  9  76  GLU 76  76  76  GLU GLU X . n 
Y  9  77  LEU 77  77  77  LEU LEU X . n 
Y  9  78  VAL 78  78  78  VAL VAL X . n 
Y  9  79  GLY 79  79  79  GLY GLY X . n 
Y  9  80  LEU 80  80  80  LEU LEU X . n 
Y  9  81  LEU 81  81  81  LEU LEU X . n 
Y  9  82  LEU 82  82  82  LEU LEU X . n 
Y  9  83  ALA 83  83  83  ALA ALA X . n 
Y  9  84  GLN 84  84  84  GLN GLN X . n 
Y  9  85  GLY 85  85  85  GLY GLY X . n 
Y  9  86  ALA 86  86  86  ALA ALA X . n 
Y  9  87  ARG 87  87  87  ARG ARG X . n 
Y  9  88  ARG 88  88  88  ARG ARG X . n 
Y  9  89  PHE 89  89  89  PHE PHE X . n 
Y  9  90  TYR 90  90  90  TYR TYR X . n 
Y  9  91  GLU 91  91  91  GLU GLU X . n 
Y  9  92  ALA 92  92  92  ALA ALA X . n 
Y  9  93  VAL 93  93  93  VAL VAL X . n 
Y  9  94  VAL 94  94  94  VAL VAL X . n 
Y  9  95  SER 95  95  95  SER SER X . n 
Y  9  96  PRO 96  96  96  PRO PRO X . n 
Y  9  97  GLY 97  97  97  GLY GLY X . n 
Y  9  98  GLU 98  98  98  GLU GLU X . n 
Y  9  99  MET 99  99  99  MET MET X . n 
Y  9  100 THR 100 100 100 THR THR X . n 
Y  9  101 ALA 101 101 101 ALA ALA X . n 
Y  9  102 LEU 102 102 102 LEU LEU X . n 
Y  9  103 LEU 103 103 103 LEU LEU X . n 
Y  9  104 ASP 104 104 104 ASP ASP X . n 
Y  9  105 LEU 105 105 105 LEU LEU X . n 
Y  9  106 PRO 106 106 106 PRO PRO X . n 
Y  9  107 PRO 107 107 107 PRO PRO X . n 
Y  9  108 GLU 108 108 108 GLU GLU X . n 
Y  9  109 GLU 109 109 109 GLU GLU X . n 
Y  9  110 LEU 110 110 110 LEU LEU X . n 
Y  9  111 LEU 111 111 111 LEU LEU X . n 
Y  9  112 LYS 112 112 112 LYS LYS X . n 
Y  9  113 ARG 113 113 113 ARG ARG X . n 
Y  9  114 VAL 114 114 114 VAL VAL X . n 
Y  9  115 MET 115 115 115 MET MET X . n 
Y  9  116 ALA 116 116 116 ALA ALA X . n 
Y  9  117 ILE 117 117 117 ILE ILE X . n 
Y  9  118 ALA 118 118 118 ALA ALA X . n 
Y  9  119 ASN 119 119 119 ASN ASN X . n 
Y  9  120 PRO 120 120 120 PRO PRO X . n 
Y  9  121 THR 121 121 121 THR THR X . n 
Y  9  122 ASP 122 122 122 ASP ASP X . n 
Y  9  123 PRO 123 123 123 PRO PRO X . n 
Y  9  124 GLY 124 124 124 GLY GLY X . n 
Y  9  125 ILE 125 125 125 ILE ILE X . n 
Y  9  126 TYR 126 126 126 TYR TYR X . n 
Y  9  127 LEU 127 127 127 LEU LEU X . n 
Y  9  128 LYS 128 128 ?   ?   ?   X . n 
Y  9  129 ARG 129 129 ?   ?   ?   X . n 
Y  9  130 ALA 130 130 ?   ?   ?   X . n 
Y  9  131 ALA 131 131 ?   ?   ?   X . n 
Z  10 1   MET 1   1   1   MET MET P . n 
Z  10 2   ALA 2   2   2   ALA ALA P . n 
Z  10 3   PRO 3   3   3   PRO PRO P . n 
Z  10 4   ILE 4   4   4   ILE ILE P . n 
Z  10 5   GLN 5   5   5   GLN GLN P . n 
Z  10 6   GLU 6   6   6   GLU GLU P . n 
Z  10 7   TYR 7   7   7   TYR TYR P . n 
Z  10 8   VAL 8   8   8   VAL VAL P . n 
Z  10 9   GLY 9   9   9   GLY GLY P . n 
Z  10 10  THR 10  10  10  THR THR P . n 
Z  10 11  LEU 11  11  11  LEU LEU P . n 
Z  10 12  ILE 12  12  12  ILE ILE P . n 
Z  10 13  TYR 13  13  13  TYR TYR P . n 
Z  10 14  VAL 14  14  14  VAL VAL P . n 
Z  10 15  GLY 15  15  15  GLY GLY P . n 
Z  10 16  VAL 16  16  16  VAL VAL P . n 
Z  10 17  ALA 17  17  17  ALA ALA P . n 
Z  10 18  LEU 18  18  18  LEU LEU P . n 
Z  10 19  PHE 19  19  19  PHE PHE P . n 
Z  10 20  ILE 20  20  20  ILE ILE P . n 
Z  10 21  GLY 21  21  21  GLY GLY P . n 
Z  10 22  VAL 22  22  22  VAL VAL P . n 
Z  10 23  ALA 23  23  23  ALA ALA P . n 
Z  10 24  ALA 24  24  24  ALA ALA P . n 
Z  10 25  LEU 25  25  25  LEU LEU P . n 
Z  10 26  LEU 26  26  26  LEU LEU P . n 
Z  10 27  VAL 27  27  27  VAL VAL P . n 
Z  10 28  GLY 28  28  28  GLY GLY P . n 
Z  10 29  ALA 29  29  29  ALA ALA P . n 
Z  10 30  LEU 30  30  30  LEU LEU P . n 
Z  10 31  LEU 31  31  31  LEU LEU P . n 
Z  10 32  GLY 32  32  32  GLY GLY P . n 
Z  10 33  PRO 33  33  33  PRO PRO P . n 
Z  10 34  LYS 34  34  34  LYS LYS P . n 
Z  10 35  LYS 35  35  35  LYS LYS P . n 
Z  10 36  PRO 36  36  36  PRO PRO P . n 
Z  10 37  GLY 37  37  37  GLY GLY P . n 
Z  10 38  ARG 38  38  38  ARG ARG P . n 
Z  10 39  ALA 39  39  39  ALA ALA P . n 
Z  10 40  LYS 40  40  40  LYS LYS P . n 
Z  10 41  LEU 41  41  41  LEU LEU P . n 
Z  10 42  MET 42  42  42  MET MET P . n 
Z  10 43  PRO 43  43  43  PRO PRO P . n 
Z  10 44  TYR 44  44  44  TYR TYR P . n 
Z  10 45  GLU 45  45  45  GLU GLU P . n 
Z  10 46  SER 46  46  46  SER SER P . n 
Z  10 47  GLY 47  47  47  GLY GLY P . n 
Z  10 48  ASN 48  48  48  ASN ASN P . n 
Z  10 49  ASP 49  49  49  ASP ASP P . n 
Z  10 50  PRO 50  50  50  PRO PRO P . n 
Z  10 51  ALA 51  51  51  ALA ALA P . n 
Z  10 52  GLY 52  52  52  GLY GLY P . n 
Z  10 53  GLU 53  53  53  GLU GLU P . n 
Z  10 54  VAL 54  54  54  VAL VAL P . n 
Z  10 55  LYS 55  55  55  LYS LYS P . n 
Z  10 56  ARG 56  56  56  ARG ARG P . n 
Z  10 57  PHE 57  57  57  PHE PHE P . n 
Z  10 58  PRO 58  58  58  PRO PRO P . n 
Z  10 59  VAL 59  59  59  VAL VAL P . n 
Z  10 60  HIS 60  60  60  HIS HIS P . n 
Z  10 61  PHE 61  61  61  PHE PHE P . n 
Z  10 62  TYR 62  62  62  TYR TYR P . n 
Z  10 63  VAL 63  63  63  VAL VAL P . n 
Z  10 64  VAL 64  64  64  VAL VAL P . n 
Z  10 65  ALA 65  65  65  ALA ALA P . n 
Z  10 66  MET 66  66  66  MET MET P . n 
Z  10 67  LEU 67  67  67  LEU LEU P . n 
Z  10 68  PHE 68  68  68  PHE PHE P . n 
Z  10 69  ILE 69  69  69  ILE ILE P . n 
Z  10 70  LEU 70  70  70  LEU LEU P . n 
Z  10 71  PHE 71  71  71  PHE PHE P . n 
Z  10 72  ASP 72  72  72  ASP ASP P . n 
Z  10 73  VAL 73  73  73  VAL VAL P . n 
Z  10 74  GLU 74  74  74  GLU GLU P . n 
Z  10 75  VAL 75  75  75  VAL VAL P . n 
Z  10 76  ALA 76  76  76  ALA ALA P . n 
Z  10 77  PHE 77  77  77  PHE PHE P . n 
Z  10 78  LEU 78  78  78  LEU LEU P . n 
Z  10 79  TRP 79  79  79  TRP TRP P . n 
Z  10 80  PRO 80  80  80  PRO PRO P . n 
Z  10 81  TYR 81  81  81  TYR TYR P . n 
Z  10 82  ALA 82  82  82  ALA ALA P . n 
Z  10 83  VAL 83  83  83  VAL VAL P . n 
Z  10 84  SER 84  84  84  SER SER P . n 
Z  10 85  ALA 85  85  85  ALA ALA P . n 
Z  10 86  GLY 86  86  86  GLY GLY P . n 
Z  10 87  GLY 87  87  87  GLY GLY P . n 
Z  10 88  LEU 88  88  88  LEU LEU P . n 
Z  10 89  GLY 89  89  89  GLY GLY P . n 
Z  10 90  LEU 90  90  90  LEU LEU P . n 
Z  10 91  TYR 91  91  91  TYR TYR P . n 
Z  10 92  GLY 92  92  92  GLY GLY P . n 
Z  10 93  PHE 93  93  93  PHE PHE P . n 
Z  10 94  LEU 94  94  94  LEU LEU P . n 
Z  10 95  GLY 95  95  95  GLY GLY P . n 
Z  10 96  VAL 96  96  96  VAL VAL P . n 
Z  10 97  LEU 97  97  97  LEU LEU P . n 
Z  10 98  ALA 98  98  98  ALA ALA P . n 
Z  10 99  PHE 99  99  99  PHE PHE P . n 
Z  10 100 THR 100 100 100 THR THR P . n 
Z  10 101 LEU 101 101 101 LEU LEU P . n 
Z  10 102 LEU 102 102 102 LEU LEU P . n 
Z  10 103 LEU 103 103 103 LEU LEU P . n 
Z  10 104 PHE 104 104 104 PHE PHE P . n 
Z  10 105 VAL 105 105 105 VAL VAL P . n 
Z  10 106 GLY 106 106 106 GLY GLY P . n 
Z  10 107 PHE 107 107 107 PHE PHE P . n 
Z  10 108 LEU 108 108 108 LEU LEU P . n 
Z  10 109 TYR 109 109 109 TYR TYR P . n 
Z  10 110 GLU 110 110 110 GLU GLU P . n 
Z  10 111 TRP 111 111 111 TRP TRP P . n 
Z  10 112 TRP 112 112 112 TRP TRP P . n 
Z  10 113 LYS 113 113 113 LYS LYS P . n 
Z  10 114 GLY 114 114 114 GLY GLY P . n 
Z  10 115 VAL 115 115 115 VAL VAL P . n 
Z  10 116 MET 116 116 116 MET MET P . n 
Z  10 117 ARG 117 117 117 ARG ARG P . n 
Z  10 118 TRP 118 118 ?   ?   ?   P . n 
Z  10 119 HIS 119 119 ?   ?   ?   P . n 
AA 11 1   MET 1   1   1   MET MET R . n 
AA 11 2   SER 2   2   2   SER SER R . n 
AA 11 3   LEU 3   3   3   LEU LEU R . n 
AA 11 4   LEU 4   4   4   LEU LEU R . n 
AA 11 5   GLU 5   5   5   GLU GLU R . n 
AA 11 6   GLY 6   6   6   GLY GLY R . n 
AA 11 7   LEU 7   7   7   LEU LEU R . n 
AA 11 8   ALA 8   8   8   ALA ALA R . n 
AA 11 9   LEU 9   9   9   LEU LEU R . n 
AA 11 10  PHE 10  10  10  PHE PHE R . n 
AA 11 11  LEU 11  11  11  LEU LEU R . n 
AA 11 12  LEU 12  12  12  LEU LEU R . n 
AA 11 13  LEU 13  13  13  LEU LEU R . n 
AA 11 14  LEU 14  14  14  LEU LEU R . n 
AA 11 15  SER 15  15  15  SER SER R . n 
AA 11 16  GLY 16  16  16  GLY GLY R . n 
AA 11 17  VAL 17  17  17  VAL VAL R . n 
AA 11 18  LEU 18  18  18  LEU LEU R . n 
AA 11 19  VAL 19  19  19  VAL VAL R . n 
AA 11 20  VAL 20  20  20  VAL VAL R . n 
AA 11 21  THR 21  21  21  THR THR R . n 
AA 11 22  LEU 22  22  22  LEU LEU R . n 
AA 11 23  ARG 23  23  23  ARG ARG R . n 
AA 11 24  ASN 24  24  24  ASN ASN R . n 
AA 11 25  ALA 25  25  25  ALA ALA R . n 
AA 11 26  ILE 26  26  26  ILE ILE R . n 
AA 11 27  HIS 27  27  27  HIS HIS R . n 
AA 11 28  ALA 28  28  28  ALA ALA R . n 
AA 11 29  ALA 29  29  29  ALA ALA R . n 
AA 11 30  LEU 30  30  30  LEU LEU R . n 
AA 11 31  ALA 31  31  31  ALA ALA R . n 
AA 11 32  LEU 32  32  32  LEU LEU R . n 
AA 11 33  ILE 33  33  33  ILE ILE R . n 
AA 11 34  LEU 34  34  34  LEU LEU R . n 
AA 11 35  ASN 35  35  35  ASN ASN R . n 
AA 11 36  PHE 36  36  36  PHE PHE R . n 
AA 11 37  LEU 37  37  37  LEU LEU R . n 
AA 11 38  VAL 38  38  38  VAL VAL R . n 
AA 11 39  LEU 39  39  39  LEU LEU R . n 
AA 11 40  ALA 40  40  40  ALA ALA R . n 
AA 11 41  GLY 41  41  41  GLY GLY R . n 
AA 11 42  VAL 42  42  42  VAL VAL R . n 
AA 11 43  TYR 43  43  43  TYR TYR R . n 
AA 11 44  VAL 44  44  44  VAL VAL R . n 
AA 11 45  ALA 45  45  45  ALA ALA R . n 
AA 11 46  LEU 46  46  46  LEU LEU R . n 
AA 11 47  ASP 47  47  47  ASP ASP R . n 
AA 11 48  ALA 48  48  48  ALA ALA R . n 
AA 11 49  ARG 49  49  49  ARG ARG R . n 
AA 11 50  PHE 50  50  50  PHE PHE R . n 
AA 11 51  LEU 51  51  51  LEU LEU R . n 
AA 11 52  GLY 52  52  52  GLY GLY R . n 
AA 11 53  PHE 53  53  53  PHE PHE R . n 
AA 11 54  ILE 54  54  54  ILE ILE R . n 
AA 11 55  GLN 55  55  55  GLN GLN R . n 
AA 11 56  VAL 56  56  56  VAL VAL R . n 
AA 11 57  ILE 57  57  57  ILE ILE R . n 
AA 11 58  VAL 58  58  58  VAL VAL R . n 
AA 11 59  TYR 59  59  59  TYR TYR R . n 
AA 11 60  ALA 60  60  60  ALA ALA R . n 
AA 11 61  GLY 61  61  61  GLY GLY R . n 
AA 11 62  ALA 62  62  62  ALA ALA R . n 
AA 11 63  ILE 63  63  63  ILE ILE R . n 
AA 11 64  VAL 64  64  64  VAL VAL R . n 
AA 11 65  VAL 65  65  65  VAL VAL R . n 
AA 11 66  LEU 66  66  66  LEU LEU R . n 
AA 11 67  PHE 67  67  67  PHE PHE R . n 
AA 11 68  LEU 68  68  68  LEU LEU R . n 
AA 11 69  PHE 69  69  69  PHE PHE R . n 
AA 11 70  VAL 70  70  70  VAL VAL R . n 
AA 11 71  ILE 71  71  71  ILE ILE R . n 
AA 11 72  MET 72  72  72  MET MET R . n 
AA 11 73  LEU 73  73  73  LEU LEU R . n 
AA 11 74  LEU 74  74  74  LEU LEU R . n 
AA 11 75  PHE 75  75  75  PHE PHE R . n 
AA 11 76  ALA 76  76  76  ALA ALA R . n 
AA 11 77  ALA 77  77  77  ALA ALA R . n 
AA 11 78  GLN 78  78  78  GLN GLN R . n 
AA 11 79  GLY 79  79  79  GLY GLY R . n 
AA 11 80  GLU 80  80  80  GLU GLU R . n 
AA 11 81  ILE 81  81  81  ILE ILE R . n 
AA 11 82  GLY 82  82  82  GLY GLY R . n 
AA 11 83  PHE 83  83  83  PHE PHE R . n 
AA 11 84  ASP 84  84  84  ASP ASP R . n 
AA 11 85  PRO 85  85  85  PRO PRO R . n 
AA 11 86  LEU 86  86  86  LEU LEU R . n 
AA 11 87  VAL 87  87  87  VAL VAL R . n 
AA 11 88  ARG 88  88  88  ARG ARG R . n 
AA 11 89  SER 89  89  89  SER SER R . n 
AA 11 90  ARG 90  90  90  ARG ARG R . n 
AA 11 91  PRO 91  91  91  PRO PRO R . n 
AA 11 92  LEU 92  92  92  LEU LEU R . n 
AA 11 93  ALA 93  93  93  ALA ALA R . n 
AA 11 94  ALA 94  94  94  ALA ALA R . n 
AA 11 95  LEU 95  95  95  LEU LEU R . n 
AA 11 96  LEU 96  96  96  LEU LEU R . n 
AA 11 97  ALA 97  97  97  ALA ALA R . n 
AA 11 98  LEU 98  98  98  LEU LEU R . n 
AA 11 99  GLY 99  99  99  GLY GLY R . n 
AA 11 100 VAL 100 100 100 VAL VAL R . n 
AA 11 101 ALA 101 101 101 ALA ALA R . n 
AA 11 102 GLY 102 102 102 GLY GLY R . n 
AA 11 103 ILE 103 103 103 ILE ILE R . n 
AA 11 104 LEU 104 104 104 LEU LEU R . n 
AA 11 105 ALA 105 105 105 ALA ALA R . n 
AA 11 106 ALA 106 106 106 ALA ALA R . n 
AA 11 107 GLY 107 107 107 GLY GLY R . n 
AA 11 108 LEU 108 108 108 LEU LEU R . n 
AA 11 109 TRP 109 109 109 TRP TRP R . n 
AA 11 110 GLY 110 110 110 GLY GLY R . n 
AA 11 111 LEU 111 111 111 LEU LEU R . n 
AA 11 112 ASP 112 112 112 ASP ASP R . n 
AA 11 113 LEU 113 113 113 LEU LEU R . n 
AA 11 114 ALA 114 114 114 ALA ALA R . n 
AA 11 115 PHE 115 115 115 PHE PHE R . n 
AA 11 116 THR 116 116 116 THR THR R . n 
AA 11 117 GLN 117 117 117 GLN GLN R . n 
AA 11 118 ASP 118 118 118 ASP ASP R . n 
AA 11 119 LEU 119 119 119 LEU LEU R . n 
AA 11 120 LYS 120 120 120 LYS LYS R . n 
AA 11 121 GLY 121 121 121 GLY GLY R . n 
AA 11 122 GLY 122 122 122 GLY GLY R . n 
AA 11 123 LEU 123 123 123 LEU LEU R . n 
AA 11 124 PRO 124 124 124 PRO PRO R . n 
AA 11 125 GLN 125 125 125 GLN GLN R . n 
AA 11 126 ALA 126 126 126 ALA ALA R . n 
AA 11 127 LEU 127 127 127 LEU LEU R . n 
AA 11 128 GLY 128 128 128 GLY GLY R . n 
AA 11 129 PRO 129 129 129 PRO PRO R . n 
AA 11 130 LEU 130 130 130 LEU LEU R . n 
AA 11 131 LEU 131 131 131 LEU LEU R . n 
AA 11 132 TYR 132 132 132 TYR TYR R . n 
AA 11 133 GLY 133 133 133 GLY GLY R . n 
AA 11 134 ASP 134 134 134 ASP ASP R . n 
AA 11 135 TRP 135 135 135 TRP TRP R . n 
AA 11 136 LEU 136 136 136 LEU LEU R . n 
AA 11 137 PHE 137 137 137 PHE PHE R . n 
AA 11 138 VAL 138 138 138 VAL VAL R . n 
AA 11 139 LEU 139 139 139 LEU LEU R . n 
AA 11 140 LEU 140 140 140 LEU LEU R . n 
AA 11 141 ALA 141 141 141 ALA ALA R . n 
AA 11 142 VAL 142 142 142 VAL VAL R . n 
AA 11 143 GLY 143 143 143 GLY GLY R . n 
AA 11 144 PHE 144 144 144 PHE PHE R . n 
AA 11 145 LEU 145 145 145 LEU LEU R . n 
AA 11 146 LEU 146 146 146 LEU LEU R . n 
AA 11 147 MET 147 147 147 MET MET R . n 
AA 11 148 ALA 148 148 148 ALA ALA R . n 
AA 11 149 ALA 149 149 149 ALA ALA R . n 
AA 11 150 THR 150 150 150 THR THR R . n 
AA 11 151 VAL 151 151 151 VAL VAL R . n 
AA 11 152 VAL 152 152 152 VAL VAL R . n 
AA 11 153 ALA 153 153 153 ALA ALA R . n 
AA 11 154 VAL 154 154 154 VAL VAL R . n 
AA 11 155 ALA 155 155 155 ALA ALA R . n 
AA 11 156 LEU 156 156 156 LEU LEU R . n 
AA 11 157 VAL 157 157 157 VAL VAL R . n 
AA 11 158 GLU 158 158 158 GLU GLU R . n 
AA 11 159 PRO 159 159 159 PRO PRO R . n 
AA 11 160 GLY 160 160 160 GLY GLY R . n 
AA 11 161 LYS 161 161 ?   ?   ?   R . n 
AA 11 162 ALA 162 162 ?   ?   ?   R . n 
AA 11 163 SER 163 163 ?   ?   ?   R . n 
AA 11 164 ARG 164 164 ?   ?   ?   R . n 
AA 11 165 ALA 165 165 ?   ?   ?   R . n 
AA 11 166 LYS 166 166 ?   ?   ?   R . n 
AA 11 167 GLU 167 167 ?   ?   ?   R . n 
AA 11 168 ALA 168 168 ?   ?   ?   R . n 
AA 11 169 GLU 169 169 ?   ?   ?   R . n 
AA 11 170 LYS 170 170 ?   ?   ?   R . n 
AA 11 171 ARG 171 171 ?   ?   ?   R . n 
AA 11 172 GLU 172 172 ?   ?   ?   R . n 
AA 11 173 GLU 173 173 ?   ?   ?   R . n 
AA 11 174 VAL 174 174 ?   ?   ?   R . n 
AA 11 175 ALA 175 175 ?   ?   ?   R . n 
AA 11 176 ARG 176 176 ?   ?   ?   R . n 
BA 12 1   MET 1   1   1   MET MET S . n 
BA 12 2   SER 2   2   2   SER SER S . n 
BA 12 3   TYR 3   3   3   TYR TYR S . n 
BA 12 4   LEU 4   4   4   LEU LEU S . n 
BA 12 5   LEU 5   5   5   LEU LEU S . n 
BA 12 6   THR 6   6   6   THR THR S . n 
BA 12 7   SER 7   7   7   SER SER S . n 
BA 12 8   ALA 8   8   8   ALA ALA S . n 
BA 12 9   LEU 9   9   9   LEU LEU S . n 
BA 12 10  LEU 10  10  10  LEU LEU S . n 
BA 12 11  PHE 11  11  11  PHE PHE S . n 
BA 12 12  ALA 12  12  12  ALA ALA S . n 
BA 12 13  LEU 13  13  13  LEU LEU S . n 
BA 12 14  GLY 14  14  14  GLY GLY S . n 
BA 12 15  VAL 15  15  15  VAL VAL S . n 
BA 12 16  TYR 16  16  16  TYR TYR S . n 
BA 12 17  GLY 17  17  17  GLY GLY S . n 
BA 12 18  VAL 18  18  18  VAL VAL S . n 
BA 12 19  LEU 19  19  19  LEU LEU S . n 
BA 12 20  THR 20  20  20  THR THR S . n 
BA 12 21  ARG 21  21  21  ARG ARG S . n 
BA 12 22  ARG 22  22  22  ARG ARG S . n 
BA 12 23  THR 23  23  23  THR THR S . n 
BA 12 24  ALA 24  24  24  ALA ALA S . n 
BA 12 25  ILE 25  25  25  ILE ILE S . n 
BA 12 26  LEU 26  26  26  LEU LEU S . n 
BA 12 27  VAL 27  27  27  VAL VAL S . n 
BA 12 28  PHE 28  28  28  PHE PHE S . n 
BA 12 29  LEU 29  29  29  LEU LEU S . n 
BA 12 30  SER 30  30  30  SER SER S . n 
BA 12 31  ILE 31  31  31  ILE ILE S . n 
BA 12 32  GLU 32  32  32  GLU GLU S . n 
BA 12 33  LEU 33  33  33  LEU LEU S . n 
BA 12 34  MET 34  34  34  MET MET S . n 
BA 12 35  LEU 35  35  35  LEU LEU S . n 
BA 12 36  ASN 36  36  36  ASN ASN S . n 
BA 12 37  ALA 37  37  37  ALA ALA S . n 
BA 12 38  ALA 38  38  38  ALA ALA S . n 
BA 12 39  ASN 39  39  39  ASN ASN S . n 
BA 12 40  LEU 40  40  40  LEU LEU S . n 
BA 12 41  SER 41  41  41  SER SER S . n 
BA 12 42  LEU 42  42  42  LEU LEU S . n 
BA 12 43  VAL 43  43  43  VAL VAL S . n 
BA 12 44  GLY 44  44  44  GLY GLY S . n 
BA 12 45  PHE 45  45  45  PHE PHE S . n 
BA 12 46  ALA 46  46  46  ALA ALA S . n 
BA 12 47  ARG 47  47  47  ARG ARG S . n 
BA 12 48  ALA 48  48  48  ALA ALA S . n 
BA 12 49  TYR 49  49  49  TYR TYR S . n 
BA 12 50  GLY 50  50  50  GLY GLY S . n 
BA 12 51  LEU 51  51  51  LEU LEU S . n 
BA 12 52  ASP 52  52  52  ASP ASP S . n 
BA 12 53  GLY 53  53  53  GLY GLY S . n 
BA 12 54  GLN 54  54  54  GLN GLN S . n 
BA 12 55  VAL 55  55  55  VAL VAL S . n 
BA 12 56  ALA 56  56  56  ALA ALA S . n 
BA 12 57  ALA 57  57  57  ALA ALA S . n 
BA 12 58  LEU 58  58  58  LEU LEU S . n 
BA 12 59  MET 59  59  59  MET MET S . n 
BA 12 60  VAL 60  60  60  VAL VAL S . n 
BA 12 61  ILE 61  61  61  ILE ILE S . n 
BA 12 62  ALA 62  62  62  ALA ALA S . n 
BA 12 63  VAL 63  63  63  VAL VAL S . n 
BA 12 64  ALA 64  64  64  ALA ALA S . n 
BA 12 65  ALA 65  65  65  ALA ALA S . n 
BA 12 66  ALA 66  66  66  ALA ALA S . n 
BA 12 67  GLU 67  67  67  GLU GLU S . n 
BA 12 68  VAL 68  68  68  VAL VAL S . n 
BA 12 69  ALA 69  69  69  ALA ALA S . n 
BA 12 70  VAL 70  70  70  VAL VAL S . n 
BA 12 71  GLY 71  71  71  GLY GLY S . n 
BA 12 72  LEU 72  72  72  LEU LEU S . n 
BA 12 73  GLY 73  73  73  GLY GLY S . n 
BA 12 74  LEU 74  74  74  LEU LEU S . n 
BA 12 75  ILE 75  75  75  ILE ILE S . n 
BA 12 76  VAL 76  76  76  VAL VAL S . n 
BA 12 77  ALA 77  77  77  ALA ALA S . n 
BA 12 78  ILE 78  78  78  ILE ILE S . n 
BA 12 79  PHE 79  79  79  PHE PHE S . n 
BA 12 80  ARG 80  80  80  ARG ARG S . n 
BA 12 81  HIS 81  81  81  HIS HIS S . n 
BA 12 82  ARG 82  82  82  ARG ARG S . n 
BA 12 83  GLU 83  83  83  GLU GLU S . n 
BA 12 84  SER 84  84  84  SER SER S . n 
BA 12 85  THR 85  85  85  THR THR S . n 
BA 12 86  ALA 86  86  86  ALA ALA S . n 
BA 12 87  VAL 87  87  87  VAL VAL S . n 
BA 12 88  ASP 88  88  88  ASP ASP S . n 
BA 12 89  ASP 89  89  89  ASP ASP S . n 
BA 12 90  LEU 90  90  90  LEU LEU S . n 
BA 12 91  SER 91  91  91  SER SER S . n 
BA 12 92  GLU 92  92  92  GLU GLU S . n 
BA 12 93  LEU 93  93  93  LEU LEU S . n 
BA 12 94  ARG 94  94  94  ARG ARG S . n 
BA 12 95  GLY 95  95  95  GLY GLY S . n 
CA 13 1   MET 1   1   1   MET MET T . n 
CA 13 2   ALA 2   2   2   ALA ALA T . n 
CA 13 3   LEU 3   3   3   LEU LEU T . n 
CA 13 4   LEU 4   4   4   LEU LEU T . n 
CA 13 5   GLY 5   5   5   GLY GLY T . n 
CA 13 6   THR 6   6   6   THR THR T . n 
CA 13 7   ILE 7   7   7   ILE ILE T . n 
CA 13 8   LEU 8   8   8   LEU LEU T . n 
CA 13 9   LEU 9   9   9   LEU LEU T . n 
CA 13 10  PRO 10  10  10  PRO PRO T . n 
CA 13 11  LEU 11  11  11  LEU LEU T . n 
CA 13 12  LEU 12  12  12  LEU LEU T . n 
CA 13 13  GLY 13  13  13  GLY GLY T . n 
CA 13 14  PHE 14  14  14  PHE PHE T . n 
CA 13 15  ALA 15  15  15  ALA ALA T . n 
CA 13 16  LEU 16  16  16  LEU LEU T . n 
CA 13 17  LEU 17  17  17  LEU LEU T . n 
CA 13 18  GLY 18  18  18  GLY GLY T . n 
CA 13 19  LEU 19  19  19  LEU LEU T . n 
CA 13 20  PHE 20  20  20  PHE PHE T . n 
CA 13 21  GLY 21  21  21  GLY GLY T . n 
CA 13 22  LYS 22  22  22  LYS LYS T . n 
CA 13 23  ARG 23  23  23  ARG ARG T . n 
CA 13 24  MET 24  24  24  MET MET T . n 
CA 13 25  ARG 25  25  25  ARG ARG T . n 
CA 13 26  GLU 26  26  26  GLU GLU T . n 
CA 13 27  PRO 27  27  27  PRO PRO T . n 
CA 13 28  LEU 28  28  28  LEU LEU T . n 
CA 13 29  PRO 29  29  29  PRO PRO T . n 
CA 13 30  GLY 30  30  30  GLY GLY T . n 
CA 13 31  VAL 31  31  31  VAL VAL T . n 
CA 13 32  LEU 32  32  32  LEU LEU T . n 
CA 13 33  ALA 33  33  33  ALA ALA T . n 
CA 13 34  SER 34  34  34  SER SER T . n 
CA 13 35  GLY 35  35  35  GLY GLY T . n 
CA 13 36  LEU 36  36  36  LEU LEU T . n 
CA 13 37  VAL 37  37  37  VAL VAL T . n 
CA 13 38  LEU 38  38  38  LEU LEU T . n 
CA 13 39  ALA 39  39  39  ALA ALA T . n 
CA 13 40  SER 40  40  40  SER SER T . n 
CA 13 41  PHE 41  41  41  PHE PHE T . n 
CA 13 42  LEU 42  42  42  LEU LEU T . n 
CA 13 43  LEU 43  43  43  LEU LEU T . n 
CA 13 44  GLY 44  44  44  GLY GLY T . n 
CA 13 45  ALA 45  45  45  ALA ALA T . n 
CA 13 46  GLY 46  46  46  GLY GLY T . n 
CA 13 47  LEU 47  47  47  LEU LEU T . n 
CA 13 48  LEU 48  48  48  LEU LEU T . n 
CA 13 49  LEU 49  49  49  LEU LEU T . n 
CA 13 50  SER 50  50  50  SER SER T . n 
CA 13 51  GLY 51  51  51  GLY GLY T . n 
CA 13 52  GLY 52  52  52  GLY GLY T . n 
CA 13 53  ALA 53  53  53  ALA ALA T . n 
CA 13 54  ARG 54  54  54  ARG ARG T . n 
CA 13 55  PHE 55  55  55  PHE PHE T . n 
CA 13 56  GLN 56  56  56  GLN GLN T . n 
CA 13 57  ALA 57  57  57  ALA ALA T . n 
CA 13 58  GLU 58  58  58  GLU GLU T . n 
CA 13 59  TRP 59  59  59  TRP TRP T . n 
CA 13 60  LEU 60  60  60  LEU LEU T . n 
CA 13 61  PRO 61  61  61  PRO PRO T . n 
CA 13 62  GLY 62  62  62  GLY GLY T . n 
CA 13 63  ILE 63  63  63  ILE ILE T . n 
CA 13 64  PRO 64  64  64  PRO PRO T . n 
CA 13 65  PHE 65  65  65  PHE PHE T . n 
CA 13 66  SER 66  66  66  SER SER T . n 
CA 13 67  LEU 67  67  67  LEU LEU T . n 
CA 13 68  LEU 68  68  68  LEU LEU T . n 
CA 13 69  LEU 69  69  69  LEU LEU T . n 
CA 13 70  ASP 70  70  70  ASP ASP T . n 
CA 13 71  ASN 71  71  71  ASN ASN T . n 
CA 13 72  LEU 72  72  72  LEU LEU T . n 
CA 13 73  SER 73  73  73  SER SER T . n 
CA 13 74  GLY 74  74  74  GLY GLY T . n 
CA 13 75  PHE 75  75  75  PHE PHE T . n 
CA 13 76  MET 76  76  76  MET MET T . n 
CA 13 77  LEU 77  77  77  LEU LEU T . n 
CA 13 78  LEU 78  78  78  LEU LEU T . n 
CA 13 79  ILE 79  79  79  ILE ILE T . n 
CA 13 80  VAL 80  80  80  VAL VAL T . n 
CA 13 81  THR 81  81  81  THR THR T . n 
CA 13 82  GLY 82  82  82  GLY GLY T . n 
CA 13 83  VAL 83  83  83  VAL VAL T . n 
CA 13 84  GLY 84  84  84  GLY GLY T . n 
CA 13 85  PHE 85  85  85  PHE PHE T . n 
CA 13 86  LEU 86  86  86  LEU LEU T . n 
CA 13 87  ILE 87  87  87  ILE ILE T . n 
CA 13 88  HIS 88  88  88  HIS HIS T . n 
CA 13 89  VAL 89  89  89  VAL VAL T . n 
CA 13 90  TYR 90  90  90  TYR TYR T . n 
CA 13 91  ALA 91  91  91  ALA ALA T . n 
CA 13 92  ILE 92  92  92  ILE ILE T . n 
CA 13 93  GLY 93  93  93  GLY GLY T . n 
CA 13 94  TYR 94  94  94  TYR TYR T . n 
CA 13 95  MET 95  95  95  MET MET T . n 
CA 13 96  GLY 96  96  96  GLY GLY T . n 
CA 13 97  GLY 97  97  97  GLY GLY T . n 
CA 13 98  ASP 98  98  98  ASP ASP T . n 
CA 13 99  PRO 99  99  99  PRO PRO T . n 
CA 13 100 GLY 100 100 100 GLY GLY T . n 
CA 13 101 TYR 101 101 101 TYR TYR T . n 
CA 13 102 SER 102 102 102 SER SER T . n 
CA 13 103 ARG 103 103 103 ARG ARG T . n 
CA 13 104 PHE 104 104 104 PHE PHE T . n 
CA 13 105 PHE 105 105 105 PHE PHE T . n 
CA 13 106 ALA 106 106 106 ALA ALA T . n 
CA 13 107 TYR 107 107 107 TYR TYR T . n 
CA 13 108 PHE 108 108 108 PHE PHE T . n 
CA 13 109 ASN 109 109 109 ASN ASN T . n 
CA 13 110 LEU 110 110 110 LEU LEU T . n 
CA 13 111 PHE 111 111 111 PHE PHE T . n 
CA 13 112 ILE 112 112 112 ILE ILE T . n 
CA 13 113 ALA 113 113 113 ALA ALA T . n 
CA 13 114 MET 114 114 114 MET MET T . n 
CA 13 115 MET 115 115 115 MET MET T . n 
CA 13 116 LEU 116 116 116 LEU LEU T . n 
CA 13 117 THR 117 117 117 THR THR T . n 
CA 13 118 LEU 118 118 118 LEU LEU T . n 
CA 13 119 VAL 119 119 119 VAL VAL T . n 
CA 13 120 LEU 120 120 120 LEU LEU T . n 
CA 13 121 ALA 121 121 121 ALA ALA T . n 
CA 13 122 ASP 122 122 122 ASP ASP T . n 
CA 13 123 SER 123 123 123 SER SER T . n 
CA 13 124 TYR 124 124 124 TYR TYR T . n 
CA 13 125 PRO 125 125 125 PRO PRO T . n 
CA 13 126 VAL 126 126 126 VAL VAL T . n 
CA 13 127 MET 127 127 127 MET MET T . n 
CA 13 128 PHE 128 128 128 PHE PHE T . n 
CA 13 129 ILE 129 129 129 ILE ILE T . n 
CA 13 130 GLY 130 130 130 GLY GLY T . n 
CA 13 131 TRP 131 131 131 TRP TRP T . n 
CA 13 132 GLU 132 132 132 GLU GLU T . n 
CA 13 133 GLY 133 133 133 GLY GLY T . n 
CA 13 134 VAL 134 134 134 VAL VAL T . n 
CA 13 135 GLY 135 135 135 GLY GLY T . n 
CA 13 136 LEU 136 136 136 LEU LEU T . n 
CA 13 137 ALA 137 137 137 ALA ALA T . n 
CA 13 138 SER 138 138 138 SER SER T . n 
CA 13 139 PHE 139 139 139 PHE PHE T . n 
CA 13 140 LEU 140 140 140 LEU LEU T . n 
CA 13 141 LEU 141 141 141 LEU LEU T . n 
CA 13 142 ILE 142 142 142 ILE ILE T . n 
CA 13 143 GLY 143 143 143 GLY GLY T . n 
CA 13 144 PHE 144 144 144 PHE PHE T . n 
CA 13 145 TRP 145 145 145 TRP TRP T . n 
CA 13 146 TYR 146 146 146 TYR TYR T . n 
CA 13 147 LYS 147 147 147 LYS LYS T . n 
CA 13 148 ASN 148 148 148 ASN ASN T . n 
CA 13 149 PRO 149 149 149 PRO PRO T . n 
CA 13 150 GLN 150 150 150 GLN GLN T . n 
CA 13 151 TYR 151 151 151 TYR TYR T . n 
CA 13 152 ALA 152 152 152 ALA ALA T . n 
CA 13 153 ASP 153 153 153 ASP ASP T . n 
CA 13 154 SER 154 154 154 SER SER T . n 
CA 13 155 ALA 155 155 155 ALA ALA T . n 
CA 13 156 ARG 156 156 156 ARG ARG T . n 
CA 13 157 LYS 157 157 157 LYS LYS T . n 
CA 13 158 ALA 158 158 158 ALA ALA T . n 
CA 13 159 PHE 159 159 159 PHE PHE T . n 
CA 13 160 ILE 160 160 160 ILE ILE T . n 
CA 13 161 VAL 161 161 161 VAL VAL T . n 
CA 13 162 ASN 162 162 162 ASN ASN T . n 
CA 13 163 ARG 163 163 163 ARG ARG T . n 
CA 13 164 ILE 164 164 164 ILE ILE T . n 
CA 13 165 GLY 165 165 165 GLY GLY T . n 
CA 13 166 ASP 166 166 166 ASP ASP T . n 
CA 13 167 LEU 167 167 167 LEU LEU T . n 
CA 13 168 GLY 168 168 168 GLY GLY T . n 
CA 13 169 PHE 169 169 169 PHE PHE T . n 
CA 13 170 MET 170 170 170 MET MET T . n 
CA 13 171 LEU 171 171 171 LEU LEU T . n 
CA 13 172 GLY 172 172 172 GLY GLY T . n 
CA 13 173 MET 173 173 173 MET MET T . n 
CA 13 174 ALA 174 174 174 ALA ALA T . n 
CA 13 175 ILE 175 175 175 ILE ILE T . n 
CA 13 176 LEU 176 176 176 LEU LEU T . n 
CA 13 177 TRP 177 177 177 TRP TRP T . n 
CA 13 178 ALA 178 178 178 ALA ALA T . n 
CA 13 179 LEU 179 179 179 LEU LEU T . n 
CA 13 180 TYR 180 180 180 TYR TYR T . n 
CA 13 181 GLY 181 181 181 GLY GLY T . n 
CA 13 182 THR 182 182 182 THR THR T . n 
CA 13 183 LEU 183 183 183 LEU LEU T . n 
CA 13 184 SER 184 184 184 SER SER T . n 
CA 13 185 ILE 185 185 185 ILE ILE T . n 
CA 13 186 SER 186 186 186 SER SER T . n 
CA 13 187 GLU 187 187 187 GLU GLU T . n 
CA 13 188 LEU 188 188 188 LEU LEU T . n 
CA 13 189 LYS 189 189 189 LYS LYS T . n 
CA 13 190 GLU 190 190 190 GLU GLU T . n 
CA 13 191 ALA 191 191 191 ALA ALA T . n 
CA 13 192 MET 192 192 192 MET MET T . n 
CA 13 193 GLU 193 193 193 GLU GLU T . n 
CA 13 194 GLY 194 194 194 GLY GLY T . n 
CA 13 195 PRO 195 195 195 PRO PRO T . n 
CA 13 196 LEU 196 196 196 LEU LEU T . n 
CA 13 197 LYS 197 197 197 LYS LYS T . n 
CA 13 198 ASN 198 198 198 ASN ASN T . n 
CA 13 199 PRO 199 199 199 PRO PRO T . n 
CA 13 200 ASP 200 200 200 ASP ASP T . n 
CA 13 201 LEU 201 201 201 LEU LEU T . n 
CA 13 202 LEU 202 202 202 LEU LEU T . n 
CA 13 203 ALA 203 203 203 ALA ALA T . n 
CA 13 204 LEU 204 204 204 LEU LEU T . n 
CA 13 205 ALA 205 205 205 ALA ALA T . n 
CA 13 206 GLY 206 206 206 GLY GLY T . n 
CA 13 207 LEU 207 207 207 LEU LEU T . n 
CA 13 208 LEU 208 208 208 LEU LEU T . n 
CA 13 209 LEU 209 209 209 LEU LEU T . n 
CA 13 210 PHE 210 210 210 PHE PHE T . n 
CA 13 211 LEU 211 211 211 LEU LEU T . n 
CA 13 212 GLY 212 212 212 GLY GLY T . n 
CA 13 213 ALA 213 213 213 ALA ALA T . n 
CA 13 214 VAL 214 214 214 VAL VAL T . n 
CA 13 215 GLY 215 215 215 GLY GLY T . n 
CA 13 216 LYS 216 216 216 LYS LYS T . n 
CA 13 217 SER 217 217 217 SER SER T . n 
CA 13 218 ALA 218 218 218 ALA ALA T . n 
CA 13 219 GLN 219 219 219 GLN GLN T . n 
CA 13 220 ILE 220 220 220 ILE ILE T . n 
CA 13 221 PRO 221 221 221 PRO PRO T . n 
CA 13 222 LEU 222 222 222 LEU LEU T . n 
CA 13 223 MET 223 223 223 MET MET T . n 
CA 13 224 VAL 224 224 224 VAL VAL T . n 
CA 13 225 TRP 225 225 225 TRP TRP T . n 
CA 13 226 LEU 226 226 226 LEU LEU T . n 
CA 13 227 PRO 227 227 227 PRO PRO T . n 
CA 13 228 ASP 228 228 228 ASP ASP T . n 
CA 13 229 ALA 229 229 229 ALA ALA T . n 
CA 13 230 MET 230 230 230 MET MET T . n 
CA 13 231 ALA 231 231 231 ALA ALA T . n 
CA 13 232 GLY 232 232 232 GLY GLY T . n 
CA 13 233 PRO 233 233 233 PRO PRO T . n 
CA 13 234 THR 234 234 234 THR THR T . n 
CA 13 235 PRO 235 235 235 PRO PRO T . n 
CA 13 236 VAL 236 236 236 VAL VAL T . n 
CA 13 237 SER 237 237 237 SER SER T . n 
CA 13 238 ALA 238 238 238 ALA ALA T . n 
CA 13 239 LEU 239 239 239 LEU LEU T . n 
CA 13 240 ILE 240 240 240 ILE ILE T . n 
CA 13 241 HIS 241 241 241 HIS HIS T . n 
CA 13 242 ALA 242 242 242 ALA ALA T . n 
CA 13 243 ALA 243 243 243 ALA ALA T . n 
CA 13 244 THR 244 244 244 THR THR T . n 
CA 13 245 MET 245 245 245 MET MET T . n 
CA 13 246 VAL 246 246 246 VAL VAL T . n 
CA 13 247 THR 247 247 247 THR THR T . n 
CA 13 248 ALA 248 248 248 ALA ALA T . n 
CA 13 249 GLY 249 249 249 GLY GLY T . n 
CA 13 250 VAL 250 250 250 VAL VAL T . n 
CA 13 251 TYR 251 251 251 TYR TYR T . n 
CA 13 252 LEU 252 252 252 LEU LEU T . n 
CA 13 253 ILE 253 253 253 ILE ILE T . n 
CA 13 254 ALA 254 254 254 ALA ALA T . n 
CA 13 255 ARG 255 255 255 ARG ARG T . n 
CA 13 256 SER 256 256 256 SER SER T . n 
CA 13 257 SER 257 257 257 SER SER T . n 
CA 13 258 PHE 258 258 258 PHE PHE T . n 
CA 13 259 LEU 259 259 259 LEU LEU T . n 
CA 13 260 TYR 260 260 260 TYR TYR T . n 
CA 13 261 SER 261 261 261 SER SER T . n 
CA 13 262 VAL 262 262 262 VAL VAL T . n 
CA 13 263 LEU 263 263 263 LEU LEU T . n 
CA 13 264 PRO 264 264 264 PRO PRO T . n 
CA 13 265 ASP 265 265 265 ASP ASP T . n 
CA 13 266 VAL 266 266 266 VAL VAL T . n 
CA 13 267 SER 267 267 267 SER SER T . n 
CA 13 268 TYR 268 268 268 TYR TYR T . n 
CA 13 269 ALA 269 269 269 ALA ALA T . n 
CA 13 270 ILE 270 270 270 ILE ILE T . n 
CA 13 271 ALA 271 271 271 ALA ALA T . n 
CA 13 272 VAL 272 272 272 VAL VAL T . n 
CA 13 273 VAL 273 273 273 VAL VAL T . n 
CA 13 274 GLY 274 274 274 GLY GLY T . n 
CA 13 275 LEU 275 275 275 LEU LEU T . n 
CA 13 276 LEU 276 276 276 LEU LEU T . n 
CA 13 277 THR 277 277 277 THR THR T . n 
CA 13 278 ALA 278 278 278 ALA ALA T . n 
CA 13 279 ALA 279 279 279 ALA ALA T . n 
CA 13 280 TYR 280 280 280 TYR TYR T . n 
CA 13 281 GLY 281 281 281 GLY GLY T . n 
CA 13 282 ALA 282 282 282 ALA ALA T . n 
CA 13 283 LEU 283 283 283 LEU LEU T . n 
CA 13 284 SER 284 284 284 SER SER T . n 
CA 13 285 ALA 285 285 285 ALA ALA T . n 
CA 13 286 PHE 286 286 286 PHE PHE T . n 
CA 13 287 GLY 287 287 287 GLY GLY T . n 
CA 13 288 GLN 288 288 288 GLN GLN T . n 
CA 13 289 THR 289 289 289 THR THR T . n 
CA 13 290 ASP 290 290 290 ASP ASP T . n 
CA 13 291 ILE 291 291 291 ILE ILE T . n 
CA 13 292 LYS 292 292 292 LYS LYS T . n 
CA 13 293 LYS 293 293 293 LYS LYS T . n 
CA 13 294 ILE 294 294 294 ILE ILE T . n 
CA 13 295 VAL 295 295 295 VAL VAL T . n 
CA 13 296 ALA 296 296 296 ALA ALA T . n 
CA 13 297 TYR 297 297 297 TYR TYR T . n 
CA 13 298 SER 298 298 298 SER SER T . n 
CA 13 299 THR 299 299 299 THR THR T . n 
CA 13 300 ILE 300 300 300 ILE ILE T . n 
CA 13 301 SER 301 301 301 SER SER T . n 
CA 13 302 GLN 302 302 302 GLN GLN T . n 
CA 13 303 LEU 303 303 303 LEU LEU T . n 
CA 13 304 GLY 304 304 304 GLY GLY T . n 
CA 13 305 TYR 305 305 305 TYR TYR T . n 
CA 13 306 MET 306 306 306 MET MET T . n 
CA 13 307 PHE 307 307 307 PHE PHE T . n 
CA 13 308 LEU 308 308 308 LEU LEU T . n 
CA 13 309 ALA 309 309 309 ALA ALA T . n 
CA 13 310 ALA 310 310 310 ALA ALA T . n 
CA 13 311 GLY 311 311 311 GLY GLY T . n 
CA 13 312 VAL 312 312 312 VAL VAL T . n 
CA 13 313 GLY 313 313 313 GLY GLY T . n 
CA 13 314 ALA 314 314 314 ALA ALA T . n 
CA 13 315 TYR 315 315 315 TYR TYR T . n 
CA 13 316 TRP 316 316 316 TRP TRP T . n 
CA 13 317 VAL 317 317 317 VAL VAL T . n 
CA 13 318 ALA 318 318 318 ALA ALA T . n 
CA 13 319 LEU 319 319 319 LEU LEU T . n 
CA 13 320 PHE 320 320 320 PHE PHE T . n 
CA 13 321 HIS 321 321 321 HIS HIS T . n 
CA 13 322 VAL 322 322 322 VAL VAL T . n 
CA 13 323 PHE 323 323 323 PHE PHE T . n 
CA 13 324 THR 324 324 324 THR THR T . n 
CA 13 325 HIS 325 325 325 HIS HIS T . n 
CA 13 326 ALA 326 326 326 ALA ALA T . n 
CA 13 327 PHE 327 327 327 PHE PHE T . n 
CA 13 328 PHE 328 328 328 PHE PHE T . n 
CA 13 329 LYS 329 329 329 LYS LYS T . n 
CA 13 330 ALA 330 330 330 ALA ALA T . n 
CA 13 331 LEU 331 331 331 LEU LEU T . n 
CA 13 332 LEU 332 332 332 LEU LEU T . n 
CA 13 333 PHE 333 333 333 PHE PHE T . n 
CA 13 334 LEU 334 334 334 LEU LEU T . n 
CA 13 335 ALA 335 335 335 ALA ALA T . n 
CA 13 336 SER 336 336 336 SER SER T . n 
CA 13 337 GLY 337 337 337 GLY GLY T . n 
CA 13 338 SER 338 338 338 SER SER T . n 
CA 13 339 VAL 339 339 339 VAL VAL T . n 
CA 13 340 ILE 340 340 340 ILE ILE T . n 
CA 13 341 HIS 341 341 341 HIS HIS T . n 
CA 13 342 ALA 342 342 342 ALA ALA T . n 
CA 13 343 LEU 343 343 343 LEU LEU T . n 
CA 13 344 GLY 344 344 344 GLY GLY T . n 
CA 13 345 GLY 345 345 345 GLY GLY T . n 
CA 13 346 GLU 346 346 346 GLU GLU T . n 
CA 13 347 GLN 347 347 347 GLN GLN T . n 
CA 13 348 ASP 348 348 348 ASP ASP T . n 
CA 13 349 VAL 349 349 349 VAL VAL T . n 
CA 13 350 ARG 350 350 350 ARG ARG T . n 
CA 13 351 LYS 351 351 351 LYS LYS T . n 
CA 13 352 MET 352 352 352 MET MET T . n 
CA 13 353 GLY 353 353 353 GLY GLY T . n 
CA 13 354 GLY 354 354 354 GLY GLY T . n 
CA 13 355 LEU 355 355 355 LEU LEU T . n 
CA 13 356 TRP 356 356 356 TRP TRP T . n 
CA 13 357 LYS 357 357 357 LYS LYS T . n 
CA 13 358 HIS 358 358 358 HIS HIS T . n 
CA 13 359 LEU 359 359 359 LEU LEU T . n 
CA 13 360 PRO 360 360 360 PRO PRO T . n 
CA 13 361 GLN 361 361 361 GLN GLN T . n 
CA 13 362 THR 362 362 362 THR THR T . n 
CA 13 363 ARG 363 363 363 ARG ARG T . n 
CA 13 364 TRP 364 364 364 TRP TRP T . n 
CA 13 365 HIS 365 365 365 HIS HIS T . n 
CA 13 366 ALA 366 366 366 ALA ALA T . n 
CA 13 367 LEU 367 367 367 LEU LEU T . n 
CA 13 368 ILE 368 368 368 ILE ILE T . n 
CA 13 369 GLY 369 369 369 GLY GLY T . n 
CA 13 370 ALA 370 370 370 ALA ALA T . n 
CA 13 371 LEU 371 371 371 LEU LEU T . n 
CA 13 372 ALA 372 372 372 ALA ALA T . n 
CA 13 373 LEU 373 373 373 LEU LEU T . n 
CA 13 374 GLY 374 374 374 GLY GLY T . n 
CA 13 375 GLY 375 375 375 GLY GLY T . n 
CA 13 376 LEU 376 376 376 LEU LEU T . n 
CA 13 377 PRO 377 377 377 PRO PRO T . n 
CA 13 378 LEU 378 378 378 LEU LEU T . n 
CA 13 379 LEU 379 379 379 LEU LEU T . n 
CA 13 380 SER 380 380 380 SER SER T . n 
CA 13 381 GLY 381 381 381 GLY GLY T . n 
CA 13 382 PHE 382 382 382 PHE PHE T . n 
CA 13 383 TRP 383 383 383 TRP TRP T . n 
CA 13 384 SER 384 384 384 SER SER T . n 
CA 13 385 LYS 385 385 385 LYS LYS T . n 
CA 13 386 ASP 386 386 386 ASP ASP T . n 
CA 13 387 ALA 387 387 387 ALA ALA T . n 
CA 13 388 ILE 388 388 388 ILE ILE T . n 
CA 13 389 LEU 389 389 389 LEU LEU T . n 
CA 13 390 ALA 390 390 390 ALA ALA T . n 
CA 13 391 ALA 391 391 391 ALA ALA T . n 
CA 13 392 THR 392 392 392 THR THR T . n 
CA 13 393 LEU 393 393 393 LEU LEU T . n 
CA 13 394 THR 394 394 394 THR THR T . n 
CA 13 395 TYR 395 395 395 TYR TYR T . n 
CA 13 396 PRO 396 396 396 PRO PRO T . n 
CA 13 397 PHE 397 397 397 PHE PHE T . n 
CA 13 398 GLY 398 398 398 GLY GLY T . n 
CA 13 399 GLY 399 399 399 GLY GLY T . n 
CA 13 400 VAL 400 400 400 VAL VAL T . n 
CA 13 401 GLY 401 401 401 GLY GLY T . n 
CA 13 402 PHE 402 402 402 PHE PHE T . n 
CA 13 403 TYR 403 403 403 TYR TYR T . n 
CA 13 404 VAL 404 404 404 VAL VAL T . n 
CA 13 405 GLY 405 405 405 GLY GLY T . n 
CA 13 406 ALA 406 406 406 ALA ALA T . n 
CA 13 407 LEU 407 407 407 LEU LEU T . n 
CA 13 408 LEU 408 408 408 LEU LEU T . n 
CA 13 409 VAL 409 409 409 VAL VAL T . n 
CA 13 410 ALA 410 410 410 ALA ALA T . n 
CA 13 411 VAL 411 411 411 VAL VAL T . n 
CA 13 412 LEU 412 412 412 LEU LEU T . n 
CA 13 413 THR 413 413 413 THR THR T . n 
CA 13 414 ALA 414 414 414 ALA ALA T . n 
CA 13 415 MET 415 415 415 MET MET T . n 
CA 13 416 TYR 416 416 416 TYR TYR T . n 
CA 13 417 ALA 417 417 417 ALA ALA T . n 
CA 13 418 MET 418 418 418 MET MET T . n 
CA 13 419 ARG 419 419 419 ARG ARG T . n 
CA 13 420 TRP 420 420 420 TRP TRP T . n 
CA 13 421 PHE 421 421 421 PHE PHE T . n 
CA 13 422 VAL 422 422 422 VAL VAL T . n 
CA 13 423 LEU 423 423 423 LEU LEU T . n 
CA 13 424 VAL 424 424 424 VAL VAL T . n 
CA 13 425 PHE 425 425 425 PHE PHE T . n 
CA 13 426 LEU 426 426 426 LEU LEU T . n 
CA 13 427 GLY 427 427 427 GLY GLY T . n 
CA 13 428 GLU 428 428 428 GLU GLU T . n 
CA 13 429 GLU 429 429 429 GLU GLU T . n 
CA 13 430 ARG 430 430 430 ARG ARG T . n 
CA 13 431 GLY 431 431 431 GLY GLY T . n 
CA 13 432 HIS 432 432 432 HIS HIS T . n 
CA 13 433 HIS 433 433 433 HIS HIS T . n 
CA 13 434 HIS 434 434 434 HIS HIS T . n 
CA 13 435 PRO 435 435 435 PRO PRO T . n 
CA 13 436 HIS 436 436 436 HIS HIS T . n 
CA 13 437 GLU 437 437 437 GLU GLU T . n 
CA 13 438 ALA 438 438 438 ALA ALA T . n 
CA 13 439 PRO 439 439 439 PRO PRO T . n 
CA 13 440 PRO 440 440 440 PRO PRO T . n 
CA 13 441 VAL 441 441 441 VAL VAL T . n 
CA 13 442 MET 442 442 442 MET MET T . n 
CA 13 443 LEU 443 443 443 LEU LEU T . n 
CA 13 444 TRP 444 444 444 TRP TRP T . n 
CA 13 445 PRO 445 445 445 PRO PRO T . n 
CA 13 446 ASN 446 446 446 ASN ASN T . n 
CA 13 447 HIS 447 447 447 HIS HIS T . n 
CA 13 448 LEU 448 448 448 LEU LEU T . n 
CA 13 449 LEU 449 449 449 LEU LEU T . n 
CA 13 450 ALA 450 450 450 ALA ALA T . n 
CA 13 451 LEU 451 451 451 LEU LEU T . n 
CA 13 452 GLY 452 452 452 GLY GLY T . n 
CA 13 453 SER 453 453 453 SER SER T . n 
CA 13 454 VAL 454 454 454 VAL VAL T . n 
CA 13 455 LEU 455 455 455 LEU LEU T . n 
CA 13 456 ALA 456 456 456 ALA ALA T . n 
CA 13 457 GLY 457 457 457 GLY GLY T . n 
CA 13 458 TYR 458 458 458 TYR TYR T . n 
CA 13 459 LEU 459 459 459 LEU LEU T . n 
CA 13 460 ALA 460 460 460 ALA ALA T . n 
CA 13 461 LEU 461 461 461 LEU LEU T . n 
CA 13 462 PRO 462 462 462 PRO PRO T . n 
CA 13 463 HIS 463 463 463 HIS HIS T . n 
CA 13 464 PRO 464 464 464 PRO PRO T . n 
CA 13 465 LEU 465 465 465 LEU LEU T . n 
CA 13 466 PRO 466 466 466 PRO PRO T . n 
CA 13 467 ASN 467 467 467 ASN ASN T . n 
CA 13 468 VAL 468 468 468 VAL VAL T . n 
CA 13 469 LEU 469 469 469 LEU LEU T . n 
CA 13 470 GLU 470 470 470 GLU GLU T . n 
CA 13 471 PRO 471 471 471 PRO PRO T . n 
CA 13 472 PHE 472 472 472 PHE PHE T . n 
CA 13 473 LEU 473 473 473 LEU LEU T . n 
CA 13 474 LYS 474 474 474 LYS LYS T . n 
CA 13 475 PRO 475 475 475 PRO PRO T . n 
CA 13 476 ALA 476 476 476 ALA ALA T . n 
CA 13 477 LEU 477 477 477 LEU LEU T . n 
CA 13 478 ALA 478 478 478 ALA ALA T . n 
CA 13 479 GLU 479 479 479 GLU GLU T . n 
CA 13 480 VAL 480 480 480 VAL VAL T . n 
CA 13 481 GLU 481 481 481 GLU GLU T . n 
CA 13 482 ALA 482 482 482 ALA ALA T . n 
CA 13 483 HIS 483 483 483 HIS HIS T . n 
CA 13 484 HIS 484 484 484 HIS HIS T . n 
CA 13 485 LEU 485 485 485 LEU LEU T . n 
CA 13 486 SER 486 486 486 SER SER T . n 
CA 13 487 LEU 487 487 487 LEU LEU T . n 
CA 13 488 GLY 488 488 488 GLY GLY T . n 
CA 13 489 ALA 489 489 489 ALA ALA T . n 
CA 13 490 GLU 490 490 490 GLU GLU T . n 
CA 13 491 TRP 491 491 491 TRP TRP T . n 
CA 13 492 GLY 492 492 492 GLY GLY T . n 
CA 13 493 LEU 493 493 493 LEU LEU T . n 
CA 13 494 ILE 494 494 494 ILE ILE T . n 
CA 13 495 ALA 495 495 495 ALA ALA T . n 
CA 13 496 LEU 496 496 496 LEU LEU T . n 
CA 13 497 SER 497 497 497 SER SER T . n 
CA 13 498 ALA 498 498 498 ALA ALA T . n 
CA 13 499 ALA 499 499 499 ALA ALA T . n 
CA 13 500 VAL 500 500 500 VAL VAL T . n 
CA 13 501 ALA 501 501 501 ALA ALA T . n 
CA 13 502 LEU 502 502 502 LEU LEU T . n 
CA 13 503 LEU 503 503 503 LEU LEU T . n 
CA 13 504 GLY 504 504 504 GLY GLY T . n 
CA 13 505 LEU 505 505 505 LEU LEU T . n 
CA 13 506 TRP 506 506 506 TRP TRP T . n 
CA 13 507 ALA 507 507 507 ALA ALA T . n 
CA 13 508 GLY 508 508 508 GLY GLY T . n 
CA 13 509 PHE 509 509 509 PHE PHE T . n 
CA 13 510 VAL 510 510 510 VAL VAL T . n 
CA 13 511 PHE 511 511 511 PHE PHE T . n 
CA 13 512 PHE 512 512 512 PHE PHE T . n 
CA 13 513 GLN 513 513 513 GLN GLN T . n 
CA 13 514 ARG 514 514 514 ARG ARG T . n 
CA 13 515 LYS 515 515 515 LYS LYS T . n 
CA 13 516 VAL 516 516 516 VAL VAL T . n 
CA 13 517 PHE 517 517 517 PHE PHE T . n 
CA 13 518 PRO 518 518 518 PRO PRO T . n 
CA 13 519 ALA 519 519 519 ALA ALA T . n 
CA 13 520 TRP 520 520 520 TRP TRP T . n 
CA 13 521 TYR 521 521 521 TYR TYR T . n 
CA 13 522 LEU 522 522 522 LEU LEU T . n 
CA 13 523 ALA 523 523 523 ALA ALA T . n 
CA 13 524 PHE 524 524 524 PHE PHE T . n 
CA 13 525 GLU 525 525 525 GLU GLU T . n 
CA 13 526 ALA 526 526 526 ALA ALA T . n 
CA 13 527 ALA 527 527 527 ALA ALA T . n 
CA 13 528 SER 528 528 528 SER SER T . n 
CA 13 529 ARG 529 529 529 ARG ARG T . n 
CA 13 530 GLU 530 530 530 GLU GLU T . n 
CA 13 531 ALA 531 531 531 ALA ALA T . n 
CA 13 532 PHE 532 532 532 PHE PHE T . n 
CA 13 533 TYR 533 533 533 TYR TYR T . n 
CA 13 534 VAL 534 534 534 VAL VAL T . n 
CA 13 535 ASP 535 535 535 ASP ASP T . n 
CA 13 536 ARG 536 536 536 ARG ARG T . n 
CA 13 537 ALA 537 537 537 ALA ALA T . n 
CA 13 538 TYR 538 538 538 TYR TYR T . n 
CA 13 539 ASN 539 539 539 ASN ASN T . n 
CA 13 540 ALA 540 540 540 ALA ALA T . n 
CA 13 541 LEU 541 541 541 LEU LEU T . n 
CA 13 542 ILE 542 542 542 ILE ILE T . n 
CA 13 543 VAL 543 543 543 VAL VAL T . n 
CA 13 544 ASN 544 544 544 ASN ASN T . n 
CA 13 545 PRO 545 545 545 PRO PRO T . n 
CA 13 546 LEU 546 546 546 LEU LEU T . n 
CA 13 547 LYS 547 547 547 LYS LYS T . n 
CA 13 548 ALA 548 548 548 ALA ALA T . n 
CA 13 549 LEU 549 549 549 LEU LEU T . n 
CA 13 550 ALA 550 550 550 ALA ALA T . n 
CA 13 551 GLU 551 551 551 GLU GLU T . n 
CA 13 552 ALA 552 552 552 ALA ALA T . n 
CA 13 553 LEU 553 553 553 LEU LEU T . n 
CA 13 554 PHE 554 554 554 PHE PHE T . n 
CA 13 555 TYR 555 555 555 TYR TYR T . n 
CA 13 556 GLY 556 556 556 GLY GLY T . n 
CA 13 557 ASP 557 557 557 ASP ASP T . n 
CA 13 558 ARG 558 558 558 ARG ARG T . n 
CA 13 559 GLY 559 559 559 GLY GLY T . n 
CA 13 560 LEU 560 560 560 LEU LEU T . n 
CA 13 561 LEU 561 561 561 LEU LEU T . n 
CA 13 562 SER 562 562 562 SER SER T . n 
CA 13 563 GLY 563 563 563 GLY GLY T . n 
CA 13 564 TYR 564 564 564 TYR TYR T . n 
CA 13 565 PHE 565 565 565 PHE PHE T . n 
CA 13 566 GLY 566 566 566 GLY GLY T . n 
CA 13 567 LEU 567 567 567 LEU LEU T . n 
CA 13 568 GLY 568 568 568 GLY GLY T . n 
CA 13 569 GLY 569 569 569 GLY GLY T . n 
CA 13 570 ALA 570 570 570 ALA ALA T . n 
CA 13 571 ALA 571 571 571 ALA ALA T . n 
CA 13 572 ARG 572 572 572 ARG ARG T . n 
CA 13 573 SER 573 573 573 SER SER T . n 
CA 13 574 LEU 574 574 574 LEU LEU T . n 
CA 13 575 GLY 575 575 575 GLY GLY T . n 
CA 13 576 GLN 576 576 576 GLN GLN T . n 
CA 13 577 GLY 577 577 577 GLY GLY T . n 
CA 13 578 LEU 578 578 578 LEU LEU T . n 
CA 13 579 ALA 579 579 579 ALA ALA T . n 
CA 13 580 ARG 580 580 580 ARG ARG T . n 
CA 13 581 LEU 581 581 581 LEU LEU T . n 
CA 13 582 GLN 582 582 582 GLN GLN T . n 
CA 13 583 THR 583 583 583 THR THR T . n 
CA 13 584 GLY 584 584 584 GLY GLY T . n 
CA 13 585 TYR 585 585 585 TYR TYR T . n 
CA 13 586 LEU 586 586 586 LEU LEU T . n 
CA 13 587 ARG 587 587 587 ARG ARG T . n 
CA 13 588 VAL 588 588 588 VAL VAL T . n 
CA 13 589 TYR 589 589 589 TYR TYR T . n 
CA 13 590 ALA 590 590 590 ALA ALA T . n 
CA 13 591 LEU 591 591 591 LEU LEU T . n 
CA 13 592 LEU 592 592 592 LEU LEU T . n 
CA 13 593 PHE 593 593 593 PHE PHE T . n 
CA 13 594 VAL 594 594 594 VAL VAL T . n 
CA 13 595 LEU 595 595 595 LEU LEU T . n 
CA 13 596 GLY 596 596 596 GLY GLY T . n 
CA 13 597 ALA 597 597 597 ALA ALA T . n 
CA 13 598 LEU 598 598 598 LEU LEU T . n 
CA 13 599 LEU 599 599 599 LEU LEU T . n 
CA 13 600 LEU 600 600 600 LEU LEU T . n 
CA 13 601 LEU 601 601 601 LEU LEU T . n 
CA 13 602 GLY 602 602 602 GLY GLY T . n 
CA 13 603 VAL 603 603 603 VAL VAL T . n 
CA 13 604 MET 604 604 604 MET MET T . n 
CA 13 605 ARG 605 605 605 ARG ARG T . n 
CA 13 606 TRP 606 606 ?   ?   ?   T . n 
DA 14 1   MET 1   1   1   MET MET U . n 
DA 14 2   VAL 2   2   2   VAL VAL U . n 
DA 14 3   VAL 3   3   3   VAL VAL U . n 
DA 14 4   LEU 4   4   4   LEU LEU U . n 
DA 14 5   ALA 5   5   5   ALA ALA U . n 
DA 14 6   VAL 6   6   6   VAL VAL U . n 
DA 14 7   LEU 7   7   7   LEU LEU U . n 
DA 14 8   LEU 8   8   8   LEU LEU U . n 
DA 14 9   PRO 9   9   9   PRO PRO U . n 
DA 14 10  VAL 10  10  10  VAL VAL U . n 
DA 14 11  VAL 11  11  11  VAL VAL U . n 
DA 14 12  PHE 12  12  12  PHE PHE U . n 
DA 14 13  GLY 13  13  13  GLY GLY U . n 
DA 14 14  ALA 14  14  14  ALA ALA U . n 
DA 14 15  LEU 15  15  15  LEU LEU U . n 
DA 14 16  LEU 16  16  16  LEU LEU U . n 
DA 14 17  LEU 17  17  17  LEU LEU U . n 
DA 14 18  LEU 18  18  18  LEU LEU U . n 
DA 14 19  GLY 19  19  19  GLY GLY U . n 
DA 14 20  LEU 20  20  20  LEU LEU U . n 
DA 14 21  PRO 21  21  21  PRO PRO U . n 
DA 14 22  ARG 22  22  22  ARG ARG U . n 
DA 14 23  ALA 23  23  23  ALA ALA U . n 
DA 14 24  LEU 24  24  24  LEU LEU U . n 
DA 14 25  GLY 25  25  25  GLY GLY U . n 
DA 14 26  VAL 26  26  26  VAL VAL U . n 
DA 14 27  LEU 27  27  27  LEU LEU U . n 
DA 14 28  GLY 28  28  28  GLY GLY U . n 
DA 14 29  ALA 29  29  29  ALA ALA U . n 
DA 14 30  GLY 30  30  30  GLY GLY U . n 
DA 14 31  LEU 31  31  31  LEU LEU U . n 
DA 14 32  SER 32  32  32  SER SER U . n 
DA 14 33  PHE 33  33  33  PHE PHE U . n 
DA 14 34  LEU 34  34  34  LEU LEU U . n 
DA 14 35  LEU 35  35  35  LEU LEU U . n 
DA 14 36  ASN 36  36  36  ASN ASN U . n 
DA 14 37  LEU 37  37  37  LEU LEU U . n 
DA 14 38  TYR 38  38  38  TYR TYR U . n 
DA 14 39  LEU 39  39  39  LEU LEU U . n 
DA 14 40  PHE 40  40  40  PHE PHE U . n 
DA 14 41  LEU 41  41  41  LEU LEU U . n 
DA 14 42  THR 42  42  42  THR THR U . n 
DA 14 43  HIS 43  43  43  HIS HIS U . n 
DA 14 44  PRO 44  44  44  PRO PRO U . n 
DA 14 45  GLY 45  45  45  GLY GLY U . n 
DA 14 46  GLY 46  46  46  GLY GLY U . n 
DA 14 47  VAL 47  47  47  VAL VAL U . n 
DA 14 48  ALA 48  48  48  ALA ALA U . n 
DA 14 49  HIS 49  49  49  HIS HIS U . n 
DA 14 50  ALA 50  50  50  ALA ALA U . n 
DA 14 51  PHE 51  51  51  PHE PHE U . n 
DA 14 52  GLN 52  52  52  GLN GLN U . n 
DA 14 53  ALA 53  53  53  ALA ALA U . n 
DA 14 54  PRO 54  54  54  PRO PRO U . n 
DA 14 55  LEU 55  55  55  LEU LEU U . n 
DA 14 56  LEU 56  56  56  LEU LEU U . n 
DA 14 57  PRO 57  57  57  PRO PRO U . n 
DA 14 58  GLY 58  58  58  GLY GLY U . n 
DA 14 59  ALA 59  59  59  ALA ALA U . n 
DA 14 60  GLY 60  60  60  GLY GLY U . n 
DA 14 61  VAL 61  61  61  VAL VAL U . n 
DA 14 62  TYR 62  62  62  TYR TYR U . n 
DA 14 63  TRP 63  63  63  TRP TRP U . n 
DA 14 64  ALA 64  64  64  ALA ALA U . n 
DA 14 65  PHE 65  65  65  PHE PHE U . n 
DA 14 66  GLY 66  66  66  GLY GLY U . n 
DA 14 67  LEU 67  67  67  LEU LEU U . n 
DA 14 68  ASP 68  68  68  ASP ASP U . n 
DA 14 69  GLY 69  69  69  GLY GLY U . n 
DA 14 70  LEU 70  70  70  LEU LEU U . n 
DA 14 71  SER 71  71  71  SER SER U . n 
DA 14 72  ALA 72  72  72  ALA ALA U . n 
DA 14 73  LEU 73  73  73  LEU LEU U . n 
DA 14 74  PHE 74  74  74  PHE PHE U . n 
DA 14 75  PHE 75  75  75  PHE PHE U . n 
DA 14 76  LEU 76  76  76  LEU LEU U . n 
DA 14 77  THR 77  77  77  THR THR U . n 
DA 14 78  ILE 78  78  78  ILE ILE U . n 
DA 14 79  ALA 79  79  79  ALA ALA U . n 
DA 14 80  LEU 80  80  80  LEU LEU U . n 
DA 14 81  THR 81  81  81  THR THR U . n 
DA 14 82  VAL 82  82  82  VAL VAL U . n 
DA 14 83  PHE 83  83  83  PHE PHE U . n 
DA 14 84  LEU 84  84  84  LEU LEU U . n 
DA 14 85  GLY 85  85  85  GLY GLY U . n 
DA 14 86  ALA 86  86  86  ALA ALA U . n 
DA 14 87  LEU 87  87  87  LEU LEU U . n 
DA 14 88  VAL 88  88  88  VAL VAL U . n 
DA 14 89  ALA 89  89  89  ALA ALA U . n 
DA 14 90  ARG 90  90  90  ARG ARG U . n 
DA 14 91  VAL 91  91  91  VAL VAL U . n 
DA 14 92  GLU 92  92  92  GLU GLU U . n 
DA 14 93  GLY 93  93  93  GLY GLY U . n 
DA 14 94  ARG 94  94  94  ARG ARG U . n 
DA 14 95  PHE 95  95  95  PHE PHE U . n 
DA 14 96  LEU 96  96  96  LEU LEU U . n 
DA 14 97  GLY 97  97  97  GLY GLY U . n 
DA 14 98  LEU 98  98  98  LEU LEU U . n 
DA 14 99  ALA 99  99  99  ALA ALA U . n 
DA 14 100 LEU 100 100 100 LEU LEU U . n 
DA 14 101 LEU 101 101 101 LEU LEU U . n 
DA 14 102 MET 102 102 102 MET MET U . n 
DA 14 103 GLU 103 103 103 GLU GLU U . n 
DA 14 104 GLY 104 104 104 GLY GLY U . n 
DA 14 105 LEU 105 105 105 LEU LEU U . n 
DA 14 106 LEU 106 106 106 LEU LEU U . n 
DA 14 107 LEU 107 107 107 LEU LEU U . n 
DA 14 108 GLY 108 108 108 GLY GLY U . n 
DA 14 109 LEU 109 109 109 LEU LEU U . n 
DA 14 110 PHE 110 110 110 PHE PHE U . n 
DA 14 111 ALA 111 111 111 ALA ALA U . n 
DA 14 112 ALA 112 112 112 ALA ALA U . n 
DA 14 113 ARG 113 113 113 ARG ARG U . n 
DA 14 114 ASP 114 114 114 ASP ASP U . n 
DA 14 115 LEU 115 115 115 LEU LEU U . n 
DA 14 116 LEU 116 116 116 LEU LEU U . n 
DA 14 117 VAL 117 117 117 VAL VAL U . n 
DA 14 118 PHE 118 118 118 PHE PHE U . n 
DA 14 119 TYR 119 119 119 TYR TYR U . n 
DA 14 120 VAL 120 120 120 VAL VAL U . n 
DA 14 121 PHE 121 121 121 PHE PHE U . n 
DA 14 122 PHE 122 122 122 PHE PHE U . n 
DA 14 123 GLU 123 123 123 GLU GLU U . n 
DA 14 124 ALA 124 124 124 ALA ALA U . n 
DA 14 125 ALA 125 125 125 ALA ALA U . n 
DA 14 126 LEU 126 126 126 LEU LEU U . n 
DA 14 127 ILE 127 127 127 ILE ILE U . n 
DA 14 128 PRO 128 128 128 PRO PRO U . n 
DA 14 129 ALA 129 129 129 ALA ALA U . n 
DA 14 130 LEU 130 130 130 LEU LEU U . n 
DA 14 131 LEU 131 131 131 LEU LEU U . n 
DA 14 132 MET 132 132 132 MET MET U . n 
DA 14 133 LEU 133 133 133 LEU LEU U . n 
DA 14 134 TYR 134 134 134 TYR TYR U . n 
DA 14 135 LEU 135 135 135 LEU LEU U . n 
DA 14 136 TYR 136 136 136 TYR TYR U . n 
DA 14 137 GLY 137 137 137 GLY GLY U . n 
DA 14 138 GLY 138 138 138 GLY GLY U . n 
DA 14 139 GLU 139 139 139 GLU GLU U . n 
DA 14 140 GLY 140 140 140 GLY GLY U . n 
DA 14 141 ARG 141 141 141 ARG ARG U . n 
DA 14 142 THR 142 142 142 THR THR U . n 
DA 14 143 ARG 143 143 143 ARG ARG U . n 
DA 14 144 ALA 144 144 144 ALA ALA U . n 
DA 14 145 LEU 145 145 145 LEU LEU U . n 
DA 14 146 TYR 146 146 146 TYR TYR U . n 
DA 14 147 THR 147 147 147 THR THR U . n 
DA 14 148 PHE 148 148 148 PHE PHE U . n 
DA 14 149 VAL 149 149 149 VAL VAL U . n 
DA 14 150 LEU 150 150 150 LEU LEU U . n 
DA 14 151 PHE 151 151 151 PHE PHE U . n 
DA 14 152 THR 152 152 152 THR THR U . n 
DA 14 153 LEU 153 153 153 LEU LEU U . n 
DA 14 154 VAL 154 154 154 VAL VAL U . n 
DA 14 155 GLY 155 155 155 GLY GLY U . n 
DA 14 156 SER 156 156 156 SER SER U . n 
DA 14 157 LEU 157 157 157 LEU LEU U . n 
DA 14 158 PRO 158 158 158 PRO PRO U . n 
DA 14 159 MET 159 159 159 MET MET U . n 
DA 14 160 LEU 160 160 160 LEU LEU U . n 
DA 14 161 ALA 161 161 161 ALA ALA U . n 
DA 14 162 ALA 162 162 162 ALA ALA U . n 
DA 14 163 VAL 163 163 163 VAL VAL U . n 
DA 14 164 LEU 164 164 164 LEU LEU U . n 
DA 14 165 GLY 165 165 165 GLY GLY U . n 
DA 14 166 ALA 166 166 166 ALA ALA U . n 
DA 14 167 ARG 167 167 167 ARG ARG U . n 
DA 14 168 LEU 168 168 168 LEU LEU U . n 
DA 14 169 LEU 169 169 169 LEU LEU U . n 
DA 14 170 SER 170 170 170 SER SER U . n 
DA 14 171 GLY 171 171 171 GLY GLY U . n 
DA 14 172 SER 172 172 172 SER SER U . n 
DA 14 173 PRO 173 173 173 PRO PRO U . n 
DA 14 174 THR 174 174 174 THR THR U . n 
DA 14 175 PHE 175 175 175 PHE PHE U . n 
DA 14 176 LEU 176 176 176 LEU LEU U . n 
DA 14 177 LEU 177 177 177 LEU LEU U . n 
DA 14 178 GLU 178 178 178 GLU GLU U . n 
DA 14 179 ASP 179 179 179 ASP ASP U . n 
DA 14 180 LEU 180 180 180 LEU LEU U . n 
DA 14 181 LEU 181 181 181 LEU LEU U . n 
DA 14 182 ALA 182 182 182 ALA ALA U . n 
DA 14 183 HIS 183 183 183 HIS HIS U . n 
DA 14 184 PRO 184 184 184 PRO PRO U . n 
DA 14 185 LEU 185 185 185 LEU LEU U . n 
DA 14 186 GLN 186 186 186 GLN GLN U . n 
DA 14 187 GLU 187 187 187 GLU GLU U . n 
DA 14 188 GLU 188 188 188 GLU GLU U . n 
DA 14 189 ALA 189 189 189 ALA ALA U . n 
DA 14 190 ALA 190 190 190 ALA ALA U . n 
DA 14 191 PHE 191 191 191 PHE PHE U . n 
DA 14 192 TRP 192 192 192 TRP TRP U . n 
DA 14 193 VAL 193 193 193 VAL VAL U . n 
DA 14 194 PHE 194 194 194 PHE PHE U . n 
DA 14 195 LEU 195 195 195 LEU LEU U . n 
DA 14 196 GLY 196 196 196 GLY GLY U . n 
DA 14 197 PHE 197 197 197 PHE PHE U . n 
DA 14 198 ALA 198 198 198 ALA ALA U . n 
DA 14 199 LEU 199 199 199 LEU LEU U . n 
DA 14 200 ALA 200 200 200 ALA ALA U . n 
DA 14 201 PHE 201 201 201 PHE PHE U . n 
DA 14 202 ALA 202 202 202 ALA ALA U . n 
DA 14 203 ILE 203 203 203 ILE ILE U . n 
DA 14 204 LYS 204 204 204 LYS LYS U . n 
DA 14 205 THR 205 205 205 THR THR U . n 
DA 14 206 PRO 206 206 206 PRO PRO U . n 
DA 14 207 LEU 207 207 207 LEU LEU U . n 
DA 14 208 PHE 208 208 208 PHE PHE U . n 
DA 14 209 PRO 209 209 209 PRO PRO U . n 
DA 14 210 LEU 210 210 210 LEU LEU U . n 
DA 14 211 HIS 211 211 211 HIS HIS U . n 
DA 14 212 ALA 212 212 212 ALA ALA U . n 
DA 14 213 TRP 213 213 213 TRP TRP U . n 
DA 14 214 LEU 214 214 214 LEU LEU U . n 
DA 14 215 PRO 215 215 215 PRO PRO U . n 
DA 14 216 PRO 216 216 216 PRO PRO U . n 
DA 14 217 PHE 217 217 217 PHE PHE U . n 
DA 14 218 HIS 218 218 218 HIS HIS U . n 
DA 14 219 GLN 219 219 219 GLN GLN U . n 
DA 14 220 GLU 220 220 220 GLU GLU U . n 
DA 14 221 ASN 221 221 221 ASN ASN U . n 
DA 14 222 HIS 222 222 222 HIS HIS U . n 
DA 14 223 PRO 223 223 223 PRO PRO U . n 
DA 14 224 SER 224 224 224 SER SER U . n 
DA 14 225 GLY 225 225 225 GLY GLY U . n 
DA 14 226 LEU 226 226 226 LEU LEU U . n 
DA 14 227 ALA 227 227 227 ALA ALA U . n 
DA 14 228 ASP 228 228 228 ASP ASP U . n 
DA 14 229 ALA 229 229 229 ALA ALA U . n 
DA 14 230 LEU 230 230 230 LEU LEU U . n 
DA 14 231 GLY 231 231 231 GLY GLY U . n 
DA 14 232 THR 232 232 232 THR THR U . n 
DA 14 233 LEU 233 233 233 LEU LEU U . n 
DA 14 234 TYR 234 234 234 TYR TYR U . n 
DA 14 235 LYS 235 235 235 LYS LYS U . n 
DA 14 236 VAL 236 236 236 VAL VAL U . n 
DA 14 237 GLY 237 237 237 GLY GLY U . n 
DA 14 238 VAL 238 238 238 VAL VAL U . n 
DA 14 239 PHE 239 239 239 PHE PHE U . n 
DA 14 240 ALA 240 240 240 ALA ALA U . n 
DA 14 241 PHE 241 241 241 PHE PHE U . n 
DA 14 242 PHE 242 242 242 PHE PHE U . n 
DA 14 243 ARG 243 243 243 ARG ARG U . n 
DA 14 244 PHE 244 244 244 PHE PHE U . n 
DA 14 245 ALA 245 245 245 ALA ALA U . n 
DA 14 246 ILE 246 246 246 ILE ILE U . n 
DA 14 247 PRO 247 247 247 PRO PRO U . n 
DA 14 248 LEU 248 248 248 LEU LEU U . n 
DA 14 249 ALA 249 249 249 ALA ALA U . n 
DA 14 250 PRO 250 250 250 PRO PRO U . n 
DA 14 251 GLU 251 251 251 GLU GLU U . n 
DA 14 252 GLY 252 252 252 GLY GLY U . n 
DA 14 253 PHE 253 253 253 PHE PHE U . n 
DA 14 254 ALA 254 254 254 ALA ALA U . n 
DA 14 255 GLN 255 255 255 GLN GLN U . n 
DA 14 256 ALA 256 256 256 ALA ALA U . n 
DA 14 257 GLN 257 257 257 GLN GLN U . n 
DA 14 258 GLY 258 258 258 GLY GLY U . n 
DA 14 259 LEU 259 259 259 LEU LEU U . n 
DA 14 260 LEU 260 260 260 LEU LEU U . n 
DA 14 261 LEU 261 261 261 LEU LEU U . n 
DA 14 262 PHE 262 262 262 PHE PHE U . n 
DA 14 263 LEU 263 263 263 LEU LEU U . n 
DA 14 264 ALA 264 264 264 ALA ALA U . n 
DA 14 265 ALA 265 265 265 ALA ALA U . n 
DA 14 266 LEU 266 266 266 LEU LEU U . n 
DA 14 267 SER 267 267 267 SER SER U . n 
DA 14 268 ALA 268 268 268 ALA ALA U . n 
DA 14 269 LEU 269 269 269 LEU LEU U . n 
DA 14 270 TYR 270 270 270 TYR TYR U . n 
DA 14 271 GLY 271 271 271 GLY GLY U . n 
DA 14 272 ALA 272 272 272 ALA ALA U . n 
DA 14 273 TRP 273 273 273 TRP TRP U . n 
DA 14 274 VAL 274 274 274 VAL VAL U . n 
DA 14 275 ALA 275 275 275 ALA ALA U . n 
DA 14 276 PHE 276 276 276 PHE PHE U . n 
DA 14 277 ALA 277 277 277 ALA ALA U . n 
DA 14 278 ALA 278 278 278 ALA ALA U . n 
DA 14 279 LYS 279 279 279 LYS LYS U . n 
DA 14 280 ASP 280 280 280 ASP ASP U . n 
DA 14 281 PHE 281 281 281 PHE PHE U . n 
DA 14 282 LYS 282 282 282 LYS LYS U . n 
DA 14 283 THR 283 283 283 THR THR U . n 
DA 14 284 LEU 284 284 284 LEU LEU U . n 
DA 14 285 LEU 285 285 285 LEU LEU U . n 
DA 14 286 ALA 286 286 286 ALA ALA U . n 
DA 14 287 TYR 287 287 287 TYR TYR U . n 
DA 14 288 ALA 288 288 288 ALA ALA U . n 
DA 14 289 GLY 289 289 289 GLY GLY U . n 
DA 14 290 LEU 290 290 290 LEU LEU U . n 
DA 14 291 SER 291 291 291 SER SER U . n 
DA 14 292 HIS 292 292 292 HIS HIS U . n 
DA 14 293 MET 293 293 293 MET MET U . n 
DA 14 294 GLY 294 294 294 GLY GLY U . n 
DA 14 295 VAL 295 295 295 VAL VAL U . n 
DA 14 296 ALA 296 296 296 ALA ALA U . n 
DA 14 297 ALA 297 297 297 ALA ALA U . n 
DA 14 298 LEU 298 298 298 LEU LEU U . n 
DA 14 299 GLY 299 299 299 GLY GLY U . n 
DA 14 300 VAL 300 300 300 VAL VAL U . n 
DA 14 301 PHE 301 301 301 PHE PHE U . n 
DA 14 302 SER 302 302 302 SER SER U . n 
DA 14 303 GLY 303 303 303 GLY GLY U . n 
DA 14 304 THR 304 304 304 THR THR U . n 
DA 14 305 PRO 305 305 305 PRO PRO U . n 
DA 14 306 GLU 306 306 306 GLU GLU U . n 
DA 14 307 GLY 307 307 307 GLY GLY U . n 
DA 14 308 ALA 308 308 308 ALA ALA U . n 
DA 14 309 MET 309 309 309 MET MET U . n 
DA 14 310 GLY 310 310 310 GLY GLY U . n 
DA 14 311 GLY 311 311 311 GLY GLY U . n 
DA 14 312 LEU 312 312 312 LEU LEU U . n 
DA 14 313 TYR 313 313 313 TYR TYR U . n 
DA 14 314 LEU 314 314 314 LEU LEU U . n 
DA 14 315 LEU 315 315 315 LEU LEU U . n 
DA 14 316 ALA 316 316 316 ALA ALA U . n 
DA 14 317 ALA 317 317 317 ALA ALA U . n 
DA 14 318 SER 318 318 318 SER SER U . n 
DA 14 319 GLY 319 319 319 GLY GLY U . n 
DA 14 320 VAL 320 320 320 VAL VAL U . n 
DA 14 321 TYR 321 321 321 TYR TYR U . n 
DA 14 322 THR 322 322 322 THR THR U . n 
DA 14 323 GLY 323 323 323 GLY GLY U . n 
DA 14 324 GLY 324 324 324 GLY GLY U . n 
DA 14 325 LEU 325 325 325 LEU LEU U . n 
DA 14 326 PHE 326 326 326 PHE PHE U . n 
DA 14 327 LEU 327 327 327 LEU LEU U . n 
DA 14 328 LEU 328 328 328 LEU LEU U . n 
DA 14 329 ALA 329 329 329 ALA ALA U . n 
DA 14 330 GLY 330 330 330 GLY GLY U . n 
DA 14 331 ARG 331 331 331 ARG ARG U . n 
DA 14 332 LEU 332 332 332 LEU LEU U . n 
DA 14 333 TYR 333 333 333 TYR TYR U . n 
DA 14 334 GLU 334 334 334 GLU GLU U . n 
DA 14 335 ARG 335 335 335 ARG ARG U . n 
DA 14 336 THR 336 336 336 THR THR U . n 
DA 14 337 GLY 337 337 337 GLY GLY U . n 
DA 14 338 THR 338 338 338 THR THR U . n 
DA 14 339 LEU 339 339 339 LEU LEU U . n 
DA 14 340 GLU 340 340 340 GLU GLU U . n 
DA 14 341 ILE 341 341 341 ILE ILE U . n 
DA 14 342 GLY 342 342 342 GLY GLY U . n 
DA 14 343 ARG 343 343 343 ARG ARG U . n 
DA 14 344 TYR 344 344 344 TYR TYR U . n 
DA 14 345 ARG 345 345 345 ARG ARG U . n 
DA 14 346 GLY 346 346 346 GLY GLY U . n 
DA 14 347 LEU 347 347 347 LEU LEU U . n 
DA 14 348 ALA 348 348 348 ALA ALA U . n 
DA 14 349 GLN 349 349 349 GLN GLN U . n 
DA 14 350 SER 350 350 350 SER SER U . n 
DA 14 351 ALA 351 351 351 ALA ALA U . n 
DA 14 352 PRO 352 352 352 PRO PRO U . n 
DA 14 353 GLY 353 353 353 GLY GLY U . n 
DA 14 354 LEU 354 354 354 LEU LEU U . n 
DA 14 355 ALA 355 355 355 ALA ALA U . n 
DA 14 356 ALA 356 356 356 ALA ALA U . n 
DA 14 357 LEU 357 357 357 LEU LEU U . n 
DA 14 358 ALA 358 358 358 ALA ALA U . n 
DA 14 359 LEU 359 359 359 LEU LEU U . n 
DA 14 360 ILE 360 360 360 ILE ILE U . n 
DA 14 361 LEU 361 361 361 LEU LEU U . n 
DA 14 362 PHE 362 362 362 PHE PHE U . n 
DA 14 363 LEU 363 363 363 LEU LEU U . n 
DA 14 364 ALA 364 364 364 ALA ALA U . n 
DA 14 365 MET 365 365 365 MET MET U . n 
DA 14 366 VAL 366 366 366 VAL VAL U . n 
DA 14 367 GLY 367 367 367 GLY GLY U . n 
DA 14 368 LEU 368 368 368 LEU LEU U . n 
DA 14 369 PRO 369 369 369 PRO PRO U . n 
DA 14 370 GLY 370 370 370 GLY GLY U . n 
DA 14 371 LEU 371 371 371 LEU LEU U . n 
DA 14 372 SER 372 372 372 SER SER U . n 
DA 14 373 GLY 373 373 373 GLY GLY U . n 
DA 14 374 PHE 374 374 374 PHE PHE U . n 
DA 14 375 PRO 375 375 375 PRO PRO U . n 
DA 14 376 GLY 376 376 376 GLY GLY U . n 
DA 14 377 GLU 377 377 377 GLU GLU U . n 
DA 14 378 PHE 378 378 378 PHE PHE U . n 
DA 14 379 LEU 379 379 379 LEU LEU U . n 
DA 14 380 THR 380 380 380 THR THR U . n 
DA 14 381 LEU 381 381 381 LEU LEU U . n 
DA 14 382 LEU 382 382 382 LEU LEU U . n 
DA 14 383 GLY 383 383 383 GLY GLY U . n 
DA 14 384 ALA 384 384 384 ALA ALA U . n 
DA 14 385 TYR 385 385 385 TYR TYR U . n 
DA 14 386 LYS 386 386 386 LYS LYS U . n 
DA 14 387 ALA 387 387 387 ALA ALA U . n 
DA 14 388 SER 388 388 388 SER SER U . n 
DA 14 389 PRO 389 389 389 PRO PRO U . n 
DA 14 390 TRP 390 390 390 TRP TRP U . n 
DA 14 391 LEU 391 391 391 LEU LEU U . n 
DA 14 392 ALA 392 392 392 ALA ALA U . n 
DA 14 393 ALA 393 393 393 ALA ALA U . n 
DA 14 394 LEU 394 394 394 LEU LEU U . n 
DA 14 395 ALA 395 395 395 ALA ALA U . n 
DA 14 396 PHE 396 396 396 PHE PHE U . n 
DA 14 397 LEU 397 397 397 LEU LEU U . n 
DA 14 398 SER 398 398 398 SER SER U . n 
DA 14 399 VAL 399 399 399 VAL VAL U . n 
DA 14 400 ILE 400 400 400 ILE ILE U . n 
DA 14 401 ALA 401 401 401 ALA ALA U . n 
DA 14 402 SER 402 402 402 SER SER U . n 
DA 14 403 ALA 403 403 403 ALA ALA U . n 
DA 14 404 ALA 404 404 404 ALA ALA U . n 
DA 14 405 TYR 405 405 405 TYR TYR U . n 
DA 14 406 ALA 406 406 406 ALA ALA U . n 
DA 14 407 LEU 407 407 407 LEU LEU U . n 
DA 14 408 THR 408 408 408 THR THR U . n 
DA 14 409 ALA 409 409 409 ALA ALA U . n 
DA 14 410 PHE 410 410 410 PHE PHE U . n 
DA 14 411 GLN 411 411 411 GLN GLN U . n 
DA 14 412 LYS 412 412 412 LYS LYS U . n 
DA 14 413 THR 413 413 413 THR THR U . n 
DA 14 414 PHE 414 414 414 PHE PHE U . n 
DA 14 415 TRP 415 415 415 TRP TRP U . n 
DA 14 416 GLU 416 416 416 GLU GLU U . n 
DA 14 417 GLU 417 417 417 GLU GLU U . n 
DA 14 418 GLY 418 418 418 GLY GLY U . n 
DA 14 419 GLY 419 419 419 GLY GLY U . n 
DA 14 420 SER 420 420 420 SER SER U . n 
DA 14 421 GLY 421 421 421 GLY GLY U . n 
DA 14 422 VAL 422 422 422 VAL VAL U . n 
DA 14 423 LYS 423 423 423 LYS LYS U . n 
DA 14 424 ASP 424 424 424 ASP ASP U . n 
DA 14 425 LEU 425 425 425 LEU LEU U . n 
DA 14 426 ALA 426 426 426 ALA ALA U . n 
DA 14 427 GLY 427 427 427 GLY GLY U . n 
DA 14 428 ALA 428 428 428 ALA ALA U . n 
DA 14 429 GLU 429 429 429 GLU GLU U . n 
DA 14 430 TRP 430 430 430 TRP TRP U . n 
DA 14 431 GLY 431 431 431 GLY GLY U . n 
DA 14 432 PHE 432 432 432 PHE PHE U . n 
DA 14 433 ALA 433 433 433 ALA ALA U . n 
DA 14 434 LEU 434 434 434 LEU LEU U . n 
DA 14 435 LEU 435 435 435 LEU LEU U . n 
DA 14 436 SER 436 436 436 SER SER U . n 
DA 14 437 VAL 437 437 437 VAL VAL U . n 
DA 14 438 LEU 438 438 438 LEU LEU U . n 
DA 14 439 ALA 439 439 439 ALA ALA U . n 
DA 14 440 LEU 440 440 440 LEU LEU U . n 
DA 14 441 LEU 441 441 441 LEU LEU U . n 
DA 14 442 LEU 442 442 442 LEU LEU U . n 
DA 14 443 MET 443 443 443 MET MET U . n 
DA 14 444 GLY 444 444 444 GLY GLY U . n 
DA 14 445 VAL 445 445 445 VAL VAL U . n 
DA 14 446 PHE 446 446 446 PHE PHE U . n 
DA 14 447 PRO 447 447 447 PRO PRO U . n 
DA 14 448 GLY 448 448 448 GLY GLY U . n 
DA 14 449 TYR 449 449 449 TYR TYR U . n 
DA 14 450 PHE 450 450 450 PHE PHE U . n 
DA 14 451 ALA 451 451 451 ALA ALA U . n 
DA 14 452 ARG 452 452 452 ARG ARG U . n 
DA 14 453 GLY 453 453 453 GLY GLY U . n 
DA 14 454 LEU 454 454 454 LEU LEU U . n 
DA 14 455 HIS 455 455 455 HIS HIS U . n 
DA 14 456 PRO 456 456 456 PRO PRO U . n 
DA 14 457 LEU 457 457 457 LEU LEU U . n 
DA 14 458 ALA 458 458 458 ALA ALA U . n 
DA 14 459 GLU 459 459 459 GLU GLU U . n 
DA 14 460 ALA 460 460 460 ALA ALA U . n 
DA 14 461 PHE 461 461 461 PHE PHE U . n 
DA 14 462 ALA 462 462 462 ALA ALA U . n 
DA 14 463 LYS 463 463 463 LYS LYS U . n 
DA 14 464 LEU 464 464 464 LEU LEU U . n 
DA 14 465 LEU 465 465 465 LEU LEU U . n 
DA 14 466 GLY 466 466 466 GLY GLY U . n 
DA 14 467 GLY 467 467 467 GLY GLY U . n 
DA 14 468 GLY 468 468 ?   ?   ?   U . n 
DA 14 469 ALA 469 469 ?   ?   ?   U . n 
EA 15 1   MET 1   1   1   MET MET V . n 
EA 15 2   THR 2   2   2   THR THR V . n 
EA 15 3   LEU 3   3   3   LEU LEU V . n 
EA 15 4   ALA 4   4   4   ALA ALA V . n 
EA 15 5   ILE 5   5   5   ILE ILE V . n 
EA 15 6   LEU 6   6   6   LEU LEU V . n 
EA 15 7   ALA 7   7   7   ALA ALA V . n 
EA 15 8   VAL 8   8   8   VAL VAL V . n 
EA 15 9   PHE 9   9   9   PHE PHE V . n 
EA 15 10  SER 10  10  10  SER SER V . n 
EA 15 11  VAL 11  11  11  VAL VAL V . n 
EA 15 12  ALA 12  12  12  ALA ALA V . n 
EA 15 13  LEU 13  13  13  LEU LEU V . n 
EA 15 14  THR 14  14  14  THR THR V . n 
EA 15 15  LEU 15  15  15  LEU LEU V . n 
EA 15 16  LEU 16  16  16  LEU LEU V . n 
EA 15 17  GLY 17  17  17  GLY GLY V . n 
EA 15 18  PHE 18  18  18  PHE PHE V . n 
EA 15 19  VAL 19  19  19  VAL VAL V . n 
EA 15 20  LEU 20  20  20  LEU LEU V . n 
EA 15 21  PRO 21  21  21  PRO PRO V . n 
EA 15 22  PRO 22  22  22  PRO PRO V . n 
EA 15 23  GLN 23  23  23  GLN GLN V . n 
EA 15 24  GLY 24  24  24  GLY GLY V . n 
EA 15 25  VAL 25  25  25  VAL VAL V . n 
EA 15 26  LYS 26  26  26  LYS LYS V . n 
EA 15 27  ARG 27  27  27  ARG ARG V . n 
EA 15 28  ALA 28  28  28  ALA ALA V . n 
EA 15 29  THR 29  29  29  THR THR V . n 
EA 15 30  LEU 30  30  30  LEU LEU V . n 
EA 15 31  LEU 31  31  31  LEU LEU V . n 
EA 15 32  GLY 32  32  32  GLY GLY V . n 
EA 15 33  LEU 33  33  33  LEU LEU V . n 
EA 15 34  ALA 34  34  34  ALA ALA V . n 
EA 15 35  LEU 35  35  35  LEU LEU V . n 
EA 15 36  ALA 36  36  36  ALA ALA V . n 
EA 15 37  LEU 37  37  37  LEU LEU V . n 
EA 15 38  ALA 38  38  38  ALA ALA V . n 
EA 15 39  SER 39  39  39  SER SER V . n 
EA 15 40  LEU 40  40  40  LEU LEU V . n 
EA 15 41  LEU 41  41  41  LEU LEU V . n 
EA 15 42  LEU 42  42  42  LEU LEU V . n 
EA 15 43  THR 43  43  43  THR THR V . n 
EA 15 44  TRP 44  44  44  TRP TRP V . n 
EA 15 45  GLY 45  45  45  GLY GLY V . n 
EA 15 46  LYS 46  46  46  LYS LYS V . n 
EA 15 47  PRO 47  47  47  PRO PRO V . n 
EA 15 48  PHE 48  48  48  PHE PHE V . n 
EA 15 49  ALA 49  49  49  ALA ALA V . n 
EA 15 50  PHE 50  50  50  PHE PHE V . n 
EA 15 51  GLY 51  51  51  GLY GLY V . n 
EA 15 52  PRO 52  52  52  PRO PRO V . n 
EA 15 53  TYR 53  53  53  TYR TYR V . n 
EA 15 54  ALA 54  54  54  ALA ALA V . n 
EA 15 55  VAL 55  55  55  VAL VAL V . n 
EA 15 56  ASP 56  56  56  ASP ASP V . n 
EA 15 57  GLY 57  57  57  GLY GLY V . n 
EA 15 58  VAL 58  58  58  VAL VAL V . n 
EA 15 59  SER 59  59  59  SER SER V . n 
EA 15 60  GLN 60  60  60  GLN GLN V . n 
EA 15 61  VAL 61  61  61  VAL VAL V . n 
EA 15 62  PHE 62  62  62  PHE PHE V . n 
EA 15 63  THR 63  63  63  THR THR V . n 
EA 15 64  LEU 64  64  64  LEU LEU V . n 
EA 15 65  LEU 65  65  65  LEU LEU V . n 
EA 15 66  ALA 66  66  66  ALA ALA V . n 
EA 15 67  LEU 67  67  67  LEU LEU V . n 
EA 15 68  LEU 68  68  68  LEU LEU V . n 
EA 15 69  GLY 69  69  69  GLY GLY V . n 
EA 15 70  ALA 70  70  70  ALA ALA V . n 
EA 15 71  LEU 71  71  71  LEU LEU V . n 
EA 15 72  TRP 72  72  72  TRP TRP V . n 
EA 15 73  THR 73  73  73  THR THR V . n 
EA 15 74  VAL 74  74  74  VAL VAL V . n 
EA 15 75  GLY 75  75  75  GLY GLY V . n 
EA 15 76  LEU 76  76  76  LEU LEU V . n 
EA 15 77  VAL 77  77  77  VAL VAL V . n 
EA 15 78  ARG 78  78  78  ARG ARG V . n 
EA 15 79  SER 79  79  79  SER SER V . n 
EA 15 80  GLY 80  80  80  GLY GLY V . n 
EA 15 81  ARG 81  81  81  ARG ARG V . n 
EA 15 82  PHE 82  82  82  PHE PHE V . n 
EA 15 83  GLU 83  83  83  GLU GLU V . n 
EA 15 84  PHE 84  84  84  PHE PHE V . n 
EA 15 85  TYR 85  85  85  TYR TYR V . n 
EA 15 86  LEU 86  86  86  LEU LEU V . n 
EA 15 87  LEU 87  87  87  LEU LEU V . n 
EA 15 88  VAL 88  88  88  VAL VAL V . n 
EA 15 89  LEU 89  89  89  LEU LEU V . n 
EA 15 90  TYR 90  90  90  TYR TYR V . n 
EA 15 91  ALA 91  91  91  ALA ALA V . n 
EA 15 92  ALA 92  92  92  ALA ALA V . n 
EA 15 93  LEU 93  93  93  LEU LEU V . n 
EA 15 94  GLY 94  94  94  GLY GLY V . n 
EA 15 95  MET 95  95  95  MET MET V . n 
EA 15 96  HIS 96  96  96  HIS HIS V . n 
EA 15 97  LEU 97  97  97  LEU LEU V . n 
EA 15 98  LEU 98  98  98  LEU LEU V . n 
EA 15 99  ALA 99  99  99  ALA ALA V . n 
EA 15 100 SER 100 100 100 SER SER V . n 
EA 15 101 THR 101 101 101 THR THR V . n 
EA 15 102 ARG 102 102 102 ARG ARG V . n 
EA 15 103 HIS 103 103 103 HIS HIS V . n 
EA 15 104 LEU 104 104 104 LEU LEU V . n 
EA 15 105 LEU 105 105 105 LEU LEU V . n 
EA 15 106 LEU 106 106 106 LEU LEU V . n 
EA 15 107 MET 107 107 107 MET MET V . n 
EA 15 108 LEU 108 108 108 LEU LEU V . n 
EA 15 109 VAL 109 109 109 VAL VAL V . n 
EA 15 110 ALA 110 110 110 ALA ALA V . n 
EA 15 111 LEU 111 111 111 LEU LEU V . n 
EA 15 112 GLU 112 112 112 GLU GLU V . n 
EA 15 113 ALA 113 113 113 ALA ALA V . n 
EA 15 114 LEU 114 114 114 LEU LEU V . n 
EA 15 115 SER 115 115 115 SER SER V . n 
EA 15 116 LEU 116 116 116 LEU LEU V . n 
EA 15 117 PRO 117 117 117 PRO PRO V . n 
EA 15 118 LEU 118 118 118 LEU LEU V . n 
EA 15 119 TYR 119 119 119 TYR TYR V . n 
EA 15 120 ALA 120 120 120 ALA ALA V . n 
EA 15 121 LEU 121 121 121 LEU LEU V . n 
EA 15 122 ALA 122 122 122 ALA ALA V . n 
EA 15 123 THR 123 123 123 THR THR V . n 
EA 15 124 TRP 124 124 124 TRP TRP V . n 
EA 15 125 ARG 125 125 125 ARG ARG V . n 
EA 15 126 ARG 126 126 126 ARG ARG V . n 
EA 15 127 GLY 127 127 127 GLY GLY V . n 
EA 15 128 GLN 128 128 128 GLN GLN V . n 
EA 15 129 GLY 129 129 129 GLY GLY V . n 
EA 15 130 LEU 130 130 130 LEU LEU V . n 
EA 15 131 GLU 131 131 131 GLU GLU V . n 
EA 15 132 ALA 132 132 132 ALA ALA V . n 
EA 15 133 ALA 133 133 133 ALA ALA V . n 
EA 15 134 LEU 134 134 134 LEU LEU V . n 
EA 15 135 LYS 135 135 135 LYS LYS V . n 
EA 15 136 TYR 136 136 136 TYR TYR V . n 
EA 15 137 PHE 137 137 137 PHE PHE V . n 
EA 15 138 LEU 138 138 138 LEU LEU V . n 
EA 15 139 LEU 139 139 139 LEU LEU V . n 
EA 15 140 GLY 140 140 140 GLY GLY V . n 
EA 15 141 ALA 141 141 141 ALA ALA V . n 
EA 15 142 LEU 142 142 142 LEU LEU V . n 
EA 15 143 ALA 143 143 143 ALA ALA V . n 
EA 15 144 ALA 144 144 144 ALA ALA V . n 
EA 15 145 ALA 145 145 145 ALA ALA V . n 
EA 15 146 PHE 146 146 146 PHE PHE V . n 
EA 15 147 PHE 147 147 147 PHE PHE V . n 
EA 15 148 LEU 148 148 148 LEU LEU V . n 
EA 15 149 TYR 149 149 149 TYR TYR V . n 
EA 15 150 GLY 150 150 150 GLY GLY V . n 
EA 15 151 ALA 151 151 151 ALA ALA V . n 
EA 15 152 ALA 152 152 152 ALA ALA V . n 
EA 15 153 LEU 153 153 153 LEU LEU V . n 
EA 15 154 PHE 154 154 154 PHE PHE V . n 
EA 15 155 TYR 155 155 155 TYR TYR V . n 
EA 15 156 GLY 156 156 156 GLY GLY V . n 
EA 15 157 ALA 157 157 157 ALA ALA V . n 
EA 15 158 THR 158 158 158 THR THR V . n 
EA 15 159 GLY 159 159 159 GLY GLY V . n 
EA 15 160 SER 160 160 160 SER SER V . n 
EA 15 161 LEU 161 161 161 LEU LEU V . n 
EA 15 162 VAL 162 162 162 VAL VAL V . n 
EA 15 163 LEU 163 163 163 LEU LEU V . n 
EA 15 164 GLY 164 164 164 GLY GLY V . n 
EA 15 165 ALA 165 165 165 ALA ALA V . n 
EA 15 166 PRO 166 166 166 PRO PRO V . n 
EA 15 167 GLY 167 167 167 GLY GLY V . n 
EA 15 168 GLU 168 168 168 GLU GLU V . n 
EA 15 169 GLY 169 169 169 GLY GLY V . n 
EA 15 170 PRO 170 170 170 PRO PRO V . n 
EA 15 171 LEU 171 171 171 LEU LEU V . n 
EA 15 172 TYR 172 172 172 TYR TYR V . n 
EA 15 173 ALA 173 173 173 ALA ALA V . n 
EA 15 174 LEU 174 174 174 LEU LEU V . n 
EA 15 175 ALA 175 175 175 ALA ALA V . n 
EA 15 176 LEU 176 176 176 LEU LEU V . n 
EA 15 177 GLY 177 177 177 GLY GLY V . n 
EA 15 178 LEU 178 178 178 LEU LEU V . n 
EA 15 179 LEU 179 179 179 LEU LEU V . n 
EA 15 180 LEU 180 180 180 LEU LEU V . n 
EA 15 181 VAL 181 181 181 VAL VAL V . n 
EA 15 182 GLY 182 182 182 GLY GLY V . n 
EA 15 183 LEU 183 183 183 LEU LEU V . n 
EA 15 184 GLY 184 184 184 GLY GLY V . n 
EA 15 185 PHE 185 185 185 PHE PHE V . n 
EA 15 186 LYS 186 186 186 LYS LYS V . n 
EA 15 187 ALA 187 187 187 ALA ALA V . n 
EA 15 188 ALA 188 188 188 ALA ALA V . n 
EA 15 189 LEU 189 189 189 LEU LEU V . n 
EA 15 190 ALA 190 190 190 ALA ALA V . n 
EA 15 191 PRO 191 191 191 PRO PRO V . n 
EA 15 192 PHE 192 192 192 PHE PHE V . n 
EA 15 193 HIS 193 193 193 HIS HIS V . n 
EA 15 194 PHE 194 194 194 PHE PHE V . n 
EA 15 195 TRP 195 195 195 TRP TRP V . n 
EA 15 196 THR 196 196 196 THR THR V . n 
EA 15 197 PRO 197 197 197 PRO PRO V . n 
EA 15 198 ASP 198 198 198 ASP ASP V . n 
EA 15 199 VAL 199 199 199 VAL VAL V . n 
EA 15 200 TYR 200 200 200 TYR TYR V . n 
EA 15 201 GLN 201 201 201 GLN GLN V . n 
EA 15 202 GLY 202 202 202 GLY GLY V . n 
EA 15 203 SER 203 203 203 SER SER V . n 
EA 15 204 PRO 204 204 204 PRO PRO V . n 
EA 15 205 THR 205 205 205 THR THR V . n 
EA 15 206 PRO 206 206 206 PRO PRO V . n 
EA 15 207 VAL 207 207 207 VAL VAL V . n 
EA 15 208 VAL 208 208 208 VAL VAL V . n 
EA 15 209 LEU 209 209 209 LEU LEU V . n 
EA 15 210 PHE 210 210 210 PHE PHE V . n 
EA 15 211 MET 211 211 211 MET MET V . n 
EA 15 212 ALA 212 212 212 ALA ALA V . n 
EA 15 213 THR 213 213 213 THR THR V . n 
EA 15 214 SER 214 214 214 SER SER V . n 
EA 15 215 VAL 215 215 215 VAL VAL V . n 
EA 15 216 LYS 216 216 216 LYS LYS V . n 
EA 15 217 ALA 217 217 217 ALA ALA V . n 
EA 15 218 ALA 218 218 218 ALA ALA V . n 
EA 15 219 ALA 219 219 219 ALA ALA V . n 
EA 15 220 PHE 220 220 220 PHE PHE V . n 
EA 15 221 ALA 221 221 221 ALA ALA V . n 
EA 15 222 ALA 222 222 222 ALA ALA V . n 
EA 15 223 LEU 223 223 223 LEU LEU V . n 
EA 15 224 LEU 224 224 224 LEU LEU V . n 
EA 15 225 ARG 225 225 225 ARG ARG V . n 
EA 15 226 VAL 226 226 226 VAL VAL V . n 
EA 15 227 ALA 227 227 227 ALA ALA V . n 
EA 15 228 ALA 228 228 228 ALA ALA V . n 
EA 15 229 PRO 229 229 229 PRO PRO V . n 
EA 15 230 PRO 230 230 230 PRO PRO V . n 
EA 15 231 GLU 231 231 231 GLU GLU V . n 
EA 15 232 ALA 232 232 232 ALA ALA V . n 
EA 15 233 LEU 233 233 233 LEU LEU V . n 
EA 15 234 ALA 234 234 234 ALA ALA V . n 
EA 15 235 LEU 235 235 235 LEU LEU V . n 
EA 15 236 LEU 236 236 236 LEU LEU V . n 
EA 15 237 VAL 237 237 237 VAL VAL V . n 
EA 15 238 ALA 238 238 238 ALA ALA V . n 
EA 15 239 LEU 239 239 239 LEU LEU V . n 
EA 15 240 SER 240 240 240 SER SER V . n 
EA 15 241 VAL 241 241 241 VAL VAL V . n 
EA 15 242 VAL 242 242 242 VAL VAL V . n 
EA 15 243 VAL 243 243 243 VAL VAL V . n 
EA 15 244 GLY 244 244 244 GLY GLY V . n 
EA 15 245 ASN 245 245 245 ASN ASN V . n 
EA 15 246 LEU 246 246 246 LEU LEU V . n 
EA 15 247 ALA 247 247 247 ALA ALA V . n 
EA 15 248 ALA 248 248 248 ALA ALA V . n 
EA 15 249 LEU 249 249 249 LEU LEU V . n 
EA 15 250 ALA 250 250 250 ALA ALA V . n 
EA 15 251 GLN 251 251 251 GLN GLN V . n 
EA 15 252 LYS 252 252 252 LYS LYS V . n 
EA 15 253 GLU 253 253 253 GLU GLU V . n 
EA 15 254 ALA 254 254 254 ALA ALA V . n 
EA 15 255 LYS 255 255 255 LYS LYS V . n 
EA 15 256 ARG 256 256 256 ARG ARG V . n 
EA 15 257 LEU 257 257 257 LEU LEU V . n 
EA 15 258 LEU 258 258 258 LEU LEU V . n 
EA 15 259 ALA 259 259 259 ALA ALA V . n 
EA 15 260 TYR 260 260 260 TYR TYR V . n 
EA 15 261 SER 261 261 261 SER SER V . n 
EA 15 262 SER 262 262 262 SER SER V . n 
EA 15 263 ILE 263 263 263 ILE ILE V . n 
EA 15 264 ALA 264 264 264 ALA ALA V . n 
EA 15 265 HIS 265 265 265 HIS HIS V . n 
EA 15 266 ALA 266 266 266 ALA ALA V . n 
EA 15 267 GLY 267 267 267 GLY GLY V . n 
EA 15 268 TYR 268 268 268 TYR TYR V . n 
EA 15 269 MET 269 269 269 MET MET V . n 
EA 15 270 ALA 270 270 270 ALA ALA V . n 
EA 15 271 LEU 271 271 271 LEU LEU V . n 
EA 15 272 ALA 272 272 272 ALA ALA V . n 
EA 15 273 LEU 273 273 273 LEU LEU V . n 
EA 15 274 TYR 274 274 274 TYR TYR V . n 
EA 15 275 THR 275 275 275 THR THR V . n 
EA 15 276 GLY 276 276 276 GLY GLY V . n 
EA 15 277 ASN 277 277 277 ASN ASN V . n 
EA 15 278 ALA 278 278 278 ALA ALA V . n 
EA 15 279 GLN 279 279 279 GLN GLN V . n 
EA 15 280 ALA 280 280 280 ALA ALA V . n 
EA 15 281 LEU 281 281 281 LEU LEU V . n 
EA 15 282 GLY 282 282 282 GLY GLY V . n 
EA 15 283 PHE 283 283 283 PHE PHE V . n 
EA 15 284 TYR 284 284 284 TYR TYR V . n 
EA 15 285 LEU 285 285 285 LEU LEU V . n 
EA 15 286 LEU 286 286 286 LEU LEU V . n 
EA 15 287 THR 287 287 287 THR THR V . n 
EA 15 288 TYR 288 288 288 TYR TYR V . n 
EA 15 289 VAL 289 289 289 VAL VAL V . n 
EA 15 290 LEU 290 290 290 LEU LEU V . n 
EA 15 291 ALA 291 291 291 ALA ALA V . n 
EA 15 292 THR 292 292 292 THR THR V . n 
EA 15 293 GLY 293 293 293 GLY GLY V . n 
EA 15 294 LEU 294 294 294 LEU LEU V . n 
EA 15 295 ALA 295 295 295 ALA ALA V . n 
EA 15 296 PHE 296 296 296 PHE PHE V . n 
EA 15 297 ALA 297 297 297 ALA ALA V . n 
EA 15 298 VAL 298 298 298 VAL VAL V . n 
EA 15 299 LEU 299 299 299 LEU LEU V . n 
EA 15 300 SER 300 300 300 SER SER V . n 
EA 15 301 GLN 301 301 301 GLN GLN V . n 
EA 15 302 ILE 302 302 302 ILE ILE V . n 
EA 15 303 SER 303 303 303 SER SER V . n 
EA 15 304 PRO 304 304 304 PRO PRO V . n 
EA 15 305 ASP 305 305 305 ASP ASP V . n 
EA 15 306 ARG 306 306 306 ARG ARG V . n 
EA 15 307 VAL 307 307 307 VAL VAL V . n 
EA 15 308 PRO 308 308 308 PRO PRO V . n 
EA 15 309 LEU 309 309 309 LEU LEU V . n 
EA 15 310 GLU 310 310 310 GLU GLU V . n 
EA 15 311 ALA 311 311 311 ALA ALA V . n 
EA 15 312 LEU 312 312 312 LEU LEU V . n 
EA 15 313 ARG 313 313 313 ARG ARG V . n 
EA 15 314 GLY 314 314 314 GLY GLY V . n 
EA 15 315 LEU 315 315 315 LEU LEU V . n 
EA 15 316 TYR 316 316 316 TYR TYR V . n 
EA 15 317 ARG 317 317 317 ARG ARG V . n 
EA 15 318 LYS 318 318 318 LYS LYS V . n 
EA 15 319 ASP 319 319 319 ASP ASP V . n 
EA 15 320 PRO 320 320 320 PRO PRO V . n 
EA 15 321 LEU 321 321 321 LEU LEU V . n 
EA 15 322 LEU 322 322 322 LEU LEU V . n 
EA 15 323 GLY 323 323 323 GLY GLY V . n 
EA 15 324 LEU 324 324 324 LEU LEU V . n 
EA 15 325 ALA 325 325 325 ALA ALA V . n 
EA 15 326 PHE 326 326 326 PHE PHE V . n 
EA 15 327 LEU 327 327 327 LEU LEU V . n 
EA 15 328 VAL 328 328 328 VAL VAL V . n 
EA 15 329 ALA 329 329 329 ALA ALA V . n 
EA 15 330 MET 330 330 330 MET MET V . n 
EA 15 331 LEU 331 331 331 LEU LEU V . n 
EA 15 332 SER 332 332 332 SER SER V . n 
EA 15 333 LEU 333 333 333 LEU LEU V . n 
EA 15 334 LEU 334 334 334 LEU LEU V . n 
EA 15 335 GLY 335 335 335 GLY GLY V . n 
EA 15 336 LEU 336 336 336 LEU LEU V . n 
EA 15 337 PRO 337 337 337 PRO PRO V . n 
EA 15 338 PRO 338 338 338 PRO PRO V . n 
EA 15 339 LEU 339 339 339 LEU LEU V . n 
EA 15 340 ALA 340 340 340 ALA ALA V . n 
EA 15 341 GLY 341 341 341 GLY GLY V . n 
EA 15 342 PHE 342 342 342 PHE PHE V . n 
EA 15 343 TRP 343 343 343 TRP TRP V . n 
EA 15 344 GLY 344 344 344 GLY GLY V . n 
EA 15 345 LYS 345 345 345 LYS LYS V . n 
EA 15 346 TYR 346 346 346 TYR TYR V . n 
EA 15 347 LEU 347 347 347 LEU LEU V . n 
EA 15 348 ALA 348 348 348 ALA ALA V . n 
EA 15 349 PHE 349 349 349 PHE PHE V . n 
EA 15 350 ALA 350 350 350 ALA ALA V . n 
EA 15 351 GLU 351 351 351 GLU GLU V . n 
EA 15 352 ALA 352 352 352 ALA ALA V . n 
EA 15 353 ALA 353 353 353 ALA ALA V . n 
EA 15 354 ARG 354 354 354 ARG ARG V . n 
EA 15 355 ALA 355 355 355 ALA ALA V . n 
EA 15 356 GLY 356 356 356 GLY GLY V . n 
EA 15 357 ALA 357 357 357 ALA ALA V . n 
EA 15 358 TRP 358 358 358 TRP TRP V . n 
EA 15 359 GLY 359 359 359 GLY GLY V . n 
EA 15 360 VAL 360 360 360 VAL VAL V . n 
EA 15 361 LEU 361 361 361 LEU LEU V . n 
EA 15 362 VAL 362 362 362 VAL VAL V . n 
EA 15 363 LEU 363 363 363 LEU LEU V . n 
EA 15 364 ALA 364 364 364 ALA ALA V . n 
EA 15 365 LEU 365 365 365 LEU LEU V . n 
EA 15 366 VAL 366 366 366 VAL VAL V . n 
EA 15 367 THR 367 367 367 THR THR V . n 
EA 15 368 SER 368 368 368 SER SER V . n 
EA 15 369 ALA 369 369 369 ALA ALA V . n 
EA 15 370 VAL 370 370 370 VAL VAL V . n 
EA 15 371 SER 371 371 371 SER SER V . n 
EA 15 372 ALA 372 372 372 ALA ALA V . n 
EA 15 373 TYR 373 373 373 TYR TYR V . n 
EA 15 374 TYR 374 374 374 TYR TYR V . n 
EA 15 375 TYR 375 375 375 TYR TYR V . n 
EA 15 376 LEU 376 376 376 LEU LEU V . n 
EA 15 377 GLY 377 377 377 GLY GLY V . n 
EA 15 378 LEU 378 378 378 LEU LEU V . n 
EA 15 379 GLY 379 379 379 GLY GLY V . n 
EA 15 380 LEU 380 380 380 LEU LEU V . n 
EA 15 381 ALA 381 381 381 ALA ALA V . n 
EA 15 382 VAL 382 382 382 VAL VAL V . n 
EA 15 383 PHE 383 383 383 PHE PHE V . n 
EA 15 384 ALA 384 384 384 ALA ALA V . n 
EA 15 385 ARG 385 385 385 ARG ARG V . n 
EA 15 386 PRO 386 386 386 PRO PRO V . n 
EA 15 387 GLU 387 387 387 GLU GLU V . n 
EA 15 388 GLU 388 388 388 GLU GLU V . n 
EA 15 389 THR 389 389 389 THR THR V . n 
EA 15 390 PRO 390 390 390 PRO PRO V . n 
EA 15 391 PHE 391 391 391 PHE PHE V . n 
EA 15 392 ARG 392 392 392 ARG ARG V . n 
EA 15 393 PRO 393 393 393 PRO PRO V . n 
EA 15 394 GLY 394 394 394 GLY GLY V . n 
EA 15 395 PRO 395 395 395 PRO PRO V . n 
EA 15 396 PRO 396 396 396 PRO PRO V . n 
EA 15 397 TRP 397 397 397 TRP TRP V . n 
EA 15 398 ALA 398 398 398 ALA ALA V . n 
EA 15 399 ARG 399 399 399 ARG ARG V . n 
EA 15 400 ALA 400 400 400 ALA ALA V . n 
EA 15 401 ALA 401 401 401 ALA ALA V . n 
EA 15 402 VAL 402 402 402 VAL VAL V . n 
EA 15 403 VAL 403 403 403 VAL VAL V . n 
EA 15 404 ALA 404 404 404 ALA ALA V . n 
EA 15 405 ALA 405 405 405 ALA ALA V . n 
EA 15 406 GLY 406 406 406 GLY GLY V . n 
EA 15 407 VAL 407 407 407 VAL VAL V . n 
EA 15 408 LEU 408 408 408 LEU LEU V . n 
EA 15 409 LEU 409 409 409 LEU LEU V . n 
EA 15 410 LEU 410 410 410 LEU LEU V . n 
EA 15 411 ALA 411 411 411 ALA ALA V . n 
EA 15 412 LEU 412 412 412 LEU LEU V . n 
EA 15 413 GLY 413 413 413 GLY GLY V . n 
EA 15 414 LEU 414 414 414 LEU LEU V . n 
EA 15 415 LEU 415 415 415 LEU LEU V . n 
EA 15 416 PRO 416 416 416 PRO PRO V . n 
EA 15 417 GLY 417 417 417 GLY GLY V . n 
EA 15 418 LEU 418 418 418 LEU LEU V . n 
EA 15 419 VAL 419 419 419 VAL VAL V . n 
EA 15 420 LEU 420 420 420 LEU LEU V . n 
EA 15 421 PRO 421 421 421 PRO PRO V . n 
EA 15 422 ALA 422 422 422 ALA ALA V . n 
EA 15 423 LEU 423 423 423 LEU LEU V . n 
EA 15 424 ALA 424 424 424 ALA ALA V . n 
EA 15 425 ALA 425 425 425 ALA ALA V . n 
EA 15 426 GLY 426 426 426 GLY GLY V . n 
EA 15 427 GLY 427 427 427 GLY GLY V . n 
FA 16 1   MET 1   1   ?   ?   ?   Q . n 
FA 16 2   THR 2   2   2   THR THR Q . n 
FA 16 3   TRP 3   3   3   TRP TRP Q . n 
FA 16 4   SER 4   4   4   SER SER Q . n 
FA 16 5   TYR 5   5   5   TYR TYR Q . n 
FA 16 6   PRO 6   6   6   PRO PRO Q . n 
FA 16 7   VAL 7   7   7   VAL VAL Q . n 
FA 16 8   ASP 8   8   8   ASP ASP Q . n 
FA 16 9   PRO 9   9   9   PRO PRO Q . n 
FA 16 10  TYR 10  10  10  TYR TYR Q . n 
FA 16 11  TRP 11  11  11  TRP TRP Q . n 
FA 16 12  MET 12  12  12  MET MET Q . n 
FA 16 13  VAL 13  13  13  VAL VAL Q . n 
FA 16 14  ALA 14  14  14  ALA ALA Q . n 
FA 16 15  LEU 15  15  15  LEU LEU Q . n 
FA 16 16  LYS 16  16  16  LYS LYS Q . n 
FA 16 17  ALA 17  17  17  ALA ALA Q . n 
FA 16 18  LEU 18  18  18  LEU LEU Q . n 
FA 16 19  LEU 19  19  19  LEU LEU Q . n 
FA 16 20  VAL 20  20  20  VAL VAL Q . n 
FA 16 21  VAL 21  21  21  VAL VAL Q . n 
FA 16 22  VAL 22  22  22  VAL VAL Q . n 
FA 16 23  GLY 23  23  23  GLY GLY Q . n 
FA 16 24  LEU 24  24  24  LEU LEU Q . n 
FA 16 25  LEU 25  25  25  LEU LEU Q . n 
FA 16 26  THR 26  26  26  THR THR Q . n 
FA 16 27  ALA 27  27  27  ALA ALA Q . n 
FA 16 28  PHE 28  28  28  PHE PHE Q . n 
FA 16 29  ALA 29  29  29  ALA ALA Q . n 
FA 16 30  PHE 30  30  30  PHE PHE Q . n 
FA 16 31  MET 31  31  31  MET MET Q . n 
FA 16 32  THR 32  32  32  THR THR Q . n 
FA 16 33  LEU 33  33  33  LEU LEU Q . n 
FA 16 34  ILE 34  34  34  ILE ILE Q . n 
FA 16 35  GLU 35  35  35  GLU GLU Q . n 
FA 16 36  ARG 36  36  36  ARG ARG Q . n 
FA 16 37  ARG 37  37  37  ARG ARG Q . n 
FA 16 38  LEU 38  38  38  LEU LEU Q . n 
FA 16 39  LEU 39  39  39  LEU LEU Q . n 
FA 16 40  ALA 40  40  40  ALA ALA Q . n 
FA 16 41  ARG 41  41  41  ARG ARG Q . n 
FA 16 42  PHE 42  42  42  PHE PHE Q . n 
FA 16 43  GLN 43  43  43  GLN GLN Q . n 
FA 16 44  VAL 44  44  44  VAL VAL Q . n 
FA 16 45  ARG 45  45  45  ARG ARG Q . n 
FA 16 46  MET 46  46  46  MET MET Q . n 
FA 16 47  GLY 47  47  47  GLY GLY Q . n 
FA 16 48  PRO 48  48  48  PRO PRO Q . n 
FA 16 49  ASN 49  49  49  ASN ASN Q . n 
FA 16 50  ARG 50  50  50  ARG ARG Q . n 
FA 16 51  VAL 51  51  51  VAL VAL Q . n 
FA 16 52  GLY 52  52  52  GLY GLY Q . n 
FA 16 53  PRO 53  53  53  PRO PRO Q . n 
FA 16 54  PHE 54  54  54  PHE PHE Q . n 
FA 16 55  GLY 55  55  55  GLY GLY Q . n 
FA 16 56  LEU 56  56  56  LEU LEU Q . n 
FA 16 57  LEU 57  57  57  LEU LEU Q . n 
FA 16 58  GLN 58  58  58  GLN GLN Q . n 
FA 16 59  PRO 59  59  59  PRO PRO Q . n 
FA 16 60  LEU 60  60  60  LEU LEU Q . n 
FA 16 61  ALA 61  61  61  ALA ALA Q . n 
FA 16 62  ASP 62  62  62  ASP ASP Q . n 
FA 16 63  ALA 63  63  63  ALA ALA Q . n 
FA 16 64  ILE 64  64  64  ILE ILE Q . n 
FA 16 65  LYS 65  65  65  LYS LYS Q . n 
FA 16 66  SER 66  66  66  SER SER Q . n 
FA 16 67  ILE 67  67  67  ILE ILE Q . n 
FA 16 68  PHE 68  68  68  PHE PHE Q . n 
FA 16 69  LYS 69  69  69  LYS LYS Q . n 
FA 16 70  GLU 70  70  70  GLU GLU Q . n 
FA 16 71  ASP 71  71  71  ASP ASP Q . n 
FA 16 72  ILE 72  72  72  ILE ILE Q . n 
FA 16 73  VAL 73  73  73  VAL VAL Q . n 
FA 16 74  VAL 74  74  74  VAL VAL Q . n 
FA 16 75  ALA 75  75  75  ALA ALA Q . n 
FA 16 76  GLN 76  76  76  GLN GLN Q . n 
FA 16 77  ALA 77  77  77  ALA ALA Q . n 
FA 16 78  ASP 78  78  78  ASP ASP Q . n 
FA 16 79  ARG 79  79  79  ARG ARG Q . n 
FA 16 80  PHE 80  80  80  PHE PHE Q . n 
FA 16 81  LEU 81  81  81  LEU LEU Q . n 
FA 16 82  PHE 82  82  82  PHE PHE Q . n 
FA 16 83  VAL 83  83  83  VAL VAL Q . n 
FA 16 84  LEU 84  84  84  LEU LEU Q . n 
FA 16 85  ALA 85  85  85  ALA ALA Q . n 
FA 16 86  PRO 86  86  86  PRO PRO Q . n 
FA 16 87  LEU 87  87  87  LEU LEU Q . n 
FA 16 88  ILE 88  88  88  ILE ILE Q . n 
FA 16 89  SER 89  89  89  SER SER Q . n 
FA 16 90  VAL 90  90  90  VAL VAL Q . n 
FA 16 91  VAL 91  91  91  VAL VAL Q . n 
FA 16 92  PHE 92  92  92  PHE PHE Q . n 
FA 16 93  ALA 93  93  93  ALA ALA Q . n 
FA 16 94  LEU 94  94  94  LEU LEU Q . n 
FA 16 95  LEU 95  95  95  LEU LEU Q . n 
FA 16 96  ALA 96  96  96  ALA ALA Q . n 
FA 16 97  PHE 97  97  97  PHE PHE Q . n 
FA 16 98  GLY 98  98  98  GLY GLY Q . n 
FA 16 99  LEU 99  99  99  LEU LEU Q . n 
FA 16 100 ILE 100 100 100 ILE ILE Q . n 
FA 16 101 PRO 101 101 101 PRO PRO Q . n 
FA 16 102 PHE 102 102 102 PHE PHE Q . n 
FA 16 103 GLY 103 103 103 GLY GLY Q . n 
FA 16 104 PRO 104 104 104 PRO PRO Q . n 
FA 16 105 PRO 105 105 105 PRO PRO Q . n 
FA 16 106 GLY 106 106 106 GLY GLY Q . n 
FA 16 107 SER 107 107 107 SER SER Q . n 
FA 16 108 PHE 108 108 108 PHE PHE Q . n 
FA 16 109 PHE 109 109 109 PHE PHE Q . n 
FA 16 110 GLY 110 110 110 GLY GLY Q . n 
FA 16 111 TYR 111 111 111 TYR TYR Q . n 
FA 16 112 GLN 112 112 112 GLN GLN Q . n 
FA 16 113 PRO 113 113 113 PRO PRO Q . n 
FA 16 114 TRP 114 114 114 TRP TRP Q . n 
FA 16 115 VAL 115 115 115 VAL VAL Q . n 
FA 16 116 ILE 116 116 116 ILE ILE Q . n 
FA 16 117 ASN 117 117 117 ASN ASN Q . n 
FA 16 118 LEU 118 118 118 LEU LEU Q . n 
FA 16 119 ASP 119 119 119 ASP ASP Q . n 
FA 16 120 LEU 120 120 120 LEU LEU Q . n 
FA 16 121 GLY 121 121 121 GLY GLY Q . n 
FA 16 122 ILE 122 122 122 ILE ILE Q . n 
FA 16 123 LEU 123 123 123 LEU LEU Q . n 
FA 16 124 TYR 124 124 124 TYR TYR Q . n 
FA 16 125 LEU 125 125 125 LEU LEU Q . n 
FA 16 126 PHE 126 126 126 PHE PHE Q . n 
FA 16 127 ALA 127 127 127 ALA ALA Q . n 
FA 16 128 VAL 128 128 128 VAL VAL Q . n 
FA 16 129 SER 129 129 129 SER SER Q . n 
FA 16 130 GLU 130 130 130 GLU GLU Q . n 
FA 16 131 LEU 131 131 131 LEU LEU Q . n 
FA 16 132 ALA 132 132 132 ALA ALA Q . n 
FA 16 133 VAL 133 133 133 VAL VAL Q . n 
FA 16 134 TYR 134 134 134 TYR TYR Q . n 
FA 16 135 GLY 135 135 135 GLY GLY Q . n 
FA 16 136 ILE 136 136 136 ILE ILE Q . n 
FA 16 137 PHE 137 137 137 PHE PHE Q . n 
FA 16 138 LEU 138 138 138 LEU LEU Q . n 
FA 16 139 SER 139 139 139 SER SER Q . n 
FA 16 140 GLY 140 140 140 GLY GLY Q . n 
FA 16 141 TRP 141 141 141 TRP TRP Q . n 
FA 16 142 ALA 142 142 142 ALA ALA Q . n 
FA 16 143 SER 143 143 143 SER SER Q . n 
FA 16 144 GLY 144 144 144 GLY GLY Q . n 
FA 16 145 SER 145 145 145 SER SER Q . n 
FA 16 146 LYS 146 146 146 LYS LYS Q . n 
FA 16 147 TYR 147 147 147 TYR TYR Q . n 
FA 16 148 SER 148 148 148 SER SER Q . n 
FA 16 149 LEU 149 149 149 LEU LEU Q . n 
FA 16 150 LEU 150 150 150 LEU LEU Q . n 
FA 16 151 GLY 151 151 151 GLY GLY Q . n 
FA 16 152 SER 152 152 152 SER SER Q . n 
FA 16 153 LEU 153 153 153 LEU LEU Q . n 
FA 16 154 ARG 154 154 154 ARG ARG Q . n 
FA 16 155 SER 155 155 155 SER SER Q . n 
FA 16 156 SER 156 156 156 SER SER Q . n 
FA 16 157 ALA 157 157 157 ALA ALA Q . n 
FA 16 158 SER 158 158 158 SER SER Q . n 
FA 16 159 LEU 159 159 159 LEU LEU Q . n 
FA 16 160 ILE 160 160 160 ILE ILE Q . n 
FA 16 161 SER 161 161 161 SER SER Q . n 
FA 16 162 TYR 162 162 162 TYR TYR Q . n 
FA 16 163 GLU 163 163 163 GLU GLU Q . n 
FA 16 164 LEU 164 164 164 LEU LEU Q . n 
FA 16 165 GLY 165 165 165 GLY GLY Q . n 
FA 16 166 LEU 166 166 166 LEU LEU Q . n 
FA 16 167 GLY 167 167 167 GLY GLY Q . n 
FA 16 168 LEU 168 168 168 LEU LEU Q . n 
FA 16 169 ALA 169 169 169 ALA ALA Q . n 
FA 16 170 LEU 170 170 170 LEU LEU Q . n 
FA 16 171 LEU 171 171 171 LEU LEU Q . n 
FA 16 172 ALA 172 172 172 ALA ALA Q . n 
FA 16 173 PRO 173 173 173 PRO PRO Q . n 
FA 16 174 VAL 174 174 174 VAL VAL Q . n 
FA 16 175 LEU 175 175 175 LEU LEU Q . n 
FA 16 176 LEU 176 176 176 LEU LEU Q . n 
FA 16 177 VAL 177 177 177 VAL VAL Q . n 
FA 16 178 GLY 178 178 178 GLY GLY Q . n 
FA 16 179 SER 179 179 179 SER SER Q . n 
FA 16 180 LEU 180 180 180 LEU LEU Q . n 
FA 16 181 ASN 181 181 181 ASN ASN Q . n 
FA 16 182 LEU 182 182 182 LEU LEU Q . n 
FA 16 183 ASN 183 183 183 ASN ASN Q . n 
FA 16 184 ASP 184 184 184 ASP ASP Q . n 
FA 16 185 ILE 185 185 185 ILE ILE Q . n 
FA 16 186 VAL 186 186 186 VAL VAL Q . n 
FA 16 187 ASN 187 187 187 ASN ASN Q . n 
FA 16 188 TRP 188 188 188 TRP TRP Q . n 
FA 16 189 GLN 189 189 189 GLN GLN Q . n 
FA 16 190 LYS 190 190 190 LYS LYS Q . n 
FA 16 191 GLU 191 191 191 GLU GLU Q . n 
FA 16 192 HIS 192 192 192 HIS HIS Q . n 
FA 16 193 GLY 193 193 193 GLY GLY Q . n 
FA 16 194 TRP 194 194 194 TRP TRP Q . n 
FA 16 195 LEU 195 195 195 LEU LEU Q . n 
FA 16 196 PHE 196 196 196 PHE PHE Q . n 
FA 16 197 LEU 197 197 197 LEU LEU Q . n 
FA 16 198 TYR 198 198 198 TYR TYR Q . n 
FA 16 199 ALA 199 199 199 ALA ALA Q . n 
FA 16 200 PHE 200 200 200 PHE PHE Q . n 
FA 16 201 PRO 201 201 201 PRO PRO Q . n 
FA 16 202 ALA 202 202 202 ALA ALA Q . n 
FA 16 203 PHE 203 203 203 PHE PHE Q . n 
FA 16 204 LEU 204 204 204 LEU LEU Q . n 
FA 16 205 VAL 205 205 205 VAL VAL Q . n 
FA 16 206 TYR 206 206 206 TYR TYR Q . n 
FA 16 207 LEU 207 207 207 LEU LEU Q . n 
FA 16 208 ILE 208 208 208 ILE ILE Q . n 
FA 16 209 ALA 209 209 209 ALA ALA Q . n 
FA 16 210 SER 210 210 210 SER SER Q . n 
FA 16 211 MET 211 211 211 MET MET Q . n 
FA 16 212 ALA 212 212 212 ALA ALA Q . n 
FA 16 213 GLU 213 213 213 GLU GLU Q . n 
FA 16 214 ALA 214 214 214 ALA ALA Q . n 
FA 16 215 ALA 215 215 215 ALA ALA Q . n 
FA 16 216 ARG 216 216 216 ARG ARG Q . n 
FA 16 217 THR 217 217 217 THR THR Q . n 
FA 16 218 PRO 218 218 218 PRO PRO Q . n 
FA 16 219 PHE 219 219 219 PHE PHE Q . n 
FA 16 220 ASP 220 220 220 ASP ASP Q . n 
FA 16 221 LEU 221 221 221 LEU LEU Q . n 
FA 16 222 PRO 222 222 222 PRO PRO Q . n 
FA 16 223 GLU 223 223 223 GLU GLU Q . n 
FA 16 224 ALA 224 224 224 ALA ALA Q . n 
FA 16 225 GLU 225 225 225 GLU GLU Q . n 
FA 16 226 GLN 226 226 226 GLN GLN Q . n 
FA 16 227 GLU 227 227 227 GLU GLU Q . n 
FA 16 228 LEU 228 228 228 LEU LEU Q . n 
FA 16 229 VAL 229 229 229 VAL VAL Q . n 
FA 16 230 GLY 230 230 230 GLY GLY Q . n 
FA 16 231 GLY 231 231 231 GLY GLY Q . n 
FA 16 232 TYR 232 232 232 TYR TYR Q . n 
FA 16 233 HIS 233 233 233 HIS HIS Q . n 
FA 16 234 THR 234 234 234 THR THR Q . n 
FA 16 235 GLU 235 235 235 GLU GLU Q . n 
FA 16 236 TYR 236 236 236 TYR TYR Q . n 
FA 16 237 SER 237 237 237 SER SER Q . n 
FA 16 238 SER 238 238 238 SER SER Q . n 
FA 16 239 ILE 239 239 239 ILE ILE Q . n 
FA 16 240 LYS 240 240 240 LYS LYS Q . n 
FA 16 241 TRP 241 241 241 TRP TRP Q . n 
FA 16 242 ALA 242 242 242 ALA ALA Q . n 
FA 16 243 LEU 243 243 243 LEU LEU Q . n 
FA 16 244 PHE 244 244 244 PHE PHE Q . n 
FA 16 245 GLN 245 245 245 GLN GLN Q . n 
FA 16 246 MET 246 246 246 MET MET Q . n 
FA 16 247 ALA 247 247 247 ALA ALA Q . n 
FA 16 248 GLU 248 248 248 GLU GLU Q . n 
FA 16 249 TYR 249 249 249 TYR TYR Q . n 
FA 16 250 ILE 250 250 250 ILE ILE Q . n 
FA 16 251 HIS 251 251 251 HIS HIS Q . n 
FA 16 252 PHE 252 252 252 PHE PHE Q . n 
FA 16 253 ILE 253 253 253 ILE ILE Q . n 
FA 16 254 THR 254 254 254 THR THR Q . n 
FA 16 255 ALA 255 255 255 ALA ALA Q . n 
FA 16 256 SER 256 256 256 SER SER Q . n 
FA 16 257 ALA 257 257 257 ALA ALA Q . n 
FA 16 258 LEU 258 258 258 LEU LEU Q . n 
FA 16 259 ILE 259 259 259 ILE ILE Q . n 
FA 16 260 PRO 260 260 260 PRO PRO Q . n 
FA 16 261 THR 261 261 261 THR THR Q . n 
FA 16 262 LEU 262 262 262 LEU LEU Q . n 
FA 16 263 PHE 263 263 263 PHE PHE Q . n 
FA 16 264 LEU 264 264 264 LEU LEU Q . n 
FA 16 265 GLY 265 265 265 GLY GLY Q . n 
FA 16 266 GLY 266 266 266 GLY GLY Q . n 
FA 16 267 TRP 267 267 267 TRP TRP Q . n 
FA 16 268 THR 268 268 268 THR THR Q . n 
FA 16 269 MET 269 269 269 MET MET Q . n 
FA 16 270 PRO 270 270 270 PRO PRO Q . n 
FA 16 271 VAL 271 271 271 VAL VAL Q . n 
FA 16 272 LEU 272 272 272 LEU LEU Q . n 
FA 16 273 GLU 273 273 273 GLU GLU Q . n 
FA 16 274 VAL 274 274 274 VAL VAL Q . n 
FA 16 275 PRO 275 275 275 PRO PRO Q . n 
FA 16 276 TYR 276 276 276 TYR TYR Q . n 
FA 16 277 LEU 277 277 277 LEU LEU Q . n 
FA 16 278 TRP 278 278 278 TRP TRP Q . n 
FA 16 279 MET 279 279 279 MET MET Q . n 
FA 16 280 PHE 280 280 280 PHE PHE Q . n 
FA 16 281 LEU 281 281 281 LEU LEU Q . n 
FA 16 282 LYS 282 282 282 LYS LYS Q . n 
FA 16 283 ILE 283 283 283 ILE ILE Q . n 
FA 16 284 ALA 284 284 284 ALA ALA Q . n 
FA 16 285 PHE 285 285 285 PHE PHE Q . n 
FA 16 286 PHE 286 286 286 PHE PHE Q . n 
FA 16 287 LEU 287 287 287 LEU LEU Q . n 
FA 16 288 PHE 288 288 288 PHE PHE Q . n 
FA 16 289 PHE 289 289 289 PHE PHE Q . n 
FA 16 290 PHE 290 290 290 PHE PHE Q . n 
FA 16 291 ILE 291 291 291 ILE ILE Q . n 
FA 16 292 TRP 292 292 292 TRP TRP Q . n 
FA 16 293 ILE 293 293 293 ILE ILE Q . n 
FA 16 294 ARG 294 294 294 ARG ARG Q . n 
FA 16 295 ALA 295 295 295 ALA ALA Q . n 
FA 16 296 THR 296 296 296 THR THR Q . n 
FA 16 297 TRP 297 297 297 TRP TRP Q . n 
FA 16 298 PHE 298 298 298 PHE PHE Q . n 
FA 16 299 ARG 299 299 299 ARG ARG Q . n 
FA 16 300 LEU 300 300 300 LEU LEU Q . n 
FA 16 301 ARG 301 301 301 ARG ARG Q . n 
FA 16 302 TYR 302 302 302 TYR TYR Q . n 
FA 16 303 ASP 303 303 303 ASP ASP Q . n 
FA 16 304 GLN 304 304 304 GLN GLN Q . n 
FA 16 305 LEU 305 305 305 LEU LEU Q . n 
FA 16 306 LEU 306 306 306 LEU LEU Q . n 
FA 16 307 ARG 307 307 307 ARG ARG Q . n 
FA 16 308 PHE 308 308 308 PHE PHE Q . n 
FA 16 309 GLY 309 309 309 GLY GLY Q . n 
FA 16 310 TRP 310 310 310 TRP TRP Q . n 
FA 16 311 GLY 311 311 311 GLY GLY Q . n 
FA 16 312 PHE 312 312 312 PHE PHE Q . n 
FA 16 313 LEU 313 313 313 LEU LEU Q . n 
FA 16 314 PHE 314 314 314 PHE PHE Q . n 
FA 16 315 PRO 315 315 315 PRO PRO Q . n 
FA 16 316 LEU 316 316 316 LEU LEU Q . n 
FA 16 317 ALA 317 317 317 ALA ALA Q . n 
FA 16 318 LEU 318 318 318 LEU LEU Q . n 
FA 16 319 LEU 319 319 319 LEU LEU Q . n 
FA 16 320 TRP 320 320 320 TRP TRP Q . n 
FA 16 321 PHE 321 321 321 PHE PHE Q . n 
FA 16 322 LEU 322 322 322 LEU LEU Q . n 
FA 16 323 VAL 323 323 323 VAL VAL Q . n 
FA 16 324 THR 324 324 324 THR THR Q . n 
FA 16 325 ALA 325 325 325 ALA ALA Q . n 
FA 16 326 LEU 326 326 326 LEU LEU Q . n 
FA 16 327 VAL 327 327 327 VAL VAL Q . n 
FA 16 328 VAL 328 328 328 VAL VAL Q . n 
FA 16 329 ALA 329 329 329 ALA ALA Q . n 
FA 16 330 LEU 330 330 330 LEU LEU Q . n 
FA 16 331 ASP 331 331 331 ASP ASP Q . n 
FA 16 332 LEU 332 332 332 LEU LEU Q . n 
FA 16 333 PRO 333 333 333 PRO PRO Q . n 
FA 16 334 ARG 334 334 334 ARG ARG Q . n 
FA 16 335 THR 335 335 335 THR THR Q . n 
FA 16 336 TYR 336 336 336 TYR TYR Q . n 
FA 16 337 LEU 337 337 337 LEU LEU Q . n 
FA 16 338 LEU 338 338 338 LEU LEU Q . n 
FA 16 339 TYR 339 339 339 TYR TYR Q . n 
FA 16 340 LEU 340 340 340 LEU LEU Q . n 
FA 16 341 SER 341 341 341 SER SER Q . n 
FA 16 342 ALA 342 342 342 ALA ALA Q . n 
FA 16 343 LEU 343 343 343 LEU LEU Q . n 
FA 16 344 SER 344 344 344 SER SER Q . n 
FA 16 345 PHE 345 345 345 PHE PHE Q . n 
FA 16 346 LEU 346 346 346 LEU LEU Q . n 
FA 16 347 VAL 347 347 347 VAL VAL Q . n 
FA 16 348 LEU 348 348 348 LEU LEU Q . n 
FA 16 349 LEU 349 349 349 LEU LEU Q . n 
FA 16 350 GLY 350 350 350 GLY GLY Q . n 
FA 16 351 ALA 351 351 351 ALA ALA Q . n 
FA 16 352 VAL 352 352 352 VAL VAL Q . n 
FA 16 353 LEU 353 353 353 LEU LEU Q . n 
FA 16 354 TYR 354 354 354 TYR TYR Q . n 
FA 16 355 THR 355 355 ?   ?   ?   Q . n 
FA 16 356 PRO 356 356 ?   ?   ?   Q . n 
FA 16 357 LYS 357 357 ?   ?   ?   Q . n 
FA 16 358 PRO 358 358 ?   ?   ?   Q . n 
FA 16 359 ALA 359 359 ?   ?   ?   Q . n 
FA 16 360 ARG 360 360 ?   ?   ?   Q . n 
FA 16 361 LYS 361 361 ?   ?   ?   Q . n 
FA 16 362 GLY 362 362 ?   ?   ?   Q . n 
FA 16 363 GLY 363 363 ?   ?   ?   Q . n 
FA 16 364 GLY 364 364 ?   ?   ?   Q . n 
FA 16 365 ALA 365 365 ?   ?   ?   Q . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
GA 17 SF4 1 501 501 SF4 SF4 1 . 
HA 18 FMN 1 502 502 FMN FMN 1 . 
IA 19 FES 1 201 201 FES FES 2 . 
JA 17 SF4 1 801 801 SF4 SF4 3 . 
KA 17 SF4 1 802 802 SF4 SF4 3 . 
LA 17 SF4 1 803 803 SF4 SF4 3 . 
MA 19 FES 1 804 804 FES FES 3 . 
NA 20 HQH 1 501 501 HQH PIE 4 . 
OA 17 SF4 1 201 201 SF4 SF4 6 . 
PA 17 SF4 1 201 201 SF4 SF4 9 . 
QA 17 SF4 1 202 202 SF4 SF4 9 . 
RA 17 SF4 1 501 501 SF4 SF4 B . 
SA 18 FMN 1 502 502 FMN FMN B . 
TA 19 FES 1 201 201 FES FES C . 
UA 17 SF4 1 801 801 SF4 SF4 D . 
VA 17 SF4 1 802 802 SF4 SF4 D . 
WA 17 SF4 1 803 803 SF4 SF4 D . 
XA 19 FES 1 804 804 FES FES D . 
YA 20 HQH 1 501 501 HQH PIE E . 
ZA 17 SF4 1 201 201 SF4 SF4 G . 
AB 17 SF4 1 201 201 SF4 SF4 O . 
BB 17 SF4 1 202 202 SF4 SF4 O . 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.13rc1_2961: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                     2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .                     3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                     4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.41 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q8O 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     95.140 
_cell.length_a_esd                 ? 
_cell.length_b                     336.590 
_cell.length_b_esd                 ? 
_cell.length_c                     262.790 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q8O 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q8O 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.90 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 24% (w/v) PEG 4000, 100 mM KCl, 100 mM glutaric acid and 0.59 mM n-undecyl-beta-maltoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-09-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6Q8O 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.60 
_reflns.d_resolution_low                 49.164 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       182595 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.1 
_reflns.pdbx_Rmerge_I_obs                0.153 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.133 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.60 
_reflns_shell.d_res_low                   3.79 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           26923 
_reflns_shell.percent_possible_all        97.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.239 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             1.106 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               111.8 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;TLS refinement.

Twin refinement.
TWINNING INFORMATION:                                              
FRACTION: 0.490                                                   
OPERATOR: -h,-k,h+l 

Data cut anisotropically to limits (Angstrom) along a*, b* and c*:
3.6, 4.2, 3.7
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Q8O 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.605 
_refine.ls_d_res_low                             49.164 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     148790 
_refine.ls_number_reflns_R_free                  1595 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    79.80 
_refine.ls_percent_reflns_R_free                 1.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2194 
_refine.ls_R_factor_R_free                       0.2352 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2179 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HEA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.03 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         250 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74146 
_refine_hist.d_res_high                       3.605 
_refine_hist.d_res_low                        49.164 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005 ? 76250  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.804 ? 103990 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.821 ? 44658  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.044 ? 11644  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 13110  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.6190 3.7357  . . 41  3021  18.00 . . . 0.2817 . 0.2816 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7357 3.8690  . . 70  7842  47.00 . . . 0.2590 . 0.2643 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8690 4.0237  . . 111 11283 68.00 . . . 0.2798 . 0.2477 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0237 4.2065  . . 156 14174 85.00 . . . 0.2421 . 0.2363 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2065 4.4278  . . 171 15919 95.00 . . . 0.2566 . 0.2242 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4278 4.7045  . . 164 15960 95.00 . . . 0.2270 . 0.2241 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7045 5.0667  . . 192 15865 95.00 . . . 0.2201 . 0.2211 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0667 5.5745  . . 164 15846 94.00 . . . 0.2310 . 0.2248 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5745 6.3764  . . 166 16020 96.00 . . . 0.2726 . 0.2214 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3764 8.0159  . . 140 15860 95.00 . . . 0.2276 . 0.2023 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.0159 33.8131 . . 167 15273 90.00 . . . 0.2161 . 0.1961 . . . . . . . . . . 
# 
_struct.entry_id                     6Q8O 
_struct.title                        'Respiratory complex I from Thermus thermophilus with bound Piericidin A' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q8O 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 17 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 19 ? 
NA N N 20 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 19 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 19 ? 
YA N N 20 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6Q8O 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6Q8O 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6Q8O 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6Q8O 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6Q8O 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6Q8O 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6Q8O 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6Q8O 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6Q8O W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6Q8O A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6Q8O J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6Q8O K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6Q8O L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6Q8O M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6Q8O N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6Q8O H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6Q8O B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6Q8O C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6Q8O D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6Q8O E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6Q8O F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6Q8O G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6Q8O O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6Q8O I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6Q8O X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6Q8O P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6Q8O R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6Q8O S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6Q8O T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6Q8O U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6Q8O V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6Q8O Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? hexadecameric 16 
2 author_defined_assembly ? hexadecameric 16 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA       
2 1 Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P2   AA2 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P3   AA3 THR A  49  ? GLY A  61  ? THR 1 49  GLY 1 61  1 ? 13 
HELX_P HELX_P4   AA4 PRO A  71  ? PHE A  78  ? PRO 1 71  PHE 1 78  1 ? 8  
HELX_P HELX_P5   AA5 LYS A  102 ? VAL A  110 ? LYS 1 102 VAL 1 110 1 ? 9  
HELX_P HELX_P6   AA6 VAL A  110 ? ILE A  125 ? VAL 1 110 ILE 1 125 1 ? 16 
HELX_P HELX_P7   AA7 TYR A  138 ? ARG A  155 ? TYR 1 138 ARG 1 155 1 ? 18 
HELX_P HELX_P8   AA8 ASN A  161 ? THR A  165 ? ASN 1 161 THR 1 165 5 ? 5  
HELX_P HELX_P9   AA9 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P10  AB1 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P11  AB2 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P12  AB3 ASN A  220 ? ARG A  233 ? ASN 1 220 ARG 1 233 1 ? 14 
HELX_P HELX_P13  AB4 ALA A  235 ? GLN A  240 ? ALA 1 235 GLN 1 240 1 ? 6  
HELX_P HELX_P14  AB5 THR A  271 ? GLU A  278 ? THR 1 271 GLU 1 278 1 ? 8  
HELX_P HELX_P15  AB6 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P16  AB7 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P17  AB8 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P18  AB9 CYS A  356 ? GLY A  365 ? CYS 1 356 GLY 1 365 1 ? 10 
HELX_P HELX_P19  AC1 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P20  AC2 GLU A  380 ? GLY A  396 ? GLU 1 380 GLY 1 396 1 ? 17 
HELX_P HELX_P21  AC3 PRO A  401 ? HIS A  416 ? PRO 1 401 HIS 1 416 1 ? 16 
HELX_P HELX_P22  AC4 PHE A  417 ? GLU A  427 ? PHE 1 417 GLU 1 427 1 ? 11 
HELX_P HELX_P23  AC5 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P24  AC6 LYS B  17  ? TYR B  18  ? LYS 2 17  TYR 2 18  5 ? 2  
HELX_P HELX_P25  AC7 PRO B  19  ? ALA B  25  ? PRO 2 19  ALA 2 25  5 ? 7  
HELX_P HELX_P26  AC8 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P27  AC9 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P28  AD1 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P29  AD2 THR B  85  ? ALA B  91  ? THR 2 85  ALA 2 91  1 ? 7  
HELX_P HELX_P30  AD3 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P31  AD4 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P32  AD5 ARG B  162 ? ILE B  166 ? ARG 2 162 ILE 2 166 5 ? 5  
HELX_P HELX_P33  AD6 SER C  18  ? ALA C  26  ? SER 3 18  ALA 3 26  1 ? 9  
HELX_P HELX_P34  AD7 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P35  AD8 ASP C  118 ? CYS C  122 ? ASP 3 118 CYS 3 122 5 ? 5  
HELX_P HELX_P36  AD9 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P37  AE1 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P38  AE2 ARG C  205 ? THR C  209 ? ARG 3 205 THR 3 209 5 ? 5  
HELX_P HELX_P39  AE3 GLY C  224 ? CYS C  230 ? GLY 3 224 CYS 3 230 1 ? 7  
HELX_P HELX_P40  AE4 THR C  239 ? ARG C  241 ? THR 3 239 ARG 3 241 5 ? 3  
HELX_P HELX_P41  AE5 CYS C  291 ? GLY C  297 ? CYS 3 291 GLY 3 297 1 ? 7  
HELX_P HELX_P42  AE6 HIS C  298 ? GLN C  303 ? HIS 3 298 GLN 3 303 1 ? 6  
HELX_P HELX_P43  AE7 THR C  321 ? LYS C  334 ? THR 3 321 LYS 3 334 1 ? 14 
HELX_P HELX_P44  AE8 ARG C  337 ? GLU C  339 ? ARG 3 337 GLU 3 339 5 ? 3  
HELX_P HELX_P45  AE9 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P46  AF1 PRO C  378 ? PHE C  382 ? PRO 3 378 PHE 3 382 5 ? 5  
HELX_P HELX_P47  AF2 SER C  386 ? GLN C  392 ? SER 3 386 GLN 3 392 1 ? 7  
HELX_P HELX_P48  AF3 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P49  AF4 ALA C  406 ? ARG C  418 ? ALA 3 406 ARG 3 418 1 ? 13 
HELX_P HELX_P50  AF5 ALA C  456 ? ALA C  462 ? ALA 3 456 ALA 3 462 5 ? 7  
HELX_P HELX_P51  AF6 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P52  AF7 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P53  AF8 GLY C  508 ? ASP C  514 ? GLY 3 508 ASP 3 514 1 ? 7  
HELX_P HELX_P54  AF9 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P55  AG1 ASN C  540 ? MET C  547 ? ASN 3 540 MET 3 547 1 ? 8  
HELX_P HELX_P56  AG2 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P57  AG3 HIS C  591 ? ARG C  596 ? HIS 3 591 ARG 3 596 1 ? 6  
HELX_P HELX_P58  AG4 THR C  606 ? LYS C  610 ? THR 3 606 LYS 3 610 5 ? 5  
HELX_P HELX_P59  AG5 GLY C  636 ? LEU C  648 ? GLY 3 636 LEU 3 648 1 ? 13 
HELX_P HELX_P60  AG6 LEU C  656 ? ARG C  667 ? LEU 3 656 ARG 3 667 1 ? 12 
HELX_P HELX_P61  AG7 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P62  AG8 VAL C  705 ? GLN C  709 ? VAL 3 705 GLN 3 709 5 ? 5  
HELX_P HELX_P63  AG9 HIS C  719 ? ALA C  727 ? HIS 3 719 ALA 3 727 1 ? 9  
HELX_P HELX_P64  AH1 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P65  AH2 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P66  AH3 THR D  74  ? THR D  82  ? THR 4 74  THR 4 82  1 ? 9  
HELX_P HELX_P67  AH4 SER D  90  ? GLY D  106 ? SER 4 90  GLY 4 106 1 ? 17 
HELX_P HELX_P68  AH5 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P69  AH6 THR D  144 ? THR D  164 ? THR 4 144 THR 4 164 1 ? 21 
HELX_P HELX_P70  AH7 GLU D  185 ? ALA D  209 ? GLU 4 185 ALA 4 209 1 ? 25 
HELX_P HELX_P71  AH8 ILE D  213 ? ARG D  219 ? ILE 4 213 ARG 4 219 1 ? 7  
HELX_P HELX_P72  AH9 PRO D  225 ? LEU D  232 ? PRO 4 225 LEU 4 232 1 ? 8  
HELX_P HELX_P73  AI1 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P74  AI2 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P75  AI3 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P76  AI4 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P77  AI5 ARG D  314 ? THR D  319 ? ARG 4 314 THR 4 319 5 ? 6  
HELX_P HELX_P78  AI6 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P79  AI7 ALA D  372 ? LEU D  378 ? ALA 4 372 LEU 4 378 1 ? 7  
HELX_P HELX_P80  AI8 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P81  AI9 PRO D  391 ? ASP D  401 ? PRO 4 391 ASP 4 401 1 ? 11 
HELX_P HELX_P82  AJ1 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P83  AJ2 ARG E  2   ? LYS E  13  ? ARG 5 2   LYS 5 13  1 ? 12 
HELX_P HELX_P84  AJ3 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P85  AJ4 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P86  AJ5 ILE E  166 ? ARG E  171 ? ILE 5 166 ARG 5 171 1 ? 6  
HELX_P HELX_P87  AJ6 GLY E  186 ? GLY E  191 ? GLY 5 186 GLY 5 191 5 ? 6  
HELX_P HELX_P88  AJ7 PHE F  21  ? SER F  35  ? PHE 6 21  SER 6 35  1 ? 15 
HELX_P HELX_P89  AJ8 CYS F  45  ? ALA F  52  ? CYS 6 45  ALA 6 52  1 ? 8  
HELX_P HELX_P90  AJ9 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P91  AK1 SER F  85  ? LYS F  87  ? SER 6 85  LYS 6 87  5 ? 3  
HELX_P HELX_P92  AK2 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P93  AK3 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P94  AK4 ASN F  126 ? VAL F  130 ? ASN 6 126 VAL 6 130 5 ? 5  
HELX_P HELX_P95  AK5 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P96  AK6 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P97  AK7 SER G  57  ? CYS G  63  ? SER 9 57  CYS 9 63  1 ? 7  
HELX_P HELX_P98  AK8 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P99  AK9 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P100 AL1 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P101 AL2 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P102 AL3 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P103 AL4 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P104 AL5 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P105 AL6 THR H  111 ? LEU H  126 ? THR 7 111 LEU 7 126 1 ? 16 
HELX_P HELX_P106 AL7 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P107 AL8 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P108 AL9 SER I  95  ? LEU I  103 ? SER W 95  LEU W 103 1 ? 9  
HELX_P HELX_P109 AM1 PRO I  106 ? ILE I  117 ? PRO W 106 ILE W 117 1 ? 12 
HELX_P HELX_P110 AM2 ASP I  122 ? LEU I  127 ? ASP W 122 LEU W 127 5 ? 6  
HELX_P HELX_P111 AM3 PRO J  3   ? LEU J  31  ? PRO A 3   LEU A 31  1 ? 29 
HELX_P HELX_P112 AM4 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P113 AM5 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P114 AM6 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P115 AM7 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P116 AM8 ARG K  49  ? TYR K  59  ? ARG J 49  TYR J 59  1 ? 11 
HELX_P HELX_P117 AM9 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P118 AN1 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P119 AN2 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P120 AN3 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P121 AN4 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P122 AN5 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P123 AN6 LEU L  51  ? PHE L  79  ? LEU K 51  PHE K 79  1 ? 29 
HELX_P HELX_P124 AN7 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P125 AN8 MET M  1   ? LEU M  3   ? MET L 1   LEU L 3   5 ? 3  
HELX_P HELX_P126 AN9 LEU M  4   ? PHE M  20  ? LEU L 4   PHE L 20  1 ? 17 
HELX_P HELX_P127 AO1 GLU M  26  ? SER M  50  ? GLU L 26  SER L 50  1 ? 25 
HELX_P HELX_P128 AO2 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P129 AO3 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P130 AO4 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P131 AO5 PRO M  149 ? LEU M  179 ? PRO L 149 LEU L 179 1 ? 31 
HELX_P HELX_P132 AO6 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P133 AO7 ASN M  198 ? SER M  217 ? ASN L 198 SER L 217 1 ? 20 
HELX_P HELX_P134 AO8 PRO M  221 ? GLY M  232 ? PRO L 221 GLY L 232 5 ? 12 
HELX_P HELX_P135 AO9 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P136 AP1 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P137 AP2 SER M  256 ? VAL M  262 ? SER L 256 VAL L 262 1 ? 7  
HELX_P HELX_P138 AP3 LEU M  263 ? PHE M  286 ? LEU L 263 PHE L 286 1 ? 24 
HELX_P HELX_P139 AP4 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P140 AP5 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P141 AP6 GLY M  354 ? LEU M  359 ? GLY L 354 LEU L 359 1 ? 6  
HELX_P HELX_P142 AP7 GLN M  361 ? GLY M  375 ? GLN L 361 GLY L 375 1 ? 15 
HELX_P HELX_P143 AP8 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P144 AP9 GLY M  399 ? LEU M  426 ? GLY L 399 LEU L 426 1 ? 28 
HELX_P HELX_P145 AQ1 PRO M  439 ? GLY M  457 ? PRO L 439 GLY L 457 1 ? 19 
HELX_P HELX_P146 AQ2 TYR M  458 ? ALA M  460 ? TYR L 458 ALA L 460 5 ? 3  
HELX_P HELX_P147 AQ3 VAL M  468 ? LEU M  477 ? VAL L 468 LEU L 477 1 ? 10 
HELX_P HELX_P148 AQ4 GLY M  488 ? LYS M  515 ? GLY L 488 LYS L 515 1 ? 28 
HELX_P HELX_P149 AQ5 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P150 AQ6 ALA M  531 ? TYR M  533 ? ALA L 531 TYR L 533 5 ? 3  
HELX_P HELX_P151 AQ7 VAL M  534 ? ILE M  542 ? VAL L 534 ILE L 542 1 ? 9  
HELX_P HELX_P152 AQ8 ILE M  542 ? LEU M  581 ? ILE L 542 LEU L 581 1 ? 40 
HELX_P HELX_P153 AQ9 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P154 AR1 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P155 AR2 PRO N  21  ? LEU N  41  ? PRO M 21  LEU M 41  1 ? 21 
HELX_P HELX_P156 AR3 ASP N  68  ? VAL N  88  ? ASP M 68  VAL M 88  1 ? 21 
HELX_P HELX_P157 AR4 PHE N  95  ? ALA N  111 ? PHE M 95  ALA M 111 1 ? 17 
HELX_P HELX_P158 AR5 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P159 AR6 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P160 AR7 GLY N  140 ? LEU N  169 ? GLY M 140 LEU M 169 1 ? 30 
HELX_P HELX_P161 AR8 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P162 AR9 ALA N  189 ? LYS N  204 ? ALA M 189 LYS M 204 1 ? 16 
HELX_P HELX_P163 AS1 LEU N  207 ? ALA N  212 ? LEU M 207 ALA M 212 5 ? 6  
HELX_P HELX_P164 AS2 TRP N  213 ? ASN N  221 ? TRP M 213 ASN M 221 1 ? 9  
HELX_P HELX_P165 AS3 GLY N  225 ? LEU N  233 ? GLY M 225 LEU M 233 1 ? 9  
HELX_P HELX_P166 AS4 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P167 AS5 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P168 AS6 ALA N  249 ? ALA N  275 ? ALA M 249 ALA M 275 1 ? 27 
HELX_P HELX_P169 AS7 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P170 AS8 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P171 AS9 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P172 AT1 GLY N  353 ? GLY N  367 ? GLY M 353 GLY M 367 1 ? 15 
HELX_P HELX_P173 AT2 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P174 AT3 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P175 AT4 SER N  398 ? TRP N  415 ? SER M 398 TRP M 415 1 ? 18 
HELX_P HELX_P176 AT5 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P177 AT6 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P178 AT7 THR O  2   ? GLY O  17  ? THR N 2   GLY N 17  1 ? 16 
HELX_P HELX_P179 AT8 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P180 AT9 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P181 AU1 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P182 AU2 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P183 AU3 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P184 AU4 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P185 AU5 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P186 AU6 PRO O  204 ? VAL O  226 ? PRO N 204 VAL N 226 1 ? 23 
HELX_P HELX_P187 AU7 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P188 AU8 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P189 AU9 LEU O  271 ? GLY O  276 ? LEU N 271 GLY N 276 1 ? 6  
HELX_P HELX_P190 AV1 GLN O  279 ? SER O  303 ? GLN N 279 SER N 303 1 ? 25 
HELX_P HELX_P191 AV2 PRO O  308 ? ARG O  313 ? PRO N 308 ARG N 313 1 ? 6  
HELX_P HELX_P192 AV3 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P193 AV4 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P194 AV5 LEU O  339 ? GLY O  356 ? LEU N 339 GLY N 356 1 ? 18 
HELX_P HELX_P195 AV6 TRP O  358 ? LEU O  380 ? TRP N 358 LEU N 380 1 ? 23 
HELX_P HELX_P196 AV7 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P197 AV8 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P198 AV9 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P199 AW1 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P200 AW2 ARG P  79  ? LEU P  95  ? ARG H 79  LEU H 95  1 ? 17 
HELX_P HELX_P201 AW3 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P202 AW4 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P203 AW5 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P204 AW6 LEU P  195 ? GLU P  213 ? LEU H 195 GLU H 213 1 ? 19 
HELX_P HELX_P205 AW7 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P206 AW8 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P207 AW9 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P208 AX1 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P209 AX2 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P210 AX3 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P211 AX4 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P212 AX5 THR Q  49  ? GLY Q  61  ? THR B 49  GLY B 61  1 ? 13 
HELX_P HELX_P213 AX6 PRO Q  71  ? PHE Q  78  ? PRO B 71  PHE B 78  1 ? 8  
HELX_P HELX_P214 AX7 LYS Q  102 ? VAL Q  110 ? LYS B 102 VAL B 110 1 ? 9  
HELX_P HELX_P215 AX8 VAL Q  110 ? ILE Q  125 ? VAL B 110 ILE B 125 1 ? 16 
HELX_P HELX_P216 AX9 ARG Q  139 ? ARG Q  155 ? ARG B 139 ARG B 155 1 ? 17 
HELX_P HELX_P217 AY1 ASN Q  161 ? THR Q  165 ? ASN B 161 THR B 165 5 ? 5  
HELX_P HELX_P218 AY2 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P219 AY3 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P220 AY4 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P221 AY5 VAL Q  221 ? ARG Q  233 ? VAL B 221 ARG B 233 1 ? 13 
HELX_P HELX_P222 AY6 ALA Q  235 ? GLN Q  240 ? ALA B 235 GLN B 240 1 ? 6  
HELX_P HELX_P223 AY7 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P224 AY8 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P225 AY9 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P226 AZ1 SER Q  336 ? GLU Q  351 ? SER B 336 GLU B 351 1 ? 16 
HELX_P HELX_P227 AZ2 CYS Q  356 ? PHE Q  366 ? CYS B 356 PHE B 366 1 ? 11 
HELX_P HELX_P228 AZ3 PHE Q  366 ? GLY Q  375 ? PHE B 366 GLY B 375 1 ? 10 
HELX_P HELX_P229 AZ4 GLU Q  380 ? LEU Q  391 ? GLU B 380 LEU B 391 1 ? 12 
HELX_P HELX_P230 AZ5 LEU Q  391 ? GLY Q  396 ? LEU B 391 GLY B 396 1 ? 6  
HELX_P HELX_P231 AZ6 PRO Q  401 ? GLU Q  427 ? PRO B 401 GLU B 427 1 ? 27 
HELX_P HELX_P232 AZ7 LYS R  7   ? ALA R  16  ? LYS C 7   ALA C 16  1 ? 10 
HELX_P HELX_P233 AZ8 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P234 AZ9 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P235 BA1 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P236 BA2 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P237 BA3 THR R  85  ? ALA R  91  ? THR C 85  ALA C 91  1 ? 7  
HELX_P HELX_P238 BA4 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P239 BA5 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P240 BA6 SER S  18  ? ALA S  26  ? SER D 18  ALA D 26  1 ? 9  
HELX_P HELX_P241 BA7 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P242 BA8 ASP S  118 ? CYS S  122 ? ASP D 118 CYS D 122 5 ? 5  
HELX_P HELX_P243 BA9 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P244 BB1 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P245 BB2 ARG S  205 ? THR S  209 ? ARG D 205 THR D 209 5 ? 5  
HELX_P HELX_P246 BB3 PHE S  222 ? GLY S  224 ? PHE D 222 GLY D 224 5 ? 3  
HELX_P HELX_P247 BB4 ASN S  225 ? CYS S  230 ? ASN D 225 CYS D 230 1 ? 6  
HELX_P HELX_P248 BB5 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P249 BB6 CYS S  291 ? GLY S  297 ? CYS D 291 GLY D 297 1 ? 7  
HELX_P HELX_P250 BB7 HIS S  298 ? GLN S  303 ? HIS D 298 GLN D 303 1 ? 6  
HELX_P HELX_P251 BB8 THR S  321 ? LYS S  334 ? THR D 321 LYS D 334 1 ? 14 
HELX_P HELX_P252 BB9 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P253 BC1 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P254 BC2 SER S  386 ? GLN S  392 ? SER D 386 GLN D 392 1 ? 7  
HELX_P HELX_P255 BC3 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P256 BC4 ALA S  406 ? ARG S  418 ? ALA D 406 ARG D 418 1 ? 13 
HELX_P HELX_P257 BC5 ALA S  456 ? TRP S  461 ? ALA D 456 TRP D 461 5 ? 6  
HELX_P HELX_P258 BC6 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P259 BC7 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P260 BC8 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P261 BC9 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P262 BD1 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P263 BD2 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P264 BD3 HIS S  591 ? ARG S  596 ? HIS D 591 ARG D 596 1 ? 6  
HELX_P HELX_P265 BD4 THR S  606 ? LYS S  610 ? THR D 606 LYS D 610 5 ? 5  
HELX_P HELX_P266 BD5 GLY S  636 ? GLY S  649 ? GLY D 636 GLY D 649 1 ? 14 
HELX_P HELX_P267 BD6 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P268 BD7 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P269 BD8 VAL S  705 ? GLN S  709 ? VAL D 705 GLN D 709 5 ? 5  
HELX_P HELX_P270 BD9 HIS S  719 ? ALA S  727 ? HIS D 719 ALA D 727 1 ? 9  
HELX_P HELX_P271 BE1 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P272 BE2 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P273 BE3 GLN T  77  ? THR T  82  ? GLN E 77  THR E 82  1 ? 6  
HELX_P HELX_P274 BE4 SER T  90  ? GLY T  106 ? SER E 90  GLY E 106 1 ? 17 
HELX_P HELX_P275 BE5 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P276 BE6 THR T  144 ? THR T  164 ? THR E 144 THR E 164 1 ? 21 
HELX_P HELX_P277 BE7 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P278 BE8 PHE T  214 ? ARG T  219 ? PHE E 214 ARG E 219 1 ? 6  
HELX_P HELX_P279 BE9 PRO T  225 ? LEU T  232 ? PRO E 225 LEU E 232 1 ? 8  
HELX_P HELX_P280 BF1 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P281 BF2 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P282 BF3 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P283 BF4 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P284 BF5 ARG T  314 ? THR T  319 ? ARG E 314 THR E 319 5 ? 6  
HELX_P HELX_P285 BF6 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P286 BF7 ALA T  372 ? SER T  380 ? ALA E 372 SER E 380 1 ? 9  
HELX_P HELX_P287 BF8 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P288 BF9 GLN T  389 ? ASP T  401 ? GLN E 389 ASP E 401 1 ? 13 
HELX_P HELX_P289 BG1 VAL T  403 ? ASP T  408 ? VAL E 403 ASP E 408 1 ? 6  
HELX_P HELX_P290 BG2 ARG U  2   ? LYS U  13  ? ARG F 2   LYS F 13  1 ? 12 
HELX_P HELX_P291 BG3 PRO U  30  ? MET U  44  ? PRO F 30  MET F 44  1 ? 15 
HELX_P HELX_P292 BG4 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P293 BG5 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P294 BG6 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P295 BG7 PHE V  21  ? SER V  35  ? PHE G 21  SER G 35  1 ? 15 
HELX_P HELX_P296 BG8 CYS V  45  ? ALA V  52  ? CYS G 45  ALA G 52  1 ? 8  
HELX_P HELX_P297 BG9 SER V  71  ? ALA V  75  ? SER G 71  ALA G 75  5 ? 5  
HELX_P HELX_P298 BH1 SER V  85  ? LYS V  87  ? SER G 85  LYS G 87  5 ? 3  
HELX_P HELX_P299 BH2 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P300 BH3 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P301 BH4 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P302 BH5 ARG V  143 ? ARG V  159 ? ARG G 143 ARG G 159 1 ? 17 
HELX_P HELX_P303 BH6 LEU W  3   ? PHE W  18  ? LEU O 3   PHE O 18  1 ? 16 
HELX_P HELX_P304 BH7 SER W  57  ? CYS W  63  ? SER O 57  CYS O 63  1 ? 7  
HELX_P HELX_P305 BH8 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P306 BH9 GLU W  125 ? ASP W  128 ? GLU O 125 ASP O 128 5 ? 4  
HELX_P HELX_P307 BI1 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P308 BI2 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P309 BI3 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P310 BI4 SER X  5   ? GLY X  28  ? SER I 5   GLY I 28  1 ? 24 
HELX_P HELX_P311 BI5 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P312 BI6 THR X  111 ? LEU X  126 ? THR I 111 LEU I 126 1 ? 16 
HELX_P HELX_P313 BI7 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P314 BI8 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P315 BI9 GLY Y  97  ? LEU Y  102 ? GLY X 97  LEU X 102 1 ? 6  
HELX_P HELX_P316 BJ1 PRO Y  106 ? ILE Y  117 ? PRO X 106 ILE X 117 1 ? 12 
HELX_P HELX_P317 BJ2 ASP Y  122 ? TYR Y  126 ? ASP X 122 TYR X 126 5 ? 5  
HELX_P HELX_P318 BJ3 ILE Z  4   ? LEU Z  31  ? ILE P 4   LEU P 31  1 ? 28 
HELX_P HELX_P319 BJ4 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P320 BJ5 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P321 BJ6 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P322 BJ7 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P323 BJ8 ALA AA 48  ? TYR AA 59  ? ALA R 48  TYR R 59  1 ? 12 
HELX_P HELX_P324 BJ9 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P325 BK1 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P326 BK2 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P327 BK3 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P328 BK4 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P329 BK5 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P330 BK6 LEU BA 51  ? ARG BA 80  ? LEU S 51  ARG S 80  1 ? 30 
HELX_P HELX_P331 BK7 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P332 BK8 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P333 BK9 PRO CA 27  ? SER CA 50  ? PRO T 27  SER T 50  1 ? 24 
HELX_P HELX_P334 BL1 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P335 BL2 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P336 BL3 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P337 BL4 ALA CA 152 ? LEU CA 179 ? ALA T 152 LEU T 179 1 ? 28 
HELX_P HELX_P338 BL5 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P339 BL6 ASN CA 198 ? ALA CA 218 ? ASN T 198 ALA T 218 1 ? 21 
HELX_P HELX_P340 BL7 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P341 BL8 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P342 BL9 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P343 BM1 SER CA 256 ? VAL CA 262 ? SER T 256 VAL T 262 1 ? 7  
HELX_P HELX_P344 BM2 LEU CA 263 ? GLY CA 287 ? LEU T 263 GLY T 287 1 ? 25 
HELX_P HELX_P345 BM3 ASP CA 290 ? VAL CA 312 ? ASP T 290 VAL T 312 1 ? 23 
HELX_P HELX_P346 BM4 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P347 BM5 GLY CA 354 ? LEU CA 359 ? GLY T 354 LEU T 359 1 ? 6  
HELX_P HELX_P348 BM6 THR CA 362 ? GLY CA 375 ? THR T 362 GLY T 375 1 ? 14 
HELX_P HELX_P349 BM7 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P350 BM8 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P351 BM9 PRO CA 439 ? GLY CA 457 ? PRO T 439 GLY T 457 1 ? 19 
HELX_P HELX_P352 BN1 TYR CA 458 ? ALA CA 460 ? TYR T 458 ALA T 460 5 ? 3  
HELX_P HELX_P353 BN2 VAL CA 468 ? LYS CA 474 ? VAL T 468 LYS T 474 1 ? 7  
HELX_P HELX_P354 BN3 GLY CA 488 ? LYS CA 515 ? GLY T 488 LYS T 515 1 ? 28 
HELX_P HELX_P355 BN4 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P356 BN5 TYR CA 533 ? ILE CA 542 ? TYR T 533 ILE T 542 1 ? 10 
HELX_P HELX_P357 BN6 ILE CA 542 ? ARG CA 580 ? ILE T 542 ARG T 580 1 ? 39 
HELX_P HELX_P358 BN7 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P359 BN8 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P360 BN9 PRO DA 21  ? LEU DA 41  ? PRO U 21  LEU U 41  1 ? 21 
HELX_P HELX_P361 BO1 ASP DA 68  ? VAL DA 88  ? ASP U 68  VAL U 88  1 ? 21 
HELX_P HELX_P362 BO2 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P363 BO3 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P364 BO4 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P365 BO5 GLY DA 140 ? LEU DA 169 ? GLY U 140 LEU U 169 1 ? 30 
HELX_P HELX_P366 BO6 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P367 BO7 ALA DA 189 ? LYS DA 204 ? ALA U 189 LYS U 204 1 ? 16 
HELX_P HELX_P368 BO8 LEU DA 207 ? HIS DA 211 ? LEU U 207 HIS U 211 5 ? 5  
HELX_P HELX_P369 BO9 TRP DA 213 ? ASN DA 221 ? TRP U 213 ASN U 221 1 ? 9  
HELX_P HELX_P370 BP1 GLY DA 225 ? TYR DA 234 ? GLY U 225 TYR U 234 1 ? 10 
HELX_P HELX_P371 BP2 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P372 BP3 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P373 BP4 ALA DA 249 ? ALA DA 278 ? ALA U 249 ALA U 278 1 ? 30 
HELX_P HELX_P374 BP5 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P375 BP6 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P376 BP7 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P377 BP8 GLY DA 353 ? GLY DA 367 ? GLY U 353 GLY U 367 1 ? 15 
HELX_P HELX_P378 BP9 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P379 BQ1 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P380 BQ2 SER DA 398 ? PHE DA 414 ? SER U 398 PHE U 414 1 ? 17 
HELX_P HELX_P381 BQ3 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P382 BQ4 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P383 BQ5 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P384 BQ6 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P385 BQ7 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P386 BQ8 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P387 BQ9 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P388 BR1 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P389 BR2 GLY EA 169 ? ALA EA 187 ? GLY V 169 ALA V 187 1 ? 19 
HELX_P HELX_P390 BR3 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P391 BR4 PRO EA 204 ? VAL EA 226 ? PRO V 204 VAL V 226 1 ? 23 
HELX_P HELX_P392 BR5 PRO EA 229 ? GLN EA 251 ? PRO V 229 GLN V 251 1 ? 23 
HELX_P HELX_P393 BR6 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P394 BR7 LEU EA 271 ? THR EA 275 ? LEU V 271 THR V 275 5 ? 5  
HELX_P HELX_P395 BR8 GLN EA 279 ? SER EA 303 ? GLN V 279 SER V 303 1 ? 25 
HELX_P HELX_P396 BR9 PRO EA 308 ? ARG EA 313 ? PRO V 308 ARG V 313 1 ? 6  
HELX_P HELX_P397 BS1 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P398 BS2 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P399 BS3 LEU EA 339 ? GLY EA 356 ? LEU V 339 GLY V 356 1 ? 18 
HELX_P HELX_P400 BS4 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P401 BS5 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P402 BS6 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P403 BS7 VAL EA 419 ? LEU EA 423 ? VAL V 419 LEU V 423 5 ? 5  
HELX_P HELX_P404 BS8 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P405 BS9 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P406 BT1 PHE FA 80  ? LEU FA 95  ? PHE Q 80  LEU Q 95  1 ? 16 
HELX_P HELX_P407 BT2 LEU FA 120 ? SER FA 143 ? LEU Q 120 SER Q 143 1 ? 24 
HELX_P HELX_P408 BT3 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P409 BT4 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P410 BT5 LEU FA 195 ? GLU FA 213 ? LEU Q 195 GLU Q 213 1 ? 19 
HELX_P HELX_P411 BT6 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P412 BT7 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P413 BT8 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P414 BT9 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P415 BU1 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc4  metalc ? ? A CYS 400 SG  ? ? ? 1_555 GA SF4 .   FE3 ? ? 1 CYS 400 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc5  metalc ? ? B CYS 83  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc6  metalc ? ? B CYS 88  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc7  metalc ? ? B CYS 124 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc8  metalc ? ? B CYS 128 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc9  metalc ? ? C CYS 34  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 34  3 FES 804 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc10 metalc ? ? C CYS 45  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc11 metalc ? ? C CYS 48  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc12 metalc ? ? C CYS 83  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc13 metalc ? ? C CYS 119 SG  ? ? ? 1_555 JA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc14 metalc ? ? C CYS 122 SG  ? ? ? 1_555 JA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc15 metalc ? ? C CYS 128 SG  ? ? ? 1_555 JA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc16 metalc ? ? C CYS 181 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc17 metalc ? ? C CYS 184 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc18 metalc ? ? C CYS 187 SG  ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc19 metalc ? ? C CYS 230 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc20 metalc ? ? C CYS 256 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc21 metalc ? ? C CYS 259 SG  ? ? ? 1_555 LA SF4 .   FE4 ? ? 3 CYS 259 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc22 metalc ? ? C CYS 263 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc23 metalc ? ? C CYS 291 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc24 metalc ? ? F CYS 45  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc25 metalc ? ? F CYS 46  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc26 metalc ? ? F CYS 111 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc27 metalc ? ? F CYS 140 SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc28 metalc ? ? G CYS 53  SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc29 metalc ? ? G CYS 56  SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc30 metalc ? ? G CYS 59  SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc31 metalc ? ? G CYS 63  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc32 metalc ? ? G CYS 98  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc33 metalc ? ? G CYS 101 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc34 metalc ? ? G CYS 104 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc35 metalc ? ? G CYS 108 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc36 metalc ? ? Q CYS 353 SG  ? ? ? 1_555 RA SF4 .   FE4 ? ? B CYS 353 B SF4 501 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc37 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc38 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc39 metalc ? ? Q CYS 400 SG  ? ? ? 1_555 RA SF4 .   FE3 ? ? B CYS 400 B SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc40 metalc ? ? R CYS 83  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc41 metalc ? ? R CYS 88  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc42 metalc ? ? R CYS 124 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc43 metalc ? ? R CYS 128 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc44 metalc ? ? S CYS 34  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc45 metalc ? ? S CYS 45  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc46 metalc ? ? S CYS 48  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc47 metalc ? ? S CYS 83  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc48 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 UA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 1.744 ? ? 
metalc49 metalc ? ? S CYS 119 SG  ? ? ? 1_555 UA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc50 metalc ? ? S CYS 122 SG  ? ? ? 1_555 UA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc51 metalc ? ? S CYS 128 SG  ? ? ? 1_555 UA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc52 metalc ? ? S CYS 181 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc53 metalc ? ? S CYS 184 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc54 metalc ? ? S CYS 187 SG  ? ? ? 1_555 VA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc55 metalc ? ? S CYS 230 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc56 metalc ? ? S CYS 256 SG  ? ? ? 1_555 WA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc57 metalc ? ? S CYS 263 SG  ? ? ? 1_555 WA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc58 metalc ? ? S CYS 291 SG  ? ? ? 1_555 WA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc59 metalc ? ? V CYS 46  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc60 metalc ? ? V CYS 111 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc61 metalc ? ? V CYS 140 SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc62 metalc ? ? W CYS 53  SG  ? ? ? 1_555 BB SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc63 metalc ? ? W CYS 56  SG  ? ? ? 1_555 BB SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc64 metalc ? ? W CYS 59  SG  ? ? ? 1_555 BB SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc65 metalc ? ? W CYS 63  SG  ? ? ? 1_555 AB SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc66 metalc ? ? W CYS 98  SG  ? ? ? 1_555 AB SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc67 metalc ? ? W CYS 101 SG  ? ? ? 1_555 AB SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? 
metalc68 metalc ? ? W CYS 104 SG  ? ? ? 1_555 AB SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc69 metalc ? ? W CYS 108 SG  ? ? ? 1_555 BB SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 115.4 ? 
2   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 110.6 ? 
3   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.6 ? 
4   SG  ? A  CYS 353 ? 1 CYS 353 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 113.9 ? 
5   S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.3 ? 
6   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE4 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.2 ? 
7   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 118.9 ? 
8   SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 109.1 ? 
9   S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.2 ? 
10  SG  ? A  CYS 356 ? 1 CYS 356 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 112.0 ? 
11  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.4 ? 
12  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE1 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.5 ? 
13  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 123.8 ? 
14  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 109.0 ? 
15  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S3 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.4 ? 
16  SG  ? A  CYS 359 ? 1 CYS 359 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 106.1 ? 
17  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.2 ? 
18  S3  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE2 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.4 ? 
19  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S1 ? GA SF4 .   ? 1 SF4 501 ? 1_555 115.4 ? 
20  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 109.6 ? 
21  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S2 ? GA SF4 .   ? 1 SF4 501 ? 1_555 107.6 ? 
22  SG  ? A  CYS 400 ? 1 CYS 400 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 114.0 ? 
23  S1  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 105.1 ? 
24  S2  ? GA SF4 .   ? 1 SF4 501 ? 1_555 FE3 ? GA SF4 . ? 1 SF4 501 ? 1_555 S4 ? GA SF4 .   ? 1 SF4 501 ? 1_555 104.3 ? 
25  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 114.9 ? 
26  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 113.7 ? 
27  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 90.9  ? 
28  SG  ? B  CYS 83  ? 2 CYS 83  ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 106.8 ? 
29  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 114.1 ? 
30  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE1 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 88  ? 2 CYS 88  ? 1_555 116.1 ? 
31  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S1 ? IA FES .   ? 2 FES 201 ? 1_555 111.2 ? 
32  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 115.9 ? 
33  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 S2 ? IA FES .   ? 2 FES 201 ? 1_555 90.9  ? 
34  SG  ? B  CYS 124 ? 2 CYS 124 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 108.9 ? 
35  S1  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 116.6 ? 
36  S2  ? IA FES .   ? 2 FES 201 ? 1_555 FE2 ? IA FES . ? 2 FES 201 ? 1_555 SG ? B  CYS 128 ? 2 CYS 128 ? 1_555 112.6 ? 
37  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 106.9 ? 
38  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 104.6 ? 
39  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 88.0  ? 
40  SG  ? C  CYS 34  ? 3 CYS 34  ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 130.1 ? 
41  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 106.9 ? 
42  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE1 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 45  ? 3 CYS 45  ? 1_555 112.2 ? 
43  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S1 ? MA FES .   ? 3 FES 804 ? 1_555 111.7 ? 
44  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 111.9 ? 
45  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 S2 ? MA FES .   ? 3 FES 804 ? 1_555 88.0  ? 
46  SG  ? C  CYS 48  ? 3 CYS 48  ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 118.3 ? 
47  S1  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 108.3 ? 
48  S2  ? MA FES .   ? 3 FES 804 ? 1_555 FE2 ? MA FES . ? 3 FES 804 ? 1_555 SG ? C  CYS 83  ? 3 CYS 83  ? 1_555 114.5 ? 
49  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.5 ? 
50  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 112.1 ? 
51  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.5 ? 
52  SG  ? C  CYS 119 ? 3 CYS 119 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.2 ? 
53  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.4 ? 
54  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE2 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.4 ? 
55  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S1 ? JA SF4 .   ? 3 SF4 801 ? 1_555 110.6 ? 
56  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.8 ? 
57  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.6 ? 
58  SG  ? C  CYS 122 ? 3 CYS 122 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.4 ? 
59  S1  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 106.3 ? 
60  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE4 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.7 ? 
61  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S2 ? JA SF4 .   ? 3 SF4 801 ? 1_555 113.2 ? 
62  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 112.4 ? 
63  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S3 ? JA SF4 .   ? 3 SF4 801 ? 1_555 104.7 ? 
64  SG  ? C  CYS 128 ? 3 CYS 128 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 114.7 ? 
65  S2  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.4 ? 
66  S3  ? JA SF4 .   ? 3 SF4 801 ? 1_555 FE1 ? JA SF4 . ? 3 SF4 801 ? 1_555 S4 ? JA SF4 .   ? 3 SF4 801 ? 1_555 105.6 ? 
67  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 114.5 ? 
68  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 113.5 ? 
69  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 106.1 ? 
70  SG  ? C  CYS 181 ? 3 CYS 181 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 111.6 ? 
71  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.7 ? 
72  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE2 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.5 ? 
73  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 111.3 ? 
74  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 115.6 ? 
75  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.5 ? 
76  SG  ? C  CYS 184 ? 3 CYS 184 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 113.4 ? 
77  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.5 ? 
78  S3  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE1 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.7 ? 
79  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 118.5 ? 
80  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 111.0 ? 
81  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
82  SG  ? C  CYS 187 ? 3 CYS 187 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 110.9 ? 
83  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.8 ? 
84  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE3 ? KA SF4 . ? 3 SF4 802 ? 1_555 S4 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.7 ? 
85  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S1 ? KA SF4 .   ? 3 SF4 802 ? 1_555 114.3 ? 
86  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 112.3 ? 
87  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S2 ? KA SF4 .   ? 3 SF4 802 ? 1_555 105.0 ? 
88  SG  ? C  CYS 230 ? 3 CYS 230 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 113.9 ? 
89  S1  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 106.1 ? 
90  S2  ? KA SF4 .   ? 3 SF4 802 ? 1_555 FE4 ? KA SF4 . ? 3 SF4 802 ? 1_555 S3 ? KA SF4 .   ? 3 SF4 802 ? 1_555 104.3 ? 
91  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 112.1 ? 
92  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.6 ? 
93  S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.3 ? 
94  SG  ? C  CYS 256 ? 3 CYS 256 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 114.5 ? 
95  S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.1 ? 
96  S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE1 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 106.3 ? 
97  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.5 ? 
98  SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 112.1 ? 
99  S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.9 ? 
100 SG  ? C  CYS 259 ? 3 CYS 259 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 116.3 ? 
101 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 106.0 ? 
102 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE4 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 104.2 ? 
103 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.0 ? 
104 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.8 ? 
105 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S2 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.8 ? 
106 SG  ? C  CYS 263 ? 3 CYS 263 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 115.8 ? 
107 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.6 ? 
108 S2  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE3 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 103.9 ? 
109 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S1 ? LA SF4 .   ? 3 SF4 803 ? 1_555 111.9 ? 
110 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.9 ? 
111 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S3 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.8 ? 
112 SG  ? C  CYS 291 ? 3 CYS 291 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 113.4 ? 
113 S1  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 105.1 ? 
114 S3  ? LA SF4 .   ? 3 SF4 803 ? 1_555 FE2 ? LA SF4 . ? 3 SF4 803 ? 1_555 S4 ? LA SF4 .   ? 3 SF4 803 ? 1_555 106.0 ? 
115 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 108.6 ? 
116 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 113.1 ? 
117 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.1 ? 
118 SG  ? F  CYS 45  ? 6 CYS 45  ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 118.0 ? 
119 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.5 ? 
120 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE3 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.8 ? 
121 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 113.4 ? 
122 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 117.2 ? 
123 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.9 ? 
124 SG  ? F  CYS 46  ? 6 CYS 46  ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 109.1 ? 
125 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.2 ? 
126 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE2 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.4 ? 
127 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.5 ? 
128 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 112.7 ? 
129 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.2 ? 
130 SG  ? F  CYS 111 ? 6 CYS 111 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 114.6 ? 
131 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.6 ? 
132 S3  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE1 ? OA SF4 . ? 6 SF4 201 ? 1_555 S4 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.5 ? 
133 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S1 ? OA SF4 .   ? 6 SF4 201 ? 1_555 114.4 ? 
134 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 109.5 ? 
135 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S2 ? OA SF4 .   ? 6 SF4 201 ? 1_555 105.8 ? 
136 SG  ? F  CYS 140 ? 6 CYS 140 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 116.3 ? 
137 S1  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 103.9 ? 
138 S2  ? OA SF4 .   ? 6 SF4 201 ? 1_555 FE4 ? OA SF4 . ? 6 SF4 201 ? 1_555 S3 ? OA SF4 .   ? 6 SF4 201 ? 1_555 106.2 ? 
139 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 113.4 ? 
140 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 117.6 ? 
141 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.8 ? 
142 SG  ? G  CYS 53  ? 9 CYS 53  ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 110.0 ? 
143 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.4 ? 
144 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE3 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
145 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 115.6 ? 
146 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 116.3 ? 
147 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.8 ? 
148 SG  ? G  CYS 56  ? 9 CYS 56  ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 108.5 ? 
149 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
150 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE4 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.3 ? 
151 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S1 ? QA SF4 .   ? 9 SF4 202 ? 1_555 112.4 ? 
152 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 112.3 ? 
153 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.7 ? 
154 SG  ? G  CYS 59  ? 9 CYS 59  ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 116.1 ? 
155 S1  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.3 ? 
156 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE2 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 104.2 ? 
157 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 117.6 ? 
158 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.1 ? 
159 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.1 ? 
160 SG  ? G  CYS 63  ? 9 CYS 63  ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 108.6 ? 
161 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 103.8 ? 
162 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE4 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.9 ? 
163 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.7 ? 
164 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.5 ? 
165 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.0 ? 
166 SG  ? G  CYS 98  ? 9 CYS 98  ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 112.1 ? 
167 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.3 ? 
168 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE2 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.2 ? 
169 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 115.3 ? 
170 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 109.6 ? 
171 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S3 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.9 ? 
172 SG  ? G  CYS 101 ? 9 CYS 101 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.6 ? 
173 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.6 ? 
174 S3  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE1 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.0 ? 
175 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S1 ? PA SF4 .   ? 9 SF4 201 ? 1_555 114.6 ? 
176 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 117.9 ? 
177 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S2 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.2 ? 
178 SG  ? G  CYS 104 ? 9 CYS 104 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 107.9 ? 
179 S1  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 106.4 ? 
180 S2  ? PA SF4 .   ? 9 SF4 201 ? 1_555 FE3 ? PA SF4 . ? 9 SF4 201 ? 1_555 S4 ? PA SF4 .   ? 9 SF4 201 ? 1_555 104.9 ? 
181 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S2 ? QA SF4 .   ? 9 SF4 202 ? 1_555 114.7 ? 
182 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 111.2 ? 
183 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S3 ? QA SF4 .   ? 9 SF4 202 ? 1_555 106.4 ? 
184 SG  ? G  CYS 108 ? 9 CYS 108 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 114.3 ? 
185 S2  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 105.5 ? 
186 S3  ? QA SF4 .   ? 9 SF4 202 ? 1_555 FE1 ? QA SF4 . ? 9 SF4 202 ? 1_555 S4 ? QA SF4 .   ? 9 SF4 202 ? 1_555 103.8 ? 
187 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 115.6 ? 
188 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 109.5 ? 
189 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 107.5 ? 
190 SG  ? Q  CYS 353 ? B CYS 353 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 115.5 ? 
191 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.2 ? 
192 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE4 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 103.7 ? 
193 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 119.1 ? 
194 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 108.0 ? 
195 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 103.9 ? 
196 SG  ? Q  CYS 356 ? B CYS 356 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 113.5 ? 
197 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 103.8 ? 
198 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE1 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 107.8 ? 
199 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 125.0 ? 
200 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 110.7 ? 
201 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S3 ? RA SF4 .   ? B SF4 501 ? 1_555 104.1 ? 
202 SG  ? Q  CYS 359 ? B CYS 359 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 102.9 ? 
203 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.6 ? 
204 S3  ? RA SF4 .   ? B SF4 501 ? 1_555 FE2 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 107.4 ? 
205 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S1 ? RA SF4 .   ? B SF4 501 ? 1_555 114.2 ? 
206 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 110.9 ? 
207 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S2 ? RA SF4 .   ? B SF4 501 ? 1_555 107.4 ? 
208 SG  ? Q  CYS 400 ? B CYS 400 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 114.2 ? 
209 S1  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 105.8 ? 
210 S2  ? RA SF4 .   ? B SF4 501 ? 1_555 FE3 ? RA SF4 . ? B SF4 501 ? 1_555 S4 ? RA SF4 .   ? B SF4 501 ? 1_555 103.5 ? 
211 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S1 ? TA FES .   ? C FES 201 ? 1_555 115.0 ? 
212 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 114.3 ? 
213 S1  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 91.0  ? 
214 SG  ? R  CYS 83  ? C CYS 83  ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 107.9 ? 
215 S1  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 113.1 ? 
216 S2  ? TA FES .   ? C FES 201 ? 1_555 FE1 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 88  ? C CYS 88  ? 1_555 114.9 ? 
217 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S1 ? TA FES .   ? C FES 201 ? 1_555 109.9 ? 
218 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 112.5 ? 
219 S1  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 S2 ? TA FES .   ? C FES 201 ? 1_555 91.0  ? 
220 SG  ? R  CYS 124 ? C CYS 124 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 116.0 ? 
221 S1  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 113.2 ? 
222 S2  ? TA FES .   ? C FES 201 ? 1_555 FE2 ? TA FES . ? C FES 201 ? 1_555 SG ? R  CYS 128 ? C CYS 128 ? 1_555 111.6 ? 
223 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S1 ? XA FES .   ? D FES 804 ? 1_555 107.8 ? 
224 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 105.9 ? 
225 S1  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 87.7  ? 
226 SG  ? S  CYS 34  ? D CYS 34  ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 127.7 ? 
227 S1  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 106.9 ? 
228 S2  ? XA FES .   ? D FES 804 ? 1_555 FE1 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 45  ? D CYS 45  ? 1_555 113.4 ? 
229 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S1 ? XA FES .   ? D FES 804 ? 1_555 110.5 ? 
230 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 112.3 ? 
231 S1  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 S2 ? XA FES .   ? D FES 804 ? 1_555 87.8  ? 
232 SG  ? S  CYS 48  ? D CYS 48  ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 119.5 ? 
233 S1  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 108.2 ? 
234 S2  ? XA FES .   ? D FES 804 ? 1_555 FE2 ? XA FES . ? D FES 804 ? 1_555 SG ? S  CYS 83  ? D CYS 83  ? 1_555 113.9 ? 
235 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 129.2 ? 
236 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 58.8  ? 
237 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 104.2 ? 
238 NE2 ? S  HIS 115 ? D HIS 115 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 124.0 ? 
239 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.5 ? 
240 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE3 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.3 ? 
241 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 110.9 ? 
242 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 117.4 ? 
243 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 105.3 ? 
244 SG  ? S  CYS 119 ? D CYS 119 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 111.4 ? 
245 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.3 ? 
246 S3  ? UA SF4 .   ? D SF4 801 ? 1_555 FE2 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 104.9 ? 
247 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S1 ? UA SF4 .   ? D SF4 801 ? 1_555 111.8 ? 
248 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 117.3 ? 
249 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 104.3 ? 
250 SG  ? S  CYS 122 ? D CYS 122 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 111.1 ? 
251 S1  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 105.4 ? 
252 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE4 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 106.1 ? 
253 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S2 ? UA SF4 .   ? D SF4 801 ? 1_555 112.8 ? 
254 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 112.0 ? 
255 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S3 ? UA SF4 .   ? D SF4 801 ? 1_555 105.8 ? 
256 SG  ? S  CYS 128 ? D CYS 128 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 114.5 ? 
257 S2  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 106.2 ? 
258 S3  ? UA SF4 .   ? D SF4 801 ? 1_555 FE1 ? UA SF4 . ? D SF4 801 ? 1_555 S4 ? UA SF4 .   ? D SF4 801 ? 1_555 104.9 ? 
259 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 113.8 ? 
260 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 113.4 ? 
261 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 106.3 ? 
262 SG  ? S  CYS 181 ? D CYS 181 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 112.5 ? 
263 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 104.7 ? 
264 S3  ? VA SF4 .   ? D SF4 802 ? 1_555 FE2 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.5 ? 
265 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 111.3 ? 
266 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 116.2 ? 
267 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 103.6 ? 
268 SG  ? S  CYS 184 ? D CYS 184 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 113.3 ? 
269 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.7 ? 
270 S3  ? VA SF4 .   ? D SF4 802 ? 1_555 FE1 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.8 ? 
271 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 116.6 ? 
272 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 108.2 ? 
273 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 106.0 ? 
274 SG  ? S  CYS 187 ? D CYS 187 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 114.7 ? 
275 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 104.7 ? 
276 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE3 ? VA SF4 . ? D SF4 802 ? 1_555 S4 ? VA SF4 .   ? D SF4 802 ? 1_555 105.8 ? 
277 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S1 ? VA SF4 .   ? D SF4 802 ? 1_555 111.4 ? 
278 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 112.7 ? 
279 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S2 ? VA SF4 .   ? D SF4 802 ? 1_555 106.2 ? 
280 SG  ? S  CYS 230 ? D CYS 230 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 116.2 ? 
281 S1  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 106.2 ? 
282 S2  ? VA SF4 .   ? D SF4 802 ? 1_555 FE4 ? VA SF4 . ? D SF4 802 ? 1_555 S3 ? VA SF4 .   ? D SF4 802 ? 1_555 103.3 ? 
283 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 111.6 ? 
284 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 114.7 ? 
285 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 104.7 ? 
286 SG  ? S  CYS 256 ? D CYS 256 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 114.3 ? 
287 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 105.0 ? 
288 S3  ? WA SF4 .   ? D SF4 803 ? 1_555 FE1 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 105.5 ? 
289 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S1 ? WA SF4 .   ? D SF4 803 ? 1_555 115.6 ? 
290 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 110.1 ? 
291 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S2 ? WA SF4 .   ? D SF4 803 ? 1_555 106.3 ? 
292 SG  ? S  CYS 263 ? D CYS 263 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 114.2 ? 
293 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 104.8 ? 
294 S2  ? WA SF4 .   ? D SF4 803 ? 1_555 FE3 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 105.0 ? 
295 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S1 ? WA SF4 .   ? D SF4 803 ? 1_555 112.9 ? 
296 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 111.8 ? 
297 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S3 ? WA SF4 .   ? D SF4 803 ? 1_555 105.9 ? 
298 SG  ? S  CYS 291 ? D CYS 291 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 115.2 ? 
299 S1  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 104.7 ? 
300 S3  ? WA SF4 .   ? D SF4 803 ? 1_555 FE2 ? WA SF4 . ? D SF4 803 ? 1_555 S4 ? WA SF4 .   ? D SF4 803 ? 1_555 105.5 ? 
301 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 111.2 ? 
302 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 117.1 ? 
303 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.3 ? 
304 SG  ? V  CYS 46  ? G CYS 46  ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 110.9 ? 
305 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.6 ? 
306 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE2 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.1 ? 
307 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 111.4 ? 
308 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 113.1 ? 
309 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.0 ? 
310 SG  ? V  CYS 111 ? G CYS 111 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 115.6 ? 
311 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 103.6 ? 
312 S3  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE1 ? ZA SF4 . ? G SF4 201 ? 1_555 S4 ? ZA SF4 .   ? G SF4 201 ? 1_555 106.2 ? 
313 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S1 ? ZA SF4 .   ? G SF4 201 ? 1_555 113.9 ? 
314 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 112.2 ? 
315 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S2 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.6 ? 
316 SG  ? V  CYS 140 ? G CYS 140 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 114.0 ? 
317 S1  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 104.4 ? 
318 S2  ? ZA SF4 .   ? G SF4 201 ? 1_555 FE4 ? ZA SF4 . ? G SF4 201 ? 1_555 S3 ? ZA SF4 .   ? G SF4 201 ? 1_555 105.9 ? 
319 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 113.7 ? 
320 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 116.2 ? 
321 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 103.2 ? 
322 SG  ? W  CYS 53  ? O CYS 53  ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 110.9 ? 
323 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 105.6 ? 
324 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE3 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 106.4 ? 
325 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 115.8 ? 
326 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 116.3 ? 
327 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 103.0 ? 
328 SG  ? W  CYS 56  ? O CYS 56  ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 108.4 ? 
329 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 105.8 ? 
330 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE4 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.6 ? 
331 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S1 ? BB SF4 .   ? O SF4 202 ? 1_555 111.7 ? 
332 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 112.4 ? 
333 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.0 ? 
334 SG  ? W  CYS 59  ? O CYS 59  ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 116.2 ? 
335 S1  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 105.5 ? 
336 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE2 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 104.4 ? 
337 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 117.6 ? 
338 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 111.7 ? 
339 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 104.4 ? 
340 SG  ? W  CYS 63  ? O CYS 63  ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 110.8 ? 
341 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.2 ? 
342 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE4 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 107.4 ? 
343 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 113.2 ? 
344 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 115.9 ? 
345 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
346 SG  ? W  CYS 98  ? O CYS 98  ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 111.8 ? 
347 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 106.0 ? 
348 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE2 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.4 ? 
349 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 113.9 ? 
350 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 111.5 ? 
351 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S3 ? AB SF4 .   ? O SF4 201 ? 1_555 107.4 ? 
352 SG  ? W  CYS 101 ? O CYS 101 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 114.4 ? 
353 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.4 ? 
354 S3  ? AB SF4 .   ? O SF4 201 ? 1_555 FE1 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.4 ? 
355 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S1 ? AB SF4 .   ? O SF4 201 ? 1_555 115.2 ? 
356 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 115.7 ? 
357 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S2 ? AB SF4 .   ? O SF4 201 ? 1_555 104.7 ? 
358 SG  ? W  CYS 104 ? O CYS 104 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 109.8 ? 
359 S1  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 105.9 ? 
360 S2  ? AB SF4 .   ? O SF4 201 ? 1_555 FE3 ? AB SF4 . ? O SF4 201 ? 1_555 S4 ? AB SF4 .   ? O SF4 201 ? 1_555 104.6 ? 
361 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S2 ? BB SF4 .   ? O SF4 202 ? 1_555 112.8 ? 
362 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 114.3 ? 
363 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S3 ? BB SF4 .   ? O SF4 202 ? 1_555 106.4 ? 
364 SG  ? W  CYS 108 ? O CYS 108 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 112.2 ? 
365 S2  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 106.4 ? 
366 S3  ? BB SF4 .   ? O SF4 202 ? 1_555 FE1 ? BB SF4 . ? O SF4 202 ? 1_555 S4 ? BB SF4 .   ? O SF4 202 ? 1_555 104.0 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -3.26 
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 0.03  
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -8.19 
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 0.50  
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 -1.76 
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -6.79 
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 -3.81 
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 -1.09 
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 -4.24 
10 GLY 52  P  . ? GLY 52  H PRO 53  P  ? PRO 53  H 1 25.36 
11 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -8.89 
12 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -1.54 
13 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 3.22  
14 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -8.49 
15 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 -1.15 
16 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -1.05 
17 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -8.19 
18 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -2.90 
19 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 0.09  
20 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 -1.98 
21 GLY 52  FA . ? GLY 52  Q PRO 53  FA ? PRO 53  Q 1 27.94 
22 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -3.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 7 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 7 ? 
AC5 ? 6 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 3 ? 
AD2 ? 5 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 7 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 7 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 3 ? 
AE4 ? 5 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 3 ? 
AF2 ? 7 ? 
AF3 ? 6 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? parallel      
AB9 3 4 ? parallel      
AC1 1 2 ? parallel      
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC4 6 7 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? parallel      
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? parallel      
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? parallel      
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD6 5 6 ? parallel      
AD6 6 7 ? parallel      
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? parallel      
AD9 3 4 ? anti-parallel 
AD9 4 5 ? parallel      
AD9 5 6 ? anti-parallel 
AD9 6 7 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? parallel      
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE5 1 2 ? parallel      
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE8 1 2 ? parallel      
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? anti-parallel 
AF2 6 7 ? anti-parallel 
AF3 1 2 ? parallel      
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? parallel      
AF3 5 6 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A  170 ? ARG A  175 ? ASP 1 170 ARG 1 175 
AA1 2 VAL A  129 ? VAL A  134 ? VAL 1 129 VAL 1 134 
AA1 3 TYR A  88  ? CYS A  91  ? TYR 1 88  CYS 1 91  
AA1 4 THR A  216 ? ASN A  219 ? THR 1 216 ASN 1 219 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? SER C  171 ? HIS 3 168 SER 3 171 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  235 ? ASP C  237 ? LEU 3 235 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? ARG C  270 ? GLY 3 264 ARG 3 270 
AA7 3 GLU C  273 ? ALA C  279 ? GLU 3 273 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 HIS C  465 ? VAL C  467 ? HIS 3 465 VAL 3 467 
AA9 2 MET C  448 ? ALA C  452 ? MET 3 448 ALA 3 452 
AA9 3 ALA C  396 ? LEU C  399 ? ALA 3 396 LEU 3 399 
AA9 4 VAL C  504 ? LEU C  507 ? VAL 3 504 LEU 3 507 
AA9 5 LYS C  531 ? ALA C  534 ? LYS 3 531 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB2 2 PHE C  692 ? ARG C  695 ? PHE 3 692 ARG 3 695 
AB2 3 LEU C  758 ? SER C  761 ? LEU 3 758 SER 3 761 
AB2 4 GLU C  715 ? ALA C  718 ? GLU 3 715 ALA 3 718 
AB2 5 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 6 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 7 ARG C  774 ? LEU C  776 ? ARG 3 774 LEU 3 776 
AB3 1 LEU D  28  ? VAL D  30  ? LEU 4 28  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB4 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB4 3 THR D  346 ? SER D  348 ? THR 4 346 SER 4 348 
AB5 1 GLY D  340 ? VAL D  342 ? GLY 4 340 VAL 4 342 
AB5 2 GLY D  351 ? SER D  359 ? GLY 4 351 SER 4 359 
AB5 3 ARG D  367 ? ARG D  371 ? ARG 4 367 ARG 4 371 
AB6 1 ILE E  17  ? ASP E  19  ? ILE 5 17  ASP 5 19  
AB6 2 LEU E  25  ? VAL E  28  ? LEU 5 25  VAL 5 28  
AB6 3 PHE E  88  ? VAL E  94  ? PHE 5 88  VAL 5 94  
AB6 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB6 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB7 1 ARG E  100 ? PRO E  102 ? ARG 5 100 PRO 5 102 
AB7 2 VAL E  125 ? GLU E  127 ? VAL 5 125 GLU 5 127 
AB8 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB8 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB9 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB9 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB9 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB9 4 VAL F  135 ? VAL F  137 ? VAL 6 135 VAL 6 137 
AC1 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AC1 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC2 1 HIS G  41  ? LEU G  43  ? HIS 9 41  LEU 9 43  
AC2 2 ILE G  113 ? LEU G  115 ? ILE 9 113 LEU 9 115 
AC3 1 ILE G  68  ? GLU G  74  ? ILE 9 68  GLU 9 74  
AC3 2 ARG G  86  ? ASN G  94  ? ARG 9 86  ASN 9 94  
AC3 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC4 1 ARG H  30  ? ASP H  36  ? ARG 7 30  ASP 7 36  
AC4 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC4 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC4 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC4 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC4 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC4 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC5 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC5 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC5 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC5 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC5 5 PHE I  89  ? VAL I  93  ? PHE W 89  VAL W 93  
AC5 6 ASN I  119 ? PRO I  120 ? ASN W 119 PRO W 120 
AC6 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC6 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC7 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC7 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC8 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC8 2 VAL Q  129 ? VAL Q  134 ? VAL B 129 VAL B 134 
AC8 3 TYR Q  88  ? ALA Q  93  ? TYR B 88  ALA B 93  
AC8 4 THR Q  216 ? ASN Q  220 ? THR B 216 ASN B 220 
AC9 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AC9 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AC9 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AC9 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AC9 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AD1 1 SER R  118 ? VAL R  122 ? SER C 118 VAL C 122 
AD1 2 HIS R  79  ? CYS R  83  ? HIS C 79  CYS C 83  
AD1 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD2 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD2 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD2 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD2 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD2 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD3 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD3 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD3 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD4 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD4 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD5 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD5 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD5 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD6 1 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD6 2 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD6 3 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD6 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD6 5 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD6 6 LEU S  343 ? LEU S  345 ? LEU D 343 LEU D 345 
AD6 7 LEU S  369 ? PHE S  371 ? LEU D 369 PHE D 371 
AD7 1 ILE S  464 ? HIS S  465 ? ILE D 464 HIS D 465 
AD7 2 MET S  448 ? PHE S  451 ? MET D 448 PHE D 451 
AD7 3 ALA S  396 ? LEU S  399 ? ALA D 396 LEU D 399 
AD7 4 VAL S  504 ? LEU S  507 ? VAL D 504 LEU D 507 
AD7 5 VAL S  532 ? ALA S  534 ? VAL D 532 ALA D 534 
AD8 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD8 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AD9 1 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AD9 2 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AD9 3 LEU S  758 ? ALA S  762 ? LEU D 758 ALA D 762 
AD9 4 ALA S  714 ? ALA S  718 ? ALA D 714 ALA D 718 
AD9 5 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AD9 6 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AD9 7 ARG S  774 ? LEU S  776 ? ARG D 774 LEU D 776 
AE1 1 LEU T  28  ? VAL T  30  ? LEU E 28  VAL E 30  
AE1 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AE1 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE2 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE2 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE2 3 PRO T  345 ? SER T  348 ? PRO E 345 SER E 348 
AE3 1 GLY T  340 ? VAL T  342 ? GLY E 340 VAL E 342 
AE3 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE3 3 ARG T  367 ? ARG T  371 ? ARG E 367 ARG E 371 
AE4 1 ILE U  17  ? ASP U  19  ? ILE F 17  ASP F 19  
AE4 2 LEU U  25  ? VAL U  28  ? LEU F 25  VAL F 28  
AE4 3 PHE U  88  ? VAL U  94  ? PHE F 88  VAL F 94  
AE4 4 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE4 5 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE5 1 ARG U  100 ? PRO U  102 ? ARG F 100 PRO F 102 
AE5 2 VAL U  125 ? GLU U  127 ? VAL F 125 GLU F 127 
AE6 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE6 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE7 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE7 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE7 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE7 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE8 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE8 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AE9 1 HIS W  41  ? LEU W  43  ? HIS O 41  LEU O 43  
AE9 2 ILE W  113 ? LEU W  115 ? ILE O 113 LEU O 115 
AF1 1 ILE W  68  ? GLU W  74  ? ILE O 68  GLU O 74  
AF1 2 ARG W  86  ? ASN W  94  ? ARG O 86  ASN O 94  
AF1 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AF2 1 PHE X  31  ? ASP X  36  ? PHE I 31  ASP I 36  
AF2 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AF2 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AF2 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AF2 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AF2 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AF2 7 ILE X  108 ? LEU X  110 ? ILE I 108 LEU I 110 
AF3 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF3 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF3 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF3 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF3 5 PHE Y  89  ? VAL Y  93  ? PHE X 89  VAL X 93  
AF3 6 ALA Y  118 ? PRO Y  120 ? ALA X 118 PRO X 120 
AF4 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF4 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF5 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF5 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  174 ? O HIS 1 174 N VAL A  134 ? N VAL 1 134 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N CYS A  91  ? N CYS 1 91  
AA1 3 4 N ILE A  90  ? N ILE 1 90  O THR A  217 ? O THR 1 217 
AA2 1 2 O LEU A  266 ? O LEU 1 266 N LYS A  250 ? N LYS 1 250 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N ALA A  289 ? N ALA 1 289 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O GLN B  120 ? O GLN 2 120 N VAL B  82  ? N VAL 2 82  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O VAL C  11  ? O VAL 3 11  N VAL C  4   ? N VAL 3 4   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O VAL C  92  ? O VAL 3 92  N GLY C  53  ? N GLY 3 53  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N GLU C  250 ? N GLU 3 250 O THR C  269 ? O THR 3 269 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O VAL C  600 ? O VAL 3 600 N MET C  585 ? N MET 3 585 
AA8 4 5 O HIS C  586 ? O HIS 3 586 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  567 ? O TYR 3 567 N GLY C  342 ? N GLY 3 342 
AA8 6 7 N LEU C  343 ? N LEU 3 343 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O GLU C  466 ? O GLU 3 466 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O ALA C  449 ? O ALA 3 449 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N LEU C  397 ? N LEU 3 397 O ILE C  506 ? O ILE 3 506 
AA9 4 5 N LEU C  505 ? N LEU 3 505 O LEU C  533 ? O LEU 3 533 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 O VAL C  771 ? O VAL 3 771 N PHE C  692 ? N PHE 3 692 
AB2 2 3 N TYR C  693 ? N TYR 3 693 O LEU C  760 ? O LEU 3 760 
AB2 3 4 O TYR C  759 ? O TYR 3 759 N TRP C  717 ? N TRP 3 717 
AB2 4 5 N LEU C  716 ? N LEU 3 716 O VAL C  748 ? O VAL 3 748 
AB2 5 6 O VAL C  743 ? O VAL 3 743 N VAL C  736 ? N VAL 3 736 
AB2 6 7 N GLU C  737 ? N GLU 3 737 O ARG C  774 ? O ARG 3 774 
AB3 1 2 N LEU D  28  ? N LEU 4 28  O VAL D  45  ? O VAL 4 45  
AB3 2 3 N THR D  46  ? N THR 4 46  O GLU D  54  ? O GLU 4 54  
AB4 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB4 2 3 O GLY D  351 ? O GLY 4 351 N SER D  348 ? N SER 4 348 
AB5 1 2 N GLY D  340 ? N GLY 4 340 O SER D  359 ? O SER 4 359 
AB5 2 3 N GLY D  354 ? N GLY 4 354 O ARG D  371 ? O ARG 4 371 
AB6 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB6 2 3 N VAL E  27  ? N VAL 5 27  O PHE E  89  ? O PHE 5 89  
AB6 3 4 O VAL E  94  ? O VAL 5 94  N PHE E  68  ? N PHE 5 68  
AB6 4 5 O VAL E  75  ? O VAL 5 75  N PHE E  48  ? N PHE 5 48  
AB7 1 2 N LEU E  101 ? N LEU 5 101 O VAL E  125 ? O VAL 5 125 
AB8 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB9 1 2 N ALA F  39  ? N ALA 6 39  O VAL F  77  ? O VAL 6 77  
AB9 2 3 N MET F  78  ? N MET 6 78  O ILE F  106 ? O ILE 6 106 
AB9 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AC1 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC2 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC3 1 2 N GLU G  71  ? N GLU 9 71  O VAL G  90  ? O VAL 9 90  
AC3 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC4 1 2 N ARG H  30  ? N ARG 7 30  O SER H  60  ? O SER 7 60  
AC4 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC4 3 4 N LEU H  69  ? N LEU 7 69  O ARG H  85  ? O ARG 7 85  
AC4 4 5 N LEU H  84  ? N LEU 7 84  O LEU H  93  ? O LEU 7 93  
AC4 5 6 N GLU H  98  ? N GLU 7 98  O GLY H  102 ? O GLY 7 102 
AC4 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC5 1 2 N VAL I  2   ? N VAL W 2   O ASP I  56  ? O ASP W 56  
AC5 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC5 3 4 O HIS I  51  ? O HIS W 51  N LYS I  30  ? N LYS W 30  
AC5 4 5 N VAL I  31  ? N VAL W 31  O TYR I  90  ? O TYR W 90  
AC5 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC6 1 2 N ALA M  53  ? N ALA L 53  O LEU M  69  ? O LEU L 69  
AC7 1 2 N LEU N  55  ? N LEU M 55  O VAL N  61  ? O VAL M 61  
AC8 1 2 O HIS Q  174 ? O HIS B 174 N VAL Q  134 ? N VAL B 134 
AC8 2 3 O TYR Q  131 ? O TYR B 131 N LEU Q  89  ? N LEU B 89  
AC8 3 4 N ILE Q  90  ? N ILE B 90  O THR Q  217 ? O THR B 217 
AC9 1 2 O LEU Q  266 ? O LEU B 266 N LYS Q  250 ? N LYS B 250 
AC9 2 3 N GLN Q  253 ? N GLN B 253 O VAL Q  328 ? O VAL B 328 
AC9 3 4 O ILE Q  329 ? O ILE B 329 N ILE Q  291 ? N ILE B 291 
AC9 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AD1 1 2 O VAL R  122 ? O VAL C 122 N VAL R  82  ? N VAL C 82  
AD1 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD2 1 2 O VAL S  13  ? O VAL D 13  N VAL S  2   ? N VAL D 2   
AD2 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD2 3 4 O ASP S  94  ? O ASP D 94  N ARG S  51  ? N ARG D 51  
AD2 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD3 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD3 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD4 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD5 1 2 N THR S  252 ? N THR D 252 O ALA S  267 ? O ALA D 267 
AD5 2 3 N ASP S  268 ? N ASP D 268 O ARG S  276 ? O ARG D 276 
AD6 1 2 O VAL S  318 ? O VAL D 318 N VAL S  311 ? N VAL D 311 
AD6 2 3 N LEU S  310 ? N LEU D 310 O VAL S  601 ? O VAL D 601 
AD6 3 4 O VAL S  600 ? O VAL D 600 N MET S  585 ? N MET D 585 
AD6 4 5 O VAL S  584 ? O VAL D 584 N TYR S  568 ? N TYR D 568 
AD6 5 6 O TYR S  567 ? O TYR D 567 N TYR S  344 ? N TYR D 344 
AD6 6 7 N LEU S  345 ? N LEU D 345 O ASP S  370 ? O ASP D 370 
AD7 1 2 O ILE S  464 ? O ILE D 464 N LEU S  450 ? N LEU D 450 
AD7 2 3 O ALA S  449 ? O ALA D 449 N VAL S  398 ? N VAL D 398 
AD7 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD7 4 5 N LEU S  505 ? N LEU D 505 O LEU S  533 ? O LEU D 533 
AD8 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AD9 1 2 O VAL S  771 ? O VAL D 771 N PHE S  692 ? N PHE D 692 
AD9 2 3 N ARG S  695 ? N ARG D 695 O ALA S  762 ? O ALA D 762 
AD9 3 4 O TYR S  759 ? O TYR D 759 N TRP S  717 ? N TRP D 717 
AD9 4 5 N LEU S  716 ? N LEU D 716 O VAL S  748 ? O VAL D 748 
AD9 5 6 O VAL S  743 ? O VAL D 743 N VAL S  736 ? N VAL D 736 
AD9 6 7 N GLU S  737 ? N GLU D 737 O ARG S  774 ? O ARG D 774 
AE1 1 2 N LEU T  28  ? N LEU E 28  O VAL T  45  ? O VAL E 45  
AE1 2 3 N THR T  46  ? N THR E 46  O GLU T  54  ? O GLU E 54  
AE2 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE2 2 3 O GLY T  351 ? O GLY E 351 N SER T  348 ? N SER E 348 
AE3 1 2 N GLY T  340 ? N GLY E 340 O SER T  359 ? O SER E 359 
AE3 2 3 N VAL T  358 ? N VAL E 358 O ARG T  367 ? O ARG E 367 
AE4 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE4 2 3 N LEU U  25  ? N LEU F 25  O PHE U  89  ? O PHE F 89  
AE4 3 4 O VAL U  92  ? O VAL F 92  N VAL U  70  ? N VAL F 70  
AE4 4 5 O VAL U  75  ? O VAL F 75  N PHE U  48  ? N PHE F 48  
AE5 1 2 N LEU U  101 ? N LEU F 101 O GLU U  127 ? O GLU F 127 
AE6 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE7 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE7 2 3 N MET V  78  ? N MET G 78  O ILE V  106 ? O ILE G 106 
AE7 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE8 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AE9 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AF1 1 2 N TYR W  69  ? N TYR O 69  O GLU W  92  ? O GLU O 92  
AF1 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AF2 1 2 N ALA X  35  ? N ALA I 35  O THR X  56  ? O THR I 56  
AF2 2 3 N LEU X  59  ? N LEU I 59  O PHE X  67  ? O PHE I 67  
AF2 3 4 N LEU X  69  ? N LEU I 69  O ARG X  85  ? O ARG I 85  
AF2 4 5 N LEU X  84  ? N LEU I 84  O LEU X  93  ? O LEU I 93  
AF2 5 6 N GLU X  98  ? N GLU I 98  O GLY X  102 ? O GLY I 102 
AF2 6 7 N LEU X  103 ? N LEU I 103 O LEU X  110 ? O LEU I 110 
AF3 1 2 N VAL Y  2   ? N VAL X 2   O ASP Y  56  ? O ASP X 56  
AF3 2 3 O LEU Y  57  ? O LEU X 57  N LEU Y  50  ? N LEU X 50  
AF3 3 4 O HIS Y  51  ? O HIS X 51  N LYS Y  30  ? N LYS X 30  
AF3 4 5 N LEU Y  33  ? N LEU X 33  O ALA Y  92  ? O ALA X 92  
AF3 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF4 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF5 1 2 N LEU DA 55  ? N LEU U 55  O VAL DA 61  ? O VAL U 61  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 8  'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 13 'binding site for residue FMN 1 502' 
AC3 Software 2 FES 201 ? 9  'binding site for residue FES 2 201' 
AC4 Software 3 SF4 801 ? 8  'binding site for residue SF4 3 801' 
AC5 Software 3 SF4 802 ? 5  'binding site for residue SF4 3 802' 
AC6 Software 3 SF4 803 ? 9  'binding site for residue SF4 3 803' 
AC7 Software 3 FES 804 ? 7  'binding site for residue FES 3 804' 
AC8 Software 4 HQH 501 ? 17 'binding site for residue HQH 4 501' 
AC9 Software 6 SF4 201 ? 10 'binding site for residue SF4 6 201' 
AD1 Software 9 SF4 201 ? 10 'binding site for residue SF4 9 201' 
AD2 Software 9 SF4 202 ? 12 'binding site for residue SF4 9 202' 
AD3 Software B SF4 501 ? 10 'binding site for residue SF4 B 501' 
AD4 Software B FMN 502 ? 14 'binding site for residue FMN B 502' 
AD5 Software C FES 201 ? 7  'binding site for residue FES C 201' 
AD6 Software D SF4 801 ? 8  'binding site for residue SF4 D 801' 
AD7 Software D SF4 802 ? 4  'binding site for residue SF4 D 802' 
AD8 Software D SF4 803 ? 9  'binding site for residue SF4 D 803' 
AD9 Software D FES 804 ? 7  'binding site for residue FES D 804' 
AE1 Software E HQH 501 ? 15 'binding site for residue HQH E 501' 
AE2 Software G SF4 201 ? 11 'binding site for residue SF4 G 201' 
AE3 Software O SF4 201 ? 10 'binding site for residue SF4 O 201' 
AE4 Software O SF4 202 ? 11 'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  PRO A  199 ? PRO 1 199 . ? 1_555 ? 
2   AC1 8  SER A  352 ? SER 1 352 . ? 1_555 ? 
3   AC1 8  CYS A  353 ? CYS 1 353 . ? 1_555 ? 
4   AC1 8  GLY A  354 ? GLY 1 354 . ? 1_555 ? 
5   AC1 8  LYS A  355 ? LYS 1 355 . ? 1_555 ? 
6   AC1 8  CYS A  356 ? CYS 1 356 . ? 1_555 ? 
7   AC1 8  CYS A  359 ? CYS 1 359 . ? 1_555 ? 
8   AC1 8  CYS A  400 ? CYS 1 400 . ? 1_555 ? 
9   AC2 13 GLY A  64  ? GLY 1 64  . ? 1_555 ? 
10  AC2 13 ARG A  65  ? ARG 1 65  . ? 1_555 ? 
11  AC2 13 GLY A  66  ? GLY 1 66  . ? 1_555 ? 
12  AC2 13 LYS A  75  ? LYS 1 75  . ? 1_555 ? 
13  AC2 13 ASN A  92  ? ASN 1 92  . ? 1_555 ? 
14  AC2 13 ASP A  94  ? ASP 1 94  . ? 1_555 ? 
15  AC2 13 SER A  96  ? SER 1 96  . ? 1_555 ? 
16  AC2 13 TYR A  180 ? TYR 1 180 . ? 1_555 ? 
17  AC2 13 GLY A  183 ? GLY 1 183 . ? 1_555 ? 
18  AC2 13 ILE A  218 ? ILE 1 218 . ? 1_555 ? 
19  AC2 13 ASN A  219 ? ASN 1 219 . ? 1_555 ? 
20  AC2 13 ASN A  220 ? ASN 1 220 . ? 1_555 ? 
21  AC2 13 THR A  223 ? THR 1 223 . ? 1_555 ? 
22  AC3 9  CYS B  83  ? CYS 2 83  . ? 1_555 ? 
23  AC3 9  THR B  85  ? THR 2 85  . ? 1_555 ? 
24  AC3 9  SER B  87  ? SER 2 87  . ? 1_555 ? 
25  AC3 9  CYS B  88  ? CYS 2 88  . ? 1_555 ? 
26  AC3 9  CYS B  124 ? CYS 2 124 . ? 1_555 ? 
27  AC3 9  LEU B  125 ? LEU 2 125 . ? 1_555 ? 
28  AC3 9  GLY B  126 ? GLY 2 126 . ? 1_555 ? 
29  AC3 9  SER B  127 ? SER 2 127 . ? 1_555 ? 
30  AC3 9  CYS B  128 ? CYS 2 128 . ? 1_555 ? 
31  AC4 8  HIS C  115 ? HIS 3 115 . ? 1_555 ? 
32  AC4 8  ASP C  118 ? ASP 3 118 . ? 1_555 ? 
33  AC4 8  CYS C  119 ? CYS 3 119 . ? 1_555 ? 
34  AC4 8  CYS C  122 ? CYS 3 122 . ? 1_555 ? 
35  AC4 8  CYS C  128 ? CYS 3 128 . ? 1_555 ? 
36  AC4 8  GLN C  131 ? GLN 3 131 . ? 1_555 ? 
37  AC4 8  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
38  AC4 8  GLY C  233 ? GLY 3 233 . ? 1_555 ? 
39  AC5 5  CYS C  181 ? CYS 3 181 . ? 1_555 ? 
40  AC5 5  CYS C  184 ? CYS 3 184 . ? 1_555 ? 
41  AC5 5  CYS C  187 ? CYS 3 187 . ? 1_555 ? 
42  AC5 5  CYS C  230 ? CYS 3 230 . ? 1_555 ? 
43  AC5 5  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
44  AC6 9  CYS C  256 ? CYS 3 256 . ? 1_555 ? 
45  AC6 9  LEU C  258 ? LEU 3 258 . ? 1_555 ? 
46  AC6 9  CYS C  259 ? CYS 3 259 . ? 1_555 ? 
47  AC6 9  VAL C  261 ? VAL 3 261 . ? 1_555 ? 
48  AC6 9  GLY C  262 ? GLY 3 262 . ? 1_555 ? 
49  AC6 9  CYS C  263 ? CYS 3 263 . ? 1_555 ? 
50  AC6 9  CYS C  291 ? CYS 3 291 . ? 1_555 ? 
51  AC6 9  GLY C  294 ? GLY 3 294 . ? 1_555 ? 
52  AC6 9  PRO C  407 ? PRO 3 407 . ? 1_555 ? 
53  AC7 7  CYS C  34  ? CYS 3 34  . ? 1_555 ? 
54  AC7 7  GLY C  43  ? GLY 3 43  . ? 1_555 ? 
55  AC7 7  CYS C  45  ? CYS 3 45  . ? 1_555 ? 
56  AC7 7  ARG C  46  ? ARG 3 46  . ? 1_555 ? 
57  AC7 7  MET C  47  ? MET 3 47  . ? 1_555 ? 
58  AC7 7  CYS C  48  ? CYS 3 48  . ? 1_555 ? 
59  AC7 7  CYS C  83  ? CYS 3 83  . ? 1_555 ? 
60  AC8 17 GLN D  33  ? GLN 4 33  . ? 1_555 ? 
61  AC8 17 HIS D  38  ? HIS 4 38  . ? 1_555 ? 
62  AC8 17 GLY D  39  ? GLY 4 39  . ? 1_555 ? 
63  AC8 17 VAL D  40  ? VAL 4 40  . ? 1_555 ? 
64  AC8 17 TYR D  87  ? TYR 4 87  . ? 1_555 ? 
65  AC8 17 THR D  135 ? THR 4 135 . ? 1_555 ? 
66  AC8 17 LEU D  138 ? LEU 4 138 . ? 1_555 ? 
67  AC8 17 LEU D  143 ? LEU 4 143 . ? 1_555 ? 
68  AC8 17 PRO D  402 ? PRO 4 402 . ? 1_555 ? 
69  AC8 17 VAL D  403 ? VAL 4 403 . ? 1_555 ? 
70  AC8 17 THR F  40  ? THR 6 40  . ? 1_555 ? 
71  AC8 17 GLY F  42  ? GLY 6 42  . ? 1_555 ? 
72  AC8 17 LEU F  43  ? LEU 6 43  . ? 1_555 ? 
73  AC8 17 MET F  51  ? MET 6 51  . ? 1_555 ? 
74  AC8 17 PHE F  68  ? PHE 6 68  . ? 1_555 ? 
75  AC8 17 GLU P  225 ? GLU H 225 . ? 1_555 ? 
76  AC8 17 GLN P  226 ? GLN H 226 . ? 1_555 ? 
77  AC9 10 ARG D  84  ? ARG 4 84  . ? 1_555 ? 
78  AC9 10 HIS D  169 ? HIS 4 169 . ? 1_555 ? 
79  AC9 10 CYS F  45  ? CYS 6 45  . ? 1_555 ? 
80  AC9 10 CYS F  46  ? CYS 6 46  . ? 1_555 ? 
81  AC9 10 ALA F  110 ? ALA 6 110 . ? 1_555 ? 
82  AC9 10 CYS F  111 ? CYS 6 111 . ? 1_555 ? 
83  AC9 10 PHE F  118 ? PHE 6 118 . ? 1_555 ? 
84  AC9 10 GLY F  139 ? GLY 6 139 . ? 1_555 ? 
85  AC9 10 CYS F  140 ? CYS 6 140 . ? 1_555 ? 
86  AC9 10 PRO F  141 ? PRO 6 141 . ? 1_555 ? 
87  AD1 10 HIS G  41  ? HIS 9 41  . ? 1_555 ? 
88  AD1 10 CYS G  63  ? CYS 9 63  . ? 1_555 ? 
89  AD1 10 ILE G  68  ? ILE 9 68  . ? 1_555 ? 
90  AD1 10 CYS G  98  ? CYS 9 98  . ? 1_555 ? 
91  AD1 10 ILE G  99  ? ILE 9 99  . ? 1_555 ? 
92  AD1 10 PHE G  100 ? PHE 9 100 . ? 1_555 ? 
93  AD1 10 CYS G  101 ? CYS 9 101 . ? 1_555 ? 
94  AD1 10 GLY G  102 ? GLY 9 102 . ? 1_555 ? 
95  AD1 10 LEU G  103 ? LEU 9 103 . ? 1_555 ? 
96  AD1 10 CYS G  104 ? CYS 9 104 . ? 1_555 ? 
97  AD2 12 CYS G  53  ? CYS 9 53  . ? 1_555 ? 
98  AD2 12 ILE G  54  ? ILE 9 54  . ? 1_555 ? 
99  AD2 12 GLY G  55  ? GLY 9 55  . ? 1_555 ? 
100 AD2 12 CYS G  56  ? CYS 9 56  . ? 1_555 ? 
101 AD2 12 SER G  57  ? SER 9 57  . ? 1_555 ? 
102 AD2 12 CYS G  59  ? CYS 9 59  . ? 1_555 ? 
103 AD2 12 TYR G  91  ? TYR 9 91  . ? 1_555 ? 
104 AD2 12 CYS G  108 ? CYS 9 108 . ? 1_555 ? 
105 AD2 12 PRO G  109 ? PRO 9 109 . ? 1_555 ? 
106 AD2 12 THR G  110 ? THR 9 110 . ? 1_555 ? 
107 AD2 12 ALA G  112 ? ALA 9 112 . ? 1_555 ? 
108 AD2 12 ILE G  113 ? ILE 9 113 . ? 1_555 ? 
109 AD3 10 PRO Q  199 ? PRO B 199 . ? 1_555 ? 
110 AD3 10 SER Q  352 ? SER B 352 . ? 1_555 ? 
111 AD3 10 CYS Q  353 ? CYS B 353 . ? 1_555 ? 
112 AD3 10 GLY Q  354 ? GLY B 354 . ? 1_555 ? 
113 AD3 10 LYS Q  355 ? LYS B 355 . ? 1_555 ? 
114 AD3 10 CYS Q  356 ? CYS B 356 . ? 1_555 ? 
115 AD3 10 CYS Q  359 ? CYS B 359 . ? 1_555 ? 
116 AD3 10 SER Q  398 ? SER B 398 . ? 1_555 ? 
117 AD3 10 PHE Q  399 ? PHE B 399 . ? 1_555 ? 
118 AD3 10 CYS Q  400 ? CYS B 400 . ? 1_555 ? 
119 AD4 14 GLY Q  64  ? GLY B 64  . ? 1_555 ? 
120 AD4 14 ARG Q  65  ? ARG B 65  . ? 1_555 ? 
121 AD4 14 GLY Q  66  ? GLY B 66  . ? 1_555 ? 
122 AD4 14 ALA Q  68  ? ALA B 68  . ? 1_555 ? 
123 AD4 14 LYS Q  75  ? LYS B 75  . ? 1_555 ? 
124 AD4 14 ASN Q  92  ? ASN B 92  . ? 1_555 ? 
125 AD4 14 ASP Q  94  ? ASP B 94  . ? 1_555 ? 
126 AD4 14 SER Q  96  ? SER B 96  . ? 1_555 ? 
127 AD4 14 GLY Q  183 ? GLY B 183 . ? 1_555 ? 
128 AD4 14 GLU Q  184 ? GLU B 184 . ? 1_555 ? 
129 AD4 14 ASN Q  219 ? ASN B 219 . ? 1_555 ? 
130 AD4 14 ASN Q  220 ? ASN B 220 . ? 1_555 ? 
131 AD4 14 THR Q  223 ? THR B 223 . ? 1_555 ? 
132 AD4 14 LEU Q  402 ? LEU B 402 . ? 1_555 ? 
133 AD5 7  CYS R  83  ? CYS C 83  . ? 1_555 ? 
134 AD5 7  CYS R  88  ? CYS C 88  . ? 1_555 ? 
135 AD5 7  CYS R  124 ? CYS C 124 . ? 1_555 ? 
136 AD5 7  LEU R  125 ? LEU C 125 . ? 1_555 ? 
137 AD5 7  GLY R  126 ? GLY C 126 . ? 1_555 ? 
138 AD5 7  SER R  127 ? SER C 127 . ? 1_555 ? 
139 AD5 7  CYS R  128 ? CYS C 128 . ? 1_555 ? 
140 AD6 8  HIS S  115 ? HIS D 115 . ? 1_555 ? 
141 AD6 8  ASP S  118 ? ASP D 118 . ? 1_555 ? 
142 AD6 8  CYS S  119 ? CYS D 119 . ? 1_555 ? 
143 AD6 8  CYS S  122 ? CYS D 122 . ? 1_555 ? 
144 AD6 8  GLY S  125 ? GLY D 125 . ? 1_555 ? 
145 AD6 8  CYS S  128 ? CYS D 128 . ? 1_555 ? 
146 AD6 8  GLN S  131 ? GLN D 131 . ? 1_555 ? 
147 AD6 8  ILE T  325 ? ILE E 325 . ? 1_555 ? 
148 AD7 4  CYS S  181 ? CYS D 181 . ? 1_555 ? 
149 AD7 4  CYS S  184 ? CYS D 184 . ? 1_555 ? 
150 AD7 4  CYS S  187 ? CYS D 187 . ? 1_555 ? 
151 AD7 4  CYS S  230 ? CYS D 230 . ? 1_555 ? 
152 AD8 9  CYS S  256 ? CYS D 256 . ? 1_555 ? 
153 AD8 9  LEU S  258 ? LEU D 258 . ? 1_555 ? 
154 AD8 9  CYS S  259 ? CYS D 259 . ? 1_555 ? 
155 AD8 9  VAL S  261 ? VAL D 261 . ? 1_555 ? 
156 AD8 9  GLY S  262 ? GLY D 262 . ? 1_555 ? 
157 AD8 9  CYS S  263 ? CYS D 263 . ? 1_555 ? 
158 AD8 9  ILE S  290 ? ILE D 290 . ? 1_555 ? 
159 AD8 9  CYS S  291 ? CYS D 291 . ? 1_555 ? 
160 AD8 9  ILE S  408 ? ILE D 408 . ? 1_555 ? 
161 AD9 7  LEU S  32  ? LEU D 32  . ? 1_555 ? 
162 AD9 7  CYS S  34  ? CYS D 34  . ? 1_555 ? 
163 AD9 7  CYS S  45  ? CYS D 45  . ? 1_555 ? 
164 AD9 7  ARG S  46  ? ARG D 46  . ? 1_555 ? 
165 AD9 7  MET S  47  ? MET D 47  . ? 1_555 ? 
166 AD9 7  CYS S  48  ? CYS D 48  . ? 1_555 ? 
167 AD9 7  CYS S  83  ? CYS D 83  . ? 1_555 ? 
168 AE1 15 GLN T  33  ? GLN E 33  . ? 1_555 ? 
169 AE1 15 HIS T  38  ? HIS E 38  . ? 1_555 ? 
170 AE1 15 GLY T  39  ? GLY E 39  . ? 1_555 ? 
171 AE1 15 TYR T  87  ? TYR E 87  . ? 1_555 ? 
172 AE1 15 LEU T  88  ? LEU E 88  . ? 1_555 ? 
173 AE1 15 THR T  135 ? THR E 135 . ? 1_555 ? 
174 AE1 15 LEU T  138 ? LEU E 138 . ? 1_555 ? 
175 AE1 15 ASP T  401 ? ASP E 401 . ? 1_555 ? 
176 AE1 15 PRO T  402 ? PRO E 402 . ? 1_555 ? 
177 AE1 15 GLY V  42  ? GLY G 42  . ? 1_555 ? 
178 AE1 15 LEU V  43  ? LEU G 43  . ? 1_555 ? 
179 AE1 15 MET V  51  ? MET G 51  . ? 1_555 ? 
180 AE1 15 PHE V  68  ? PHE G 68  . ? 1_555 ? 
181 AE1 15 GLU FA 225 ? GLU Q 225 . ? 1_555 ? 
182 AE1 15 GLN FA 226 ? GLN Q 226 . ? 1_555 ? 
183 AE2 11 ARG T  84  ? ARG E 84  . ? 1_555 ? 
184 AE2 11 CYS V  45  ? CYS G 45  . ? 1_555 ? 
185 AE2 11 CYS V  46  ? CYS G 46  . ? 1_555 ? 
186 AE2 11 GLY V  82  ? GLY G 82  . ? 1_555 ? 
187 AE2 11 ARG V  83  ? ARG G 83  . ? 1_555 ? 
188 AE2 11 ALA V  110 ? ALA G 110 . ? 1_555 ? 
189 AE2 11 CYS V  111 ? CYS G 111 . ? 1_555 ? 
190 AE2 11 PHE V  118 ? PHE G 118 . ? 1_555 ? 
191 AE2 11 GLY V  139 ? GLY G 139 . ? 1_555 ? 
192 AE2 11 CYS V  140 ? CYS G 140 . ? 1_555 ? 
193 AE2 11 PRO V  141 ? PRO G 141 . ? 1_555 ? 
194 AE3 10 HIS W  41  ? HIS O 41  . ? 1_555 ? 
195 AE3 10 CYS W  63  ? CYS O 63  . ? 1_555 ? 
196 AE3 10 ALA W  65  ? ALA O 65  . ? 1_555 ? 
197 AE3 10 ILE W  68  ? ILE O 68  . ? 1_555 ? 
198 AE3 10 CYS W  98  ? CYS O 98  . ? 1_555 ? 
199 AE3 10 ILE W  99  ? ILE O 99  . ? 1_555 ? 
200 AE3 10 PHE W  100 ? PHE O 100 . ? 1_555 ? 
201 AE3 10 CYS W  101 ? CYS O 101 . ? 1_555 ? 
202 AE3 10 GLY W  102 ? GLY O 102 . ? 1_555 ? 
203 AE3 10 CYS W  104 ? CYS O 104 . ? 1_555 ? 
204 AE4 11 CYS W  53  ? CYS O 53  . ? 1_555 ? 
205 AE4 11 ILE W  54  ? ILE O 54  . ? 1_555 ? 
206 AE4 11 GLY W  55  ? GLY O 55  . ? 1_555 ? 
207 AE4 11 CYS W  56  ? CYS O 56  . ? 1_555 ? 
208 AE4 11 SER W  57  ? SER O 57  . ? 1_555 ? 
209 AE4 11 CYS W  59  ? CYS O 59  . ? 1_555 ? 
210 AE4 11 VAL W  70  ? VAL O 70  . ? 1_555 ? 
211 AE4 11 TYR W  91  ? TYR O 91  . ? 1_555 ? 
212 AE4 11 CYS W  108 ? CYS O 108 . ? 1_555 ? 
213 AE4 11 PRO W  109 ? PRO O 109 . ? 1_555 ? 
214 AE4 11 ILE W  113 ? ILE O 113 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1   1 CD2 D HIS 115 ? ? FE3 D SF4 801 ? ? 1.64 
2   1 NE2 3 HIS 115 ? ? FE3 3 SF4 801 ? ? 1.68 
3   1 SG  D CYS 259 ? ? FE4 D SF4 803 ? ? 1.82 
4   1 SG  G CYS 45  ? ? FE3 G SF4 201 ? ? 1.88 
5   1 NE2 3 HIS 115 ? ? S4  3 SF4 801 ? ? 1.91 
6   1 O   H TRP 292 ? ? OG1 H THR 296 ? ? 1.97 
7   1 OE1 X GLU 91  ? ? OH  X TYR 126 ? ? 2.03 
8   1 NE2 D HIS 115 ? ? S2  D SF4 801 ? ? 2.05 
9   1 OH  B TYR 32  ? ? OE1 B GLU 116 ? ? 2.05 
10  1 O   Q TRP 292 ? ? OG1 Q THR 296 ? ? 2.06 
11  1 OH  B TYR 18  ? ? O   B LYS 102 ? ? 2.07 
12  1 OG  6 SER 114 ? ? O   9 LEU 96  ? ? 2.07 
13  1 OG1 F THR 182 ? ? O   F TYR 184 ? ? 2.07 
14  1 O   4 GLU 333 ? ? OG  4 SER 363 ? ? 2.08 
15  1 OD2 3 ASP 8   ? ? OH  3 TYR 28  ? ? 2.08 
16  1 OE2 E GLU 185 ? ? OH  O TYR 165 ? ? 2.08 
17  1 OG  N SER 261 ? ? OH  N TYR 375 ? ? 2.09 
18  1 O   M LEU 332 ? ? OG1 M THR 336 ? ? 2.09 
19  1 OH  T TYR 280 ? ? O   T ALA 531 ? ? 2.09 
20  1 O   U LEU 332 ? ? OG1 U THR 336 ? ? 2.09 
21  1 O   G MET 50  ? ? OG  G SER 53  ? ? 2.10 
22  1 OH  T TYR 305 ? ? O   T ALA 406 ? ? 2.10 
23  1 O   B ALA 372 ? ? OG1 B THR 376 ? ? 2.10 
24  1 O   L TRP 59  ? ? NH2 M ARG 452 ? ? 2.10 
25  1 O   Q GLN 43  ? ? N   Q ARG 45  ? ? 2.10 
26  1 O   J ALA 60  ? ? OH  H TYR 134 ? ? 2.10 
27  1 ND2 3 ASN 286 ? ? O   3 TRP 289 ? ? 2.10 
28  1 OH  H TYR 162 ? ? O   H LEU 305 ? ? 2.10 
29  1 O   R ALA 60  ? ? OH  Q TYR 134 ? ? 2.10 
30  1 O   H ALA 29  ? ? OG1 H THR 32  ? ? 2.10 
31  1 OH  L TYR 564 ? ? O   M PRO 209 ? ? 2.11 
32  1 OG  R SER 15  ? ? O   R ALA 31  ? ? 2.11 
33  1 OG1 3 THR 697 ? ? O   3 ALA 762 ? ? 2.11 
34  1 O   6 MET 50  ? ? OG  6 SER 53  ? ? 2.12 
35  1 O   A LYS 35  ? ? NZ  A LYS 40  ? ? 2.12 
36  1 OE2 E GLU 152 ? ? OH  E TYR 204 ? ? 2.12 
37  1 O   I LEU 103 ? ? N   I LEU 110 ? ? 2.12 
38  1 OE2 E GLU 341 ? ? OH  F TYR 57  ? ? 2.12 
39  1 CB  D CYS 83  ? ? FE2 D FES 804 ? ? 2.12 
40  1 O   U PHE 217 ? ? ND2 U ASN 221 ? ? 2.13 
41  1 OH  9 TYR 26  ? ? OE2 9 GLU 120 ? ? 2.13 
42  1 OD1 3 ASP 419 ? ? NZ  3 LYS 447 ? ? 2.13 
43  1 OG  J SER 15  ? ? O   J ALA 31  ? ? 2.13 
44  1 OE1 1 GLU 95  ? ? OH  1 TYR 138 ? ? 2.13 
45  1 NZ  F LYS 134 ? ? O   F LEU 141 ? ? 2.13 
46  1 O   E GLU 333 ? ? OG  E SER 363 ? ? 2.13 
47  1 OE1 P GLN 5   ? ? OH  Q TYR 10  ? ? 2.14 
48  1 OD2 D ASP 8   ? ? OH  D TYR 28  ? ? 2.14 
49  1 O   P LYS 35  ? ? NZ  P LYS 40  ? ? 2.14 
50  1 OH  E TYR 172 ? ? O   E GLU 180 ? ? 2.14 
51  1 O   M PHE 122 ? ? OH  M TYR 234 ? ? 2.14 
52  1 O   B ARG 260 ? ? OH  B TYR 264 ? ? 2.14 
53  1 OH  1 TYR 131 ? ? O   2 LYS 17  ? ? 2.15 
54  1 OH  3 TYR 190 ? ? O   3 PHE 222 ? ? 2.15 
55  1 OG  V SER 261 ? ? OH  V TYR 375 ? ? 2.15 
56  1 O   3 CYS 48  ? ? OG  3 SER 82  ? ? 2.15 
57  1 O   M PHE 217 ? ? ND2 M ASN 221 ? ? 2.15 
58  1 OH  N TYR 136 ? ? NZ  N LYS 186 ? ? 2.15 
59  1 O   Q ALA 29  ? ? OG1 Q THR 32  ? ? 2.15 
60  1 OXT 1 ARG 438 ? ? OG1 2 THR 146 ? ? 2.16 
61  1 OG  E SER 128 ? ? NH2 E ARG 350 ? ? 2.16 
62  1 O   J ASP 47  ? ? N   J GLY 122 ? ? 2.16 
63  1 OH  L TYR 280 ? ? O   L ALA 531 ? ? 2.16 
64  1 O   B GLY 25  ? ? OG1 B THR 28  ? ? 2.16 
65  1 OH  T TYR 124 ? ? OG  T SER 256 ? ? 2.16 
66  1 NH1 J ARG 49  ? ? OD2 H ASP 119 ? ? 2.17 
67  1 OG  3 SER 271 ? ? OH  9 TYR 69  ? ? 2.17 
68  1 O   H GLN 43  ? ? N   H ARG 45  ? ? 2.17 
69  1 O   1 ALA 372 ? ? OG1 1 THR 376 ? ? 2.17 
70  1 NZ  O LYS 52  ? ? OE2 O GLU 171 ? ? 2.17 
71  1 OG1 N THR 2   ? ? OG  N SER 39  ? ? 2.17 
72  1 OD2 3 ASP 401 ? ? OH  3 TYR 454 ? ? 2.17 
73  1 OD2 D ASP 94  ? ? OG  D SER 97  ? ? 2.17 
74  1 OE1 N GLN 128 ? ? NH2 N ARG 306 ? ? 2.17 
75  1 O   9 GLU 149 ? ? OG1 9 THR 153 ? ? 2.17 
76  1 OH  M TYR 313 ? ? O   M MET 443 ? ? 2.17 
77  1 NE2 1 GLN 288 ? ? O   1 VAL 335 ? ? 2.18 
78  1 OD1 Q ASP 71  ? ? NZ  Q LYS 240 ? ? 2.18 
79  1 OH  T TYR 564 ? ? O   U PRO 209 ? ? 2.18 
80  1 O   H ARG 50  ? ? N   H GLY 52  ? ? 2.18 
81  1 O   B GLY 354 ? ? NH1 B ARG 360 ? ? 2.18 
82  1 NZ  H LYS 16  ? ? O   H TRP 114 ? ? 2.18 
83  1 O   R VAL 17  ? ? OG1 R THR 21  ? ? 2.18 
84  1 O   Q ARG 50  ? ? N   Q GLY 52  ? ? 2.18 
85  1 O   O GLU 149 ? ? OG1 O THR 153 ? ? 2.18 
86  1 OE2 D GLU 198 ? ? NH1 D ARG 440 ? ? 2.18 
87  1 ND1 W HIS 51  ? ? OD1 W ASP 56  ? ? 2.18 
88  1 OD1 D ASP 419 ? ? NZ  D LYS 447 ? ? 2.18 
89  1 OH  1 TYR 32  ? ? OE1 1 GLU 116 ? ? 2.18 
90  1 OH  4 TYR 148 ? ? O   H PHE 42  ? ? 2.18 
91  1 O   4 GLN 77  ? ? OG1 4 THR 80  ? ? 2.18 
92  1 OE1 B GLU 95  ? ? OH  B TYR 138 ? ? 2.18 
93  1 O   V SER 59  ? ? OG1 V THR 63  ? ? 2.18 
94  1 O   V ALA 120 ? ? OG1 V THR 123 ? ? 2.19 
95  1 N   E MET 26  ? ? O   E LEU 47  ? ? 2.19 
96  1 O   3 GLU 710 ? ? NH1 3 ARG 713 ? ? 2.19 
97  1 O   3 LEU 728 ? ? NE2 3 HIS 749 ? ? 2.19 
98  1 O   N ALA 120 ? ? OG1 N THR 123 ? ? 2.19 
99  1 O   Q ASN 117 ? ? ND2 Q ASN 181 ? ? 2.19 
100 1 OH  E TYR 148 ? ? O   Q PHE 42  ? ? 2.19 
101 1 O   S GLY 95  ? ? NE2 V GLN 251 ? ? 2.19 
102 1 N   D GLY 224 ? ? OD1 D ASP 292 ? ? 2.19 
103 1 OE2 O GLU 171 ? ? NH2 I ARG 43  ? ? 2.19 
104 1 NH1 D ARG 9   ? ? O   D ALA 26  ? ? 2.19 
105 1 NE2 L GLN 288 ? ? O   L SER 528 ? ? 2.19 
106 1 OH  V TYR 136 ? ? NZ  V LYS 186 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 TYR 1 38  ? ? 68.65   -3.49   
2   1 LYS 1 81  ? ? 72.43   -11.45  
3   1 ASP 1 82  ? ? -166.68 116.27  
4   1 ALA 1 177 ? ? -140.97 22.79   
5   1 CYS 1 182 ? ? -58.44  -7.75   
6   1 PHE 1 366 ? ? -95.88  -61.38  
7   1 ASN 2 137 ? ? 66.22   -25.88  
8   1 ASP 2 138 ? ? -155.04 -1.37   
9   1 ASN 3 7   ? ? 65.98   -27.84  
10  1 ASP 3 8   ? ? -157.04 -0.84   
11  1 HIS 3 38  ? ? 56.36   14.61   
12  1 PRO 3 172 ? ? -53.55  -8.71   
13  1 LEU 3 218 ? ? 57.33   72.56   
14  1 CYS 3 230 ? ? -47.59  109.09  
15  1 GLU 3 314 ? ? -106.34 72.25   
16  1 MET 3 673 ? ? 68.66   -4.16   
17  1 PRO 3 765 ? ? -80.68  44.81   
18  1 GLN 4 33  ? ? 72.52   -2.02   
19  1 GLU 4 51  ? ? -79.33  -163.12 
20  1 MET 4 85  ? ? -94.64  -62.17  
21  1 LEU 4 88  ? ? -92.85  -61.22  
22  1 ASP 4 401 ? ? 45.19   72.10   
23  1 ALA 6 56  ? ? -90.78  45.83   
24  1 ARG 6 57  ? ? -133.49 -30.99  
25  1 PRO 6 102 ? ? -67.98  78.74   
26  1 CYS 6 140 ? ? -153.34 85.40   
27  1 ARG 6 178 ? ? -173.62 142.04  
28  1 THR 9 23  ? ? 178.47  161.45  
29  1 SER 9 57  ? ? 56.83   19.80   
30  1 PHE 9 100 ? ? 62.76   63.40   
31  1 GLU 9 178 ? ? 68.85   -5.33   
32  1 MET 7 44  ? ? -95.49  -63.11  
33  1 ARG 7 88  ? ? 68.81   -3.14   
34  1 TRP W 37  ? ? 60.11   72.82   
35  1 TYR A 44  ? ? 179.51  159.70  
36  1 GLU A 45  ? ? 60.53   72.48   
37  1 SER A 46  ? ? 66.72   63.76   
38  1 ALA J 76  ? ? 48.18   14.52   
39  1 GLU J 158 ? ? 27.84   61.04   
40  1 LEU K 51  ? ? 71.90   -5.53   
41  1 GLU K 83  ? ? -75.64  -166.39 
42  1 SER K 91  ? ? -140.52 17.78   
43  1 PRO L 10  ? ? -82.56  40.26   
44  1 TYR L 151 ? ? -91.48  47.09   
45  1 ALA L 152 ? ? -124.26 -51.04  
46  1 MET L 245 ? ? 70.69   -10.58  
47  1 GLN L 361 ? ? 67.30   -5.09   
48  1 PHE L 517 ? ? 52.39   75.06   
49  1 HIS M 43  ? ? -50.01  109.80  
50  1 LEU M 55  ? ? -120.56 -52.62  
51  1 ARG M 90  ? ? 72.37   -8.12   
52  1 GLU M 188 ? ? 59.85   8.33    
53  1 ALA M 249 ? ? -153.97 72.38   
54  1 THR M 304 ? ? 49.14   78.14   
55  1 LEU M 397 ? ? -83.67  49.96   
56  1 GLU M 416 ? ? -73.85  -169.91 
57  1 PHE M 446 ? ? -119.29 55.18   
58  1 LYS N 46  ? ? -119.68 76.96   
59  1 ASP N 56  ? ? -126.45 -169.56 
60  1 PHE N 84  ? ? -56.29  -6.19   
61  1 THR N 123 ? ? -100.79 75.58   
62  1 PRO N 191 ? ? -85.78  40.09   
63  1 THR N 213 ? ? -90.82  -65.55  
64  1 ALA N 227 ? ? -95.26  36.27   
65  1 ALA N 270 ? ? -59.58  -6.62   
66  1 ALA N 278 ? ? 68.08   -5.31   
67  1 PRO N 338 ? ? -98.73  47.59   
68  1 PRO N 393 ? ? -79.24  41.06   
69  1 ALA N 422 ? ? -110.07 78.56   
70  1 ALA N 424 ? ? -78.81  -160.68 
71  1 GLN H 43  ? ? -91.43  48.74   
72  1 VAL H 44  ? ? 49.46   -56.27  
73  1 ARG H 50  ? ? -75.57  -143.66 
74  1 VAL H 51  ? ? -45.98  15.46   
75  1 PHE H 68  ? ? 71.21   -1.79   
76  1 GLU H 70  ? ? 60.09   70.88   
77  1 ILE H 100 ? ? -58.95  108.93  
78  1 PHE H 108 ? ? -96.91  38.55   
79  1 TYR H 111 ? ? -108.65 -67.69  
80  1 LEU H 118 ? ? -49.78  151.13  
81  1 TRP H 194 ? ? 53.42   71.91   
82  1 ALA H 214 ? ? 77.66   -5.28   
83  1 ALA H 215 ? ? -64.01  -72.06  
84  1 ARG H 216 ? ? 177.97  176.63  
85  1 PHE H 219 ? ? 57.83   2.26    
86  1 ASP H 220 ? ? -92.14  48.71   
87  1 THR H 234 ? ? 80.37   -4.08   
88  1 TRP H 267 ? ? -37.62  -71.63  
89  1 THR H 268 ? ? 23.16   57.69   
90  1 LEU H 272 ? ? 71.53   -11.03  
91  1 GLU H 273 ? ? 35.67   53.57   
92  1 ARG H 301 ? ? 69.41   -2.80   
93  1 TYR H 302 ? ? 67.25   -9.79   
94  1 ASP H 331 ? ? 57.16   7.44    
95  1 TYR B 38  ? ? 67.75   -4.70   
96  1 LYS B 81  ? ? 74.66   -13.72  
97  1 ASP B 82  ? ? -168.78 114.55  
98  1 TRP B 279 ? ? -90.37  -60.52  
99  1 PRO B 401 ? ? -66.39  2.19    
100 1 GLU C 123 ? ? -78.97  -166.18 
101 1 ASN C 137 ? ? 67.41   -26.44  
102 1 ASP C 138 ? ? -155.81 -1.17   
103 1 ASN D 7   ? ? 64.80   -27.13  
104 1 ASP D 8   ? ? -156.07 -0.78   
105 1 HIS D 38  ? ? 56.01   15.90   
106 1 ALA D 44  ? ? -121.42 -52.36  
107 1 PRO D 172 ? ? -55.21  -9.89   
108 1 GLU D 193 ? ? -93.14  -63.14  
109 1 LEU D 218 ? ? 56.31   70.60   
110 1 CYS D 230 ? ? -51.44  109.01  
111 1 GLN D 303 ? ? -93.38  -62.02  
112 1 GLU D 314 ? ? -105.97 73.22   
113 1 ASN D 502 ? ? -150.79 76.74   
114 1 PHE D 570 ? ? -161.12 -168.30 
115 1 MET D 673 ? ? 67.00   -4.73   
116 1 PRO D 765 ? ? -82.29  44.07   
117 1 GLU E 51  ? ? -79.47  -163.17 
118 1 ARG E 84  ? ? -68.63  5.22    
119 1 MET E 85  ? ? -96.68  -61.93  
120 1 LEU E 88  ? ? -93.10  -63.29  
121 1 GLU E 210 ? ? -91.47  57.76   
122 1 SER E 255 ? ? -90.26  31.17   
123 1 THR E 332 ? ? -95.11  -60.28  
124 1 ALA G 56  ? ? -88.22  48.34   
125 1 ARG G 57  ? ? -131.15 -34.98  
126 1 GLN G 74  ? ? -140.08 10.94   
127 1 PRO G 102 ? ? -67.19  77.00   
128 1 ARG G 178 ? ? -172.35 143.86  
129 1 THR O 23  ? ? 179.28  161.74  
130 1 ASN O 79  ? ? -119.07 69.72   
131 1 PHE O 100 ? ? 63.26   63.53   
132 1 GLU O 178 ? ? 69.72   -4.57   
133 1 MET I 44  ? ? -95.16  -62.83  
134 1 ARG I 88  ? ? 67.91   -3.07   
135 1 HIS I 90  ? ? 39.76   58.93   
136 1 TRP X 37  ? ? 60.33   72.54   
137 1 GLU P 45  ? ? 61.36   72.58   
138 1 SER P 46  ? ? 66.77   62.90   
139 1 ALA R 76  ? ? 48.90   19.01   
140 1 GLU R 158 ? ? 27.06   61.56   
141 1 LEU S 51  ? ? 71.97   -6.82   
142 1 GLU S 83  ? ? -74.75  -165.39 
143 1 PRO T 10  ? ? -83.85  36.90   
144 1 PHE T 20  ? ? -90.81  -67.05  
145 1 ALA T 152 ? ? -120.41 -50.17  
146 1 MET T 245 ? ? 71.21   -10.64  
147 1 GLN T 361 ? ? 64.75   -3.00   
148 1 PRO T 396 ? ? -63.70  -178.76 
149 1 HIS T 436 ? ? -140.07 34.29   
150 1 LEU T 477 ? ? -160.59 -169.63 
151 1 PHE T 517 ? ? 53.68   74.45   
152 1 HIS U 43  ? ? -49.76  108.41  
153 1 ARG U 90  ? ? 71.12   -7.18   
154 1 LYS U 235 ? ? -99.41  37.35   
155 1 ALA U 249 ? ? -153.23 72.58   
156 1 THR U 304 ? ? 49.78   77.80   
157 1 TYR U 344 ? ? 60.24   65.16   
158 1 LEU U 397 ? ? -86.61  48.98   
159 1 GLU U 416 ? ? -73.18  -169.47 
160 1 LYS V 46  ? ? -117.87 79.53   
161 1 PHE V 84  ? ? -55.17  -6.94   
162 1 PRO V 191 ? ? -85.46  36.44   
163 1 THR V 213 ? ? -90.82  -64.05  
164 1 ALA V 227 ? ? -91.22  33.04   
165 1 ALA V 278 ? ? 67.12   -5.34   
166 1 PRO V 338 ? ? -96.17  46.14   
167 1 TRP V 358 ? ? -107.10 -60.13  
168 1 PRO V 393 ? ? -78.56  42.33   
169 1 ALA V 424 ? ? -79.42  -161.34 
170 1 GLN Q 43  ? ? -89.12  45.51   
171 1 VAL Q 44  ? ? 40.03   -24.10  
172 1 ARG Q 50  ? ? -76.63  -138.72 
173 1 VAL Q 51  ? ? -31.97  -4.93   
174 1 PHE Q 68  ? ? 72.87   -0.77   
175 1 PHE Q 108 ? ? -96.37  38.13   
176 1 TYR Q 111 ? ? -110.29 -71.22  
177 1 TRP Q 194 ? ? 53.80   71.40   
178 1 ALA Q 214 ? ? 73.59   -5.83   
179 1 ALA Q 215 ? ? -63.29  -73.29  
180 1 ARG Q 216 ? ? 175.95  176.53  
181 1 PHE Q 219 ? ? 59.04   -2.56   
182 1 ASP Q 220 ? ? -96.09  48.32   
183 1 THR Q 234 ? ? 79.12   -4.63   
184 1 THR Q 268 ? ? 30.35   47.20   
185 1 LEU Q 272 ? ? 71.04   -11.83  
186 1 GLU Q 273 ? ? 34.40   53.32   
187 1 ARG Q 301 ? ? 66.90   -4.44   
188 1 TYR Q 302 ? ? 69.96   -11.34  
189 1 ASP Q 331 ? ? 58.49   4.46    
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 PRO 9 21  ? ? VAL 9 22  ? ? -146.01 
2 1 THR H 217 ? ? PRO H 218 ? ? 113.05  
3 1 GLY H 266 ? ? TRP H 267 ? ? -138.77 
4 1 PRO O 21  ? ? VAL O 22  ? ? -148.02 
5 1 THR Q 217 ? ? PRO Q 218 ? ? 113.78  
6 1 GLY Q 266 ? ? TRP Q 267 ? ? -145.70 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1   ? refined -41.4016  19.6143  406.7396 1.4624 1.4061  1.0904 -0.0382 0.3474  0.3234  0.0051  0.0008  0.0240 
0.0007  -0.0133 -0.0077 0.1750  -0.1105 0.1595  -0.0335 -0.0927 -0.0979 0.0820  0.1732  -0.0015 
'X-RAY DIFFRACTION' 2   ? refined -24.4700  27.6984  397.4523 1.3231 1.1484  0.8078 0.4446  -0.3327 0.2296  0.1321  0.1090  0.0642 
0.0726  -0.0555 0.0226  0.1553  0.1324  -0.1029 0.0395  0.1365  0.1391  0.0421  -0.1331 0.1546  
'X-RAY DIFFRACTION' 3   ? refined -29.8109  26.0017  383.8670 1.3170 1.3036  1.6601 -0.2838 -0.0548 0.8407  0.0232  0.0432  0.0266 
-0.0185 -0.0168 -0.0040 0.0693  -0.0517 -0.0873 -0.0024 0.0493  0.0518  -0.1181 -0.0579 0.0859  
'X-RAY DIFFRACTION' 4   ? refined -44.7892  31.4698  393.6605 1.2433 1.3881  0.5863 -0.4810 0.2633  0.2297  0.0144  0.0664  0.3133 
-0.0294 -0.0324 0.0491  0.0102  0.0574  0.0656  -0.0360 0.1279  0.1208  0.1865  0.1125  0.3437  
'X-RAY DIFFRACTION' 5   ? refined -39.1070  33.0359  385.3474 1.0229 0.4537  0.9822 -0.3979 0.3073  -0.0783 0.0065  0.0018  0.2126 
0.0094  -0.0395 -0.0221 -0.1979 0.0751  0.1172  0.0884  -0.0564 0.1053  0.0651  -0.0100 -0.5597 
'X-RAY DIFFRACTION' 6   ? refined -48.7134  8.2912   386.7351 0.7499 0.5265  0.2525 -0.1552 -0.1533 0.2825  0.0644  0.0357  0.1941 
-0.0101 0.1237  -0.0040 -0.1054 -0.2686 -0.1119 0.0492  -0.0133 -0.0244 0.0541  0.2359  -0.5655 
'X-RAY DIFFRACTION' 7   ? refined -58.4107  5.4457   370.5900 0.8127 0.4919  0.8119 -0.0377 0.2769  0.1982  0.1341  0.0039  0.0521 
0.0058  0.0557  0.0104  0.1922  -0.2880 0.0839  -0.1383 -0.1555 0.0789  -0.1640 0.0756  -0.2712 
'X-RAY DIFFRACTION' 8   ? refined -51.8236  50.3135  385.9231 1.2089 1.4997  0.6263 -0.4366 0.0534  -0.1531 0.0354  0.0056  0.0181 
0.0038  0.0152  0.0109  0.0176  -0.0814 0.0491  0.1002  -0.0832 -0.0364 0.0074  -0.1133 -0.0007 
'X-RAY DIFFRACTION' 9   ? refined -57.7576  42.7508  382.9090 1.3571 2.1673  1.5146 0.1458  -0.0340 -0.1511 0.0328  0.0093  0.0193 
0.0052  0.0187  0.0119  0.0561  0.0462  -0.0724 0.1112  0.1794  0.1566  -0.0891 0.0966  0.0010  
'X-RAY DIFFRACTION' 10  ? refined -59.9972  44.6999  374.3079 0.7207 0.7075  0.7147 -0.2157 0.1849  -0.3892 0.2004  0.2917  0.4363 
-0.0346 -0.0998 -0.3146 -0.2763 -0.2289 0.1047  0.1279  0.0046  0.0901  -0.1173 -0.0083 -0.0855 
'X-RAY DIFFRACTION' 11  ? refined -66.0577  35.1432  380.6052 1.4094 1.3156  1.6389 -0.1229 -0.1445 -0.6714 0.0560  0.0084  0.0128 
0.0039  -0.0271 -0.0054 0.0625  0.1698  -0.0383 -0.0768 0.1179  -0.0119 0.0068  -0.0002 0.0006  
'X-RAY DIFFRACTION' 12  ? refined -66.2572  19.6168  386.0628 1.3070 1.0584  1.0244 -0.4208 0.4181  0.0774  0.4994  0.0039  0.4669 
0.0439  0.4812  0.0417  0.0900  0.2132  -0.0292 -0.1041 0.2062  0.0055  0.1387  0.1064  -0.0037 
'X-RAY DIFFRACTION' 13  ? refined -76.0071  17.5642  384.3813 1.2453 1.2738  0.8086 -0.3479 0.0902  0.2141  0.0019  0.0049  0.0146 
-0.0009 0.0051  0.0029  -0.0277 0.0246  -0.0443 0.0770  -0.0570 -0.0686 0.0469  -0.0265 0.0006  
'X-RAY DIFFRACTION' 14  ? refined -79.3709  30.1370  382.0198 1.1277 1.4562  0.6777 -0.0444 -0.0239 0.0840  0.0099  0.0007  0.0235 
-0.0003 -0.0148 0.0022  -0.0430 -0.0571 -0.0237 0.0570  -0.0019 0.0563  -0.0486 -0.0688 0.0001  
'X-RAY DIFFRACTION' 15  ? refined -64.5597  21.7293  387.3736 1.3862 0.7628  1.0739 -0.1584 -0.1077 0.4645  0.0543  0.0940  0.0295 
0.0411  -0.0154 -0.0533 0.0727  -0.0862 -0.0129 0.0454  -0.1102 0.0724  -0.0313 0.1129  0.0247  
'X-RAY DIFFRACTION' 16  ? refined -65.5747  25.2765  393.3362 1.0735 0.7506  1.1237 -0.4451 0.2725  0.3670  0.0461  0.0515  0.2048 
0.0352  0.0481  -0.0238 0.0071  -0.0014 0.0034  0.0077  0.0185  -0.0342 -0.0432 0.0042  -0.0596 
'X-RAY DIFFRACTION' 17  ? refined -77.0430  23.2110  395.8909 1.2744 1.3064  0.8799 -0.2969 0.4424  0.4516  0.0081  0.0014  0.0675 
0.0032  0.0228  0.0104  0.0374  -0.0630 -0.0001 0.0149  0.0074  0.0543  0.0886  0.0294  0.2435  
'X-RAY DIFFRACTION' 18  ? refined -72.2555  33.5552  401.1473 1.2052 1.3677  1.6457 -0.4280 0.1430  0.0477  0.0198  0.0078  0.0019 
-0.0107 0.0004  -0.0017 0.0162  -0.0267 0.0123  -0.0069 -0.0216 0.0395  -0.0808 0.0074  -0.0011 
'X-RAY DIFFRACTION' 19  ? refined -64.0047  16.5994  402.9889 1.3976 1.8865  0.7265 0.2788  0.2412  0.4573  0.0175  0.0938  0.0594 
-0.0296 -0.0201 0.0122  -0.0216 0.0093  -0.0159 0.0699  -0.0209 -0.0066 0.0185  0.0413  -0.0311 
'X-RAY DIFFRACTION' 20  ? refined -39.5344  21.1384  352.5849 0.6269 0.2249  0.7947 -0.2650 0.2324  -0.0792 0.0515  0.0862  0.4957 
-0.0020 0.1641  -0.0003 -0.2966 0.0573  0.2226  -0.1394 -0.1127 0.0346  -0.0496 0.0590  -1.2171 
'X-RAY DIFFRACTION' 21  ? refined -57.4034  24.6817  353.8621 0.4661 0.2384  0.7986 -0.3714 0.3816  -0.1755 0.2043  0.1088  0.0253 
0.1430  0.0710  0.0474  0.0691  0.0257  0.1075  0.0278  0.1074  0.1742  0.1106  -0.1257 1.7132  
'X-RAY DIFFRACTION' 22  ? refined -53.8439  43.1494  345.1123 0.3154 -0.6113 1.0692 -0.3164 0.3850  -0.2269 0.0518  0.2268  0.0059 
0.0402  0.0153  0.0060  0.1304  -0.2922 -0.1165 0.1550  0.1246  0.2675  -0.0913 0.0697  1.2097  
'X-RAY DIFFRACTION' 23  ? refined -54.4861  70.9839  318.5340 0.6438 0.3955  0.6081 0.1412  -0.2758 -0.2364 0.1185  0.3561  0.6028 
0.0559  0.2133  0.3634  0.1078  -0.1017 -0.0035 -0.1647 -0.0695 0.3360  -0.0744 -0.1602 -0.0451 
'X-RAY DIFFRACTION' 24  ? refined -36.6220  54.7984  349.1377 0.5578 0.5804  0.3832 0.2110  0.2022  0.0695  0.0458  0.2122  0.0113 
0.1199  0.0530  0.0472  0.0508  -0.4908 -0.0235 0.3607  0.1489  0.4382  -0.0321 0.1730  0.3964  
'X-RAY DIFFRACTION' 25  ? refined -39.5819  69.7143  346.0612 1.1198 0.4536  0.8646 0.2173  0.0146  -0.1506 0.6696  0.4091  0.0819 
-0.0980 0.0432  -0.0658 -0.1623 -0.2403 0.0453  0.2991  -0.0397 0.3810  -0.0949 -0.2575 -0.4170 
'X-RAY DIFFRACTION' 26  ? refined -44.7146  58.5725  323.9198 0.3658 0.0990  0.9247 -0.1883 -0.0996 -0.0583 0.0597  0.1231  0.1603 
0.0903  -0.0046 -0.0287 0.1535  0.0222  -0.1238 0.1880  -0.0247 -0.1120 0.1480  0.1051  0.0065  
'X-RAY DIFFRACTION' 27  ? refined -46.3419  64.3450  344.5817 0.5897 0.1502  0.9420 -0.2867 0.0408  -0.2241 0.0296  0.1161  0.1955 
0.0376  0.0517  0.0732  -0.0249 -0.0862 0.2148  0.0904  -0.0513 0.0543  -0.1789 0.0093  -1.3541 
'X-RAY DIFFRACTION' 28  ? refined -58.7975  72.0575  354.4654 0.6488 0.3448  0.7415 0.0375  0.0391  -0.2889 0.4192  0.4670  0.0497 
-0.4245 -0.0400 -0.0011 -0.0379 -0.0804 -0.0416 0.2486  0.0169  0.5257  -0.0467 -0.0788 0.8433  
'X-RAY DIFFRACTION' 29  ? refined -53.0109  8.6201   308.1000 0.7370 -0.0002 0.6711 0.0216  0.1898  -0.0200 0.2861  0.2049  0.2276 
0.0201  0.0490  0.1259  -0.0330 0.1772  -0.2657 0.2353  -0.0641 -0.3007 0.2426  -0.0209 -0.1655 
'X-RAY DIFFRACTION' 30  ? refined -68.6109  -1.5159  311.7094 1.0675 0.2693  1.2864 0.2014  -0.2163 -0.0138 0.1228  0.5174  0.2353 
-0.1999 -0.0115 -0.0775 -0.1060 -0.0762 0.1243  0.2373  -0.2198 -0.1975 0.0662  0.1101  -0.3160 
'X-RAY DIFFRACTION' 31  ? refined -47.1045  -7.3539  296.0083 0.9536 0.9381  1.2249 0.5763  0.1489  -0.1663 0.2519  0.0916  0.2797 
-0.0815 -0.2378 0.1372  0.0835  0.2010  -0.0379 -0.2119 -0.1372 0.1054  -0.0621 -0.1463 -0.1080 
'X-RAY DIFFRACTION' 32  ? refined -51.7221  2.4973   316.3244 0.9740 0.0177  0.9793 -0.0968 0.1217  -0.0755 0.4954  0.1299  0.2768 
0.1194  0.1987  -0.1174 0.1704  0.3987  -0.2142 0.2694  0.1260  0.0123  0.1082  0.1028  1.4437  
'X-RAY DIFFRACTION' 33  ? refined -22.8171  -4.9371  319.6665 1.2050 0.9367  1.8441 0.0659  -0.0998 0.1655  0.0236  0.0529  
-0.0007 0.0373  -0.0038 -0.0059 0.0151  -0.0348 -0.0284 -0.0278 -0.0537 0.0834  0.1864  -0.1482 0.0017  
'X-RAY DIFFRACTION' 34  ? refined -27.5595  5.5760   322.6880 1.1182 0.1842  1.1649 0.0106  0.0244  -0.1372 0.2280  0.0264  0.0857 
-0.0749 0.0213  0.0013  -0.1039 -0.0079 0.1177  -0.0140 0.1992  0.0426  -0.1272 0.0499  0.2616  
'X-RAY DIFFRACTION' 35  ? refined -20.9316  3.8452   309.7415 1.5149 1.2985  1.1894 0.4004  0.2785  -0.1584 0.0047  0.0024  0.0203 
-0.0001 -0.0080 -0.0018 0.0242  -0.1837 0.0064  0.0211  -0.0926 -0.0140 0.0076  0.2023  0.0008  
'X-RAY DIFFRACTION' 36  ? refined -32.1079  13.1299  318.0935 0.6887 0.3335  0.8089 0.2992  0.0925  -0.2113 0.0315  0.3280  0.3854 
0.0905  0.0205  0.1496  -0.0084 -0.1373 0.0696  0.0008  0.0694  0.0146  -0.0963 0.0277  0.0859  
'X-RAY DIFFRACTION' 37  ? refined -33.4537  -1.7693  311.0054 1.0681 1.3486  1.2152 0.4917  0.0870  -0.5468 0.0957  0.0335  0.0679 
-0.0574 0.0848  -0.0468 -0.2359 -0.0837 -0.0533 -0.0142 -0.0653 -0.0353 0.2395  0.0041  -0.1050 
'X-RAY DIFFRACTION' 38  ? refined -27.6232  12.1163  310.8534 0.4281 0.9993  0.7535 0.1999  0.0563  0.0121  0.0202  0.0189  0.0170 
-0.0198 0.0157  -0.0196 -0.0529 -0.4717 -0.0220 0.0168  0.2045  0.0030  0.0005  0.0293  0.0014  
'X-RAY DIFFRACTION' 39  ? refined -36.7236  15.0268  304.0896 0.1823 0.1305  0.5598 0.1811  0.1138  0.1876  0.0312  0.0116  0.0140 
-0.0202 -0.0198 0.0123  -0.0331 -0.0161 -0.0085 -0.0132 -0.0136 -0.0065 0.0259  0.0180  -0.2449 
'X-RAY DIFFRACTION' 40  ? refined -35.7885  20.7793  301.7087 0.3243 0.6042  0.4255 0.0657  0.2239  -0.1723 0.2584  0.0314  0.1538 
0.0669  -0.1317 -0.0676 0.0159  0.1709  -0.0331 -0.0295 -0.0504 0.0062  0.1270  0.0359  0.2828  
'X-RAY DIFFRACTION' 41  ? refined -51.6828  31.3779  319.8603 0.4150 0.1308  0.7310 -0.0833 0.2916  -0.1083 0.0163  0.0048  0.0260 
-0.0007 0.0005  -0.0154 0.0074  -0.0753 0.0767  0.0663  -0.0709 0.1089  0.0536  -0.0802 -0.1794 
'X-RAY DIFFRACTION' 42  ? refined -43.2585  27.5777  338.2719 0.7237 0.1630  0.7643 -0.1779 0.0661  0.1658  0.0567  0.1094  0.0851 
0.0466  0.0115  0.0860  -0.0043 -0.0089 -0.0004 -0.0149 -0.0166 0.0037  0.0173  0.0161  -0.1214 
'X-RAY DIFFRACTION' 43  ? refined -43.3066  9.7493   339.3635 0.6857 0.2140  0.6099 0.0044  -0.0459 -0.1528 0.0513  0.1691  0.0308 
0.0924  -0.0405 -0.0706 0.0365  0.0232  0.0834  -0.0818 0.0244  -0.0590 -0.0728 0.0136  0.0981  
'X-RAY DIFFRACTION' 44  ? refined -86.4764  30.6990  288.8927 0.5364 0.6894  0.4961 -0.4678 0.1553  -0.2699 0.1659  0.0858  0.0759 
-0.1031 0.0967  -0.0804 0.0907  -0.0526 -0.2080 0.0051  -0.0056 -0.0158 0.0628  -0.0112 0.0835  
'X-RAY DIFFRACTION' 45  ? refined -68.5154  14.5182  299.3705 1.2587 2.1078  0.8078 0.1426  0.0652  0.1459  0.0981  0.0029  0.0324 
0.0115  0.0162  0.0108  -0.2642 0.0309  -0.0236 -0.0764 -0.2216 -0.0115 0.0846  0.2832  0.0011  
'X-RAY DIFFRACTION' 46  ? refined -73.5129  15.1099  292.8100 1.0083 1.9068  1.1869 -0.6151 0.3510  0.2502  0.4793  0.0799  0.2695 
0.0157  -0.3530 0.0155  -0.0216 0.3835  -0.1644 -0.0607 -0.0149 0.0876  0.0354  -0.1966 -0.0560 
'X-RAY DIFFRACTION' 47  ? refined -68.1931  27.8137  301.6490 0.5248 0.2328  1.0249 -0.3119 0.1060  -0.2809 0.0043  0.0367  0.0864 
0.0158  -0.0096 -0.0385 -0.0770 0.0768  0.0635  -0.2191 -0.0174 0.0917  0.0582  -0.1571 0.0740  
'X-RAY DIFFRACTION' 48  ? refined -73.8544  -11.6131 289.5538 0.9103 0.5374  0.6536 0.0990  -0.2901 -0.3284 0.0934  0.0445  0.0569 
-0.0501 -0.0389 -0.0063 0.0210  -0.0277 -0.0134 0.0210  0.0026  -0.0426 0.2193  0.0555  -0.2607 
'X-RAY DIFFRACTION' 49  ? refined -80.6243  7.1613   310.6060 0.6458 0.4592  0.6364 -0.4154 0.0516  -0.2079 0.1472  0.1373  0.0503 
0.0749  -0.0235 -0.0828 -0.0409 0.0087  -0.0045 0.0555  -0.0781 -0.1214 -0.0510 0.0249  -0.1825 
'X-RAY DIFFRACTION' 50  ? refined -78.4457  21.9594  331.3652 0.5177 0.3870  0.6357 -0.2911 0.1606  -0.2015 0.0116  0.1254  0.0411 
-0.0322 -0.0061 -0.0148 -0.0815 0.0400  0.0649  0.0098  0.0708  0.0936  -0.1132 0.0570  0.0829  
'X-RAY DIFFRACTION' 51  ? refined -67.1746  28.0668  331.8409 0.4778 0.0965  0.4621 0.0683  -0.0214 0.1502  0.0740  0.1096  0.2503 
-0.0875 0.0111  0.0016  -0.0067 -0.0900 -0.1390 0.1352  0.0176  0.0598  0.1493  -0.0225 0.4463  
'X-RAY DIFFRACTION' 52  ? refined -71.1017  27.0152  331.5204 0.4252 0.0502  0.6411 -0.2150 0.0098  -0.0754 0.0600  0.0604  0.2975 
-0.0307 -0.0914 -0.0226 0.1294  0.0800  -0.0869 0.0900  0.1284  -0.0637 0.2152  -0.0888 1.4961  
'X-RAY DIFFRACTION' 53  ? refined -75.1637  26.0432  317.2525 0.4591 0.1217  0.6217 -0.2446 0.0931  0.0369  0.1874  0.2488  0.1379 
0.1757  0.0223  -0.0864 0.0298  -0.0791 0.1092  -0.0484 -0.0167 0.0530  -0.0820 0.0330  -0.0407 
'X-RAY DIFFRACTION' 54  ? refined -84.9592  22.0464  317.6068 0.4036 0.1749  0.5972 -0.2514 0.1422  -0.0423 0.0442  0.1187  0.0084 
0.0768  0.0260  0.0372  0.0035  -0.1112 -0.0857 -0.0651 -0.0728 0.0422  0.0281  -0.0308 -0.3840 
'X-RAY DIFFRACTION' 55  ? refined -85.6842  12.1390  326.6742 0.8773 0.7133  0.2500 -0.2124 -0.0683 -0.2075 0.0041  0.0913  0.0499 
-0.0181 0.0122  -0.0663 0.1115  0.1064  -0.0675 -0.1316 -0.2113 0.1337  -0.0499 -0.1684 -0.1193 
'X-RAY DIFFRACTION' 56  ? refined -84.8077  25.2588  360.2856 1.1350 0.9752  1.2278 -0.1189 0.4555  -0.0478 0.0069  0.0125  0.0106 
0.0099  -0.0043 0.0000  -0.1373 0.0299  -0.1869 -0.0976 0.0867  -0.0653 -0.0219 -0.1178 -0.0005 
'X-RAY DIFFRACTION' 57  ? refined -76.6517  24.8211  350.1286 0.6508 0.1456  0.7418 -0.2088 0.3352  -0.2869 0.0946  0.3059  0.0986 
-0.0302 0.0564  0.0085  -0.0433 -0.0431 0.0577  0.0353  0.0182  -0.0428 0.0890  -0.0388 -0.1406 
'X-RAY DIFFRACTION' 58  ? refined -72.9444  25.2309  360.0276 0.7763 0.2285  0.6158 -0.3504 0.1816  -0.0624 0.8646  0.2109  0.2423 
-0.2010 -0.1485 -0.1552 -0.2626 0.2253  0.2619  -0.1232 0.0078  -0.1175 -0.0116 0.0271  -0.5836 
'X-RAY DIFFRACTION' 59  ? refined -77.5348  22.6193  370.4408 0.6240 0.4182  0.7521 -0.2909 0.1143  0.2155  0.0112  0.4994  0.0949 
0.0075  0.0293  -0.0336 0.0624  -0.0890 -0.1506 0.0252  -0.0022 0.0062  0.1539  -0.0113 0.5469  
'X-RAY DIFFRACTION' 60  ? refined -79.5028  36.9928  370.9729 0.7737 1.4120  0.9564 -0.4058 0.0707  0.0485  0.0230  0.0089  0.0032 
0.0038  0.0022  0.0058  -0.0591 -0.1168 0.0258  -0.0880 -0.1751 0.0146  -0.1201 -0.0858 -0.0007 
'X-RAY DIFFRACTION' 61  ? refined -47.3094  54.4055  309.7241 1.2831 1.3218  1.0698 0.0906  0.0614  0.0338  0.0027  0.0147  0.0098 
-0.0005 -0.0012 -0.0030 0.0588  -0.1033 0.0388  0.0168  0.0373  0.0309  0.0908  -0.1260 -0.0010 
'X-RAY DIFFRACTION' 62  ? refined -48.0837  49.6314  299.4251 0.3852 0.1048  0.7333 0.0550  0.1457  0.0621  0.0208  0.2611  0.1445 
0.0538  0.0403  0.0272  0.0877  0.1047  -0.0931 -0.0325 0.0651  -0.1263 0.0826  0.0321  0.0917  
'X-RAY DIFFRACTION' 63  ? refined -63.1381  43.0975  310.7512 0.9952 1.1265  1.0503 -0.0153 -0.2564 0.0182  0.0061  0.0125  0.0012 
0.0090  -0.0021 -0.0033 0.0468  0.0345  0.0051  -0.0962 -0.0854 0.0657  -0.0134 0.1171  0.0005  
'X-RAY DIFFRACTION' 64  ? refined -49.2783  48.8298  305.1612 0.7451 0.2672  0.7938 -0.2325 0.0288  0.1195  0.5370  0.2043  0.1702 
0.3272  -0.1662 -0.0736 -0.0574 0.0359  -0.0808 0.0572  -0.0057 0.1244  0.0105  -0.0632 -0.2594 
'X-RAY DIFFRACTION' 65  ? refined -54.0145  45.2093  298.6054 0.5872 0.3949  0.7150 -0.3962 0.0510  -0.0861 0.4274  0.2613  0.0771 
0.2426  0.0826  -0.0311 -0.1181 0.1689  0.1541  -0.0817 0.0644  -0.0366 0.1190  -0.0146 -0.3241 
'X-RAY DIFFRACTION' 66  ? refined -47.6513  45.8592  317.5067 0.8173 0.5254  0.8049 -0.0226 0.0341  -0.4998 0.0961  0.2229  0.2168 
-0.0586 -0.0352 0.1325  -0.0560 0.0321  -0.0274 -0.0507 0.0361  -0.0751 0.0119  0.0758  -0.3507 
'X-RAY DIFFRACTION' 67  ? refined -42.6502  38.1303  312.2140 0.7004 0.7379  1.0645 -0.4550 -0.0352 -0.0768 0.0964  0.0615  0.0169 
0.0705  -0.0378 -0.0237 0.0542  -0.0650 -0.0709 0.0394  -0.0122 0.0524  0.0007  0.0131  -0.0653 
'X-RAY DIFFRACTION' 68  ? refined -57.9672  39.0253  300.0316 0.7211 0.5526  0.5733 0.0744  -0.1327 0.2169  0.0288  0.0284  0.0129 
-0.0057 -0.0160 -0.0078 0.0160  0.2735  0.0995  0.1483  -0.0097 0.0495  0.0885  -0.2235 -0.0079 
'X-RAY DIFFRACTION' 69  ? refined -66.3445  13.0494  264.8455 0.5820 0.4151  0.8218 0.1642  -0.0818 -0.1866 0.6643  -0.0016 0.2722 
0.0885  -0.4289 -0.0321 0.2410  0.6430  -0.5043 -0.2023 0.0684  0.2003  0.0038  -0.2939 1.5088  
'X-RAY DIFFRACTION' 70  ? refined -55.3173  -11.8779 255.9424 1.3561 0.3837  0.8739 -0.2645 0.1085  -0.0628 0.2302  0.3576  0.2823 
0.1805  -0.0778 0.1210  -0.1524 0.1476  -0.1450 -0.2854 0.0931  -0.1112 -0.0643 -0.0293 0.3126  
'X-RAY DIFFRACTION' 71  ? refined -66.7178  24.1663  246.7662 1.1640 0.7088  0.9949 -0.1075 0.1501  0.1856  0.0774  0.0191  0.0353 
-0.0272 -0.0223 0.0107  -0.0219 -0.0979 -0.1194 0.1332  -0.4482 0.1507  -0.2164 0.2202  0.0032  
'X-RAY DIFFRACTION' 72  ? refined -64.6318  12.0069  252.8433 0.6449 0.3984  0.7316 0.1197  0.1540  -0.4053 0.0267  0.0032  0.0404 
-0.0019 -0.0343 0.0011  0.0067  0.0128  0.0448  0.0491  0.0550  -0.1155 0.0160  -0.0430 0.4298  
'X-RAY DIFFRACTION' 73  ? refined -48.7030  26.5586  244.6937 1.4836 0.5617  1.3074 0.1875  0.2375  0.3423  1.0637  0.1877  0.6818 
0.0848  -0.7976 -0.0153 0.0977  -0.3617 -0.2766 0.4874  -0.2239 -0.0369 -0.2684 0.2781  0.0273  
'X-RAY DIFFRACTION' 74  ? refined -61.6240  -0.8770  242.0802 0.6896 1.1309  0.5726 -0.3913 -0.1095 -0.1735 0.0380  0.0497  0.0282 
-0.0161 0.0025  -0.0404 0.2081  -0.2701 -0.1699 -0.0589 -0.2351 0.1463  0.1197  -0.0687 0.0011  
'X-RAY DIFFRACTION' 75  ? refined -57.5831  21.1712  241.4452 1.4442 0.4551  0.6948 0.2405  0.2282  -0.0341 0.3805  0.0791  1.0759 
0.1371  -0.5237 -0.2930 0.1573  -0.0884 -0.0193 0.1423  -0.0268 -0.0072 -0.2439 0.1938  -0.0503 
'X-RAY DIFFRACTION' 76  ? refined -60.9106  11.7711  241.2651 0.5575 0.7549  0.6552 -0.2514 -0.2409 -0.2766 0.0651  0.0177  0.6723 
-0.0315 -0.2110 0.1107  -0.0067 0.1128  -0.0557 -0.2951 0.0680  0.0693  0.1030  0.0941  -0.2969 
'X-RAY DIFFRACTION' 77  ? refined -54.2496  4.8326   248.1669 0.7639 0.1157  0.7607 0.0284  0.0228  -0.2066 0.0968  0.0595  0.0367 
-0.0099 0.0564  0.0008  -0.0104 0.0368  -0.0828 -0.0090 -0.0273 -0.0224 0.0639  0.0052  -0.5819 
'X-RAY DIFFRACTION' 78  ? refined -38.8499  16.5479  260.2941 2.3605 2.5579  2.4737 0.1031  -0.0421 0.0429  0.0065  0.0734  0.0235 
-0.0156 -0.0002 -0.0281 0.0837  -0.0002 -0.0089 0.0176  0.0481  -0.0335 -0.0155 0.0264  -0.0016 
'X-RAY DIFFRACTION' 79  ? refined -31.9568  19.2992  249.0967 0.6434 0.9323  1.1499 -0.3614 0.1745  0.0110  0.0468  0.0440  0.0078 
0.0148  -0.0051 0.0105  0.0061  -0.0120 -0.0471 -0.0798 0.0346  0.0478  -0.0143 0.0570  0.0399  
'X-RAY DIFFRACTION' 80  ? refined 22.0939   1.7852   181.6756 0.6698 0.8641  1.0993 0.4394  -0.0272 -0.2418 0.2211  0.1517  0.1789 
-0.0856 0.0097  0.0014  0.0099  -0.1885 0.1697  -0.0892 -0.0182 -0.0738 -0.1017 -0.2005 0.0876  
'X-RAY DIFFRACTION' 81  ? refined 23.7254   24.4508  181.3005 0.8087 1.4321  0.7318 -0.0125 0.0919  0.1367  0.7382  0.1741  
-0.0028 -0.1119 0.0761  -0.0091 0.0091  -0.2028 -0.5169 -0.1634 -0.3490 -0.1450 -0.0824 0.8683  -0.1117 
'X-RAY DIFFRACTION' 82  ? refined 46.0747   22.1822  183.6191 0.9244 1.4132  0.8551 -0.1672 0.1780  -0.1069 0.0088  0.0038  0.0002 
-0.0069 -0.0027 0.0037  0.2394  0.1001  -0.1030 0.1841  -0.2677 -0.1594 -0.3063 0.2363  0.0011  
'X-RAY DIFFRACTION' 83  ? refined 27.8568   30.8400  161.9205 1.3537 1.2249  0.8194 0.1735  -0.0665 0.3941  1.0065  0.3773  0.5699 
-0.6150 -0.7604 0.4628  -0.1842 0.4912  0.0384  0.2004  -0.4134 0.0228  -0.0789 -0.2775 -0.4273 
'X-RAY DIFFRACTION' 84  ? refined 29.9328   44.3711  191.8451 0.7865 1.0187  0.4138 -0.1893 -0.2715 0.2013  0.1142  0.0841  0.3196 
-0.0680 0.0930  -0.0489 0.0883  -0.0560 -0.1042 -0.0946 0.0143  0.1060  0.2191  -0.0684 0.2132  
'X-RAY DIFFRACTION' 85  ? refined -22.5936  24.4998  225.3076 0.7806 0.1458  0.7351 -0.0972 -0.4423 -0.0021 0.5550  0.4402  0.8439 
0.0176  0.2482  0.2786  -0.0169 0.1867  0.1136  0.2548  -0.0983 0.2730  -0.1182 0.3686  -0.8244 
'X-RAY DIFFRACTION' 86  ? refined -6.6263   -8.8250  207.5669 0.7320 0.6668  0.9459 -0.1829 0.3430  -0.0029 0.2885  0.7229  1.0367 
-0.3825 0.1331  0.2800  -0.1467 -0.0678 -0.3713 -0.2517 -0.4283 -0.0175 0.2130  0.1506  -0.7091 
'X-RAY DIFFRACTION' 87  ? refined -5.7459   11.3475  205.2307 0.7906 1.0938  0.5792 -0.3104 -0.0475 -0.1885 0.4122  0.9605  0.2780 
0.4106  0.1373  -0.2649 0.0889  0.5273  -0.5002 -0.3912 0.0078  -0.3505 -0.1842 0.1077  -0.5857 
'X-RAY DIFFRACTION' 88  ? refined 5.4874    2.6245   197.7496 0.7669 0.8409  1.1277 -0.0323 0.1150  0.1239  0.0402  0.0634  0.1062 
-0.0414 -0.0633 0.0850  0.1335  -0.2219 -0.2009 -0.1778 -0.0524 -0.4008 -0.0316 0.0383  -0.0041 
'X-RAY DIFFRACTION' 89  ? refined -41.2752  -10.0966 241.8216 0.9193 1.1959  1.2291 -0.2101 0.0298  -0.2522 0.1275  0.0630  0.1142 
-0.0600 -0.1202 0.0600  -0.3626 0.0723  0.0218  -0.0767 0.2367  0.2867  -0.1304 0.6098  -0.0001 
'X-RAY DIFFRACTION' 90  ? refined -51.0144  8.8555   233.7333 0.9325 1.1558  0.3919 -0.0035 -0.1249 -0.2441 0.3262  0.2596  0.1252 
-0.0610 0.0879  -0.1589 0.2212  0.0385  -0.0848 0.1229  0.1026  -0.0422 -0.2019 -0.3691 0.3553  
'X-RAY DIFFRACTION' 91  ? refined -29.1304  3.8684   230.3361 0.5784 0.9922  0.8574 -0.1280 0.0800  -0.0442 0.1786  0.0112  0.0926 
-0.0323 -0.1258 0.0133  0.0366  0.1834  -0.6344 -0.0351 0.0010  -0.1052 -0.1369 0.2634  -0.0022 
'X-RAY DIFFRACTION' 92  ? refined -18.1639  6.6536   230.8953 0.9031 0.9186  0.9269 -0.3456 -0.0842 0.1983  0.0539  0.0417  0.0255 
0.0167  -0.0301 -0.0337 0.1232  0.0305  0.0239  0.1343  0.1128  -0.1643 -0.0709 -0.1255 -0.0013 
'X-RAY DIFFRACTION' 93  ? refined -26.2036  -12.7638 226.3450 0.8612 1.1333  1.0866 -0.1063 -0.0238 -0.4131 0.2485  0.1008  0.2747 
0.0460  -0.0654 -0.1670 -0.0168 -0.2134 -0.2189 -0.2393 -0.3113 0.0181  -0.1395 0.2324  -0.1582 
'X-RAY DIFFRACTION' 94  ? refined -87.4119  8.5994   269.5854 0.6049 0.7135  1.0937 -0.3870 0.0220  -0.2429 0.0473  0.0050  0.0722 
-0.0147 0.0487  -0.0148 -0.0967 0.0149  -0.0561 -0.1032 0.0934  -0.1922 0.0137  -0.0413 0.1460  
'X-RAY DIFFRACTION' 95  ? refined -77.7902  16.9267  277.3765 0.4222 1.2859  0.8195 0.1167  0.0133  0.0190  0.0971  0.7891  0.1028 
0.1352  0.0205  -0.0644 -0.0460 0.5282  -0.0689 -0.4170 -0.4059 -0.3618 0.0741  0.2712  -0.1238 
'X-RAY DIFFRACTION' 96  ? refined -75.9785  8.9299   262.4214 0.5442 0.9243  0.8662 -0.3574 0.0674  -0.2041 0.1103  0.2322  0.0594 
-0.1567 0.0794  -0.1171 -0.4630 0.1751  -0.3063 -0.5266 0.1281  -0.3202 -0.2075 0.3681  -0.1607 
'X-RAY DIFFRACTION' 97  ? refined -72.6065  0.5492   269.2315 0.8107 0.9529  0.4580 -0.0617 0.1771  -0.2368 0.0701  0.7900  0.2105 
0.0138  0.0987  0.2052  0.1430  0.1262  -0.0987 -0.1981 -0.1278 -0.2283 0.1691  0.3503  -0.0974 
'X-RAY DIFFRACTION' 98  ? refined -86.0344  -5.0951  273.4155 0.7876 0.4801  0.9680 0.2407  0.1174  -0.2494 0.2344  0.5705  0.2017 
-0.0018 -0.2101 0.0818  0.0559  0.1186  -0.0078 0.0196  -0.0220 0.2036  0.0172  -0.1506 0.6987  
'X-RAY DIFFRACTION' 99  ? refined -65.1636  -11.6734 265.2952 0.9460 0.8160  0.6686 -0.1221 0.0683  0.0026  0.0233  0.0231  0.0212 
0.0258  -0.0176 -0.0124 -0.0248 -0.2326 -0.2306 0.0835  0.0401  0.1998  0.2293  0.0640  0.0002  
'X-RAY DIFFRACTION' 100 ? refined -72.5930  -23.9697 270.1168 1.6162 1.0069  1.6489 -0.5633 0.6313  0.0079  0.4606  0.4444  0.1069 
-0.4329 -0.1733 0.2019  -0.0167 0.0953  -0.0496 -0.3087 0.0355  0.0164  0.0171  -0.0429 0.0261  
'X-RAY DIFFRACTION' 101 ? refined -88.3854  103.8476 252.7874 1.3805 1.9807  0.8044 0.4362  0.0308  0.4931  0.0062  0.0327  0.0024 
0.0150  0.0034  0.0099  0.1530  0.1414  0.0151  -0.0802 -0.0646 -0.0792 -0.0951 -0.0371 0.0013  
'X-RAY DIFFRACTION' 102 ? refined -71.6999  96.0668  261.9946 1.0842 1.2735  1.3131 0.0675  0.3171  0.3922  0.0341  0.0135  0.0298 
0.0031  -0.0326 -0.0032 -0.0412 0.1748  -0.0233 -0.0867 0.0028  -0.0410 0.0243  0.0330  -0.0011 
'X-RAY DIFFRACTION' 103 ? refined -85.3622  96.5370  269.9936 2.4792 1.6900  1.0183 0.3453  0.0233  0.2740  0.0068  0.0335  0.0029 
-0.0141 -0.0012 0.0125  0.2081  0.2525  0.0159  0.1556  0.0720  0.1494  -0.0752 0.4644  0.0027  
'X-RAY DIFFRACTION' 104 ? refined -88.6708  95.3936  269.3114 0.7869 1.7627  0.4476 0.2888  -0.0655 -0.1013 0.0767  0.2313  0.0699 
0.0122  -0.0048 0.0471  0.1092  0.0066  -0.0184 0.1114  -0.1433 -0.0200 -0.2062 0.1669  -0.0011 
'X-RAY DIFFRACTION' 105 ? refined -98.6928  116.7681 276.4418 0.7693 1.3151  0.7951 0.0173  -0.0181 0.6293  0.0071  0.0517  0.1113 
-0.0152 0.0239  0.0082  0.1079  0.0139  0.0118  -0.1995 -0.1483 -0.0468 -0.1087 0.0172  0.1141  
'X-RAY DIFFRACTION' 106 ? refined -106.4910 118.5716 295.0899 1.4408 1.3358  1.0845 -0.3803 0.0225  0.0405  0.0035  0.0074  0.0236 
-0.0022 0.0105  0.0013  0.0547  0.0608  0.0283  -0.0009 0.1628  -0.0239 -0.0955 0.2757  0.0053  
'X-RAY DIFFRACTION' 107 ? refined -105.2476 119.0340 285.3831 1.4848 1.9081  1.1713 0.2532  0.0745  0.4789  0.0385  0.0098  0.0314 
0.0177  -0.0378 -0.0158 -0.3341 0.3678  -0.0954 -0.3183 -0.2179 -0.0143 0.2725  -0.0188 -0.0029 
'X-RAY DIFFRACTION' 108 ? refined -99.5035  73.7451  274.1560 0.8087 1.1489  1.0008 0.1682  -0.2881 0.0840  0.0026  0.0018  0.0081 
0.0006  -0.0036 -0.0032 -0.0884 0.1464  0.0268  -0.2165 -0.3003 -0.0467 -0.1112 -0.0590 -0.0027 
'X-RAY DIFFRACTION' 109 ? refined -104.9570 80.9511  276.6160 0.6322 1.4545  0.6105 0.1006  -0.0129 -0.1390 0.0262  0.1737  0.0243 
0.0209  -0.0149 -0.0617 0.1165  -0.0436 0.1500  -0.0232 0.0103  0.0428  -0.1617 0.0981  0.0096  
'X-RAY DIFFRACTION' 110 ? refined -109.9714 76.3361  282.9552 0.5694 0.3728  0.4355 -0.0462 -0.2115 -0.1555 0.0125  0.0768  0.0107 
0.0129  -0.0053 0.0166  -0.0322 0.0298  0.0055  -0.0346 0.0316  0.0149  -0.0234 -0.0124 0.3402  
'X-RAY DIFFRACTION' 111 ? refined -103.0159 82.6507  288.5273 0.7940 1.2668  0.6311 -0.3782 0.2296  -0.1790 0.0062  0.0276  0.0051 
-0.0136 -0.0003 -0.0025 0.0085  -0.0573 -0.0639 0.0005  -0.0496 -0.0414 0.0379  0.0985  0.0003  
'X-RAY DIFFRACTION' 112 ? refined -113.4685 89.1900  279.2722 1.1514 1.7963  1.1675 -0.0700 -0.4233 0.0535  0.0164  0.0004  0.0357 
-0.0009 0.0192  -0.0028 -0.0150 -0.0576 0.0199  0.0250  -0.0935 -0.1207 -0.0007 0.0078  0.0008  
'X-RAY DIFFRACTION' 113 ? refined -113.5922 104.5957 273.1444 1.4930 1.5414  1.2324 -0.1444 0.0003  0.4991  0.0021  0.0048  0.0135 
0.0037  -0.0035 -0.0046 0.0085  0.0582  0.0581  -0.0356 0.0354  0.0634  0.0411  0.0700  -0.0006 
'X-RAY DIFFRACTION' 114 ? refined -123.6583 106.0775 274.4540 2.2544 2.1719  2.0526 0.9228  -0.0215 0.4616  0.0005  0.0059  0.0038 
0.0012  0.0004  0.0006  0.0506  -0.0229 0.0137  -0.0579 0.0291  -0.0223 0.0276  0.0730  -0.0001 
'X-RAY DIFFRACTION' 115 ? refined -126.7251 93.8848  276.8464 1.2555 1.2175  1.6613 0.3030  0.1847  -0.2677 0.0145  0.0139  0.0156 
-0.0001 0.0125  0.0081  -0.0317 0.0564  0.0645  -0.0429 0.0544  0.0378  -0.0087 -0.0608 0.0006  
'X-RAY DIFFRACTION' 116 ? refined -112.2559 100.9465 269.0493 1.7197 2.1431  1.0374 0.4371  0.4463  -0.2872 0.0050  0.0176  0.0074 
0.0046  -0.0041 0.0059  -0.0631 0.0807  -0.0441 0.0463  -0.0493 0.0170  0.1580  -0.0308 -0.0003 
'X-RAY DIFFRACTION' 117 ? refined -124.0198 101.7381 262.9685 1.8335 2.4069  1.4390 0.2233  -0.4804 -0.0996 0.0117  0.0621  0.0015 
-0.0093 -0.0035 0.0030  0.1068  -0.0708 0.0517  -0.0174 0.0804  0.0217  -0.0420 -0.0514 0.0014  
'X-RAY DIFFRACTION' 118 ? refined -113.7444 102.5863 256.9822 2.0237 2.2198  1.3043 0.0430  -0.5732 0.1731  0.0036  0.0037  0.0214 
0.0069  0.0057  -0.0026 -0.0509 0.0108  0.0394  0.0451  -0.2042 0.0739  0.0535  0.1295  0.0010  
'X-RAY DIFFRACTION' 119 ? refined -86.0756  102.5149 306.3080 0.7930 0.4401  0.7450 -0.1799 0.0157  0.3350  0.1103  1.1254  0.5898 
0.2595  0.0091  -0.1831 -0.1116 -0.1274 -0.2916 -0.0160 0.1357  0.4609  0.0813  -0.2594 -0.8065 
'X-RAY DIFFRACTION' 120 ? refined -103.7132 99.4838  306.9160 1.4225 1.2741  0.7321 0.4554  -0.0278 -0.0327 0.6134  0.0177  0.0053 
0.0629  -0.0452 0.0077  0.1298  0.5873  -0.2976 -0.0947 0.0562  0.0022  -0.4363 -0.2415 0.0334  
'X-RAY DIFFRACTION' 121 ? refined -101.3146 80.5858  314.2084 0.9828 0.7391  0.7714 -0.2906 0.5175  -0.0856 0.4331  0.0581  0.5231 
0.0780  0.1182  -0.1225 0.1663  -0.4421 0.3898  0.3428  0.0499  0.3975  -0.5330 -0.4054 -1.0894 
'X-RAY DIFFRACTION' 122 ? refined -101.7888 52.6286  340.8219 0.4852 0.3598  1.0753 -0.2026 -0.0177 0.0580  0.0099  0.0208  0.7663 
-0.0070 -0.0456 0.1186  -0.0806 0.0051  -0.0084 0.2683  -0.3311 -0.0173 0.4576  -0.2631 -0.5053 
'X-RAY DIFFRACTION' 123 ? refined -82.4982  63.4186  307.5200 0.4578 0.9895  0.7694 0.3103  0.1568  -0.1730 -0.0030 0.1347  0.9192 
0.0195  -0.0093 -0.1159 -0.0306 -0.0876 -0.2473 -0.0731 -0.0822 -0.1473 -0.1481 0.3855  -1.1006 
'X-RAY DIFFRACTION' 124 ? refined -98.4804  49.5786  329.6395 0.4639 0.6599  0.8661 0.3507  0.2001  -0.1653 0.0119  0.0215  0.0193 
0.0170  -0.0195 -0.0232 -0.0024 0.0442  -0.0646 0.0131  0.0147  0.1105  0.0169  -0.1443 0.6566  
'X-RAY DIFFRACTION' 125 ? refined -92.5989  65.0327  335.3782 0.5240 1.0043  0.7781 -0.0530 -0.1234 0.0404  0.0041  0.0968  0.0409 
-0.0125 -0.0014 -0.0326 0.0096  -0.3640 -0.2060 -0.1548 -0.0345 0.2396  -0.3081 -0.6102 0.0035  
'X-RAY DIFFRACTION' 126 ? refined -93.8854  59.3746  314.8069 0.5448 1.3062  0.8551 0.3051  0.0045  -0.0440 0.0642  0.0717  0.2412 
-0.0365 0.0588  -0.1262 -0.0048 0.2655  -0.1500 -0.1079 -0.0488 -0.0701 -0.3917 -0.5409 -0.0155 
'X-RAY DIFFRACTION' 127 ? refined -106.4518 51.4060  304.7727 0.6277 1.1580  1.5507 0.0337  0.0763  -0.0629 0.0195  0.0123  0.0217 
0.0132  0.0226  0.0077  0.2574  0.1074  0.0630  -0.2005 0.0467  0.1650  0.1128  0.1703  0.0020  
'X-RAY DIFFRACTION' 128 ? refined -97.2709  110.9632 372.3756 1.4066 2.1858  1.5070 -0.3734 -0.4035 -0.1296 0.0888  0.0227  0.0407 
0.0355  0.0464  0.0052  0.0942  -0.1277 0.3352  0.2439  0.2599  -0.1822 -0.0912 0.1773  -0.0091 
'X-RAY DIFFRACTION' 129 ? refined -101.3269 116.1355 345.0090 0.9707 1.2525  1.7915 -0.0395 0.0254  -0.1465 0.0522  0.0600  0.0291 
0.0566  -0.0332 -0.0083 -0.1151 -0.6290 -0.0278 -0.2430 0.2698  0.5796  -0.1897 0.0119  0.0031  
'X-RAY DIFFRACTION' 130 ? refined -115.5597 124.7345 347.9142 1.0284 0.5578  1.3127 0.5910  0.0919  -0.2543 0.0416  0.0380  0.1398 
-0.0394 0.0135  -0.0063 0.0438  -0.0117 0.1075  0.0535  -0.0361 0.0255  -0.0768 -0.0165 -0.1230 
'X-RAY DIFFRACTION' 131 ? refined -96.0169  130.0201 368.4023 1.3414 1.1936  1.2915 -0.5710 -0.3122 -0.3245 0.0195  0.2917  0.5436 
0.0760  -0.0643 -0.1756 -0.0428 -0.1376 0.0830  0.2128  -0.2150 -0.0206 -0.2463 -0.2065 0.0571  
'X-RAY DIFFRACTION' 132 ? refined -98.5102  121.3427 344.2918 1.0890 1.1820  1.0844 -0.3909 0.2814  -0.3830 0.2289  0.4778  0.2267 
-0.3170 -0.0527 0.1897  0.3021  0.0177  0.2340  -0.4014 -0.0290 -0.0965 -0.5710 0.4370  -0.0013 
'X-RAY DIFFRACTION' 133 ? refined -69.4461  127.8558 340.5525 1.3051 0.9335  1.4376 -0.3838 -0.2594 -0.1046 0.0091  0.0086  0.0027 
-0.0100 0.0050  -0.0054 0.0006  -0.0995 0.0710  0.0833  0.0121  0.0921  -0.2665 -0.2268 -0.0021 
'X-RAY DIFFRACTION' 134 ? refined -74.5454  117.6963 337.4184 1.6131 0.8421  1.7742 -0.4040 0.4656  -0.2542 0.0131  0.0018  0.0528 
-0.0059 -0.0201 0.0101  0.2270  -0.0723 0.0211  0.0329  0.2994  -0.0316 0.0447  0.1731  0.0010  
'X-RAY DIFFRACTION' 135 ? refined -76.9196  117.1024 346.0632 0.8140 0.6863  0.8777 -0.2539 0.0168  0.0104  0.0073  0.0378  0.2049 
0.0156  0.0402  0.0908  -0.1217 -0.2135 0.1517  0.0169  -0.3157 -0.0657 -0.3776 0.3123  -0.0224 
'X-RAY DIFFRACTION' 136 ? refined -77.7963  110.0928 351.4697 1.0370 1.8372  1.3399 0.0104  0.0649  -0.3464 0.0245  0.0084  0.0047 
-0.0140 -0.0015 -0.0017 -0.3458 0.0411  -0.0685 0.1441  0.1275  0.0177  -0.0543 -0.0455 -0.0014 
'X-RAY DIFFRACTION' 137 ? refined -93.1017  96.2502  346.4079 1.2755 2.0758  1.2606 -0.3194 -0.1482 -0.2199 0.1060  0.0952  0.0131 
-0.0998 -0.0330 0.0432  -0.0717 -0.4663 0.1021  0.1080  0.3751  0.0659  0.1851  0.4446  -0.0028 
'X-RAY DIFFRACTION' 138 ? refined -90.3835  105.5637 321.3972 0.8902 1.2571  1.0177 0.1499  0.1354  -0.1041 0.0202  0.0001  0.0118 
0.0032  -0.0170 -0.0020 0.1668  0.0077  -0.5190 -0.0871 0.0836  0.1206  0.0190  0.0435  -0.0001 
'X-RAY DIFFRACTION' 139 ? refined -134.2031 93.2432  370.5865 0.6300 0.2719  0.6733 0.2834  0.0959  -0.2923 0.0246  0.0964  0.0498 
0.0272  0.0021  -0.0347 -0.0018 -0.0068 0.0074  0.0189  -0.0259 0.0000  -0.0033 -0.0366 -0.2920 
'X-RAY DIFFRACTION' 140 ? refined -115.9136 108.9527 360.1037 1.0656 0.8022  0.6571 -0.0526 0.0648  -0.4209 0.4193  0.2545  0.5011 
-0.0782 0.3472  -0.2887 -0.3027 0.0241  0.0428  -0.0848 -0.0619 0.1103  -0.2379 0.0865  -0.7431 
'X-RAY DIFFRACTION' 141 ? refined -115.9517 105.5900 363.4522 0.4355 0.4677  0.8617 0.1088  0.1655  -0.1999 0.0373  0.1004  0.4218 
0.0576  0.1219  0.2063  -0.1264 -0.1491 0.0632  -0.1508 0.0376  -0.2835 -0.0611 0.1466  -0.2970 
'X-RAY DIFFRACTION' 142 ? refined -114.1358 97.8585  356.9608 0.6267 0.7252  0.8686 -0.2262 -0.0828 -0.0748 0.0682  0.1401  0.1132 
-0.0569 0.0105  0.1008  0.0816  0.0727  -0.3945 -0.2858 -0.3283 0.5513  0.1316  -0.3005 -0.0030 
'X-RAY DIFFRACTION' 143 ? refined -129.7295 88.4593  353.5394 1.0504 1.6404  1.2788 -0.3739 0.1703  0.1485  0.0078  0.0132  0.0455 
0.0016  -0.0087 0.0194  0.0868  0.1217  -0.0289 0.0677  -0.0030 -0.0351 0.0627  0.1474  0.0007  
'X-RAY DIFFRACTION' 144 ? refined -119.9254 86.4087  363.7582 1.3843 2.1330  1.2056 -0.1008 -0.1180 0.0664  0.0150  0.0121  0.0139 
0.0088  -0.0095 0.0010  0.0134  -0.0688 -0.0621 -0.0547 0.0226  -0.0182 0.0340  0.1006  0.0006  
'X-RAY DIFFRACTION' 145 ? refined -120.9716 135.4399 369.8350 1.7089 1.7767  1.4092 0.0779  0.5570  -0.8543 0.0718  0.0567  0.0265 
0.0269  0.0044  0.0380  -0.0788 0.0330  -0.0996 -0.0127 -0.0218 0.0973  -0.0050 -0.0724 -0.1814 
'X-RAY DIFFRACTION' 146 ? refined -131.3844 117.5992 355.1967 1.3336 2.1914  2.0163 0.1790  -0.1541 -0.2128 0.0098  0.0366  0.0016 
-0.0190 -0.0042 0.0092  -0.0652 -0.0224 0.1049  0.0261  -0.0211 -0.0050 -0.0710 -0.0146 -0.0010 
'X-RAY DIFFRACTION' 147 ? refined -124.8423 107.5176 333.8440 0.9477 0.5281  1.2668 0.0523  0.0395  -0.0946 -0.0005 -0.0005 0.0074 
-0.0013 -0.0001 -0.0015 -0.2225 0.3367  0.0170  -0.1150 0.1362  -0.0950 0.1520  0.0181  0.0029  
'X-RAY DIFFRACTION' 148 ? refined -114.6403 95.3756  327.7971 1.1551 0.5530  0.9735 0.2660  0.1372  -0.0282 0.0620  0.0037  0.0071 
-0.0045 -0.0204 0.0074  -0.0729 0.0218  0.1341  -0.1028 -0.0565 -0.0363 0.0507  -0.1059 0.0195  
'X-RAY DIFFRACTION' 149 ? refined -118.3831 96.6573  328.0010 0.6093 0.2801  0.8736 0.1257  -0.1942 0.0597  0.0825  0.1362  0.1981 
-0.0387 -0.0511 -0.1183 0.0801  0.0403  -0.0115 -0.1420 0.1694  0.2673  0.0109  -0.1832 0.3247  
'X-RAY DIFFRACTION' 150 ? refined -123.6915 101.8571 343.4234 1.0998 1.5048  1.3443 -0.0163 0.0217  -0.1948 0.0264  0.0080  0.0118 
0.0049  -0.0084 -0.0114 -0.0676 -0.1096 -0.1916 0.1115  -0.0283 0.1078  0.0538  0.0164  -0.0001 
'X-RAY DIFFRACTION' 151 ? refined -129.3322 99.7637  341.2504 0.7440 0.8621  1.6193 -0.2015 0.1390  -0.1258 0.0224  -0.0002 0.0303 
0.0031  -0.0268 -0.0021 0.2067  0.1586  -0.1307 0.0863  -0.0978 0.0477  -0.0150 -0.2737 0.0018  
'X-RAY DIFFRACTION' 152 ? refined -132.7756 111.0434 334.1919 1.3861 1.9154  1.3351 -0.1913 -0.3891 -0.4333 0.0260  0.0183  0.0196 
-0.0224 0.0231  -0.0188 -0.0760 -0.0036 0.1060  0.0601  -0.2189 -0.0405 0.0160  0.0117  -0.0057 
'X-RAY DIFFRACTION' 153 ? refined -132.2156 98.2721  298.7710 0.4713 1.5128  0.7498 0.3021  0.0567  -0.0915 0.0589  0.0140  0.1481 
-0.0260 0.0611  -0.0141 0.0564  0.1381  0.0317  0.0134  0.0296  0.0315  0.0490  -0.0027 0.0374  
'X-RAY DIFFRACTION' 154 ? refined -124.1156 99.0449  309.2402 1.6145 1.5644  1.4378 0.2757  0.0152  -0.0874 0.0103  0.0241  0.0322 
0.0137  0.0155  0.0252  -0.0404 -0.1395 0.1862  0.0521  -0.3331 -0.0545 -0.2558 0.0031  -0.0014 
'X-RAY DIFFRACTION' 155 ? refined -120.2954 98.5463  299.4604 1.5823 1.9627  1.5683 0.1761  -0.2871 -0.2235 0.0132  0.0414  0.0013 
-0.0015 0.0046  0.0049  -0.0794 -0.1746 0.0256  0.0013  0.0302  0.0657  0.1023  -0.1956 -0.0014 
'X-RAY DIFFRACTION' 156 ? refined -125.2007 101.1802 289.1884 1.9747 2.3016  2.1934 0.7972  -0.4892 -0.0268 0.0531  0.0201  0.0280 
-0.0108 0.0402  -0.0127 0.2415  0.0701  0.0968  0.1666  0.1294  0.0639  -0.1276 -0.1113 0.0012  
'X-RAY DIFFRACTION' 157 ? refined -126.6878 87.0695  289.1080 0.7050 0.4265  0.7937 -0.1468 -0.4645 0.1766  0.0422  0.0025  0.0798 
-0.0078 0.0324  -0.0139 -0.0449 -0.0760 0.0580  0.0132  0.0183  -0.0120 -0.0447 -0.1389 0.0487  
'X-RAY DIFFRACTION' 158 ? refined -94.7774  68.8558  349.7756 1.1901 1.4757  0.8063 0.2951  -0.0689 0.0024  0.0050  0.0065  0.0068 
0.0044  -0.0023 -0.0057 0.0902  0.0182  0.0377  -0.0392 0.0423  -0.1028 -0.0877 0.0746  0.0005  
'X-RAY DIFFRACTION' 159 ? refined -98.0183  65.8009  358.9699 1.4468 1.2087  1.7556 0.1164  0.0549  -0.2266 0.0735  0.0239  0.0192 
0.0352  0.0310  0.0125  -0.0756 0.1152  0.0075  -0.0510 -0.0490 0.0070  0.1053  -0.2043 0.0016  
'X-RAY DIFFRACTION' 160 ? refined -90.3204  77.8570  367.3234 1.9859 2.1768  1.7018 -0.3316 -0.1115 0.3221  0.0082  0.0558  0.0095 
-0.0014 0.0079  -0.0129 0.0239  -0.0621 0.0214  0.0145  0.0083  -0.0180 0.0110  0.0637  0.0006  
'X-RAY DIFFRACTION' 161 ? refined -106.3953 80.7513  350.3426 1.3952 2.1881  1.0053 -0.4766 -0.2500 -0.4894 0.0251  0.0088  0.0001 
0.0008  -0.0021 -0.0007 -0.0356 0.2014  0.1379  0.0805  0.0215  -0.0786 0.0468  -0.0224 0.0011  
'X-RAY DIFFRACTION' 162 ? refined -90.0930  77.4313  356.1247 1.7915 1.9074  2.0495 -0.1228 -0.1282 0.4209  0.0246  0.0036  0.0008 
0.0086  0.0012  0.0010  -0.0338 -0.0013 0.0433  0.0071  -0.0664 -0.0861 -0.0677 0.0088  0.0001  
'X-RAY DIFFRACTION' 163 ? refined -105.0246 72.1329  357.9055 0.3707 0.8158  0.9844 -0.2043 -0.1320 -0.1502 0.0039  0.0206  0.1442 
0.0044  -0.0144 -0.0540 -0.1720 0.2488  0.0454  0.0668  -0.1325 -0.0889 -0.1477 0.1921  -0.1721 
'X-RAY DIFFRACTION' 164 ? refined -98.0924  83.9404  361.0115 1.3111 1.7491  1.4873 0.0845  0.3530  -0.0898 0.0069  0.0023  0.0355 
0.0011  0.0075  0.0104  0.1959  0.0330  0.0426  0.1564  0.0143  -0.0503 -0.0545 0.0333  0.0020  
'X-RAY DIFFRACTION' 165 ? refined -96.3332  77.9881  341.8179 1.1416 1.3404  1.4317 -0.6213 -0.5678 -0.0354 0.0766  0.0015  
-0.0003 0.0120  -0.0061 -0.0008 -0.0217 0.0145  0.0295  -0.0229 -0.0641 0.1334  0.0134  -0.1450 -0.0237 
'X-RAY DIFFRACTION' 166 ? refined -97.4378  84.7457  352.6649 0.9039 1.1625  1.3556 0.6519  -0.1215 0.0980  0.7497  0.2394  0.1228 
-0.2386 0.2483  0.0020  0.1885  0.3981  -0.0834 -0.2580 -0.1340 0.0550  0.1298  0.2008  -0.0339 
'X-RAY DIFFRACTION' 167 ? refined -116.4056 101.4686 388.9602 0.4049 0.2529  0.6885 0.1005  0.0018  -0.0382 0.0606  0.6794  0.0839 
-0.0656 -0.0058 0.2220  0.2198  0.0041  -0.1153 0.0073  -0.1496 0.4096  0.1950  -0.0693 0.2482  
'X-RAY DIFFRACTION' 168 ? refined -107.4823 124.6558 402.9988 2.6878 1.6939  1.7266 -0.3330 1.2352  -0.2622 0.0818  0.1462  0.1449 
-0.0420 -0.0104 0.1384  0.0712  0.0063  -0.0255 -0.2234 -0.4840 -0.1447 0.1874  0.2030  -0.0556 
'X-RAY DIFFRACTION' 169 ? refined -106.5717 136.7616 407.4352 1.3280 0.6883  1.1577 -0.3242 -0.1703 -0.4144 0.1204  0.0233  0.2453 
-0.0516 -0.1203 0.0371  0.1045  0.0460  -0.2011 -0.1271 -0.0856 -0.0117 0.0348  -0.1249 0.1330  
'X-RAY DIFFRACTION' 170 ? refined -93.0018  127.4461 392.3993 1.4292 1.0436  0.9576 0.1471  0.0631  -0.2838 0.0151  0.0204  0.0461 
0.0032  0.0050  0.0293  -0.0059 0.0436  0.0509  0.0249  0.0380  -0.0364 -0.0035 0.0048  -0.0005 
'X-RAY DIFFRACTION' 171 ? refined -114.1271 98.6267  412.8341 1.8719 1.7195  0.8981 0.2171  -0.2676 -0.0829 0.0214  -0.0004 0.0177 
0.0039  -0.0027 0.0009  -0.1250 -0.0175 0.0341  -0.0012 -0.2323 0.2095  -0.0290 0.0743  0.0025  
'X-RAY DIFFRACTION' 172 ? refined -114.8191 110.8927 409.3776 1.8953 2.1230  2.0148 -0.0812 0.7566  -0.2192 0.0118  0.0003  0.0022 
0.0003  0.0062  0.0019  0.1223  -0.0138 -0.1742 -0.0094 0.1733  -0.1437 -0.0340 -0.0217 -0.0003 
'X-RAY DIFFRACTION' 173 ? refined -102.2562 110.6776 398.2803 1.5125 0.9408  1.8051 -0.0638 0.3538  -0.2156 0.0074  0.0078  0.0071 
0.0015  -0.0078 -0.0020 -0.0705 -0.0555 0.1232  -0.0212 0.0242  0.0296  -0.0555 0.0054  -0.0004 
'X-RAY DIFFRACTION' 174 ? refined -91.6034  95.8019  402.2910 1.4712 1.0545  1.2517 0.1268  0.0924  -0.2454 0.0150  -0.0004 0.0087 
-0.0011 -0.0113 0.0004  0.0148  -0.1188 -0.0541 0.0075  0.0027  0.0542  -0.0637 0.0807  0.0003  
'X-RAY DIFFRACTION' 175 ? refined -99.9616  96.1937  423.7230 0.4511 0.5048  0.6851 0.1924  -0.0045 -0.1915 0.0946  0.0994  0.0849 
-0.0971 0.0880  -0.0911 0.0714  0.1284  0.1009  0.0450  -0.0232 0.1855  0.0537  0.0751  -0.0091 
'X-RAY DIFFRACTION' 176 ? refined -121.5510 113.5652 428.5914 1.3196 1.9638  1.2557 -0.4091 -0.4212 -0.0175 0.0041  0.0037  0.0062 
0.0041  -0.0052 -0.0056 0.1089  0.1723  -0.1971 0.0927  -0.0322 -0.0623 0.0010  -0.1594 0.0010  
'X-RAY DIFFRACTION' 177 ? refined -103.6659 128.5922 412.5787 0.9604 0.6627  1.0258 0.0095  0.1840  -0.4628 0.0832  0.0231  0.0336 
-0.0406 0.0498  -0.0220 0.1068  -0.0076 0.0267  0.3068  -0.0310 0.2485  -0.1005 -0.0347 0.0161  
'X-RAY DIFFRACTION' 178 ? refined -104.6836 101.7154 418.0059 1.2838 1.2291  0.8771 0.3531  0.0062  -0.0482 0.0972  0.0276  0.0568 
0.0110  -0.0190 0.0387  0.2465  0.1711  -0.1445 0.0976  0.0787  -0.0188 0.2450  0.2724  -0.0076 
'X-RAY DIFFRACTION' 179 ? refined -106.1504 114.4857 415.4685 1.2429 1.3990  0.8864 -0.0218 -0.5902 -0.1676 0.4222  0.9478  0.2552 
0.6324  -0.3230 -0.4851 0.0642  0.0662  0.1999  0.2952  0.0259  0.1560  -0.0534 0.0069  0.2591  
'X-RAY DIFFRACTION' 180 ? refined -86.7521  107.8638 399.2178 1.6072 1.7693  1.4298 0.1869  0.2887  0.0336  0.0092  0.0096  0.0062 
0.0020  -0.0056 -0.0063 -0.0153 -0.0863 -0.0092 0.0120  0.0294  -0.0477 -0.0351 0.0558  -0.0003 
'X-RAY DIFFRACTION' 181 ? refined -80.2240  103.6158 410.2321 1.1282 1.7028  1.3707 0.3006  0.1750  0.2307  0.0021  0.0122  0.0275 
0.0047  0.0065  0.0184  0.0568  -0.0470 0.0270  0.0627  0.0892  0.0025  -0.0187 0.0209  0.0005  
'X-RAY DIFFRACTION' 182 ? refined -25.1798  121.5301 477.8535 1.1890 0.9704  1.1084 0.0276  0.0521  -0.1365 0.0596  0.0591  0.0608 
-0.0454 0.0173  0.0335  -0.0892 0.4285  -0.1979 0.1248  -0.0645 -0.1067 0.1367  0.1085  -0.0049 
'X-RAY DIFFRACTION' 183 ? refined -29.6676  102.8062 476.0423 0.7699 1.9780  0.8344 0.0427  0.1746  -0.0714 0.1546  0.1135  0.5096 
-0.0995 -0.2785 0.1950  0.2973  -0.2728 0.0415  0.1437  -0.3697 0.0442  0.5347  0.2380  0.0551  
'X-RAY DIFFRACTION' 184 ? refined -13.8668  92.4904  481.5501 1.3310 2.2232  0.7622 0.3192  0.0807  0.2929  0.0925  0.0312  0.0151 
0.0267  -0.0188 0.0242  -0.0815 0.0583  -0.0022 -0.2036 0.1126  0.1046  0.0005  0.1423  0.0010  
'X-RAY DIFFRACTION' 185 ? refined -0.5752   101.2131 474.3577 1.1662 1.8649  1.4679 0.5222  0.0175  -0.3962 -0.0004 0.0053  0.0174 
-0.0030 -0.0019 0.0024  0.0311  -0.0230 0.1185  0.1792  -0.2027 -0.0531 0.0544  0.1834  0.0007  
'X-RAY DIFFRACTION' 186 ? refined -24.4823  98.6714  500.9081 1.3824 1.4797  1.4890 0.0252  -0.1337 0.1073  0.0057  0.0569  0.0058 
0.0031  -0.0061 -0.0029 -0.2400 -0.1150 0.1539  -0.1385 -0.1694 -0.0959 -0.1260 -0.0228 -0.0048 
'X-RAY DIFFRACTION' 187 ? refined -14.8254  79.9335  476.8812 1.6812 1.6718  1.4249 -0.2376 0.4235  0.3018  0.0651  0.0146  0.0982 
0.0182  -0.0392 0.0159  0.1525  0.2918  0.2068  0.0349  -0.1448 -0.1801 -0.2065 -0.4071 0.0070  
'X-RAY DIFFRACTION' 188 ? refined -69.8111  98.6278  434.1358 1.0415 1.1295  0.6941 0.2320  0.4972  0.1918  0.3131  0.7848  0.1239 
-0.2409 -0.0884 0.2861  0.2186  -0.2329 0.1444  -0.1858 -0.4096 0.1487  -0.1593 0.1061  -0.8668 
'X-RAY DIFFRACTION' 189 ? refined -53.3959  132.9342 452.2580 0.4319 1.0251  1.4872 -0.0144 -0.0728 -0.3023 0.0351  0.1087  0.0644 
-0.0634 0.0494  -0.0885 -0.1375 0.1542  0.3086  0.0550  -0.4826 -0.2139 -0.0857 -0.4523 -0.1142 
'X-RAY DIFFRACTION' 190 ? refined -59.8822  113.6126 452.2114 0.7648 1.0881  0.6983 -0.0926 -0.0911 -0.2173 0.0867  0.7038  0.4707 
0.0300  -0.1017 -0.5129 0.0151  -0.5386 0.4925  -0.2175 -0.1975 -0.2268 -0.2292 0.5958  -0.0637 
'X-RAY DIFFRACTION' 191 ? refined -39.9722  110.6930 457.8767 1.0345 1.1868  1.0171 0.1113  0.5197  0.1149  0.1664  0.0055  0.0507 
-0.0449 0.0946  -0.0249 0.1165  0.1924  -0.1764 0.0126  0.0053  0.1158  -0.0934 -0.0353 0.0578  
'X-RAY DIFFRACTION' 192 ? refined -41.7697  120.8774 461.9926 1.4004 1.0949  1.3290 0.7104  0.1483  -0.1135 0.4789  0.4112  0.0602 
-0.0530 -0.0326 -0.1471 0.3163  0.5585  0.1813  -0.4245 -0.0902 0.0347  0.0240  0.0526  -0.1133 
'X-RAY DIFFRACTION' 193 ? refined -87.5543  140.4632 413.7310 0.7685 0.1256  0.9877 0.0366  -0.0506 -0.0279 0.0785  0.0029  0.1727 
-0.0015 0.0058  0.0138  0.0644  -0.0081 -0.0451 -0.1612 -0.1631 -0.1394 0.0989  0.0387  -0.0139 
'X-RAY DIFFRACTION' 194 ? refined -89.6972  135.6519 428.2082 0.7938 0.4486  0.7263 0.0493  -0.2221 -0.2978 0.0540  0.6560  0.7635 
0.1327  0.0069  0.5031  -0.0873 0.0273  0.0139  0.0504  -0.1288 0.2002  -0.1068 -0.2750 0.2063  
'X-RAY DIFFRACTION' 195 ? refined -88.9245  126.3599 415.0325 0.8435 0.5001  0.7637 0.2148  -0.0760 -0.3003 0.5515  -0.0020 0.4480 
0.0179  0.2640  0.0025  -0.0662 -0.1460 0.0730  0.0411  0.0357  0.0307  0.1068  -0.2211 0.4887  
'X-RAY DIFFRACTION' 196 ? refined -92.2647  115.6520 424.8516 0.9364 0.5229  0.5867 0.3676  0.0751  -0.0453 0.5569  0.1101  0.1484 
0.1450  -0.1342 0.0587  0.0647  -0.1164 0.1297  0.1217  -0.0941 0.1100  0.0155  0.0152  0.0624  
'X-RAY DIFFRACTION' 197 ? refined -74.5179  119.6877 431.1135 1.3677 1.5008  0.7106 0.0425  0.2091  -0.0620 0.0356  -0.0014 0.0299 
-0.0034 0.0327  -0.0049 0.0610  0.2435  0.0641  0.0554  -0.2964 0.0970  0.3117  0.4360  -0.0033 
'X-RAY DIFFRACTION' 198 ? refined -68.7350  124.8015 430.7171 1.2227 0.7022  1.4220 0.1406  -0.0221 -0.4451 0.1073  0.0330  0.1057 
0.0507  -0.0032 -0.0410 0.0881  0.0679  0.2385  0.1409  0.2130  0.1068  -0.1610 -0.0576 0.0146  
'X-RAY DIFFRACTION' 199 ? refined -129.0379 109.9836 385.3255 0.5591 0.6036  0.7540 0.2688  -0.0751 -0.3889 0.1969  0.0225  0.0655 
-0.0881 0.1081  -0.0341 -0.1020 -0.1575 -0.0311 0.0472  0.1946  -0.1935 0.0338  -0.0960 0.3893  
'X-RAY DIFFRACTION' 200 ? refined -123.2805 121.8428 391.0037 0.8592 0.4989  0.8812 0.1189  -0.1536 -0.1424 0.8023  0.3373  0.3736 
0.1863  -0.3851 -0.2870 0.2467  -0.4103 0.2703  0.2687  -0.2418 -0.3098 -0.1748 0.2289  -0.0827 
'X-RAY DIFFRACTION' 201 ? refined -114.9167 138.8587 392.7876 0.9750 0.6327  1.2146 0.3313  -0.3218 -0.4318 0.0036  0.1018  0.1753 
-0.0006 -0.0046 0.1232  -0.0232 0.1204  -0.0761 -0.1426 -0.1815 0.0389  0.1867  -0.0432 -0.2479 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1   1   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 2   2   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 3   3   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 61 through 86 )
;
'X-RAY DIFFRACTION' 4   4   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 87 through 155 )
;
'X-RAY DIFFRACTION' 5   5   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 156 through 232 )
;
'X-RAY DIFFRACTION' 6   6   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 233 through 366 )
;
'X-RAY DIFFRACTION' 7   7   ? ? ? ? ? ? ? ? ? 
;chain '1' and (resid 367 through 438 )
;
'X-RAY DIFFRACTION' 8   8   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 9   9   ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 10  10  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 39 through 66 )
;
'X-RAY DIFFRACTION' 11  11  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 12  12  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 13  13  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 14  14  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 15  15  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 117 through 132 )
;
'X-RAY DIFFRACTION' 16  16  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 133 through 146 )
;
'X-RAY DIFFRACTION' 17  17  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 18  18  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 159 through 165 )
;
'X-RAY DIFFRACTION' 19  19  ? ? ? ? ? ? ? ? ? 
;chain '2' and (resid 166 through 180 )
;
'X-RAY DIFFRACTION' 20  20  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 1 through 137 )
;
'X-RAY DIFFRACTION' 21  21  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 138 through 193 )
;
'X-RAY DIFFRACTION' 22  22  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 23  23  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 24  24  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 351 through 460 )
;
'X-RAY DIFFRACTION' 25  25  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 461 through 595 )
;
'X-RAY DIFFRACTION' 26  26  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 596 through 667 )
;
'X-RAY DIFFRACTION' 27  27  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 28  28  ? ? ? ? ? ? ? ? ? 
;chain '3' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 29  29  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 26 through 139 )
;
'X-RAY DIFFRACTION' 30  30  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 31  31  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 209 through 247 )
;
'X-RAY DIFFRACTION' 32  32  ? ? ? ? ? ? ? ? ? 
;chain '4' and (resid 248 through 409 )
;
'X-RAY DIFFRACTION' 33  33  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 34  34  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 35  35  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 32 through 43 )
;
'X-RAY DIFFRACTION' 36  36  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 44 through 67 )
;
'X-RAY DIFFRACTION' 37  37  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 68 through 86 )
;
'X-RAY DIFFRACTION' 38  38  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 87 through 109 )
;
'X-RAY DIFFRACTION' 39  39  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 110 through 121 )
;
'X-RAY DIFFRACTION' 40  40  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 122 through 141 )
;
'X-RAY DIFFRACTION' 41  41  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 142 through 175 )
;
'X-RAY DIFFRACTION' 42  42  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 176 through 185 )
;
'X-RAY DIFFRACTION' 43  43  ? ? ? ? ? ? ? ? ? 
;chain '5' and (resid 186 through 196 )
;
'X-RAY DIFFRACTION' 44  44  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 45  45  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 46  46  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 57 through 77 )
;
'X-RAY DIFFRACTION' 47  47  ? ? ? ? ? ? ? ? ? 
;chain '6' and (resid 78 through 181 )
;
'X-RAY DIFFRACTION' 48  48  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 49  49  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 19 through 38 )
;
'X-RAY DIFFRACTION' 50  50  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 39 through 48 )
;
'X-RAY DIFFRACTION' 51  51  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 52  52  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 53  53  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 113 through 135 )
;
'X-RAY DIFFRACTION' 54  54  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 136 through 167 )
;
'X-RAY DIFFRACTION' 55  55  ? ? ? ? ? ? ? ? ? 
;chain '9' and (resid 168 through 181 )
;
'X-RAY DIFFRACTION' 56  56  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 57  57  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 58  58  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 59  59  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 60  60  ? ? ? ? ? ? ? ? ? 
;chain '7' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 61  61  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 62  62  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 10 through 35 )
;
'X-RAY DIFFRACTION' 63  63  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 36 through 46 )
;
'X-RAY DIFFRACTION' 64  64  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 47 through 69 )
;
'X-RAY DIFFRACTION' 65  65  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 70 through 95 )
;
'X-RAY DIFFRACTION' 66  66  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 96 through 106 )
;
'X-RAY DIFFRACTION' 67  67  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 107 through 117 )
;
'X-RAY DIFFRACTION' 68  68  ? ? ? ? ? ? ? ? ? 
;chain 'W' and (resid 118 through 127 )
;
'X-RAY DIFFRACTION' 69  69  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 2 through 88 )
;
'X-RAY DIFFRACTION' 70  70  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 89 through 117 )
;
'X-RAY DIFFRACTION' 71  71  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 72  72  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 25 through 73 )
;
'X-RAY DIFFRACTION' 73  73  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 74 through 108 )
;
'X-RAY DIFFRACTION' 74  74  ? ? ? ? ? ? ? ? ? 
;chain 'J' and (resid 109 through 160 )
;
'X-RAY DIFFRACTION' 75  75  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 76  76  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 24 through 51 )
;
'X-RAY DIFFRACTION' 77  77  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 52 through 78 )
;
'X-RAY DIFFRACTION' 78  78  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 79 through 86 )
;
'X-RAY DIFFRACTION' 79  79  ? ? ? ? ? ? ? ? ? 
;chain 'K' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 80  80  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 81  81  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 71 through 425 )
;
'X-RAY DIFFRACTION' 82  82  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 426 through 458 )
;
'X-RAY DIFFRACTION' 83  83  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 459 through 510 )
;
'X-RAY DIFFRACTION' 84  84  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 511 through 542 )
;
'X-RAY DIFFRACTION' 85  85  ? ? ? ? ? ? ? ? ? 
;chain 'L' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 86  86  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 1 through 114 )
;
'X-RAY DIFFRACTION' 87  87  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 115 through 414 )
;
'X-RAY DIFFRACTION' 88  88  ? ? ? ? ? ? ? ? ? 
;chain 'M' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 89  89  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 1 through 127 )
;
'X-RAY DIFFRACTION' 90  90  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 128 through 187 )
;
'X-RAY DIFFRACTION' 91  91  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 188 through 357 )
;
'X-RAY DIFFRACTION' 92  92  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 358 through 395 )
;
'X-RAY DIFFRACTION' 93  93  ? ? ? ? ? ? ? ? ? 
;chain 'N' and (resid 396 through 427 )
;
'X-RAY DIFFRACTION' 94  94  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 2 through 42 )
;
'X-RAY DIFFRACTION' 95  95  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 43 through 104 )
;
'X-RAY DIFFRACTION' 96  96  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 105 through 147 )
;
'X-RAY DIFFRACTION' 97  97  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 148 through 262 )
;
'X-RAY DIFFRACTION' 98  98  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 263 through 296 )
;
'X-RAY DIFFRACTION' 99  99  ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 297 through 334 )
;
'X-RAY DIFFRACTION' 100 100 ? ? ? ? ? ? ? ? ? 
;chain 'H' and (resid 335 through 354 )
;
'X-RAY DIFFRACTION' 101 101 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 2 through 38 )
;
'X-RAY DIFFRACTION' 102 102 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 39 through 60 )
;
'X-RAY DIFFRACTION' 103 103 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 61 through 124 )
;
'X-RAY DIFFRACTION' 104 104 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 125 through 267 )
;
'X-RAY DIFFRACTION' 105 105 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 268 through 366 )
;
'X-RAY DIFFRACTION' 106 106 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 367 through 395 )
;
'X-RAY DIFFRACTION' 107 107 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 396 through 438 )
;
'X-RAY DIFFRACTION' 108 108 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 3 through 22 )
;
'X-RAY DIFFRACTION' 109 109 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 23 through 38 )
;
'X-RAY DIFFRACTION' 110 110 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 39 through 53 )
;
'X-RAY DIFFRACTION' 111 111 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 54 through 66 )
;
'X-RAY DIFFRACTION' 112 112 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 67 through 77 )
;
'X-RAY DIFFRACTION' 113 113 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 78 through 92 )
;
'X-RAY DIFFRACTION' 114 114 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 93 through 104 )
;
'X-RAY DIFFRACTION' 115 115 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 105 through 116 )
;
'X-RAY DIFFRACTION' 116 116 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 117 through 146 )
;
'X-RAY DIFFRACTION' 117 117 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 147 through 158 )
;
'X-RAY DIFFRACTION' 118 118 ? ? ? ? ? ? ? ? ? 
;chain 'C' and (resid 159 through 180 )
;
'X-RAY DIFFRACTION' 119 119 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 1 through 128 )
;
'X-RAY DIFFRACTION' 120 120 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 129 through 193 )
;
'X-RAY DIFFRACTION' 121 121 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 194 through 309 )
;
'X-RAY DIFFRACTION' 122 122 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 310 through 350 )
;
'X-RAY DIFFRACTION' 123 123 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 351 through 546 )
;
'X-RAY DIFFRACTION' 124 124 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 547 through 594 )
;
'X-RAY DIFFRACTION' 125 125 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 595 through 667 )
;
'X-RAY DIFFRACTION' 126 126 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 668 through 719 )
;
'X-RAY DIFFRACTION' 127 127 ? ? ? ? ? ? ? ? ? 
;chain 'D' and (resid 720 through 777 )
;
'X-RAY DIFFRACTION' 128 128 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 26 through 53 )
;
'X-RAY DIFFRACTION' 129 129 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 54 through 139 )
;
'X-RAY DIFFRACTION' 130 130 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 140 through 208 )
;
'X-RAY DIFFRACTION' 131 131 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 209 through 232 )
;
'X-RAY DIFFRACTION' 132 132 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 233 through 409 )
;
'X-RAY DIFFRACTION' 133 133 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 1 through 13 )
;
'X-RAY DIFFRACTION' 134 134 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 14 through 31 )
;
'X-RAY DIFFRACTION' 135 135 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 32 through 86 )
;
'X-RAY DIFFRACTION' 136 136 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 87 through 121 )
;
'X-RAY DIFFRACTION' 137 137 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 122 through 175 )
;
'X-RAY DIFFRACTION' 138 138 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 176 through 196 )
;
'X-RAY DIFFRACTION' 139 139 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 20 through 34 )
;
'X-RAY DIFFRACTION' 140 140 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 35 through 56 )
;
'X-RAY DIFFRACTION' 141 141 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 57 through 88 )
;
'X-RAY DIFFRACTION' 142 142 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 89 through 158 )
;
'X-RAY DIFFRACTION' 143 143 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 159 through 168 )
;
'X-RAY DIFFRACTION' 144 144 ? ? ? ? ? ? ? ? ? 
;chain 'G' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 145 145 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 2 through 18 )
;
'X-RAY DIFFRACTION' 146 146 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 19 through 30 )
;
'X-RAY DIFFRACTION' 147 147 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 31 through 48 )
;
'X-RAY DIFFRACTION' 148 148 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 49 through 74 )
;
'X-RAY DIFFRACTION' 149 149 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 75 through 112 )
;
'X-RAY DIFFRACTION' 150 150 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 113 through 125 )
;
'X-RAY DIFFRACTION' 151 151 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 126 through 168 )
;
'X-RAY DIFFRACTION' 152 152 ? ? ? ? ? ? ? ? ? 
;chain 'O' and (resid 169 through 181 )
;
'X-RAY DIFFRACTION' 153 153 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 3 through 27 )
;
'X-RAY DIFFRACTION' 154 154 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 28 through 60 )
;
'X-RAY DIFFRACTION' 155 155 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 61 through 81 )
;
'X-RAY DIFFRACTION' 156 156 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 82 through 111 )
;
'X-RAY DIFFRACTION' 157 157 ? ? ? ? ? ? ? ? ? 
;chain 'I' and (resid 112 through 129 )
;
'X-RAY DIFFRACTION' 158 158 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 1 through 9 )
;
'X-RAY DIFFRACTION' 159 159 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 10 through 21 )
;
'X-RAY DIFFRACTION' 160 160 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 22 through 29 )
;
'X-RAY DIFFRACTION' 161 161 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 30 through 46 )
;
'X-RAY DIFFRACTION' 162 162 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 47 through 59 )
;
'X-RAY DIFFRACTION' 163 163 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 60 through 83 )
;
'X-RAY DIFFRACTION' 164 164 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 84 through 93 )
;
'X-RAY DIFFRACTION' 165 165 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 94 through 106 )
;
'X-RAY DIFFRACTION' 166 166 ? ? ? ? ? ? ? ? ? 
;chain 'X' and (resid 107 through 127 )
;
'X-RAY DIFFRACTION' 167 167 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 2 through 58 )
;
'X-RAY DIFFRACTION' 168 168 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 59 through 83 )
;
'X-RAY DIFFRACTION' 169 169 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 84 through 112 )
;
'X-RAY DIFFRACTION' 170 170 ? ? ? ? ? ? ? ? ? 
;chain 'P' and (resid 113 through 117 )
;
'X-RAY DIFFRACTION' 171 171 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 1 through 24 )
;
'X-RAY DIFFRACTION' 172 172 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 25 through 62 )
;
'X-RAY DIFFRACTION' 173 173 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 63 through 73 )
;
'X-RAY DIFFRACTION' 174 174 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 74 through 87 )
;
'X-RAY DIFFRACTION' 175 175 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 88 through 108 )
;
'X-RAY DIFFRACTION' 176 176 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 109 through 123 )
;
'X-RAY DIFFRACTION' 177 177 ? ? ? ? ? ? ? ? ? 
;chain 'R' and (resid 124 through 160 )
;
'X-RAY DIFFRACTION' 178 178 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 1 through 23 )
;
'X-RAY DIFFRACTION' 179 179 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 24 through 76 )
;
'X-RAY DIFFRACTION' 180 180 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 77 through 86 )
;
'X-RAY DIFFRACTION' 181 181 ? ? ? ? ? ? ? ? ? 
;chain 'S' and (resid 87 through 95 )
;
'X-RAY DIFFRACTION' 182 182 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 1 through 70 )
;
'X-RAY DIFFRACTION' 183 183 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 71 through 290 )
;
'X-RAY DIFFRACTION' 184 184 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 291 through 425 )
;
'X-RAY DIFFRACTION' 185 185 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 426 through 455 )
;
'X-RAY DIFFRACTION' 186 186 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 456 through 488 )
;
'X-RAY DIFFRACTION' 187 187 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 489 through 542 )
;
'X-RAY DIFFRACTION' 188 188 ? ? ? ? ? ? ? ? ? 
;chain 'T' and (resid 543 through 605 )
;
'X-RAY DIFFRACTION' 189 189 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 1 through 95 )
;
'X-RAY DIFFRACTION' 190 190 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 96 through 304 )
;
'X-RAY DIFFRACTION' 191 191 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 305 through 414 )
;
'X-RAY DIFFRACTION' 192 192 ? ? ? ? ? ? ? ? ? 
;chain 'U' and (resid 415 through 467 )
;
'X-RAY DIFFRACTION' 193 193 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 1 through 42 )
;
'X-RAY DIFFRACTION' 194 194 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 43 through 75 )
;
'X-RAY DIFFRACTION' 195 195 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 76 through 127 )
;
'X-RAY DIFFRACTION' 196 196 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 128 through 225 )
;
'X-RAY DIFFRACTION' 197 197 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 226 through 357 )
;
'X-RAY DIFFRACTION' 198 198 ? ? ? ? ? ? ? ? ? 
;chain 'V' and (resid 358 through 427 )
;
'X-RAY DIFFRACTION' 199 199 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 2 through 104 )
;
'X-RAY DIFFRACTION' 200 200 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 105 through 296 )
;
'X-RAY DIFFRACTION' 201 201 ? ? ? ? ? ? ? ? ? 
;chain 'Q' and (resid 297 through 354 )
;
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 1 MET 1   ? A  MET 1   
2   1 Y 1 2 MET 1   ? B  MET 1   
3   1 Y 1 2 GLY 2   ? B  GLY 2   
4   1 Y 1 2 VAL 181 ? B  VAL 181 
5   1 Y 1 3 LYS 56  ? C  LYS 56  
6   1 Y 1 3 LYS 57  ? C  LYS 57  
7   1 Y 1 3 GLY 58  ? C  GLY 58  
8   1 Y 1 3 PRO 59  ? C  PRO 59  
9   1 Y 1 3 ASP 60  ? C  ASP 60  
10  1 Y 1 3 GLY 61  ? C  GLY 61  
11  1 Y 1 3 LYS 62  ? C  LYS 62  
12  1 Y 1 3 PRO 63  ? C  PRO 63  
13  1 Y 1 3 LEU 64  ? C  LEU 64  
14  1 Y 1 3 LEU 65  ? C  LEU 65  
15  1 Y 1 3 ASN 66  ? C  ASN 66  
16  1 Y 1 3 GLU 67  ? C  GLU 67  
17  1 Y 1 3 LYS 68  ? C  LYS 68  
18  1 Y 1 3 GLY 69  ? C  GLY 69  
19  1 Y 1 3 GLU 70  ? C  GLU 70  
20  1 Y 1 3 PRO 71  ? C  PRO 71  
21  1 Y 1 3 GLU 72  ? C  GLU 72  
22  1 Y 1 3 TYR 144 ? C  TYR 144 
23  1 Y 1 3 GLN 145 ? C  GLN 145 
24  1 Y 1 3 LYS 146 ? C  LYS 146 
25  1 Y 1 3 GLY 147 ? C  GLY 147 
26  1 Y 1 3 PRO 778 ? C  PRO 778 
27  1 Y 1 3 ALA 779 ? C  ALA 779 
28  1 Y 1 3 GLY 780 ? C  GLY 780 
29  1 Y 1 3 GLY 781 ? C  GLY 781 
30  1 Y 1 3 GLU 782 ? C  GLU 782 
31  1 Y 1 3 ALA 783 ? C  ALA 783 
32  1 Y 1 4 MET 1   ? D  MET 1   
33  1 Y 1 4 ARG 2   ? D  ARG 2   
34  1 Y 1 4 GLU 3   ? D  GLU 3   
35  1 Y 1 4 GLU 4   ? D  GLU 4   
36  1 Y 1 4 PHE 5   ? D  PHE 5   
37  1 Y 1 4 LEU 6   ? D  LEU 6   
38  1 Y 1 4 GLU 7   ? D  GLU 7   
39  1 Y 1 4 GLU 8   ? D  GLU 8   
40  1 Y 1 4 ILE 9   ? D  ILE 9   
41  1 Y 1 4 PRO 10  ? D  PRO 10  
42  1 Y 1 4 LEU 11  ? D  LEU 11  
43  1 Y 1 4 ASP 12  ? D  ASP 12  
44  1 Y 1 4 ALA 13  ? D  ALA 13  
45  1 Y 1 4 PRO 14  ? D  PRO 14  
46  1 Y 1 4 PRO 15  ? D  PRO 15  
47  1 Y 1 4 GLU 16  ? D  GLU 16  
48  1 Y 1 4 GLU 17  ? D  GLU 17  
49  1 Y 1 4 ALA 18  ? D  ALA 18  
50  1 Y 1 4 LYS 19  ? D  LYS 19  
51  1 Y 1 4 GLU 20  ? D  GLU 20  
52  1 Y 1 4 LEU 21  ? D  LEU 21  
53  1 Y 1 4 ARG 22  ? D  ARG 22  
54  1 Y 1 4 THR 23  ? D  THR 23  
55  1 Y 1 4 GLU 24  ? D  GLU 24  
56  1 Y 1 4 VAL 25  ? D  VAL 25  
57  1 Y 1 5 ALA 197 ? E  ALA 197 
58  1 Y 1 5 ASP 198 ? E  ASP 198 
59  1 Y 1 5 LEU 199 ? E  LEU 199 
60  1 Y 1 5 LYS 200 ? E  LYS 200 
61  1 Y 1 5 LYS 201 ? E  LYS 201 
62  1 Y 1 5 ALA 202 ? E  ALA 202 
63  1 Y 1 5 ARG 203 ? E  ARG 203 
64  1 Y 1 5 GLU 204 ? E  GLU 204 
65  1 Y 1 5 VAL 205 ? E  VAL 205 
66  1 Y 1 5 LYS 206 ? E  LYS 206 
67  1 Y 1 5 GLY 207 ? E  GLY 207 
68  1 Y 1 6 MET 1   ? F  MET 1   
69  1 Y 1 6 ALA 2   ? F  ALA 2   
70  1 Y 1 6 LEU 3   ? F  LEU 3   
71  1 Y 1 6 LYS 4   ? F  LYS 4   
72  1 Y 1 6 ASP 5   ? F  ASP 5   
73  1 Y 1 6 LEU 6   ? F  LEU 6   
74  1 Y 1 6 PHE 7   ? F  PHE 7   
75  1 Y 1 6 GLU 8   ? F  GLU 8   
76  1 Y 1 6 ARG 9   ? F  ARG 9   
77  1 Y 1 6 ASP 10  ? F  ASP 10  
78  1 Y 1 6 VAL 11  ? F  VAL 11  
79  1 Y 1 6 GLN 12  ? F  GLN 12  
80  1 Y 1 6 GLU 13  ? F  GLU 13  
81  1 Y 1 6 LEU 14  ? F  LEU 14  
82  1 Y 1 6 GLU 15  ? F  GLU 15  
83  1 Y 1 9 MET 1   ? G  MET 1   
84  1 Y 1 9 ARG 182 ? G  ARG 182 
85  1 Y 1 7 MET 1   ? H  MET 1   
86  1 Y 1 7 SER 2   ? H  SER 2   
87  1 Y 1 W LYS 128 ? I  LYS 128 
88  1 Y 1 W ARG 129 ? I  ARG 129 
89  1 Y 1 W ALA 130 ? I  ALA 130 
90  1 Y 1 W ALA 131 ? I  ALA 131 
91  1 Y 1 A TRP 118 ? J  TRP 118 
92  1 Y 1 A HIS 119 ? J  HIS 119 
93  1 Y 1 J LYS 161 ? K  LYS 161 
94  1 Y 1 J ALA 162 ? K  ALA 162 
95  1 Y 1 J SER 163 ? K  SER 163 
96  1 Y 1 J ARG 164 ? K  ARG 164 
97  1 Y 1 J ALA 165 ? K  ALA 165 
98  1 Y 1 J LYS 166 ? K  LYS 166 
99  1 Y 1 J GLU 167 ? K  GLU 167 
100 1 Y 1 J ALA 168 ? K  ALA 168 
101 1 Y 1 J GLU 169 ? K  GLU 169 
102 1 Y 1 J LYS 170 ? K  LYS 170 
103 1 Y 1 J ARG 171 ? K  ARG 171 
104 1 Y 1 J GLU 172 ? K  GLU 172 
105 1 Y 1 J GLU 173 ? K  GLU 173 
106 1 Y 1 J VAL 174 ? K  VAL 174 
107 1 Y 1 J ALA 175 ? K  ALA 175 
108 1 Y 1 J ARG 176 ? K  ARG 176 
109 1 Y 1 L TRP 606 ? M  TRP 606 
110 1 Y 1 M GLY 468 ? N  GLY 468 
111 1 Y 1 M ALA 469 ? N  ALA 469 
112 1 Y 1 H MET 1   ? P  MET 1   
113 1 Y 1 H THR 355 ? P  THR 355 
114 1 Y 1 H PRO 356 ? P  PRO 356 
115 1 Y 1 H LYS 357 ? P  LYS 357 
116 1 Y 1 H PRO 358 ? P  PRO 358 
117 1 Y 1 H ALA 359 ? P  ALA 359 
118 1 Y 1 H ARG 360 ? P  ARG 360 
119 1 Y 1 H LYS 361 ? P  LYS 361 
120 1 Y 1 H GLY 362 ? P  GLY 362 
121 1 Y 1 H GLY 363 ? P  GLY 363 
122 1 Y 1 H GLY 364 ? P  GLY 364 
123 1 Y 1 H ALA 365 ? P  ALA 365 
124 1 Y 1 B MET 1   ? Q  MET 1   
125 1 Y 1 C MET 1   ? R  MET 1   
126 1 Y 1 C GLY 2   ? R  GLY 2   
127 1 Y 1 C VAL 181 ? R  VAL 181 
128 1 Y 1 D LYS 56  ? S  LYS 56  
129 1 Y 1 D LYS 57  ? S  LYS 57  
130 1 Y 1 D GLY 58  ? S  GLY 58  
131 1 Y 1 D PRO 59  ? S  PRO 59  
132 1 Y 1 D ASP 60  ? S  ASP 60  
133 1 Y 1 D GLY 61  ? S  GLY 61  
134 1 Y 1 D LYS 62  ? S  LYS 62  
135 1 Y 1 D PRO 63  ? S  PRO 63  
136 1 Y 1 D LEU 64  ? S  LEU 64  
137 1 Y 1 D LEU 65  ? S  LEU 65  
138 1 Y 1 D ASN 66  ? S  ASN 66  
139 1 Y 1 D GLU 67  ? S  GLU 67  
140 1 Y 1 D LYS 68  ? S  LYS 68  
141 1 Y 1 D GLY 69  ? S  GLY 69  
142 1 Y 1 D GLU 70  ? S  GLU 70  
143 1 Y 1 D PRO 71  ? S  PRO 71  
144 1 Y 1 D GLU 72  ? S  GLU 72  
145 1 Y 1 D TYR 144 ? S  TYR 144 
146 1 Y 1 D GLN 145 ? S  GLN 145 
147 1 Y 1 D LYS 146 ? S  LYS 146 
148 1 Y 1 D GLY 147 ? S  GLY 147 
149 1 Y 1 D PRO 778 ? S  PRO 778 
150 1 Y 1 D ALA 779 ? S  ALA 779 
151 1 Y 1 D GLY 780 ? S  GLY 780 
152 1 Y 1 D GLY 781 ? S  GLY 781 
153 1 Y 1 D GLU 782 ? S  GLU 782 
154 1 Y 1 D ALA 783 ? S  ALA 783 
155 1 Y 1 E MET 1   ? T  MET 1   
156 1 Y 1 E ARG 2   ? T  ARG 2   
157 1 Y 1 E GLU 3   ? T  GLU 3   
158 1 Y 1 E GLU 4   ? T  GLU 4   
159 1 Y 1 E PHE 5   ? T  PHE 5   
160 1 Y 1 E LEU 6   ? T  LEU 6   
161 1 Y 1 E GLU 7   ? T  GLU 7   
162 1 Y 1 E GLU 8   ? T  GLU 8   
163 1 Y 1 E ILE 9   ? T  ILE 9   
164 1 Y 1 E PRO 10  ? T  PRO 10  
165 1 Y 1 E LEU 11  ? T  LEU 11  
166 1 Y 1 E ASP 12  ? T  ASP 12  
167 1 Y 1 E ALA 13  ? T  ALA 13  
168 1 Y 1 E PRO 14  ? T  PRO 14  
169 1 Y 1 E PRO 15  ? T  PRO 15  
170 1 Y 1 E GLU 16  ? T  GLU 16  
171 1 Y 1 E GLU 17  ? T  GLU 17  
172 1 Y 1 E ALA 18  ? T  ALA 18  
173 1 Y 1 E LYS 19  ? T  LYS 19  
174 1 Y 1 E GLU 20  ? T  GLU 20  
175 1 Y 1 E LEU 21  ? T  LEU 21  
176 1 Y 1 E ARG 22  ? T  ARG 22  
177 1 Y 1 E THR 23  ? T  THR 23  
178 1 Y 1 E GLU 24  ? T  GLU 24  
179 1 Y 1 E VAL 25  ? T  VAL 25  
180 1 Y 1 F ALA 197 ? U  ALA 197 
181 1 Y 1 F ASP 198 ? U  ASP 198 
182 1 Y 1 F LEU 199 ? U  LEU 199 
183 1 Y 1 F LYS 200 ? U  LYS 200 
184 1 Y 1 F LYS 201 ? U  LYS 201 
185 1 Y 1 F ALA 202 ? U  ALA 202 
186 1 Y 1 F ARG 203 ? U  ARG 203 
187 1 Y 1 F GLU 204 ? U  GLU 204 
188 1 Y 1 F VAL 205 ? U  VAL 205 
189 1 Y 1 F LYS 206 ? U  LYS 206 
190 1 Y 1 F GLY 207 ? U  GLY 207 
191 1 Y 1 G MET 1   ? V  MET 1   
192 1 Y 1 G ALA 2   ? V  ALA 2   
193 1 Y 1 G LEU 3   ? V  LEU 3   
194 1 Y 1 G LYS 4   ? V  LYS 4   
195 1 Y 1 G ASP 5   ? V  ASP 5   
196 1 Y 1 G LEU 6   ? V  LEU 6   
197 1 Y 1 G PHE 7   ? V  PHE 7   
198 1 Y 1 G GLU 8   ? V  GLU 8   
199 1 Y 1 G ARG 9   ? V  ARG 9   
200 1 Y 1 G ASP 10  ? V  ASP 10  
201 1 Y 1 G VAL 11  ? V  VAL 11  
202 1 Y 1 G GLN 12  ? V  GLN 12  
203 1 Y 1 G GLU 13  ? V  GLU 13  
204 1 Y 1 G LEU 14  ? V  LEU 14  
205 1 Y 1 G GLU 15  ? V  GLU 15  
206 1 Y 1 O MET 1   ? W  MET 1   
207 1 Y 1 O ARG 182 ? W  ARG 182 
208 1 Y 1 I MET 1   ? X  MET 1   
209 1 Y 1 I SER 2   ? X  SER 2   
210 1 Y 1 X LYS 128 ? Y  LYS 128 
211 1 Y 1 X ARG 129 ? Y  ARG 129 
212 1 Y 1 X ALA 130 ? Y  ALA 130 
213 1 Y 1 X ALA 131 ? Y  ALA 131 
214 1 Y 1 P TRP 118 ? Z  TRP 118 
215 1 Y 1 P HIS 119 ? Z  HIS 119 
216 1 Y 1 R LYS 161 ? AA LYS 161 
217 1 Y 1 R ALA 162 ? AA ALA 162 
218 1 Y 1 R SER 163 ? AA SER 163 
219 1 Y 1 R ARG 164 ? AA ARG 164 
220 1 Y 1 R ALA 165 ? AA ALA 165 
221 1 Y 1 R LYS 166 ? AA LYS 166 
222 1 Y 1 R GLU 167 ? AA GLU 167 
223 1 Y 1 R ALA 168 ? AA ALA 168 
224 1 Y 1 R GLU 169 ? AA GLU 169 
225 1 Y 1 R LYS 170 ? AA LYS 170 
226 1 Y 1 R ARG 171 ? AA ARG 171 
227 1 Y 1 R GLU 172 ? AA GLU 172 
228 1 Y 1 R GLU 173 ? AA GLU 173 
229 1 Y 1 R VAL 174 ? AA VAL 174 
230 1 Y 1 R ALA 175 ? AA ALA 175 
231 1 Y 1 R ARG 176 ? AA ARG 176 
232 1 Y 1 T TRP 606 ? CA TRP 606 
233 1 Y 1 U GLY 468 ? DA GLY 468 
234 1 Y 1 U ALA 469 ? DA ALA 469 
235 1 Y 1 Q MET 1   ? FA MET 1   
236 1 Y 1 Q THR 355 ? FA THR 355 
237 1 Y 1 Q PRO 356 ? FA PRO 356 
238 1 Y 1 Q LYS 357 ? FA LYS 357 
239 1 Y 1 Q PRO 358 ? FA PRO 358 
240 1 Y 1 Q ALA 359 ? FA ALA 359 
241 1 Y 1 Q ARG 360 ? FA ARG 360 
242 1 Y 1 Q LYS 361 ? FA LYS 361 
243 1 Y 1 Q GLY 362 ? FA GLY 362 
244 1 Y 1 Q GLY 363 ? FA GLY 363 
245 1 Y 1 Q GLY 364 ? FA GLY 364 
246 1 Y 1 Q ALA 365 ? FA ALA 365 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N      N  N N 1   
ALA CA     C  N S 2   
ALA C      C  N N 3   
ALA O      O  N N 4   
ALA CB     C  N N 5   
ALA OXT    O  N N 6   
ALA H      H  N N 7   
ALA H2     H  N N 8   
ALA HA     H  N N 9   
ALA HB1    H  N N 10  
ALA HB2    H  N N 11  
ALA HB3    H  N N 12  
ALA HXT    H  N N 13  
ARG N      N  N N 14  
ARG CA     C  N S 15  
ARG C      C  N N 16  
ARG O      O  N N 17  
ARG CB     C  N N 18  
ARG CG     C  N N 19  
ARG CD     C  N N 20  
ARG NE     N  N N 21  
ARG CZ     C  N N 22  
ARG NH1    N  N N 23  
ARG NH2    N  N N 24  
ARG OXT    O  N N 25  
ARG H      H  N N 26  
ARG H2     H  N N 27  
ARG HA     H  N N 28  
ARG HB2    H  N N 29  
ARG HB3    H  N N 30  
ARG HG2    H  N N 31  
ARG HG3    H  N N 32  
ARG HD2    H  N N 33  
ARG HD3    H  N N 34  
ARG HE     H  N N 35  
ARG HH11   H  N N 36  
ARG HH12   H  N N 37  
ARG HH21   H  N N 38  
ARG HH22   H  N N 39  
ARG HXT    H  N N 40  
ASN N      N  N N 41  
ASN CA     C  N S 42  
ASN C      C  N N 43  
ASN O      O  N N 44  
ASN CB     C  N N 45  
ASN CG     C  N N 46  
ASN OD1    O  N N 47  
ASN ND2    N  N N 48  
ASN OXT    O  N N 49  
ASN H      H  N N 50  
ASN H2     H  N N 51  
ASN HA     H  N N 52  
ASN HB2    H  N N 53  
ASN HB3    H  N N 54  
ASN HD21   H  N N 55  
ASN HD22   H  N N 56  
ASN HXT    H  N N 57  
ASP N      N  N N 58  
ASP CA     C  N S 59  
ASP C      C  N N 60  
ASP O      O  N N 61  
ASP CB     C  N N 62  
ASP CG     C  N N 63  
ASP OD1    O  N N 64  
ASP OD2    O  N N 65  
ASP OXT    O  N N 66  
ASP H      H  N N 67  
ASP H2     H  N N 68  
ASP HA     H  N N 69  
ASP HB2    H  N N 70  
ASP HB3    H  N N 71  
ASP HD2    H  N N 72  
ASP HXT    H  N N 73  
CYS N      N  N N 74  
CYS CA     C  N R 75  
CYS C      C  N N 76  
CYS O      O  N N 77  
CYS CB     C  N N 78  
CYS SG     S  N N 79  
CYS OXT    O  N N 80  
CYS H      H  N N 81  
CYS H2     H  N N 82  
CYS HA     H  N N 83  
CYS HB2    H  N N 84  
CYS HB3    H  N N 85  
CYS HG     H  N N 86  
CYS HXT    H  N N 87  
FES FE1    FE N N 88  
FES FE2    FE N N 89  
FES S1     S  N N 90  
FES S2     S  N N 91  
FMN N1     N  N N 92  
FMN C2     C  N N 93  
FMN O2     O  N N 94  
FMN N3     N  N N 95  
FMN C4     C  N N 96  
FMN O4     O  N N 97  
FMN C4A    C  N N 98  
FMN N5     N  N N 99  
FMN C5A    C  Y N 100 
FMN C6     C  Y N 101 
FMN C7     C  Y N 102 
FMN C7M    C  N N 103 
FMN C8     C  Y N 104 
FMN C8M    C  N N 105 
FMN C9     C  Y N 106 
FMN C9A    C  Y N 107 
FMN N10    N  N N 108 
FMN C10    C  N N 109 
FMN "C1'"  C  N N 110 
FMN "C2'"  C  N S 111 
FMN "O2'"  O  N N 112 
FMN "C3'"  C  N S 113 
FMN "O3'"  O  N N 114 
FMN "C4'"  C  N R 115 
FMN "O4'"  O  N N 116 
FMN "C5'"  C  N N 117 
FMN "O5'"  O  N N 118 
FMN P      P  N N 119 
FMN O1P    O  N N 120 
FMN O2P    O  N N 121 
FMN O3P    O  N N 122 
FMN HN3    H  N N 123 
FMN H6     H  N N 124 
FMN HM71   H  N N 125 
FMN HM72   H  N N 126 
FMN HM73   H  N N 127 
FMN HM81   H  N N 128 
FMN HM82   H  N N 129 
FMN HM83   H  N N 130 
FMN H9     H  N N 131 
FMN "H1'1" H  N N 132 
FMN "H1'2" H  N N 133 
FMN "H2'"  H  N N 134 
FMN "HO2'" H  N N 135 
FMN "H3'"  H  N N 136 
FMN "HO3'" H  N N 137 
FMN "H4'"  H  N N 138 
FMN "HO4'" H  N N 139 
FMN "H5'1" H  N N 140 
FMN "H5'2" H  N N 141 
FMN HOP2   H  N N 142 
FMN HOP3   H  N N 143 
GLN N      N  N N 144 
GLN CA     C  N S 145 
GLN C      C  N N 146 
GLN O      O  N N 147 
GLN CB     C  N N 148 
GLN CG     C  N N 149 
GLN CD     C  N N 150 
GLN OE1    O  N N 151 
GLN NE2    N  N N 152 
GLN OXT    O  N N 153 
GLN H      H  N N 154 
GLN H2     H  N N 155 
GLN HA     H  N N 156 
GLN HB2    H  N N 157 
GLN HB3    H  N N 158 
GLN HG2    H  N N 159 
GLN HG3    H  N N 160 
GLN HE21   H  N N 161 
GLN HE22   H  N N 162 
GLN HXT    H  N N 163 
GLU N      N  N N 164 
GLU CA     C  N S 165 
GLU C      C  N N 166 
GLU O      O  N N 167 
GLU CB     C  N N 168 
GLU CG     C  N N 169 
GLU CD     C  N N 170 
GLU OE1    O  N N 171 
GLU OE2    O  N N 172 
GLU OXT    O  N N 173 
GLU H      H  N N 174 
GLU H2     H  N N 175 
GLU HA     H  N N 176 
GLU HB2    H  N N 177 
GLU HB3    H  N N 178 
GLU HG2    H  N N 179 
GLU HG3    H  N N 180 
GLU HE2    H  N N 181 
GLU HXT    H  N N 182 
GLY N      N  N N 183 
GLY CA     C  N N 184 
GLY C      C  N N 185 
GLY O      O  N N 186 
GLY OXT    O  N N 187 
GLY H      H  N N 188 
GLY H2     H  N N 189 
GLY HA2    H  N N 190 
GLY HA3    H  N N 191 
GLY HXT    H  N N 192 
HIS N      N  N N 193 
HIS CA     C  N S 194 
HIS C      C  N N 195 
HIS O      O  N N 196 
HIS CB     C  N N 197 
HIS CG     C  Y N 198 
HIS ND1    N  Y N 199 
HIS CD2    C  Y N 200 
HIS CE1    C  Y N 201 
HIS NE2    N  Y N 202 
HIS OXT    O  N N 203 
HIS H      H  N N 204 
HIS H2     H  N N 205 
HIS HA     H  N N 206 
HIS HB2    H  N N 207 
HIS HB3    H  N N 208 
HIS HD1    H  N N 209 
HIS HD2    H  N N 210 
HIS HE1    H  N N 211 
HIS HE2    H  N N 212 
HIS HXT    H  N N 213 
HQH C21    C  N N 214 
HQH C22    C  N N 215 
HQH C23    C  N N 216 
HQH C24    C  N N 217 
HQH C25    C  N N 218 
HQH C26    C  N N 219 
HQH C27    C  N N 220 
HQH C28    C  N N 221 
HQH C29    C  N N 222 
HQH C10    C  N N 223 
HQH C11    C  N N 224 
HQH C12    C  N N 225 
HQH C13    C  N N 226 
HQH C14    C  N N 227 
HQH C15    C  N N 228 
HQH C16    C  N N 229 
HQH C17    C  N N 230 
HQH C18    C  N N 231 
HQH C19    C  N N 232 
HQH C20    C  N N 233 
HQH C30    C  N N 234 
HQH C6     C  N R 235 
HQH C7     C  N R 236 
HQH C8     C  N N 237 
HQH C9     C  N N 238 
HQH N5     N  N N 239 
HQH O1     O  N N 240 
HQH O2     O  N N 241 
HQH O3     O  N N 242 
HQH O4     O  N N 243 
HQH H1     H  N N 244 
HQH H2     H  N N 245 
HQH H3     H  N N 246 
HQH H4     H  N N 247 
HQH H6     H  N N 248 
HQH H7     H  N N 249 
HQH H8     H  N N 250 
HQH H9     H  N N 251 
HQH H10    H  N N 252 
HQH H11    H  N N 253 
HQH H12    H  N N 254 
HQH H13    H  N N 255 
HQH H14    H  N N 256 
HQH H15    H  N N 257 
HQH H16    H  N N 258 
HQH H17    H  N N 259 
HQH H18    H  N N 260 
HQH H19    H  N N 261 
HQH H20    H  N N 262 
HQH H21    H  N N 263 
HQH H22    H  N N 264 
HQH H23    H  N N 265 
HQH H24    H  N N 266 
HQH H25    H  N N 267 
HQH H26    H  N N 268 
HQH H27    H  N N 269 
HQH H28    H  N N 270 
HQH H29    H  N N 271 
HQH H30    H  N N 272 
HQH H31    H  N N 273 
HQH H32    H  N N 274 
HQH H33    H  N N 275 
HQH H34    H  N N 276 
HQH H35    H  N N 277 
HQH H36    H  N N 278 
HQH H37    H  N N 279 
HQH H5     H  N N 280 
ILE N      N  N N 281 
ILE CA     C  N S 282 
ILE C      C  N N 283 
ILE O      O  N N 284 
ILE CB     C  N S 285 
ILE CG1    C  N N 286 
ILE CG2    C  N N 287 
ILE CD1    C  N N 288 
ILE OXT    O  N N 289 
ILE H      H  N N 290 
ILE H2     H  N N 291 
ILE HA     H  N N 292 
ILE HB     H  N N 293 
ILE HG12   H  N N 294 
ILE HG13   H  N N 295 
ILE HG21   H  N N 296 
ILE HG22   H  N N 297 
ILE HG23   H  N N 298 
ILE HD11   H  N N 299 
ILE HD12   H  N N 300 
ILE HD13   H  N N 301 
ILE HXT    H  N N 302 
LEU N      N  N N 303 
LEU CA     C  N S 304 
LEU C      C  N N 305 
LEU O      O  N N 306 
LEU CB     C  N N 307 
LEU CG     C  N N 308 
LEU CD1    C  N N 309 
LEU CD2    C  N N 310 
LEU OXT    O  N N 311 
LEU H      H  N N 312 
LEU H2     H  N N 313 
LEU HA     H  N N 314 
LEU HB2    H  N N 315 
LEU HB3    H  N N 316 
LEU HG     H  N N 317 
LEU HD11   H  N N 318 
LEU HD12   H  N N 319 
LEU HD13   H  N N 320 
LEU HD21   H  N N 321 
LEU HD22   H  N N 322 
LEU HD23   H  N N 323 
LEU HXT    H  N N 324 
LYS N      N  N N 325 
LYS CA     C  N S 326 
LYS C      C  N N 327 
LYS O      O  N N 328 
LYS CB     C  N N 329 
LYS CG     C  N N 330 
LYS CD     C  N N 331 
LYS CE     C  N N 332 
LYS NZ     N  N N 333 
LYS OXT    O  N N 334 
LYS H      H  N N 335 
LYS H2     H  N N 336 
LYS HA     H  N N 337 
LYS HB2    H  N N 338 
LYS HB3    H  N N 339 
LYS HG2    H  N N 340 
LYS HG3    H  N N 341 
LYS HD2    H  N N 342 
LYS HD3    H  N N 343 
LYS HE2    H  N N 344 
LYS HE3    H  N N 345 
LYS HZ1    H  N N 346 
LYS HZ2    H  N N 347 
LYS HZ3    H  N N 348 
LYS HXT    H  N N 349 
MET N      N  N N 350 
MET CA     C  N S 351 
MET C      C  N N 352 
MET O      O  N N 353 
MET CB     C  N N 354 
MET CG     C  N N 355 
MET SD     S  N N 356 
MET CE     C  N N 357 
MET OXT    O  N N 358 
MET H      H  N N 359 
MET H2     H  N N 360 
MET HA     H  N N 361 
MET HB2    H  N N 362 
MET HB3    H  N N 363 
MET HG2    H  N N 364 
MET HG3    H  N N 365 
MET HE1    H  N N 366 
MET HE2    H  N N 367 
MET HE3    H  N N 368 
MET HXT    H  N N 369 
PHE N      N  N N 370 
PHE CA     C  N S 371 
PHE C      C  N N 372 
PHE O      O  N N 373 
PHE CB     C  N N 374 
PHE CG     C  Y N 375 
PHE CD1    C  Y N 376 
PHE CD2    C  Y N 377 
PHE CE1    C  Y N 378 
PHE CE2    C  Y N 379 
PHE CZ     C  Y N 380 
PHE OXT    O  N N 381 
PHE H      H  N N 382 
PHE H2     H  N N 383 
PHE HA     H  N N 384 
PHE HB2    H  N N 385 
PHE HB3    H  N N 386 
PHE HD1    H  N N 387 
PHE HD2    H  N N 388 
PHE HE1    H  N N 389 
PHE HE2    H  N N 390 
PHE HZ     H  N N 391 
PHE HXT    H  N N 392 
PRO N      N  N N 393 
PRO CA     C  N S 394 
PRO C      C  N N 395 
PRO O      O  N N 396 
PRO CB     C  N N 397 
PRO CG     C  N N 398 
PRO CD     C  N N 399 
PRO OXT    O  N N 400 
PRO H      H  N N 401 
PRO HA     H  N N 402 
PRO HB2    H  N N 403 
PRO HB3    H  N N 404 
PRO HG2    H  N N 405 
PRO HG3    H  N N 406 
PRO HD2    H  N N 407 
PRO HD3    H  N N 408 
PRO HXT    H  N N 409 
SER N      N  N N 410 
SER CA     C  N S 411 
SER C      C  N N 412 
SER O      O  N N 413 
SER CB     C  N N 414 
SER OG     O  N N 415 
SER OXT    O  N N 416 
SER H      H  N N 417 
SER H2     H  N N 418 
SER HA     H  N N 419 
SER HB2    H  N N 420 
SER HB3    H  N N 421 
SER HG     H  N N 422 
SER HXT    H  N N 423 
SF4 FE1    FE N N 424 
SF4 FE2    FE N N 425 
SF4 FE3    FE N N 426 
SF4 FE4    FE N N 427 
SF4 S1     S  N N 428 
SF4 S2     S  N N 429 
SF4 S3     S  N N 430 
SF4 S4     S  N N 431 
THR N      N  N N 432 
THR CA     C  N S 433 
THR C      C  N N 434 
THR O      O  N N 435 
THR CB     C  N R 436 
THR OG1    O  N N 437 
THR CG2    C  N N 438 
THR OXT    O  N N 439 
THR H      H  N N 440 
THR H2     H  N N 441 
THR HA     H  N N 442 
THR HB     H  N N 443 
THR HG1    H  N N 444 
THR HG21   H  N N 445 
THR HG22   H  N N 446 
THR HG23   H  N N 447 
THR HXT    H  N N 448 
TRP N      N  N N 449 
TRP CA     C  N S 450 
TRP C      C  N N 451 
TRP O      O  N N 452 
TRP CB     C  N N 453 
TRP CG     C  Y N 454 
TRP CD1    C  Y N 455 
TRP CD2    C  Y N 456 
TRP NE1    N  Y N 457 
TRP CE2    C  Y N 458 
TRP CE3    C  Y N 459 
TRP CZ2    C  Y N 460 
TRP CZ3    C  Y N 461 
TRP CH2    C  Y N 462 
TRP OXT    O  N N 463 
TRP H      H  N N 464 
TRP H2     H  N N 465 
TRP HA     H  N N 466 
TRP HB2    H  N N 467 
TRP HB3    H  N N 468 
TRP HD1    H  N N 469 
TRP HE1    H  N N 470 
TRP HE3    H  N N 471 
TRP HZ2    H  N N 472 
TRP HZ3    H  N N 473 
TRP HH2    H  N N 474 
TRP HXT    H  N N 475 
TYR N      N  N N 476 
TYR CA     C  N S 477 
TYR C      C  N N 478 
TYR O      O  N N 479 
TYR CB     C  N N 480 
TYR CG     C  Y N 481 
TYR CD1    C  Y N 482 
TYR CD2    C  Y N 483 
TYR CE1    C  Y N 484 
TYR CE2    C  Y N 485 
TYR CZ     C  Y N 486 
TYR OH     O  N N 487 
TYR OXT    O  N N 488 
TYR H      H  N N 489 
TYR H2     H  N N 490 
TYR HA     H  N N 491 
TYR HB2    H  N N 492 
TYR HB3    H  N N 493 
TYR HD1    H  N N 494 
TYR HD2    H  N N 495 
TYR HE1    H  N N 496 
TYR HE2    H  N N 497 
TYR HH     H  N N 498 
TYR HXT    H  N N 499 
VAL N      N  N N 500 
VAL CA     C  N S 501 
VAL C      C  N N 502 
VAL O      O  N N 503 
VAL CB     C  N N 504 
VAL CG1    C  N N 505 
VAL CG2    C  N N 506 
VAL OXT    O  N N 507 
VAL H      H  N N 508 
VAL H2     H  N N 509 
VAL HA     H  N N 510 
VAL HB     H  N N 511 
VAL HG11   H  N N 512 
VAL HG12   H  N N 513 
VAL HG13   H  N N 514 
VAL HG21   H  N N 515 
VAL HG22   H  N N 516 
VAL HG23   H  N N 517 
VAL HXT    H  N N 518 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N     CA     sing N N 1   
ALA N     H      sing N N 2   
ALA N     H2     sing N N 3   
ALA CA    C      sing N N 4   
ALA CA    CB     sing N N 5   
ALA CA    HA     sing N N 6   
ALA C     O      doub N N 7   
ALA C     OXT    sing N N 8   
ALA CB    HB1    sing N N 9   
ALA CB    HB2    sing N N 10  
ALA CB    HB3    sing N N 11  
ALA OXT   HXT    sing N N 12  
ARG N     CA     sing N N 13  
ARG N     H      sing N N 14  
ARG N     H2     sing N N 15  
ARG CA    C      sing N N 16  
ARG CA    CB     sing N N 17  
ARG CA    HA     sing N N 18  
ARG C     O      doub N N 19  
ARG C     OXT    sing N N 20  
ARG CB    CG     sing N N 21  
ARG CB    HB2    sing N N 22  
ARG CB    HB3    sing N N 23  
ARG CG    CD     sing N N 24  
ARG CG    HG2    sing N N 25  
ARG CG    HG3    sing N N 26  
ARG CD    NE     sing N N 27  
ARG CD    HD2    sing N N 28  
ARG CD    HD3    sing N N 29  
ARG NE    CZ     sing N N 30  
ARG NE    HE     sing N N 31  
ARG CZ    NH1    sing N N 32  
ARG CZ    NH2    doub N N 33  
ARG NH1   HH11   sing N N 34  
ARG NH1   HH12   sing N N 35  
ARG NH2   HH21   sing N N 36  
ARG NH2   HH22   sing N N 37  
ARG OXT   HXT    sing N N 38  
ASN N     CA     sing N N 39  
ASN N     H      sing N N 40  
ASN N     H2     sing N N 41  
ASN CA    C      sing N N 42  
ASN CA    CB     sing N N 43  
ASN CA    HA     sing N N 44  
ASN C     O      doub N N 45  
ASN C     OXT    sing N N 46  
ASN CB    CG     sing N N 47  
ASN CB    HB2    sing N N 48  
ASN CB    HB3    sing N N 49  
ASN CG    OD1    doub N N 50  
ASN CG    ND2    sing N N 51  
ASN ND2   HD21   sing N N 52  
ASN ND2   HD22   sing N N 53  
ASN OXT   HXT    sing N N 54  
ASP N     CA     sing N N 55  
ASP N     H      sing N N 56  
ASP N     H2     sing N N 57  
ASP CA    C      sing N N 58  
ASP CA    CB     sing N N 59  
ASP CA    HA     sing N N 60  
ASP C     O      doub N N 61  
ASP C     OXT    sing N N 62  
ASP CB    CG     sing N N 63  
ASP CB    HB2    sing N N 64  
ASP CB    HB3    sing N N 65  
ASP CG    OD1    doub N N 66  
ASP CG    OD2    sing N N 67  
ASP OD2   HD2    sing N N 68  
ASP OXT   HXT    sing N N 69  
CYS N     CA     sing N N 70  
CYS N     H      sing N N 71  
CYS N     H2     sing N N 72  
CYS CA    C      sing N N 73  
CYS CA    CB     sing N N 74  
CYS CA    HA     sing N N 75  
CYS C     O      doub N N 76  
CYS C     OXT    sing N N 77  
CYS CB    SG     sing N N 78  
CYS CB    HB2    sing N N 79  
CYS CB    HB3    sing N N 80  
CYS SG    HG     sing N N 81  
CYS OXT   HXT    sing N N 82  
FES FE1   S1     sing N N 83  
FES FE1   S2     sing N N 84  
FES FE2   S1     sing N N 85  
FES FE2   S2     sing N N 86  
FMN N1    C2     sing N N 87  
FMN N1    C10    doub N N 88  
FMN C2    O2     doub N N 89  
FMN C2    N3     sing N N 90  
FMN N3    C4     sing N N 91  
FMN N3    HN3    sing N N 92  
FMN C4    O4     doub N N 93  
FMN C4    C4A    sing N N 94  
FMN C4A   N5     doub N N 95  
FMN C4A   C10    sing N N 96  
FMN N5    C5A    sing N N 97  
FMN C5A   C6     doub Y N 98  
FMN C5A   C9A    sing Y N 99  
FMN C6    C7     sing Y N 100 
FMN C6    H6     sing N N 101 
FMN C7    C7M    sing N N 102 
FMN C7    C8     doub Y N 103 
FMN C7M   HM71   sing N N 104 
FMN C7M   HM72   sing N N 105 
FMN C7M   HM73   sing N N 106 
FMN C8    C8M    sing N N 107 
FMN C8    C9     sing Y N 108 
FMN C8M   HM81   sing N N 109 
FMN C8M   HM82   sing N N 110 
FMN C8M   HM83   sing N N 111 
FMN C9    C9A    doub Y N 112 
FMN C9    H9     sing N N 113 
FMN C9A   N10    sing N N 114 
FMN N10   C10    sing N N 115 
FMN N10   "C1'"  sing N N 116 
FMN "C1'" "C2'"  sing N N 117 
FMN "C1'" "H1'1" sing N N 118 
FMN "C1'" "H1'2" sing N N 119 
FMN "C2'" "O2'"  sing N N 120 
FMN "C2'" "C3'"  sing N N 121 
FMN "C2'" "H2'"  sing N N 122 
FMN "O2'" "HO2'" sing N N 123 
FMN "C3'" "O3'"  sing N N 124 
FMN "C3'" "C4'"  sing N N 125 
FMN "C3'" "H3'"  sing N N 126 
FMN "O3'" "HO3'" sing N N 127 
FMN "C4'" "O4'"  sing N N 128 
FMN "C4'" "C5'"  sing N N 129 
FMN "C4'" "H4'"  sing N N 130 
FMN "O4'" "HO4'" sing N N 131 
FMN "C5'" "O5'"  sing N N 132 
FMN "C5'" "H5'1" sing N N 133 
FMN "C5'" "H5'2" sing N N 134 
FMN "O5'" P      sing N N 135 
FMN P     O1P    doub N N 136 
FMN P     O2P    sing N N 137 
FMN P     O3P    sing N N 138 
FMN O2P   HOP2   sing N N 139 
FMN O3P   HOP3   sing N N 140 
GLN N     CA     sing N N 141 
GLN N     H      sing N N 142 
GLN N     H2     sing N N 143 
GLN CA    C      sing N N 144 
GLN CA    CB     sing N N 145 
GLN CA    HA     sing N N 146 
GLN C     O      doub N N 147 
GLN C     OXT    sing N N 148 
GLN CB    CG     sing N N 149 
GLN CB    HB2    sing N N 150 
GLN CB    HB3    sing N N 151 
GLN CG    CD     sing N N 152 
GLN CG    HG2    sing N N 153 
GLN CG    HG3    sing N N 154 
GLN CD    OE1    doub N N 155 
GLN CD    NE2    sing N N 156 
GLN NE2   HE21   sing N N 157 
GLN NE2   HE22   sing N N 158 
GLN OXT   HXT    sing N N 159 
GLU N     CA     sing N N 160 
GLU N     H      sing N N 161 
GLU N     H2     sing N N 162 
GLU CA    C      sing N N 163 
GLU CA    CB     sing N N 164 
GLU CA    HA     sing N N 165 
GLU C     O      doub N N 166 
GLU C     OXT    sing N N 167 
GLU CB    CG     sing N N 168 
GLU CB    HB2    sing N N 169 
GLU CB    HB3    sing N N 170 
GLU CG    CD     sing N N 171 
GLU CG    HG2    sing N N 172 
GLU CG    HG3    sing N N 173 
GLU CD    OE1    doub N N 174 
GLU CD    OE2    sing N N 175 
GLU OE2   HE2    sing N N 176 
GLU OXT   HXT    sing N N 177 
GLY N     CA     sing N N 178 
GLY N     H      sing N N 179 
GLY N     H2     sing N N 180 
GLY CA    C      sing N N 181 
GLY CA    HA2    sing N N 182 
GLY CA    HA3    sing N N 183 
GLY C     O      doub N N 184 
GLY C     OXT    sing N N 185 
GLY OXT   HXT    sing N N 186 
HIS N     CA     sing N N 187 
HIS N     H      sing N N 188 
HIS N     H2     sing N N 189 
HIS CA    C      sing N N 190 
HIS CA    CB     sing N N 191 
HIS CA    HA     sing N N 192 
HIS C     O      doub N N 193 
HIS C     OXT    sing N N 194 
HIS CB    CG     sing N N 195 
HIS CB    HB2    sing N N 196 
HIS CB    HB3    sing N N 197 
HIS CG    ND1    sing Y N 198 
HIS CG    CD2    doub Y N 199 
HIS ND1   CE1    doub Y N 200 
HIS ND1   HD1    sing N N 201 
HIS CD2   NE2    sing Y N 202 
HIS CD2   HD2    sing N N 203 
HIS CE1   NE2    sing Y N 204 
HIS CE1   HE1    sing N N 205 
HIS NE2   HE2    sing N N 206 
HIS OXT   HXT    sing N N 207 
HQH C27   C16    sing N N 208 
HQH C14   C9     sing N N 209 
HQH C16   C9     doub N E 210 
HQH C9    C7     sing N N 211 
HQH O1    C7     sing N N 212 
HQH C7    C6     sing N N 213 
HQH C6    C10    sing N N 214 
HQH C6    C8     sing N N 215 
HQH C8    C11    doub N E 216 
HQH C11   C22    sing N N 217 
HQH C11   C18    sing N N 218 
HQH C26   C17    sing N N 219 
HQH C21   C18    doub N E 220 
HQH C21   C15    sing N N 221 
HQH C15   C17    sing N N 222 
HQH C17   C20    doub N E 223 
HQH C20   C13    sing N N 224 
HQH C13   C12    sing N N 225 
HQH N5    C12    sing N N 226 
HQH N5    C24    sing N N 227 
HQH C12   C19    doub N N 228 
HQH O2    C24    sing N N 229 
HQH O2    C29    sing N N 230 
HQH C24   C25    doub N N 231 
HQH C19   C28    sing N N 232 
HQH C19   C23    sing N N 233 
HQH C25   C23    sing N N 234 
HQH C25   O3     sing N N 235 
HQH C23   O4     doub N N 236 
HQH C30   O3     sing N N 237 
HQH C21   H1     sing N N 238 
HQH C22   H2     sing N N 239 
HQH C22   H3     sing N N 240 
HQH C22   H4     sing N N 241 
HQH C26   H6     sing N N 242 
HQH C26   H7     sing N N 243 
HQH C26   H8     sing N N 244 
HQH C27   H9     sing N N 245 
HQH C27   H10    sing N N 246 
HQH C27   H11    sing N N 247 
HQH C28   H12    sing N N 248 
HQH C28   H13    sing N N 249 
HQH C28   H14    sing N N 250 
HQH C29   H15    sing N N 251 
HQH C29   H16    sing N N 252 
HQH C29   H17    sing N N 253 
HQH C10   H18    sing N N 254 
HQH C10   H19    sing N N 255 
HQH C10   H20    sing N N 256 
HQH C13   H21    sing N N 257 
HQH C13   H22    sing N N 258 
HQH C14   H23    sing N N 259 
HQH C14   H24    sing N N 260 
HQH C14   H25    sing N N 261 
HQH C15   H26    sing N N 262 
HQH C15   H27    sing N N 263 
HQH C16   H28    sing N N 264 
HQH C18   H29    sing N N 265 
HQH C20   H30    sing N N 266 
HQH C30   H31    sing N N 267 
HQH C30   H32    sing N N 268 
HQH C30   H33    sing N N 269 
HQH C6    H34    sing N N 270 
HQH C7    H35    sing N N 271 
HQH C8    H36    sing N N 272 
HQH O1    H37    sing N N 273 
HQH N5    H5     sing N N 274 
ILE N     CA     sing N N 275 
ILE N     H      sing N N 276 
ILE N     H2     sing N N 277 
ILE CA    C      sing N N 278 
ILE CA    CB     sing N N 279 
ILE CA    HA     sing N N 280 
ILE C     O      doub N N 281 
ILE C     OXT    sing N N 282 
ILE CB    CG1    sing N N 283 
ILE CB    CG2    sing N N 284 
ILE CB    HB     sing N N 285 
ILE CG1   CD1    sing N N 286 
ILE CG1   HG12   sing N N 287 
ILE CG1   HG13   sing N N 288 
ILE CG2   HG21   sing N N 289 
ILE CG2   HG22   sing N N 290 
ILE CG2   HG23   sing N N 291 
ILE CD1   HD11   sing N N 292 
ILE CD1   HD12   sing N N 293 
ILE CD1   HD13   sing N N 294 
ILE OXT   HXT    sing N N 295 
LEU N     CA     sing N N 296 
LEU N     H      sing N N 297 
LEU N     H2     sing N N 298 
LEU CA    C      sing N N 299 
LEU CA    CB     sing N N 300 
LEU CA    HA     sing N N 301 
LEU C     O      doub N N 302 
LEU C     OXT    sing N N 303 
LEU CB    CG     sing N N 304 
LEU CB    HB2    sing N N 305 
LEU CB    HB3    sing N N 306 
LEU CG    CD1    sing N N 307 
LEU CG    CD2    sing N N 308 
LEU CG    HG     sing N N 309 
LEU CD1   HD11   sing N N 310 
LEU CD1   HD12   sing N N 311 
LEU CD1   HD13   sing N N 312 
LEU CD2   HD21   sing N N 313 
LEU CD2   HD22   sing N N 314 
LEU CD2   HD23   sing N N 315 
LEU OXT   HXT    sing N N 316 
LYS N     CA     sing N N 317 
LYS N     H      sing N N 318 
LYS N     H2     sing N N 319 
LYS CA    C      sing N N 320 
LYS CA    CB     sing N N 321 
LYS CA    HA     sing N N 322 
LYS C     O      doub N N 323 
LYS C     OXT    sing N N 324 
LYS CB    CG     sing N N 325 
LYS CB    HB2    sing N N 326 
LYS CB    HB3    sing N N 327 
LYS CG    CD     sing N N 328 
LYS CG    HG2    sing N N 329 
LYS CG    HG3    sing N N 330 
LYS CD    CE     sing N N 331 
LYS CD    HD2    sing N N 332 
LYS CD    HD3    sing N N 333 
LYS CE    NZ     sing N N 334 
LYS CE    HE2    sing N N 335 
LYS CE    HE3    sing N N 336 
LYS NZ    HZ1    sing N N 337 
LYS NZ    HZ2    sing N N 338 
LYS NZ    HZ3    sing N N 339 
LYS OXT   HXT    sing N N 340 
MET N     CA     sing N N 341 
MET N     H      sing N N 342 
MET N     H2     sing N N 343 
MET CA    C      sing N N 344 
MET CA    CB     sing N N 345 
MET CA    HA     sing N N 346 
MET C     O      doub N N 347 
MET C     OXT    sing N N 348 
MET CB    CG     sing N N 349 
MET CB    HB2    sing N N 350 
MET CB    HB3    sing N N 351 
MET CG    SD     sing N N 352 
MET CG    HG2    sing N N 353 
MET CG    HG3    sing N N 354 
MET SD    CE     sing N N 355 
MET CE    HE1    sing N N 356 
MET CE    HE2    sing N N 357 
MET CE    HE3    sing N N 358 
MET OXT   HXT    sing N N 359 
PHE N     CA     sing N N 360 
PHE N     H      sing N N 361 
PHE N     H2     sing N N 362 
PHE CA    C      sing N N 363 
PHE CA    CB     sing N N 364 
PHE CA    HA     sing N N 365 
PHE C     O      doub N N 366 
PHE C     OXT    sing N N 367 
PHE CB    CG     sing N N 368 
PHE CB    HB2    sing N N 369 
PHE CB    HB3    sing N N 370 
PHE CG    CD1    doub Y N 371 
PHE CG    CD2    sing Y N 372 
PHE CD1   CE1    sing Y N 373 
PHE CD1   HD1    sing N N 374 
PHE CD2   CE2    doub Y N 375 
PHE CD2   HD2    sing N N 376 
PHE CE1   CZ     doub Y N 377 
PHE CE1   HE1    sing N N 378 
PHE CE2   CZ     sing Y N 379 
PHE CE2   HE2    sing N N 380 
PHE CZ    HZ     sing N N 381 
PHE OXT   HXT    sing N N 382 
PRO N     CA     sing N N 383 
PRO N     CD     sing N N 384 
PRO N     H      sing N N 385 
PRO CA    C      sing N N 386 
PRO CA    CB     sing N N 387 
PRO CA    HA     sing N N 388 
PRO C     O      doub N N 389 
PRO C     OXT    sing N N 390 
PRO CB    CG     sing N N 391 
PRO CB    HB2    sing N N 392 
PRO CB    HB3    sing N N 393 
PRO CG    CD     sing N N 394 
PRO CG    HG2    sing N N 395 
PRO CG    HG3    sing N N 396 
PRO CD    HD2    sing N N 397 
PRO CD    HD3    sing N N 398 
PRO OXT   HXT    sing N N 399 
SER N     CA     sing N N 400 
SER N     H      sing N N 401 
SER N     H2     sing N N 402 
SER CA    C      sing N N 403 
SER CA    CB     sing N N 404 
SER CA    HA     sing N N 405 
SER C     O      doub N N 406 
SER C     OXT    sing N N 407 
SER CB    OG     sing N N 408 
SER CB    HB2    sing N N 409 
SER CB    HB3    sing N N 410 
SER OG    HG     sing N N 411 
SER OXT   HXT    sing N N 412 
SF4 FE1   S2     sing N N 413 
SF4 FE1   S3     sing N N 414 
SF4 FE1   S4     sing N N 415 
SF4 FE2   S1     sing N N 416 
SF4 FE2   S3     sing N N 417 
SF4 FE2   S4     sing N N 418 
SF4 FE3   S1     sing N N 419 
SF4 FE3   S2     sing N N 420 
SF4 FE3   S4     sing N N 421 
SF4 FE4   S1     sing N N 422 
SF4 FE4   S2     sing N N 423 
SF4 FE4   S3     sing N N 424 
THR N     CA     sing N N 425 
THR N     H      sing N N 426 
THR N     H2     sing N N 427 
THR CA    C      sing N N 428 
THR CA    CB     sing N N 429 
THR CA    HA     sing N N 430 
THR C     O      doub N N 431 
THR C     OXT    sing N N 432 
THR CB    OG1    sing N N 433 
THR CB    CG2    sing N N 434 
THR CB    HB     sing N N 435 
THR OG1   HG1    sing N N 436 
THR CG2   HG21   sing N N 437 
THR CG2   HG22   sing N N 438 
THR CG2   HG23   sing N N 439 
THR OXT   HXT    sing N N 440 
TRP N     CA     sing N N 441 
TRP N     H      sing N N 442 
TRP N     H2     sing N N 443 
TRP CA    C      sing N N 444 
TRP CA    CB     sing N N 445 
TRP CA    HA     sing N N 446 
TRP C     O      doub N N 447 
TRP C     OXT    sing N N 448 
TRP CB    CG     sing N N 449 
TRP CB    HB2    sing N N 450 
TRP CB    HB3    sing N N 451 
TRP CG    CD1    doub Y N 452 
TRP CG    CD2    sing Y N 453 
TRP CD1   NE1    sing Y N 454 
TRP CD1   HD1    sing N N 455 
TRP CD2   CE2    doub Y N 456 
TRP CD2   CE3    sing Y N 457 
TRP NE1   CE2    sing Y N 458 
TRP NE1   HE1    sing N N 459 
TRP CE2   CZ2    sing Y N 460 
TRP CE3   CZ3    doub Y N 461 
TRP CE3   HE3    sing N N 462 
TRP CZ2   CH2    doub Y N 463 
TRP CZ2   HZ2    sing N N 464 
TRP CZ3   CH2    sing Y N 465 
TRP CZ3   HZ3    sing N N 466 
TRP CH2   HH2    sing N N 467 
TRP OXT   HXT    sing N N 468 
TYR N     CA     sing N N 469 
TYR N     H      sing N N 470 
TYR N     H2     sing N N 471 
TYR CA    C      sing N N 472 
TYR CA    CB     sing N N 473 
TYR CA    HA     sing N N 474 
TYR C     O      doub N N 475 
TYR C     OXT    sing N N 476 
TYR CB    CG     sing N N 477 
TYR CB    HB2    sing N N 478 
TYR CB    HB3    sing N N 479 
TYR CG    CD1    doub Y N 480 
TYR CG    CD2    sing Y N 481 
TYR CD1   CE1    sing Y N 482 
TYR CD1   HD1    sing N N 483 
TYR CD2   CE2    doub Y N 484 
TYR CD2   HD2    sing N N 485 
TYR CE1   CZ     doub Y N 486 
TYR CE1   HE1    sing N N 487 
TYR CE2   CZ     sing Y N 488 
TYR CE2   HE2    sing N N 489 
TYR CZ    OH     sing N N 490 
TYR OH    HH     sing N N 491 
TYR OXT   HXT    sing N N 492 
VAL N     CA     sing N N 493 
VAL N     H      sing N N 494 
VAL N     H2     sing N N 495 
VAL CA    C      sing N N 496 
VAL CA    CB     sing N N 497 
VAL CA    HA     sing N N 498 
VAL C     O      doub N N 499 
VAL C     OXT    sing N N 500 
VAL CB    CG1    sing N N 501 
VAL CB    CG2    sing N N 502 
VAL CB    HB     sing N N 503 
VAL CG1   HG11   sing N N 504 
VAL CG1   HG12   sing N N 505 
VAL CG1   HG13   sing N N 506 
VAL CG2   HG21   sing N N 507 
VAL CG2   HG22   sing N N 508 
VAL CG2   HG23   sing N N 509 
VAL OXT   HXT    sing N N 510 
# 
_pdbx_audit_support.funding_organization   'Medical Research Council (United Kingdom)' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           MC_U105674180 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        HQH 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   HQH 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4HEA 
_pdbx_initial_refinement_model.details          ? 
# 
_pdbx_reflns_twin.domain_id    1 
_pdbx_reflns_twin.crystal_id   1 
_pdbx_reflns_twin.diffrn_id    1 
_pdbx_reflns_twin.type         ? 
_pdbx_reflns_twin.operator     -H,-K,H+L 
_pdbx_reflns_twin.fraction     0.490 
# 
_atom_sites.entry_id                    6Q8O 
_atom_sites.fract_transf_matrix[1][1]   0.010511 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001931 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002971 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003869 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? -30.581  -1.028  408.391 1.00 256.05 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? -30.780  -1.261  406.965 1.00 256.47 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? -29.703  -0.549  406.147 1.00 261.85 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? -29.229  0.521   406.532 1.00 263.82 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? -32.174  -0.782  406.507 1.00 252.00 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? -33.153  -1.140  407.491 1.00 250.37 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? -32.552  -1.418  405.177 1.00 250.36 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? -29.316  -1.154  405.024 1.00 264.58 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? -28.342  -0.574  404.130 1.00 266.89 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? -28.775  0.783   403.616 1.00 268.07 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? -29.957  1.016   403.340 1.00 269.57 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? -27.827  1.719   403.488 1.00 266.12 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? -28.213  3.099   403.163 1.00 262.07 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? -28.665  3.261   401.722 1.00 254.30 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? -27.833  3.417   400.824 1.00 253.75 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? -26.923  3.891   403.426 1.00 264.19 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? -26.113  3.012   404.344 1.00 265.93 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? -26.405  1.626   403.851 1.00 266.82 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? -29.984  3.288   401.515 1.00 246.64 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? -30.646  3.641   400.259 1.00 238.25 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? -32.089  3.994   400.595 1.00 229.67 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? -32.768  3.258   401.321 1.00 229.59 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? -30.593  2.506   399.212 1.00 239.00 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? -29.152  2.177   398.808 1.00 241.20 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? -31.405  2.871   397.975 1.00 238.25 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? -29.030  0.979   397.886 1.00 242.37 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? -32.567  5.122   400.080 1.00 221.58 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? -33.892  5.631   400.413 1.00 212.65 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? -34.872  5.212   399.324 1.00 198.28 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? -34.806  5.703   398.192 1.00 197.04 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? -33.836  7.144   400.600 1.00 217.07 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? -33.004  7.422   401.856 1.00 221.26 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? -32.718  8.892   402.075 1.00 222.81 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? -33.702  6.832   403.074 1.00 222.32 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? -35.773  4.288   399.669 1.00 185.15 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? -36.728  3.754   398.708 1.00 171.57 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? -38.132  3.608   399.284 1.00 159.91 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? -38.975  2.956   398.654 1.00 157.38 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? -36.246  2.400   398.173 1.00 170.23 ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? -34.922  2.490   397.675 1.00 168.21 ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? -38.416  4.181   400.451 1.00 152.29 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? -39.721  4.002   401.052 1.00 147.11 ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? -39.912  4.643   402.411 1.00 144.87 ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? -39.563  5.808   402.622 1.00 142.99 ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? -40.472  3.873   403.346 1.00 146.99 ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? -40.917  4.367   404.643 1.00 151.19 ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? -39.869  4.208   405.748 1.00 158.07 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? -40.229  4.126   406.930 1.00 160.65 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? -42.228  3.676   405.027 1.00 148.89 ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? -43.125  4.342   406.072 1.00 146.88 ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? -43.082  5.852   405.936 1.00 146.04 ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? -44.551  3.834   405.939 1.00 144.82 ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? -38.585  4.155   405.408 1.00 160.29 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? -37.566  4.089   406.447 1.00 158.77 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? -37.546  5.401   407.232 1.00 158.53 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? -37.605  6.483   406.639 1.00 159.79 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? -36.190  3.812   405.842 1.00 156.66 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? -35.284  3.035   406.783 1.00 154.50 ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? -35.745  2.020   407.343 1.00 153.05 ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? -34.117  3.436   406.971 1.00 154.89 ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? -37.464  5.339   408.566 1.00 155.71 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? -37.718  6.536   409.386 1.00 154.01 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? -36.665  7.627   409.275 1.00 154.72 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? -36.848  8.691   409.877 1.00 155.90 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? -37.768  5.972   410.813 1.00 153.94 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? -36.939  4.738   410.757 1.00 154.90 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? -37.134  4.161   409.386 1.00 155.41 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? -35.581  7.415   408.535 1.00 155.75 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? -34.564  8.446   408.369 1.00 158.58 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? -34.948  9.482   407.322 1.00 163.84 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? -34.151  10.385  407.043 1.00 167.30 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? -33.233  7.806   407.980 1.00 156.19 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? -33.403  6.541   407.170 1.00 154.21 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? -32.072  5.992   406.723 1.00 153.25 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? -32.242  4.946   405.724 1.00 153.20 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? -31.259  4.487   404.959 1.00 154.87 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? -30.038  4.985   405.089 1.00 156.35 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? -31.497  3.533   404.070 1.00 155.20 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? -36.139  9.371   406.741 1.00 163.51 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? -36.620  10.348  405.777 1.00 163.76 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? -37.131  11.598  406.483 1.00 159.46 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? -37.787  11.518  407.525 1.00 160.38 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? -37.727  9.736   404.917 1.00 168.05 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? -38.424  10.726  404.029 1.00 172.96 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? -37.738  11.354  403.001 1.00 175.73 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? -39.762  11.028  404.216 1.00 172.64 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? -38.371  12.266  402.180 1.00 175.14 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? -40.398  11.940  403.396 1.00 172.84 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? -39.702  12.559  402.378 1.00 174.12 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? -36.819  12.758  405.910 1.00 153.16 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? -37.233  14.048  406.446 1.00 146.86 ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? -38.351  14.624  405.589 1.00 146.58 ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? -38.150  14.890  404.400 1.00 143.98 ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? -36.070  15.040  406.498 1.00 142.87 ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? -35.161  14.915  407.701 1.00 141.88 ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? -34.185  16.075  407.802 1.00 143.32 ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? -33.308  16.200  406.922 1.00 144.26 ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? -34.303  16.870  408.756 1.00 143.67 ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? -39.522  14.819  406.191 1.00 148.58 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? -40.560  15.621  405.556 1.00 145.03 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? -40.103  17.073  405.564 1.00 143.74 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? -40.002  17.695  406.626 1.00 145.85 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? -41.894  15.453  406.277 1.00 140.79 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? -42.285  14.009  406.542 1.00 137.78 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? -42.981  13.436  405.320 1.00 137.01 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? -42.864  11.984  405.236 1.00 138.66 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? -43.724  11.203  404.591 1.00 139.43 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? -44.768  11.731  403.969 1.00 137.70 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? -43.536  9.891   404.562 1.00 140.66 ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? -39.825  17.619  404.381 1.00 139.25 ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? -39.285  18.968  404.263 1.00 138.68 ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? -40.218  19.915  403.529 1.00 137.52 ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? -40.456  21.032  404.001 1.00 141.13 ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? -37.925  18.921  403.543 1.00 140.28 ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? -37.082  17.944  404.165 1.00 140.55 ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? -37.247  20.276  403.603 1.00 142.98 ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? -40.763  19.493  402.390 1.00 131.46 ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? -41.544  20.387  401.543 1.00 124.12 ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? -42.977  20.503  402.053 1.00 118.03 ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? -43.433  21.592  402.418 1.00 118.21 ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? -41.502  19.884  400.097 1.00 121.04 ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? -40.070  19.675  399.593 1.00 117.24 ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? -40.026  19.359  398.107 1.00 115.93 ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? -39.197  20.883  399.909 1.00 116.38 ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? -43.697  19.385  402.090 1.00 112.25 ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? -45.086  19.338  402.530 1.00 111.21 ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? -45.227  19.205  404.041 1.00 112.24 ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? -46.335  18.943  404.521 1.00 110.96 ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? -45.825  18.189  401.836 1.00 113.64 ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? -46.781  18.650  400.757 1.00 120.42 ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? -46.314  19.218  399.584 1.00 122.17 ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? -48.154  18.522  400.916 1.00 124.20 ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? -47.188  19.645  398.600 1.00 121.80 ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? -49.035  18.951  399.936 1.00 123.55 ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? -48.544  19.512  398.781 1.00 120.44 ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? -49.407  19.935  397.798 1.00 116.47 ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? -44.136  19.360  404.794 1.00 116.11 ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? -44.191  19.204  406.245 1.00 118.66 ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? -45.213  20.149  406.868 1.00 122.24 ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? -46.120  19.716  407.587 1.00 124.16 ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? -42.803  19.433  406.845 1.00 116.64 ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? -45.085  21.448  406.603 1.00 122.22 ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? -45.968  22.434  407.216 1.00 121.94 ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? -47.333  22.510  406.540 1.00 125.24 ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? -48.140  23.374  406.898 1.00 127.08 ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? -45.313  23.817  407.179 1.00 120.25 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? -43.910  23.832  407.695 1.00 121.38 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? -42.896  24.526  407.069 1.00 122.53 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? -43.342  23.207  408.753 1.00 122.74 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? -41.769  24.348  407.733 1.00 123.37 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? -42.011  23.547  408.755 1.00 123.59 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? -47.607  21.626  405.583 1.00 125.26 ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? -48.862  21.670  404.843 1.00 124.42 ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? -50.010  21.184  405.719 1.00 124.76 ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? -49.894  20.178  406.433 1.00 127.73 ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? -48.735  20.846  403.551 1.00 122.52 ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? -50.097  20.529  402.973 1.00 122.29 ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? -47.896  21.610  402.535 1.00 120.13 ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? -51.128  21.911  405.677 1.00 122.21 ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? -52.332  21.578  406.398 1.00 122.28 ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? -52.488  22.302  407.718 1.00 124.07 ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? -53.619  22.505  408.174 1.00 124.17 ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? -51.382  22.693  408.340 1.00 126.37 ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? -51.452  23.408  409.604 1.00 130.96 ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? -52.112  24.762  409.392 1.00 134.81 ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? -51.736  25.508  408.483 1.00 134.87 ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? -50.051  23.592  410.182 1.00 131.88 ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? -49.260  22.307  410.332 1.00 132.50 ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? -49.987  21.296  411.191 1.00 131.10 ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? -49.027  20.230  411.691 1.00 129.15 ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? -49.522  19.570  412.929 1.00 127.71 ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? -53.122  25.070  410.197 1.00 136.39 ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? -53.683  26.409  410.153 1.00 131.70 ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? -52.627  27.396  410.629 1.00 125.92 ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? -51.859  27.111  411.551 1.00 126.66 ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? -54.950  26.503  411.001 1.00 132.19 ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? -55.693  27.813  410.822 1.00 132.95 ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? -56.760  28.024  411.868 1.00 136.09 ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? -56.667  27.403  412.947 1.00 140.22 ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? -57.696  28.809  411.612 1.00 141.01 ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? -52.584  28.559  409.992 1.00 120.78 ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? -51.526  29.501  410.281 1.00 117.67 ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? -50.168  29.087  409.764 1.00 116.71 ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? -49.166  29.706  410.133 1.00 114.84 ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? -50.102  28.044  408.929 1.00 116.60 ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? -48.851  27.666  408.282 1.00 114.06 ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? -48.410  28.696  407.257 1.00 119.94 ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? -47.240  28.698  406.863 1.00 125.20 ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? -48.976  26.303  407.605 1.00 105.62 ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? -50.203  26.192  406.906 1.00 102.51 ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? -49.319  29.569  406.820 1.00 121.14 ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? -48.972  30.656  405.918 1.00 124.43 ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? -48.525  31.906  406.655 1.00 123.55 ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? -48.094  32.867  406.008 1.00 120.41 ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? -50.155  31.016  405.007 1.00 127.86 ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? -51.402  31.434  405.739 1.00 126.51 ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? -51.701  32.685  406.198 1.00 120.99 ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? -52.533  30.611  406.057 1.00 125.91 ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? -52.934  32.685  406.802 1.00 119.48 ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? -53.467  31.425  406.727 1.00 122.82 ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? -52.842  29.264  405.849 1.00 122.85 ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? -54.686  30.938  407.190 1.00 121.13 ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? -54.055  28.782  406.310 1.00 119.00 ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? -54.961  29.617  406.971 1.00 118.92 ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? -48.614  31.926  407.982 1.00 126.15 ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? -48.025  33.025  408.725 1.00 126.77 ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? -46.517  32.941  408.560 1.00 126.14 ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? -45.923  31.876  408.757 1.00 123.94 ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? -48.403  32.960  410.207 1.00 127.81 ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? -48.013  31.695  410.753 1.00 127.82 ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? -49.899  33.132  410.395 1.00 129.41 ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? -45.899  34.054  408.161 1.00 127.11 ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? -44.450  34.062  408.012 1.00 127.97 ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? -43.775  33.605  409.294 1.00 127.76 ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? -42.747  32.922  409.251 1.00 124.23 ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? -43.974  35.460  407.615 1.00 130.52 ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? -42.457  35.628  407.575 1.00 134.82 ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? -41.859  34.652  406.586 1.00 136.25 ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? -42.076  37.055  407.221 1.00 136.17 ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? -44.376  33.932  410.439 1.00 132.89 ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? -43.836  33.530  411.731 1.00 138.96 ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? -43.807  32.015  411.877 1.00 138.24 ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? -42.908  31.473  412.529 1.00 140.16 ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? -44.657  34.167  412.851 1.00 143.84 ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? -44.682  35.680  412.760 1.00 146.36 ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? -45.309  36.207  411.816 1.00 146.36 ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? -44.070  36.344  413.624 1.00 147.32 ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? -44.800  31.322  411.316 1.00 133.53 ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? -44.793  29.864  411.340 1.00 128.75 ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? -43.555  29.326  410.635 1.00 121.95 ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? -42.801  28.525  411.200 1.00 118.58 ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? -46.072  29.325  410.699 1.00 131.08 ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? -46.227  27.828  410.784 1.00 133.37 ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? -45.574  26.987  409.898 1.00 133.20 ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? -47.015  27.254  411.768 1.00 134.46 ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? -45.711  25.623  409.985 1.00 133.36 ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? -47.155  25.887  411.862 1.00 134.74 ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? -46.501  25.077  410.966 1.00 133.96 ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? -46.631  23.714  411.053 1.00 134.55 ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? -43.345  29.745  409.385 1.00 122.29 ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? -42.145  29.355  408.651 1.00 128.36 ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? -40.882  29.757  409.401 1.00 129.78 ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? -39.848  29.090  409.282 1.00 129.58 ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? -42.168  29.968  407.248 1.00 130.85 ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? -41.045  29.501  406.348 1.00 126.43 ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? -40.941  28.172  405.969 1.00 124.33 ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? -40.108  30.395  405.855 1.00 120.44 ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? -39.916  27.744  405.147 1.00 121.00 ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? -39.087  29.977  405.023 1.00 117.36 ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? -38.994  28.649  404.677 1.00 119.01 ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? -37.978  28.218  403.856 1.00 119.20 ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? -40.951  30.839  410.177 1.00 129.06 ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? -39.811  31.264  410.982 1.00 125.80 ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? -39.512  30.250  412.079 1.00 119.96 ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? -38.360  29.843  412.265 1.00 121.82 ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? -40.087  32.641  411.585 1.00 127.24 ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? -40.139  33.814  410.605 1.00 128.25 ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? -40.309  35.141  411.337 1.00 127.90 ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? -38.904  33.827  409.717 1.00 129.18 ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? -40.541  29.838  412.822 1.00 112.48 ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? -40.341  28.936  413.951 1.00 111.75 ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? -39.791  27.581  413.528 1.00 119.33 ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? -39.290  26.837  414.380 1.00 125.66 ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? -41.647  28.730  414.720 1.00 108.21 ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? -41.874  29.728  415.844 1.00 109.89 ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? -43.334  30.134  415.940 1.00 118.31 ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? -44.194  28.964  416.102 1.00 127.23 ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? -45.520  28.988  416.015 1.00 131.65 ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? -46.154  30.126  415.774 1.00 134.77 ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? -46.214  27.870  416.177 1.00 130.94 ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? -39.868  27.237  412.245 1.00 117.89 ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? -39.443  25.929  411.771 1.00 115.61 ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? -38.095  25.968  411.065 1.00 114.73 ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? -37.707  24.979  410.437 1.00 116.26 ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? -40.500  25.355  410.829 1.00 114.55 ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? -41.744  24.900  411.525 1.00 117.22 ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? -42.741  25.771  411.910 1.00 118.19 ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? -42.152  23.667  411.906 1.00 116.88 ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? -43.707  25.093  412.503 1.00 118.02 ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? -43.376  23.815  412.511 1.00 116.70 ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? -37.374  27.078  411.155 1.00 112.66 ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? -36.046  27.175  410.592 1.00 110.96 ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? -35.987  27.786  409.212 1.00 106.33 ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? -35.002  27.567  408.500 1.00 106.50 ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? -37.009  28.532  408.811 1.00 106.10 ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? -37.025  29.108  407.487 1.00 109.87 ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? -36.059  30.263  407.322 1.00 110.77 ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? -35.603  30.882  408.283 1.00 110.93 ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? -35.741  30.539  406.057 1.00 111.55 ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? -34.972  31.688  405.584 1.00 113.26 ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? -33.507  31.652  405.990 1.00 116.54 ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? -32.748  32.541  405.587 1.00 107.24 ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? -35.592  33.017  406.031 1.00 113.77 ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? -36.749  33.415  405.155 1.00 118.10 ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? -36.540  33.826  403.849 1.00 117.19 ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? -38.051  33.345  405.618 1.00 123.82 ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? -37.595  34.180  403.036 1.00 118.87 ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? -39.111  33.695  404.810 1.00 125.45 ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? -38.878  34.113  403.520 1.00 123.13 ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? -39.930  34.465  402.708 1.00 123.94 ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? -33.078  30.660  406.770 1.00 100.82 ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? -31.676  30.575  407.158 1.00 98.03  ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? -30.802  30.243  405.957 1.00 94.57  ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? -29.652  30.699  405.872 1.00 92.61  ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? -31.511  29.529  408.257 1.00 97.11  ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? -31.298  30.114  409.637 1.00 96.32  ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? -30.889  29.068  410.641 1.00 101.13 ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? -31.361  27.919  410.524 1.00 104.11 ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? -30.116  29.398  411.561 1.00 103.92 ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? -31.339  29.443  405.032 1.00 95.56  ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? -30.572  28.979  403.883 1.00 102.83 ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? -30.129  30.144  403.007 1.00 108.34 ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? -28.987  30.180  402.538 1.00 106.78 ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? -31.410  27.990  403.072 1.00 107.04 ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? -32.074  27.086  403.963 1.00 109.55 ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? -30.538  27.194  402.130 1.00 107.32 ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? -31.027  31.096  402.755 1.00 111.93 ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? -30.637  32.274  401.990 1.00 108.74 ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? -29.543  33.054  402.711 1.00 106.87 ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? -28.558  33.472  402.092 1.00 105.55 ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? -31.852  33.162  401.727 1.00 105.50 ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? -29.697  33.252  404.023 1.00 107.13 ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? -28.713  34.022  404.781 1.00 107.17 ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? -27.328  33.395  404.695 1.00 102.15 ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? -26.329  34.104  404.529 1.00 96.54  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? -29.146  34.147  406.241 1.00 111.33 ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? -28.172  34.940  407.101 1.00 108.23 ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? -28.622  34.992  408.552 1.00 102.27 ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? -29.663  36.074  408.766 1.00 95.71  ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? -29.788  36.447  410.200 1.00 91.47  ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? -27.242  32.068  404.811 1.00 102.80 ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? -25.935  31.426  404.696 1.00 102.91 ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? -25.403  31.508  403.267 1.00 102.22 ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? -24.270  31.955  403.047 1.00 98.93  ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? -26.000  29.973  405.183 1.00 103.77 ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? -27.107  29.153  404.568 1.00 103.43 ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? -27.050  27.690  404.940 1.00 102.77 ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? -25.918  27.019  404.311 1.00 104.07 ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? -25.675  25.720  404.428 1.00 110.61 ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? -26.501  24.956  405.129 1.00 113.25 ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? -24.630  25.179  403.822 1.00 114.76 ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? -26.207  31.091  402.279 1.00 105.14 ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? -25.704  30.957  400.912 1.00 104.93 ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? -25.291  32.307  400.337 1.00 108.77 ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? -24.218  32.434  399.737 1.00 107.10 ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? -26.752  30.264  400.018 1.00 99.86  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? -26.255  30.181  398.582 1.00 96.63  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? -27.057  28.863  400.533 1.00 100.79 ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? -26.114  33.343  400.532 1.00 117.02 ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? -25.908  34.603  399.819 1.00 126.90 ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? -24.553  35.232  400.126 1.00 131.57 ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? -23.947  35.863  399.253 1.00 133.38 ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? -27.044  35.569  400.152 1.00 131.22 ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? -28.334  35.256  399.393 1.00 134.27 ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? -29.465  36.181  399.804 1.00 136.84 ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? -28.100  35.330  397.899 1.00 133.52 ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? -24.063  35.084  401.357 1.00 131.88 ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? -22.776  35.659  401.722 1.00 129.38 ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? -21.642  34.644  401.779 1.00 129.29 ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? -20.476  35.043  401.675 1.00 129.57 ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? -22.873  36.395  403.064 1.00 126.65 ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? -24.238  36.999  403.325 1.00 127.15 ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? -24.126  38.203  404.243 1.00 129.21 ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? -25.473  38.585  404.827 1.00 130.66 ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? -25.323  39.386  406.072 1.00 130.19 ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? -21.940  33.353  401.931 1.00 127.66 ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? -20.881  32.352  402.002 1.00 124.09 ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? -20.613  31.750  400.627 1.00 113.07 ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? -19.497  31.838  400.106 1.00 109.46 ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? -21.255  31.254  403.002 1.00 131.39 ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? -21.437  31.746  404.420 1.00 137.38 ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? -22.071  30.703  405.312 1.00 144.88 ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? -22.539  29.674  404.783 1.00 148.42 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? -22.108  30.915  406.541 1.00 147.44 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? -21.630  31.143  400.032 1.00 110.63 ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? -21.477  30.450  398.764 1.00 115.42 ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? -21.690  31.422  397.612 1.00 131.03 ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? -22.625  32.226  397.626 1.00 135.31 ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? -22.470  29.291  398.668 1.00 108.39 ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? -22.183  28.161  399.637 1.00 100.29 ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? -23.229  27.074  399.540 1.00 85.92  ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? -22.922  25.941  400.493 1.00 85.93  ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? -21.664  25.250  400.116 1.00 87.87  ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? -20.833  31.337  396.620 1.00 139.13 ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? -20.987  32.159  395.433 1.00 141.52 ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? -21.915  31.464  394.444 1.00 133.41 ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? -22.207  30.273  394.592 1.00 133.02 ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? -19.619  32.433  394.801 1.00 147.70 ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? -18.992  31.199  394.439 1.00 151.62 ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? -18.722  33.191  395.773 1.00 148.04 ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? -22.443  32.183  393.446 1.00 123.68 ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? -23.386  31.531  392.522 1.00 117.61 ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? -22.800  30.293  391.870 1.00 112.80 ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? -23.488  29.273  391.741 1.00 109.95 ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? -23.686  32.631  391.497 1.00 118.99 ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? -23.388  33.900  392.205 1.00 120.16 ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? -22.246  33.605  393.109 1.00 120.26 ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? -21.533  30.358  391.457 1.00 112.46 ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? -20.869  29.181  390.910 1.00 109.21 ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? -20.848  28.037  391.915 1.00 102.26 ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? -20.940  26.868  391.525 1.00 105.10 ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? -19.442  29.540  390.490 1.00 112.20 ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? -19.392  30.320  389.189 1.00 114.50 ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? -19.896  29.815  388.165 1.00 114.66 ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? -18.840  31.440  389.194 1.00 115.13 ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? -20.754  28.352  393.209 1.00 97.84  ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? -20.715  27.308  394.229 1.00 102.16 ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? -22.043  26.562  394.310 1.00 107.52 ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? -22.070  25.327  394.280 1.00 105.20 ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? -20.348  27.910  395.586 1.00 98.76  ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? -18.909  28.380  395.688 1.00 95.71  ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? -18.542  28.814  397.088 1.00 96.63  ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? -18.997  28.165  398.053 1.00 98.58  ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? -17.800  29.806  397.224 1.00 96.47  ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? -23.160  27.292  394.390 1.00 110.97 ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? -24.455  26.618  394.454 1.00 106.77 ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? -24.767  25.944  393.126 1.00 108.76 ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? -25.463  24.923  393.090 1.00 110.91 ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? -25.569  27.601  394.874 1.00 98.68  ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? -25.685  28.754  393.894 1.00 95.95  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? -26.911  26.879  395.024 1.00 95.13  ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? -24.222  26.461  392.023 1.00 108.87 ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? -24.448  25.837  390.721 1.00 108.58 ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? -23.744  24.487  390.652 1.00 116.56 ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? -24.334  23.483  390.238 1.00 119.52 ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? -23.999  26.775  389.587 1.00 101.74 ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? -25.018  27.899  389.395 1.00 92.41  ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? -23.817  26.001  388.287 1.00 104.86 ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? -24.621  28.920  388.355 1.00 88.67  ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? -22.466  24.445  391.045 1.00 120.17 ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? -21.772  23.167  391.172 1.00 125.07 ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? -22.469  22.258  392.172 1.00 125.44 ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? -22.504  21.036  391.985 1.00 123.07 ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? -20.317  23.388  391.592 1.00 128.23 ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? -19.309  23.392  390.454 1.00 132.10 ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? -19.129  22.015  389.840 1.00 134.99 ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? -19.735  21.748  388.783 1.00 136.80 ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? -18.388  21.193  390.416 1.00 134.15 ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? -23.049  22.834  393.226 1.00 128.58 ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? -23.744  22.027  394.224 1.00 129.64 ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? -24.968  21.348  393.622 1.00 118.95 ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? -25.205  20.160  393.861 1.00 117.64 ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? -24.130  22.886  395.426 1.00 136.20 ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? -24.420  22.061  396.664 1.00 139.76 ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? -23.153  21.674  397.397 1.00 140.60 ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? -22.203  22.485  397.405 1.00 140.88 ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? -23.088  20.556  397.942 1.00 141.07 ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? -25.773  22.091  392.856 1.00 109.58 ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? -26.949  21.484  392.241 1.00 101.65 ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? -26.530  20.525  391.130 1.00 105.69 ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? -27.203  19.515  390.891 1.00 109.29 ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? -27.932  22.556  391.729 1.00 92.63  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? -29.247  21.915  391.314 1.00 88.93  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? -28.204  23.590  392.807 1.00 88.26  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? -25.427  20.815  390.429 1.00 104.04 ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? -24.878  19.833  389.497 1.00 102.75 ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? -24.571  18.527  390.212 1.00 109.60 ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? -24.824  17.439  389.682 1.00 116.72 ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? -23.608  20.364  388.827 1.00 95.90  ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? -23.191  19.550  387.608 1.00 92.25  ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? -21.855  19.995  387.021 1.00 90.48  ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? -21.905  21.384  386.422 1.00 91.99  ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? -20.690  21.636  385.598 1.00 92.13  ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? -24.020  18.620  391.422 1.00 110.76 ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? -23.740  17.429  392.213 1.00 117.73 ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? -25.018  16.797  392.746 1.00 116.06 ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? -25.057  15.584  392.983 1.00 112.99 ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? -22.810  17.786  393.373 1.00 126.29 ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? -21.363  18.009  392.972 1.00 131.25 ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? -20.520  18.395  394.175 1.00 133.09 ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? -19.605  19.488  393.868 1.00 133.63 ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? -18.385  19.605  394.381 1.00 135.12 ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? -17.933  18.692  395.228 1.00 136.09 ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? -17.618  20.633  394.047 1.00 135.72 ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? -26.069  17.599  392.935 1.00 117.79 ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? -27.336  17.094  393.449 1.00 118.65 ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? -27.943  16.020  392.561 1.00 126.81 ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? -28.772  15.239  393.038 1.00 130.31 ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? -28.335  18.244  393.615 1.00 108.89 ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? -28.766  18.749  392.361 1.00 101.91 ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? -27.555  15.957  391.291 1.00 154.19 ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? -28.187  15.013  390.397 1.00 158.18 ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? -29.637  15.329  390.131 1.00 161.22 ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? -30.383  14.457  389.681 1.00 162.21 ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? -30.056  16.562  390.400 1.00 160.72 ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? -31.455  16.937  390.268 1.00 159.96 ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? -31.825  17.056  388.798 1.00 157.69 ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? -31.304  17.919  388.083 1.00 159.77 ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? -31.713  18.252  390.996 1.00 162.08 ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? -33.080  18.912  390.816 1.00 166.26 ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? -34.199  17.941  391.144 1.00 166.27 ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? -33.180  20.157  391.682 1.00 169.11 ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? -32.725  16.192  388.350 1.00 152.21 ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? -33.277  16.291  387.012 1.00 147.23 ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? -34.518  17.173  387.029 1.00 140.70 ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? -35.143  17.393  388.069 1.00 138.54 ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? -33.613  14.909  386.450 1.00 151.66 ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? -32.394  14.067  386.094 1.00 154.85 ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? -32.802  12.702  385.558 1.00 154.66 ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? -32.960  12.727  384.106 1.00 153.86 ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? -33.320  11.682  383.369 1.00 150.45 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? -33.547  10.510  383.942 1.00 149.44 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? -33.444  11.805  382.054 1.00 148.82 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? -34.852  17.701  385.857 1.00 139.35 ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? -35.996  18.577  385.715 1.00 140.48 ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? -37.286  18.006  386.263 1.00 140.37 ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? -37.748  16.952  385.814 1.00 137.81 ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? -37.875  18.697  387.237 1.00 143.91 ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? -39.109  18.254  387.872 1.00 147.97 ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? -40.353  18.675  387.107 1.00 148.99 ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? -41.460  18.300  387.504 1.00 151.68 ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? -39.196  18.790  389.306 1.00 151.97 ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? -38.176  18.218  390.275 1.00 157.88 ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? -38.454  16.743  390.522 1.00 165.17 ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? -37.235  15.966  390.704 1.00 172.11 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? -36.701  15.697  391.891 1.00 178.30 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? -37.282  16.149  392.995 1.00 181.30 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? -35.589  14.981  391.976 1.00 179.96 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? -40.206  19.441  386.028 1.00 147.77 ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? -41.352  19.767  385.208 1.00 149.69 ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? -41.825  18.645  384.316 1.00 154.31 ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? -42.879  18.770  383.686 1.00 154.21 ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? -41.076  17.549  384.258 1.00 160.62 ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? -41.362  16.431  383.379 1.00 166.10 ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? -40.289  16.163  382.348 1.00 170.19 ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? -40.243  15.058  381.787 1.00 171.70 ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? -39.418  17.136  382.078 1.00 171.80 ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? -38.344  16.929  381.114 1.00 172.52 ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? -37.287  15.985  381.673 1.00 167.27 ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? -37.003  14.931  381.093 1.00 164.73 ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? -37.724  18.273  380.726 1.00 175.87 ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? -36.697  16.348  382.805 1.00 164.41 ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? -35.631  15.574  383.396 1.00 161.52 ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? -34.228  16.032  383.074 1.00 157.99 ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? -33.276  15.311  383.390 1.00 161.37 ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? -34.063  17.176  382.433 1.00 151.73 ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? -32.689  17.588  382.185 1.00 151.63 ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? -32.098  18.169  383.471 1.00 149.59 ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? -32.781  18.900  384.192 1.00 151.30 ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? -32.620  18.602  381.043 1.00 158.37 ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? -31.378  18.474  380.195 1.00 163.05 ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? -30.227  19.183  380.497 1.00 163.85 ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? -31.360  17.615  379.106 1.00 162.76 ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? -29.089  19.047  379.718 1.00 161.44 ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? -30.227  17.476  378.326 1.00 160.75 ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? -29.091  18.192  378.632 1.00 159.76 ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? -30.843  17.854  383.785 1.00 145.58 ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? -30.244  18.337  385.041 1.00 140.80 ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? -30.145  19.855  385.101 1.00 130.63 ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? -29.457  20.484  384.294 1.00 127.49 ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? -28.858  17.681  385.039 1.00 145.11 ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? -29.024  16.472  384.168 1.00 147.37 ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? -29.952  16.916  383.081 1.00 147.25 ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? -30.856  20.441  386.073 1.00 126.71 ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? -30.916  21.894  386.214 1.00 122.86 ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? -29.540  22.509  386.431 1.00 121.44 ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? -29.347  23.695  386.138 1.00 112.66 ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? -31.837  22.283  387.375 1.00 120.17 ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? -31.095  22.274  388.600 1.00 114.32 ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? -33.002  21.311  387.497 1.00 113.04 ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? -28.582  21.731  386.928 1.00 112.57 ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? -27.234  22.216  387.131 1.00 112.46 ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? -26.585  22.567  385.810 1.00 112.34 ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? -26.139  23.701  385.608 1.00 112.32 ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? -26.512  21.594  384.900 1.00 114.00 ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? -25.981  21.873  383.570 1.00 115.12 ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? -26.839  22.902  382.842 1.00 114.75 ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? -26.327  23.675  382.022 1.00 116.22 ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? -25.882  20.576  382.766 1.00 121.56 ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? -25.282  20.660  381.364 1.00 130.76 ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? -23.785  20.890  381.454 1.00 131.63 ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? -25.582  19.399  380.569 1.00 136.80 ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? -28.144  22.925  383.129 1.00 116.70 ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? -29.014  23.975  382.609 1.00 117.73 ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? -28.485  25.356  382.968 1.00 118.31 ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? -28.347  26.230  382.104 1.00 115.36 ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? -30.431  23.806  383.156 1.00 112.63 ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? -31.425  24.794  382.580 1.00 112.74 ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? -32.768  24.705  383.285 1.00 114.48 ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? -33.877  25.296  382.433 1.00 113.00 ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? -35.172  25.331  383.161 1.00 113.17 ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? -28.190  25.574  384.250 1.00 122.49 ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? -27.621  26.851  384.665 1.00 126.32 ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? -26.236  27.053  384.070 1.00 123.35 ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? -25.843  28.188  383.780 1.00 116.48 ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? -27.568  26.941  386.191 1.00 132.15 ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? -28.916  26.897  386.841 1.00 136.18 ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? -30.120  26.806  386.213 1.00 137.01 ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? -29.200  26.955  388.245 1.00 137.50 ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? -31.136  26.795  387.134 1.00 137.32 ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? -30.597  26.887  388.389 1.00 135.44 ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? -28.410  27.055  389.392 1.00 138.56 ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? -31.221  26.917  389.632 1.00 131.67 ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? -29.032  27.084  390.626 1.00 135.00 ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? -30.422  27.017  390.735 1.00 131.27 ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? -25.485  25.967  383.881 1.00 128.70 ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? -24.193  26.085  383.221 1.00 132.21 ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? -24.336  26.482  381.759 1.00 132.29 ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? -23.341  26.874  381.141 1.00 130.59 ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? -23.414  24.772  383.328 1.00 134.31 ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? -23.691  23.923  382.229 1.00 136.76 ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? -25.544  26.388  381.194 1.00 134.26 ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? -25.794  26.955  379.875 1.00 135.47 ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? -26.078  28.449  379.922 1.00 136.76 ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? -26.004  29.109  378.880 1.00 138.41 ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? -26.983  26.282  379.181 1.00 135.31 ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? -26.702  24.900  378.677 1.00 134.95 ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? -25.426  24.535  378.292 1.00 137.86 ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? -27.728  23.984  378.532 1.00 132.23 ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? -25.171  23.267  377.810 1.00 137.58 ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? -27.478  22.717  378.049 1.00 133.99 ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? -26.198  22.360  377.687 1.00 136.21 ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? -26.398  28.998  381.090 1.00 138.20 ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? -26.777  30.395  381.157 1.00 144.24 ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? -25.571  31.297  380.909 1.00 137.03 ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? -24.425  30.878  381.080 1.00 138.85 ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? -27.409  30.702  382.509 1.00 158.78 ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? -28.798  30.131  382.655 1.00 171.86 ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? -29.981  31.262  381.902 1.00 181.84 ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? -29.594  32.782  382.768 1.00 180.48 ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? -25.809  32.547  380.497 1.00 129.52 ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? -24.675  33.418  380.149 1.00 133.53 ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? -23.714  33.641  381.301 1.00 135.22 ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? -22.497  33.699  381.085 1.00 140.59 ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? -25.368  34.717  379.714 1.00 132.72 ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? -26.696  34.256  379.207 1.00 127.34 ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? -27.096  33.192  380.181 1.00 124.03 ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? -24.243  33.808  382.516 1.00 127.87 ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? -23.476  33.894  383.755 1.00 122.91 ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? -22.738  35.227  383.846 1.00 121.37 ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? -22.221  35.580  384.910 1.00 118.02 ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? -22.499  32.716  383.859 1.00 122.61 ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? -21.971  32.427  385.251 1.00 123.74 ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? -21.305  31.059  385.298 1.00 123.12 ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? -22.255  29.985  385.809 1.00 112.16 ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? -23.404  29.741  384.890 1.00 112.21 ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? -22.701  35.973  382.739 1.00 126.80 ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? -22.263  37.365  382.707 1.00 131.27 ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? -22.638  38.032  381.389 1.00 137.83 ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? -22.159  37.623  380.327 1.00 137.98 ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? -20.752  37.477  382.926 1.00 127.08 ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? -20.351  38.813  383.527 1.00 118.92 ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? -20.730  39.860  382.963 1.00 114.59 ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? -19.656  38.820  384.564 1.00 117.35 ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? -23.499  39.049  381.444 1.00 141.59 ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? -23.808  39.861  380.268 1.00 139.46 ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? -23.860  41.357  380.530 1.00 127.15 ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? -23.671  42.130  379.586 1.00 118.17 ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? -25.143  39.428  379.651 1.00 145.76 ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? -26.308  39.591  380.607 1.00 150.98 ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? -26.077  39.868  381.802 1.00 153.93 ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? -27.464  39.448  380.166 1.00 152.31 ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? -24.088  41.802  381.764 1.00 127.35 ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? -24.444  43.172  382.049 1.00 130.79 ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? -25.915  43.488  381.906 1.00 135.94 ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? -26.388  44.453  382.516 1.00 138.73 ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? -26.660  42.705  381.131 1.00 138.14 ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? -28.094  42.917  381.023 1.00 138.65 ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? -28.824  42.297  382.209 1.00 135.67 ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? -28.322  41.399  382.892 1.00 136.11 ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? -28.664  42.340  379.726 1.00 138.97 ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? -28.279  43.069  378.456 1.00 136.75 ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? -29.051  42.489  377.279 1.00 134.10 ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? -29.509  43.578  376.326 1.00 132.44 ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? -29.912  43.029  375.003 1.00 130.77 ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? -30.027  42.805  382.450 1.00 129.80 ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? -30.867  42.286  383.517 1.00 123.28 ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? -31.312  40.867  383.181 1.00 119.82 ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? -31.518  40.526  382.015 1.00 117.40 ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? -32.074  43.205  383.718 1.00 121.19 ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? -33.270  42.565  384.385 1.00 113.60 ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? -33.087  42.446  385.877 1.00 118.64 ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? -32.223  41.711  386.352 1.00 123.44 ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? -33.896  43.180  386.632 1.00 113.80 ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? -31.430  40.027  384.203 1.00 92.53  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? -31.894  38.658  384.030 1.00 93.12  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? -33.250  38.471  384.696 1.00 92.90  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? -33.738  39.334  385.429 1.00 92.21  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? -30.885  37.655  384.600 1.00 93.55  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? -29.492  37.832  384.082 1.00 91.86  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? -28.386  37.334  384.738 1.00 91.96  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? -29.024  38.449  382.971 1.00 90.81  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? -27.298  37.636  384.054 1.00 90.79  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? -27.658  38.314  382.979 1.00 91.06  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? -33.860  37.319  384.424 1.00 95.03  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? -35.140  36.966  385.017 1.00 98.55  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? -35.127  35.508  385.444 1.00 105.23 ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? -34.596  34.646  384.737 1.00 98.25  ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? -36.312  37.188  384.046 1.00 97.09  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? -36.633  38.637  383.742 1.00 94.62  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? -37.365  39.407  384.630 1.00 95.27  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? -36.234  39.223  382.556 1.00 90.19  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? -37.668  40.731  384.351 1.00 91.79  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? -36.538  40.543  382.270 1.00 88.14  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? -37.253  41.292  383.171 1.00 90.08  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? -37.554  42.605  382.886 1.00 92.04  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? -35.709  35.246  386.607 1.00 121.33 ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? -35.969  33.895  387.084 1.00 133.45 ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? -37.478  33.717  387.149 1.00 148.93 ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? -38.165  34.474  387.841 1.00 151.65 ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? -35.344  33.662  388.456 1.00 127.16 ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? -35.661  32.286  389.030 1.00 118.93 ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? -35.297  31.175  388.058 1.00 117.95 ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? -34.962  32.110  390.341 1.00 115.64 ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? -37.993  32.711  386.455 1.00 160.09 ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? -39.430  32.566  386.263 1.00 171.21 ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? -39.900  31.312  386.984 1.00 175.93 ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? -39.375  30.217  386.749 1.00 177.97 ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? -39.790  32.518  384.772 1.00 176.54 ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? -39.448  33.853  384.105 1.00 180.14 ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? -41.261  32.174  384.586 1.00 177.80 ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? -39.952  33.984  382.683 1.00 183.01 ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? -40.871  31.478  387.876 1.00 179.32 ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? -41.506  30.355  388.548 1.00 184.01 ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? -42.724  29.933  387.738 1.00 179.11 ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? -43.638  30.736  387.521 1.00 176.56 ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? -41.908  30.733  389.971 1.00 195.25 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? -42.568  29.379  390.953 1.00 205.59 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? -42.736  28.679  387.290 1.00 177.65 ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? -43.795  28.179  386.414 1.00 177.09 ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? -44.935  27.652  387.282 1.00 172.75 ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? -45.114  26.449  387.479 1.00 170.48 ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? -43.246  27.120  385.465 1.00 178.76 ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? -44.289  26.611  384.483 1.00 179.58 ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? -45.381  27.166  384.369 1.00 178.56 ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? -43.938  25.565  383.741 1.00 180.92 ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? -45.728  28.587  387.806 1.00 169.41 ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? -46.828  28.264  388.701 1.00 161.38 ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? -48.134  28.036  387.954 1.00 153.55 ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? -49.212  28.185  388.540 1.00 152.32 ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? -47.004  29.368  389.745 1.00 161.27 ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? -48.058  27.683  386.675 1.00 149.75 ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? -49.221  27.226  385.921 1.00 150.42 ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? -49.253  25.715  386.059 1.00 145.12 ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? -48.472  25.004  385.426 1.00 147.90 ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? -49.136  27.651  384.459 1.00 154.79 ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? -50.342  27.206  383.644 1.00 154.76 ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? -51.341  27.955  383.592 1.00 153.27 ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? -50.297  26.105  383.059 1.00 154.22 ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? -50.137  25.222  386.917 1.00 138.12 ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? -50.314  23.788  387.118 1.00 139.22 ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? -51.580  23.399  386.364 1.00 139.05 ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? -52.688  23.463  386.896 1.00 142.57 ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? -50.390  23.450  388.601 1.00 142.85 ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? -50.744  22.004  388.889 1.00 142.84 ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? -50.837  21.701  390.369 1.00 138.17 ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? -51.599  22.392  391.077 1.00 136.12 ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? -50.140  20.773  390.827 1.00 136.01 ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? -51.410  22.973  385.112 1.00 136.37 ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? -52.544  22.732  384.236 1.00 138.66 ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? -52.721  21.282  383.822 1.00 140.25 ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? -53.844  20.895  383.484 1.00 143.06 ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? -52.427  23.586  382.962 1.00 141.15 ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? -52.315  24.963  383.273 1.00 144.07 ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? -51.676  20.472  383.850 1.00 139.84 ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? -51.809  19.105  383.374 1.00 140.41 ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? -52.580  18.283  384.401 1.00 138.48 ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? -52.252  18.323  385.593 1.00 137.32 ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? -50.443  18.486  383.097 1.00 142.38 ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? -50.536  17.091  382.513 1.00 144.06 ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? -49.434  16.796  381.525 1.00 145.33 ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? -48.562  17.668  381.327 1.00 145.39 ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? -49.456  15.704  380.925 1.00 146.64 ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? -53.616  17.554  383.990 1.00 136.15 ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? -54.392  16.751  384.942 1.00 136.83 ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? -53.523  15.748  385.686 1.00 134.39 ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? -52.436  15.369  385.243 1.00 134.58 ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? -55.423  16.048  384.054 1.00 136.26 ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? -55.551  16.943  382.864 1.00 133.80 ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? -54.190  17.516  382.636 1.00 133.58 ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? -54.018  15.323  386.845 1.00 130.94 ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? -53.221  14.508  387.732 1.00 132.42 ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? -52.140  15.255  388.476 1.00 138.06 ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? -51.397  14.631  389.239 1.00 140.23 ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? -52.020  16.563  388.276 1.00 142.91 ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? -51.055  17.399  388.985 1.00 146.27 ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? -51.837  18.381  389.852 1.00 145.14 ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? -52.399  19.357  389.347 1.00 143.72 ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? -50.133  18.124  388.008 1.00 147.41 ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? -49.393  19.143  388.658 1.00 148.75 ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? -51.900  18.096  391.154 1.00 141.73 ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? -52.537  18.975  392.128 1.00 137.07 ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? -51.641  19.188  393.342 1.00 132.08 ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? -52.134  19.451  394.443 1.00 133.19 ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? -53.897  18.429  392.568 1.00 137.83 ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? -53.938  16.937  392.727 1.00 140.16 ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? -53.626  16.351  393.941 1.00 140.51 ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? -54.317  16.122  391.675 1.00 143.71 ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? -53.670  14.979  394.096 1.00 142.17 ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? -54.362  14.747  391.826 1.00 145.53 ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? -54.038  14.177  393.038 1.00 144.51 ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? -50.323  19.086  393.163 1.00 124.48 ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? -49.420  19.151  394.306 1.00 115.06 ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? -49.029  20.580  394.666 1.00 114.98 ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? -48.980  20.924  395.852 1.00 117.79 ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? -48.159  18.319  394.037 1.00 105.99 ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? -47.323  18.756  392.836 1.00 100.04 ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? -45.882  18.282  392.997 1.00 98.63  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? -44.980  18.620  391.814 1.00 100.68 ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? -44.848  20.082  391.575 1.00 101.84 ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? -48.766  21.428  393.669 1.00 112.91 ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? -48.225  22.758  393.932 1.00 114.05 ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? -49.249  23.704  394.541 1.00 111.10 ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? -48.859  24.697  395.169 1.00 105.79 ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? -47.667  23.351  392.638 1.00 117.90 ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? -46.567  22.498  392.039 1.00 118.68 ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? -45.966  21.705  392.792 1.00 120.14 ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? -46.302  22.610  390.824 1.00 117.11 ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? -50.542  23.427  394.355 1.00 116.87 ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? -51.582  24.274  394.928 1.00 123.52 ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? -51.376  24.455  396.424 1.00 125.95 ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? -51.457  25.570  396.945 1.00 125.07 ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? -52.962  23.674  394.645 1.00 127.13 ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? -54.118  24.436  395.293 1.00 127.20 ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? -55.428  24.209  394.545 1.00 125.37 ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? -56.298  23.244  395.212 1.00 121.65 ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? -57.366  23.572  395.935 1.00 119.81 ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? -57.709  24.846  396.077 1.00 121.81 ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? -58.098  22.626  396.505 1.00 117.04 ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? -51.078  23.365  397.130 1.00 128.89 ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? -51.018  23.429  398.585 1.00 130.92 ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? -49.692  23.987  399.081 1.00 127.25 ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? -49.647  24.577  400.166 1.00 125.57 ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? -51.302  22.046  399.169 1.00 133.84 ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? -52.582  21.488  398.605 1.00 134.66 ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? -53.784  22.143  398.817 1.00 135.81 ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? -52.590  20.337  397.833 1.00 133.24 ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? -54.960  21.667  398.291 1.00 135.54 ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? -53.770  19.848  397.303 1.00 133.93 ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? -54.951  20.521  397.538 1.00 134.10 ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? -56.138  20.060  397.026 1.00 132.48 ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? -48.613  23.830  398.312 1.00 124.29 ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? -47.394  24.578  398.610 1.00 122.57 ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? -47.672  26.073  398.528 1.00 132.20 ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? -47.283  26.848  399.409 1.00 134.12 ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? -46.250  24.170  397.664 1.00 110.15 ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? -45.779  22.748  397.958 1.00 105.40 ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? -45.082  25.138  397.782 1.00 107.01 ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? -44.532  22.365  397.198 1.00 102.87 ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? -48.372  26.495  397.472 1.00 138.09 ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? -48.670  27.914  397.306 1.00 141.17 ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? -49.647  28.418  398.362 1.00 140.22 ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? -49.576  29.585  398.762 1.00 139.99 ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? -49.218  28.168  395.903 1.00 144.19 ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? -48.272  27.797  394.761 1.00 145.64 ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? -48.805  28.298  393.426 1.00 144.91 ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? -46.874  28.342  395.028 1.00 145.76 ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? -50.560  27.562  398.817 1.00 138.49 ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? -51.550  27.972  399.805 1.00 137.26 ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? -50.998  27.955  401.225 1.00 131.73 ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? -51.494  28.695  402.081 1.00 130.21 ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? -52.778  27.063  399.716 1.00 143.04 ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? -53.582  27.230  398.439 1.00 148.64 ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? -54.952  26.591  398.525 1.00 151.47 ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? -55.330  26.141  399.626 1.00 152.21 ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? -55.650  26.541  397.490 1.00 151.57 ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? -49.989  27.127  401.499 1.00 129.30 ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? -49.520  26.925  402.862 1.00 128.35 ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? -48.061  27.299  403.093 1.00 133.47 ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? -47.731  27.759  404.189 1.00 135.97 ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? -49.726  25.458  403.277 1.00 119.27 ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? -51.059  24.897  402.807 1.00 108.62 ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? -52.067  25.631  402.827 1.00 106.03 ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? -51.096  23.717  402.406 1.00 104.76 ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? -47.182  27.122  402.109 1.00 133.69 ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? -45.754  27.377  402.309 1.00 134.27 ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? -45.143  28.114  401.117 1.00 133.96 ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? -44.314  27.539  400.396 1.00 133.46 ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? -45.002  26.064  402.597 1.00 135.44 ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? -45.146  25.683  404.063 1.00 135.21 ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? -45.528  24.937  401.719 1.00 136.69 ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? -45.507  29.386  400.870 1.00 133.30 ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? -44.912  30.125  399.743 1.00 129.65 ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? -43.484  30.591  400.004 1.00 125.53 ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? -42.657  30.654  399.085 1.00 122.17 ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? -45.860  31.322  399.570 1.00 130.57 ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? -47.088  30.993  400.382 1.00 132.09 ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? -46.587  30.155  401.509 1.00 133.36 ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? -43.191  30.948  401.257 1.00 124.60 ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? -41.879  31.498  401.587 1.00 123.40 ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? -40.756  30.514  401.282 1.00 118.97 ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? -39.631  30.933  400.992 1.00 120.18 ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? -41.847  31.945  403.047 1.00 127.47 ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? -42.667  33.170  403.312 1.00 135.54 ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? -42.325  34.410  402.816 1.00 135.43 ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? -43.811  33.350  404.016 1.00 136.07 ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? -43.221  35.300  403.200 1.00 136.22 ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? -44.133  34.683  403.931 1.00 135.67 ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? -41.033  29.211  401.346 1.00 113.52 ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? -40.072  28.235  400.840 1.00 107.71 ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? -39.772  28.484  399.367 1.00 109.08 ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? -38.610  28.436  398.940 1.00 113.58 ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? -40.610  26.820  401.047 1.00 100.34 ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? -39.945  25.730  400.206 1.00 93.15  ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? -38.515  25.507  400.650 1.00 90.26  ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? -40.742  24.435  400.269 1.00 91.52  ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? -40.813  28.752  398.575 1.00 102.68 ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? -40.610  29.069  397.166 1.00 97.24  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? -39.801  30.346  396.996 1.00 91.48  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? -38.928  30.421  396.126 1.00 84.67  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? -41.953  29.190  396.450 1.00 93.52  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? -41.856  29.647  394.995 1.00 94.60  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? -41.101  28.625  394.165 1.00 95.52  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? -43.238  29.910  394.415 1.00 95.57  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? -40.080  31.367  397.812 1.00 97.39  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? -39.308  32.607  397.725 1.00 102.38 ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? -37.839  32.345  398.038 1.00 101.36 ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? -36.942  32.854  397.357 1.00 101.42 ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? -39.903  33.685  398.653 1.00 107.56 ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? -41.247  34.181  398.116 1.00 108.85 ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? -38.939  34.857  398.815 1.00 107.51 ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? -42.000  35.093  399.070 1.00 107.82 ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? -37.575  31.542  399.069 1.00 96.03  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? -36.205  31.197  399.433 1.00 91.59  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? -35.493  30.501  398.276 1.00 88.63  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? -34.372  30.873  397.896 1.00 84.68  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? -36.233  30.320  400.687 1.00 91.74  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? -34.912  30.137  401.409 1.00 92.35  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? -35.111  29.627  402.826 1.00 90.85  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? -36.278  29.430  403.222 1.00 91.84  ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? -34.114  29.429  403.546 1.00 94.36  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? -36.145  29.495  397.689 1.00 89.62  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? -35.532  28.773  396.584 1.00 92.33  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? -35.298  29.646  395.367 1.00 95.12  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? -34.276  29.521  394.684 1.00 88.89  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? -36.250  30.531  395.069 1.00 100.49 ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? -36.105  31.414  393.920 1.00 101.84 ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? -34.992  32.421  394.145 1.00 93.46  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? -34.272  32.771  393.210 1.00 84.85  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? -37.418  32.137  393.634 1.00 104.73 ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? -38.538  31.241  393.168 1.00 109.85 ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? -40.049  32.179  392.921 1.00 113.25 ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? -39.614  33.105  391.456 1.00 112.17 ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? -34.846  32.916  395.374 1.00 94.28  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? -33.725  33.798  395.676 1.00 99.44  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? -32.411  33.062  395.463 1.00 110.65 ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? -31.462  33.610  394.892 1.00 115.42 ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? -33.844  34.353  397.107 1.00 98.19  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? -35.042  35.296  397.216 1.00 99.72  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? -32.571  35.086  397.505 1.00 96.23  ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? -35.335  35.751  398.630 1.00 101.01 ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? -32.340  31.802  395.902 1.00 115.14 ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? -31.120  31.021  395.701 1.00 122.58 ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? -30.793  30.871  394.215 1.00 128.30 ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? -29.659  31.125  393.783 1.00 131.77 ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? -31.269  29.650  396.365 1.00 125.80 ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? -31.479  29.670  397.884 1.00 128.10 ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? -31.932  28.310  398.411 1.00 129.90 ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? -30.222  30.140  398.602 1.00 127.17 ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? -31.785  30.480  393.412 1.00 126.53 ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? -31.544  30.286  391.982 1.00 121.06 ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? -31.198  31.602  391.283 1.00 116.77 ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? -30.280  31.650  390.451 1.00 117.16 ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? -32.756  29.622  391.334 1.00 119.51 ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? -31.932  32.675  391.589 1.00 112.11 ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? -31.632  33.966  390.993 1.00 108.79 ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? -30.243  34.453  391.351 1.00 110.68 ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? -29.540  35.022  390.515 1.00 111.84 ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? -29.839  34.255  392.609 1.00 113.66 ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? -28.457  34.501  392.994 1.00 119.73 ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? -27.503  33.701  392.124 1.00 122.48 ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? -26.460  34.212  391.701 1.00 124.60 ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? -28.250  34.145  394.465 1.00 123.04 ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? -26.817  34.292  394.913 1.00 129.00 ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? -26.205  35.533  394.953 1.00 131.59 ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? -26.067  33.181  395.273 1.00 132.11 ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? -24.891  35.669  395.354 1.00 134.27 ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? -24.750  33.306  395.672 1.00 134.47 ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? -24.167  34.555  395.713 1.00 135.91 ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? -22.855  34.700  396.108 1.00 137.04 ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? -27.853  32.447  391.832 1.00 118.71 ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? -26.992  31.635  390.979 1.00 111.44 ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? -26.834  32.263  389.598 1.00 102.31 ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? -25.727  32.300  389.050 1.00 97.11  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? -27.540  30.214  390.869 1.00 112.88 ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? -27.924  32.761  389.019 1.00 101.14 ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? -27.888  33.294  387.658 1.00 99.15  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? -27.889  34.828  387.642 1.00 100.85 ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? -28.149  35.428  386.602 1.00 98.40  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? -29.032  32.734  386.797 1.00 94.93  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? -30.388  33.230  387.301 1.00 94.19  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? -28.988  31.212  386.773 1.00 91.55  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? -31.574  32.666  386.544 1.00 92.72  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? -27.596  35.470  388.776 1.00 108.46 ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? -27.500  36.934  388.855 1.00 117.11 ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? -28.771  37.614  388.348 1.00 119.08 ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? -28.725  38.678  387.726 1.00 115.34 ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? -26.283  37.481  388.101 1.00 122.83 ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? -24.903  37.214  388.694 1.00 128.04 ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? -24.243  35.954  388.165 1.00 133.96 ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? -22.808  35.991  388.442 1.00 138.26 ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? -22.006  34.932  388.445 1.00 140.50 ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? -22.486  33.726  388.189 1.00 143.02 ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? -20.715  35.086  388.706 1.00 138.96 ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? -29.919  37.009  388.625 1.00 124.18 ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? -31.196  37.570  388.208 1.00 126.24 ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? -31.727  38.471  389.317 1.00 124.97 ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? -32.025  37.998  390.419 1.00 128.42 ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? -32.195  36.461  387.884 1.00 126.00 ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? -31.848  39.767  389.021 1.00 115.18 ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? -32.267  40.733  390.026 1.00 104.42 ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? -33.776  40.778  390.208 1.00 101.28 ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? -34.242  41.250  391.247 1.00 106.28 ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? -31.765  42.138  389.678 1.00 102.74 ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? -32.660  42.747  388.743 1.00 106.32 ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? -30.373  42.078  389.065 1.00 100.47 ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? -34.554  40.330  389.225 1.00 94.34  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? -36.007  40.309  389.337 1.00 90.68  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? -36.514  38.999  388.752 1.00 90.08  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? -35.916  38.431  387.832 1.00 91.10  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? -36.669  41.522  388.626 1.00 87.13  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? -38.186  41.506  388.793 1.00 84.41  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? -36.109  42.838  389.154 1.00 89.49  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? -37.616  38.514  389.305 1.00 92.48  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? -38.242  37.304  388.812 1.00 95.13  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? -39.745  37.466  388.757 1.00 100.81 ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? -40.337  38.244  389.510 1.00 101.61 ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? -40.360  36.726  387.840 1.00 104.24 ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? -41.806  36.724  387.671 1.00 105.00 ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? -42.352  35.320  387.898 1.00 109.32 ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? -41.696  34.321  387.586 1.00 109.29 ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? -42.204  37.241  386.283 1.00 101.52 ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? -42.063  38.741  386.151 1.00 100.53 ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? -40.822  39.327  385.975 1.00 100.31 ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? -43.170  39.572  386.220 1.00 101.40 ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? -40.687  40.697  385.864 1.00 99.79  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? -43.042  40.946  386.109 1.00 102.04 ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? -41.797  41.500  385.931 1.00 100.97 ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? -41.650  42.863  385.819 1.00 102.31 ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? -43.560  35.253  388.449 1.00 112.38 ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? -44.240  33.993  388.723 1.00 114.53 ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? -45.560  33.997  387.971 1.00 115.03 ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? -46.411  34.866  388.201 1.00 114.81 ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? -44.475  33.781  390.225 1.00 114.46 ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? -43.155  33.859  390.991 1.00 116.09 ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? -45.155  32.445  390.467 1.00 113.23 ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? -43.276  33.458  392.440 1.00 117.32 ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? -45.733  33.028  387.080 1.00 117.41 ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? -46.945  32.894  386.279 1.00 121.33 ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? -47.842  31.849  386.928 1.00 123.17 ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? -47.622  30.646  386.774 1.00 123.65 ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? -46.592  32.512  384.847 1.00 125.41 ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? -47.774  32.387  383.910 1.00 129.27 ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? -48.492  31.203  383.821 1.00 132.21 ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? -48.170  33.451  383.117 1.00 131.14 ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? -49.570  31.083  382.969 1.00 135.83 ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? -49.250  33.340  382.263 1.00 133.92 ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? -49.945  32.156  382.192 1.00 137.83 ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? -51.020  32.046  381.339 1.00 142.22 ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? -48.871  32.313  387.632 1.00 124.43 ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? -49.849  31.444  388.275 1.00 126.09 ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? -51.075  31.351  387.377 1.00 111.95 ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? -51.444  32.324  386.705 1.00 108.74 ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? -50.210  31.955  389.685 1.00 139.93 ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? -48.949  32.339  390.451 1.00 144.66 ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? -51.166  33.140  389.625 1.00 143.61 ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? -51.685  30.171  387.328 1.00 102.81 ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? -52.831  29.968  386.457 1.00 97.79  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? -54.075  30.608  387.058 1.00 99.42  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? -54.199  30.753  388.277 1.00 100.06 ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? -53.091  28.482  386.220 1.00 93.95  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? -53.354  27.685  387.473 1.00 93.47  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? -53.784  26.284  387.102 1.00 89.59  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? -55.040  26.281  386.359 1.00 87.79  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? -55.608  25.190  385.859 1.00 86.67  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? -55.033  24.008  386.017 1.00 86.79  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? -56.748  25.281  385.193 1.00 86.82  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? -55.010  30.975  386.188 1.00 98.40  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? -56.176  31.734  386.597 1.00 93.28  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? -57.192  30.967  387.420 1.00 86.48  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? -58.280  31.480  387.700 1.00 85.92  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? -56.856  29.742  387.813 1.00 92.62  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? -57.720  28.945  388.670 1.00 104.39 ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? -57.271  28.927  390.125 1.00 112.10 ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? -58.022  28.444  390.981 1.00 110.34 ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? -57.795  27.506  388.147 1.00 107.78 ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? -58.830  27.304  387.067 1.00 111.05 ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? -58.359  27.809  385.726 1.00 117.33 ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? -57.130  27.865  385.516 1.00 120.46 ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? -59.213  28.156  384.886 1.00 120.13 ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? -56.078  29.431  390.429 1.00 121.43 ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? -55.590  29.490  391.806 1.00 132.73 ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? -55.718  30.939  392.261 1.00 142.73 ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? -54.791  31.736  392.114 1.00 145.13 ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? -54.146  29.002  391.905 1.00 133.97 ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? -53.945  27.522  391.642 1.00 133.03 ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? -54.986  26.731  391.194 1.00 130.70 ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? -52.710  26.919  391.839 1.00 132.33 ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? -54.811  25.388  390.946 1.00 129.51 ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? -52.526  25.567  391.593 1.00 130.52 ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? -53.584  24.809  391.147 1.00 130.68 ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? -53.430  23.466  390.897 1.00 134.28 ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? -56.874  31.283  392.830 1.00 146.62 ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? -57.012  32.606  393.423 1.00 146.15 ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? -56.714  32.596  394.911 1.00 146.65 ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? -56.219  33.594  395.442 1.00 149.25 ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? -58.410  33.186  393.194 1.00 142.49 ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? -58.454  34.664  393.565 1.00 138.62 ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? -59.830  35.277  393.501 1.00 137.00 ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? -59.775  36.723  393.694 1.00 135.24 ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? -59.644  37.318  394.876 1.00 134.05 ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? -59.548  36.595  395.983 1.00 132.23 ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? -59.606  38.642  394.948 1.00 135.02 ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? -57.018  31.496  395.599 1.00 143.93 ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? -56.563  31.354  396.975 1.00 141.35 ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? -55.049  31.480  397.041 1.00 136.46 ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? -54.511  32.286  397.809 1.00 136.19 ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? -57.018  30.011  397.547 1.00 145.26 ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? -56.417  29.673  398.895 1.00 146.99 ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? -57.343  28.750  399.659 1.00 144.82 ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? -58.519  29.459  400.148 1.00 141.16 ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? -59.635  28.859  400.548 1.00 136.17 ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? -59.729  27.538  400.510 1.00 132.62 ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? -60.658  29.582  400.978 1.00 136.70 ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? -54.348  30.702  396.213 1.00 133.67 ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? -52.895  30.798  396.134 1.00 133.60 ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? -52.444  32.182  395.684 1.00 136.92 ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? -51.406  32.672  396.138 1.00 139.20 ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? -52.356  29.725  395.189 1.00 130.85 ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? -53.210  32.830  394.803 1.00 134.42 ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? -52.839  34.162  394.331 1.00 129.63 ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? -52.876  35.182  395.465 1.00 124.93 ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? -51.952  35.991  395.618 1.00 121.77 ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? -53.764  34.590  393.192 1.00 130.11 ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? -53.951  35.170  396.257 1.00 126.27 ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? -54.044  36.071  397.401 1.00 129.59 ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? -52.982  35.748  398.443 1.00 133.27 ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? -52.385  36.661  399.027 1.00 132.87 ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? -55.443  36.005  398.015 1.00 130.14 ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? -56.495  36.667  397.145 1.00 129.90 ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? -56.124  37.493  396.285 1.00 130.31 ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? -57.693  36.367  397.325 1.00 128.94 ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? -52.730  34.457  398.689 1.00 137.88 ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? -51.664  34.079  399.614 1.00 140.74 ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? -50.327  34.637  399.153 1.00 143.28 ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? -49.552  35.165  399.958 1.00 147.08 ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? -51.573  32.557  399.740 1.00 138.55 ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? -52.838  31.872  400.211 1.00 133.69 ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? -52.866  31.653  401.705 1.00 127.09 ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? -53.633  30.458  402.031 1.00 122.10 ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? -54.921  30.469  402.353 1.00 120.91 ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? -55.587  31.616  402.391 1.00 118.32 ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? -55.544  29.334  402.634 1.00 122.94 ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? -50.051  34.542  397.852 1.00 140.74 ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? -48.769  34.986  397.324 1.00 140.53 ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? -48.641  36.501  397.377 1.00 141.29 ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? -47.586  37.024  397.753 1.00 143.13 ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? -48.603  34.481  395.893 1.00 141.73 ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? -47.987  33.089  395.796 1.00 146.67 ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? -47.770  32.686  394.347 1.00 147.85 ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? -46.682  33.060  396.566 1.00 150.26 ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? -49.695  37.222  396.989 1.00 139.57 ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? -49.656  38.678  397.077 1.00 136.00 ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? -49.462  39.139  398.517 1.00 131.58 ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? -48.652  40.037  398.787 1.00 129.46 ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? -50.933  39.273  396.487 1.00 136.34 ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? -50.790  40.717  396.054 1.00 138.30 ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? -50.194  40.850  394.669 1.00 141.68 ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? -49.016  41.251  394.563 1.00 143.10 ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? -50.902  40.555  393.684 1.00 142.94 ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? -50.174  38.515  399.461 1.00 128.83 ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? -50.012  38.877  400.863 1.00 124.10 ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? -48.602  38.577  401.349 1.00 113.63 ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? -47.988  39.403  402.030 1.00 111.62 ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? -51.043  38.149  401.725 1.00 129.19 ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? -51.033  38.591  403.181 1.00 134.00 ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? -52.152  37.973  403.995 1.00 140.22 ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? -52.987  37.236  403.469 1.00 144.75 ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? -52.178  38.275  405.287 1.00 140.09 ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? -48.068  37.404  401.002 1.00 106.58 ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? -46.734  37.030  401.456 1.00 102.16 ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? -45.672  37.963  400.891 1.00 102.19 ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? -44.729  38.339  401.596 1.00 104.62 ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? -46.435  35.583  401.068 1.00 100.50 ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? -45.804  38.344  399.618 1.00 100.44 ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? -44.811  39.221  399.006 1.00 98.38  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? -44.895  40.624  399.599 1.00 106.67 ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? -43.866  41.247  399.890 1.00 106.06 ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? -44.972  39.236  397.474 1.00 90.39  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? -44.677  37.852  396.892 1.00 85.63  ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? -44.052  40.266  396.852 1.00 88.95  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? -44.508  37.831  395.386 1.00 83.93  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? -46.113  41.139  399.807 1.00 112.82 ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? -46.248  42.434  400.471 1.00 114.61 ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? -45.659  42.393  401.874 1.00 120.18 ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? -44.977  43.333  402.297 1.00 119.06 ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? -47.715  42.862  400.529 1.00 110.01 ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? -48.319  43.303  399.207 1.00 106.69 ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? -49.608  44.075  399.457 1.00 106.23 ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? -50.286  44.480  398.163 1.00 105.50 ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? -51.245  43.440  397.713 1.00 105.57 ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? -45.919  41.310  402.610 1.00 124.62 ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? -45.380  41.152  403.957 1.00 126.35 ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? -43.857  41.165  403.948 1.00 124.76 ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? -43.226  41.912  404.705 1.00 125.34 ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? -45.907  39.853  404.568 1.00 130.34 ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? -47.373  39.900  404.977 1.00 134.02 ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? -47.857  38.581  405.546 1.00 136.41 ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? -47.873  38.434  406.785 1.00 136.98 ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? -48.218  37.690  404.750 1.00 136.88 ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? -43.248  40.322  403.110 1.00 122.07 ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? -41.793  40.232  403.078 1.00 119.19 ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? -41.171  41.550  402.637 1.00 117.33 ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? -40.102  41.934  403.126 1.00 116.36 ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? -41.358  39.094  402.156 1.00 118.02 ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? -41.827  42.260  401.715 1.00 115.65 ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? -41.309  43.550  401.274 1.00 111.58 ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? -41.407  44.589  402.386 1.00 110.07 ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? -40.491  45.398  402.570 1.00 110.01 ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? -42.046  44.013  400.017 1.00 106.10 ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? -41.238  43.796  398.742 1.00 100.25 ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? -41.938  44.331  397.506 1.00 97.99  ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? -42.425  43.271  396.630 1.00 98.84  ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? -42.875  43.480  395.397 1.00 104.34 ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? -42.900  44.709  394.901 1.00 106.82 ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? -43.297  42.465  394.657 1.00 105.10 ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? -42.517  44.591  403.128 1.00 108.94 ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? -42.676  45.533  404.231 1.00 112.37 ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? -41.647  45.269  405.323 1.00 116.30 ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? -41.012  46.200  405.831 1.00 113.27 ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? -44.097  45.450  404.789 1.00 113.58 ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? -41.468  44.004  405.700 1.00 126.95 ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? -40.497  43.665  406.733 1.00 139.83 ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? -39.062  43.720  406.230 1.00 147.62 ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? -38.140  43.457  407.010 1.00 149.07 ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? -40.761  42.265  407.295 1.00 146.24 ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? -42.010  42.116  408.143 1.00 149.51 ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? -42.015  40.750  408.818 1.00 149.96 ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? -43.239  40.498  409.568 1.00 151.37 ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? -43.512  39.354  410.185 1.00 152.22 ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? -42.640  38.356  410.153 1.00 153.12 ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? -44.652  39.210  410.848 1.00 152.03 ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? -38.850  44.052  404.960 1.00 136.53 ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? -37.506  44.236  404.455 1.00 140.58 ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? -36.787  42.976  404.034 1.00 140.69 ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? -35.552  42.966  404.014 1.00 141.64 ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? -37.513  41.905  403.703 1.00 138.01 ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? -36.869  40.675  403.255 1.00 135.16 ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? -36.686  40.621  401.744 1.00 131.92 ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? -35.857  39.841  401.262 1.00 127.49 ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? -37.666  39.456  403.736 1.00 134.74 ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? -37.573  39.245  405.235 1.00 133.06 ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? -36.541  38.502  405.790 1.00 131.19 ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? -38.512  39.796  406.095 1.00 130.60 ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? -36.447  38.314  407.161 1.00 129.09 ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? -38.426  39.611  407.467 1.00 128.17 ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? -37.392  38.869  407.992 1.00 127.49 ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? -37.306  38.686  409.354 1.00 126.60 ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? -37.428  41.437  400.998 1.00 134.68 ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? -37.238  41.638  399.563 1.00 137.95 ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? -37.139  43.143  399.343 1.00 147.72 ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? -38.145  43.852  399.441 1.00 152.03 ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? -38.385  41.037  398.749 1.00 131.02 ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? -38.723  39.557  398.933 1.00 125.48 ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? -39.726  39.111  397.885 1.00 124.75 ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? -37.469  38.711  398.848 1.00 123.98 ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? -35.945  43.632  399.045 1.00 148.42 ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? -35.709  45.055  399.090 1.00 147.82 ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? -34.537  45.511  398.256 1.00 147.42 ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? -34.064  44.796  397.371 1.00 139.96 ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? -34.086  46.734  398.555 1.00 154.50 ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? -33.034  47.389  397.784 1.00 154.89 ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? -31.793  46.512  397.690 1.00 156.32 ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? -31.401  46.072  396.605 1.00 158.84 ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? -32.682  48.723  398.447 1.00 148.98 ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? -33.879  49.567  398.844 1.00 143.64 ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? -34.641  50.083  397.644 1.00 141.91 ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? -35.847  50.892  398.085 1.00 142.41 ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? -35.450  52.092  398.870 1.00 144.77 ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? -31.160  46.255  398.828 1.00 152.37 ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? -29.997  45.384  398.910 1.00 146.60 ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? -30.259  44.392  400.028 1.00 143.20 ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? -30.519  44.793  401.167 1.00 140.77 ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? -28.714  46.181  399.159 1.00 145.25 ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? -28.317  47.036  397.967 1.00 144.22 ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? -27.404  46.691  397.217 1.00 143.50 ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? -29.007  48.156  397.785 1.00 144.13 ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? -30.192  43.105  399.710 1.00 143.73 ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? -30.638  42.071  400.631 1.00 142.52 ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? -29.502  41.720  401.579 1.00 140.33 ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? -28.433  41.279  401.142 1.00 140.84 ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? -31.109  40.836  399.863 1.00 140.50 ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? -32.293  41.084  398.928 1.00 139.98 ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? -32.812  39.784  398.336 1.00 138.01 ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? -33.390  41.810  399.677 1.00 141.99 ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? -29.733  41.943  402.873 1.00 136.26 ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? -28.846  41.488  403.940 1.00 130.06 ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? -27.477  42.160  403.864 1.00 128.22 ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? -26.479  41.618  404.341 1.00 130.57 ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? -28.716  39.963  403.910 1.00 125.14 ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? -30.021  39.261  403.647 1.00 123.86 ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? -31.156  39.586  404.368 1.00 123.55 ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? -30.124  38.312  402.646 1.00 125.41 ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? -32.363  38.957  404.116 1.00 124.17 ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? -31.331  37.681  402.391 1.00 126.51 ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? -32.448  38.005  403.126 1.00 125.74 ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? -27.419  43.349  403.263 1.00 121.69 ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? -26.195  44.110  403.176 1.00 116.45 ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? -25.379  43.879  401.922 1.00 113.69 ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? -24.613  44.765  401.529 1.00 117.37 ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? -25.522  42.722  401.279 1.00 110.30 ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? -24.729  42.423  400.098 1.00 112.85 ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? -25.213  43.244  398.904 1.00 115.55 ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? -26.296  43.838  398.914 1.00 111.31 ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? -24.782  40.928  399.775 1.00 115.35 ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? -23.651  40.572  398.971 1.00 115.53 ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? -26.057  40.577  399.025 1.00 117.48 ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? -24.389  43.257  397.855 1.00 123.41 ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? -24.630  44.068  396.668 1.00 128.17 ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? -25.672  43.464  395.742 1.00 117.98 ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? -25.815  43.929  394.606 1.00 119.53 ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? -23.325  44.255  395.893 1.00 136.83 ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? -22.732  42.937  395.435 1.00 142.05 ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? -22.841  41.944  396.185 1.00 142.66 ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? -22.170  42.888  394.322 1.00 143.91 ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? -26.389  42.441  396.191 1.00 105.95 ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? -27.395  41.803  395.362 1.00 98.71  ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? -28.731  42.493  395.595 1.00 93.97  ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? -28.968  43.087  396.650 1.00 95.20  ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? -27.492  40.306  395.680 1.00 99.05  ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? -28.422  39.542  394.772 1.00 97.02  ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? -27.995  39.112  393.528 1.00 93.92  ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? -29.714  39.238  395.166 1.00 98.75  ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? -28.838  38.406  392.691 1.00 92.47  ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? -30.560  38.529  394.328 1.00 97.34  ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? -30.120  38.117  393.092 1.00 94.44  ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? -29.603  42.415  394.599 1.00 89.98  ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? -30.938  42.973  394.713 1.00 91.42  ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? -31.927  41.974  394.141 1.00 91.56  ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? -31.614  41.242  393.199 1.00 93.39  ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? -31.061  44.319  393.988 1.00 100.52 ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? -30.222  45.293  394.584 1.00 108.12 ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? -33.131  41.960  394.702 1.00 94.08  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? -34.116  41.003  394.227 1.00 94.60  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? -35.510  41.440  394.638 1.00 103.57 ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? -35.711  42.025  395.705 1.00 111.43 ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? -33.837  39.588  394.745 1.00 83.97  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? -34.539  38.521  393.963 1.00 76.25  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? -34.036  38.098  392.749 1.00 64.63  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? -35.703  37.949  394.430 1.00 64.80  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? -34.679  37.123  392.017 1.00 64.61  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? -36.346  36.970  393.702 1.00 65.60  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? -35.834  36.560  392.494 1.00 64.69  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? -36.464  41.142  393.764 1.00 104.02 ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? -37.876  41.337  394.039 1.00 112.79 ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? -38.655  40.537  393.009 1.00 109.93 ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? -38.190  40.328  391.886 1.00 111.95 ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? -38.275  42.815  393.983 1.00 125.06 ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? -39.590  43.085  394.683 1.00 131.21 ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? -40.349  42.119  394.905 1.00 131.79 ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? -39.869  44.259  395.006 1.00 131.86 ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? -39.847  40.107  393.400 1.00 106.10 ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? -40.728  39.343  392.534 1.00 98.43  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? -41.971  40.157  392.216 1.00 99.75  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? -42.324  41.105  392.923 1.00 101.99 ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? -41.132  38.011  393.182 1.00 87.63  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? -40.029  36.983  393.426 1.00 72.32  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? -40.605  35.735  394.065 1.00 67.66  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? -39.356  36.639  392.117 1.00 65.03  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? -42.628  39.781  391.125 1.00 95.90  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? -43.895  40.389  390.754 1.00 96.20  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? -44.824  39.295  390.261 1.00 91.66  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? -44.413  38.422  389.490 1.00 83.73  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? -43.684  41.489  389.711 1.00 102.16 ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? -42.847  42.622  390.218 1.00 108.52 ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? -43.206  43.372  391.319 1.00 113.14 ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? -41.656  43.114  389.800 1.00 113.32 ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? -42.283  44.288  391.545 1.00 112.79 ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? -41.332  44.154  390.638 1.00 113.60 ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? -46.063  39.346  390.721 1.00 96.53  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? -47.042  38.284  390.536 1.00 102.55 ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? -47.783  38.505  389.227 1.00 113.80 ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? -47.954  39.638  388.767 1.00 116.01 ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? -48.008  38.237  391.741 1.00 101.14 ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? -48.817  36.947  391.744 1.00 106.34 ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? -47.239  38.406  393.046 1.00 96.86  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? -48.224  37.406  388.618 1.00 120.96 ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? -48.943  37.447  387.350 1.00 126.60 ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? -50.053  36.411  387.387 1.00 128.00 ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? -49.781  35.212  387.497 1.00 127.02 ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? -47.998  37.171  386.174 1.00 130.13 ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? -48.602  37.445  384.832 1.00 134.28 ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? -48.511  38.671  384.210 1.00 134.44 ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? -49.303  36.647  383.992 1.00 134.42 ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? -49.131  38.618  383.045 1.00 135.00 ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? -49.621  37.402  382.889 1.00 134.45 ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? -51.298  36.875  387.297 1.00 129.67 ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? -52.452  35.990  387.295 1.00 128.41 ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? -52.802  35.626  385.859 1.00 116.33 ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? -52.857  36.499  384.987 1.00 118.66 ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? -53.649  36.648  387.982 1.00 135.39 ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? -53.509  36.801  389.490 1.00 137.24 ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? -54.849  37.145  390.111 1.00 135.27 ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? -55.757  36.004  390.044 1.00 132.08 ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? -57.079  36.086  390.143 1.00 131.07 ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? -57.666  37.262  390.314 1.00 132.76 ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? -57.815  34.988  390.071 1.00 129.84 ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? -53.049  34.344  385.619 1.00 101.93 ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? -53.295  33.840  384.286 1.00 95.75  ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? -54.763  33.789  383.927 1.00 93.16  ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? -55.613  34.412  384.568 1.00 92.09  ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? -55.060  33.022  382.872 1.00 92.75  ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? -56.433  32.872  382.405 1.00 89.23  ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? -56.753  31.445  381.955 1.00 75.63  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? -57.692  31.247  381.171 1.00 67.19  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? -56.714  33.866  381.279 1.00 88.21  ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? -56.012  30.449  382.430 1.00 66.99  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? -56.377  29.069  382.185 1.00 66.88  ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? -56.181  28.571  380.767 1.00 66.84  ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? -57.156  28.355  380.041 1.00 66.99  ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? -54.926  28.397  380.353 1.00 66.62  ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? -54.605  27.781  379.068 1.00 75.28  ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? -53.446  26.818  379.274 1.00 84.95  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? -52.357  27.238  379.676 1.00 80.68  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? -54.251  28.832  378.013 1.00 66.53  ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? -53.693  25.530  379.006 1.00 93.87  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? -52.726  24.480  379.324 1.00 95.65  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? -51.367  24.744  378.688 1.00 93.78  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? -50.326  24.514  379.314 1.00 90.27  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? -53.272  23.119  378.884 1.00 103.01 ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? -52.296  21.966  379.013 1.00 117.40 ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? -51.462  21.849  380.115 1.00 125.87 ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? -52.206  20.999  378.025 1.00 124.81 ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? -50.566  20.801  380.226 1.00 131.58 ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? -51.313  19.946  378.130 1.00 129.67 ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? -50.496  19.853  379.231 1.00 131.24 ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? -49.608  18.808  379.335 1.00 129.48 ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? -51.354  25.241  377.449 1.00 99.97  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? -50.097  25.424  376.731 1.00 111.88 ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? -49.179  26.406  377.451 1.00 115.13 ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? -47.956  26.351  377.275 1.00 119.36 ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? -50.370  25.860  375.274 1.00 120.51 ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? -49.059  26.042  374.504 1.00 124.93 ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? -51.197  27.135  375.235 1.00 124.03 ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? -48.221  24.774  374.402 1.00 126.57 ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? -49.732  27.281  378.295 1.00 110.04 ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? -48.899  28.186  379.081 1.00 100.96 ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? -47.906  27.448  379.970 1.00 104.72 ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? -47.040  28.092  380.571 1.00 104.90 ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? -49.771  29.106  379.938 1.00 88.44  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? -50.941  30.113  379.008 1.00 78.43  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? -48.002  26.118  380.062 1.00 106.93 ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? -47.017  25.366  380.815 1.00 106.36 ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? -45.711  25.166  380.078 1.00 105.83 ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? -44.668  24.976  380.711 1.00 108.51 ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? -45.737  25.186  378.746 1.00 101.17 ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? -44.491  25.141  377.991 1.00 95.87  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? -43.739  26.448  378.202 1.00 105.46 ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? -44.320  27.531  378.086 1.00 108.26 ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? -44.754  24.904  376.503 1.00 84.57  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? -43.669  24.068  375.816 1.00 77.99  ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? -42.409  24.855  375.512 1.00 71.76  ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? -42.470  26.097  375.546 1.00 72.30  ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? -41.353  24.234  375.259 1.00 65.42  ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? -42.447  26.344  378.525 1.00 109.08 ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? -41.686  27.515  378.952 1.00 110.75 ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? -41.666  28.619  377.897 1.00 108.61 ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? -41.599  29.803  378.248 1.00 107.89 ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? -40.259  27.105  379.330 1.00 115.55 ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? -39.452  26.470  378.214 1.00 121.36 ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? -38.022  26.163  378.629 1.00 122.27 ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? -37.377  27.041  379.240 1.00 122.36 ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? -37.537  25.049  378.340 1.00 122.21 ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? -41.730  28.263  376.611 1.00 107.59 ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? -41.753  29.272  375.556 1.00 106.38 ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? -43.136  29.868  375.328 1.00 109.27 ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? -43.231  31.002  374.851 1.00 109.37 ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? -41.236  28.683  374.240 1.00 104.77 ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? -42.028  27.547  373.875 1.00 109.14 ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? -39.783  28.251  374.370 1.00 101.31 ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? -44.207  29.150  375.669 1.00 115.58 ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? -45.543  29.716  375.515 1.00 120.30 ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? -45.845  30.708  376.629 1.00 122.36 ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? -46.491  31.738  376.397 1.00 124.84 ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? -46.589  28.602  375.489 1.00 121.64 ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? -45.365  30.414  377.839 1.00 122.25 ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? -45.603  31.286  378.984 1.00 127.57 ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? -44.985  32.662  378.779 1.00 128.07 ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? -45.573  33.676  379.167 1.00 125.41 ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? -45.046  30.631  380.248 1.00 131.46 ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? -45.442  31.169  381.622 1.00 135.68 ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? -45.300  30.061  382.649 1.00 139.08 ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? -44.578  32.365  382.018 1.00 135.13 ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? -43.781  32.716  378.207 1.00 128.61 ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? -43.105  33.997  378.029 1.00 123.29 ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? -43.848  34.884  377.035 1.00 114.29 ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? -44.025  36.085  377.279 1.00 117.20 ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? -41.660  33.760  377.594 1.00 125.42 ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? -40.854  32.951  378.603 1.00 128.19 ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? -39.074  33.106  378.383 1.00 132.23 ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? -38.837  32.107  376.919 1.00 132.86 ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? -44.303  34.310  375.917 1.00 102.78 ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? -45.126  35.074  374.983 1.00 94.00  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? -46.435  35.503  375.632 1.00 89.74  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? -46.894  36.632  375.429 1.00 92.29  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? -45.388  34.268  373.709 1.00 86.77  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? -44.166  34.174  372.808 1.00 78.16  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? -43.242  34.979  372.909 1.00 71.29  ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? -44.170  33.204  371.905 1.00 80.19  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? -47.051  34.616  376.419 1.00 81.84  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? -48.289  34.972  377.105 1.00 79.15  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? -48.082  36.179  378.013 1.00 83.02  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? -48.824  37.165  377.938 1.00 85.68  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? -48.799  33.773  377.906 1.00 76.48  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? -50.054  34.041  378.510 1.00 76.94  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? -47.061  36.120  378.869 1.00 81.98  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? -46.819  37.193  379.832 1.00 79.87  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? -46.429  38.490  379.134 1.00 71.25  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? -46.841  39.573  379.556 1.00 65.98  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? -45.738  36.772  380.829 1.00 79.52  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? -45.449  37.740  381.980 1.00 80.10  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? -45.270  36.980  383.281 1.00 80.83  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? -44.220  38.598  381.696 1.00 81.23  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? -45.640  38.397  378.062 1.00 72.73  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? -45.208  39.580  377.324 1.00 78.06  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? -46.377  40.398  376.793 1.00 91.44  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? -46.197  41.573  376.454 1.00 96.09  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? -44.310  39.147  376.164 1.00 74.59  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? -43.212  40.114  375.786 1.00 72.04  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? -42.286  39.536  374.735 1.00 68.33  ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? -41.638  38.509  375.019 1.00 66.41  ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? -42.217  40.094  373.622 1.00 68.05  ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? -47.565  39.810  376.729 1.00 95.36  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? -48.710  40.416  376.087 1.00 97.77  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? -49.019  39.846  374.724 1.00 97.68  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? -49.849  40.415  374.005 1.00 94.48  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? -48.386  38.740  374.355 1.00 100.18 ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? -48.636  38.045  373.106 1.00 101.61 ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? -49.554  36.859  373.363 1.00 100.51 ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? -49.816  36.479  374.507 1.00 103.29 ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? -47.313  37.573  372.495 1.00 103.96 ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? -46.139  38.536  372.683 1.00 108.75 ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? -44.826  37.908  372.234 1.00 112.48 ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? -46.389  39.838  371.941 1.00 110.04 ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? -50.045  36.265  372.283 1.00 94.42  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? -50.688  34.974  372.426 1.00 90.17  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? -49.647  33.936  372.823 1.00 93.16  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? -48.480  34.012  372.430 1.00 92.29  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? -51.384  34.564  371.128 1.00 87.23  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? -52.672  35.316  370.842 1.00 87.35  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? -53.152  35.045  369.430 1.00 87.69  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? -54.366  34.238  369.433 1.00 86.27  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? -54.391  32.930  369.208 1.00 87.75  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? -53.264  32.274  368.968 1.00 85.86  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? -55.541  32.275  369.231 1.00 92.65  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? -50.076  32.961  373.624 1.00 97.03  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? -49.171  31.933  374.131 1.00 94.51  ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? -48.890  30.920  373.020 1.00 95.26  ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? -49.293  29.756  373.066 1.00 96.64  ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? -49.758  31.264  375.366 1.00 90.66  ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? -48.178  31.385  372.010 1.00 92.91  ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? -47.676  30.450  371.019 1.00 90.91  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? -46.221  30.165  371.327 1.00 98.22  ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? -45.435  31.111  371.483 1.00 105.31 ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? -47.815  31.012  369.603 1.00 84.95  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? -49.244  31.406  369.264 1.00 80.45  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? -50.180  31.062  369.982 1.00 73.67  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? -49.418  32.121  368.157 1.00 83.29  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? -45.832  28.899  371.452 1.00 99.08  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? -44.443  28.596  371.813 1.00 100.80 ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? -43.470  29.202  370.813 1.00 100.15 ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? -43.788  29.406  369.640 1.00 101.68 ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? -44.388  27.061  371.802 1.00 99.61  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? -45.706  26.593  371.276 1.00 96.56  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? -46.686  27.702  371.407 1.00 96.59  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? -42.272  29.495  371.299 1.00 97.28  ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? -41.260  30.156  370.498 1.00 97.95  ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? -40.398  29.126  369.783 1.00 95.52  ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? -40.554  27.915  369.949 1.00 99.21  ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? -40.394  31.062  371.370 1.00 101.67 ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? -41.172  32.056  372.196 1.00 106.29 ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? -40.245  33.054  372.856 1.00 109.73 ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? -40.935  34.298  373.167 1.00 114.60 ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? -40.398  35.294  373.861 1.00 122.15 ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? -39.162  35.187  374.328 1.00 124.32 ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? -41.098  36.395  374.091 1.00 126.45 ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? -39.476  29.618  368.967 1.00 88.90  ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? -38.497  28.753  368.333 1.00 82.24  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? -37.412  28.439  369.354 1.00 88.96  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? -36.759  29.351  369.874 1.00 87.34  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? -37.912  29.428  367.095 1.00 76.09  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? -37.183  28.527  366.100 1.00 79.63  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? -38.157  27.622  365.376 1.00 81.07  ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? -36.386  29.352  365.102 1.00 84.56  ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? -37.261  27.161  369.677 1.00 96.62  ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? -36.282  26.682  370.646 1.00 94.78  ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? -34.847  26.707  370.116 1.00 86.77  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? -33.919  26.851  370.922 1.00 85.96  ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? -36.658  25.280  371.134 1.00 93.30  ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? -36.775  25.195  372.653 1.00 87.59  ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? -37.790  24.149  373.075 1.00 83.86  ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? -37.964  24.124  374.583 1.00 76.80  ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? -39.040  23.180  374.990 1.00 70.33  ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? -34.604  26.511  368.815 1.00 78.18  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? -33.233  26.624  368.291 1.00 74.66  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? -32.519  27.875  368.781 1.00 79.04  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? -31.295  27.841  368.981 1.00 78.65  ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? -33.445  26.645  366.772 1.00 75.49  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? -34.644  25.773  366.572 1.00 77.41  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? -35.458  25.783  367.853 1.00 77.24  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? -33.227  29.017  368.977 1.00 86.97  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? -32.728  30.030  369.922 1.00 92.44  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? -33.121  29.661  371.345 1.00 104.13 ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? -34.303  29.681  371.702 1.00 107.60 ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? -33.418  31.322  369.452 1.00 82.03  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? -34.018  31.031  368.135 1.00 82.59  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? -34.277  29.568  368.102 1.00 86.38  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? -32.126  29.320  372.167 1.00 108.08 ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? -32.422  28.839  373.509 1.00 108.15 ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? -32.901  29.994  374.391 1.00 105.68 ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? -32.498  31.143  374.199 1.00 107.34 ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? -31.192  28.186  374.143 1.00 113.37 ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? -30.912  26.781  373.657 1.00 117.11 ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? -31.736  25.728  374.022 1.00 116.09 ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? -29.811  26.512  372.860 1.00 116.82 ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? -31.477  24.437  373.589 1.00 111.60 ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? -29.551  25.219  372.423 1.00 114.39 ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? -30.386  24.185  372.790 1.00 110.78 ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? -33.771  29.711  375.365 1.00 104.39 ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? -34.201  30.774  376.288 1.00 108.58 ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? -33.098  31.274  377.201 1.00 116.00 ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? -33.158  32.425  377.653 1.00 119.21 ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? -35.336  30.116  377.084 1.00 105.24 ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? -35.092  28.657  376.971 1.00 105.60 ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? -34.394  28.412  375.669 1.00 105.20 ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? -32.091  30.444  377.482 1.00 117.85 ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? -31.025  30.837  378.399 1.00 115.75 ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? -30.305  32.092  377.923 1.00 105.71 ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? -29.972  32.966  378.730 1.00 100.90 ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? -30.040  29.682  378.574 1.00 119.34 ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? -30.061  32.207  376.619 1.00 100.96 ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? -29.414  33.395  376.080 1.00 100.91 ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? -30.400  34.479  375.664 1.00 96.63  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? -29.990  35.633  375.500 1.00 105.59 ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? -28.534  33.030  374.877 1.00 109.52 ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? -27.658  31.806  375.085 1.00 120.33 ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? -28.178  30.590  374.344 1.00 129.84 ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? -28.824  30.711  373.304 1.00 135.77 ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? -27.904  29.407  374.883 1.00 129.75 ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? -31.683  34.148  375.491 1.00 82.01  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? -32.679  35.160  375.133 1.00 75.22  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? -34.058  34.664  375.569 1.00 70.19  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? -34.637  33.796  374.913 1.00 70.55  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? -32.645  35.459  373.642 1.00 74.74  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? -33.163  36.749  373.362 1.00 64.14  ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? -34.565  35.216  376.666 1.00 68.60  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? -35.896  34.881  377.134 1.00 64.37  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? -36.851  36.058  377.101 1.00 72.47  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? -36.986  36.726  376.072 1.00 75.96  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? -37.526  36.304  378.221 1.00 77.01  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? -38.431  37.439  378.376 1.00 82.04  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? -37.759  38.754  378.001 1.00 77.69  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? -36.723  39.115  378.566 1.00 73.13  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? -38.926  37.492  379.822 1.00 90.11  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? -40.402  37.798  380.050 1.00 97.95  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? -41.257  37.126  378.992 1.00 101.59 ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? -40.817  37.361  381.446 1.00 98.52  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? -38.375  39.477  377.062 1.00 79.89  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? -37.847  40.742  376.547 1.00 88.49  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? -36.355  40.642  376.246 1.00 92.51  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? -35.562  41.517  376.596 1.00 96.98  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? -38.134  41.898  377.505 1.00 96.24  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? -39.579  42.271  377.589 1.00 103.10 ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? -40.308  42.907  376.629 1.00 103.60 ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? -40.468  42.067  378.697 1.00 106.32 ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? -41.595  43.092  377.058 1.00 105.83 ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? -41.721  42.590  378.326 1.00 107.70 ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? -40.330  41.488  379.962 1.00 103.76 ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? -42.827  42.551  379.170 1.00 106.21 ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? -41.432  41.451  380.799 1.00 101.76 ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? -42.662  41.980  380.400 1.00 103.01 ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? -35.969  39.546  375.597 1.00 91.50  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? -34.589  39.334  375.233 1.00 91.26  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? -33.651  39.088  376.390 1.00 91.52  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? -32.480  38.768  376.154 1.00 94.72  ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? -34.115  39.219  377.633 1.00 87.78  ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? -33.211  39.025  378.751 1.00 91.69  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? -32.917  37.537  378.939 1.00 98.64  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? -33.735  36.685  378.586 1.00 102.35 ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? -33.814  39.601  380.030 1.00 94.32  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? -34.066  41.109  380.008 1.00 100.90 ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? -32.845  41.898  379.564 1.00 100.38 ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? -32.987  43.375  379.901 1.00 93.91  ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? -34.377  43.862  379.699 1.00 88.28  ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? -31.746  37.201  379.477 1.00 105.11 ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? -31.372  35.785  379.612 1.00 105.17 ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? -32.131  35.100  380.734 1.00 95.34  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? -31.626  34.988  381.854 1.00 87.18  ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? -29.866  35.845  379.902 1.00 114.81 ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? -29.437  37.209  379.445 1.00 116.57 ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? -30.604  38.095  379.726 1.00 111.29 ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? -33.344  34.640  380.452 1.00 97.81  ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? -34.226  34.139  381.495 1.00 105.98 ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? -34.063  32.639  381.686 1.00 115.92 ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? -33.674  31.911  380.770 1.00 119.70 ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? -35.688  34.451  381.171 1.00 106.47 ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? -36.111  33.667  380.050 1.00 105.28 ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? -35.851  35.913  380.843 1.00 110.63 ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? -34.371  32.185  382.899 1.00 121.91 ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? -34.338  30.774  383.251 1.00 125.21 ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? -35.578  30.460  384.072 1.00 121.57 ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? -35.989  31.255  384.921 1.00 120.74 ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? -33.066  30.415  384.035 1.00 129.63 ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? -31.928  30.560  383.182 1.00 133.29 ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? -33.115  28.980  384.542 1.00 128.96 ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? -36.178  29.305  383.800 1.00 116.98 ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? -37.414  28.878  384.438 1.00 110.29 ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? -37.167  27.536  385.105 1.00 108.18 ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? -36.442  26.691  384.570 1.00 107.02 ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? -38.572  28.781  383.422 1.00 105.43 ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? -38.686  30.082  382.628 1.00 103.58 ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? -39.885  28.468  384.121 1.00 104.22 ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? -39.285  29.929  381.252 1.00 104.38 ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? -37.762  27.344  386.277 1.00 110.98 ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? -37.704  26.065  386.961 1.00 116.91 ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? -39.065  25.777  387.574 1.00 117.08 ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? -39.857  26.685  387.836 1.00 118.02 ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? -36.610  26.039  388.037 1.00 122.65 ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? -35.263  25.603  387.491 1.00 126.13 ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? -34.257  26.292  387.658 1.00 124.75 ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? -35.237  24.448  386.837 1.00 128.48 ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? -39.325  24.494  387.808 1.00 115.30 ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? -40.592  24.088  388.396 1.00 112.38 ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? -40.641  24.466  389.872 1.00 109.77 ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? -39.609  24.574  390.541 1.00 109.61 ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? -40.791  22.582  388.225 1.00 110.07 ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? -42.187  22.134  388.585 1.00 107.64 ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? -42.386  21.405  389.555 1.00 105.96 ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? -43.168  22.581  387.814 1.00 108.06 ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? -41.864  24.678  390.371 1.00 104.82 ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? -42.046  25.120  391.752 1.00 96.43  ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? -41.405  24.128  392.706 1.00 80.43  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? -40.724  24.507  393.665 1.00 70.98  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? -43.543  25.304  392.066 1.00 101.99 ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? -43.740  25.710  393.523 1.00 101.86 ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? -44.178  26.309  391.120 1.00 105.07 ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? -41.612  22.839  392.450 1.00 77.91  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? -40.987  21.812  393.267 1.00 80.51  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? -39.469  21.915  393.206 1.00 77.27  ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? -38.790  21.736  394.220 1.00 72.73  ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? -41.451  20.437  392.803 1.00 85.41  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? -41.019  19.306  393.691 1.00 88.74  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? -40.934  18.020  392.925 1.00 91.89  ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? -41.759  17.831  392.008 1.00 93.35  ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? -40.034  17.213  393.223 1.00 93.70  ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? -38.922  22.219  392.025 1.00 78.24  ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? -37.473  22.329  391.868 1.00 78.42  ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? -36.918  23.490  392.686 1.00 76.57  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? -35.984  23.321  393.482 1.00 74.81  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? -37.128  22.505  390.386 1.00 80.90  ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? -37.985  21.681  389.588 1.00 83.11  ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? -35.684  22.126  390.107 1.00 82.83  ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? -37.490  24.681  392.496 1.00 79.91  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? -37.042  25.860  393.230 1.00 84.12  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? -37.194  25.666  394.732 1.00 78.66  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? -36.308  26.040  395.507 1.00 73.08  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? -37.826  27.084  392.758 1.00 90.56  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? -37.583  27.445  391.293 1.00 95.01  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? -38.468  28.597  390.854 1.00 97.69  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? -36.115  27.793  391.097 1.00 95.66  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? -38.306  25.069  395.159 1.00 76.50  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? -38.502  24.795  396.575 1.00 71.44  ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? -37.443  23.829  397.088 1.00 71.46  ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? -36.816  24.069  398.125 1.00 74.10  ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? -39.907  24.241  396.804 1.00 64.62  ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? -37.209  22.740  396.350 1.00 65.22  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? -36.254  21.720  396.756 1.00 65.26  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? -34.832  22.253  396.792 1.00 75.04  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? -33.970  21.639  397.427 1.00 73.77  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? -36.337  20.533  395.793 1.00 64.22  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? -37.586  19.874  395.896 1.00 64.33  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? -34.570  23.372  396.111 1.00 87.86  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? -33.256  24.005  396.217 1.00 94.76  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? -32.934  24.332  397.673 1.00 94.64  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? -31.787  24.192  398.114 1.00 97.73  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? -33.183  25.263  395.329 1.00 99.06  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? -31.861  25.989  395.534 1.00 99.64  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? -33.346  24.896  393.863 1.00 100.19 ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? -33.935  24.750  398.445 1.00 90.99  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? -33.690  25.235  399.805 1.00 89.10  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? -33.209  24.103  400.706 1.00 82.52  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? -32.187  24.279  401.376 1.00 80.40  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? -34.928  25.913  400.414 1.00 94.86  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? -34.618  26.409  401.821 1.00 96.97  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? -35.383  27.047  399.551 1.00 96.79  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? -33.895  22.953  400.798 1.00 78.95  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? -33.355  21.885  401.659 1.00 80.59  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? -31.968  21.440  401.244 1.00 70.97  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? -31.131  21.144  402.107 1.00 71.13  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? -34.378  20.748  401.516 1.00 85.27  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? -35.278  21.130  400.408 1.00 83.02  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? -35.231  22.605  400.284 1.00 80.25  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? -31.712  21.379  399.933 1.00 64.50  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? -30.401  20.981  399.427 1.00 72.54  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? -29.311  21.799  400.102 1.00 84.48  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? -28.365  21.256  400.683 1.00 89.97  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? -30.347  21.140  397.895 1.00 63.79  ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? -31.258  20.123  397.208 1.00 69.97  ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? -28.921  20.980  397.385 1.00 63.69  ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? -31.272  20.233  395.695 1.00 63.82  ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? -29.434  23.124  400.036 1.00 90.64  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? -28.421  23.998  400.604 1.00 89.69  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? -28.543  24.134  402.115 1.00 88.82  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? -27.557  24.467  402.773 1.00 83.32  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? -28.510  25.382  399.959 1.00 88.11  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? -28.505  25.363  398.448 1.00 92.49  ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? -27.291  24.227  397.767 1.00 102.68 ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? -25.770  24.937  398.382 1.00 105.69 ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? -29.720  23.858  402.675 1.00 95.33  ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? -29.966  24.099  404.093 1.00 105.48 ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? -29.248  23.080  404.964 1.00 117.11 ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? -28.354  23.429  405.743 1.00 122.75 ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? -31.472  24.081  404.365 1.00 105.70 ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? -31.853  24.258  405.825 1.00 104.81 ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? -33.354  24.203  406.038 1.00 101.53 ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? -34.003  23.301  405.473 1.00 97.39  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? -33.887  25.067  406.764 1.00 101.74 ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? -29.624  21.805  404.844 1.00 106.51 ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? -29.052  20.737  405.665 1.00 111.01 ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? -28.570  19.641  404.717 1.00 119.46 ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? -29.272  18.665  404.442 1.00 119.05 ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? -30.066  20.217  406.697 1.00 107.37 ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? -31.460  19.925  406.152 1.00 101.83 ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? -32.497  19.923  407.266 1.00 92.88  ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? -33.854  20.067  406.752 1.00 82.15  ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? -34.940  19.670  407.404 1.00 70.29  ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? -34.827  19.104  408.597 1.00 69.29  ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? -36.139  19.837  406.864 1.00 62.49  ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? -27.357  19.824  404.206 1.00 127.80 ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? -26.687  18.816  403.411 1.00 134.92 ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? -27.190  18.690  401.988 1.00 140.29 ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? -28.400  18.694  401.741 1.00 138.87 ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? -26.261  18.561  401.042 1.00 145.76 ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? -26.601  18.266  399.657 1.00 149.60 ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? -26.598  16.768  399.387 1.00 155.32 ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? -27.459  16.267  398.657 1.00 153.73 ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? -25.636  18.977  398.709 1.00 148.64 ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? -25.627  16.044  399.949 1.00 161.30 ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? -25.653  14.586  399.876 1.00 164.27 ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? -26.894  14.031  400.556 1.00 164.34 ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? -27.428  12.999  400.132 1.00 165.59 ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? -24.392  14.000  400.511 1.00 167.56 ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? -23.162  14.185  399.644 1.00 171.60 ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? -23.098  13.566  398.561 1.00 173.16 ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? -22.261  14.948  400.045 1.00 173.89 ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? -27.347  14.692  401.625 1.00 165.07 ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? -28.648  14.391  402.209 1.00 170.24 ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? -29.733  14.341  401.142 1.00 175.25 ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? -30.587  13.448  401.152 1.00 176.14 ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? -28.986  15.442  403.269 1.00 170.78 ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? -30.386  15.361  403.775 1.00 169.15 ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? -30.840  14.620  404.825 1.00 168.95 ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? -31.528  16.042  403.240 1.00 165.59 ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? -32.192  14.803  404.982 1.00 168.15 ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? -32.638  15.670  404.019 1.00 167.20 ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? -31.717  16.930  402.178 1.00 161.26 ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? -33.919  16.156  403.771 1.00 166.72 ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? -32.990  17.411  401.933 1.00 160.42 ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? -34.074  17.023  402.726 1.00 163.15 ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? -29.701  15.287  400.200 1.00 179.52 ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? -30.602  15.239  399.051 1.00 185.04 ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? -30.243  14.087  398.119 1.00 194.75 ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? -31.111  13.299  397.725 1.00 198.20 ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? -30.554  16.574  398.303 1.00 181.61 ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? -31.461  16.643  397.101 1.00 178.82 ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? -32.791  17.001  397.232 1.00 177.32 ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? -30.974  16.356  395.836 1.00 177.50 ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? -33.615  17.074  396.122 1.00 175.54 ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? -31.796  16.421  394.728 1.00 176.02 ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? -33.117  16.782  394.872 1.00 175.15 ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? -28.963  13.973  397.756 1.00 198.69 ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? -28.535  12.941  396.817 1.00 199.56 ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? -28.704  11.532  397.371 1.00 198.18 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? -28.713  10.573  396.592 1.00 195.69 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? -27.077  13.170  396.415 1.00 200.85 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? -28.840  11.382  398.690 1.00 199.08 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? -29.113  10.069  399.260 1.00 199.93 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? -30.557  9.637   399.022 1.00 196.04 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? -30.906  8.486   399.307 1.00 199.66 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? -28.772  10.078  400.757 1.00 203.88 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? -28.864  8.727   401.459 1.00 206.52 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? -28.481  8.802   402.923 1.00 207.52 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? -27.358  9.169   403.264 1.00 207.83 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? -29.414  8.443   403.798 1.00 207.90 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? -31.388  10.515  398.469 1.00 188.78 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? -32.774  10.205  398.145 1.00 183.41 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? -32.902  9.976   396.645 1.00 181.57 ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? -32.361  10.746  395.847 1.00 182.87 ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? -33.719  11.326  398.591 1.00 181.73 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? -34.135  11.258  400.050 1.00 180.83 ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? -35.049  12.686  400.669 1.00 178.20 ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? -33.709  13.736  401.211 1.00 177.23 ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? -33.598  8.909   396.272 1.00 178.97 ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? -33.886  8.608   394.885 1.00 175.83 ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? -32.942  7.571   394.295 1.00 172.80 ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? -31.953  7.151   394.902 1.00 173.96 ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? -33.265  7.169   393.066 1.00 169.01 ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? -32.582  6.074   392.388 1.00 166.42 ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? -31.316  6.607   391.708 1.00 164.08 ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? -30.903  7.750   391.921 1.00 166.02 ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? -33.544  5.395   391.411 1.00 166.32 ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? -34.851  5.349   391.995 1.00 166.78 ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? -33.119  3.954   391.138 1.00 166.68 ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? -30.684  5.778   390.872 1.00 160.16 ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? -29.371  6.097   390.321 1.00 158.33 ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? -29.392  7.284   389.367 1.00 148.89 ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? -28.346  7.909   389.161 1.00 147.08 ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? -28.797  4.874   389.601 1.00 165.82 ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? -27.280  4.852   389.514 1.00 172.61 ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? -26.772  3.918   388.433 1.00 177.50 ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? -27.290  2.786   388.329 1.00 178.99 ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? -25.855  4.316   387.685 1.00 179.38 ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? -30.542  7.607   388.774 1.00 143.12 ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? -30.655  8.776   387.914 1.00 138.97 ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? -31.679  9.797   388.384 1.00 137.63 ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? -31.659  10.931  387.894 1.00 135.66 ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? -31.008  8.360   386.478 1.00 134.11 ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? -29.818  7.992   385.615 1.00 127.69 ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? -30.090  8.209   384.142 1.00 121.57 ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? -30.955  7.559   383.556 1.00 120.33 ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? -29.351  9.128   383.534 1.00 118.42 ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? -32.550  9.448   389.325 1.00 137.93 ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? -33.598  10.338  389.816 1.00 138.84 ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? -33.290  10.632  391.279 1.00 140.73 ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? -33.792  9.953   392.176 1.00 141.67 ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? -34.985  9.710   389.643 1.00 138.48 ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? -35.320  9.574   388.272 1.00 138.89 ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? -32.476  11.654  391.518 1.00 141.85 ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? -31.988  11.947  392.856 1.00 143.89 ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? -32.978  12.836  393.601 1.00 144.55 ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? -33.776  13.561  393.003 1.00 145.08 ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? -30.620  12.630  392.796 1.00 144.55 ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? -29.557  11.858  392.026 1.00 146.13 ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? -29.220  10.532  392.691 1.00 148.05 ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? -28.130  9.801   391.920 1.00 147.42 ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? -27.890  8.427   392.437 1.00 146.33 ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? -32.919  12.767  394.926 1.00 144.04 ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? -33.761  13.600  395.759 1.00 140.58 ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? -35.135  13.013  395.999 1.00 138.58 ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? -35.436  11.860  395.680 1.00 138.97 ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? -35.986  13.844  396.585 1.00 139.06 ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? -37.368  13.491  396.865 1.00 146.06 ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? -38.282  14.089  395.805 1.00 149.98 ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? -37.862  14.878  394.957 1.00 150.62 ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? -37.776  13.995  398.249 1.00 152.33 ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? -37.845  15.506  398.323 1.00 157.53 ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? -36.227  16.233  398.008 1.00 162.67 ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? -36.527  17.965  398.350 1.00 163.60 ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? -39.555  13.707  395.871 1.00 153.21 ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? -40.552  14.125  394.902 1.00 152.36 ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? -41.899  14.175  395.606 1.00 150.19 ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? -42.165  13.395  396.524 1.00 148.88 ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? -40.605  13.163  393.704 1.00 150.26 ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? -41.720  13.440  392.706 1.00 146.09 ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? -41.496  14.749  391.977 1.00 143.01 ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? -42.534  14.978  390.888 1.00 142.14 ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? -43.910  15.038  391.455 1.00 143.30 ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? -42.748  15.094  395.167 1.00 150.27 ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? -44.125  15.154  395.645 1.00 151.91 ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? -44.964  14.277  394.726 1.00 153.21 ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? -45.344  14.693  393.630 1.00 157.34 ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? -44.630  16.590  395.681 1.00 150.24 ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? -44.276  17.512  396.849 1.00 148.32 ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? -42.837  17.367  397.300 1.00 149.25 ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? -44.550  18.939  396.432 1.00 146.28 ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? -45.230  13.048  395.160 1.00 147.61 ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? -46.102  12.163  394.409 1.00 141.48 ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? -47.551  12.535  394.685 1.00 135.69 ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? -47.885  13.075  395.743 1.00 134.55 ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? -45.867  10.704  394.808 1.00 145.82 ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? -44.565  10.098  394.322 1.00 152.29 ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? -43.356  10.439  394.907 1.00 155.97 ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? -44.553  9.161   393.299 1.00 156.24 ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? -42.167  9.880   394.472 1.00 158.58 ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? -43.370  8.595   392.859 1.00 159.10 ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? -42.181  8.959   393.448 1.00 159.85 ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? -41.003  8.398   393.010 1.00 160.95 ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? -48.417  12.264  393.716 1.00 133.79 ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? -49.839  12.480  393.927 1.00 135.03 ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? -50.613  11.426  393.157 1.00 132.88 ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? -50.177  10.959  392.103 1.00 132.72 ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? -50.286  13.887  393.504 1.00 140.53 ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? -50.090  14.213  392.032 1.00 145.91 ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? -48.667  14.600  391.691 1.00 150.41 ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? -47.784  14.562  392.542 1.00 153.02 ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? -48.437  14.979  390.440 1.00 151.09 ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? -51.766  11.054  393.699 1.00 131.04 ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? -52.601  10.024  393.098 1.00 129.12 ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? -54.052  10.483  393.146 1.00 132.12 ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? -54.477  11.176  394.077 1.00 131.23 ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? -52.416  8.650   393.783 1.00 125.52 ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? -53.138  7.557   392.994 1.00 124.80 ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? -52.905  8.691   395.222 1.00 124.73 ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? -53.084  6.197   393.641 1.00 127.52 ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? -54.809  10.089  392.123 1.00 136.51 ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? -56.214  10.441  392.003 1.00 137.28 ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? -57.005  9.253   391.471 1.00 138.17 ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? -56.480  8.399   390.744 1.00 138.76 ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? -56.410  11.655  391.085 1.00 135.80 ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? -55.560  11.585  389.954 1.00 135.87 ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? -58.280  9.216   391.849 1.00 136.59 ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? -59.181  8.146   391.494 1.00 135.88 ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? -60.051  7.741   392.668 1.00 135.43 ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? -60.068  8.399   393.713 1.00 134.02 ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? -60.800  6.645   392.514 1.00 135.15 ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? -61.673  6.142   393.600 1.00 135.67 ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? -60.917  5.315   394.635 1.00 137.95 ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? -61.127  4.110   394.804 1.00 137.19 ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? -62.712  5.312   392.830 1.00 132.22 ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? -62.484  5.605   391.358 1.00 130.04 ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? -61.043  5.936   391.250 1.00 131.63 ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? -60.017  5.967   395.368 1.00 138.69 ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? -59.240  5.304   396.407 1.00 136.66 ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? -59.595  5.945   397.743 1.00 135.15 ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? -60.142  7.049   397.804 1.00 134.74 ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? -57.719  5.371   396.132 1.00 135.88 ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? -57.151  6.703   396.554 1.00 136.59 ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? -56.989  4.228   396.814 1.00 135.76 ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? -59.288  5.227   398.827 1.00 134.92 ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? -59.753  5.650   400.145 1.00 135.61 ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? -59.135  6.982   400.551 1.00 136.65 ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? -59.835  7.874   401.039 1.00 134.56 ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? -59.463  4.579   401.197 1.00 134.51 ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? -59.900  5.010   402.592 1.00 133.25 ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? -59.961  3.856   403.572 1.00 132.01 ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? -60.372  4.347   404.951 1.00 131.10 ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? -61.496  5.318   404.876 1.00 130.14 ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? -57.820  7.130   400.389 1.00 139.13 ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? -57.129  8.385   400.691 1.00 140.68 ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? -56.224  8.777   399.527 1.00 142.09 ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? -55.015  8.511   399.536 1.00 143.07 ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? -56.364  8.285   402.016 1.00 140.15 ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? -55.406  7.105   402.163 1.00 139.02 ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? -54.840  7.050   403.578 1.00 139.26 ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? -55.710  6.315   404.492 1.00 141.38 ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? -55.586  5.019   404.764 1.00 145.88 ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? -54.618  4.312   404.201 1.00 147.86 ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? -56.426  4.431   405.606 1.00 147.11 ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? -56.783  9.415   398.501 1.00 142.35 ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? -55.964  9.947   397.409 1.00 144.49 ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? -55.258  11.226  397.837 1.00 150.72 ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? -55.489  11.761  398.921 1.00 155.31 ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? -56.988  10.232  396.306 1.00 142.55 ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? -58.243  10.525  397.052 1.00 141.47 ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? -58.220  9.660   398.286 1.00 141.93 ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? -54.377  11.714  396.966 1.00 151.74 ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? -53.801  13.015  397.242 1.00 152.29 ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? -52.309  13.183  397.051 1.00 152.31 ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? -51.705  12.533  396.193 1.00 152.35 ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? -51.714  14.060  397.863 1.00 149.80 ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? -50.313  14.452  397.753 1.00 141.99 ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? -49.517  13.799  398.875 1.00 131.97 ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? -50.000  13.689  400.008 1.00 131.56 ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? -50.170  15.986  397.811 1.00 141.04 ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? -48.753  16.411  397.459 1.00 140.80 ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? -51.202  16.667  396.915 1.00 138.98 ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? -48.286  13.386  398.564 1.00 122.86 ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? -47.393  12.769  399.540 1.00 120.78 ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? -45.955  13.074  399.144 1.00 114.44 ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? -45.537  12.759  398.026 1.00 110.81 ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? -47.624  11.256  399.628 1.00 130.69 ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? -49.035  10.883  400.032 1.00 140.23 ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? -49.422  10.885  401.365 1.00 143.08 ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? -49.984  10.538  399.079 1.00 143.09 ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? -50.716  10.554  401.738 1.00 143.00 ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? -51.277  10.205  399.443 1.00 143.31 ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? -51.638  10.214  400.773 1.00 142.59 ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? -52.924  9.879   401.129 1.00 140.97 ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? -45.205  13.687  400.055 1.00 118.21 ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? -43.799  14.025  399.836 1.00 124.23 ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? -42.951  12.799  400.149 1.00 125.82 ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? -42.730  12.469  401.317 1.00 124.14 ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? -43.398  15.204  400.714 1.00 127.86 ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? -42.008  15.749  400.458 1.00 126.75 ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? -41.609  16.779  401.490 1.00 122.74 ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? -42.512  17.336  402.147 1.00 121.68 ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? -40.398  17.041  401.643 1.00 120.07 ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? -42.468  12.111  399.115 1.00 130.36 ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? -41.792  10.836  399.302 1.00 137.14 ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? -40.542  10.756  398.438 1.00 145.49 ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? -40.445  11.438  397.412 1.00 145.50 ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? -42.723  9.661   398.959 1.00 134.70 ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? -44.091  9.697   399.642 1.00 134.76 ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? -45.079  8.737   398.985 1.00 134.06 ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? -43.946  9.422   401.127 1.00 136.79 ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? -39.566  9.942   398.833 1.00 153.69 ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? -38.398  9.717   397.975 1.00 156.47 ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? -38.762  8.938   396.718 1.00 155.33 ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? -39.797  8.273   396.635 1.00 155.56 ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? -37.442  8.921   398.872 1.00 160.85 ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? -38.316  8.316   399.920 1.00 161.82 ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? -39.407  9.314   400.155 1.00 158.72 ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? -37.880  9.037   395.727 1.00 155.03 ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? -38.095  8.413   394.426 1.00 154.10 ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? -37.690  6.941   394.442 1.00 148.31 ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? -36.607  6.594   394.922 1.00 150.00 ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? -37.295  9.163   393.360 1.00 157.30 ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? -37.925  9.176   391.982 1.00 158.13 ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? -39.092  10.541  391.829 1.00 156.66 ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? -37.989  11.884  391.396 1.00 154.46 ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? -38.556  6.078   393.910 1.00 139.77 ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? -38.215  4.673   393.784 1.00 133.38 ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? -39.189  3.670   394.372 1.00 132.10 ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? -39.013  2.463   394.180 1.00 132.72 ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? -40.209  4.140   395.087 1.00 132.98 ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? -41.194  3.232   395.666 1.00 134.28 ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? -41.956  2.493   394.573 1.00 139.55 ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? -42.249  3.049   393.513 1.00 140.85 ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? -42.185  3.996   396.550 1.00 129.54 ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? -43.080  4.750   395.725 1.00 124.80 ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? -41.450  4.943   397.487 1.00 129.47 ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? -42.279  1.230   394.836 1.00 140.38 ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? -43.064  0.463   393.883 1.00 138.48 ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? -44.520  0.918   393.923 1.00 141.72 ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? -44.991  1.501   394.903 1.00 143.11 ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? -42.974  -1.037  394.178 1.00 132.28 ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? -43.475  -1.298  395.494 1.00 130.13 ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? -41.534  -1.520  394.081 1.00 130.73 ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? -45.232  0.657   392.824 1.00 144.48 ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? -46.617  1.103   392.720 1.00 147.60 ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? -47.485  0.437   393.778 1.00 146.37 ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? -48.401  1.061   394.326 1.00 146.58 ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? -47.161  0.819   391.317 1.00 152.58 ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? -46.325  1.409   390.212 1.00 154.24 ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? -45.182  0.768   389.769 1.00 155.39 ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? -46.674  2.616   389.629 1.00 151.19 ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? -44.410  1.309   388.763 1.00 153.19 ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? -45.903  3.161   388.621 1.00 149.69 ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? -44.770  2.506   388.189 1.00 150.81 ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? -47.212  -0.835  394.072 1.00 144.95 ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? -47.972  -1.552  395.088 1.00 144.96 ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? -47.906  -0.827  396.425 1.00 140.46 ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? -48.933  -0.597  397.075 1.00 136.94 ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? -47.436  -2.977  395.220 1.00 150.01 ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? -48.190  -3.858  396.197 1.00 150.19 ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? -47.398  -5.123  396.485 1.00 148.42 ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? -46.978  -5.778  395.251 1.00 145.17 ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? -47.765  -6.554  394.515 1.00 142.90 ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? -49.016  -6.779  394.892 1.00 141.05 ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? -47.302  -7.107  393.404 1.00 143.78 ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? -46.694  -0.471  396.855 1.00 142.08 ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? -46.524  0.269   398.100 1.00 145.64 ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? -47.282  1.590   398.075 1.00 143.51 ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? -47.982  1.933   399.034 1.00 145.45 ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? -45.039  0.522   398.357 1.00 150.11 ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? -44.780  1.594   399.404 1.00 153.39 ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? -43.308  1.775   399.711 1.00 154.56 ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? -42.514  0.865   399.392 1.00 153.86 ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? -42.945  2.833   400.268 1.00 154.33 ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? -47.155  2.348   396.983 1.00 138.49 ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? -47.815  3.649   396.906 1.00 138.23 ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? -49.328  3.515   397.024 1.00 141.49 ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? -49.968  4.234   397.798 1.00 139.24 ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? -47.432  4.360   395.607 1.00 139.61 ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? -47.461  5.897   395.605 1.00 144.55 ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? -46.818  6.437   394.344 1.00 146.92 ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? -48.868  6.474   395.749 1.00 145.26 ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? -49.921  2.599   396.259 1.00 149.69 ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? -51.377  2.496   396.236 1.00 157.99 ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? -51.902  1.913   397.543 1.00 159.10 ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? -52.895  2.397   398.098 1.00 159.85 ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? -51.840  1.680   395.016 1.00 165.52 ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? -51.277  2.287   393.729 1.00 167.83 ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? -53.358  1.626   394.955 1.00 167.67 ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? -51.064  1.285   392.618 1.00 169.91 ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? -51.249  0.874   398.062 1.00 157.77 ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? -51.786  0.139   399.203 1.00 154.34 ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? -51.387  0.779   400.531 1.00 149.02 ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? -52.251  1.154   401.329 1.00 148.35 ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? -51.332  -1.324  399.136 1.00 156.35 ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? -52.093  -2.126  398.106 1.00 156.97 ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? -53.437  -2.424  398.282 1.00 157.10 ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? -51.472  -2.571  396.948 1.00 156.69 ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? -54.138  -3.149  397.336 1.00 157.24 ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? -52.165  -3.297  395.999 1.00 156.61 ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? -53.497  -3.582  396.197 1.00 156.95 ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? -54.191  -4.304  395.253 1.00 156.81 ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? -50.082  0.904   400.781 1.00 144.55 ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? -49.615  1.506   402.026 1.00 141.60 ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? -50.087  2.949   402.155 1.00 136.78 ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? -50.628  3.349   403.194 1.00 135.90 ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? -48.088  1.440   402.100 1.00 144.53 ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? -47.509  0.040   402.170 1.00 149.67 ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? -47.432  -0.485  403.589 1.00 154.85 ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? -48.470  -0.486  404.285 1.00 156.20 ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? -46.329  -0.887  404.014 1.00 156.67 ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? -49.899  3.744   401.103 1.00 133.73 ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? -50.124  5.186   401.162 1.00 131.80 ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? -51.566  5.552   400.819 1.00 128.54 ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? -52.270  6.151   401.636 1.00 129.24 ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? -49.136  5.888   400.227 1.00 134.44 ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? -47.718  5.556   400.551 1.00 140.23 ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? -46.942  4.605   399.960 1.00 141.96 ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? -46.905  6.173   401.551 1.00 143.02 ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? -45.694  4.589   400.531 1.00 143.03 ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? -45.646  5.544   401.511 1.00 144.24 ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? -47.118  7.196   402.477 1.00 143.07 ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? -44.607  5.906   402.361 1.00 144.76 ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? -46.086  7.552   403.319 1.00 143.21 ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? -44.848  6.909   403.256 1.00 143.91 ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? -52.022  5.193   399.619 1.00 127.33 ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? -53.373  5.558   399.211 1.00 129.40 ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? -54.439  4.710   399.889 1.00 130.94 ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? -55.630  4.996   399.726 1.00 129.19 ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? -53.511  5.453   397.692 1.00 130.43 ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? -54.047  3.681   400.636 1.00 134.43 ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? -54.992  2.870   401.371 1.00 137.37 ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? -55.640  1.761   400.581 1.00 140.13 ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? -56.584  1.138   401.081 1.00 140.89 ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? -55.168  1.493   399.368 1.00 141.10 ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? -55.695  0.420   398.562 1.00 138.83 ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? -56.991  0.807   397.880 1.00 132.67 ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? -57.746  1.656   398.363 1.00 133.78 ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? -57.282  0.174   396.748 1.00 126.10 ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? -58.471  0.547   395.974 1.00 126.57 ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? -59.763  0.240   396.715 1.00 129.20 ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? -59.803  -0.530  397.677 1.00 131.72 ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? -58.354  -0.307  394.706 1.00 127.39 ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? -56.910  -0.707  394.639 1.00 127.60 ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? -56.462  -0.835  396.057 1.00 125.65 ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? -60.837  0.870   396.241 1.00 130.31 ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? -62.189  0.527   396.660 1.00 132.76 ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? -62.919  -0.309  395.623 1.00 134.58 ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? -63.899  -0.980  395.965 1.00 132.47 ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? -63.010  1.795   396.932 1.00 133.21 ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? -62.377  2.906   397.768 1.00 132.22 ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? -63.076  4.227   397.495 1.00 129.79 ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? -62.454  2.562   399.246 1.00 133.16 ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? -62.459  -0.282  394.373 1.00 138.59 ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? -63.042  -1.041  393.276 1.00 142.05 ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? -61.903  -1.567  392.407 1.00 140.86 ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? -60.755  -1.134  392.577 1.00 133.73 ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? -64.012  -0.165  392.477 1.00 145.27 ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? -65.114  0.471   393.318 1.00 151.46 ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? -66.298  -0.449  393.540 1.00 158.42 ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? -66.702  -1.150  392.590 1.00 161.13 ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? -66.825  -0.475  394.673 1.00 159.87 ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? -62.157  -2.493  391.480 1.00 145.70 ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? -61.070  -2.977  390.614 1.00 144.33 ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? -60.602  -1.896  389.650 1.00 138.31 ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? -61.410  -1.200  389.032 1.00 134.95 ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? -61.702  -4.162  389.871 1.00 144.45 ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? -62.907  -4.531  390.678 1.00 144.90 ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? -63.400  -3.254  391.264 1.00 146.93 ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? -59.283  -1.758  389.531 1.00 135.25 ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? -58.657  -0.807  388.621 1.00 132.12 ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? -58.194  -1.575  387.392 1.00 134.91 ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? -57.577  -2.640  387.517 1.00 140.78 ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? -57.479  -0.081  389.299 1.00 130.29 ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? -57.935  1.237   389.930 1.00 135.44 ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? -56.346  0.182   388.315 1.00 124.60 ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? -58.897  1.079   391.088 1.00 139.04 ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? -58.506  -1.054  386.202 1.00 132.84 ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? -58.068  -1.715  384.979 1.00 134.17 ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? -56.725  -1.207  384.489 1.00 134.28 ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? -56.019  -1.941  383.789 1.00 135.95 ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? -59.084  -1.530  383.845 1.00 134.65 ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? -59.170  -0.114  383.302 1.00 133.18 ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? -60.219  0.035   382.220 1.00 129.54 ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? -60.459  -0.884  381.437 1.00 127.49 ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? -60.842  1.202   382.162 1.00 129.33 ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? -56.353  0.020   384.844 1.00 131.78 ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? -55.082  0.567   384.397 1.00 130.06 ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? -54.702  1.740   385.286 1.00 126.44 ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? -55.505  2.243   386.074 1.00 127.34 ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? -55.142  1.000   382.930 1.00 130.70 ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? -53.454  2.172   385.140 1.00 120.84 ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? -52.912  3.279   385.913 1.00 112.85 ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? -52.130  4.171   384.961 1.00 94.67  ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? -51.380  3.680   384.112 1.00 89.61  ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? -52.034  2.776   387.081 1.00 120.68 ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? -50.968  1.788   386.590 1.00 124.21 ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? -52.894  2.119   388.156 1.00 120.44 ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? -49.577  2.377   386.447 1.00 123.53 ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? -52.320  5.480   385.088 1.00 86.52  ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? -51.536  6.449   384.330 1.00 83.64  ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? -50.533  7.047   385.307 1.00 86.31  ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? -50.906  7.914   386.112 1.00 89.58  ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? -52.432  7.519   383.685 1.00 77.67  ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? -53.490  6.865   382.796 1.00 74.14  ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? -51.602  8.445   382.839 1.00 74.60  ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? -54.495  7.834   382.209 1.00 68.47  ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? -49.278  6.559   385.317 1.00 88.82  ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? -48.332  6.920   386.386 1.00 98.43  ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? -47.882  8.374   386.418 1.00 110.26 ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? -48.091  9.065   387.418 1.00 117.17 ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? -47.134  5.997   386.113 1.00 94.34  ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? -47.266  5.597   384.680 1.00 88.61  ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? -48.731  5.536   384.411 1.00 86.88  ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? -47.264  8.853   385.340 1.00 112.35 ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? -46.536  10.106  385.418 1.00 111.31 ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? -47.416  11.338  385.454 1.00 109.99 ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? -47.478  12.038  386.467 1.00 110.33 ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? -48.086  11.618  384.350 1.00 110.23 ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? -49.061  12.692  384.277 1.00 113.11 ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? -50.068  12.349  383.213 1.00 114.21 ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? -50.295  11.174  382.917 1.00 110.99 ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? -50.656  13.376  382.604 1.00 117.95 ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? -51.488  13.130  381.434 1.00 119.62 ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? -50.636  12.841  380.206 1.00 119.96 ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? -51.050  12.068  379.335 1.00 116.70 ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? -52.417  14.320  381.184 1.00 120.67 ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? -53.163  14.143  379.991 1.00 121.63 ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? -49.446  13.442  380.126 1.00 123.03 ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? -48.511  13.210  379.031 1.00 124.01 ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? -47.840  11.851  379.112 1.00 124.81 ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? -47.058  11.507  378.217 1.00 125.82 ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? -47.435  14.300  379.025 1.00 124.17 ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? -48.011  15.595  378.992 1.00 123.43 ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? -48.121  11.077  380.151 1.00 124.77 ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? -47.303  9.889   380.301 1.00 129.25 ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? -48.067  8.640   379.885 1.00 129.89 ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? -49.279  8.545   380.114 1.00 128.65 ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? -46.844  9.746   381.748 1.00 133.60 ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? -47.970  9.905   382.620 1.00 136.55 ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? -45.818  10.813  382.062 1.00 134.39 ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? -47.373  7.685   379.278 1.00 133.12 ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? -48.032  6.467   378.806 1.00 136.69 ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? -48.524  5.625   379.970 1.00 138.90 ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? -47.796  5.415   380.952 1.00 138.03 ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? -46.922  5.749   378.024 1.00 137.97 ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? -45.969  6.844   377.641 1.00 136.65 ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? -45.985  7.785   378.799 1.00 134.48 ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? -49.761  5.138   379.903 1.00 140.76 ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? -50.254  4.223   380.937 1.00 143.30 ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? -49.644  2.836   380.798 1.00 144.21 ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? -49.275  2.398   379.705 1.00 144.40 ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? -51.767  4.192   380.690 1.00 140.30 ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? -51.911  4.540   379.248 1.00 136.67 ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? -50.828  5.541   378.972 1.00 137.69 ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? -49.536  2.143   381.931 1.00 143.54 ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? -49.051  0.772   381.947 1.00 145.81 ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? -50.099  -0.155  382.551 1.00 149.20 ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? -50.941  0.286   383.340 1.00 148.49 ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? -47.736  0.653   382.728 1.00 147.38 ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? -46.580  1.429   382.099 1.00 148.37 ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? -45.324  1.296   382.943 1.00 150.91 ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? -46.342  0.965   380.669 1.00 146.79 ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? -50.082  -1.439  382.194 1.00 153.29 ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? -51.123  -2.355  382.675 1.00 156.09 ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? -51.058  -2.564  384.181 1.00 158.05 ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? -50.120  -2.158  384.870 1.00 160.70 ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? -50.827  -3.660  381.925 1.00 156.42 ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? -49.950  -3.261  380.782 1.00 154.84 ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? -49.145  -2.114  381.281 1.00 153.76 ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? -52.108  -3.208  384.691 1.00 156.86 ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? -52.202  -3.596  386.098 1.00 155.80 ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? -51.652  -5.007  386.279 1.00 159.28 ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? -52.374  -5.998  386.157 1.00 160.59 ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? -53.640  -3.497  386.590 1.00 151.45 ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? -53.750  -3.184  388.052 1.00 148.55 ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? -53.098  -2.086  388.586 1.00 147.99 ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? -54.482  -3.997  388.898 1.00 146.67 ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? -53.187  -1.796  389.933 1.00 147.15 ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? -54.572  -3.713  390.248 1.00 146.97 ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? -53.923  -2.610  390.764 1.00 147.27 ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? -50.359  -5.106  386.579 1.00 158.67 ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? -49.706  -6.392  386.787 1.00 157.52 ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? -48.957  -6.345  388.110 1.00 157.50 ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? -48.384  -5.313  388.469 1.00 160.55 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? -48.749  -6.735  385.637 1.00 155.50 ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? -49.445  -6.642  384.388 1.00 154.66 ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? -48.195  -8.143  385.792 1.00 156.11 ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? -48.970  -7.465  388.837 1.00 154.77 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? -48.261  -7.537  390.111 1.00 153.35 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? -46.775  -7.254  389.939 1.00 150.57 ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? -46.218  -6.374  390.603 1.00 148.78 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? -48.478  -8.909  390.748 1.00 157.93 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? -49.893  -9.131  391.235 1.00 162.97 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? -50.182  -8.361  392.505 1.00 168.76 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? -49.587  -8.696  393.550 1.00 171.85 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? -50.990  -7.410  392.456 1.00 169.60 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? -46.113  -7.989  389.043 1.00 152.09 ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? -44.711  -7.712  388.759 1.00 155.92 ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? -44.510  -6.313  388.190 1.00 161.23 ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? -43.408  -5.764  388.297 1.00 161.90 ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? -44.147  -8.769  387.809 1.00 153.44 ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? -42.637  -8.926  387.903 1.00 149.41 ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? -42.111  -10.037 387.022 1.00 145.67 ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? -41.935  -9.802  385.809 1.00 144.68 ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? -41.874  -11.146 387.543 1.00 144.39 ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? -45.549  -5.726  387.592 1.00 165.05 ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? -45.506  -4.320  387.202 1.00 168.71 ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? -45.837  -3.429  388.394 1.00 171.60 ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? -45.265  -2.347  388.553 1.00 169.71 ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? -46.442  -4.060  386.005 1.00 168.69 ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? -46.599  -2.567  385.751 1.00 168.72 ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? -45.908  -4.751  384.754 1.00 168.45 ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? -46.782  -3.848  389.238 1.00 175.76 ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? -46.998  -3.131  390.490 1.00 177.24 ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? -45.733  -3.121  391.334 1.00 176.20 ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? -45.465  -2.147  392.047 1.00 172.82 ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? -48.148  -3.763  391.274 1.00 181.12 ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? -49.560  -3.345  390.863 1.00 184.36 ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? -50.591  -4.302  391.442 1.00 187.11 ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? -49.841  -1.917  391.301 1.00 184.00 ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? -44.944  -4.192  391.257 1.00 178.47 ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? -43.669  -4.312  391.947 1.00 177.78 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? -42.519  -3.637  391.198 1.00 174.04 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? -41.352  -3.938  391.479 1.00 172.97 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? -43.349  -5.789  392.191 1.00 179.08 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? -44.246  -6.413  393.244 1.00 179.28 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? -44.164  -5.999  394.420 1.00 179.29 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? -45.034  -7.316  392.898 1.00 179.50 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? -42.817  -2.749  390.248 1.00 170.74 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? -41.860  -1.956  389.482 1.00 167.03 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? -41.548  -0.664  390.229 1.00 157.76 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? -42.456  -0.015  390.752 1.00 154.00 ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? -42.403  -1.620  388.092 1.00 170.28 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? -42.697  -2.829  387.379 1.00 173.07 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? -41.402  -0.796  387.288 1.00 169.71 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? -40.278  -0.277  390.325 1.00 154.87 ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? -39.952  1.012   390.947 1.00 154.89 ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? -40.237  2.159   389.987 1.00 152.98 ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? -39.811  2.142   388.831 1.00 151.92 ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? -38.452  0.897   391.253 1.00 157.09 ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? -38.081  -0.543  390.971 1.00 157.24 ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? -39.076  -1.054  389.992 1.00 155.24 ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? -40.983  3.145   390.472 1.00 151.45 ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? -41.268  4.345   389.697 1.00 148.61 ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? -39.999  5.173   389.542 1.00 147.53 ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? -39.443  5.655   390.534 1.00 143.65 ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? -42.358  5.164   390.379 1.00 148.10 ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? -43.465  4.332   390.978 1.00 150.45 ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? -44.598  5.348   391.931 1.00 153.98 ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? -45.574  6.088   390.626 1.00 154.36 ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? -39.534  5.333   388.307 1.00 151.12 ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? -38.329  6.110   388.061 1.00 152.92 ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? -38.329  6.591   386.618 1.00 150.29 ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? -39.150  6.174   385.797 1.00 149.79 ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? -37.066  5.296   388.351 1.00 156.24 ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? -36.848  4.340   387.330 1.00 158.47 ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? -37.378  7.479   386.322 1.00 146.53 ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? -37.202  8.019   384.980 1.00 142.38 ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? -36.692  6.983   383.992 1.00 140.04 ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? -36.704  7.243   382.785 1.00 139.94 ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? -36.227  9.193   385.023 1.00 141.12 ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? -36.784  10.448  385.651 1.00 140.32 ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? -38.098  10.512  386.082 1.00 140.61 ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? -35.986  11.566  385.828 1.00 139.61 ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? -38.603  11.658  386.664 1.00 141.09 ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? -36.481  12.715  386.408 1.00 139.37 ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? -37.790  12.757  386.822 1.00 140.11 ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? -38.283  13.904  387.400 1.00 139.70 ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? -36.245  5.830   384.472 1.00 137.20 ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? -35.594  4.815   383.657 1.00 134.04 ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? -36.329  3.487   383.674 1.00 134.21 ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? -36.450  2.839   382.632 1.00 132.15 ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? -34.157  4.618   384.144 1.00 132.85 ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? -34.032  4.711   385.652 1.00 134.34 ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? -32.667  5.171   386.100 1.00 137.58 ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? -31.686  4.936   385.365 1.00 139.77 ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? -32.575  5.752   387.199 1.00 138.71 ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? -36.800  3.048   384.843 1.00 139.21 ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? -37.577  1.816   384.911 1.00 147.63 ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? -38.873  1.955   384.125 1.00 148.08 ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? -39.319  1.006   383.469 1.00 148.95 ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? -37.839  1.444   386.369 1.00 152.79 ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? -36.588  1.281   387.176 1.00 153.24 ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? -35.830  2.353   387.597 1.00 152.35 ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? -35.950  0.172   387.620 1.00 153.04 ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? -34.786  1.913   388.275 1.00 152.75 ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? -34.835  0.593   388.303 1.00 153.37 ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? -39.489  3.137   384.173 1.00 147.20 ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? -40.640  3.396   383.320 1.00 149.85 ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? -40.212  3.552   381.868 1.00 157.46 ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? -40.981  3.220   380.959 1.00 158.50 ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? -41.389  4.636   383.809 1.00 145.66 ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? -42.328  4.394   384.994 1.00 141.22 ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? -42.388  5.594   385.912 1.00 139.10 ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? -43.720  4.055   384.496 1.00 138.33 ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? -38.992  4.045   381.638 1.00 163.35 ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? -38.467  4.189   380.282 1.00 166.82 ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? -38.511  2.861   379.532 1.00 168.23 ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? -39.023  2.785   378.411 1.00 168.18 ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? -37.039  4.742   380.335 1.00 168.05 ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? -36.137  4.333   379.179 1.00 169.86 ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? -36.380  5.147   377.926 1.00 173.20 ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? -36.835  6.288   377.990 1.00 174.50 ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? -36.076  4.560   376.773 1.00 174.15 ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? -37.978  1.796   380.140 1.00 169.01 ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? -37.865  0.513   379.454 1.00 168.64 ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? -39.209  -0.184  379.271 1.00 165.89 ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? -39.274  -1.182  378.546 1.00 167.90 ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? -36.906  -0.406  380.211 1.00 170.35 ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? -40.273  0.311   379.900 1.00 161.15 ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? -41.632  -0.131  379.621 1.00 158.86 ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? -42.345  0.806   378.654 1.00 160.62 ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? -43.570  0.727   378.508 1.00 159.21 ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? -42.425  -0.262  380.925 1.00 157.52 ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? -43.579  -1.262  380.879 1.00 158.40 ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? -43.119  -2.706  380.925 1.00 159.30 ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? -44.284  -3.648  380.646 1.00 156.89 ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? -43.847  -4.931  380.027 1.00 155.02 ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? -41.600  1.684   377.982 1.00 162.46 ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? -42.145  2.634   377.044 1.00 159.04 ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? -42.622  3.928   377.672 1.00 153.16 ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? -42.591  4.975   377.018 1.00 153.77 ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? -43.039  3.883   378.932 1.00 146.59 ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? -43.560  5.047   379.628 1.00 140.01 ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? -42.410  5.864   380.212 1.00 133.27 ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? -41.241  5.686   379.861 1.00 130.45 ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? -44.553  4.617   380.706 1.00 141.15 ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? -45.352  5.708   381.132 1.00 140.65 ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? -42.749  6.794   381.096 1.00 129.84 ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? -41.778  7.645   381.763 1.00 127.11 ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? -42.417  8.149   383.046 1.00 124.09 ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? -43.638  8.091   383.212 1.00 125.54 ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? -41.343  8.808   380.868 1.00 129.62 ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? -42.508  9.567   380.252 1.00 133.15 ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? -42.005  10.731  378.972 1.00 137.66 ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? -41.514  9.608   377.667 1.00 136.51 ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? -41.585  8.647   383.953 1.00 121.10 ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? -42.077  9.179   385.222 1.00 119.86 ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? -42.195  10.684  385.025 1.00 123.36 ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? -41.277  11.446  385.322 1.00 124.12 ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? -41.143  8.820   386.370 1.00 116.59 ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? -41.536  9.337   387.752 1.00 115.23 ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? -42.838  8.692   388.192 1.00 114.91 ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? -40.431  9.067   388.760 1.00 115.36 ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? -43.342  11.108  384.509 1.00 126.33 ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? -43.525  12.499  384.159 1.00 131.59 ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? -43.637  13.430  385.344 1.00 137.94 ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? -42.724  14.217  385.606 1.00 140.63 ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? -44.745  13.340  386.082 1.00 140.33 ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? -45.004  14.262  387.177 1.00 140.08 ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? -45.279  13.573  388.507 1.00 142.21 ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? -45.520  14.265  389.502 1.00 141.38 ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? -46.197  15.170  386.836 1.00 135.59 ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? -47.243  14.384  386.256 1.00 132.71 ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? -45.783  16.235  385.836 1.00 134.02 ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? -45.253  12.244  388.558 1.00 143.05 ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? -45.713  11.551  389.742 1.00 140.50 ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? -47.206  11.615  389.954 1.00 136.22 ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? -47.691  11.161  390.994 1.00 137.45 ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? -47.949  12.169  388.999 1.00 129.60 ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? -49.389  12.235  389.109 1.00 123.16 ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? -50.049  11.012  388.521 1.00 119.41 ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? -50.263  10.925  387.308 1.00 117.55 ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? -50.384  10.072  389.377 1.00 119.21 ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? -51.018  8.832   388.962 1.00 119.15 ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? -52.520  9.045   388.951 1.00 118.60 ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? -53.081  9.699   389.838 1.00 119.27 ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? -50.624  7.671   389.895 1.00 118.49 ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? -51.005  6.333   389.275 1.00 115.62 ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? -49.134  7.715   390.212 1.00 120.15 ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? -53.172  8.509   387.929 1.00 117.68 ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? -54.628  8.471   387.871 1.00 117.52 ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? -55.045  7.026   387.648 1.00 121.09 ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? -54.559  6.372   386.718 1.00 123.96 ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? -55.196  9.387   386.770 1.00 112.36 ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? -54.696  10.820  386.967 1.00 111.47 ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? -56.713  9.363   386.795 1.00 110.69 ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? -55.198  11.805  385.931 1.00 113.41 ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? -55.926  6.522   388.508 1.00 118.76 ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? -56.343  5.128   388.434 1.00 117.61 ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? -57.630  5.012   387.632 1.00 113.48 ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? -58.613  5.693   387.932 1.00 109.64 ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? -56.542  4.560   389.838 1.00 126.38 ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? -55.501  4.959   390.885 1.00 136.52 ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? -55.781  4.249   392.202 1.00 142.39 ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? -54.089  4.661   390.401 1.00 137.21 ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? -57.633  4.133   386.638 1.00 118.81 ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? -58.774  3.903   385.758 1.00 125.76 ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? -59.346  2.529   386.087 1.00 134.06 ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? -58.627  1.524   385.979 1.00 139.72 ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? -58.375  3.995   384.277 1.00 125.32 ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? -57.575  5.273   384.021 1.00 123.41 ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? -59.609  3.954   383.390 1.00 127.18 ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? -57.412  5.613   382.558 1.00 123.82 ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? -60.606  2.434   386.503 1.00 133.58 ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? -61.180  1.138   386.869 1.00 135.87 ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? -61.699  0.388   385.649 1.00 139.05 ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? -61.878  0.945   384.566 1.00 141.73 ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? -62.329  1.533   387.800 1.00 133.33 ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? -62.791  2.831   387.232 1.00 131.31 ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? -61.531  3.542   386.800 1.00 130.96 ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? -61.959  -0.906  385.858 1.00 136.38 ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? -62.529  -1.731  384.797 1.00 131.65 ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? -63.928  -1.275  384.412 1.00 130.98 ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? -64.360  -1.492  383.275 1.00 130.74 ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? -62.558  -3.197  385.228 1.00 129.06 ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? -61.190  -3.794  385.482 1.00 130.48 ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? -61.265  -5.123  386.191 1.00 136.44 ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? -62.254  -5.349  386.917 1.00 139.62 ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? -60.338  -5.942  386.022 1.00 139.56 ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? -64.649  -0.644  385.339 1.00 130.55 ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? -66.045  -0.307  385.097 1.00 129.40 ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? -66.214  0.713   383.978 1.00 130.49 ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? -67.307  0.813   383.411 1.00 129.27 ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? -66.693  0.201   386.384 1.00 126.98 ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? -68.192  -0.016  386.434 1.00 125.97 ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? -68.691  -0.113  387.860 1.00 127.12 ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? -68.245  1.006   388.679 1.00 129.68 ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? -69.006  2.049   388.989 1.00 130.22 ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? -70.252  2.120   388.543 1.00 129.46 ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? -68.521  3.022   389.747 1.00 129.77 ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? -65.162  1.449   383.630 1.00 132.12 ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? -65.176  2.364   382.495 1.00 131.40 ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? -64.097  1.914   381.523 1.00 130.29 ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? -62.951  1.685   381.924 1.00 130.91 ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? -64.944  3.824   382.927 1.00 129.67 ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? -64.903  4.736   381.710 1.00 126.76 ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? -66.026  4.275   383.892 1.00 130.81 ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? -64.463  1.790   380.252 1.00 125.94 ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? -63.546  1.260   379.255 1.00 120.00 ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? -62.470  2.286   378.918 1.00 111.99 ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? -62.685  3.498   379.009 1.00 102.08 ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? -64.303  0.860   377.989 1.00 119.21 ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? -63.437  0.286   377.026 1.00 119.32 ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? -61.293  1.775   378.545 1.00 115.08 ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? -60.176  2.634   378.160 1.00 114.78 ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? -60.578  3.683   377.132 1.00 113.18 ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? -60.100  4.822   377.185 1.00 114.89 ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? -59.026  1.789   377.614 1.00 116.16 ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? -57.930  1.522   378.616 1.00 117.30 ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? -57.135  3.084   379.037 1.00 116.26 ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? -56.170  2.617   380.465 1.00 118.97 ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? -61.427  3.312   376.172 1.00 110.47 ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? -61.780  4.239   375.101 1.00 108.92 ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? -62.401  5.509   375.667 1.00 108.84 ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? -62.120  6.606   375.187 1.00 108.78 ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? -62.700  3.557   374.071 1.00 111.46 ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? -63.267  4.582   373.097 1.00 104.70 ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? -61.932  2.488   373.315 1.00 119.25 ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? -63.237  5.390   376.701 1.00 110.13 ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? -63.846  6.580   377.299 1.00 107.77 ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? -62.799  7.474   377.967 1.00 102.22 ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? -62.831  8.707   377.827 1.00 97.35  ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? -64.921  6.146   378.297 1.00 105.83 ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? -65.695  7.308   378.873 1.00 100.47 ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? -66.334  8.047   378.098 1.00 96.66  ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? -65.684  7.465   380.108 1.00 98.95  ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? -61.840  6.866   378.668 1.00 98.95  ? 340 ALA 1 N     1 
ATOM   2635  C  CA    . ALA A  1  340 ? -60.787  7.638   379.321 1.00 92.40  ? 340 ALA 1 CA    1 
ATOM   2636  C  C     . ALA A  1  340 ? -59.926  8.371   378.299 1.00 84.96  ? 340 ALA 1 C     1 
ATOM   2637  O  O     . ALA A  1  340 ? -59.740  9.590   378.387 1.00 78.71  ? 340 ALA 1 O     1 
ATOM   2638  C  CB    . ALA A  1  340 ? -59.932  6.718   380.193 1.00 93.29  ? 340 ALA 1 CB    1 
ATOM   2639  N  N     . MET A  1  341 ? -59.387  7.636   377.320 1.00 86.66  ? 341 MET 1 N     1 
ATOM   2640  C  CA    . MET A  1  341 ? -58.578  8.263   376.278 1.00 87.20  ? 341 MET 1 CA    1 
ATOM   2641  C  C     . MET A  1  341 ? -59.408  9.224   375.444 1.00 92.42  ? 341 MET 1 C     1 
ATOM   2642  O  O     . MET A  1  341 ? -58.874  10.188  374.892 1.00 91.06  ? 341 MET 1 O     1 
ATOM   2643  C  CB    . MET A  1  341 ? -57.937  7.203   375.384 1.00 83.25  ? 341 MET 1 CB    1 
ATOM   2644  C  CG    . MET A  1  341 ? -57.431  5.989   376.124 1.00 82.79  ? 341 MET 1 CG    1 
ATOM   2645  S  SD    . MET A  1  341 ? -56.387  6.454   377.514 1.00 84.84  ? 341 MET 1 SD    1 
ATOM   2646  C  CE    . MET A  1  341 ? -54.906  7.012   376.677 1.00 82.20  ? 341 MET 1 CE    1 
ATOM   2647  N  N     . TRP A  1  342 ? -60.712  8.975   375.346 1.00 101.03 ? 342 TRP 1 N     1 
ATOM   2648  C  CA    . TRP A  1  342 ? -61.634  9.895   374.701 1.00 106.85 ? 342 TRP 1 CA    1 
ATOM   2649  C  C     . TRP A  1  342 ? -61.563  11.260  375.357 1.00 106.53 ? 342 TRP 1 C     1 
ATOM   2650  O  O     . TRP A  1  342 ? -61.308  12.277  374.698 1.00 100.32 ? 342 TRP 1 O     1 
ATOM   2651  C  CB    . TRP A  1  342 ? -63.052  9.336   374.814 1.00 109.21 ? 342 TRP 1 CB    1 
ATOM   2652  C  CG    . TRP A  1  342 ? -63.939  9.674   373.695 1.00 111.69 ? 342 TRP 1 CG    1 
ATOM   2653  C  CD1   . TRP A  1  342 ? -64.414  8.822   372.750 1.00 113.20 ? 342 TRP 1 CD1   1 
ATOM   2654  C  CD2   . TRP A  1  342 ? -64.433  10.972  373.355 1.00 112.75 ? 342 TRP 1 CD2   1 
ATOM   2655  N  NE1   . TRP A  1  342 ? -65.202  9.501   371.861 1.00 113.66 ? 342 TRP 1 NE1   1 
ATOM   2656  C  CE2   . TRP A  1  342 ? -65.223  10.826  372.205 1.00 112.08 ? 342 TRP 1 CE2   1 
ATOM   2657  C  CE3   . TRP A  1  342 ? -64.292  12.243  373.918 1.00 114.59 ? 342 TRP 1 CE3   1 
ATOM   2658  C  CZ2   . TRP A  1  342 ? -65.871  11.898  371.605 1.00 111.83 ? 342 TRP 1 CZ2   1 
ATOM   2659  C  CZ3   . TRP A  1  342 ? -64.933  13.305  373.319 1.00 116.10 ? 342 TRP 1 CZ3   1 
ATOM   2660  C  CH2   . TRP A  1  342 ? -65.714  13.128  372.175 1.00 115.56 ? 342 TRP 1 CH2   1 
ATOM   2661  N  N     . ASN A  1  343 ? -61.821  11.297  376.666 1.00 110.44 ? 343 ASN 1 N     1 
ATOM   2662  C  CA    . ASN A  1  343 ? -61.784  12.573  377.367 1.00 111.40 ? 343 ASN 1 CA    1 
ATOM   2663  C  C     . ASN A  1  343 ? -60.377  13.157  377.360 1.00 113.03 ? 343 ASN 1 C     1 
ATOM   2664  O  O     . ASN A  1  343 ? -60.215  14.380  377.295 1.00 115.91 ? 343 ASN 1 O     1 
ATOM   2665  C  CB    . ASN A  1  343 ? -62.306  12.423  378.796 1.00 109.61 ? 343 ASN 1 CB    1 
ATOM   2666  C  CG    . ASN A  1  343 ? -62.531  13.763  379.475 1.00 109.48 ? 343 ASN 1 CG    1 
ATOM   2667  O  OD1   . ASN A  1  343 ? -61.595  14.390  379.969 1.00 115.67 ? 343 ASN 1 OD1   1 
ATOM   2668  N  ND2   . ASN A  1  343 ? -63.777  14.216  379.481 1.00 103.85 ? 343 ASN 1 ND2   1 
ATOM   2669  N  N     . LEU A  1  344 ? -59.353  12.303  377.404 1.00 108.13 ? 344 LEU 1 N     1 
ATOM   2670  C  CA    . LEU A  1  344 ? -57.976  12.782  377.317 1.00 102.09 ? 344 LEU 1 CA    1 
ATOM   2671  C  C     . LEU A  1  344 ? -57.741  13.548  376.020 1.00 97.25  ? 344 LEU 1 C     1 
ATOM   2672  O  O     . LEU A  1  344 ? -57.241  14.680  376.030 1.00 97.23  ? 344 LEU 1 O     1 
ATOM   2673  C  CB    . LEU A  1  344 ? -57.008  11.601  377.418 1.00 102.94 ? 344 LEU 1 CB    1 
ATOM   2674  C  CG    . LEU A  1  344 ? -56.852  10.908  378.773 1.00 105.32 ? 344 LEU 1 CG    1 
ATOM   2675  C  CD1   . LEU A  1  344 ? -55.594  10.053  378.778 1.00 105.82 ? 344 LEU 1 CD1   1 
ATOM   2676  C  CD2   . LEU A  1  344 ? -56.817  11.931  379.896 1.00 106.47 ? 344 LEU 1 CD2   1 
ATOM   2677  N  N     . THR A  1  345 ? -58.104  12.940  374.888 1.00 95.74  ? 345 THR 1 N     1 
ATOM   2678  C  CA    . THR A  1  345 ? -57.865  13.561  373.592 1.00 99.20  ? 345 THR 1 CA    1 
ATOM   2679  C  C     . THR A  1  345 ? -58.733  14.796  373.409 1.00 105.31 ? 345 THR 1 C     1 
ATOM   2680  O  O     . THR A  1  345 ? -58.284  15.787  372.826 1.00 104.92 ? 345 THR 1 O     1 
ATOM   2681  C  CB    . THR A  1  345 ? -58.114  12.561  372.462 1.00 99.60  ? 345 THR 1 CB    1 
ATOM   2682  O  OG1   . THR A  1  345 ? -59.466  12.091  372.522 1.00 101.51 ? 345 THR 1 OG1   1 
ATOM   2683  C  CG2   . THR A  1  345 ? -57.154  11.381  372.550 1.00 99.51  ? 345 THR 1 CG2   1 
ATOM   2684  N  N     . ARG A  1  346 ? -59.975  14.765  373.901 1.00 114.98 ? 346 ARG 1 N     1 
ATOM   2685  C  CA    . ARG A  1  346 ? -60.813  15.955  373.788 1.00 126.02 ? 346 ARG 1 CA    1 
ATOM   2686  C  C     . ARG A  1  346 ? -60.265  17.088  374.645 1.00 126.09 ? 346 ARG 1 C     1 
ATOM   2687  O  O     . ARG A  1  346 ? -60.402  18.263  374.284 1.00 120.84 ? 346 ARG 1 O     1 
ATOM   2688  C  CB    . ARG A  1  346 ? -62.263  15.643  374.173 1.00 134.05 ? 346 ARG 1 CB    1 
ATOM   2689  C  CG    . ARG A  1  346 ? -62.538  15.613  375.669 1.00 139.49 ? 346 ARG 1 CG    1 
ATOM   2690  C  CD    . ARG A  1  346 ? -64.005  15.362  375.972 1.00 142.00 ? 346 ARG 1 CD    1 
ATOM   2691  N  NE    . ARG A  1  346 ? -64.871  16.129  375.084 1.00 141.20 ? 346 ARG 1 NE    1 
ATOM   2692  C  CZ    . ARG A  1  346 ? -65.265  17.377  375.316 1.00 138.05 ? 346 ARG 1 CZ    1 
ATOM   2693  N  NH1   . ARG A  1  346 ? -64.864  18.014  376.408 1.00 136.09 ? 346 ARG 1 NH1   1 
ATOM   2694  N  NH2   . ARG A  1  346 ? -66.053  17.992  374.445 1.00 136.56 ? 346 ARG 1 NH2   1 
ATOM   2695  N  N     . PHE A  1  347 ? -59.621  16.753  375.766 1.00 131.40 ? 347 PHE 1 N     1 
ATOM   2696  C  CA    . PHE A  1  347 ? -58.965  17.762  376.586 1.00 135.30 ? 347 PHE 1 CA    1 
ATOM   2697  C  C     . PHE A  1  347 ? -57.774  18.365  375.853 1.00 130.07 ? 347 PHE 1 C     1 
ATOM   2698  O  O     . PHE A  1  347 ? -57.632  19.592  375.783 1.00 131.62 ? 347 PHE 1 O     1 
ATOM   2699  C  CB    . PHE A  1  347 ? -58.527  17.144  377.918 1.00 139.81 ? 347 PHE 1 CB    1 
ATOM   2700  C  CG    . PHE A  1  347 ? -57.347  17.830  378.549 1.00 141.07 ? 347 PHE 1 CG    1 
ATOM   2701  C  CD1   . PHE A  1  347 ? -56.082  17.270  378.482 1.00 141.22 ? 347 PHE 1 CD1   1 
ATOM   2702  C  CD2   . PHE A  1  347 ? -57.503  19.035  379.206 1.00 140.92 ? 347 PHE 1 CD2   1 
ATOM   2703  C  CE1   . PHE A  1  347 ? -54.997  17.905  379.057 1.00 142.41 ? 347 PHE 1 CE1   1 
ATOM   2704  C  CE2   . PHE A  1  347 ? -56.423  19.673  379.782 1.00 141.86 ? 347 PHE 1 CE2   1 
ATOM   2705  C  CZ    . PHE A  1  347 ? -55.170  19.108  379.707 1.00 143.35 ? 347 PHE 1 CZ    1 
ATOM   2706  N  N     . TYR A  1  348 ? -56.899  17.512  375.308 1.00 120.81 ? 348 TYR 1 N     1 
ATOM   2707  C  CA    . TYR A  1  348 ? -55.755  18.013  374.547 1.00 113.98 ? 348 TYR 1 CA    1 
ATOM   2708  C  C     . TYR A  1  348 ? -56.203  18.863  373.366 1.00 113.00 ? 348 TYR 1 C     1 
ATOM   2709  O  O     . TYR A  1  348 ? -55.571  19.875  373.042 1.00 114.42 ? 348 TYR 1 O     1 
ATOM   2710  C  CB    . TYR A  1  348 ? -54.876  16.859  374.066 1.00 110.04 ? 348 TYR 1 CB    1 
ATOM   2711  C  CG    . TYR A  1  348 ? -54.033  16.251  375.157 1.00 109.32 ? 348 TYR 1 CG    1 
ATOM   2712  C  CD1   . TYR A  1  348 ? -52.934  16.923  375.659 1.00 110.97 ? 348 TYR 1 CD1   1 
ATOM   2713  C  CD2   . TYR A  1  348 ? -54.322  15.001  375.670 1.00 110.98 ? 348 TYR 1 CD2   1 
ATOM   2714  C  CE1   . TYR A  1  348 ? -52.160  16.378  376.654 1.00 114.07 ? 348 TYR 1 CE1   1 
ATOM   2715  C  CE2   . TYR A  1  348 ? -53.552  14.447  376.666 1.00 115.83 ? 348 TYR 1 CE2   1 
ATOM   2716  C  CZ    . TYR A  1  348 ? -52.472  15.140  377.153 1.00 118.82 ? 348 TYR 1 CZ    1 
ATOM   2717  O  OH    . TYR A  1  348 ? -51.695  14.595  378.144 1.00 124.54 ? 348 TYR 1 OH    1 
ATOM   2718  N  N     . ALA A  1  349 ? -57.299  18.472  372.719 1.00 110.30 ? 349 ALA 1 N     1 
ATOM   2719  C  CA    . ALA A  1  349 ? -57.806  19.230  371.585 1.00 105.84 ? 349 ALA 1 CA    1 
ATOM   2720  C  C     . ALA A  1  349 ? -58.378  20.562  372.046 1.00 99.33  ? 349 ALA 1 C     1 
ATOM   2721  O  O     . ALA A  1  349 ? -58.275  21.571  371.339 1.00 98.16  ? 349 ALA 1 O     1 
ATOM   2722  C  CB    . ALA A  1  349 ? -58.862  18.408  370.849 1.00 104.67 ? 349 ALA 1 CB    1 
ATOM   2723  N  N     . HIS A  1  350 ? -58.992  20.574  373.231 1.00 93.87  ? 350 HIS 1 N     1 
ATOM   2724  C  CA    . HIS A  1  350 ? -59.511  21.809  373.805 1.00 95.23  ? 350 HIS 1 CA    1 
ATOM   2725  C  C     . HIS A  1  350 ? -58.398  22.828  374.003 1.00 100.64 ? 350 HIS 1 C     1 
ATOM   2726  O  O     . HIS A  1  350 ? -58.657  24.035  374.037 1.00 104.80 ? 350 HIS 1 O     1 
ATOM   2727  C  CB    . HIS A  1  350 ? -60.210  21.510  375.135 1.00 93.78  ? 350 HIS 1 CB    1 
ATOM   2728  C  CG    . HIS A  1  350 ? -60.868  22.700  375.764 1.00 94.13  ? 350 HIS 1 CG    1 
ATOM   2729  N  ND1   . HIS A  1  350 ? -62.123  23.137  375.394 1.00 93.59  ? 350 HIS 1 ND1   1 
ATOM   2730  C  CD2   . HIS A  1  350 ? -60.449  23.540  376.740 1.00 94.56  ? 350 HIS 1 CD2   1 
ATOM   2731  C  CE1   . HIS A  1  350 ? -62.448  24.195  376.115 1.00 93.73  ? 350 HIS 1 CE1   1 
ATOM   2732  N  NE2   . HIS A  1  350 ? -61.449  24.461  376.938 1.00 94.11  ? 350 HIS 1 NE2   1 
ATOM   2733  N  N     . GLU A  1  351 ? -57.155  22.361  374.132 1.00 99.44  ? 351 GLU 1 N     1 
ATOM   2734  C  CA    . GLU A  1  351 ? -56.033  23.191  374.544 1.00 94.50  ? 351 GLU 1 CA    1 
ATOM   2735  C  C     . GLU A  1  351 ? -54.971  23.369  373.465 1.00 84.96  ? 351 GLU 1 C     1 
ATOM   2736  O  O     . GLU A  1  351 ? -53.885  23.874  373.765 1.00 92.93  ? 351 GLU 1 O     1 
ATOM   2737  C  CB    . GLU A  1  351 ? -55.389  22.589  375.794 1.00 97.62  ? 351 GLU 1 CB    1 
ATOM   2738  C  CG    . GLU A  1  351 ? -56.229  22.725  377.042 1.00 104.02 ? 351 GLU 1 CG    1 
ATOM   2739  C  CD    . GLU A  1  351 ? -56.273  24.143  377.552 1.00 113.23 ? 351 GLU 1 CD    1 
ATOM   2740  O  OE1   . GLU A  1  351 ? -55.385  24.936  377.179 1.00 117.07 ? 351 GLU 1 OE1   1 
ATOM   2741  O  OE2   . GLU A  1  351 ? -57.192  24.467  378.331 1.00 116.67 ? 351 GLU 1 OE2   1 
ATOM   2742  N  N     . SER A  1  352 ? -55.244  22.979  372.225 1.00 65.53  ? 352 SER 1 N     1 
ATOM   2743  C  CA    . SER A  1  352 ? -54.241  23.151  371.186 1.00 52.56  ? 352 SER 1 CA    1 
ATOM   2744  C  C     . SER A  1  352 ? -54.078  24.630  370.861 1.00 53.69  ? 352 SER 1 C     1 
ATOM   2745  O  O     . SER A  1  352 ? -55.059  25.368  370.738 1.00 50.81  ? 352 SER 1 O     1 
ATOM   2746  C  CB    . SER A  1  352 ? -54.630  22.367  369.932 1.00 42.04  ? 352 SER 1 CB    1 
ATOM   2747  O  OG    . SER A  1  352 ? -53.684  22.537  368.890 1.00 39.16  ? 352 SER 1 OG    1 
ATOM   2748  N  N     . CYS A  1  353 ? -52.826  25.064  370.730 1.00 55.04  ? 353 CYS 1 N     1 
ATOM   2749  C  CA    . CYS A  1  353 ? -52.551  26.463  370.434 1.00 51.06  ? 353 CYS 1 CA    1 
ATOM   2750  C  C     . CYS A  1  353 ? -52.727  26.790  368.960 1.00 53.82  ? 353 CYS 1 C     1 
ATOM   2751  O  O     . CYS A  1  353 ? -52.867  27.968  368.616 1.00 51.60  ? 353 CYS 1 O     1 
ATOM   2752  C  CB    . CYS A  1  353 ? -51.138  26.832  370.879 1.00 44.03  ? 353 CYS 1 CB    1 
ATOM   2753  S  SG    . CYS A  1  353 ? -49.926  26.706  369.578 1.00 38.28  ? 353 CYS 1 SG    1 
ATOM   2754  N  N     . GLY A  1  354 ? -52.703  25.784  368.089 1.00 64.99  ? 354 GLY 1 N     1 
ATOM   2755  C  CA    . GLY A  1  354 ? -53.052  25.955  366.696 1.00 83.28  ? 354 GLY 1 CA    1 
ATOM   2756  C  C     . GLY A  1  354 ? -51.885  26.149  365.752 1.00 103.57 ? 354 GLY 1 C     1 
ATOM   2757  O  O     . GLY A  1  354 ? -52.099  26.177  364.534 1.00 110.76 ? 354 GLY 1 O     1 
ATOM   2758  N  N     . LYS A  1  355 ? -50.662  26.294  366.270 1.00 108.24 ? 355 LYS 1 N     1 
ATOM   2759  C  CA    . LYS A  1  355 ? -49.534  26.622  365.402 1.00 102.75 ? 355 LYS 1 CA    1 
ATOM   2760  C  C     . LYS A  1  355 ? -49.237  25.501  364.413 1.00 90.83  ? 355 LYS 1 C     1 
ATOM   2761  O  O     . LYS A  1  355 ? -49.025  25.759  363.222 1.00 87.47  ? 355 LYS 1 O     1 
ATOM   2762  C  CB    . LYS A  1  355 ? -48.292  26.941  366.240 1.00 100.41 ? 355 LYS 1 CB    1 
ATOM   2763  C  CG    . LYS A  1  355 ? -47.654  28.290  365.906 1.00 94.15  ? 355 LYS 1 CG    1 
ATOM   2764  C  CD    . LYS A  1  355 ? -46.544  28.679  366.880 1.00 86.22  ? 355 LYS 1 CD    1 
ATOM   2765  C  CE    . LYS A  1  355 ? -45.169  28.521  366.243 1.00 79.82  ? 355 LYS 1 CE    1 
ATOM   2766  N  NZ    . LYS A  1  355 ? -44.108  29.228  367.013 1.00 73.93  ? 355 LYS 1 NZ    1 
ATOM   2767  N  N     . CYS A  1  356 ? -49.237  24.254  364.873 1.00 80.87  ? 356 CYS 1 N     1 
ATOM   2768  C  CA    . CYS A  1  356 ? -49.002  23.131  363.976 1.00 76.33  ? 356 CYS 1 CA    1 
ATOM   2769  C  C     . CYS A  1  356 ? -50.294  22.709  363.293 1.00 67.48  ? 356 CYS 1 C     1 
ATOM   2770  O  O     . CYS A  1  356 ? -51.328  22.543  363.946 1.00 53.47  ? 356 CYS 1 O     1 
ATOM   2771  C  CB    . CYS A  1  356 ? -48.411  21.944  364.729 1.00 86.57  ? 356 CYS 1 CB    1 
ATOM   2772  S  SG    . CYS A  1  356 ? -46.989  22.345  365.724 1.00 99.23  ? 356 CYS 1 SG    1 
ATOM   2773  N  N     . THR A  1  357 ? -50.229  22.558  361.973 1.00 79.01  ? 357 THR 1 N     1 
ATOM   2774  C  CA    . THR A  1  357 ? -51.279  21.850  361.242 1.00 89.33  ? 357 THR 1 CA    1 
ATOM   2775  C  C     . THR A  1  357 ? -51.492  20.423  361.741 1.00 93.35  ? 357 THR 1 C     1 
ATOM   2776  O  O     . THR A  1  357 ? -52.657  20.033  361.937 1.00 99.07  ? 357 THR 1 O     1 
ATOM   2777  C  CB    . THR A  1  357 ? -50.963  21.875  359.742 1.00 93.61  ? 357 THR 1 CB    1 
ATOM   2778  O  OG1   . THR A  1  357 ? -50.599  23.204  359.343 1.00 90.51  ? 357 THR 1 OG1   1 
ATOM   2779  C  CG2   . THR A  1  357 ? -52.153  21.396  358.927 1.00 99.59  ? 357 THR 1 CG2   1 
ATOM   2780  N  N     . PRO A  1  358 ? -50.457  19.596  361.951 1.00 87.15  ? 358 PRO 1 N     1 
ATOM   2781  C  CA    . PRO A  1  358 ? -50.728  18.210  362.384 1.00 82.89  ? 358 PRO 1 CA    1 
ATOM   2782  C  C     . PRO A  1  358 ? -51.508  18.123  363.682 1.00 76.97  ? 358 PRO 1 C     1 
ATOM   2783  O  O     . PRO A  1  358 ? -52.542  17.452  363.732 1.00 75.64  ? 358 PRO 1 O     1 
ATOM   2784  C  CB    . PRO A  1  358 ? -49.321  17.613  362.514 1.00 87.52  ? 358 PRO 1 CB    1 
ATOM   2785  C  CG    . PRO A  1  358 ? -48.427  18.788  362.706 1.00 87.80  ? 358 PRO 1 CG    1 
ATOM   2786  C  CD    . PRO A  1  358 ? -49.009  19.829  361.813 1.00 86.02  ? 358 PRO 1 CD    1 
ATOM   2787  N  N     . CYS A  1  359 ? -51.038  18.782  364.740 1.00 75.01  ? 359 CYS 1 N     1 
ATOM   2788  C  CA    . CYS A  1  359 ? -51.754  18.769  366.012 1.00 74.05  ? 359 CYS 1 CA    1 
ATOM   2789  C  C     . CYS A  1  359 ? -53.190  19.230  365.817 1.00 68.25  ? 359 CYS 1 C     1 
ATOM   2790  O  O     . CYS A  1  359 ? -54.132  18.466  366.040 1.00 67.38  ? 359 CYS 1 O     1 
ATOM   2791  C  CB    . CYS A  1  359 ? -51.014  19.642  367.024 1.00 81.08  ? 359 CYS 1 CB    1 
ATOM   2792  S  SG    . CYS A  1  359 ? -51.948  20.388  368.391 1.00 84.24  ? 359 CYS 1 SG    1 
ATOM   2793  N  N     . ARG A  1  360 ? -53.368  20.471  365.359 1.00 66.79  ? 360 ARG 1 N     1 
ATOM   2794  C  CA    . ARG A  1  360 ? -54.701  21.027  365.151 1.00 64.35  ? 360 ARG 1 CA    1 
ATOM   2795  C  C     . ARG A  1  360 ? -55.613  20.032  364.438 1.00 65.22  ? 360 ARG 1 C     1 
ATOM   2796  O  O     . ARG A  1  360 ? -56.563  19.503  365.030 1.00 66.46  ? 360 ARG 1 O     1 
ATOM   2797  C  CB    . ARG A  1  360 ? -54.574  22.335  364.357 1.00 60.49  ? 360 ARG 1 CB    1 
ATOM   2798  C  CG    . ARG A  1  360 ? -55.856  22.874  363.752 1.00 58.76  ? 360 ARG 1 CG    1 
ATOM   2799  C  CD    . ARG A  1  360 ? -55.624  24.194  363.025 1.00 54.03  ? 360 ARG 1 CD    1 
ATOM   2800  N  NE    . ARG A  1  360 ? -55.193  24.022  361.640 1.00 45.35  ? 360 ARG 1 NE    1 
ATOM   2801  C  CZ    . ARG A  1  360 ? -53.935  24.140  361.235 1.00 29.92  ? 360 ARG 1 CZ    1 
ATOM   2802  N  NH1   . ARG A  1  360 ? -52.981  24.426  362.107 1.00 33.79  ? 360 ARG 1 NH1   1 
ATOM   2803  N  NH2   . ARG A  1  360 ? -53.630  23.976  359.958 1.00 29.68  ? 360 ARG 1 NH2   1 
ATOM   2804  N  N     . GLU A  1  361 ? -55.271  19.685  363.197 1.00 66.79  ? 361 GLU 1 N     1 
ATOM   2805  C  CA    . GLU A  1  361 ? -56.161  18.858  362.386 1.00 71.25  ? 361 GLU 1 CA    1 
ATOM   2806  C  C     . GLU A  1  361 ? -56.316  17.461  362.974 1.00 73.70  ? 361 GLU 1 C     1 
ATOM   2807  O  O     . GLU A  1  361 ? -57.419  17.060  363.353 1.00 71.77  ? 361 GLU 1 O     1 
ATOM   2808  C  CB    . GLU A  1  361 ? -55.647  18.798  360.948 1.00 75.81  ? 361 GLU 1 CB    1 
ATOM   2809  C  CG    . GLU A  1  361 ? -55.392  20.165  360.341 1.00 85.76  ? 361 GLU 1 CG    1 
ATOM   2810  C  CD    . GLU A  1  361 ? -56.639  21.028  360.272 1.00 95.26  ? 361 GLU 1 CD    1 
ATOM   2811  O  OE1   . GLU A  1  361 ? -57.760  20.479  360.285 1.00 98.74  ? 361 GLU 1 OE1   1 
ATOM   2812  O  OE2   . GLU A  1  361 ? -56.499  22.266  360.220 1.00 98.44  ? 361 GLU 1 OE2   1 
ATOM   2813  N  N     . GLY A  1  362 ? -55.220  16.705  363.